BYKdb

Dataset for cluster tadcd of phylum lentisphaerae

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1G0YAS5      MNKFMEQPVQSGTGSAGIGGGSKKSFNVVD---------LKQYFFIVVKRIWLVALCFIV
A0A7C5AHC4      -MSDSKDLIPVGSNLPERDSAWRFQAPAIEIDNSDVSSFLRTYWHVLLKRRRTIAAVTFV
A0A1G0YWH6      ------------------MTQDRSFQDHDYDIPEEQQTHWREYVRVLWEWKWITITAVVI
A0A1G0YCS8      ----------------------------MADSQQDTALHFLDYWRVIKSRKEIVMAVTLL
A0A7C6UGI3      ----------------------------MAEEAQTTTLHFLDYWRVIRDRKEVILAVALL
                                                          *  :: ..        .:

A0A1G0YAS5      SLSVMVVILIRQIPEYQSVATLLLSRGLPLPVRLKQ-EEME-LILGDYIATQQRIIQSSL
A0A7C5AHC4      ATTLAAIYAFKSRPVYEAVSKVAVEAETPQIQTVQDLYQSR-PTDATYLATQVDILRSDD
A0A1G0YWH6      GATLGLIQNFKAVPVYQATTPVELEADTPRIVNFQDVAATD-TRSSDYLNTKVQVLRSRS
A0A1G0YCS8      IVITGVAVTFMQPKKYSSTVRILVREDSMDVDVF-ERQMIQ-GYNPFFLRTQERILKSTP
A0A7C6UGI3      TIVTGTAYTLMMPQKFTAVTQLEVLEDSMDVDPFYDRQSSRLGYNPFFLMTQQKIMTSRP
                         :     : :.  : :         . :           :: *:  :: *  

A0A1G0YAS5      VINGARERLNLPG------D-EFNQKYRS----------------------LSVVPIWQT
A0A7C5AHC4      LAWKTIEQLHLDQ------NAQFNPAARGADLSSGSPDAVKAGLIQAFKDRLKVDLLQGT
A0A1G0YWH6      LAEKVVKTLALNG------NPDFLPGAGE-----------NADFAGALQGCVSAQLRRGT
A0A1G0YCS8      LLYAVIDNLNLQAVWGQQYNDDKSPITKE-----------DA--LATLSSSIKIEQDRDT
A0A7C6UGI3      ILTQVIRNLNLQRVWGLQLNEDKSPITAE-----------LA--LQILTRNLRVEQDRDT
                :   .   * *        : :                             :     . *

A0A1G0YAS5      AIMAITVKGLDPVFCADFANALAEEYLDFKAGERMDTSQATVISLTQQANRLHEELKKAE
A0A7C5AHC4      SVIQVAYESFDPALAARVVNTLVGNYTEYNFLTKYDATRQASAWMEQRLDELKDKVEKSQ
A0A1G0YWH6      RIIDITAEHTNPKMAALVANGVAQEFVKLNSENRLSASMDAIRWLSTQAEQYKTQLAKSE
A0A1G0YCS8      SLINISVTQEDRELAARIANEMAAVYREQRLDVKRSELRRAIEVLDNEVQKQQEKVDQAE
A0A7C6UGI3      TLMNISVKSEDPKLAADIANEIANVYRDRRLNAKRREIQRAIDAMSNEVRKQQERVEEAE
                 :: ::    :  :.* ..* :.  : . .   .      :   :       :  : :::

A0A1G0YAS5      IQSLAFIRENSVVGIQER---GNVAAEFLGSLSRQAATYRNQRMLLEAQQPLLSQASDEV
A0A7C5AHC4      QALVNYEQQHSIVDLGNR---ENVMEQRLGSLTQDLTEAQND---LAQKQSLYQLAEAN-
A0A1G0YWH6      AAVQEYREKTRDVSLEDS---YNIVLDKLKSMNTAFGNAKMA---RMSTETEWKQVQAL-
A0A1G0YCS8      SELERIRQEVGVSFLGQG---FRADKVRLQQLEADRIASRVD---MLVRKARLNQLES--
A0A7C6UGI3      MELERIRQEQGIALIGKGMASYRIETASLSMLQSERSAARVE---MLVRKARLDQLED--
                        :     : .     .     *  :       .         :.  .  .   

