BYKdb

Dataset for cluster orphancd of phylum cyanobacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

71 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A846FUP5      ------------------------------------------------------------
A0A6P0ITZ8      ------------------------------------------------------------
A0A6P0SLN0      ------------------------------------------------------------
A0A2T1DKP1      ------------------------------------------------------------
A0A2T1CC83      ------------------------------------------------------------
A0A0D6KL48      ------------------------------------------------------------
A0A1B7WWU1      ------------------------------------------------------------
A0A328V843      ------------------------------------------------------------
A0A2N6LHT1      ------------------------------------------------------------
A0A2T1EZA0      MFWEEKPPKDINRITTIDARVKGHSLRVAIIIGSTFPAVHNVTTTGAPPEAFPGGTARPL
A0A6M0AN00      ------------------------------------------------------------
A0A1U7JBN8      ------------------------------------------------MPF---PPSSTH
A0A2W4VXF4      ------------------------------------------------MPFSSKPAAREV
A0A2W7AI98      ------------------------------------------------MPFSSKPAAREV
A0A2P8QVH5      ------------------------------------------------------------
A0A433W4W4      ------------------------------------------------------------
K9U5W1          ------------------------------------------------------------
L8M1L4          ------------------------------------------------------------
A0A7G8GTF0      ------------------------------------------------------------
A0A7G8H3H8      ------------------------------------------------------------
A0A4P5VLH9      ------------------------------------------------------------
A0A2W6ZN45      ------------------------------------------------------MLTEAG
A0A081GP61      -----------------------------------------MGGFPPSGAAGRFQAPYPD
K9P6R9          ------------------------------------------------------------
A0A6G3Z347      ------------------------------------------------------------
A0A7T1IAR0      ------------------------------------------------------------
A0A6P0S1R8      ------------------------------------------------------------
A0A0A2B4S6      ------------------------------------------------------------
K9SGV8          ------------------------------------------------------------
B0CA08          ------------------------------------------------------------
B0BZC6          ------------------------------------------------------------
A0A6P0M090      ------------------------------------------------------------
A0A563VX16      ------------------------------------------------------------
A0A6G3Z709      ------------------------------------------------------------
A0A0V7ZGW0      ------------------------------------------------------------
A0A355DPN1      ------------------------------------------------------------
A0A0V7ZMP6      ------------------------------------------------------------
A0A433W046      ------------------------------------------------------------
K9TU02          ------------------------------------------------------------
A0A2P8QV10      ------------------------------------------------------------
A0A6J4NIB3      ------------------------------------------------------------
A0A6P0VB93      ------------------------------------------------------------
A0A6P0W0Y0      ------------------------------------------------------------
A0A846BJ08      ------------------------------------------------------------
A0A6M0AB25      ------------------------------------------------------------
A0A1D8TTM0      ------------------------------------------------------------
A0A846GII1      ------------------------------------------------------------
B8HQ70          ------------------------------------------------------------
A0A2S6V636      ------------------------------------------------------------
A0A6P0IXR4      ------------------------------------------------------------
A0A845XP18      ------------------------------------------------------------
A0A845ZT65      ------------------------------------------------------------
A0A1D8TWE6      ------------------------------------------------------------
A0A845WQ93      ------------------------------------------------------------
A0A1D9G3S3      ------------------------------------------------------------
A0A6P0KRF3      ------------------------------------------------------------
A0A6P0LQ61      ------------------------------------------------------------
A0A6L9YP52      ------------------------------------------------------------
A0A6P0L3X9      ------------------------------------------------------------
A0A6M0A6X4      ------------------------------------------------------------
A0A1U7N3U5      ------------------------------------------------------------
A0A6L9ZB93      ------------------------------------------------------------
A0A6P0S980      ------------------------------------------------------------
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
A0A846CZ70      ------------------------------------------------------------
A0A846E3I8      ------------------------------------------------------------
A0A355DU96      ------------------------------------------------------------
A0A846A9P3      ------------------------------------------------------------
A0A5B8NQW4      ------------------------------------------------------------
A0A6P0XUL2      ------------------------------------------------------------
                                                                            

A0A846FUP5      ------------------------------------------------------------
A0A6P0ITZ8      ------------------------------------------------------------
A0A6P0SLN0      ------------------------------------------------------------
A0A2T1DKP1      ------------------------------------------------------------
A0A2T1CC83      ------------------------------------------------------------
A0A0D6KL48      ------------------------------------------------------------
A0A1B7WWU1      ------------------------------------------------------------
A0A328V843      ------------------------------------------------------------
A0A2N6LHT1      ------------------------------------------------------------
A0A2T1EZA0      SLPGTGASGPGLFDPSSQQSPLSPMGESQSGGGGLGGIVRTVKRRQSIFLITFALVTGVL
A0A6M0AN00      ------------------------------------------------------------
