BYKdb

Dataset for cluster orphancd of phylum nitrospirae

[Download (right click)] [Edit] [Sequences] [Repertoires]

26 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1G3XWL5      MKIEREKPNFVISEGTVGFDLSEENYFQTQCKVLKSRNLAKRIIRSLGLDTNPEFIQDME
A0A419GMT6      ------------------------------------------------------------
A0A7C1NS32      ------------------------------------------------------------
A0A533Z3V6      ------------------------------------------------------------
A0A7C0WL89      ------------------------------------------------------------
A0A0F2J1D3      ------------------------------------------------------------
A0A7C1KTI3      ------------------------------------------------------------
A0A2H0YJQ4      ------------------------------------------------------------
A0A2M7FB38      ------------------------------------------------------------
A0A419FNZ3      ------------------------------------------------------------
A0A1G1GRK8      ------------------------------------------------------------
A0A7C1XH67      ------------------------------------------------------------
A0A2H0YFB4      ------------------------------------------------------------
A0A2M7FBY9      ------------------------------------------------------------
A0A533YEM2      ------------------------------------------------------------
A0A0K2GDM9      ------------------------------------------------------------
A0A1G1I4J7      ------------------------------------------------------------
A0A2M8DK40      ------------------------------------------------------------
A0A3C1G280      ------------------------------------------------------------
A0A0S8DM58      ------------------------------------------------------------
A0A3A4WKT5      ------------------------------------------------------------
A0A2U3QDU5      ------------------------------------------------------------
A0A7C0ZYC7      ------------------------------------------------------------
A0A1G1GZ72      ------------------------------------------------------------
A0A1G1F9B9      ------------------------------------------------------------
A0A7C1G619      ------------------------------------------------------------
                                                                            

A0A1G3XWL5      NKKSSSNENIILAINRPSEKEIEPKLIDVFIGSINVNPVQRSSLVNVSFASDNPELSARV
A0A419GMT6      ------------------------------------------------------------
A0A7C1NS32      ------------------------------------------------------------
A0A533Z3V6      ------------------------------------------------------------
A0A7C0WL89      ------------------------------------------------------------
A0A0F2J1D3      ------------------------------------------------------------
A0A7C1KTI3      ------------------------------------------------------------
A0A2H0YJQ4      ------------------------------------------------------------
A0A2M7FB38      ------------------------------------------------------------
A0A419FNZ3      ------------------------------------------------------------
A0A1G1GRK8      ------------------------------------------------------------
A0A7C1XH67      ------------------------------------------------------------
A0A2H0YFB4      ------------------------------------------------------------
A0A2M7FBY9      ------------------------------------------------------------
A0A533YEM2      ------------------------------------------------------------
A0A0K2GDM9      ------------------------------------------------------------
A0A1G1I4J7      ------------------------------------------------------------
A0A2M8DK40      ------------------------------------------------------------
A0A3C1G280      ------------------------------------------------------------
A0A0S8DM58      ------------------------------------------------------------
A0A3A4WKT5      ------------------------------------------------------------
A0A2U3QDU5      ------------------------------------------------------------
A0A7C0ZYC7      ------------------------------------------------------------
A0A1G1GZ72      ------------------------------------------------------------
A0A1G1F9B9      ------------------------------------------------------------
A0A7C1G619      ------------------------------------------------------------
                                                                            

A0A1G3XWL5      ANTIGESFIELNIESRFEATYKAREWLQGQINIMKAKLEQAEEALNKYASAHGIIFLDEN
A0A419GMT6      ------------------------------------------------------------
A0A7C1NS32      ------------------------------------------------------------
A0A533Z3V6      ------------------------------------------------------------
A0A7C0WL89      ------------------------------------------------------------
A0A0F2J1D3      ------------------------------------------------------------
A0A7C1KTI3      ------------------------------------------------------------
A0A2H0YJQ4      ------------------------------------------------------------
A0A2M7FB38      ------------------------------------------------------------
A0A419FNZ3      ------------------------------------------------------------
A0A1G1GRK8      ------------------------------------------------------------
A0A7C1XH67      ------------------------------------------------------------
A0A2H0YFB4      ------------------------------------------------------------
A0A2M7FBY9      ------------------------------------------------------------
A0A533YEM2      ------------------------------------------------------------
A0A0K2GDM9      ------------------------------------------------------------
A0A1G1I4J7      ------------------------------------------------------------
A0A2M8DK40      ------------------------------------------------------------
A0A3C1G280      ------------------------------------------------------------
A0A0S8DM58      ------------------------------------------------------------
A0A3A4WKT5      ------------------------------------------------------------
A0A2U3QDU5      ------------------------------------------------------------
A0A7C0ZYC7      ------------------------------------------------------------
A0A1G1GZ72      ------------------------------------------------------------
A0A1G1F9B9      ------------------------------------------------------------
A0A7C1G619      ------------------------------------------------------------
                                                                            

