BYKdb

Dataset for cluster orphancd of phylum ignavibacteriae

[Download (right click)] [Edit] [Sequences] [Repertoires]

11 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1G0RXP0      --------------MEKFNLE-KYLHGESKSIKDYILLIRNNLKYIFIISPIVISLTVIY
A0A3D6B6N8      MMNNNNNGSGNPAGNQNFNIE-KYLLSGTKSAKDYILLFRNNLKNIVIISLLILIIAAAY
A0A1G0RWW2      ---------MAEEIQDDYNVH------QTNTFKDYLRIIRVNWIPVSLITLAGLIVAIIY
A0A3A0BD75      ----MENNP-TGNFINQYQLNNGTEDSGRDTLRDYLVILRMHWVAIALIFAAAMCVTIVY
A0A3N5L0V6      ----MENQPTNRNSLNTIETN----IKSSHSIRFYFNLILRNKVPIILSLVVGIIVSYFY
A0A1G0TD08      ----------MNNNQNNFDLQ----ELEGKSFKDYLALVQKNLWPFLIISLVILIGTAFY
A0A1G0XBL4      ----------MNNNKNDFDFQ----ELEGRNFKDYLILLRKNLTPFLIILIMSIAVSIVY
A0A523N7W7      ------------------------------------------------------------
A0A2M8FIB1      ------------------------------------------------------------
A0A2H0Z4Q0      ------------------------------------------------------------
A0A2M7ITQ8      ------------------------------------------------------------
                                                                            

A0A1G0RXP0      ILLAKDIYKSSATIRITKQ-NENVLENTG-QSYDVGYVDRFIANEIRTITDYSIREKIAE
A0A3D6B6N8      AILAKNIYTSAASIRITNP-YKNVLEDGR-QNTDNAFLDRYIVSEIGVIGNYATRKKIAQ
A0A1G0RWW2      AANATDIYKSTAALKIARPQGGSVLTSPLLPEFQEWGNDRFIANEIEIMRSFTAREMVAV
A0A3A0BD75      ILTATNYYSTTTSIKINKP-QESILSSSIFTDFGGQQADRFIANEIDLMQTYPIRQKAAK
A0A3N5L0V6      AYSQEDIYSSASLMRLAKP-KENVLEGKIFSDIEGELPERFINNEVEILKSFAIREKTAR
A0A1G0TD08      VLRLTDIYVSETSVKISKS-GGSILQTAPLLGMGDLGNDRMINNEIEILKSFDLRKIVAN
A0A1G0XBL4      TLRLPDIYVSETSIKISKS-GGSVLQSQPFGDFGDLGSDRIINNEIEILKSYDLREIIAK
A0A523N7W7      ------------------------------------------------------------
A0A2M8FIB1      ------------------------------------------------------------
A0A2H0Z4Q0      ------------------------------------------------------------
A0A2M7ITQ8      ------------------------------------------------------------
                                                                            

A0A1G0RXP0      VLIDSFKSTPSKNLFYLVKSADDRGNIGHK---PVMELAGLLGGAISVEQIQGTDMITIS
A0A3D6B6N8      ALIDSFEVSKHKDMLPLISA--QKGSSSHK---SVNQIAGMLGGIISVEQNQGTDVVFIS
A0A1G0RWW2      SLIDSFYRDTDKSRYSILLDQKPKTGDFENDIKSVDALAISLSD-VAIDQKRGLDIIEIS
A0A3A0BD75      FILDTLQTIEDKSALYYLYSDPENISQGFR---TVESMAKLLSDIVAIDQKRGLDVVTLV
A0A3N5L0V6      SIIDSFKVLKDKQSFALICMNRANCMEPK----SVNQVASLLTGYIEIAQKRGLDIVSIK
A0A1G0TD08      ALLDSFAQSKSKDDFKLLYKSESNFGRETKKLLQSPNIEEMLGSIVDIEQKRGLDVIVIA
A0A1G0XBL4      ALLDSFAQSSSKDDFKLLYKSESEFRNDNKRLLKLGEIEGVLGSKVNIEQKRGLDVIVIS
A0A523N7W7      ------------------------------------------------------------
A0A2M8FIB1      ------------------------------------------------------------
A0A2H0Z4Q0      ------------------------------------------------------------
A0A2M7ITQ8      ------------------------------------------------------------
                                                                            