A0A1U7JBN8      EINGNGHGHAKPGFMTVMAPPS-LVEQRDEVDFNQLVGVFRRRA-----GIFFGVAALSL
A0A2W4VXF4      NGNGNGQGHASQSFVPVTAPPSPLIDDGDDFDLNHLVAVLGRRA-----GIFWGVAALSF
A0A2W7AI98      NGNGNGQGHASQSFVPVTAPPSPLIDDGDDFDLNHLVAVLGRRA-----GIFGGVAALSF
A0A2P8QVH5      ---------MADTSLDNERLSVEHRVENRANATDLRQLFTVLLRRRLLILSLFCIPLSAS
A0A433W4W4      ---------MADTSLDNERLSVEHRVENRANATDLRQLFTVLLRRRLLILSLFCIPLSAS
K9U5W1          ---------MADTSLDNERLSVEHRVENRANATDLRQLFTVLLRRRLLILSLFCIPLSAS
L8M1L4          -------MNNTIVRSDFVNLPAQETG--FSLSDFKQILYRRWKPALALGIMAFGVVLIPK
A0A7G8GTF0      -------------------MPENSSENTISLSEIAFSLKRRWK----IIFISFSLLFTFN
A0A7G8H3H8      ---------------MSTDIPEEDLGKSISLSEIAFALKRRWK----VVAISFSFLYILN
A0A4P5VLH9      ------------------------------------------------------------
A0A2W6ZN45      SPTPHSPFGTGSTQVAASALSPTANQPDDASTNVLFKLIRSLKRRQALFLFVFFVTTALL
A0A081GP61      QPLQSPLTPTAEAQAGSGGLG---------------GLVRTIRRRQTVFLLTFAVVTGAL
K9P6R9          ---------MGETQSGGGGLG---------------GLVRTVKRRQSIFLITFAVVTGVL
A0A6G3Z347      ----------MTSELQSPPANMLAPAPAQEGGLKLGRFASALKRN---ILLIAGITTLTA
A0A7T1IAR0      ----------------MSQVSGSDETPTESEGLNLGELWQAVRRRRRLALLVGTVVAASA
A0A6P0S1R8      ------------------------------------------------------------
A0A0A2B4S6      ------------------------------------------------------------
K9SGV8          -----------------------------MNQLQQYLFIIRRRWPVATLVFVSAVLVTTF
B0CA08          --------------------------------MSNYWLMLKRRG-LPAGFTFLTVLSLAL
B0BZC6          ---------------------------MNESVSKVIKIIYRNRW-TTVGTFLSVFTGIVV
A0A6P0M090      --------------------------------IDQLRPLVDA------------------
A0A563VX16      ---------MEQRIENYMNQNVYDLDNSTELGYGEIFSIFWRRR-SYFIGICGGVLACMI
A0A6G3Z709      ------------------------------------------------------------
A0A0V7ZGW0      ---------------------------------MKVSAIIQRLW-LPLLGLNGVIVGSVI
A0A355DPN1      -----------------------------------------------MLGVFCGVLAIAI
A0A0V7ZMP6      --------------------------------MKKATKIAVRHW-KFVLAWNKIILGIAV
A0A433W046      --------------------------------MKQIFSIARKHW-LPLLGFNTAVLAATI
K9TU02          --------------------------------MKQIFSIARKHW-LPLLGFNTAVLAATI
A0A2P8QV10      --------------------------------MKQIFSIARKHW-LPLLGFNSAVLAATI
A0A6J4NIB3      ------------------------------------------------------------
A0A6P0VB93      --------------------------------MNRFVAIALRHW-KPVLGLNIVLFAIAL
A0A6P0W0Y0      --------------------------------MNRFVAIALRHW-KPVLGLNIVLFAIAL
A0A846BJ08      --------------------------------MNRFVAIALRHW-KPVLGLNIVLFAIAL
A0A6M0AB25      ------------------------------------------------------------
A0A1D8TTM0      --------------------------------MNRLIAIAIRHW-KPVIGLNIVLSAIAL
A0A846GII1      --------------------------------MNRFIAIALRHC-KPVIGLNIVLSAIAL
B8HQ70          --------------------------------MFQITSTLRRHW-KPLIALNTVLIGSTA
A0A2S6V636      --------------------------------MNHIVNIIRRHW-MPLLLLNGVVLAATL
A0A6P0IXR4      ------------------------------------------------------------
A0A845XP18      ------------------------------------------------------------
A0A845ZT65      ---------------------------------------------------YSLVLAASF
A0A1D8TWE6      --------------------------------MKKVAGILNRHW-TFLLVFNSLVLGASF
A0A845WQ93      --------------------------------MKKVAGILNRHW-TFLLVFNSLVLGASF
A0A1D9G3S3      --------------------------------MKKVAAILNRHW-TILLVFNSLVLGASF
A0A6P0KRF3      --------------------------------MKKVAAILNRHW-TLLLVFNSLVLGASF
A0A6P0LQ61      --------------------------------MKKVAAILNRHW-TLLLVFNSLVLGASF
A0A6L9YP52      --------------------------------MKKVAAILNRHW-TLLLVFNSLVLGGSF
A0A6P0L3X9      --------------------------------MKKVAAILNRHW-TILLVFNLLVLGASF
A0A6M0A6X4      --------------------------------MKKVAAILNRHW-TLLLVFNSLVLGASF
A0A1U7N3U5      --------------------------------MKKVAAILNRHW-TILLVFNSLVLAASF
A0A6L9ZB93      --------------------------------MKKVAAILNRHW-TILLVFNSLVLAASF
A0A6P0S980      --------------------------------MKKVAAILNRHW-TILLVFNSLVLAASF
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
A0A846CZ70      ------------------------------------------------------------
A0A846E3I8      ------------------------------------------------------------
A0A355DU96      ------------------------------------------------------------
A0A846A9P3      ------------------------------------------------------------
A0A5B8NQW4      ------------------------------------------------------------
A0A6P0XUL2      ------------------------------------------------------------
                                                                            

A0A846FUP5      ------------------------------------------------------------
A0A6P0ITZ8      ------------------------------------------------------------
A0A6P0SLN0      ------------------------------------------------------------
A0A2T1DKP1      ------------------------------------------------------------
A0A2T1CC83      ------------------------------------------------------------
A0A0D6KL48      ------------------------------------------------------------
A0A1B7WWU1      ------------------------------------------------------------
A0A328V843      ------------------------------------------------------------
A0A2N6LHT1      ------------------------------------------------------------
A0A2T1EZA0      AINTLRQRIFSPVYQGGFQMQI-SNPFDNPGTGGGGGGSVESIARSEIKTDVP-------
A0A6M0AN00      ------------------------------------------------------------
A0A1U7JBN8      AGFTLWHLSRPPAYSGSASLLVEPVTAVNTPGLETVTGAPSP-SGSGLDYT---------
A0A2W4VXF4      GGLTLWHLTRPPVYNGSANLLVEPVTVVNTPGLEAVMELPGARSASGLDYT---------
A0A2W7AI98      GGLTLWHLTRPPVYNGSANLLVEPVTVVNTPGLEAVMELPGARSASGLDYT---------
A0A2P8QVH5      SFLALMAK---PTYQSSMQLLV-SSNLYQGQNS-------NAQGGVEESDFTDSNL--KV
A0A433W4W4      SFLALMAK---PTYQSSMQLLV-SSNLYQGQNS-------NAQGGVEESDFTDSNL--KV
K9U5W1          SFLALMAK---PTYQSSMQLLV-SSNLYQGQNS-------NAQGGVEESDFTDSNL--KV
L8M1L4          LLST-------PQYRSEAKILL-KSPQNQQS---------AEVQLNALNSRRNYYN--LK
A0A7G8GTF0      TIYILYNWSFNRQYKGGVKILI-VDPFGESSGGQ-GMPS-GGLDNQFFEELARNNT--AT
A0A7G8H3H8      VAYTLYNWNFNRIYRGGVKLLI-VDPFGENSAASGGLPSGGGLDNQFFEELARNDT--AT
A0A4P5VLH9      ------------------------------MEA-------SRGGESKLETIARQTQ--KN
A0A2W6ZN45      AANALRQRIVAPVYIGGFQMLI-TDPLANVGPS--------TPSSGVVESLAKTTSLGNS
A0A081GP61      AINTLRQRIFSPVYQGGFQMQI-SNPFED--KN-------GGGGGGSVEAIARTPL--KP
K9P6R9          AINTLRQRIFSPVYQGGFQMQI-SNPFDNPGSG-------GGGGGGSVETIARSEI--KT
A0A6G3Z347      SAAVFKAITDTPTYESSLELL---TPPITLETQ--------IISTLNPEALSNQSE--VV