A0A1G3XWL5      EKGVENENIITKRLSELSTHHTEASADRMNKEALYNTVRSDDSDSSPVVMGNSLIMELKK
A0A419GMT6      --------------------------ADRISKEAIYKEVRKSDVDYGVVLQDPLIRSLTD
A0A7C1NS32      ------------------------------------------------------------
A0A533Z3V6      ------------------------------------------------------------
A0A7C0WL89      ------------------------------------------------------------
A0A0F2J1D3      ------------------------------------------------------------
A0A7C1KTI3      ------------------------------------------------------------
A0A2H0YJQ4      ------------------------------------------------------------
A0A2M7FB38      ------------------------------------------------------------
A0A419FNZ3      ------------------------------------------------------------
A0A1G1GRK8      ------------------------------------------------------------
A0A7C1XH67      ------------------------------------------------------------
A0A2H0YFB4      ------------------------------------------------------------
A0A2M7FBY9      ------------------------------------------------------------
A0A533YEM2      ------------------------------------------------------------
A0A0K2GDM9      ------------------------------------------------------------
A0A1G1I4J7      ------------------------------------------------------------
A0A2M8DK40      ------------------------------------------------------------
A0A3C1G280      ------------------------------------------------------------
A0A0S8DM58      ------------------------------------------------------------
A0A3A4WKT5      ------------------------------------------------------------
A0A2U3QDU5      ------------------------------------------------------------
A0A7C0ZYC7      ------------------------------------------------------------
A0A1G1GZ72      ------------------------------------------------------------
A0A1G1F9B9      ------------------------------------------------------------
A0A7C1G619      ------------------------------------------------------------
                                                                            

A0A1G3XWL5      NLASLESEYNQKLKTYKPAYPKMVKLKEQIDQIKKKMDSEAKKIITGVKKDYDAALKREK
A0A419GMT6      RYVNLESEYFNLLQVHKPEYPKMIRLREQMEKLKETIGTQEQKIINTLSSDYQLALKKEK
A0A7C1NS32      -------------------------------MRWGMIDDEIFRVVDSMKSQYDVALRNEL
A0A533Z3V6      ------------------------------------------------------------
A0A7C0WL89      ----------------------MIKAKEKLNSLKKEKESEIQKIFQGTKNAYDLAVSQEK
A0A0F2J1D3      --------------------------------------------MELAKRIVIDAITIEV
A0A7C1KTI3      ------------------------------------------------------AVKRES
A0A2H0YJQ4      ------------------------------------------------------------
A0A2M7FB38      ------------------------------------------------------------
A0A419FNZ3      ------------------------------------------------------------
A0A1G1GRK8      ------------------------------------------------------------
A0A7C1XH67      ------------------------------------------------------------
A0A2H0YFB4      ------------------------------------------------------------
A0A2M7FBY9      ------------------------------------------------------------
A0A533YEM2      ------------------------------------------------------------
A0A0K2GDM9      ------------------------------------------------------------
A0A1G1I4J7      ------------------------------------------------------------
A0A2M8DK40      ------------------------------------------------------------
A0A3C1G280      ------------------------------------------------------------
A0A0S8DM58      ------------------------------------------------------------
A0A3A4WKT5      ------------------------------------------------------------
A0A2U3QDU5      ------------------------------------------------------------
A0A7C0ZYC7      ------------------------------------------------------------
A0A1G1GZ72      ------------------------------------------------------------
A0A1G1F9B9      ------------------------------------------------------------
A0A7C1G619      ------------------------------------------------------------
                                                                            