A0A1G0RXP0      AESPSPLETAIIVNICALEYQKLNLAMNREKLTNIRKFLEQQREEKFAELKNAEDTLMIF
A0A3D6B6N8      AESRSAFETALIANCAALEYQKINTAVSREKLTNLRKFLDDQAQEKLAELRSIEDSLMRF
A0A1G0RWW2      ALSPSPFEATLIANVYSQQYKTLNLDQNRNQLTLVTNFLDEQRKEKYDDLNSAEETLRAF
A0A3A0BD75      AESPSPIEATIISNLYARAYSEYSLELSRKDLTNTISFLVKEKDRKMRDLNNAEASLEDF
A0A3N5L0V6      AESPSPQEAALIANCYAETYADYSLKFNRGHLTLNREFLEKQVQGKYDDLLKSEDRLTTF
A0A1G0TD08      AQSPSPREAALIAALYAKIYRTYNLEINREQLSFVRDFLDQQRAEKKIQLSQAEDTLRAF
A0A1G0XBL4      AESPSPKEAALIAALYAKVYRTYNLEINREQLSYIRNFLDQQRAEKKTQLSQAEDTLRAF
A0A523N7W7      ------------------------------------------------------------
A0A2M8FIB1      ------------------------------------------------------------
A0A2H0Z4Q0      ------------------------------------------------------------
A0A2M7ITQ8      ------------------------------------------------------------
                                                                            

A0A1G0RXP0      QEKSGIVDLDFQSTGLISQLSQLEAQIEVTKIELSTSDEILKQYKFFLSKQDPQLVDYLE
A0A3D6B6N8      QEKGGIISFDVQSTNIIGQLSNLDAQKEAIKIQLSTSNEVLKQYKFFLKKQDPQLVEYLE
A0A1G0RWW2      QERGGLIALDERASTLISVLSQFEAQKSATQVDLMASNKVLESLRQELKAQNPRMADYLT
A0A3A0BD75      QKRSGLINLDVQSEQLVNSISELDKAKGYAQVEITGNQTKYNELSAEIKKIDPQLVTFLE
A0A3N5L0V6      LRSQNIVELNAQANALINTMTSIETQHNGAAIDLQTSGRTVSEIKSELDKIDPKATDFIA
A0A1G0TD08      QEKGGIIALDEQAQTLIQQLSQFEAQMNAAKIELIASTEVLNKYKEELTKQDPKLADYLA
A0A1G0XBL4      QEKGGMIALDEQSQLLIQQLSQFEAQMNAAKIELVASEEVLNKYKDELSKQDPKLADYLE
A0A523N7W7      ------------------------------------------------------------
A0A2M8FIB1      ------------------------------------------------------------
A0A2H0Z4Q0      ------------------------------------------------------------
A0A2M7ITQ8      --KGGIIALDDQAKELITQLSKFEADLNLGKMELAISEKTLKQYKDELRRQDPQLTAYLE
                                                                            

A0A1G0RXP0      NQTSQAYINVLQQQLAELQVNKDLALSLKNPNVDISNKIKEYDQRIEELKQKLNSAISSI
A0A3D6B6N8      GQTSQAYINALQQQLAELQVNRDIAMSIKSSDVDVSSKVKEYDTRIADIKQKLNSTISTI
A0A1G0RWW2      SLTSQKYITAIQDEIAKLEVNKQVAVSRKDGLTEESPVIQEYDRKISELRKQLDKELEVL
A0A3A0BD75      GELSGKYVTDLQAKISELELQKSIELSNTQTQAVRDKIIGDYEQRLQPLRNSLNEKVMKL
A0A3N5L0V6      SKITDPYVAQLQQEIAKLEIQRDLVISGNEELLKDAKSLSSLNNKIADLKKNLDIKIEIL
A0A1G0TD08      SVTSETYITALQNQIAELQLNKDIALAKFESGIDISQKVKEFDLKINDLKGKLDEKIKVL
A0A1G0XBL4      SVTSETYITALQNQIAELQLNKDIALARLEPGIDISQKVKEFDVKIRELKDRLDEKIKVL
A0A523N7W7      ------------------------------------------------------------
A0A2M8FIB1      ------------------------------------------------------------
A0A2H0Z4Q0      ------------------------------------QAIREYDAKIKELRNKLNSKIEGF
A0A2M7ITQ8      NFSSEEYLKNLQTELARLEVNRDVALSSVKDKNVDTQAIREYDAKIKELRNKLNSKIEGF
                                                                            