A0A7T1IAR0      FGSTLWERTFSPIYQGSFQLLI-SDPISTGDGA--------GAEGGTVETLARNRT--SI
A0A6P0S1R8      ------------------------------------------------------------
A0A0A2B4S6      ------------------MLISDPLNNNKNNSANSIGGVFEQLALNST---DNDLP----
K9SGV8          HAIFVMK----PRYRASGEMLVTPGDQAIAITNVGVSKTVNQPRSLSGGY----LN----
B0CA08          LQAFQEK----PIYEAVGQLKFEESQRSSKLIGLDSAVDDESRQQSSLRW-QRSLD----
B0BZC6          YLLITPR-----LYSAKVRLILDQRPATSISPLGRDIAQTPGDN-------NKGLA----
A0A6P0M090      ---------------------------------------------------QNPLS----
A0A563VX16      PLVLTQK----PVYRSSMQMLVEPN-----YEDKDNRGDFDPIESSIEIDYATQLN----
A0A6G3Z709      ---------------------------------------------------MEPRT----
A0A0V7ZGW0      MIATFSQ----KTWTANAQLIL-PDTTTNLDASLGTLGQLKEQGVAFTNE-LNPLK----
A0A355DPN1      PIALNKE----PTYQSSMQLLIEPYVQQKQEGKPQTEEQFTDSNVEVDYA----------
A0A0V7ZMP6      ANIALLP----RVWISKSLLIL-PTSTSNVDADLDNSDDLKTKEVGFSQQ-VNPLN----
A0A433W046      YAAFYASTSIPPVWTANAKLNL-PQ-TGGLSANLGPLGSTQTTALNFKD--VSPLD----
K9TU02          YAAFYASTSIPPVWTANAKLNL-PQ-TGGLSANLGPLGSTQTTALNFKD--VSPLD----
A0A2P8QV10      YAAFYASTSIPPVWTANAKLNL-PQ-TGGLSANLGPLGSTQTTALNFKD--VSPLD----
A0A6J4NIB3      ------------------------------------------------------------
A0A6P0VB93      YSASKVT----EVWAARAKLIL-PQSSSALNANLGTLGDIKNTGIAFSQQ-VNPLK----
A0A6P0W0Y0      YSASKVT----EVWAARAKLIL-PQSSSALNANLGTLGDIKNTGIAFSQQ-VNPLK----
A0A846BJ08      YSASKVT----EVWAARAKLIL-PQSSSALNANLGTLGDIKNTGIAFSQQ-VNPLK----
A0A6M0AB25      ------------------------------------------------------------
A0A1D8TTM0      YNASKVT----EVWAARAKLII-PKSSSDLNANLGTLGDFRDRGVSFSQQ-VNPLN----
A0A846GII1      YSASKVT----EVWAARAKLIL-PKSSSDLNANLGTLGDFRDTGVAFSQQ-VNPLN----
B8HQ70          LIAAFYP----RTWQASARFVV-PINTNQLSADIGTLGQLRPGDGVVPSDLMNPVT----
A0A2S6V636      YSVIYTKTNVAPVWKATAKLNL-PQPTTRLDTNLGTLGQIQNTALGFTRE-LNPLQ----
A0A6P0IXR4      ------------------------------------------------------------
A0A845XP18      ------------------------------------------------------------
A0A845ZT65      GAFSLLK----PFWIAKAQLIL-PE-TGKLQASLGTLGSLTKGDSELSAK-SHPLN----
A0A1D8TWE6      GAFSLLK----PFWIAKAQLIL-PE-TGKLQASLGTLGSLTKGDSKLATK-SHPLN----
A0A845WQ93      GAFSLLK----PFWIAKAQLIL-PE-TGKLQASLETLGSLTKGDSKLATK-SHPLN----
A0A1D9G3S3      GAFSLLK----PFWIAKAQLIL-PE-TGKLQASLGTLGSLTKGDSKLATK-SHPLN----
A0A6P0KRF3      GAFSLLK----PFWIAKAQLIL-PE-TGKLQASLGTLGSLTKGDSKLATK-SHPLN----
A0A6P0LQ61      GAFSLLK----PFWIAKAQLIL-PE-TGKLQASLGTLGSLTKGDSKLATK-SHPLN----
A0A6L9YP52      GAFSLLK----PFWIAKAQLIL-PE-TGKLQASLGTLGSLTKGDSKLATK-SHPLN----
A0A6P0L3X9      GAFSLLK----PFWIAKAQLIL-PE-TGKLQASLGTLGSLTKGDSKLATK-SHPLN----
A0A6M0A6X4      GAFSLLK----PFWIAKAQLIL-PE-TGKLQASLGTLGSLTKGDSKLATK-SHPLN----
A0A1U7N3U5      GAFSLLK----PFWIAKAQLIL-PE-TGKLQASLGTLGSLTKGDSKLATK-SHPLN----
A0A6L9ZB93      GAFSLLK----PFWIAKAQLIL-PE-TGKLQASLGTLGSLTKGDSKLATK-SHPLN----
A0A6P0S980      GAFSLLK----PFWIAKAQLIL-PE-TGKLQASLGTLGSLTKGDSKLATK-SHPLN----
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
A0A846CZ70      ------------------------------------------------------------
A0A846E3I8      ------------------------------------------------------------
A0A355DU96      ------------------------------------------------------------
A0A846A9P3      ------------------------------------------------------------
A0A5B8NQW4      ------------------------------------------------------------
A0A6P0XUL2      ------------------------------------------------------------
                                                                            

A0A846FUP5      ------------------------------------------------------------
A0A6P0ITZ8      ------------------------------------------------------------
A0A6P0SLN0      ------------------------------------------------------------
A0A2T1DKP1      ------------------------------------------------------------
A0A2T1CC83      ------------------------------------------------------------
A0A0D6KL48      ------------------------------------------------------------
A0A1B7WWU1      ------------------------------------------------------------
A0A328V843      ------------------------------------------------------------
A0A2N6LHT1      ------------------------------------------------------------
A0A2T1EZA0      ------SLIVLMRSPLLLGPVA-----QRQGVPLRA--LESNLSINQESARV--------
A0A6M0AN00      ------------------------------------------------------------
A0A1U7JBN8      ------SQIRVLRGPAVINPILAKIQQRYPDITYNS--LLNGLNIVQEGE----------
A0A2W4VXF4      ------SQIRVLRGPDVIKPILVNIQRQHPEITYTT--LLNDLVISQEGE----------
A0A2W7AI98      ------SQIRVLRGPDVIKPILVNIQRQHPEITYTT--LLNDLVISQEGE----------
A0A2P8QVH5      DYT---AQLSVMTSPKLVERAVELLRPEYPNITVEE--INGKPAKVKQSPLKVTQVESGT
A0A433W4W4      DYT---AQLSVMTSPKLVERAVELLRPEYPNITVEE--INGKPAKVKQSPLKVTQVESGT
K9U5W1          DYT---AQLSVMTSPKLVERAVELLRPEYPNITVEE--INGKPAKVKQSPLKVTQVESGT
L8M1L4          DLS---TDILVLKSYSLINKA------------IEK--YPETFSGLSAAEVRTKLNIFPA
A0A7G8GTF0      NIP---TLIEVLKSKSVLGKL-----SASNDIFYGK--LVRSIEIIAKGENAGGGGLAAM
A0A7G8H3H8      NIP---TLIEVLKSKSVLGKL-----SASNDIFYEK--LVKSITITPKGENSGGGGLAAM
A0A4P5VLH9      DVP---SLIVLMRSPLLVKPV-----ADRMGVSIND--LISNLSIAP-AGNV--------
A0A2W6ZN45      DVP---TLIQLLTSPVVLKPI-----AEAQAIPLGS--LIGSLAIGSTRADS--------
A0A081GP61      DVP---SLIVLMRSPLLLGPV-----AQRQGVPLDL--LAANLSINPESAAV--------
K9P6R9          DVP---SLIVLMRSPLLLGPV-----AQRQGVSLGA--LESNLSINQESAQV--------
A0A6G3Z347      NVAIDETKLKILKSPRVMEPIVVRLQERYLDIDYGE--VVGSLDIYPTST----------
A0A7T1IAR0      DFP---SLVETLRSPMVLDPLRRQLGPA------GG--LLGAAQVSQVAE----------
A0A6P0S1R8      ------------------------------------------------------------
A0A0A2B4S6      ------TLIELLKSPILLNPISKDYGIP----------FNKFSKSLKISTPGGLRT--QS
K9SGV8          ------TEMQIMRSKEVIQRALEI---VERPISYGE-----FLGSFGVN---------VI
B0CA08          ------TEILTMKSPRRLSMLALA---IESQGLFSRPSVEQIKSGLDIS---------QF
B0BZC6          ------TQEELVRSKSVLTKAIVLFNQSNQDSAIEK--VTLGEVKPEVATE-------VI
A0A6P0M090      ------TEVEVIYSHPLLQQIIDQLNLTDNEGLPLE--PEALKKKLTVK---------IV
A0A563VX16      ------LMRSSQLLGRAVVKLRPS---YPDITT-EE--IQNYLVVSQVREQEDK----KE
A0A6G3Z709      ------LLGKVDAK--------------------------------------------PI
A0A0V7ZGW0      ------VLTSIITSDDAIRPVLLS---DPEKDKFRS--LSSYKKLFKVK---------PT
A0A355DPN1      ------TQLNLMRSSQLIQKAVDR---LHPKYPEIQ--VTDIKESFSLTGVQEEDTDIKD
A0A0V7ZMP6      ------VISSIATSDNVLKKVWEQ---DPQKTSYKQ--LSEYRGLFDVS---------PE
A0A433W046      ------VQLAILTSDAVMKRVQAV---DPEKSLYSK--VSSFSQLFVVT---------PQ
K9TU02          ------VQLAILTSDAVMKRVQAV---DPEKSLYSK--VSSFSQLFVVT---------PQ