A0A1G3XWL5      YLKSEFEVQKKEAINLKDYFVQYQILKR-------EVDTNRELYNGLLQKLKETGVSETL
A0A419GMT6      FLIAAIEKLRNEVSNLQDKIVQIQILKR-------EVDTNSELYNALLQRLKEVGVSAAL
A0A7C1NS32      ALKGELVRLKEESQSLGKHAVAYSVLAR-------DVYTNKEMYEVLLKRLKETSITGGM
A0A533Z3V6      ------------------------------------------------------------
A0A7C0WL89      NITDLLNATKNELLNLNEKSVQYSIMKR-------DVDTNSALYDTLTASLKKASVTQQA
A0A0F2J1D3      YKEKT-KILKNYLSKYKEELIKLPAISEDNAKVNLELSVNKDIYQKLLEYILQIEIAESM
A0A7C1KTI3      YLNAIFNVQKNRVMEFQKKMVQYHILKR-------EVDTNKELYNNMLQRLKEVAVSATM
A0A2H0YJQ4      ------------MSKIEEALEKAKQARSGVKENKAVPEA-------------PEETAPRY
A0A2M7FB38      ------------MSKIEEALEKAKQARSGVKENKAVPEA-------------PEETAPRY
A0A419FNZ3      ------------MSKIEEALEKANKLR--------GPSGD------------VKSRLMD-
A0A1G1GRK8      ------------MSRTENALEKASRIRRSPQPVPAGRNGE------------PA------
A0A7C1XH67      ------------MSRIEEILEKATKMRK------GGGNGE------------KSKKMSLP
A0A2H0YFB4      ------------MRSIEKGLEKAIRERESR----------------------SSPDLFKL
A0A2M7FBY9      ------------MRSIEKGLEKAIRERESR----------------------SSPDLFKL
A0A533YEM2      -----MASQDKERNQSLESLDEAQHLHRLLE---------------------LEMGSRGP
A0A0K2GDM9      ------------MKDVNPALRAVP--PPESGSSSA-----------------YQRGDSRG
A0A1G1I4J7      ------------MSKIEEALAKIQSKPRPGGAREP-----------------L----PRV
A0A2M8DK40      ------------MSKIEEALEKATRERQG-GGHEAGGVPQRSSV--------REAHTAVV
A0A3C1G280      ------------MSRIEQALEKAIKMRESMAGGDTGDMLTAMPH--------KPAQTEFE
A0A0S8DM58      ------------MSKIEEALEKANKLRA------------------------SNVRKKTQ
A0A3A4WKT5      ------------MSKIEEALKKANILRE------------------------SYGNTGNV
A0A2U3QDU5      ------------MSRIERALEKANMVRD-----------------REEPVLPEQSVGQAD
A0A7C0ZYC7      ------------MSRIEKAIEKASKMRDSMETGKAVTVPDKENRPENKAVLDKKAVTVSD
A0A1G1GZ72      ---------------------------------------------------MIKGFIEKI
A0A1G1F9B9      ------------------------------------------------------------
A0A7C1G619      ------------------------------------------------------------
                                                                            

A0A1G3XWL5      KASNIQVIDRAEIPESPYKPNKRLNIILSIIVGLFGGIGLAFFVEYLDNTIKTPEDLEKR
A0A419GMT6      TESNVQVLDRAQVPRSPFKPKKGFNAALSLILGLFGGVFLAFFVEYFDQTIRTPQDVEKW
A0A7C1NS32      QTTNVRVLDKALPPSIPFRPRRILNIFLAIILGLIMGPVVAIFFEHIDNSVKTPEDIERY
A0A533Z3V6      -----RIIDPGNFPGKPVKPDFLKVFLGGLVAGAGLAGGFIWWLDFRNIPFRRPEEVLAA
A0A7C0WL89      RSVNVWVLKKASLPRYPSSPRKVLNLLLGTILGFLGGVGLAFFLEYLDNTVQSPGEIEQR
A0A0F2J1D3      TMSDRILVEPAELPEEQKYPWNKLNYILGFILAVFWAFTVALFLEYIDDTIKDPDELKQT
A0A7C1KTI3      RATNIQILDRAEYPKSPYKPNKPLNILLSIVLGLFGGVGLAFFMEYFDNTVKDPQDIEKR
A0A2H0YJQ4      THTVFKEVNP--------------------------------------------------
A0A2M7FB38      THTVFKEVNP--------------------------------------------------
A0A419FNZ3      ----ISRRPE--------------------------------------------------
A0A1G1GRK8      ----ATGAQG--------------------------------------------------
A0A7C1XH67      GAKLPKVTRR--------------------------------------------------
A0A2H0YFB4      QKEWNDKSLD--------------------------------------------------
A0A2M7FBY9      QKEWNDKSLD--------------------------------------------------
A0A533YEM2      ETQVQRKVGK--------------------------------------------------
A0A0K2GDM9      DAPVLEKMLG--------------------------------------------------
A0A1G1I4J7      DLPAAMNVDR--------------------------------------------------
A0A2M8DK40      AEVAVVNPDP--------------------------------------------------
A0A3C1G280      AGEVRVD-----------------------------------------------------
A0A0S8DM58      SLNIFERVEP--------------------------------------------------
A0A3A4WKT5      KAHIPSDGEI--------------------------------------------------
A0A2U3QDU5      ITDVFVTDNT--------------------------------------------------
A0A7C0ZYC7      KVNIV-------------------------------------------------------
A0A1G1GZ72      MEMKDNLRRD--------------------------------------------------
A0A1G1F9B9      ------------------------------------------------------------
A0A7C1G619      ------------------------------------------------------------
                                                                            

