BYKdb

Dataset for cluster orphancd of phylum ignavibacteriae

[Download (right click)] [Edit] [Sequences] [Repertoires]

13 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1G0RXP0      --------------MEKFNLEKYLHGESKSIKDYILLIRNNLKYIFIISPIVISLTVIYI
A0A3D6B6N8      MMNNNNNGSGNPAGNQNFNIEKYLLSGTKSAKDYILLFRNNLKNIVIISLLILIIAAAYA
A0A3A0BD75      ----MENNPTGNFINQYQLNNGTEDSGRDTLRDYLVILRMHWVAIALIFAAAMCVTIVYI
A0A3N5L0V6      ----MENQPTN---RNSLNTIETNIKSSHSIRFYFNLILRNKVPIILSLVVGIIVSYFYA
A0A1G0RWW2      -------MAEE---IQD----DYNVHQTNTFKDYLRIIRVNWIPVSLITLAGLIVAIIYA
A0A6M8V159      -------MAED---QQE----DYGVHQTNTFKDYIRLIRANWVPVVLITLVGLIVASIYA
A0A6M8VC48      -----MNNQNS---FEP----GFDEHQSSTLKDYLILFSVNLKPVLTILAASLIISIIYA
A0A1G0TD08      ----MNNNQNN---FD------LQELEGKSFKDYLALVQKNLWPFLIISLVILIGTAFYV
A0A1G0XBL4      ----MNNNKND---FD------FQELEGRNFKDYLILLRKNLTPFLIILIMSIAVSIVYT
A0A523N7W7      ------------------------------------------------------------
A0A2M8FIB1      ------------------------------------------------------------
A0A2H0Z4Q0      ------------------------------------------------------------
A0A2M7ITQ8      ------------------------------------------------------------
                                                                            

A0A1G0RXP0      LLAKDIYKSSATIRITKQ-NENVLENTG-QSYDVGYVDRFIANEIRTITDYSIREKIAEV
A0A3D6B6N8      ILAKNIYTSAASIRITNP-YKNVLEDGR-QNTDNAFLDRYIVSEIGVIGNYATRKKIAQA
A0A3A0BD75      LTATNYYSTTTSIKINKP-QESILSSSIFTDFGGQQADRFIANEIDLMQTYPIRQKAAKF
A0A3N5L0V6      YSQEDIYSSASLMRLAKP-KENVLEGKIFSDIEGELPERFINNEVEILKSFAIREKTARS
A0A1G0RWW2      ANATDIYKSTAALKIARPQGGSVLTSPLLPEFQEWGNDRFIANEIEIMRSFTAREMVAVS
A0A6M8V159      INAIDIYKSTATIKISRPQGGSVLTSPLLPEFQEWGNDRFIANEIEIMTSYTARRMVAVT
A0A6M8VC48      LTAPNIFKTFTALKITKP-GGSILQSPLLPEINDYGNDRFIANEIEILKSYNLRERIAKI
A0A1G0TD08      LRLTDIYVSETSVKISKS-GGSILQTAPLLGMGDLGNDRMINNEIEILKSFDLRKIVANA
A0A1G0XBL4      LRLPDIYVSETSIKISKS-GGSVLQSQPFGDFGDLGSDRIINNEIEILKSYDLREIIAKA
A0A523N7W7      ------------------------------------------------------------
A0A2M8FIB1      ------------------------------------------------------------
A0A2H0Z4Q0      ------------------------------------------------------------
A0A2M7ITQ8      ------------------------------------------------------------
                                                                            

A0A1G0RXP0      LIDSFKSTPSKNLFYLVKSADDR---GNIGHKPVMELAGLLGGAISVEQIQGTDMITISA
A0A3D6B6N8      LIDSFEVSKHKDMLPLISA--QK---GSSSHKSVNQIAGMLGGIISVEQNQGTDVVFISA
A0A3A0BD75      ILDTLQTIEDKSALYYLYSDPEN---ISQGFRTVESMAKLLSDIVAIDQKRGLDVVTLVA
A0A3N5L0V6      IIDSFKVLKDKQSFALICMNRAN----CMEPKSVNQVASLLTGYIEIAQKRGLDIVSIKA
A0A1G0RWW2      LIDSFYRDTDKSRYSILLDQKPKTGDFENDIKSVDALAISLSD-VAIDQKRGLDIIEISA
A0A6M8V159      LIDSFYRDLNKSHYFVLKDTKLTENESDNNVKSVDDLAIALSD-VSIDQKRGLDIIELSA
A0A6M8VC48      LIDTLLKSPDKNDFSLLLVDELG---KDKTPASVPEAAKILEDAVQIEQKRGLDIIDISV
A0A1G0TD08      LLDSFAQSKSKDDFKLLYKSESNFGRETKKLLQSPNIEEMLGSIVDIEQKRGLDVIVIAA
A0A1G0XBL4      LLDSFAQSSSKDDFKLLYKSESEFRNDNKRLLKLGEIEGVLGSKVNIEQKRGLDVIVISA
A0A523N7W7      ------------------------------------------------------------
A0A2M8FIB1      ------------------------------------------------------------
A0A2H0Z4Q0      ------------------------------------------------------------
A0A2M7ITQ8      ------------------------------------------------------------
                                                                            

