BYKdb

Dataset for cluster orphancd of phylum nitrospirae

[Download (right click)] [Edit] [Sequences] [Repertoires]

20 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1G3XWL5      MKIEREKPNFVISEGTVGFDLSEENYFQTQCKVLKSRNLAKRIIRSLGLDTNPEFIQDME
A0A419GMT6      ------------------------------------------------------------
A0A0F2J1D3      ------------------------------------------------------------
A0A533Z3V6      ------------------------------------------------------------
A0A2H0YJQ4      ------------------------------------------------------------
A0A2M7FB38      ------------------------------------------------------------
A0A533YEM2      ------------------------------------------------------------
A0A2M8DK40      ------------------------------------------------------------
A0A3C1G280      ------------------------------------------------------------
A0A2H0YFB4      ------------------------------------------------------------
A0A2M7FBY9      ------------------------------------------------------------
A0A1G1GRK8      ------------------------------------------------------------
A0A419FNZ3      ------------------------------------------------------------
A0A2U3QDU5      ------------------------------------------------------------
A0A0S8DM58      ------------------------------------------------------------
A0A3A4WKT5      ------------------------------------------------------------
A0A0K2GDM9      ------------------------------------------------------------
A0A1G1I4J7      ------------------------------------------------------------
A0A1G1F9B9      ------------------------------------------------------------
A0A1G1GZ72      ------------------------------------------------------------
                                                                            

A0A1G3XWL5      NKKSSSNENIILAINRPSEKEIEPKLIDVFIGSINVNPVQRSSLVNVSFASDNPELSARV
A0A419GMT6      ------------------------------------------------------------
A0A0F2J1D3      ------------------------------------------------------------
A0A533Z3V6      ------------------------------------------------------------
A0A2H0YJQ4      ------------------------------------------------------------
A0A2M7FB38      ------------------------------------------------------------
A0A533YEM2      ------------------------------------------------------------
A0A2M8DK40      ------------------------------------------------------------
A0A3C1G280      ------------------------------------------------------------
A0A2H0YFB4      ------------------------------------------------------------
A0A2M7FBY9      ------------------------------------------------------------
A0A1G1GRK8      ------------------------------------------------------------
A0A419FNZ3      ------------------------------------------------------------
A0A2U3QDU5      ------------------------------------------------------------
A0A0S8DM58      ------------------------------------------------------------
A0A3A4WKT5      ------------------------------------------------------------
A0A0K2GDM9      ------------------------------------------------------------
A0A1G1I4J7      ------------------------------------------------------------
A0A1G1F9B9      ------------------------------------------------------------
A0A1G1GZ72      ------------------------------------------------------------
                                                                            

A0A1G3XWL5      ANTIGESFIELNIESRFEATYKAREWLQGQINIMKAKLEQAEEALNKYASAHGIIFLDEN
A0A419GMT6      ------------------------------------------------------------
A0A0F2J1D3      ------------------------------------------------------------
A0A533Z3V6      ------------------------------------------------------------
A0A2H0YJQ4      ------------------------------------------------------------
A0A2M7FB38      ------------------------------------------------------------
A0A533YEM2      ------------------------------------------------------------
A0A2M8DK40      ------------------------------------------------------------
A0A3C1G280      ------------------------------------------------------------
A0A2H0YFB4      ------------------------------------------------------------
A0A2M7FBY9      ------------------------------------------------------------
A0A1G1GRK8      ------------------------------------------------------------
A0A419FNZ3      ------------------------------------------------------------
A0A2U3QDU5      ------------------------------------------------------------
A0A0S8DM58      ------------------------------------------------------------
A0A3A4WKT5      ------------------------------------------------------------
A0A0K2GDM9      ------------------------------------------------------------
A0A1G1I4J7      ------------------------------------------------------------
A0A1G1F9B9      ------------------------------------------------------------
A0A1G1GZ72      ------------------------------------------------------------
                                                                            