A0A1G3XWL5      VSLPTLGFIPFHGDY-----EGDLPVEYITHADSKSPVSEAYCTLRTFLLLSTGG-----
A0A419GMT6      SRLPVIGMVPLI--------KDNLRESSSSVSDNTQVLTESFRSIGTWIKFANSS-----
A0A7C1NS32      LNIPYLGPLPDFQG-QNSERAGGQSTMLVTSLDPKSVTAEAYRSVRTSIIFSSPD-----
A0A533Z3V6      LDYPTLATIPFMSGLWGNDQKPPDSEPVMAQSRVMRCLAWPLRVIDRLRALTSASSVKPV
A0A7C0WL89      FGLTVLGAIEQLKG------KDQKVESFLQQAP-LSPFAESYRLIRSSILLSAVD-----
A0A0F2J1D3      SKQPLLGSIPKTKV------FKDIKN--ISNLPPTSPFVEAYRTIRNSLLFASID-----
A0A7C1KTI3      MNLPALGLIPLYAS------SDPSERLLITHSDNKGHIAEAFRSIGTFISLSSAA-----
A0A2H0YJQ4      --------------------DMMEENRIVTLAGKSSHITEQYRMLRTQILQRTEG-----
A0A2M7FB38      --------------------DMMEENRIVTLAGKSSHITEQYRMLRTQILQRTEG-----
A0A419FNZ3      --------------------HQVENEYLVTITRPDSPVAEEYRRLKSILIRETKA-----
A0A1G1GRK8      --------------------ARIEHPHLVTSRSTFSPVAEEYKKLKARVMRMTKQ-----
A0A7C1XH67      --------------------ARIENPNVVTVLDPDSSTAEEYRKLKSMVVRLTKS-----
A0A2H0YFB4      --------------------FSKLSAYLVTILDSKSLAAEQFKRLRTQVMKKMRS-----
A0A2M7FBY9      --------------------FSKLSAYLVTILDSKSLAAEQFKRLRTQVMKKMRS-----
A0A533YEM2      --------------------RAAPDAHLVSLLAPTSVEAEQYRTLGFLLQQKQQT-----
A0A0K2GDM9      --------------------RAKPDEHLVSLLTPATFEAEQYRTLGLMLEQRRQT-----
A0A1G1I4J7      --------------------DAFIERRIVTAVFESGPAVEEYKKLRTRVLAWLRA-----
A0A2M8DK40      --------------------LHLAENRVVVASGPSLGASDAYRQLRATLMLAADH-----
A0A3C1G280      --------------------LKGIDRHIVSLTDPYSQGAEEYRKLRVRLLRATQK-----
A0A0S8DM58      --------------------REVENDYLVSLNEPNSPVAEEFRKLKSMLLRITKK-----
A0A3A4WKT5      --------------------IKTDNQYLVTLTQPGSPVAEEYRRLKSMLIRETKA-----
A0A2U3QDU5      --------------------ELPKNPYLVTLNEPDSPIAEEYKKLKSMVVKMTKQ-----
A0A7C0ZYC7      ------------------------NPYVITLNNPGSPISEQYRNLKSMVVRLTQK-----
A0A1G1GZ72      --------------------NLLPHEKTIRSGNIQTVITEQYRLLRSRLSSLNGS-----
A0A1G1F9B9      -------------------------------------ISEAYSSIRTLLLFSTAG-----
A0A7C1G619      ------------------------------------------------------S-----
                                                                            

