BYKdb

Dataset for cluster orphancd of phylum ignavibacteriae

[Download (right click)] [Edit] [Sequences] [Repertoires]

14 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A523N7W7      ------------------------------------------------------------
A0A2M8FIB1      ------------------------------------------------------------
A0A2H0Z4Q0      ------------------------------------------------------------
A0A2M7ITQ8      ------------------------------------------------------------
A0A7J5EBK8      ---------------------MVKYEESATPEKFSLILNFE-------------------
A0A1G0RXP0      --------------MEKFNLEKYLHGESKSIKDYILLIRNNLKYIFIISPIVISLTVIYI
A0A3D6B6N8      MMNNNNNGSGNPAGNQNFNIEKYLLSGTKSAKDYILLFRNNLKNIVIISLLILIIAAAYA
A0A3A0BD75      ----MENNPTGNFINQYQLNNGTEDSGRDTLRDYLVILRMHWVAIALIFAAAMCVTIVYI
A0A3N5L0V6      ----MENQPTNR---NSLNTIETNIKSSHSIRFYFNLILRNKVPIILSLVVGIIVSYFYA
A0A1G0RWW2      -------MAEEI---QD----DYNVHQTNTFKDYLRIIRVNWIPVSLITLAGLIVAIIYA
A0A6M8V159      -------MAEDQ---QE----DYGVHQTNTFKDYIRLIRANWVPVVLITLVGLIVASIYA
A0A6M8VC48      -----MNNQNSF---EP----GFDEHQSSTLKDYLILFSVNLKPVLTILAASLIISIIYA
A0A1G0TD08      ----MNNNQNNF---D------LQELEGKSFKDYLALVQKNLWPFLIISLVILIGTAFYV
A0A1G0XBL4      ----MNNNKNDF---D------FQELEGRNFKDYLILLRKNLTPFLIILIMSIAVSIVYT
                                                                            

A0A523N7W7      ------------------------------------------------------------
A0A2M8FIB1      ------------------------------------------------------------
A0A2H0Z4Q0      ------------------------------------------------------------
A0A2M7ITQ8      ------------------------------------------------------------
A0A7J5EBK8      --------------------------------PDSADDNPLSQSVKKLKS---------A
A0A1G0RXP0      LLAKDIYKSSATIRITKQ-NENVLENTG-QSYDVGYVDRFIANEIRTITDYSIREKIAEV
A0A3D6B6N8      ILAKNIYTSAASIRITNP-YKNVLEDGR-QNTDNAFLDRYIVSEIGVIGNYATRKKIAQA
A0A3A0BD75      LTATNYYSTTTSIKINKP-QESILSSSIFTDFGGQQADRFIANEIDLMQTYPIRQKAAKF
A0A3N5L0V6      YSQEDIYSSASLMRLAKP-KENVLEGKIFSDIEGELPERFINNEVEILKSFAIREKTARS
A0A1G0RWW2      ANATDIYKSTAALKIARPQGGSVLTSPLLPEFQEWGNDRFIANEIEIMRSFTAREMVAVS
A0A6M8V159      INAIDIYKSTATIKISRPQGGSVLTSPLLPEFQEWGNDRFIANEIEIMTSYTARRMVAVT
A0A6M8VC48      LTAPNIFKTFTALKITKP-GGSILQSPLLPEINDYGNDRFIANEIEILKSYNLRERIAKI
A0A1G0TD08      LRLTDIYVSETSVKISKS-GGSILQTAPLLGMGDLGNDRMINNEIEILKSFDLRKIVANA
A0A1G0XBL4      LRLPDIYVSETSIKISKS-GGSVLQSQPFGDFGDLGSDRIINNEIEILKSYDLREIIAKA
                                                                            