A0A1G3XWL5      EKGVENENIITKRLSELSTHHTEASADRMNKEALYNTVRSDDSDSSPVVMGNSLIMELKK
A0A419GMT6      --------------------------ADRISKEAIYKEVRKSDVDYGVVLQDPLIRSLTD
A0A0F2J1D3      ------------------------------------------------------------
A0A533Z3V6      ------------------------------------------------------------
A0A2H0YJQ4      ------------------------------------------------------------
A0A2M7FB38      ------------------------------------------------------------
A0A533YEM2      ------------------------------------------------------------
A0A2M8DK40      ------------------------------------------------------------
A0A3C1G280      ------------------------------------------------------------
A0A2H0YFB4      ------------------------------------------------------------
A0A2M7FBY9      ------------------------------------------------------------
A0A1G1GRK8      ------------------------------------------------------------
A0A419FNZ3      ------------------------------------------------------------
A0A2U3QDU5      ------------------------------------------------------------
A0A0S8DM58      ------------------------------------------------------------
A0A3A4WKT5      ------------------------------------------------------------
A0A0K2GDM9      ------------------------------------------------------------
A0A1G1I4J7      ------------------------------------------------------------
A0A1G1F9B9      ------------------------------------------------------------
A0A1G1GZ72      ------------------------------------------------------------
                                                                            

A0A1G3XWL5      NLASLESEYNQKLKTYKPAYPKMVKLKEQIDQIKKKMDSEAKKIITGVKKDYDAALKREK
A0A419GMT6      RYVNLESEYFNLLQVHKPEYPKMIRLREQMEKLKETIGTQEQKIINTLSSDYQLALKKEK
A0A0F2J1D3      --------------------------------------MELAKRIVIDAITIEVYKEKTK
A0A533Z3V6      ------------------------------------------------------------
A0A2H0YJQ4      ------------------------------------------------------------
A0A2M7FB38      ------------------------------------------------------------
A0A533YEM2      ------------------------------------------------------------
A0A2M8DK40      ------------------------------------------------------------
A0A3C1G280      ------------------------------------------------------------
A0A2H0YFB4      ------------------------------------------------------------
A0A2M7FBY9      ------------------------------------------------------------
A0A1G1GRK8      ------------------------------------------------------------
A0A419FNZ3      ------------------------------------------------------------
A0A2U3QDU5      ------------------------------------------------------------
A0A0S8DM58      ------------------------------------------------------------
A0A3A4WKT5      ------------------------------------------------------------
A0A0K2GDM9      ------------------------------------------------------------
A0A1G1I4J7      ------------------------------------------------------------
A0A1G1F9B9      ------------------------------------------------------------
A0A1G1GZ72      ------------------------------------------------------------
                                                                            

A0A1G3XWL5      YLKSEFEVQKKEAINLKDYFVQYQILKREVDTNRELYNGLLQKLKETGVSETLKASNIQV
A0A419GMT6      FLIAAIEKLRNEVSNLQDKIVQIQILKREVDTNSELYNALLQRLKEVGVSAALTESNVQV
A0A0F2J1D3      ILKNYLSKYKEELIKLPAISEDNAKVNLELSVNKDIYQKLLEYILQIEIAESMTMSDRIL
A0A533Z3V6      ----------------------------------------------------------RI
A0A2H0YJQ4      --MSKIEEALEKAKQARSGVKENKAVPEAPEETAPRYTHTVFKEVNP-----DMMEENRI
A0A2M7FB38      --MSKIEEALEKAKQARSGVKENKAVPEAPEETAPRYTHTVFKEVNP-----DMMEENRI
A0A533YEM2      --MASQDKERNQSLESLDE-AQHLHRLLELEMGSRGPETQVQRKVGKRA-----APDAHL
A0A2M8DK40      --MSKIEEALEKATRERQG-GGHEAGGVPQRSSVREAHTAVVAEVAVVNPDPLHLAENRV
A0A3C1G280      --MSRIEQALEKAIKMRESMAGGDTGDMLTAMPHKPAQTEFEAGEVRVD---LKGIDRHI
A0A2H0YFB4      --MRSIEKGLEKAIRERESRSSPDLF-----KLQKEWNDKSLD---------FSKLSAYL
A0A2M7FBY9      --MRSIEKGLEKAIRERESRSSPDLF-----KLQKEWNDKSLD---------FSKLSAYL
A0A1G1GRK8      --MSRTENALEKASRIRRSPQPVPAG-----RNGEPAATGAQG---------ARIEHPHL
A0A419FNZ3      --MSKIEEALEKANKLRGPSGDVKSR--------LMDISRRPE---------HQVENEYL
A0A2U3QDU5      --MSRIERALEKANMVRDREEPVLPEQSVGQADITDVFVTDNT---------ELPKNPYL
A0A0S8DM58      --MSKIEEALEKANKLRASNVRKKTQ-------SLNIFERVEP---------REVENDYL
A0A3A4WKT5      --MSKIEEALKKANILRESYGNTGNV-------KAHIPSDGEI---------IKTDNQYL
A0A0K2GDM9      --MKDVNPALRAVP--PPESGSSSAYQRGDSRGDAPVLEKMLG---------RAKPDEHL
A0A1G1I4J7      --MSKIEEALAKIQSKPRPGGAREPL----PRVDLPAAMNVDR---------DAFIERRI
A0A1G1F9B9      ------------------------------------------------------------
A0A1G1GZ72      MIKGFIEKIMEMKDNLRRD---------------------------------NLLPHEKT
                                                                            