A0A1G3XWL5      -------------R-PPRIIAITSPAREEGKTTTAINTAISFARS-GAKVLIIDADMRRP
A0A419GMT6      -------------V-KPRQILVTSPLEGEGKTLVSINTAMSLLNV-VGKGVIIDADFRRP
A0A7C1NS32      ---------------DRKTLLVTSSNPTEGKSVTSSNLAVTMAQN-GARTLLLDMDFRRP
A0A533Z3V6      VQANLNALAAEQFR-VFRILALSSSVAAEGKTTVAVGLAVTLARDYLEETILIDGDMRNP
A0A7C0WL89      -------------H-PPRRILFTSMAPAEGKTATTVNIARILSQS-DKKVLVMDCDLRRP
A0A0F2J1D3      -------------K-PVKTFLVTSSIEKEGKSSIASNLAVTFSAE-DKNVLLLDLDLRRP
A0A7C1KTI3      -------------R-PPKTILITSPGEKEGKTTVTINTATALTNT-LGKGIVIDADLRKP
A0A2H0YJQ4      -------------N-GDNCLMVTSAADGEGKTTTAINLAVSIAQEVQKNVLLVDADLRRP
A0A2M7FB38      -------------N-GDNCLMVTSATDGEGKTTTAINLAVSIAQEVQKNVLLVDADLRRP
A0A419FNZ3      -------------D-FLNTIMVTSSVDGEGKSLTAVNLAITLAQEIDHTILLIDADLRKP
A0A1G1GRK8      -------------EPFRNVLLVTSSVGGEGKSVTAANLALSLARDYDHSVVLIDADTRKP
A0A7C1XH67      -------------DEFQNMLMVTSSVGGEGKSLTALNLAITLAQEYDYTVLLVDADLRRP
A0A2H0YFB4      -------------R-MENTLMVTSATRGEGKTTTALNLAVSVAQGMNETVLMMDTDFRKP
A0A2M7FBY9      -------------R-MENTLMVTSATRGEGKTTTALNLAVSVAQGMNETVLMMDTDFRKP
A0A533YEM2      -------------G-ALKVIAVSSATPGDGKTTTAINLAGAMAQSHEARVLLVDADLRLP
A0A0K2GDM9      -------------G-LLQVVAMTSPTMGDGKTLTAINLAGAVSQSPSARVLLMDVDFRKP
A0A1G1I4J7      -------------A-EGNVVMLASAGGKEGKSLTAVNLAVSVARELHQTALLIDADLRRP
A0A2M8DK40      -------------Q-RL-AFVVTSPLQGDGKSITTLNLGYAIAQELQLDAVVVDTDLRRP
A0A3C1G280      -------------N-FLNTIMVTSSGVGEGKSITAINLAVSIANEIDHTVLLVDGDLRRP
A0A0S8DM58      -------------D-FLNTVMITSSISGEGKTITAINLAVTIAQEIDHSILLIDADLRRP
A0A3A4WKT5      -------------N-FLNTVMITSAVEAEGKSLTAVNLALTLSQEIDHTILLVDADLRKP
A0A2U3QDU5      -------------GKFQNTLMVTSTVAEEGKSITAMNLAITLACEYDHTVLLVDADLRRP
A0A7C0ZYC7      -------------QGFKNTLMVTSTSGSEGKSLTAVNLAITLAQEYDHTVLLVDADFRNP
A0A1G1GZ72      -------------H-GNKVIAVTSTQKGEGKSITSVNLAIVMAEDTKKKVLLIDGDMRKP
A0A1G1F9B9      -------------K-PPKVMMITSPLREEGKTTTAINTAISLTK-SDARVIIVDADMRRP
A0A7C1G619      -------------R-PPRTIMVTSSMESEGKSTVAVNTALSSMT-YMGNGILVDADLRKP
                                   . .:*    :**:  : . .           :::* * * *