A0A523N7W7      ------------------------------------------------------------
A0A2M8FIB1      ------------------------------------------------------------
A0A2H0Z4Q0      ------------------------------------------------------------
A0A2M7ITQ8      ------------------------------------------------------------
A0A7J5EBK8      LSDEY---------------------KNAAPRSIYSITQVLFGSVAIEQKRGLDIVEITV
A0A1G0RXP0      LIDSFKSTPSKNLFYLVKSADDR---GNIGHKPVMELAGLLGGAISVEQIQGTDMITISA
A0A3D6B6N8      LIDSFEVSKHKDMLPLISA--QK---GSSSHKSVNQIAGMLGGIISVEQNQGTDVVFISA
A0A3A0BD75      ILDTLQTIEDKSALYYLYSDPEN---ISQGFRTVESMAKLLSDIVAIDQKRGLDVVTLVA
A0A3N5L0V6      IIDSFKVLKDKQSFALICMNRAN----CMEPKSVNQVASLLTGYIEIAQKRGLDIVSIKA
A0A1G0RWW2      LIDSFYRDTDKSRYSILLDQKPKTGDFENDIKSVDALAISLSD-VAIDQKRGLDIIEISA
A0A6M8V159      LIDSFYRDLNKSHYFVLKDTKLTENESDNNVKSVDDLAIALSD-VSIDQKRGLDIIELSA
A0A6M8VC48      LIDTLLKSPDKNDFSLLLVDELG---KDKTPASVPEAAKILEDAVQIEQKRGLDIIDISV
A0A1G0TD08      LLDSFAQSKSKDDFKLLYKSESNFGRETKKLLQSPNIEEMLGSIVDIEQKRGLDVIVIAA
A0A1G0XBL4      LLDSFAQSSSKDDFKLLYKSESEFRNDNKRLLKLGEIEGVLGSKVNIEQKRGLDVIVISA
                                                                            

A0A523N7W7      ------------------------------------------------------------
A0A2M8FIB1      ------------------------------------------------------------
A0A2H0Z4Q0      ------------------------------------------------------------
A0A2M7ITQ8      ------------------------------------------------------------
A0A7J5EBK8      ESPSAYEAALIANTYADAYRELNLQYNRQQMISVKKFLDQQREEKLNELVSAEENLKTYQ
A0A1G0RXP0      ESPSPLETAIIVNICALEYQKLNLAMNREKLTNIRKFLEQQREEKFAELKNAEDTLMIFQ
A0A3D6B6N8      ESRSAFETALIANCAALEYQKINTAVSREKLTNLRKFLDDQAQEKLAELRSIEDSLMRFQ
A0A3A0BD75      ESPSPIEATIISNLYARAYSEYSLELSRKDLTNTISFLVKEKDRKMRDLNNAEASLEDFQ
A0A3N5L0V6      ESPSPQEAALIANCYAETYADYSLKFNRGHLTLNREFLEKQVQGKYDDLLKSEDRLTTFL
A0A1G0RWW2      LSPSPFEATLIANVYSQQYKTLNLDQNRNQLTLVTNFLDEQRKEKYDDLNSAEETLRAFQ
A0A6M8V159      VSPSPYEAALIANVYAQQYKKLNLEQNRDQLTLVTNFLDEQRKEKYDELNAAEETLRDFQ
A0A6M8VC48      QSKEPSEAVLIANVYAKEYLMYNLEINRNQLIFVRKFLDNQRQEKKEQLNEAEEILRSYQ
A0A1G0TD08      QSPSPREAALIAALYAKIYRTYNLEINREQLSFVRDFLDQQRAEKKIQLSQAEDTLRAFQ
A0A1G0XBL4      ESPSPKEAALIAALYAKVYRTYNLEINREQLSYIRNFLDQQRAEKKTQLSQAEDTLRAFQ
                                                                            