A0A1G3XWL5      IDRAEIPESPYKPNKRLNIILSIIVGLFGGIGLAFFVEYLDNTIKTPEDLEKRVSLPTLG
A0A419GMT6      LDRAQVPRSPFKPKKGFNAALSLILGLFGGVFLAFFVEYFDQTIRTPQDVEKWSRLPVIG
A0A0F2J1D3      VEPAELPEEQKYPWNKLNYILGFILAVFWAFTVALFLEYIDDTIKDPDELKQTSKQPLLG
A0A533Z3V6      IDPGNFPGKPVKPDFLKVFLGGLVAGAGLAGGFIWWLDFRNIPFRRPEEVLAALDYPTLA
A0A2H0YJQ4      VTL---------------------------------------------------------
A0A2M7FB38      VTL---------------------------------------------------------
A0A533YEM2      VSL---------------------------------------------------------
A0A2M8DK40      VVA---------------------------------------------------------
A0A3C1G280      VSL---------------------------------------------------------
A0A2H0YFB4      VTI---------------------------------------------------------
A0A2M7FBY9      VTI---------------------------------------------------------
A0A1G1GRK8      VTS---------------------------------------------------------
A0A419FNZ3      VTI---------------------------------------------------------
A0A2U3QDU5      VTL---------------------------------------------------------
A0A0S8DM58      VSL---------------------------------------------------------
A0A3A4WKT5      VTL---------------------------------------------------------
A0A0K2GDM9      VSL---------------------------------------------------------
A0A1G1I4J7      VTA---------------------------------------------------------
A0A1G1F9B9      ------------------------------------------------------------
A0A1G1GZ72      IRS---------------------------------------------------------
                                                                            

A0A1G3XWL5      FIPFHGDYEGDLPVEYITH-----------------------------ADSKSPVSEAYC
A0A419GMT6      MVP--------------------------------LIKDNLRESSSSVSDNTQVLTESFR
A0A0F2J1D3      SIP------------------------------KTKVFKDIKNISN--LPPTSPFVEAYR
A0A533Z3V6      TIPFMSGLWGNDQKPPDSEPVMAQSRVMRCLAWPLRVIDRLRALTS--ASSVKPVVQANL
A0A2H0YJQ4      ------------------------------------------------AGKSSHITEQYR
A0A2M7FB38      ------------------------------------------------AGKSSHITEQYR
A0A533YEM2      ------------------------------------------------LAPTSVEAEQYR
A0A2M8DK40      ------------------------------------------------SGPSLGASDAYR
A0A3C1G280      ------------------------------------------------TDPYSQGAEEYR
A0A2H0YFB4      ------------------------------------------------LDSKSLAAEQFK
A0A2M7FBY9      ------------------------------------------------LDSKSLAAEQFK
A0A1G1GRK8      ------------------------------------------------RSTFSPVAEEYK
A0A419FNZ3      ------------------------------------------------TRPDSPVAEEYR
A0A2U3QDU5      ------------------------------------------------NEPDSPIAEEYK
A0A0S8DM58      ------------------------------------------------NEPNSPVAEEFR
A0A3A4WKT5      ------------------------------------------------TQPGSPVAEEYR
A0A0K2GDM9      ------------------------------------------------LTPATFEAEQYR
A0A1G1I4J7      ------------------------------------------------VFESGPAVEEYK
A0A1G1F9B9      ------------------------------------------------------ISEAYS
A0A1G1GZ72      ------------------------------------------------GNIQTVITEQYR
                                                                        :   