A0A2P8QV10      ------VQLAILTSDAVMKRVQAV---DPEKSLYSK--VSSFSQLFVVT---------PQ
A0A6J4NIB3      ---------------------HAV---DPERPLYSS--LGSYRRLFEVT---------PQ
A0A6P0VB93      ------NLSSIMTSNDAISQIWES---DPEKALYPR--LSEYKSLFDVS---------PE
A0A6P0W0Y0      ------NLSSIMTSNDAISQIWES---DPEKALYPR--LSEYKSLFDVS---------PE
A0A846BJ08      ------NLSSIMTSNDAISQIWES---DPEKALYPR--LSEYKSLFDVS---------PE
A0A6M0AB25      -----------MTSNDTISQVWEF---DPEKSLYPR--LSEYKSLFDVS---------PE
A0A1D8TTM0      ------NLSSIMTSNDTISQVWEF---DPEKSLYPR--LSGYKSLFDVS---------PE
A0A846GII1      ------NLSSIMTSNDTISQIWES---DPEKSLYPR--LSVYKSLFDVS---------PE
B8HQ70          ------LQAEIVKSPTLIGQVLAV---DPER-DQHT--LQSFMPLFEAK---------PQ
A0A2S6V636      ------IQMAILMSDTVMERTLAV---DPEKSLFPR--LSDYKLAFSAT---------PQ
A0A6P0IXR4      ------------------------------------------------------------
A0A845XP18      ------------------------------------------------------------
A0A845ZT65      ------MQASILKSDALMRRLLES---DPEKTDFQR--LVQYKQLFAVS---------PH
A0A1D8TWE6      ------MQASILTSDALMSRLLES---DLEKTDFQR--LVQYKKLFAIS---------PD
A0A845WQ93      ------MQASILTSDALMSRLLES---DLEKTDFQR--LVQYKKLFAIS---------PD
A0A1D9G3S3      ------MQASILTSDALMRRLLES---DPEKTDFQR--LVQYKKLFAVS---------PD
A0A6P0KRF3      ------MQASILTSDALMRRLLES---DPEKTDFQR--LVQYKKLFAIS---------PD
A0A6P0LQ61      ------MQASILTSDALMRRLLES---DPEKTDFQR--LVQYKKLFAIS---------PD
A0A6L9YP52      ------MQASILTSDALMRRLLES---DPEKTDFQR--LVQYKKLFAVS---------PD
A0A6P0L3X9      ------MQASILNSDALMRRLLES---DPEKTDFKR--LVQYKKLFAVS---------PD
A0A6M0A6X4      ------MQASILTSDALMRRLLES---DPEKTDFQR--LVQYKKLFAVS---------PD
A0A1U7N3U5      ------MQASILNSDALMRRLLES---DPEKTDFQR--LVQYKKLFAVS---------PD
A0A6L9ZB93      ------MQASILNSDALMRRLLES---DPEKTDFQR--LVQYKKLFAVS---------PD
A0A6P0S980      ------MQASILNSDALMRRLLES---DPEKTDFQR--LVQYKKLFAVS---------PD
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
A0A846CZ70      ------------------------------------------------------------
A0A846E3I8      ------------------------------------------------------------
A0A355DU96      ------------------------------------------------------------
A0A846A9P3      ------------------------------------------------------------
A0A5B8NQW4      ------------------------------------------------------------
A0A6P0XUL2      ------------------------------------------------------------
                                                                            

A0A846FUP5      ------------------------------------------------------------
A0A6P0ITZ8      ------------------------------------------------------------
A0A6P0SLN0      ------------------------------------------------------------
A0A2T1DKP1      ------------------------------------------------------------
A0A2T1CC83      ------------------------------------------------------------
A0A0D6KL48      ------------------------------------------------------------
A0A1B7WWU1      ------------------------------------------------------------
A0A328V843      ------------------------------------------------------------
A0A2N6LHT1      ------------------------------------------------------------
A0A2T1EZA0      ------DNVLNVSLRWPDPAKGKAILRQLAKDYTSFSLTQRQAAVNSGVRFLDEQAPAIE
A0A6M0AN00      ------------------------------------------------------------
A0A1U7JBN8      ------SKVLRISYSNADPAVAAFVLNQVVEGFVNYSVQDRQGDLRRGLTFLDEQLQEKW
A0A2W4VXF4      ------SKVLRISYSDADPEVVTTVMSEVVKGFVAYSVQDRQGELRRGLEFLDEQLQEKW
A0A2W7AI98      ------SKVLRISYRDADPEVVTTVMSEVVEGFVAYSVQDRQGELRRGLEFLDEQLQEKW
A0A2P8QVH5      KTLQTLSQVFEVTFVAGDPIKSQKVLQALQNVYQIYNLEQQKLRLTNGLAFVNEQLPKIR
A0A433W4W4      KTLQTLSQVFEVTFVAGDPIKSQKVLQALQNVYQIYNLEQQKLRLTNGLAFVNEQLPKIR
K9U5W1          KTLQTLSQVFEVTFVAGDPIKSQKVLQALQNVYQIYNLEQQKLRLTNGLAFVNEQLPKIR
L8M1L4          MINDIPTDILNISFVDSAPEVAQGVLDALSEVYVEYSLERERSQALNAIQFIEEQLPKAE
A0A7G8GTF0      RGGGGEAGILQISLNWHDRSEGKKILDLFTDTILNFSQKEKELRLQKGIDFLNRQSPDLE
A0A7G8H3H8      RGGGGDAGILEISLNWHDPSEGKKILGLFTDTILNFSQKEKQLRLVKGINFLDSQSPELE
A0A4P5VLH9      ------EEVLNVNLRWRDPAKGRLILNELSKDYTKFSKSQRESTLNSGVEFLEQQAPRLR
A0A2W6ZN45      ------QGVLNIQLRWSDPVQGRKILTALADSYPKYALIQRQEKLGQGLEFLGQQAPALQ
A0A081GP61      ------ENVLNISLRWPDPVKGKAILRQLAKDYTAFSLTQRQAAVNSGVRFLDQQAPAIE
K9P6R9          ------ENVLNVSLSWPDPAKGKAILRQLAKDYTAFSLTQRQAAVNSGVRFLDEQAPAIE
A0A6G3Z347      ------GDTLTVQYKGVDAEKVLYVLEVVAEFYLKFSLEDRQNDIFRGIDFVDEQLPIVR
A0A7T1IAR0      ------G-VLSVSLSGSKPSEIQAALDSLSAAYLNFAIDQRQRQLNEGLKFLDEQEPKLQ
A0A6P0S1R8      ------------------------------------------------------------
A0A0A2B4S6      MA----QGVLRISFKGENPRIVNSMLVSISKAYLKSALDQKQQRLSDGLIFLNNQSPKLE
K9SGV8          PG----TDVLRFSYTSGDPKLAVEAANSMMQSYAENNIERNRAAVRAARLFIEEQLPKAE
B0CA08          DE----TNVVQIRFKSYNREFPKNIVNLLMQQYVDNTPKSKQASTQSAISFIEKQLPQVK
B0BZC6          PG----TQIIEITFRHTDPGVTSSLLNLIASSVIQENAETIRSEARATRQFLENQIPRRQ
A0A6P0M090      GG----TDVVRLSYKGKNSEKGAAVINQLMRLYIENQILSKKSEAAKAREFITNQLPQSE
A0A563VX16      VG----TKIFQAVYKDEDAEKTQRVLEAIQEVYLEYNLEQQDKRLREGLSFINQEIPEVR
A0A6G3Z709      SG----TDVMRITVRSEDPQEAADIANQVIDSYRRQNIDSNREEAAAARLFIEDQLPETE
A0A0V7ZGW0      DQ----STNIQLQVTASEPELAKQRAKRLIESYQERLNELRQGTANAREQFTQRQLKDAE
A0A355DPN1      TQ----TKIVKVVYTSNDPIKTQDVLAAIQTVYQDYNLQQQQVRLTEGLAFINDQLPTAR
A0A0V7ZMP6      ND----STVISLSVEGSTPKLATERAQNLIASLKERLQELRQDRVISQSEFIQDEVRQAH
A0A433W046      PA----TTLIEVEAQGSRPDIAYKRLFTFLEVYQQRLNELRRKDAEVRVQYTQEELEQAR
K9TU02          PA----TTLIEVEAQGSRPDIAYKRLFTFLEVYQQRLNELRRKDAEVRVQYTQEELEQAR
A0A2P8QV10      PA----TTLIEVEAQGSRPDLAYKRLFTFLEVYQQRLNELRRKDAEVRVQYTQEELEQAR
A0A6J4NIB3      EL----STLLLVEAEGSSPELARFRAATVIEFYQQRLNELRRNDADVREKFARLELEDSR
A0A6P0VB93      GE----STVISLSAEGSTPELARQRTAALIETFQQRLNELRQDDAVQRSQFTQKELQQAV
A0A6P0W0Y0      GE----STVISLSAEGSTPELARQRTAALIETFQQRLNELRQDDAVQRSQFTQKELQQAV
A0A846BJ08      GE----STVISLSAEGSTPELARQRTAALIETFQQRLNELRQDDAVQRSQFTQKELQQAV
A0A6M0AB25      GE----STIISLSAEGSTPELARQRTAALIGAFQQRLNELRLDDAVQRSQFMRKELEQAA
A0A1D8TTM0      GE----STIISLSAEGSTPELARQRTAALIEAFQQRLNELRLDDAVQRSQFMRKELEQAA
A0A846GII1      GE----STIISLSAEGTTPELARQRTAALIEAFQQRLNELRQDDAVQRSQFMGKELEQAA
B8HQ70          SL----SPLMTVEVKGTTPELAHQRLSTWIKLYQKRLTYLRENDASTRQTLPQQELQEAS
A0A2S6V636      EQ----STIINLQVKASSPDIAQRRLSNLINIYQLRLNELRHQDTNVRKQFSQTDLEEAQ
A0A6P0IXR4      ------------------------------------------------------------
A0A845XP18      ----------------------------------------RQADGTTRVEFNKKALDRAK
A0A845ZT65      QE----STTIWLNATGASPELARDRVRALISAYQERLNELRQADGTTRVEFNKKALDRAK