A0A523N7W7      ------------------------------------------------------------
A0A2M8FIB1      ------------------------------------------------------------
A0A2H0Z4Q0      ------------------------------------------------------------
A0A2M7ITQ8      -KGGIIALDDQAKELITQLSKFEADLNLGKMELAISEKTLKQYKDELRRQDPQLTAYLEN
A0A7J5EBK8      EEGGIIELGEQAKALIEQMTDFESKKNATKIDLTISEKSLAQYKDELAEQNPKLKDYLEN
A0A1G0RXP0      EKSGIVDLDFQSTGLISQLSQLEAQIEVTKIELSTSDEILKQYKFFLSKQDPQLVDYLEN
A0A3D6B6N8      EKGGIISFDVQSTNIIGQLSNLDAQKEAIKIQLSTSNEVLKQYKFFLKKQDPQLVEYLEG
A0A3A0BD75      KRSGLINLDVQSEQLVNSISELDKAKGYAQVEITGNQTKYNELSAEIKKIDPQLVTFLEG
A0A3N5L0V6      RSQNIVELNAQANALINTMTSIETQHNGAAIDLQTSGRTVSEIKSELDKIDPKATDFIAS
A0A1G0RWW2      ERGGLIALDERASTLISVLSQFEAQKSATQVDLMASNKVLESLRQELKAQNPRMADYLTS
A0A6M8V159      ESGGLIALDERASTLISVLAQFEAQKSATQVDLMASNKVLENLRKELQAQNPRMADYLTS
A0A6M8VC48      EKGGIIALDQQAQTLIQQLAQFEAQRNAVQIELEASNEILKQYKNELQQQDPKLADYLAS
A0A1G0TD08      EKGGIIALDEQAQTLIQQLSQFEAQMNAAKIELIASTEVLNKYKEELTKQDPKLADYLAS
A0A1G0XBL4      EKGGMIALDEQSQLLIQQLSQFEAQMNAAKIELVASEEVLNKYKDELSKQDPKLADYLES
                                                                            

A0A523N7W7      ------------------------------------------------------------
A0A2M8FIB1      ------------------------------------------------------------
A0A2H0Z4Q0      ------------------------------------QAIREYDAKIKELRNKLNSKIEGF
A0A2M7ITQ8      FSSEEYLKNLQTELARLEVNRDVA-LSSVKDKNVDTQAIREYDAKIKELRNKLNSKIEGF
A0A7J5EBK8      LTTEPYLNSLQKQIAELQTKRDLVKVNASNRSADISKTIADYDKQITELQDKVKEKISIY
A0A1G0RXP0      QTSQAYINVLQQQLAELQVNKDLA-LSLKNPNVDISNKIKEYDQRIEELKQKLNSAISSI
A0A3D6B6N8      QTSQAYINALQQQLAELQVNRDIA-MSIKSSDVDVSSKVKEYDTRIADIKQKLNSTISTI
A0A3A0BD75      ELSGKYVTDLQAKISELELQKSIE-LSNTQTQAVRDKIIGDYEQRLQPLRNSLNEKVMKL
A0A3N5L0V6      KITDPYVAQLQQEIAKLEIQRDLV-ISGNEELLKDAKSLSSLNNKIADLKKNLDIKIEIL
A0A1G0RWW2      LTSQKYITAIQDEIAKLEVNKQVA-VSRKDGLTEESPVIQEYDRKISELRKQLDKELEVL
A0A6M8V159      LTSQKYITAIQEEITKLEINKQVA-LSKKDGLTEDSPVILEYDRKINELRKELDKELGVL
A0A6M8VC48      ATSETYIKALQNQISELQIRRDLS-VAKAEPKTDFSTQLKEYDNKIDELKKKLDEKIKVL
A0A1G0TD08      VTSETYITALQNQIAELQLNKDIA-LAKFESGIDISQKVKEFDLKINDLKGKLDEKIKVL
A0A1G0XBL4      VTSETYITALQNQIAELQLNKDIA-LARLEPGIDISQKVKEFDVKIRELKDRLDEKIKVL
                                                                            