A0A1G0YAS5      VLATLSYPIQIGTIPVPNSSMSTSSVNSVLGGGPESLIEYGVVEQPFWSALKRKKAVLEG
A0A7C5AHC4      -------PKQAGIL----------------------------VQDQLLQQLQQKYGDLQT
A0A1G0YWH6      -----------------------------LDSGRDAALIPAIASDGEVETLHQSLTQKQI
A0A1G0YCS8      -----------------------------LEGTELMNASSYVVMDQSIASIRQQLIDTEV
A0A7C6UGI3      -----------------------------LEGEKLMDAAAYIVQDPTLLGIRQQLIDSQV
                                                          . :     :...    : 

A0A1G0YAS5      QLVSYRKK--YKEEHPLVKETVSALQETDDALNVELEFALRQFYSQLESLSIREKSAERV
A0A7C5AHC4      DYVNALAQ--YGPNFPKVVRLREQIREVSSLMDQEQKQVLERLRHDYLAALGREKILSAA
A0A1G0YWH6      AVSVLRER--YKDQYPAMIVALSEQKEIENKLKQACVAAVEKIKARYAVAKAQEESLVEP
A0A1G0YCS8      ALKLMLEN--MGVNHPDVKRLQAGVDELKKKLNESLVGLKIGLNADYEVAKAKFDALEAE
A0A7C6UGI3      SLQLMIKNGVMGENHPEVLRLRGAVDELQRQLDSALTGLKAGIKADYEVARQKFEALEEE
                       .     :.* :        * .  :.         :         . .     

A0A1G0YAS5      EKEWEDQALE-VSKKMQEYRNIQRNSDRLQGLYDLVFNRLKEVDITLGIEPESVRIMERA
A0A7C5AHC4      VDQEKAEIGK-ASQLLIQENILKHEFQTNEDLYDNLLMHVKNATVSAGLRANNVHVIDHA
A0A1G0YWH6      LAEQEKQALE-LSRKLVEYNRLKRNAESDRQLYDSLLMRMKEAGVTGKLEFNNMHIIDPA
A0A1G0YCS8      LQAAKHSDIEDEKKKFLPFDRAERNVIIQRDILNALRARITQQGIEVEVPRTPVEVVEPA
A0A7C6UGI3      LNRIKASDIASEGENYLPFDRAERNVSIQRDILTALRARITQTGIEVEVPRTTVDIIEEA
                    : .               :.:      :   :  .:.:  :   :    : ::: *

A0A1G0YAS5      KPPSSPITPRKLQSLFMAALVGLGIGLGLIFGLEYIDDSIRYPEEVTQGLGIPFLGVVPS
A0A7C5AHC4      LIPTHPVPPKQGVDIAVGFLVGLMLGITIAFAEEGLDNSVKNAEDVERYIPAPALAVIPA
A0A1G0YWH6      RVPGAPCRPDKKRNLTYAIVMGLLAGLVLSYGAHFYDDKIKTCKDIESYLGMPLLCEVPR
A0A1G0YCS8      EPANKPSSPLVMLNILLSIFLGFGAGIGLAYFIEYLDTSVRTVDDVEQFLGLPVLGVIPQ
A0A7C6UGI3      EPPTKPSSPLVVLNIFLSVVLGLMAGVALAFFVEYLDVSIKTVDEVEKYLDLPVLAVIPQ
                  .  *  *    .:  . .:*:  *: : :     * .:.  .::   :  * *  :* 

A0A1G0YAS5      A-------NWDPEDLRAHILANID--------QKSGLAEAYRNVRSSLLLGKAKDRLKTL
A0A7C5AHC4      AASVEPHRGWLAGGAKASPLRDVEVALTVAKAPTSPLAEAFRTLRTSVLLSTAPRPPQTV
A0A1G0YWH6      I--------ENKSDSDRATIVSTD--------PLSLASEAFSSLRATIGATPNAKDIKVL
A0A1G0YCS8      ---------------KIRPLIHEG--------PESPHGEPYRVLRTNMQFSNKGIHGGAF
A0A7C6UGI3      ---------------QSRPLTEAG--------QSSGQGESYRALRTGLMLLARETKHKIL
                                   :              *  .*.:  :*: :           .