A0A1G0RXP0      KADAFSSNPEQVRELAQKLIEEEIKNNTLSVRLNQLQTITKGYEVNLKRLPKTSTELSQF
A0A3D6B6N8      KAEAYSGNPDQVRDLAQRLIEEEIKNSSLSVQLDQLEKATGKYEGNLRRLPKASTVLSQY
A0A1G0RWW2      KAGIFASSPEEVKELTQKIIAEEVRNQSLETSIKELDKIVQGYEARFMKLPKNAIELARL
A0A3A0BD75      EEALYVQTPEERRELIQELLLAGVQRSESKSRLNIISGMLGKYEREFSLLPSQALELAKI
A0A3N5L0V6      KTGASANTPDGRRILESKLFDAQLLNDQSKIKERLLKDFKGKYEAQFNKMPEQTIEYANL
A0A1G0TD08      KAGILASSPEEVRGISQKIIEAEVKNQSLRSSVASLSALVRKYEERFNKLPKTTLELARF
A0A1G0XBL4      KSGILASSPEAVRGISQKIIEAEVKNQSLRSSVTGLSALVNRYEERFNRLPKTTLELARF
A0A523N7W7      ----------------QKIIEEEVRNQALQTSIKELDKIVKSYEKRFLKLPKSALELARL
A0A2M8FIB1      ----------------------------------------------------SAIEYARL
A0A2H0Z4Q0      KASIFASSPEEVKLMTKNVIEEEIKSKSLEIKVKNLSEIVNKYDSKFNQLPKSAIEYARL
A0A2M7ITQ8      KASIFASSPEEVKLMTKNVIEEEIKSKSLEIKVKNLSEIVNKYDSKFNQLPKSAIEYARL
                                                                     :   :. 

A0A1G0RXP0      QRNRETLQQLYLLINEKYQQATINELSQPGNVSIIGEGGIPSAPAKPNRILILLFGLMLG
A0A3D6B6N8      QRERESLQQTYLLLNERYQEAMINEASESGNVVILNPAVIPDSPSKPNRLLILLIGLILG
A0A1G0RWW2      KRNSEALEKLYLLVEQRYQEAIINEQSQPGNVLIIDEARIPLSPAKPNRKLIVIIGLLLG
A0A3A0BD75      ERQRLSSEKLYLLLEEKYQEALINQNARIGNVLITDPARVPSQPSKPKKTIVLLAGVLIG
A0A3N5L0V6      ERERKSDEKLYLMLLEKYQEALINEESQPNNVKIIDYGKTPKEKSKPNRFLIIMIGVLVG
A0A1G0TD08      QRTRESTEKLFTLIEEKYQEALINEQSQAGNVLIIDNARVPIKPSKPNRLLMMLVGLLIG
A0A1G0XBL4      KRTRESSEKLFTLIEEKYQEALINEQSQAGNVLIIDNARIPSGPSKPNRHLLILIGVLMG
A0A523N7W7      KRRSEALEKLYLLLEQRYQEALINVESQPGNVIIIDKARIPNSPSKPNRTLIILVGFVLG
A0A2M8FIB1      QRGRESLEKLYILVEEKYQEAVINEQSQPGNVLIIDVARRPDKPSKPNRLLIVLVGTILG
A0A2H0Z4Q0      QRGRESLEKLYILVEEKYQEAVINEQSQPGNVLIIDVARRPDKPSKPNRLLIVLVGTILG
A0A2M7ITQ8      QRGRESLEKLYILVEEKYQEAVINEQSQPGNVLIIDVARRPDKPSKPNRLLIVLVGTILG
                :*   : :: : :: :.**:* **  :  .** * . .  *   :**:. :::: * ::*

A0A1G0RXP0      PGLAVGLIIIKDYFDNTVKTPEDIEKNNISFLSWVPQFKTNGESKDFN----QDLVTLNK
A0A3D6B6N8      PIIAFALILIKDHFDDTVKTPDDIEKEEIKFLTWIPHLKSNVKDNGFS----PGLVVLDE
A0A1G0RWW2      AGLAAGYVFVKNYFDDTVKSPDDIEKRKINVLAWIPPFESIMAGDHS-----VQFIVDKL
A0A3A0BD75      LGLGFGYAFGRNYLDRSIKNPEEIEKKGVTILAWIPSIDTLKEFKGGSP---DELVVLNK
A0A3N5L0V6      LSIGYGFALFRNILDVSVKSPEELENIGISLIGWVPTFMRISRNGSRNAPSEQELILSYN
A0A1G0TD08      FGLAFGYVLIRDYFDDKINTPEDIEKKNIHVLAWIPKINELNGINLNG----KDFIIENN
A0A1G0XBL4      FGLGFGFVLVKDYFDNTIKTPEDIEKQNVNVLAWIPKVEELNGKSKNG----NDFIIEKN
A0A523N7W7      AGLAFGYIFIRNYFDDTVKTPEDIQSKNINVLAWIPKIEGLGVNGKKD----FQFIVAKS
A0A2M8FIB1      LGFGLGYAFLRNYFDNTVKTPEDLKDRNINVIGWVPKIQSLDKSISKD----LEFIIYNK
A0A2H0Z4Q0      LGFGLGYAFLRNYFDNTVKTPEDLKDRNINVIGWVPQIQSLDKSISED----LEFIIYNK
A0A2M7ITQ8      LGFGLGYAFLRNYFDNTVKTPEDLKDRNINVIGWVPKIQSLDKSISKD----LEFIXXXK
                  :. .  : .: :* .::.*::::.  : .: *:* .                ::    