A0A523N7W7      ----------------QKIIEEEVRNQALQTSIKELDKIVKSYEKRFLKLPKSALELARL
A0A2M8FIB1      ----------------------------------------------------SAIEYARL
A0A2H0Z4Q0      KASIFASSPEEVKLMTKNVIEEEIKSKSLEIKVKNLSEIVNKYDSKFNQLPKSAIEYARL
A0A2M7ITQ8      KASIFASSPEEVKLMTKNVIEEEIKSKSLEIKVKNLSEIVNKYDSKFNQLPKSAIEYARL
A0A7J5EBK8      RAGIFASSPEQIKQLTQKVLEEQIRYQSLSSSFNELDKIVKSYEKRFNQLPKRTIDLARL
A0A1G0RXP0      KADAFSSNPEQVRELAQKLIEEEIKNNTLSVRLNQLQTITKGYEVNLKRLPKTSTELSQF
A0A3D6B6N8      KAEAYSGNPDQVRDLAQRLIEEEIKNSSLSVQLDQLEKATGKYEGNLRRLPKASTVLSQY
A0A3A0BD75      EEALYVQTPEERRELIQELLLAGVQRSESKSRLNIISGMLGKYEREFSLLPSQALELAKI
A0A3N5L0V6      KTGASANTPDGRRILESKLFDAQLLNDQSKIKERLLKDFKGKYEAQFNKMPEQTIEYANL
A0A1G0RWW2      KAGIFASSPEEVKELTQKIIAEEVRNQSLETSIKELDKIVQGYEARFMKLPKNAIELARL
A0A6M8V159      KAGIFASSPEEVKELTQKIIAEEVKNQSLQTSIKELDKIVEGYEARFMKLPKNTIELARL
A0A6M8VC48      KAGIFASSPEEVKSLSQKIIEEEIKNGSLRTTLAELNVVVKRYDERFNRLPKTSIELARF
A0A1G0TD08      KAGILASSPEEVRGISQKIIEAEVKNQSLRSSVASLSALVRKYEERFNKLPKTTLELARF
A0A1G0XBL4      KSGILASSPEAVRGISQKIIEAEVKNQSLRSSVTGLSALVNRYEERFNRLPKTTLELARF
                                                                     :   :. 

A0A523N7W7      KRRSEALEKLYLLLEQRYQEALINVESQPGNVIIIDKARIPNSPSKPNRTLIILVGFVLG
A0A2M8FIB1      QRGRESLEKLYILVEEKYQEAVINEQSQPGNVLIIDVARRPDKPSKPNRLLIVLVGTILG
A0A2H0Z4Q0      QRGRESLEKLYILVEEKYQEAVINEQSQPGNVLIIDVARRPDKPSKPNRLLIVLVGTILG
A0A2M7ITQ8      QRGRESLEKLYILVEEKYQEAVINEQSQPGNVLIIDVARRPDKPSKPNRLLIVLVGTILG
A0A7J5EBK8      QREKTGFEKLYLLVEEKYQEALINEQSTPGNVLIIDQARIPREASKPNRKLIVLVGLVLG
A0A1G0RXP0      QRNRETLQQLYLLINEKYQQATINELSQPGNVSIIGEGGIPSAPAKPNRILILLFGLMLG
A0A3D6B6N8      QRERESLQQTYLLLNERYQEAMINEASESGNVVILNPAVIPDSPSKPNRLLILLIGLILG
A0A3A0BD75      ERQRLSSEKLYLLLEEKYQEALINQNARIGNVLITDPARVPSQPSKPKKTIVLLAGVLIG
A0A3N5L0V6      ERERKSDEKLYLMLLEKYQEALINEESQPNNVKIIDYGKTPKEKSKPNRFLIIMIGVLVG
A0A1G0RWW2      KRNSEALEKLYLLVEQRYQEAIINEQSQPGNVLIIDEARIPLSPAKPNRKLIVIIGLLLG
A0A6M8V159      KRNSEALEKLYLMIEQRYQEALINEQSQPGNVLIIDEARVAQFPSKPNRKLIIIIGFLLG
A0A6M8VC48      QRNRESLEKLYTLVEERYQEALINEQSQPGNVLIIDNARTPDRPSKPNRFLIIIVGIFIG
A0A1G0TD08      QRTRESTEKLFTLIEEKYQEALINEQSQAGNVLIIDNARVPIKPSKPNRLLMMLVGLLIG
A0A1G0XBL4      KRTRESSEKLFTLIEEKYQEALINEQSQAGNVLIIDNARIPSGPSKPNRHLLILIGVLMG
                :*     :: : :: :.**:* **  :  .** * . .  .   :**:. :::: * .:*