A0A1G0RXP0      ESPSPLETAIIVNICALEYQKLNLAMNREKLTNIRKFLEQQREEKFAELKNAEDTLMIFQ
A0A3D6B6N8      ESRSAFETALIANCAALEYQKINTAVSREKLTNLRKFLDDQAQEKLAELRSIEDSLMRFQ
A0A3A0BD75      ESPSPIEATIISNLYARAYSEYSLELSRKDLTNTISFLVKEKDRKMRDLNNAEASLEDFQ
A0A3N5L0V6      ESPSPQEAALIANCYAETYADYSLKFNRGHLTLNREFLEKQVQGKYDDLLKSEDRLTTFL
A0A1G0RWW2      LSPSPFEATLIANVYSQQYKTLNLDQNRNQLTLVTNFLDEQRKEKYDDLNSAEETLRAFQ
A0A6M8V159      VSPSPYEAALIANVYAQQYKKLNLEQNRDQLTLVTNFLDEQRKEKYDELNAAEETLRDFQ
A0A6M8VC48      QSKEPSEAVLIANVYAKEYLMYNLEINRNQLIFVRKFLDNQRQEKKEQLNEAEEILRSYQ
A0A1G0TD08      QSPSPREAALIAALYAKIYRTYNLEINREQLSFVRDFLDQQRAEKKIQLSQAEDTLRAFQ
A0A1G0XBL4      ESPSPKEAALIAALYAKVYRTYNLEINREQLSYIRNFLDQQRAEKKTQLSQAEDTLRAFQ
A0A523N7W7      ------------------------------------------------------------
A0A2M8FIB1      ------------------------------------------------------------
A0A2H0Z4Q0      ------------------------------------------------------------
A0A2M7ITQ8      ------------------------------------------------------------
                                                                            

A0A1G0RXP0      EKSGIVDLDFQSTGLISQLSQLEAQIEVTKIELSTSDEILKQYKFFLSKQDPQLVDYLEN
A0A3D6B6N8      EKGGIISFDVQSTNIIGQLSNLDAQKEAIKIQLSTSNEVLKQYKFFLKKQDPQLVEYLEG
A0A3A0BD75      KRSGLINLDVQSEQLVNSISELDKAKGYAQVEITGNQTKYNELSAEIKKIDPQLVTFLEG
A0A3N5L0V6      RSQNIVELNAQANALINTMTSIETQHNGAAIDLQTSGRTVSEIKSELDKIDPKATDFIAS
A0A1G0RWW2      ERGGLIALDERASTLISVLSQFEAQKSATQVDLMASNKVLESLRQELKAQNPRMADYLTS
A0A6M8V159      ESGGLIALDERASTLISVLAQFEAQKSATQVDLMASNKVLENLRKELQAQNPRMADYLTS
A0A6M8VC48      EKGGIIALDQQAQTLIQQLAQFEAQRNAVQIELEASNEILKQYKNELQQQDPKLADYLAS
A0A1G0TD08      EKGGIIALDEQAQTLIQQLSQFEAQMNAAKIELIASTEVLNKYKEELTKQDPKLADYLAS
A0A1G0XBL4      EKGGMIALDEQSQLLIQQLSQFEAQMNAAKIELVASEEVLNKYKDELSKQDPKLADYLES
A0A523N7W7      ------------------------------------------------------------
A0A2M8FIB1      ------------------------------------------------------------
A0A2H0Z4Q0      ------------------------------------------------------------
A0A2M7ITQ8      -KGGIIALDDQAKELITQLSKFEADLNLGKMELAISEKTLKQYKDELRRQDPQLTAYLEN
                                                                            