A0A1D8TWE6      QE----STTIWLNARGDSPELARDRVKALISAYQDRLNELRQADGSTRVEFNKKALERAK
A0A845WQ93      QE----STTIWLNARGDSPELARDRVKALISAYQERLNELRQADGTTRVEFNKKALERAK
A0A1D9G3S3      QE----STTIWLNASGDSPELARDRVKALISAYQERLNELRQADGTTRVEFNKKALERAK
A0A6P0KRF3      QE----STTIWLNASGDSPELARDRVKALISAYQERLNELRQADGTTRVEFNKKALERAK
A0A6P0LQ61      QE----STTIWLNASGDSPELARDRVRALISAYQERLNELRQADGTTRVEFNKKALERAK
A0A6L9YP52      QE----STTIWLNASGDSPELARDRVRALISAYQERLNELRQADGTTRVEFNKKALERAK
A0A6P0L3X9      EE----STTIWLNATGDSPKLARDRVKALISAYQERLNELRQADGTTRVEFNKKALERAK
A0A6M0A6X4      QE----STTIWLNATGDSPELARDRVKALISAYQERLNELRQADGTTRVEFNKKALERAK
A0A1U7N3U5      QE----STTIWLNATGDSPKLARDRVKALISAYQERLNELRQADGTTRVEFNKKALERAK
A0A6L9ZB93      QE----STTIWLNATGDSPKLARDRVKALISAYQERLNELRQADGTTRVEFNKKALERAK
A0A6P0S980      QE----STTIWLNATGDSPKLARDRVKALISAYQERLNELRQADGTTRVEFNKKALERAK
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
A0A846CZ70      ------------------------------------------------------------
A0A846E3I8      ------------------------------------------------------------
A0A355DU96      ------------------------------------------------------------
A0A846A9P3      ------------------------------------------------------------
A0A5B8NQW4      ------------------------------------------------------------
A0A6P0XUL2      ------------------------------------------------------------
                                                                            

A0A846FUP5      ------------------------------------------------------------
A0A6P0ITZ8      ------------------------------------------------------------
A0A6P0SLN0      ------------------------------------------------------------
A0A2T1DKP1      ------------------------------------------------------------
A0A2T1CC83      ------------------------------------------------------------
A0A0D6KL48      ------------------------------------------------------------
A0A1B7WWU1      ------------------------------------------------------------
A0A328V843      ----------QYFKQRNYVVDLGT-EFAISVQEMAQLNRNITTLEAELNAVQSLVNSLGN
A0A2N6LHT1      KQLQEAEQKENRYRQSSGIVSFDE-QTKSLVESLATLEEQENTLSAQLQELRSKEASLQQ
A0A2T1EZA0      ERVQKLSQEMLKFRERNNFVDPAA-AAGQILGAREGLVNQLRTLQNEQVQLDSQLKSIQT
A0A6M0AN00      -------------------------------------------------------EAVQQ
A0A1U7JBN8      QEVAAIEGDLSEFQKRYDLVDVNA-TSESVTQRLNQMLADQEQLRVELSALAPLYENLRE
A0A2W4VXF4      QEVDTIESDLSEFQKRYDLVNVTT-TAESVAQRLNQMLSDQEQLRVQLTSLGPLYENLRS
A0A2W7AI98      QEVDTIESDLSEFQKRYDLVNVTT-TAESVAQRLNQMLSDQEQLRVQLTSLGPLYENLRS
A0A2P8QVH5      KDVSQAEANLENFRKQNKLLDPEV-QAKNLLDALAAVESERRTIRAQFQDQQARYNKLQQ
A0A433W4W4      KDVSQAEANLENFRKQNKLLDPEV-QAKNLLDALAAVESERRTIRAQFQDQQARYNKLQQ
K9U5W1          KDVSQAEANLENFRKQNKLLDPEV-QAKNLLDALAAVESERRTIRAQFQDQQARYNKLQQ
L8M1L4          EELNKAAFAIRSFRQKNNLVDPDE-YVGRVADFRQSLEEELKRGEIALD-IAQTKYRTIS
A0A7G8GTF0      KEVENMQLKLADFRRVHSMVDPLR-TGENIKKNENKIRDEILEIEKSRDRLLQARSEIVA
A0A7G8H3H8      KDVEKMQLKLAEFRRVNSMVDPLR-TGQNLKRNEDKIRDEVLEIEKTRDRLLQARSEIVA
A0A4P5VLH9      NNVTKLEAQLLDFRQKYNVLDPSG-LAEKIVSNRDDLVAKSMALQVEHNDLKSKLASVQS
A0A2W6ZN45      QRVNSLQRTLKQFRESNSFLEPLA-QGGSIISSRDGLLGQLRTLQVEQAELETQLASVRS
A0A081GP61      ARVQKLSNEMLRFRERNNFVDPAT-AAGQILGARDGLVNQLRDLQNEQVQLDSQLQSIQS
K9P6R9          ERVQKLSQEMLKFRQRNNFVDPAT-AAGQILGAREGLVNQLRTLQNEQVQLDSQLKSIQT
A0A6G3Z347      DRVEQLEAELEGLRQRSNLIDPLQ-QGEQLSQKAAEFTAEQLNLRVQIQEAEQLSQNLQR
A0A7T1IAR0      FTVNQLQGQLAAFRRRYNLLDPEI-EAGALKTESSGFDGVERELDAERSRLEKLRQGVVA
A0A6P0S1R8      ------------------------------------------------------------
A0A0A2B4S6      GKNKQVQKELSDFRERNQLIEPTV-EGQELKTRLDYLENELDNIKNERVKLNNLLNSIEN
K9SGV8          QDVENAEQQLRAFREQYNFVSASA-EAEATIDRFRSTESRIEDMQVSLAKIDAQSDQLGN
B0CA08          QRVNSAETALRKFKETYQIADLEI-AKSANATNLSQLQTALDEIDRELVEVQTQQLSLQN
B0BZC6          QELVKVESSISQFKQQYNIVSLEETDNKRLTQSIAEAEKVAEEISANLRQVQARGLALSK
A0A6P0M090      ANVRQAEAALRQFKERNQVVSLTE-EARSLVAVMADLDSQITTVQAQLEEANAQAAGLRN
A0A563VX16      QKLTNAERNLEVMLTRYNLIAPQT-EAIDISKLLTNTRQQREELKAQYKQTQSKYESLEQ
A0A6G3Z709      KEVLRVEEALRQFKETNDIISLDQ-EASNAVSVLSNLDQEITQLQARLADLDAQSARIQG
A0A0V7ZGW0      RNLQLVKSKLAQFKKSTGFVSDEE-QTKNLVTAINTLRTTQTDVLAQAKATATRSQELSR
A0A355DPN1      DNVIQAEKALEQFRETQNLIDPVQ-QATTITDALSTVEQEQQAIRAQYQETQARYRVLQQ
A0A0V7ZMP6      RKLMDAQKKLNKFKEAGNVISDEH-DAKQKVITINALNKSRVEALAEAKAAQAQTRILSA
A0A433W046      LNLNQAQANLSNFQRSTGLVNSPE-QSGGLISAINNLKTTQATLIAQGQANATQAQAAAV
K9TU02          LNLNQAQANLSNFQRSTGLVNSPE-QSGGLISAINNLKTTQATLIAQGQANATQAQAAAV
A0A2P8QV10      LNLNQAQANLSNFQRSTGLVDSPE-QSKGLISAINNLKTTQATLIAQGQANATQAQAAAV
A0A6J4NIB3      KNLLQAQKALTQFQEATGIVDRDA-QTEGLVEAINNLKNTQATVLAEARSNETQAKAVAA
A0A6P0VB93      ENLRQAQAALASFKASSNLVSAED-QTREMVVAINTLTTEQAQLVAQAQASKAQVETLSA
A0A6P0W0Y0      ENLRQAQAALASFKASSNLVSAED-QTREMVVAINTLTTEQAQLVAQAQASKAQVETLSA
A0A846BJ08      ENLRQAQAALASFKASSNLVSAED-QTREMVVAINTLTTEQAQLVAQAQASKAQVETLSA
A0A6M0AB25      ENLRQAQAALAAFKASSNLVSAED-QTREMVTAINTLTTEQAQVLAQAQASKAQVETLSA
A0A1D8TTM0      ENLRQTQAALVAFKASSNLVSAED-QTREMVTAINTLTTEQAQVLAQAQASKAQVETLSA
A0A846GII1      TNLRQAQAALTAFKASSNLVSAED-QTREMVTAINTLTTEQAQVLAQARASKARVEALST
B8HQ70          NNLRRTQTQLSVFRQANNITDINE-QIRGLVNSISDLKTEYARALAQAQASNAQQQALSQ
A0A2S6V636      AQLAKAQAELASFQQATGLTEVAE-QTRALIAQQRELRTTYTNVLSQAQANQAQAQAASE
A0A6P0IXR4      ------------------------------------------------------------
A0A845XP18      QKLDQSQEALAKFQESSGLVNSEA-QTEGLVRAITDLSISQAQAQAEAQASQHQLQILST
A0A845ZT65      QKLDQSQEALAKFQESSGLVNSEA-QTEGLVRAITDLSISQAQAQAEAQASQHQLQILST
A0A1D8TWE6      QKLDQSQEALAKFQESSGLVNSKA-QTEGLVRAITDLSISQAQAQAQAQASQHQLQILST
A0A845WQ93      QKLDQSQEALAKFQESSGLVNSKA-QTEGLVRAITDLSISQAQAQAQAQASQHQLQILST
A0A1D9G3S3      QKLDQSQEALAKFQESSGLVNSKA-QTEGLVRAITDLSISQAQAQAEAQASQHQLQILST
A0A6P0KRF3      QKLDQSQEALAKFQESSGLVNSKA-QTEGLVRAITDLSISQAQAQAEAQASQHQLQILST
A0A6P0LQ61      QKLDQSQEALAKFQESSGLVNSKA-QTEGLVRAITDLSISQAQAQAEAQASQHQLQILST
A0A6L9YP52      QKLDQSQEALAKFQESSGLVNSKA-QTEGLVRAITDLSISQAQAQAQAQASQHQLQILST
A0A6P0L3X9      QKLDQSQEALAKFQESSGLVNSKA-QTEGLVRAITDLSISQAQAQAQAQASQHQLQILST
A0A6M0A6X4      QKLDQSQEGLAKFQESSGLVNSKA-QTEGLVRAITDLSISQAQAQAQAQASQHQLQILST
A0A1U7N3U5      QKLDQSQEALAKFQESSGLVNSKA-QTEGLVRAITDLSISQAQAQAQAQASQHQLQILST
A0A6L9ZB93      QKLDQSQEALAKFQESSGLVNSKA-QTEGLVRAITDLSISQAQAQAQAQASQHQLQILST
A0A6P0S980      QKLDQSQEALAKFQESSGLVNSKA-QTEGLVRAITDLSISQAQAQAQAQASQHQLQILST
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
A0A846CZ70      ------------------------------------------------------------
A0A846E3I8      ------------------------------------------------------------