A0A1G3XWL5      TLRTFLLLSTGGR-PPRIIAITSPAREEGKTTTAINTAISFARS-GAKVLIIDADMRRPK
A0A419GMT6      SIGTWIKFANSSV-KPRQILVTSPLEGEGKTLVSINTAMSLLNVV-GKGVIIDADFRRPC
A0A0F2J1D3      TIRNSLLFASIDK-PVKTFLVTSSIEKEGKSSIASNLAVTFSAED-KNVLLLDLDLRRPS
A0A533Z3V6      NALAAEQF----R-VFRILALSSSVAAEGKTTVAVGLAVTLARDYLEETILIDGDMRNPS
A0A2H0YJQ4      MLRTQILQRTEGN-GDNCLMVTSAADGEGKTTTAINLAVSIAQEVQKNVLLVDADLRRPS
A0A2M7FB38      MLRTQILQRTEGN-GDNCLMVTSATDGEGKTTTAINLAVSIAQEVQKNVLLVDADLRRPS
A0A533YEM2      TLGFLLQQKQQTG-ALKVIAVSSATPGDGKTTTAINLAGAMAQSHEARVLLVDADLRLPS
A0A2M8DK40      QLRATLMLAADHQ-RL-AFVVTSPLQGDGKSITTLNLGYAIAQELQLDAVVVDTDLRRPV
A0A3C1G280      KLRVRLLRATQKN-FLNTIMVTSSGVGEGKSITAINLAVSIANEIDHTVLLVDGDLRRPS
A0A2H0YFB4      RLRTQVMKKMRSR-MENTLMVTSATRGEGKTTTALNLAVSVAQGMNETVLMMDTDFRKPG
A0A2M7FBY9      RLRTQVMKKMRSR-MENTLMVTSATRGEGKTTTALNLAVSVAQGMNETVLMMDTDFRKPG
A0A1G1GRK8      KLKARVMRMTKQEPFRNVLLVTSSVGGEGKSVTAANLALSLARDYDHSVVLIDADTRKPS
A0A419FNZ3      RLKSILIRETKAD-FLNTIMVTSSVDGEGKSLTAVNLAITLAQEIDHTILLIDADLRKPM
A0A2U3QDU5      KLKSMVVKMTKQGKFQNTLMVTSTVAEEGKSITAMNLAITLACEYDHTVLLVDADLRRPS
A0A0S8DM58      KLKSMLLRITKKD-FLNTVMITSSISGEGKTITAINLAVTIAQEIDHSILLIDADLRRPM
A0A3A4WKT5      RLKSMLIRETKAN-FLNTVMITSAVEAEGKSLTAVNLALTLSQEIDHTILLVDADLRKPT
A0A0K2GDM9      TLGLMLEQRRQTG-LLQVVAMTSPTMGDGKTLTAINLAGAVSQSPSARVLLMDVDFRKPS
A0A1G1I4J7      KLRTRVLAWLRAA-EGNVVMLASAGGKEGKSLTAVNLAVSVARELHQTALLIDADLRRPH
A0A1G1F9B9      SIRTLLLFSTAGK-PPKVMMITSPLREEGKTTTAINTAISLTK-SDARVIIVDADMRRPR
A0A1G1GZ72      LLRSRLSSLNGSH-GNKVIAVTSTQKGEGKSITSVNLAIVMAEDTKKKVLLIDGDMRKPS
                                  . ::*.   :**:  : . .  .        :::* * * * 