A0A1G3XWL5      KLHRLFDV-DNT-SGLSTYLSGIE-ELTEDLMKETNIPNLHVITSGPIPPNPAELLN---
A0A419GMT6      CVHTSLDL-DNS-TGLSSFLSGTS-EF-DQLIKKSSVTGLDVITSGPMPHNPSEVLN---
A0A7C1NS32      VLHKIFNV-PQE-KGFSNMLVGDA-GV-DDVIARTNVPNLDVIPSGHIPPNPAELLS---
A0A533Z3V6      SVSSRMGL-RNE-KGLVNVLAGEC-DL-DSVLYQHSHRNLKILTAGTNEGNGSLPVDRLG
A0A7C0WL89      RQHTLFSI-PNS-VGLSSYLTGNT-K--ENIVQNIPGETFSLVTAGPVPPNPAELLD---
A0A0F2J1D3      SAHTFFNK-TSA-KGITNVLADTM-TL-DEAIEKTDIKGLDLLLSGPIPPDPSRLIE---
A0A7C1KTI3      KIHNGFGV-ENS-TGLSTFLSGNM-EF-DEGLIKPTTGVLDVITSGPIPPNPSELLG---
A0A2H0YJQ4      SIHKMLGL-KPE-KGLVHYLMDQV-PL-EDLLIRTGVEKLTFLPAGGTLPNSTEIFN---
A0A2M7FB38      SIHKMLGL-KPE-KGLVHYLMDQV-PL-EDLLIRTGVEKLTFLPAGGTLPNSTEIFN---
A0A419FNZ3      MIHEYLGI-SHK-YGLADYLSGDI-DF-SEIVVKAGIGNLMFIPAGHVAVNPVELLA---
A0A1G1GRK8      SLHTLLNV-KPG-IGLADCVADDI-DI-GSALVKVGNGNLQFVPAGKRHENPVELFS---
A0A7C1XH67      SLNEYLGI-HAD-IGLTDCLVDGM-GV-GNALIKTGIGGLVYLPPGRRVSNPGDLLS---
A0A2H0YFB4      GVHTYLGI-EAK-KGLVDFLRGEA-EI-PELLVKTEIPKLILLPSGQPPENPSELLS---
A0A2M7FBY9      GVHTYLGI-EAK-KGLVDFLRGEA-EI-PELLVKTEIPKLILLPSGQPPENPSELLS---
A0A533YEM2      SVARQLGMTESEVPGFADAIMNPEYAL-KDVVRECPGFHLAVLPAGRCPLLPDEVFK---
A0A0K2GDM9      SIAAQLGL-RDNIVGLRDAALNAGLRL-KDVVRRHPAWNLSIATAGRAQGLPHEIIK---
A0A1G1I4J7      HLHQLLDV-KGQ-PGLSDFLMGEG-DL-SGLFHSTGIPKLTLVPAGTPTARSPELLA---
A0A2M8DK40      VLAKFLGI-EGQ-RGVSDYLNDPSVTL-DDVVVRLAGGPLWVSAGTVRLHNTSELLG---
A0A3C1G280      SLHRYLGI-EPS-LGLSDYLMGKT-AL-SNALVRTGVGKLVLLPAGTPPQNPSELLS---
A0A0S8DM58      MIHNYLGM-NPK-YGLSDYLLKDI-DI-SEILVKTGIGKMVLLPAGKTVPNPQELLS---
A0A3A4WKT5      TLHEYLGI-SCK-YGLSDYLTRDI-DL-SEILVKTGIGNLLIIPAGHTVENPVELLS---
A0A2U3QDU5      SLSHLLGI-ETS-PGLSDCLLNGL-DI-KDALVKTGIGKMVFLPSGSHVSDPVELLL---
A0A7C0ZYC7      SLHRYLNI-NPE-IGLSDYLINGH-DI-GMALIKTGIGKLTFLPTGRNVADPAEILS---
A0A1G1GZ72      SIHAFFNC-KSE-YGLVDLLTNKI-DI-ESILVPSGVNNLTILPAGGPVESPSDIIA---
A0A1G1F9B9      RLHKVFKV-ENI-SGLSSFLSGNT-EFSEELIKHTDVPWLDVLTSGPLPPNPAELLS---
A0A7C1G619      SVHKFFDV-DNS-AGLSSFLSGLK-GL-DEIVQKSKYLGLDVITSGPIPPNPSELLS---
                     :        *.               .       :               .    