A0A355DU96      ------------------------------------------------------------
A0A846A9P3      ------------------------------------------------------------
A0A5B8NQW4      ------------------------------------------------------------
A0A6P0XUL2      ------------------------------------------------------------
                                                                            

A0A846FUP5      ------------------------------------------------------------
A0A6P0ITZ8      ------------------------------------------------------------
A0A6P0SLN0      ------------------------------------------------------------
A0A2T1DKP1      ------------------------------------------------------------
A0A2T1CC83      ------------------------------------------------------------
A0A0D6KL48      ----------------------------MKLNTDTAVELTTLSQSPGVQQVL--------
A0A1B7WWU1      ------------------------------------------------------------
A0A328V843      QV--------------------------GLNL-EEAIAVNTLSQSPVVRAAL--------
A0A2N6LHT1      VT--------------------------DAKALNQAYAAVRGGQDEELKALR--------
A0A2T1EZA0      GKLQFTPSG-------------------APTALEQLGRNSVLVPGRGDSAAEAASGTKTP
A0A6M0AN00      KL--------------------------ARSP-QNALTSSRLSQSGRYQNLL--------
A0A1U7JBN8      QV--------------------------GFDP-NTAIRVANLNESPTYQALL--------
A0A2W4VXF4      QV--------------------------GFEP-SVAIGVANLNESPTYQGLL--------
A0A2W7AI98      QV--------------------------GFEP-SVAIGVANLNESPTYQGLL--------
A0A2P8QVH5      QI--------------------------SRSP-QQALIASRLSQSPRYQSLL--------
A0A433W4W4      QI--------------------------SRSP-QQALIASRLSQSPRYQSLL--------
K9U5W1          QI--------------------------SRSP-QQALIASRLSQSPRYQSLL--------
L8M1L4          NQL--IELGQDPETIV--TTS-------------------VLGQDGVYQSLA--------
A0A7G8GTF0      GNV--SALGYKEGITDRGSGA-------------------QLTISDVDQSLL--------
A0A7G8H3H8      GNV--SALGYQEGITDRGSGA-------------------RLTISDVDQSLL--------
A0A4P5VLH9      GRLNWTPSGAPTPIQQLGRQG-------TVIP-GRSDANDSNEIGAGQTTPN--------
A0A2W6ZN45      GKLITLPSPGSSGSGVVGQGSPAAGNPQLGLA-TRPRADSVAPSSNTVVTPQ--------
A0A081GP61      GKLQFSSSGAPTAIQQLGRNS-------VLVP-GRANQNQGAEVAKGTPTPL--------
K9P6R9          GKLQFTPSGAPTALEQLGRNS-------VLVP-GRG--NSAAEASSGTKTPL--------
A0A6G3Z347      ELL---------------------------EG-EESAVTSALLESERYQNLL--------
A0A7T1IAR0      GTL-------------------------TSSG-FSTASDSGVTVTQANGDLL--------
A0A6P0S1R8      ------------------------------------------------------------
A0A0A2B4S6      GSLT------------------------AYGFKQAITTDLNLNERIPTEGVSFINLDLEL
K9SGV8          LVAD------------------------EIDSVEQALLRTALSQSPHTAGVM--------
B0CA08          ML--------------------------KVNP-QQAI----LGISTAHKNIS--------
B0BZC6          VI--------------------------DQSSGKESYLSAKAGQNPELISLR--------
A0A6P0M090      QV--------------------------GLNP-QQAIAISALSQSTSVQGVL--------
A0A563VX16      QL--------------------------ATTG-NVDSVDSRLSLSSRYQNLL--------
A0A6G3Z709      QL--------------------------GLNV-SEGLALSSLNQSDGVQESL--------
A0A0V7ZGW0      TL--------------------------GMAP-QQAINSLRLSENKEYQALR--------
A0A355DPN1      QL--------------------------ERSP-QEALTSSRLSQSPRYQALL--------
A0A0V7ZMP6      RL--------------------------SLPP-QTALKSLQTKGTETSLSIR--------
A0A433W046      SL--------------------------GITP-QQAMNSLRLGENKEYQATR--------
K9TU02          SL--------------------------GITP-QQAMNSLRLGENKEYQATR--------
A0A2P8QV10      SL--------------------------GITP-QQAMNSLRLGENKEYQATR--------
A0A6J4NIB3      RL--------------------------STTP-QQAMNSLSLSENKEYQAIR--------
A0A6P0VB93      RL--------------------------ELNP-EQAIRSLNLGENQDYQFFR--------
A0A6P0W0Y0      RL--------------------------ELNP-EQAIRSLNLGENQDYQFFR--------
A0A846BJ08      RL--------------------------ELNP-EQAIRSLNLGENQDYQFFR--------
A0A6M0AB25      RL--------------------------ELNP-EQAIRSLSLGENQDYQFFR--------
A0A1D8TTM0      RL--------------------------ELNP-QQAIRSLSLGENQDYQFFR--------
A0A846GII1      RL--------------------------ELNP-EQAIRSLSLGENQDYQFLR--------
B8HQ70          HL--------------------------RLTP-QAAMTTLRLGENKEYQLVR--------
A0A2S6V636      RL--------------------------GINA-QQAMNSLRLGENREYQAIR--------
A0A6P0IXR4      ------------------------------------------------------------
A0A845XP18      RL--------------------------GLTP-KQAIRSLGLAENRDYQFVR--------
A0A845ZT65      RL--------------------------GLTP-KQAIRSLGLAENRDYQFVR--------
A0A1D8TWE6      RL--------------------------GLTP-KQAIRSLGLAENRDYQFVR--------
A0A845WQ93      RL--------------------------GLTP-KQAIRSLGLAENRDYQFVR--------
A0A1D9G3S3      RL--------------------------GLTP-KQAIRSLGLAENRDYQFVR--------
A0A6P0KRF3      RL--------------------------GLTP-KQAIRSLGLAENRDYQFVR--------
A0A6P0LQ61      RL--------------------------GLTP-KQAIRSLGLAENRDYQFVR--------
A0A6L9YP52      RL--------------------------GLTP-KQAIRSLGLAENRDYQFVR--------
A0A6P0L3X9      RL--------------------------GLTP-KQAIRSLGLAENRDYQFVR--------
A0A6M0A6X4      RL--------------------------GLTP-KQAIRSLGLAENRDYQFVR--------
A0A1U7N3U5      RL--------------------------GLTP-KQAIRSLGLAENRDYQFVR--------
A0A6L9ZB93      RL--------------------------GLTP-KQAIRSLGLAENRDYQFVR--------
A0A6P0S980      RL--------------------------GLTP-KQAIRSLGLAENRDYQFVR--------
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
A0A846CZ70      ------------------------------------------------------------
A0A846E3I8      ------------------------------------------------------------
A0A355DU96      ------------------------------------------------------------
A0A846A9P3      ------------------------------------------------------------
A0A5B8NQW4      ------------------------------------------------------------
A0A6P0XUL2      ------------------------------------------------------------
                                                                            

A0A846FUP5      ------------------------------------------------------------
A0A6P0ITZ8      ------------------------------------------------------------
A0A6P0SLN0      ------------------------MQALLEQREELQNQIKGYIFQARAAQPGVNATIGQ-
A0A2T1DKP1      ------------VEQTRYRSGHPAIANLERKVDALNALLQERI--GQVVSNGGPVPTGN-
A0A2T1CC83      ------------------------------------------------------------
A0A0D6KL48      -TEYQKVQDELAVARTRLTEDNPKIINLENQAVALKNQLEGRV--AQTIGNSEYMPEQN-
A0A1B7WWU1      ------------------------------------------------------------
A0A328V843      -QELENVEGELAQEQRRFRDENPRIISLKGKRDNLENLLQREIQVYLGSSRPFSRGLLR-
A0A2N6LHT1      -NKLAEIETQLVQARLSLTDNHPTVINLLGQRNGLRALYQQGL--ARVSPRNQSISSGS-