A0A1G3XWL5      LHRLFDVDNT--SGLSTYLSGIEELTEDLMKETNIPNLHVITS------GPIPPNPAELL
A0A419GMT6      VHTSLDLDNS--TGLSSFLSGTS-EFDQLIKKSSVTGLDVITS------GPMPHNPSEVL
A0A0F2J1D3      AHTFFNKTSA--KGITNVLADTM-TLDEAIEKTDIKGLDLLLS------GPIPPDPSRLI
A0A533Z3V6      VSSRMGLRNE--KGLVNVLAGEC-DLDSVLYQHSHRNLKILTAGTNEGNGSLPVDRLGLP
A0A2H0YJQ4      IHKMLGLKPE--KGLVHYLMDQV-PLEDLLIRTGVEKLTFLPA------GGTLPNSTEIF
A0A2M7FB38      IHKMLGLKPE--KGLVHYLMDQV-PLEDLLIRTGVEKLTFLPA------GGTLPNSTEIF
A0A533YEM2      VARQLGMTESEVPGFADAIMNPEYALKDVVRECPGFHLAVLPA------GRCPLLPDEVF
A0A2M8DK40      LAKFLGIEGQ--RGVSDYLNDPSVTLDDVVVRLAGGPLWVSAG------TVRLHNTSELL
A0A3C1G280      LHRYLGIEPS--LGLSDYLMGKT-ALSNALVRTGVGKLVLLPA------GTPPQNPSELL
A0A2H0YFB4      VHTYLGIEAK--KGLVDFLRGEA-EIPELLVKTEIPKLILLPS------GQPPENPSELL
A0A2M7FBY9      VHTYLGIEAK--KGLVDFLRGEA-EIPELLVKTEIPKLILLPS------GQPPENPSELL
A0A1G1GRK8      LHTLLNVKPG--IGLADCVADDI-DIGSALVKVGNGNLQFVPA------GKRHENPVELF
A0A419FNZ3      IHEYLGISHK--YGLADYLSGDI-DFSEIVVKAGIGNLMFIPA------GHVAVNPVELL
A0A2U3QDU5      LSHLLGIETS--PGLSDCLLNGL-DIKDALVKTGIGKMVFLPS------GSHVSDPVELL
A0A0S8DM58      IHNYLGMNPK--YGLSDYLLKDI-DISEILVKTGIGKMVLLPA------GKTVPNPQELL
A0A3A4WKT5      LHEYLGISCK--YGLSDYLTRDI-DLSEILVKTGIGNLLIIPA------GHTVENPVELL
A0A0K2GDM9      IAAQLGLRDN-IVGLRDAALNAGLRLKDVVRRHPAWNLSIATA------GRAQGLPHEII
A0A1G1I4J7      LHQLLDVKGQ--PGLSDFLMGEG-DLSGLFHSTGIPKLTLVPA------GTPTARSPELL
A0A1G1F9B9      LHKVFKVENI--SGLSSFLSGNTEFSEELIKHTDVPWLDVLTS------GPLPPNPAELL
A0A1G1GZ72      IHAFFNCKSE--YGLVDLLTNKIDI-ESILVPSGVNNLTILPA------GGPVESPSDII
                    :        *.              .       : .  .               : 

A0A1G3XWL5      NSL-RLKELINSL---YLYNFIIFDTPPVIGLPDSLILSSYTDGVMLIAKSGKTTKETTL
A0A419GMT6      NSD-RMRELMDALSAMYD--FIVIDSAPLLGLSDSLILSASVDSVMLVVKSGQTPKDALI
A0A0F2J1D3      ESE-KIKNIIEALKQKYS--LIIIDTPPVVSVNDAVVIGKLVDGAVYVVEAGRASGSMVN
A0A533Z3V6      ASRGEFQKLLESLRHRGV--FVILDSPPILPMADMNLYAQVVDGIALVVRAGQTPQSVVV
A0A2H0YJQ4      NSS-RMKNFIREVKDRYKDRYVIFDTTPILSTADPVVLSQSMDGIIFVVQADRTQRGDLA
A0A2M7FB38      NSS-RMKNFIREVKDRYKDRYVIFDTTPILSTADPVVLSQSMDGIIFVVQADRTQRGDLA
A0A533YEM2      KSA-RVRELLEEARTSYD--YIVLDTPPFVLVPDCRMIEKWVDGFLMVIAAHKTPQKLVE
A0A2M8DK40      GSR-RMEQFCGELRHRFPTAILLFDSPPILPAPDAMTLVQWLDGGIIVVSAGKTSRRALS
A0A3C1G280      SSE-RMKETVRELKNRYKDRYVIFDSSPVLATADTLSLSNYMDGIIFVVQASETSPRDAQ
A0A2H0YFB4      SSE-RMSQLIREIKSRYEDRFIILDTSPINVFTDASILIPLVEGVLMVVQDGVTPREYVL
A0A2M7FBY9      SSE-RMSQLIREIKSRYEDRFIILDTSPINVFTDASILIPLVEGVLMVVQDGVTPREYVL
A0A1G1GRK8      SSQ-RMRTVILEMKSRYPDRYIIIDTPPVLLFAETKMISALADGIIFVVREGLAPLQHII
A0A419FNZ3      ASE-KMNAFIKEIKHRYVDRYVIIDTPPILPFADAIAVGSVVDGVVFVIKEGRTQKKSIE
A0A2U3QDU5      LSR-RMQELLSDIKHRYADRYVIIDTPPVLPFAEVHSLASGVDGLIYVVREGLAPLNGIK
A0A0S8DM58      SSV-KMEYLIKELKQRYMDRYIIIDTPPILSFAEAISIGHCVDGVIYVVKEGQTQRKAVQ
A0A3A4WKT5      SSV-RMKTLIHELKHRYMDRYVIIDTPPILPFADAISLGSLVDGVLFIVKEGRIQKKSLE
A0A0K2GDM9      KSA-RFAELLNEARRDYE--WIFLDTPPLMLAPDCLILGRNVDGFLMVVYANKTSRQEVA
A0A1G1I4J7      ASQ-RMSEFLEEVRRRYKDRIVILDAPPVLPATDAVILANHVDGIVFVVRAGGSAREDVQ
A0A1G1F9B9      SSS-RFRDLIDGLHPLYN--FILFDTPPMLGLADAAITSTHTDGVILVVRSGQTPKEAAQ
A0A1G1GZ72      ANP-RFKEGIERLKKRFD--YIIMDSPPIIPFADMNILGDIVDGILLVVKAETTPKERVV
                 .   .               :.:*:.*.    :        :.   :            