A0A1G0RXP0      QDSPISESFRAIRARIQHSRIEEEFPKLILVTSAAESEGKTFISTNLAGSYVQSGKKTLL
A0A3D6B6N8      NDSPVSESFRVIKARIQQSSVDPDLSKIILVTSPAEGEGKSFVSANLAGSFALSNKKTLL
A0A1G0RWW2      PDSIPSEAFRALRTRIQFSRINTESLKTILITSSAPQEGKTTIAVNLAGSFAHSKKKVLL
A0A3A0BD75      STSTAAESFKALRTRVQFSKLEEKPLKSILVTSSIPGEGKTFVSSNLASSFAIDNKKVLL
A0A3N5L0V6      TDSAPAESFRTLRTRLQFSKLEPEPIKTILITSSIPREGKTIISANLAASFALSN-KVLL
A0A1G0TD08      PTSIPSESIRALRTRVQFSKLRKDALKTILVTSPAPQEGKSTIALNLAGSFAHSKRKTLL
A0A1G0XBL4      PSSIPSETIRGLRTRVQFSKVDKDKLKTILVTSPAPLEGKTTIALNLAGSFAQGNRKTLL
A0A523N7W7      PDSIPSEAFRALRTRVQFSRIAKDSLKTILVTSATPREGKTTISINLAGSFALTNRKTLL
A0A2M8FIB1      PDSVPSEAFRALRTRVQFSKVDQGNMKVIHITSSTPGEGKTLISSNLAGSFAQANHKTLL
A0A2H0Z4Q0      PDSVPSEAFRALRTRVQFSKVDQGNMKVIHVTSSTPGEGKTLISSNLAGSFAQANHKTLL
A0A2M7ITQ8      PDSVPSEAFRALRTRVQFSKVDQGNMKVIHITSSTPGEGKTLISSNLAGSFAQANHKTLL
                  *  :*::. :.:*:* * :     * * :**.   ***: :: ***.*:.    *.**

A0A1G0RXP0      IDCDLRRPRIHKIMNVNKKPGLADYLANKAKLDEIIRNTKTNNLFYITSGTIPSNPAEVI
A0A3D6B6N8      IDCDLRRPTIHTKMGVDKKPGLVDYLSRKVALETIIR-SKTNTLSFITAGTNLSNPAELL
A0A1G0RWW2      IDCDLRKPSVHKLFNRDKVPGLIDYLVGSAKLEEVLIKAEIPNLSFILSGTIPPNPAEML
A0A3A0BD75      LDCDLRKPRLHNVFAADRFPGLSDYLFSHVELEDIIRDSQNENLKFITAGTIPPNPSELL
A0A3N5L0V6      LDCDFRKPRIHNIFNQKRYPGLCDFLFGTVGFEEIIRDTQFDNLSLITCGTIPTNPAELI
A0A1G0TD08      IDADLRKPRLHSVFKKEKEPGLVNYLFGELSYEKLINATDTKNLFLITAGTIVPNPSEVL
A0A1G0XBL4      IDADLRKPRLHQVFNKEKQPGLVDYLFGEVPFEKVLTVTNTKNLFLITSGMIAPNPAEML
A0A523N7W7      IDCDLRKPTVHHVFNSQRVPGLIDYLFGDAQINEIVKPTDINNLSYVPTGTIPPNPAEML
A0A2M8FIB1      LDCDLRKPRVHTIFGMNRQPGLVEYLFDQVNLATIIKPTKLANLDVITVGTIPPNPAEML
A0A2H0Z4Q0      LDCDLRKPRVHTIFGMNRQPGLVEYLFDQVNLATIIKPTKLANLDVITVGTIPPNPAEML
A0A2M7ITQ8      LDCDLRKPRVHTIFGMNRQPGLVEYLFDQVNLATIIKPTKLANLDVITVGTIPPNPAEML
                :*.*:*.* :*  :  .. *** ::*        ::  :.  .*  :  *   .**:*::