A0A1G3XWL5      ----SLRLKELINSL---YLYNFIIFDTPPVIGLPDSLILSSYTDGVMLIAKSGKTTKET
A0A419GMT6      ----SDRMRELMDALSAMYD--FIVIDSAPLLGLSDSLILSASVDSVMLVVKSGQTPKDA
A0A7C1NS32      ----SDGIASFMDIFKSRYD--RIVIDSPPILSATDPVIISTFVDEVLMVIKMGETSREL
A0A533Z3V6      LPASRGEFQKLLESLRHRGV--FVILDSPPILPMADMNLYAQVVDGIALVVRAGQTPQSV
A0A7C0WL89      ----STKMKALLDRMADIYD--FVLLDSPPLQSVADSLTLSTIVDGTIIVVRAGETTYDM
A0A0F2J1D3      ----SEKIKNIIEALKQKYS--LIIIDTPPVVSVNDAVVIGKLVDGAVYVVEAGRASGSM
A0A7C1KTI3      ----SARMKDLLDALYSIYD--FVIIDSAPVLGMTDSLYLSSFADGVVIVIRSGQTPRDA
A0A2H0YJQ4      ----SSRMKNFIREVKDRYKDRYVIFDTTPILSTADPVVLSQSMDGIIFVVQADRTQRGD
A0A2M7FB38      ----SSRMKNFIREVKDRYKDRYVIFDTTPILSTADPVVLSQSMDGIIFVVQADRTQRGD
A0A419FNZ3      ----SEKMNAFIKEIKHRYVDRYVIIDTPPILPFADAIAVGSVVDGVVFVIKEGRTQKKS
A0A1G1GRK8      ----SQRMRTVILEMKSRYPDRYIIIDTPPVLLFAETKMISALADGIIFVVREGLAPLQH
A0A7C1XH67      ----SSRMSEIMKEIKHRYPDRYVIIDTPPVLPFAEVLSIGALVDGVIFVVREGVTSEEN
A0A2H0YFB4      ----SERMSQLIREIKSRYEDRFIILDTSPINVFTDASILIPLVEGVLMVVQDGVTPREY
A0A2M7FBY9      ----SERMSQLIREIKSRYEDRFIILDTSPINVFTDASILIPLVEGVLMVVQDGVTPREY
A0A533YEM2      ----SARVRELLEEARTSYD--YIVLDTPPFVLVPDCRMIEKWVDGFLMVIAAHKTPQKL
A0A0K2GDM9      ----SARFAELLNEARRDYE--WIFLDTPPLMLAPDCLILGRNVDGFLMVVYANKTSRQE
A0A1G1I4J7      ----SQRMSEFLEEVRRRYKDRIVILDAPPVLPATDAVILANHVDGIVFVVRAGGSARED
A0A2M8DK40      ----SRRMEQFCGELRHRFPTAILLFDSPPILPAPDAMTLVQWLDGGIIVVSAGKTSRRA
A0A3C1G280      ----SERMKETVRELKNRYKDRYVIFDSSPVLATADTLSLSNYMDGIIFVVQASETSPRD
A0A0S8DM58      ----SVKMEYLIKELKQRYMDRYIIIDTPPILSFAEAISIGHCVDGVIYVVKEGQTQRKA
A0A3A4WKT5      ----SVRMKTLIHELKHRYMDRYVIIDTPPILPFADAISLGSLVDGVLFIVKEGRIQKKS
A0A2U3QDU5      ----SRRMQELLSDIKHRYADRYVIIDTPPVLPFAEVHSLASGVDGLIYVVREGLAPLNG
A0A7C0ZYC7      ----SRKMKELINEMKHRYSDRYIIIDTPPVLPFAETRSIGAVVDSTIFVVKEGMVPLYD
A0A1G1GZ72      ----NPRFKEGIERLKKRFD--YIIMDSPPIIPFADMNILGDIVDGILLVVKAETTPKER
A0A1G1F9B9      ----SSRFRDLIDGLHPLYN--FILFDTPPMLGLADAAITSTHTDGVILVVRSGQTPKEA
A0A7C1G619      ----SAEMKGFLDDLSTRYD--FVIIDSPPVLGLSDSPVMSTMSDGVIVVVSAGRTSGEA
                       .               :.:*:.*.    :        :    :          