A0A1G3XWL5      ETRRMLEAVGAKILGIVLNAVDQSAMRYSHYYNYYRSYYRSYGDENKK------------
A0A419GMT6      QSNKVLLKVATKILGVVLNG-TDIKKKYGYSYCHTSYGNDKQVKKIPFIIKAS-------
A0A0F2J1D3      HFVDAASKANINIFGLILNKFRPHASNYYHYYQHYRYYKK--------------------
A0A533Z3V6      EALDFMEAGEIT--GVILNGITNMRRPYYSTYTSSRYVTQGQIDEVDGHENECQQSDSMH
A0A2H0YJQ4      EALALLQGRN--ILGIVMNNHSDT------GETYYYEA----------------------
A0A2M7FB38      EALALLQGRN--ILGIVMNNHSDT------GETYYYEA----------------------
A0A533YEM2      EALNIINPAK--LVGLVLNYDDH----LISHYYGYYSAYSQQQEHRQQRLKQRLTKS---
A0A2M8DK40      DAVRQFGANR--IAGVVVNRSDRSSYGYGYGYRYYYGGYGYGGEGAPTAETGEKDG----
A0A3C1G280      RALSLIKGRP--VLGAVFN--NVPPYLAKSHQRYSYQYAGKAKPEKSNGGSGEHDEP---
A0A2H0YFB4      RAISQIEREK--LLGICLNMISAP--ESLQDSYYYYRDYDKEGK----------------
A0A2M7FBY9      RAISQIEREK--LLGICLNMISAP--ESLQDSYYYYRDYDKEGK----------------
A0A1G1GRK8      EALDLLKEEQ--LLGIVYNDAGPEGVNGTYPYHSYYRHYHSRT-----------------
A0A419FNZ3      NAMNLMRNLR--VLGIVFNHASEENLDGHYYNTYYYNRTKK-------------------
A0A2U3QDU5      EALGMLKGCN--VLGFVFNGVELDMMDDYHRYYNYRRYYSRGGNGKK-------------
A0A0S8DM58      NGLHLLKDIN--VFGVIFNAVRGMNSNGYHKGTDYYAY----------------------
A0A3A4WKT5      NAVHLIKDLK--ILGVVFNYAHAENLEGHYSRYYYYNYKKKEKK----------------
A0A0K2GDM9      EALNSLGPSK--LLGLVYNGDDRLLSSYNYGAYYMTPE----SG----------------
A0A1G1I4J7      QAVRQFDPRK--VIGVALNGAVDTGHYSAYGYHYVTSPVMAGVG----------------
A0A1G1F9B9      QARKILDSVNAKVLGVVLNAINESNFKYGYYSYYQYYYQNYGSSEEK-------------
A0A1G1GZ72      DALKSLNKEN--IIGVVLNDSKKRLTKIYY------------------------------
                              *   *                                         

A0A1G3XWL5      ---------------------------------------
A0A419GMT6      ---------------------------------------
A0A0F2J1D3      ---------------------------------------
A0A533Z3V6      RDNLDAVAAGHVVGDCASVGIWVRAPIFFRAACSNSSSR
A0A2H0YJQ4      ---------------------------------------
A0A2M7FB38      ---------------------------------------
A0A533YEM2      ---------------------------------------
A0A2M8DK40      ---------------------------------------
A0A3C1G280      ---------------------------------------
A0A2H0YFB4      ---------------------------------------
A0A2M7FBY9      ---------------------------------------
A0A1G1GRK8      ---------------------------------------
A0A419FNZ3      ---------------------------------------
A0A2U3QDU5      ---------------------------------------
A0A0S8DM58      ---------------------------------------
A0A3A4WKT5      ---------------------------------------
A0A0K2GDM9      ---------------------------------------
A0A1G1I4J7      ---------------------------------------
A0A1G1F9B9      ---------------------------------------
A0A1G1GZ72      ---------------------------------------
                                                       

© 1998-2020Legal notice