A0A2T1EZA0      LDLLNQFEQELATAKGTFKENSPIVQSLLARRNQLLPVVQRQA-----ADAVKARLLAN-
A0A6M0AN00      -NEIQRIELALVEQSRIYTEAHPTIQKLIEQRQSVFALLQEET--RRVLGQVPTQLVTT-
A0A1U7JBN8      -GDLREIEQTIAAESARFQADTPMIEALTDQRQQLLPLLEAEAQRLVGSAVEAETLGYQ-
A0A2W4VXF4      -GDLREIEQTIAAESARFQSDTPMIEVLVDQRQQLLPLLEAEAGRLVGSAVDANTLGYQ-
A0A2W7AI98      -GDLREIEQTIAAESARFQSDTPMIEVLVDQRQQLLPLLEAEAGRLVGSAVDANTLGYQ-
A0A2P8QVH5      -DEIQALDVTLEKLRVQYRDDYPKVQDLLKQRQNLIGLLRTEA--GRSADRLPAQLSTT-
A0A433W4W4      -DEIQALDVTLEKLRVQYRDDYPKVQDLLKQRQNLIGLLRTEA--GRSADRLPAQLSTT-
K9U5W1          -DEIQALDVTLEKLRVQYRDDYPKVQDLLKQRQNLIGLLRTEA--GRSADRLPAQLSTT-
L8M1L4          -SQLKDLETQYTLASVQFKDNYPMMQDLKLQREQLRNLLLE-----RSTQILGEGISPAV
A0A7G8GTF0      -KEMQKVESLLAAARSTYQPDSLMVRGLSKRLENLRPLLIS-----NQLDAVDAALALN-
A0A7G8H3H8      -KEMQKVESQLAAARSTYQPDSLMVRGLSKRLENLRPLLIS-----NQLDAVDAALALN-
A0A4P5VLH9      -ETLDEFEQKLANARAVYKDDSPIVQSILAQRDAILPVVRK-----QATDAIKAQLFAN-
A0A2W6ZN45      -QQLSQLDQQIATARATFKSDSPQLQTLLAQRNRIKPLVQS-----QGIDQLSSQLFAN-
A0A081GP61      -DLLNQFEQELATAKGTYKQNSPIVQSLLARRNQLLPVVQR-----QASDAVKARLLSN-
K9P6R9          -DLLNQFEQELATAKGTFKENSPIVQSLLARRNQLLPVVQR-----QAADAVKARLLAN-
A0A6G3Z347      -NQMLELDGQLAEELTLYLEDSPEIEVIREQRENLQPLLQREG--IRVQDQLANFTREL-
A0A7T1IAR0      -AQLQGVEEQLSLARSTYRSDTPRMQSLTALRARLAGQLRSNQ--LEAIDTALKLN----
A0A6P0S1R8      -----------------------------------QGQIEGYI--ALA--QADEAEVNA-
A0A0A2B4S6      LDQYILVKQKLAIARTKYLEDSEIVKGLKYRVEQIEPTLKSNQISALI---SAREIIDK-
K9SGV8          -GELQQTKQAIATQLAIYREDSPQIAVLRDQERNLEQLLRQRAKQVAGIPPSESIDIDA-
B0CA08          -TSLEEIDKDLAEAKSNFREDHPAVLELLERQAQLKQLLSQKI--EKFAQSDAQLNFDS-
B0BZC6          -DQLSNLESQLKIRRESLTDDHPDIQKLITEKDAAQALYQQKL--ATI---SPRSRLNS-
A0A6P0M090      -QELQEVERQLAVGRNRYGKNHPVMIRLTKHQRSLRGHLQQQIDQILGSQSLAGTQIQI-
A0A563VX16      -NELQRIDIELETQRSRFTDSNPIVQGLLTERRQKQQLLEKEA--GNI-LGSTNLQVSS-
A0A6G3Z709      -SELQNIQAELAEERSRYREGHPAIDMLERREAEAEALLGSRI--QEVLGRELTVPVED-
A0A0V7ZGW0      -QKLTEVNTEIAVNRGTLTEEHPTVRALLQQRQKLLMALNRQL--NAV--VPSADGIDA-
A0A355DPN1      -NELQKTELAIAQQRVKFTDAEPRVEQLLEQRQRQLALLQEET--QRVLGETSTQIAFS-
A0A0V7ZMP6      -EKLSKVNISLQEAQTYLTDNHPRIENLKFQQEELRNELQEDR--VSD-NSVSSVAINP-
A0A433W046      -TQLSQLESTMAVTRSKYRDDSPQVQSLLQQRQQLLRQLNQQI--AVAIPGANAAQIDT-
K9TU02          -TQLSQLESTMAVTRSKYRDDSPQVQSLLQQRQQLLRQLNQQI--AVAIPGANAAQIDT-
A0A2P8QV10      -TQLSQLESTMAVTRSKYRDDSPQVQSLLQQRQQLLRQLNQQI--AVAIPGARPAQIDT-
A0A6J4NIB3      -EEVSLVETALSQARGKFTEQSPQVQALLLQRQELRRDLNQRL--AKAIPGVKAETVDI-
A0A6P0VB93      -RELSKIEALLTQTQAKFTDEHPQVKALLEQREELQGQIEGYI--TQA--QADEAEVNA-
A0A6P0W0Y0      -RELSKIEALLTQTQAKFTDEHPQVKALLEQREELQGQIEGYI--ALA--QADEAEVNA-
A0A846BJ08      -RELSKTEALLTQTQAKFTDEHPQVQALLEQREELQGQIEGYI--ALA--QADEAEVNA-
A0A6M0AB25      -QELSEVEALLTETQAKFTDGHPQVQALLEQRQDLQDQIERYI--FQA--RAAQSGVNA-
A0A1D8TTM0      -QELSEVEALLTETQAKFTNENPQVQALLEQREELQNQIEGYI--FQA--RAAQPGVNA-
A0A846GII1      -QELSEVEALLAQTQAKFTNENPQVQALLEQREELQGQIEGYI--AQA--RAAQPGVNA-
B8HQ70          -DRLAQVEADLATARGTLTDDNPRVQDLLEQRQKLTQLLDQNL--RAAIGNSSLAGVDR-
A0A2S6V636      -QKLSDAETALAEARSRYTDESPQVQSLLSQRQELMQLLNQQI--AIAAPGASANQIDP-
A0A6P0IXR4      -------------------------QNLLLQREQLQQQIQQYI--FLA---AGDTLVDP-
A0A845XP18      -QQLTELEATLVKAQATYTYAHPEIQNLLLQREQLQQQIQQYI--FLA---AGDTLVDP-
A0A845ZT65      -QQLTELEATLVKAQATYTYAHPEIQNLLLQREQLQQQIQQYI--FLA---AGDTLVDP-
A0A1D8TWE6      -QQLTELEATLVKAQTTYTYAHPEIQNLLLQREQLQQQIQQYI--FLA---AGDTLVDP-
A0A845WQ93      -QQLTELEATLVKAQTTYTYAHPEIQNLLLQREQLQQQIQQYI--FLA---AGDTLVDP-
A0A1D9G3S3      -QQLTELEATLVKAQATYTYAHPEIQNLLLQREQLQQQIQQYI--FLA---AGDTLVDP-
A0A6P0KRF3      -QQLTELEATLVKAQATYTYAHPEIQNLLLQREQLQQQIQQYI--FLA---AGDTLVDP-
A0A6P0LQ61      -QQLTELEATLVKAQATYTYAHPEIQNLLLQREQLQQQIQQYI--FLA---AGDTLVDP-
A0A6L9YP52      -QQLTELEATLVKAQTTYTYAHPEIQNLLLQREQLQQQIQQYI--FLA---AGDTLVDP-
A0A6P0L3X9      -QQLTELEATLVKAQTTYTYAHPEIQNLLLQREQLQQQIQQYI--FLG---AGDTLVDP-
A0A6M0A6X4      -QQLTELEATLVKAQTTYTYAHPEVQNLLLQREELQQQIQQYI--FLA---AGDTLVDP-
A0A1U7N3U5      -QQLTELEATLVKAQTTYTYAHPEIQNLLLQREELQQQIQQYI--FLA---AGDTLVDP-
A0A6L9ZB93      -QQLTELEATLVKAQTTYTYAHPEIQNLLLQREELQQQIQQYI--FLA---AGDTLVDP-
A0A6P0S980      -QQLTELEGTLVKAQTTYTYAHPEIQNLLLQREQLQQQIQQYI--FLA---AGDTLVDP-
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
A0A846CZ70      ------------------------------------------------------------
A0A846E3I8      ------------------------------------------------------------
A0A355DU96      ------------------------------------------------------------
A0A846A9P3      ------------------------------------------------------------
A0A5B8NQW4      ------------------------------------------------------------
A0A6P0XUL2      ------------------------------------------------------------
                                                                            

A0A846FUP5      -----------------------------------SIVDLETRHTMAVEREATIQKEKDA
A0A6P0ITZ8      ---------------------------------SSRFILSETERSALEQKLYLVQTERIK
A0A6P0SLN0      ----------------------------ESAALIRQLILAESQTQAYYSQGKQIQTQIDQ
A0A2T1DKP1      -----------------------LQLGDLQQGLISDLVRSEAERVGLSERLSSLSNAQSA
A0A2T1CC83      --------------------------------------------------VGALYNSQQD
A0A0D6KL48      -----------------------LQIGNLKQTLTENLVKSEVERLALTNQVAELKQVLLV
A0A1B7WWU1      -----------------------------------------------TKQVEELQRVFIF
A0A328V843      -------------------------VMDVKNNKIEEFVNAEIRRLDLTKQLDSLYEARDG
A0A2N6LHT1      -----------------------VAGDQISQDLTSQLIINDVERLALENKLKVVQTNRAN
A0A2T1EZA0      -----------------------------------------------VAQQDEINRQILL
A0A6M0AN00      ----------------GNNLLTEGQLGGVDINLVNELITSQINLVSLQTRDQALIKTEQE
A0A1U7JBN8      --------------------------GSVSQDLMQQLVNTANQMQVLQTQDQAIGQAVQL
A0A2W4VXF4      --------------------------GSVSRELVQQLVDTANQMQVLETQDQAIAQAVQQ
A0A2W7AI98      --------------------------GSVSRELVQQLVDTANQMQVLETQDQAIAQAVQQ
A0A2P8QVH5      ----------------EKSLPKQLQLGDSDRKLVDALVDAQVVWFGLSARDQSLAKSEQQ
A0A433W4W4      ----------------EKSLPKQLQLGDSDRKLVDALVDAQVVWFGLSARDQSLAKSEQQ
K9U5W1          ----------------EKSLPKQLQLGDSDRKLVDALVDAQVVWFGLSARDQSLAKSEQQ
L8M1L4          LDKVLVSYTQTNIVAAGDSGSQVSTSGSTLQQLAEQLLSTQTEYLSLQSQINQINQAKAN
A0A7G8GTF0      -----------------------------------------------KGRLINAEKRAED
A0A7G8H3H8      -----------------------------------------------KGRLMNAKKRAED
A0A4P5VLH9      -----------------------------------------------ESQQDELNRQILL
A0A2W6ZN45      -----------------------------------------------QAQQNELNRQILL