A0A1G0RXP0      ESEVMKNFLLEIRDFFDVIILDSAPIIAVIDAEVLANLADGTILVISADKTEYRLMKDAV
A0A3D6B6N8      ESKAMKNFLQEVKDIFDVVIIDSAPIVAVIDSEILAKLVDGTILVISADKTENRLMKDAV
A0A1G0RWW2      DSQEMRSFLKKLRDQFDLIILDSPPIIAVTDSEILTSMVDGTILIVSSENTEIDMMERSV
A0A3A0BD75      GSVQMKKFLELLENKFDMIVIDSPPLISVTDSEILFAVTDGGILVAKAQKTPIDVVMKSA
A0A3N5L0V6      ASKHMQTFLNLVKPKFDYIIIDSPPLATVTDAELLSSYADGTVVVSLANKTRLDLLINTI
A0A1G0TD08      DSTELDILLKKVREEFDYVIIDCPPIIAVTDAEILARKVDGVILVVSANKTEKNLLDLAV
A0A1G0XBL4      DSVQMENLLAKVRTEFDYVVIDSSPIVAVTDAEILARKVDGSILVVSSNKTEKDLLNLAV
A0A523N7W7      DSNQMRDLLAKFRAEYDLVIIDSPPVIAVTDSEILSNMVDGTIIVVSADTTEIELMERAV
A0A2M8FIB1      GSKKMQDFITHMKTLYDYIIIDSPPIISVTDSEIIAAYCDAVYLVVSANYTEFDLLEKAL
A0A2H0Z4Q0      GSKKMQDFITHMKTLYDYIIIDSPPIISVTDSEIIAAYCDAVYLVVSANYTEFDLLEKAL
A0A2M7ITQ8      GSKKMQDFITHMKTLYDYIIIDSPPIISVTDSEIIAAYCDAVYLVVSANYTEFDLLEKAL
                 *  :  ::  .   :* :::*..*: :* *:*::    *.  ::  :: *   ::  : 

A0A1G0RXP0      ELIKHNNV-SFLGTVLNNFEYKSGYGYYYKYYYNY--SKYSNQRGRKKIKLKS-------
A0A3D6B6N8      DLIKRDKA-TFLGTVLNNFKYKSGYGYYYKYYYNY--SNSSDHKSKKSYKLKS-------
A0A1G0RWW2      ELIRRENT-QFLGTVLNNFSYKSGYGSYYKYYYYY--SRPDGKSA---------------
A0A3A0BD75      NTVNNINPRNFLGCVLNDFNVKGSYGYYYNYYYYY--SKPEQKANA--------------
A0A3N5L0V6      ETLNKIND-SFIGVILNNFDYQATYGSYYKYYYYYYGSEKGKESGEKVTKAAKGTTKSSL
A0A1G0TD08      KLIKSEDS-FLIGTVLNNFSTKTGYGSYYKYYYYY--TADGEKKTSKFKKKEKQA-----
A0A1G0XBL4      QLIKNDSS-YLIGTVLNRFSSKSGYGSYYKYYYYY--SSDGKKKST--KKKHSKT-----
A0A523N7W7      DLIKQENT-QFLGTVLNNFSFKSGYGSYYKYYYYYSSPDAKKTKV---------------
A0A2M8FIB1      DILKNSNV-NFVGTILNNFVFKNSYGSYYKYYYYYYNREKEGTRSKKTT-----------
A0A2H0Z4Q0      DILKNSNV-NFVGTILNNFVFKNSYGSYYKYYYYYYNREKEGTRSKKTT-----------
A0A2M7ITQ8      DILKNSNV-NFVGTILNNFVFKNSYGSYYKYYYYYYNREKEGTRSKKTT-----------
                . :.  .   ::* :** *  :  ** **:*** *                         

A0A1G0RXP0      --
A0A3D6B6N8      --
A0A1G0RWW2      --
A0A3A0BD75      --
A0A3N5L0V6      KP
A0A1G0TD08      --
A0A1G0XBL4      --
A0A523N7W7      --
A0A2M8FIB1      --
A0A2H0Z4Q0      --
A0A2M7ITQ8      --
                  

© 1998-2020Legal notice