A0A1G0YAS5      VITSAVPKEGKTTTCLNLAISLAQAGSRVLMVDADMRRGELHKFFGLEGGR--GLADVLT
A0A7C5AHC4      LVSSAQPGEGKTSTALNLALSLAQRGGQVLIVDADLRKPAVAGALGLKEKK--GLCGVLT
A0A1G0YWH6      MVTSTAPGEGKSLVASNMAIAFAHDNLRTLLIDADLRHPTLYKDFQIKTQTVRGLSQYLM
A0A1G0YCS8      AVISGGVGEGKSTTLFNLAYTCAQLGYKTIVVDSDLRRPVQHSILSMSNRI--GLTNVLM
A0A7C6UGI3      AVISGGVGEGKSTTLFNLGYVYAEQGSKVLIVDTDLRRPVQHKMVGLNNRI--GVANVLT
                 : *    ***: .  *:.   *  . ..:::*:*:*.      . :.     *:   * 

A0A1G0YAS5      GQ-AKPEAVIQRSGVPNLDLIATGPFPSNPAEIVLRPEMNSFLDYARRTYDKVVFDCPPV
A0A7C5AHC4      GAYSLDEALVRIENLNGLWVLASGPHPPNPAELLSSPTMEQLLKDLCGRFNHIVIDSPPL
A0A1G0YWH6      DG-CKREDVILKSGIRDLDIIIAGKIAKNPAELLGSARMRELIEQERQRYDRIIIDTPPV
A0A1G0YCS8      KD-STLEECVKPTIVPNLSFLPSGRLPRSMMGIIDSQRMRELVKDLKSRYDYVFFDSPPI
A0A7C6UGI3      GE-MKADEVIQQTGVPNMDMMPSGRLRRGSMGIMNNIRLRELLDTVKDNYDIILLDSPPI
                      :  :    : .: .: :*    .   ::    : .::.     :: :.:* **:

A0A1G0YAS5      MAVSEAAILASMVDGVITIVWAGHTSKKLAQLCARLIRERGAVILGCVLNNLEFSRVGYY
A0A7C5AHC4      LALTDAIVLSALVDGVVLVVESGVTPRNALVRSFRMLQDAGARVLGTVVNKMDLRVDGYY
A0A1G0YWH6      AVVSDAIVLLPRVQGIIFVTHFRKLRRDAVARAVKKLREMGAPLIGNVLNNIDLKKHGYY
A0A1G0YCS8      IGITDASILASEVDGVLLVVQYRKYPRVISSRAKRMVENVGGKLLGVVLNNINIMRDDYY
A0A7C6UGI3      LGVTDAAILSSEADGVLLVVQYRKYPKIISLRAKRMIENAGGHLVGAVLNNINIMRDDYY
                  :::* :* . .:*:: :.      .     . . : : *. ::* *:*::::   .**

A0A1G0YAS5      YYSTYYGYYNYDYHYGKNEAGKRV--------------------------
A0A7C5AHC4      GYS-YRRYYGSDYFKEKSDVVTTAVAAPADFASGTPQSRPSERPRPDVQE
A0A1G0YWH6      YYP-YHGSYRYPYYHKKDGRRRMESEEESES-------------------
A0A1G0YCS8      YY------YHASYTQYNPDGQEKVPAKTIAASADGKDSLF----------
A0A7C6UGI3      YY------YHYTTKKYYGSTRHEQLEDAAEV-------------------
                 *      *                                         

© 1998-2021Legal notice