A0A523N7W7      AGLAFGYIFIRNYFDDTVKTPEDIQSKNINVLAWIPKIEGLGVNGK----KDFQFIVAKS
A0A2M8FIB1      LGFGLGYAFLRNYFDNTVKTPEDLKDRNINVIGWVPKIQSLDKSIS----KDLEFIIYNK
A0A2H0Z4Q0      LGFGLGYAFLRNYFDNTVKTPEDLKDRNINVIGWVPQIQSLDKSIS----EDLEFIIYNK
A0A2M7ITQ8      LGFGLGYAFLRNYFDNTVKTPEDLKDRNINVIGWVPKIQSLDKSIS----KDLEFIXXXK
A0A7J5EBK8      VSLGIGFALVKNYFDNSVKTPEDITKKNINVLAWIPKIEGINSSNK-----EFEFIFAKR
A0A1G0RXP0      PGLAVGLIIIKDYFDNTVKTPEDIEKNNISFLSWVPQFKTNGESKD----FNQDLVTLNK
A0A3D6B6N8      PIIAFALILIKDHFDDTVKTPDDIEKEEIKFLTWIPHLKSNVKDNG----FSPGLVVLDE
A0A3A0BD75      LGLGFGYAFGRNYLDRSIKNPEEIEKKGVTILAWIPSIDTLKEFKGG---SPDELVVLNK
A0A3N5L0V6      LSIGYGFALFRNILDVSVKSPEELENIGISLIGWVPTFMRISRNGSRNAPSEQELILSYN
A0A1G0RWW2      AGLAAGYVFVKNYFDDTVKSPDDIEKRKINVLAWIPPFESIMAGDH----S-VQFIVDKL
A0A6M8V159      AGLAVGYVFVKNYFDDTVKSPDDIEHRNINVLAWIPHFDSSIAGDQ----T-VQFIVDKL
A0A6M8VC48      FGLAFAYVFLKNYFDNTVKTPEDIQNSNMNLLGWTPRVDELMEKEN----SKIDFIISNK
A0A1G0TD08      FGLAFGYVLIRDYFDDKINTPEDIEKKNIHVLAWIPKINELNGINL----NGKDFIIENN
A0A1G0XBL4      FGLGFGFVLVKDYFDNTIKTPEDIEKQNVNVLAWIPKVEELNGKSK----NGNDFIIEKN
                  :. .  : .: :* .::.*:::    : .: * * .                ::    

A0A523N7W7      PDSIPSEAFRALRTRVQFSRIAKDSLKTILVTSATPREGKTTISINLAGSFALTNRKTLL
A0A2M8FIB1      PDSVPSEAFRALRTRVQFSKVDQGNMKVIHITSSTPGEGKTLISSNLAGSFAQANHKTLL
A0A2H0Z4Q0      PDSVPSEAFRALRTRVQFSKVDQGNMKVIHVTSSTPGEGKTLISSNLAGSFAQANHKTLL
A0A2M7ITQ8      PDSVPSEAFRALRTRVQFSKVDQGNMKVIHITSSTPGEGKTLISSNLAGSFAQANHKTLL
A0A7J5EBK8      PDSIPSEAFRALRTRIQFSKIDSHKLKTILVTSSTPREGKTTVSVNLAGSFAHANKKTII
A0A1G0RXP0      QDSPISESFRAIRARIQHSRIEEEFPKLILVTSAAESEGKTFISTNLAGSYVQSGKKTLL
A0A3D6B6N8      NDSPVSESFRVIKARIQQSSVDPDLSKIILVTSPAEGEGKSFVSANLAGSFALSNKKTLL
A0A3A0BD75      STSTAAESFKALRTRVQFSKLEEKPLKSILVTSSIPGEGKTFVSSNLASSFAIDNKKVLL
A0A3N5L0V6      TDSAPAESFRTLRTRLQFSKLEPEPIKTILITSSIPREGKTIISANLAASFALSN-KVLL
A0A1G0RWW2      PDSIPSEAFRALRTRIQFSRINTESLKTILITSSAPQEGKTTIAVNLAGSFAHSKKKVLL
A0A6M8V159      PDSIPSEAFRALRTRIQFSRINTESLKTILITSSAPQEGKTTIAVNLAGSFAHSKKKVLL
A0A6M8VC48      PDSVSSESFRALRTRIQFSRPDKENLKTIVVTSPAPQEGKTFVTVNLAGSFAQSEKKVLL
A0A1G0TD08      PTSIPSESIRALRTRVQFSKLRKDALKTILVTSPAPQEGKSTIALNLAGSFAHSKRKTLL
A0A1G0XBL4      PSSIPSETIRGLRTRVQFSKVDKDKLKTILVTSPAPLEGKTTIALNLAGSFAQGNRKTLL
                  *  :*::. :.:*:* *       * * :**.   ***: :: ***.*:.    *.::