A0A1G0RXP0      QTSQAYINVLQQQLAELQVNKDLALSLKNPNVDISNKIKEYDQRIEELKQKLNSAISSIK
A0A3D6B6N8      QTSQAYINALQQQLAELQVNRDIAMSIKSSDVDVSSKVKEYDTRIADIKQKLNSTISTIK
A0A3A0BD75      ELSGKYVTDLQAKISELELQKSIELSNTQTQAVRDKIIGDYEQRLQPLRNSLNEKVMKLE
A0A3N5L0V6      KITDPYVAQLQQEIAKLEIQRDLVISGNEELLKDAKSLSSLNNKIADLKKNLDIKIEILK
A0A1G0RWW2      LTSQKYITAIQDEIAKLEVNKQVAVSRKDGLTEESPVIQEYDRKISELRKQLDKELEVLK
A0A6M8V159      LTSQKYITAIQEEITKLEINKQVALSKKDGLTEDSPVILEYDRKINELRKELDKELGVLK
A0A6M8VC48      ATSETYIKALQNQISELQIRRDLSVAKAEPKTDFSTQLKEYDNKIDELKKKLDEKIKVLK
A0A1G0TD08      VTSETYITALQNQIAELQLNKDIALAKFESGIDISQKVKEFDLKINDLKGKLDEKIKVLK
A0A1G0XBL4      VTSETYITALQNQIAELQLNKDIALARLEPGIDISQKVKEFDVKIRELKDRLDEKIKVLK
A0A523N7W7      ------------------------------------------------------------
A0A2M8FIB1      ------------------------------------------------------------
A0A2H0Z4Q0      -----------------------------------QAIREYDAKIKELRNKLNSKIEGFK
A0A2M7ITQ8      FSSEEYLKNLQTELARLEVNRDVALSSVKDKNVDTQAIREYDAKIKELRNKLNSKIEGFK
                                                                            

A0A1G0RXP0      ADAFSSNPEQVRELAQKLIEEEIKNNTLSVRLNQLQTITKGYEVNLKRLPKTSTELSQFQ
A0A3D6B6N8      AEAYSGNPDQVRDLAQRLIEEEIKNSSLSVQLDQLEKATGKYEGNLRRLPKASTVLSQYQ
A0A3A0BD75      EALYVQTPEERRELIQELLLAGVQRSESKSRLNIISGMLGKYEREFSLLPSQALELAKIE
A0A3N5L0V6      TGASANTPDGRRILESKLFDAQLLNDQSKIKERLLKDFKGKYEAQFNKMPEQTIEYANLE
A0A1G0RWW2      AGIFASSPEEVKELTQKIIAEEVRNQSLETSIKELDKIVQGYEARFMKLPKNAIELARLK
A0A6M8V159      AGIFASSPEEVKELTQKIIAEEVKNQSLQTSIKELDKIVEGYEARFMKLPKNTIELARLK
A0A6M8VC48      AGIFASSPEEVKSLSQKIIEEEIKNGSLRTTLAELNVVVKRYDERFNRLPKTSIELARFQ
A0A1G0TD08      AGILASSPEEVRGISQKIIEAEVKNQSLRSSVASLSALVRKYEERFNKLPKTTLELARFQ
A0A1G0XBL4      SGILASSPEAVRGISQKIIEAEVKNQSLRSSVTGLSALVNRYEERFNRLPKTTLELARFK
A0A523N7W7      ---------------QKIIEEEVRNQALQTSIKELDKIVKSYEKRFLKLPKSALELARLK
A0A2M8FIB1      ---------------------------------------------------SAIEYARLQ
A0A2H0Z4Q0      ASIFASSPEEVKLMTKNVIEEEIKSKSLEIKVKNLSEIVNKYDSKFNQLPKSAIEYARLQ
A0A2M7ITQ8      ASIFASSPEEVKLMTKNVIEEEIKSKSLEIKVKNLSEIVNKYDSKFNQLPKSAIEYARLQ
                                                                    :   :. :