A0A1G3XWL5      TLETRRMLEAVGAKILGIVLNAVDQSAMRYSHYYNYYRSYYRSYGDENKK----------
A0A419GMT6      LIQSNKVLLKVATKILGVVLNG-TDIKKKYGYSYCHTSYGNDKQVKKIPFIIKAS-----
A0A7C1NS32      VQTAIGKLHHVKANLIGTVLNGVDTGQGNYYQ----YQYYGDRQPETEQGVFGRLRKPFL
A0A533Z3V6      VVEALDFMEA--GEITGVILNGITNMRRPYYSTYTSSRYVTQGQIDEVDGHENECQQSDS
A0A7C0WL89      IENGLRQLKAINAHLLGFILNGVNKNTGADGYYHGYYKYYTQDDQKEP------------
A0A0F2J1D3      VNHFVDAASKANINIFGLILNKFRPHASNYYHYYQHYRYYKK------------------
A0A7C1KTI3      LTETKRMLNRINAKILGVVINGIKEKDLRYGSYSYYYSSYYKEH----------------
A0A2H0YJQ4      LAEALALLQ--GRNILGIVMNNHSDTGETYYYEA--------------------------
A0A2M7FB38      LAEALALLQ--GRNILGIVMNNHSDTGETYYYEA--------------------------
A0A419FNZ3      IENAMNLMR--NLRVLGIVFNHASEENLDGHY---YNTYYYNRTKK--------------
A0A1G1GRK8      IIEALDLLK--EEQLLGIVYNDAGPEGVNGTYPY-HSYYRHYHSRT--------------
A0A7C1XH67      LKDAVGMLK--NANILGAVYNAAESVFFDGHYKYKYSKYSSYYRDR--------------
A0A2H0YFB4      VLRAISQIE--REKLLGICLNMISAPESLQD-SYYYYRDYDKEGK---------------
A0A2M7FBY9      VLRAISQIE--REKLLGICLNMISAPESLQD-SYYYYRDYDKEGK---------------
A0A533YEM2      VEEALNIIN--PAKLVGLVLNYDDHLIS----HYYGYYSAYSQQQEHRQQRLKQRLTKS-
A0A0K2GDM9      VAEALNSLG--PSKLLGLVYNGDDRLLSSYNYGAYYMTPE----SG--------------
A0A1G1I4J7      VQQAVRQFD--PRKVIGVALNGAVDTGHYSAYGYHYVTSPVMAGVG--------------
A0A2M8DK40      LSDAVRQFG--ANRIAGVVVNRSDRSSYGYGYGYRYYYGGYGYGGEGAPTAETGEKDG--
A0A3C1G280      AQRALSLIK--GRPVLGAVFN--NVPPYLAKSHQRYSYQYAGKAKPEKSNGGSGEHDEP-
A0A0S8DM58      VQNGLHLLK--DINVFGVIFNAVRGMNSNGYHKGTDYYAY--------------------
A0A3A4WKT5      LENAVHLIK--DLKILGVVFNYAHAENLEGHYSRYYYYNYKKKEKK--------------
A0A2U3QDU5      IKEALGMLK--GCNVLGFVFNGVELDMMDDYHRYYNYRRYYSRGGNGKK-----------
A0A7C0ZYC7      IKDALDILK--DCNILGMVYNDAGFENLRGHYSYY-YKQYSGNGDGA-------------
A0A1G1GZ72      VVDALKSLN--KENIIGVVLNDS-KKRLTKIYY---------------------------
A0A1G1F9B9      AQQARKILDSVNAKVLGVVLNAINESNFKYGYYSYYQYYYQNYGSSEEK-----------
A0A7C1G619      LVQTKKILLGVHSKILGVVLNRV-KYRAQYGYYSYYYHNYRYAASRKKTGIS--------
                              : *   *                                       

A0A1G3XWL5      -----------------------------------------
A0A419GMT6      -----------------------------------------
A0A7C1NS32      MRK--------------------------------------
A0A533Z3V6      MHRDNLDAVAAGHVVGDCASVGIWVRAPIFFRAACSNSSSR
A0A7C0WL89      -----------------------------------------
A0A0F2J1D3      -----------------------------------------
A0A7C1KTI3      -----------------------------------------
A0A2H0YJQ4      -----------------------------------------
A0A2M7FB38      -----------------------------------------
A0A419FNZ3      -----------------------------------------
A0A1G1GRK8      -----------------------------------------
A0A7C1XH67      -----------------------------------------
A0A2H0YFB4      -----------------------------------------
A0A2M7FBY9      -----------------------------------------
A0A533YEM2      -----------------------------------------
A0A0K2GDM9      -----------------------------------------
A0A1G1I4J7      -----------------------------------------
A0A2M8DK40      -----------------------------------------
A0A3C1G280      -----------------------------------------
A0A0S8DM58      -----------------------------------------
A0A3A4WKT5      -----------------------------------------
A0A2U3QDU5      -----------------------------------------
A0A7C0ZYC7      -----------------------------------------
A0A1G1GZ72      -----------------------------------------
A0A1G1F9B9      -----------------------------------------
A0A7C1G619      -----------------------------------------
                                                         

© 1998-2021Legal notice