A0A523N7W7      IDCDLRKPTVHHVFNSQRVPGLIDYLFGDAQINEIVKPTDINNLSYVPTGTIPPNPAEML
A0A2M8FIB1      LDCDLRKPRVHTIFGMNRQPGLVEYLFDQVNLATIIKPTKLANLDVITVGTIPPNPAEML
A0A2H0Z4Q0      LDCDLRKPRVHTIFGMNRQPGLVEYLFDQVNLATIIKPTKLANLDVITVGTIPPNPAEML
A0A2M7ITQ8      LDCDLRKPRVHTIFGMNRQPGLVEYLFDQVNLATIIKPTKLANLDVITVGTIPPNPAEML
A0A7J5EBK8      IDCDLRKPRMHTLFEAKRFPGFTDYFFGQASYEEIVQRSKVDNLSFITAGTIPPNPSEII
A0A1G0RXP0      IDCDLRRPRIHKIMNVNKKPGLADYLANKAKLDEIIRNTKTNNLFYITSGTIPSNPAEVI
A0A3D6B6N8      IDCDLRRPTIHTKMGVDKKPGLVDYLSRKVALETIIR-SKTNTLSFITAGTNLSNPAELL
A0A3A0BD75      LDCDLRKPRLHNVFAADRFPGLSDYLFSHVELEDIIRDSQNENLKFITAGTIPPNPSELL
A0A3N5L0V6      LDCDFRKPRIHNIFNQKRYPGLCDFLFGTVGFEEIIRDTQFDNLSLITCGTIPTNPAELI
A0A1G0RWW2      IDCDLRKPSVHKLFNRDKVPGLIDYLVGSAKLEEVLIKAEIPNLSFILSGTIPPNPAEML
A0A6M8V159      IDCDLRKPSVHKLFEKEKVPGLIDYLVGSVKLEEVLMKSKIQNLSFISSGTIPPNPAEML
A0A6M8VC48      VDCDLRKPRVHRIFEAQKDPGLIDYLVGEKTFDEIVHKSTLKNLYYITSGTIPPNPSEML
A0A1G0TD08      IDADLRKPRLHSVFKKEKEPGLVNYLFGELSYEKLINATDTKNLFLITAGTIVPNPSEVL
A0A1G0XBL4      IDADLRKPRLHQVFNKEKQPGLVDYLFGEVPFEKVLTVTNTKNLFLITSGMIAPNPAEML
                :*.*:*.* :*  :  .. **: :::        ::  :   .*  :  *   .**:*::