A0A1G0RXP0      RNRETLQQLYLLINEKYQQATINELSQPGNVSIIGEGGIPSAPAKPNRILILLFGLMLGP
A0A3D6B6N8      RERESLQQTYLLLNERYQEAMINEASESGNVVILNPAVIPDSPSKPNRLLILLIGLILGP
A0A3A0BD75      RQRLSSEKLYLLLEEKYQEALINQNARIGNVLITDPARVPSQPSKPKKTIVLLAGVLIGL
A0A3N5L0V6      RERKSDEKLYLMLLEKYQEALINEESQPNNVKIIDYGKTPKEKSKPNRFLIIMIGVLVGL
A0A1G0RWW2      RNSEALEKLYLLVEQRYQEAIINEQSQPGNVLIIDEARIPLSPAKPNRKLIVIIGLLLGA
A0A6M8V159      RNSEALEKLYLMIEQRYQEALINEQSQPGNVLIIDEARVAQFPSKPNRKLIIIIGFLLGA
A0A6M8VC48      RNRESLEKLYTLVEERYQEALINEQSQPGNVLIIDNARTPDRPSKPNRFLIIIVGIFIGF
A0A1G0TD08      RTRESTEKLFTLIEEKYQEALINEQSQAGNVLIIDNARVPIKPSKPNRLLMMLVGLLIGF
A0A1G0XBL4      RTRESSEKLFTLIEEKYQEALINEQSQAGNVLIIDNARIPSGPSKPNRHLLILIGVLMGF
A0A523N7W7      RRSEALEKLYLLLEQRYQEALINVESQPGNVIIIDKARIPNSPSKPNRTLIILVGFVLGA
A0A2M8FIB1      RGRESLEKLYILVEEKYQEAVINEQSQPGNVLIIDVARRPDKPSKPNRLLIVLVGTILGL
A0A2H0Z4Q0      RGRESLEKLYILVEEKYQEAVINEQSQPGNVLIIDVARRPDKPSKPNRLLIVLVGTILGL
A0A2M7ITQ8      RGRESLEKLYILVEEKYQEAVINEQSQPGNVLIIDVARRPDKPSKPNRLLIVLVGTILGL
                *   : :: : :: :.**:* **  :  .** * . .  .   :**:. :::: * .:* 

A0A1G0RXP0      GLAVGLIIIKDYFDNTVKTPEDIEKNNISFLSWVPQFKTNGESKD----FNQDLVTLNKQ
A0A3D6B6N8      IIAFALILIKDHFDDTVKTPDDIEKEEIKFLTWIPHLKSNVKDNG----FSPGLVVLDEN
A0A3A0BD75      GLGFGYAFGRNYLDRSIKNPEEIEKKGVTILAWIPSIDTLKEFKGG---SPDELVVLNKS
A0A3N5L0V6      SIGYGFALFRNILDVSVKSPEELENIGISLIGWVPTFMRISRNGSRNAPSEQELILSYNT
A0A1G0RWW2      GLAAGYVFVKNYFDDTVKSPDDIEKRKINVLAWIPPFESIMAGDH----S-VQFIVDKLP
A0A6M8V159      GLAVGYVFVKNYFDDTVKSPDDIEHRNINVLAWIPHFDSSIAGDQ----T-VQFIVDKLP
A0A6M8VC48      GLAFAYVFLKNYFDNTVKTPEDIQNSNMNLLGWTPRVDELMEKEN----SKIDFIISNKP
A0A1G0TD08      GLAFGYVLIRDYFDDKINTPEDIEKKNIHVLAWIPKINELNGINL----NGKDFIIENNP
A0A1G0XBL4      GLGFGFVLVKDYFDNTIKTPEDIEKQNVNVLAWIPKVEELNGKSK----NGNDFIIEKNP
A0A523N7W7      GLAFGYIFIRNYFDDTVKTPEDIQSKNINVLAWIPKIEGLGVNGK----KDFQFIVAKSP
A0A2M8FIB1      GFGLGYAFLRNYFDNTVKTPEDLKDRNINVIGWVPKIQSLDKSIS----KDLEFIIYNKP
A0A2H0Z4Q0      GFGLGYAFLRNYFDNTVKTPEDLKDRNINVIGWVPQIQSLDKSIS----EDLEFIIYNKP
A0A2M7ITQ8      GFGLGYAFLRNYFDNTVKTPEDLKDRNINVIGWVPKIQSLDKSIS----KDLEFIXXXKP
                 :. .  : .: :* .::.*::::   : .: * * .                ::     

A0A1G0RXP0      DSPISESFRAIRARIQHSRIEEEFPKLILVTSAAESEGKTFISTNLAGSYVQSGKKTLLI
A0A3D6B6N8      DSPVSESFRVIKARIQQSSVDPDLSKIILVTSPAEGEGKSFVSANLAGSFALSNKKTLLI
A0A3A0BD75      TSTAAESFKALRTRVQFSKLEEKPLKSILVTSSIPGEGKTFVSSNLASSFAIDNKKVLLL
A0A3N5L0V6      DSAPAESFRTLRTRLQFSKLEPEPIKTILITSSIPREGKTIISANLAASFALSN-KVLLL
A0A1G0RWW2      DSIPSEAFRALRTRIQFSRINTESLKTILITSSAPQEGKTTIAVNLAGSFAHSKKKVLLI
A0A6M8V159      DSIPSEAFRALRTRIQFSRINTESLKTILITSSAPQEGKTTIAVNLAGSFAHSKKKVLLI
A0A6M8VC48      DSVSSESFRALRTRIQFSRPDKENLKTIVVTSPAPQEGKTFVTVNLAGSFAQSEKKVLLV
A0A1G0TD08      TSIPSESIRALRTRVQFSKLRKDALKTILVTSPAPQEGKSTIALNLAGSFAHSKRKTLLI
A0A1G0XBL4      SSIPSETIRGLRTRVQFSKVDKDKLKTILVTSPAPLEGKTTIALNLAGSFAQGNRKTLLI
A0A523N7W7      DSIPSEAFRALRTRVQFSRIAKDSLKTILVTSATPREGKTTISINLAGSFALTNRKTLLI
A0A2M8FIB1      DSVPSEAFRALRTRVQFSKVDQGNMKVIHITSSTPGEGKTLISSNLAGSFAQANHKTLLL
A0A2H0Z4Q0      DSVPSEAFRALRTRVQFSKVDQGNMKVIHVTSSTPGEGKTLISSNLAGSFAQANHKTLLL
A0A2M7ITQ8      DSVPSEAFRALRTRVQFSKVDQGNMKVIHITSSTPGEGKTLISSNLAGSFAQANHKTLLL
                 *  :*::. :.:*:* *       * * :**.   ***: :: ***.*:.    *.**:

A0A1G0RXP0      DCDLRRPRIHKIMNVNKKPGLADYLANKAKLDEIIRNTKTNNLFYITSGTIPSNPAEVIE
A0A3D6B6N8      DCDLRRPTIHTKMGVDKKPGLVDYLSRKVALETIIR-SKTNTLSFITAGTNLSNPAELLE
A0A3A0BD75      DCDLRKPRLHNVFAADRFPGLSDYLFSHVELEDIIRDSQNENLKFITAGTIPPNPSELLG
A0A3N5L0V6      DCDFRKPRIHNIFNQKRYPGLCDFLFGTVGFEEIIRDTQFDNLSLITCGTIPTNPAELIA
A0A1G0RWW2      DCDLRKPSVHKLFNRDKVPGLIDYLVGSAKLEEVLIKAEIPNLSFILSGTIPPNPAEMLD
A0A6M8V159      DCDLRKPSVHKLFEKEKVPGLIDYLVGSVKLEEVLMKSKIQNLSFISSGTIPPNPAEMLD
A0A6M8VC48      DCDLRKPRVHRIFEAQKDPGLIDYLVGEKTFDEIVHKSTLKNLYYITSGTIPPNPSEMLD
A0A1G0TD08      DADLRKPRLHSVFKKEKEPGLVNYLFGELSYEKLINATDTKNLFLITAGTIVPNPSEVLD
A0A1G0XBL4      DADLRKPRLHQVFNKEKQPGLVDYLFGEVPFEKVLTVTNTKNLFLITSGMIAPNPAEMLD
A0A523N7W7      DCDLRKPTVHHVFNSQRVPGLIDYLFGDAQINEIVKPTDINNLSYVPTGTIPPNPAEMLD
A0A2M8FIB1      DCDLRKPRVHTIFGMNRQPGLVEYLFDQVNLATIIKPTKLANLDVITVGTIPPNPAEMLG
A0A2H0Z4Q0      DCDLRKPRVHTIFGMNRQPGLVEYLFDQVNLATIIKPTKLANLDVITVGTIPPNPAEMLG
A0A2M7ITQ8      DCDLRKPRVHTIFGMNRQPGLVEYLFDQVNLATIIKPTKLANLDVITVGTIPPNPAEMLG
                *.*:*.* :*  :  .. *** ::*        ::  :   .*  :  *   .**:*:: 