A0A523N7W7      DSNQMRDLLAKFRAEYDLVIIDSPPVIAVTDSEILSNMVDGTIIVVSADTTEIELMERAV
A0A2M8FIB1      GSKKMQDFITHMKTLYDYIIIDSPPIISVTDSEIIAAYCDAVYLVVSANYTEFDLLEKAL
A0A2H0Z4Q0      GSKKMQDFITHMKTLYDYIIIDSPPIISVTDSEIIAAYCDAVYLVVSANYTEFDLLEKAL
A0A2M7ITQ8      GSKKMQDFITHMKTLYDYIIIDSPPIISVTDSEIIAAYCDAVYLVVSANYTEFDLLEKAL
A0A7J5EBK8      GSVQMEQFLAKLKKEYDYVIIDSPPVIAVTDSEILSRLVDASILVVSANTTEIDLMEKSV
A0A1G0RXP0      ESEVMKNFLLEIRDFFDVIILDSAPIIAVIDAEVLANLADGTILVISADKTEYRLMKDAV
A0A3D6B6N8      ESKAMKNFLQEVKDIFDVVIIDSAPIVAVIDSEILAKLVDGTILVISADKTENRLMKDAV
A0A3A0BD75      GSVQMKKFLELLENKFDMIVIDSPPLISVTDSEILFAVTDGGILVAKAQKTPIDVVMKSA
A0A3N5L0V6      ASKHMQTFLNLVKPKFDYIIIDSPPLATVTDAELLSSYADGTVVVSLANKTRLDLLINTI
A0A1G0RWW2      DSQEMRSFLKKLRDQFDLIILDSPPIIAVTDSEILTSMVDGTILIVSSENTEIDMMERSV
A0A6M8V159      DSQEMRNFLKQLREKFDLIILDSPPIIAVTDSEILTSMVDGTLLVVSSESTEIDMMERSV
A0A6M8VC48      DSLQMDEFLKLVRDKFDYVIIDSPPIIAVTDAEILTKKVDGTILVVSSEITEHRMMERAN
A0A1G0TD08      DSTELDILLKKVREEFDYVIIDCPPIIAVTDAEILARKVDGVILVVSANKTEKNLLDLAV
A0A1G0XBL4      DSVQMENLLAKVRTEFDYVVIDSSPIVAVTDAEILARKVDGSILVVSSNKTEKDLLNLAV
                 *  :  ::  .   :* :::*..*: :* *:*::    *.  ::  :: *   ::  : 

A0A523N7W7      DLIKQENT-QFLGTVLNNFSFKSGYGSYYKYYYYYSSPDAKKTKV---------------
A0A2M8FIB1      DILKNSNV-NFVGTILNNFVFKNSYGSYYKYYYYYYNREKEGTRSKKTT-----------
A0A2H0Z4Q0      DILKNSNV-NFVGTILNNFVFKNSYGSYYKYYYYYYNREKEGTRSKKTT-----------
A0A2M7ITQ8      DILKNSNV-NFVGTILNNFVFKNSYGSYYKYYYYYYNREKEGTRSKKTT-----------
A0A7J5EBK8      ELLKHEHG-SFIGVLLNNFSYKSGYGSYYKYYYYYSQPNNGATHKKEKV-----------
A0A1G0RXP0      ELIKHNNV-SFLGTVLNNFEYKSGYGYYYKYYYNYSKYSNQRGRKKIKLKS---------
A0A3D6B6N8      DLIKRDKA-TFLGTVLNNFKYKSGYGYYYKYYYNYSNSSDHKSKKSYKLKS---------
A0A3A0BD75      NTVNNINPRNFLGCVLNDFNVKGSYGYYYNYYYYYSKPEQKANA----------------
A0A3N5L0V6      ETLNKIND-SFIGVILNNFDYQATYGSYYKYYYYYYGSEKGKESGEKVTKAAKGTTKSSL
A0A1G0RWW2      ELIRRENT-QFLGTVLNNFSYKSGYGSYYKYYYYYSRPDGKSA-----------------
A0A6M8V159      ELIRRENT-QFLGTVLNNFSYKSGYGSYYKYYYYYSRPETKS------------------
A0A6M8VC48      QLIQHDNA-TLIGIVLNGFDTNSAYGTYYKYKYYYYYSAK--------------------
A0A1G0TD08      KLIKSEDS-FLIGTVLNNFSTKTGYGSYYKYYYYYTADGEKKTSKFKKKEKQA-------
A0A1G0XBL4      QLIKNDSS-YLIGTVLNRFSSKSGYGSYYKYYYYYSSDGKKKST--KKKHSKT-------
                . :.      ::* :** *  :  ** **:* * *                         

A0A523N7W7      --
A0A2M8FIB1      --
A0A2H0Z4Q0      --
A0A2M7ITQ8      --
A0A7J5EBK8      --
A0A1G0RXP0      --
A0A3D6B6N8      --
A0A3A0BD75      --
A0A3N5L0V6      KP
A0A1G0RWW2      --
A0A6M8V159      --
A0A6M8VC48      --
A0A1G0TD08      --
A0A1G0XBL4      --
                  

© 1998-2021Legal notice