A0A1G0RXP0      SEVMKNFLLEIRDFFDVIILDSAPIIAVIDAEVLANLADGTILVISADKTEYRLMKDAVE
A0A3D6B6N8      SKAMKNFLQEVKDIFDVVIIDSAPIVAVIDSEILAKLVDGTILVISADKTENRLMKDAVD
A0A3A0BD75      SVQMKKFLELLENKFDMIVIDSPPLISVTDSEILFAVTDGGILVAKAQKTPIDVVMKSAN
A0A3N5L0V6      SKHMQTFLNLVKPKFDYIIIDSPPLATVTDAELLSSYADGTVVVSLANKTRLDLLINTIE
A0A1G0RWW2      SQEMRSFLKKLRDQFDLIILDSPPIIAVTDSEILTSMVDGTILIVSSENTEIDMMERSVE
A0A6M8V159      SQEMRNFLKQLREKFDLIILDSPPIIAVTDSEILTSMVDGTLLVVSSESTEIDMMERSVE
A0A6M8VC48      SLQMDEFLKLVRDKFDYVIIDSPPIIAVTDAEILTKKVDGTILVVSSEITEHRMMERANQ
A0A1G0TD08      STELDILLKKVREEFDYVIIDCPPIIAVTDAEILARKVDGVILVVSANKTEKNLLDLAVK
A0A1G0XBL4      SVQMENLLAKVRTEFDYVVIDSSPIVAVTDAEILARKVDGSILVVSSNKTEKDLLNLAVQ
A0A523N7W7      SNQMRDLLAKFRAEYDLVIIDSPPVIAVTDSEILSNMVDGTIIVVSADTTEIELMERAVD
A0A2M8FIB1      SKKMQDFITHMKTLYDYIIIDSPPIISVTDSEIIAAYCDAVYLVVSANYTEFDLLEKALD
A0A2H0Z4Q0      SKKMQDFITHMKTLYDYIIIDSPPIISVTDSEIIAAYCDAVYLVVSANYTEFDLLEKALD
A0A2M7ITQ8      SKKMQDFITHMKTLYDYIIIDSPPIISVTDSEIIAAYCDAVYLVVSANYTEFDLLEKALD
                *  :  ::  .   :* :::*..*: :* *:*::    *.  ::  :: *   ::  : .

A0A1G0RXP0      LIKHNNV-SFLGTVLNNFEYKSGYGYYYKYYYNYSKYSNQRGRKKIKLKS----------
A0A3D6B6N8      LIKRDKA-TFLGTVLNNFKYKSGYGYYYKYYYNYSNSSDHKSKKSYKLKS----------
A0A3A0BD75      TVNNINPRNFLGCVLNDFNVKGSYGYYYNYYYYYSKPEQKANA-----------------
A0A3N5L0V6      TLNKIND-SFIGVILNNFDYQATYGSYYKYYYYYYGSEKGKESGEKVTKAAKGTTKSSLK
A0A1G0RWW2      LIRRENT-QFLGTVLNNFSYKSGYGSYYKYYYYYSRPDGKSA------------------
A0A6M8V159      LIRRENT-QFLGTVLNNFSYKSGYGSYYKYYYYYSRPETKS-------------------
A0A6M8VC48      LIQHDNA-TLIGIVLNGFDTNSAYGTYYKYKYYYYYSAK---------------------
A0A1G0TD08      LIKSEDS-FLIGTVLNNFSTKTGYGSYYKYYYYYTADGEKKTSKFKKKEKQA--------
A0A1G0XBL4      LIKNDSS-YLIGTVLNRFSSKSGYGSYYKYYYYYSSDGKKKST--KKKHSKT--------
A0A523N7W7      LIKQENT-QFLGTVLNNFSFKSGYGSYYKYYYYYSSPDAKKTKV----------------
A0A2M8FIB1      ILKNSNV-NFVGTILNNFVFKNSYGSYYKYYYYYYNREKEGTRSKKTT------------
A0A2H0Z4Q0      ILKNSNV-NFVGTILNNFVFKNSYGSYYKYYYYYYNREKEGTRSKKTT------------
A0A2M7ITQ8      ILKNSNV-NFVGTILNNFVFKNSYGSYYKYYYYYYNREKEGTRSKKTT------------
                 :.  .   ::* :** *  :  ** **:* * *                          

A0A1G0RXP0      -
A0A3D6B6N8      -
A0A3A0BD75      -
A0A3N5L0V6      P
A0A1G0RWW2      -
A0A6M8V159      -
A0A6M8VC48      -
A0A1G0TD08      -
A0A1G0XBL4      -
A0A523N7W7      -
A0A2M8FIB1      -
A0A2H0Z4Q0      -
A0A2M7ITQ8      -
                 

© 1998-2021Legal notice