A0A081GP61      -----------------------------------------------LAQQDEINRQILL
K9P6R9          -----------------------------------------------VAQQDEINRQILL
A0A6G3Z347      -----------------------------------------------QVRDQALTRAITT
A0A7T1IAR0      -----------------------------------------------AARASTLAGQRRQ
A0A6P0S1R8      ----------------T--------IGQESAALIEQLILAESQTQAYYSQSKQIQIQIDQ
A0A0A2B4S6      ----------------N---------------------------------IQNAKIKIKS
K9SGV8          ----------------L------FQIGGLQEQSVQQFYSLDNERVGLLEEISALNDVYSN
B0CA08          ----------------N-----------QEDDLRSQLIQLDIRRNGLSKQQLKLRQQLSS
B0BZC6          ----------------DGTVQ--VANEKVTQELSEKLVLSVVERNELRDKLANTRAYISK
A0A6P0M090      ----------------T---EGLLEVDELKQKLISDFIESEVKRRSLAEGLATLAKARIA
A0A563VX16      ----------------SDNLESRGQLDSSNLELAEALASTRNELIGLESRERSLALTEQK
A0A6G3Z709      ----------------LN--VGRLQLGELRQNLIAELTRLEVERIGVNNRMAQLTNSRNS
A0A0V7ZGW0      ----------------N---FGGNNFKDATIELIAQLIQVESESKGLQQQVLIIQNKLER
A0A355DPN1      ----------------TQNLLTEGQLGSNDLTLSSQLAEAQTTLQALQARDRSLAITQQQ
A0A0V7ZMP6      ----------------N---L-------ADRHIVHKLILAESQAEAMSSKAQQLQIQINY
A0A433W046      ----------------T---LG-NGPNDSRLELMVELIRNQTLAQGTQQQAKQIQKQIDK
K9TU02          ----------------T---LG-NGPNDSRLELMVELIRNQTLAQGTQQQAKQIQKQIDK
A0A2P8QV10      ----------------T---LG-NGPNDSRLELMVELIRNQTLAQGAQQQAKQIQKQVDK
A0A6J4NIB3      ----------------T---LGGGNGKDSRVEMISKMIGAQTLAQGLQQQANQLANQEAK
A0A6P0VB93      ----------------T---IG-----QESAALIEQLILAESQTQAYYSQSKQIQIQIDQ
A0A6P0W0Y0      ----------------T---IG-----QESAALIEQLILAESQTQAYYSQSKQIQIQIDQ
A0A846BJ08      ----------------T---IG-----QESAALIEQLILAESQTQAYYSQSKQIQIQIDQ
A0A6M0AB25      ----------------T---IG-----QESAALIRQLILAESQTQAYYSQGKQIQTQIDQ
A0A1D8TTM0      ----------------T---IG-----QESAALIRELILAESQTQAYYSQGKQIQTQIDQ
A0A846GII1      ----------------T---IG-----QESAVLIRELILAESQTEAYYSQGKQIQTQIDQ
B8HQ70          ----------------S---LAGSAAGDSRIALIADLIRTQSTANGQQSQAQQLQQQLGQ
A0A2S6V636      ----------------T---LGGNGTRDSRIEMIAELIRAQNNAAGLQQQANQIASEINR
A0A6P0IXR4      ----------------T---L--TDSAQGRAMLIQQLILAESAASGQQQQAEQLQQQIDQ
A0A845XP18      ----------------T---L--TDSAQGRAMLIQQLILAESAASGQQQQAEQLQQQIDQ
A0A845ZT65      ----------------T---L--TDSAQGRAMLIQQLILAESAASGQQQQAEQLQQQIDQ
A0A1D8TWE6      ----------------T---L--TDSAQGRAMLIQQLILAESAASGQQQQAEQLQQQIDQ
A0A845WQ93      ----------------T---L--TDSAQGRAMLIQQLILAESAASGQQQQAEQLQQQIDQ
A0A1D9G3S3      ----------------T---L--TDSAQGRAMLIQQLILAESAASGQQQQAEQLQQQIDQ
A0A6P0KRF3      ----------------T---L--TDSAQGRAMLIQQLILAESAASGQQQQAEQLQQQIDQ
A0A6P0LQ61      ----------------T---L--TDSAQGRAMLIQQLILAESAASGQQQQAEQLQQQIDQ
A0A6L9YP52      ----------------T---L--TDSAQGRAMLIQQLILAESAASGQQQQAEQLQQQIDQ
A0A6P0L3X9      ----------------T---L--TDSAQGRAMLIQQLILEESAASGQQQQAEQLQQQIDQ
A0A6M0A6X4      ----------------T---L--TDSAQGRAMLIQQLILAESAASGQQQQAEQLQQQIDQ
A0A1U7N3U5      ----------------T---L--TDSAQGRAMLIQQLILAESAASGQQQQAEQLQQQIDQ
A0A6L9ZB93      ----------------T---L--TDSAQGRAMLIQQLILAESAASGQQQQAEQLQQQIDQ
A0A6P0S980      ----------------T---L--TDSAQGRAMLIQQLILAESAASGQQQQAEQLQQQIDQ
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
A0A846CZ70      ------------------------------------------------------------
A0A846E3I8      -------------------------------------------------------QQIDQ
A0A355DU96      ------------------------------------------------------------
A0A846A9P3      ------------------------------------------------------------
A0A5B8NQW4      ------------------------------------------------------------
A0A6P0XUL2      ------------------------------------------------------------
                                                                            

A0A846FUP5      ADEMLLELDQISVKYELLQSQADTSRTQLTEVQNRLSQVSIASRMDNTNIKLNDAAYVPF
A0A6P0ITZ8      LQNRLGQIPVLGQPFANLVRRQEEAIASLKLLQNKLEEARIAEAQLVSNIQIIERAKLPS
A0A6P0SLN0      LGSTLKTLPAAQARLVQLQQQYDIAEGVYNGLVAQVQQSKLNALSSYPSVQVFEEPRADS
A0A2T1DKP1      YRARANALPRLEETQRELERRLKAAQTTYEVLLSRLQEVQVAENQNIGNARALSSAIVSE
A0A2T1CC83      LIKRAKVLPQLEQKDRELVRQAESAGKTYETLLNNLQEATIAANSKSGNADVVEYAAVPD
A0A0D6KL48      NKNRLDSLPRLEQQQLQLQRQLKVAQVTYEQLSKQLQEVEVVENQNVGNARVISEALVAD
A0A1B7WWU1      NRRRLDSLPRLEQQQLQLQRQLTVAQITYQEFLKQYQLVQVLENQNVGNSRVISEALVPE
A0A328V843      LERRARILPQLEQQQQELERKAEVARLTYRTLLQNLEEAQVAANKITNNARIIETANVPD
A0A2N6LHT1      LQARLAQLPIQQQQLTPLTRQREESAESLKLLQSKLEEARIAEAQLVGNIQIIEAAQPPT
A0A2T1EZA0      LSENFRNNPQKLAEFENINQRLSIAREQYSSYIQARERYRLEMARSISPWEVIGPPDFGS
A0A6M0AN00      IRIQLREFPALIAQYNRLQPQVAIKQNTLQQLLQARQELSIELARGGFNWQVVEAP-LPG
A0A1U7JBN8      LRAEIQRLADLSRSYQQISRELTVAETSLDQLLASRQDLRFQMARQASPWELISPLNETS
A0A2W4VXF4      LRAEIQRLADLSRSYQQIDRELTVAESSLDRLLTSRQDLRLQMARQTAPWELISPLDESS
A0A2W7AI98      LRAEIQRLADLSRSYQQIDRELTVAESSLDRLLTSRQDLRLQMARQTAPWELISPLDESS
A0A2P8QVH5      LRSTLLKYPQLLAEYNRLMPEIAINRKTLEQLLQTQQNLGIKIAQGGFNWQIIRDPE-PG
A0A433W4W4      LRSTLLKYPQLLAEYNRLMPEIAINRKTLEQLLQTQQNLGIKIAQGGFNWQIIRDPE-PG
K9U5W1          LRSTLLKYPQLLAEYNRLMPEIAINRKTLEQLLQTQQNLGIKIAQGGFNWQIIRDPE-PG
L8M1L4          VEADFQRLPQLQEIYTRLQRNIKIQSQAVDYLLQRKQELQIAAAEEITPWQILDKPYLPA
A0A7G8GTF0      TEKRFLSIQNIIKEYESLQERLNQARSKLNGLVSAREAFELDSAQNSVPWRIISPPGMSH
A0A7G8H3H8      VEEKFLFTQNIIREYEGLQERLAQARSKLSGLTSAREAFEFDNAQNSVPWRIISPPGMSS
A0A4P5VLH9      LNENFKNSPSLMKKYEELASNLKSARENYSSYLIARDNYRLQRARSTSPWQVIAPAEFNE
A0A2W6ZN45      LNKNFKQSPEEIRKYEELQQKIEVAQANYLSYIQARENFRLEVAKQTVPWQVISPPVFGD
A0A081GP61      LNQNFRNNPQKLSEFENINQRLSIAREQYSSYIQARERYRLEMARSITPWEVIGPPDFGA
K9P6R9          LSENFRNNPQKLAEFENINQRLLIAREQYSSYIQARERYRLEMARSISPWEVIGPPDFGS
A0A6G3Z347      LNQQIKDLSTTTRTYNNIQRELEIATANLNQFLTKREALRIDAAQRQTPWEILTPPK-QP
A0A7T1IAR0      VDRRFLKQPALIKDYEQIQQRLTVAQQNLTNFLTTRSTFQLERAQKSVPWTLLSPPAVDG
A0A6P0S1R8      LNDTLKTLPAAQAQLVELQQQYNIAEGVYNGLVAQVQETKLNAFSSYPSVQVFEEPRADS
A0A0A2B4S6      LKEKFEKQPKLISEYKTLQQKALLAAKNLEGLSSAKEKFQLEIAQRSVPWSIIAPPKVYP
K9SGV8          YRERYRELPKLEQEERRLERKVTVAESTYAELLQQLQEVRIAEQQNIGNTRILSLASTPI
B0CA08          YRQQARNLPQLEQRQNELERTAKASASTYRNLLEQIQELKVTENQSPLTVSILESAT-DP
B0BZC6          LDARRKQYPVLEKTLASLQRKKEGATESVNLLRQKLDEARIAEAQLVSNLRIIEEANKPT
A0A6P0M090      YEQRVNVLPRLEQTQQQLEQRLQAARFTYETLLKNLNELKVAENQDTANARIIEPAIVPK
A0A563VX16      LKEKLNQFPDLIAQYNSLEQEVAVHQATLKKLLESRQEIGIVINRGGFSWEIIEPPQQGL
A0A6G3Z709      FLLRANNLPQLEKLERELERNLQAAQTTYETLLTQLQEIRVIENQTVGNVRIVSLAQVPN
A0A0V7ZGW0      LQTELKNISTLQAQLLDLQRQYDIAEGVYKGIVAQLEQSKIAAFNAYPNLQVLDQPTVDP
A0A355DPN1      LRAKLNRLPELMAEYERLQPEVQIRRDTLQKLLEARQELGIEIARGGFKWQVVEPPKPGK
A0A0V7ZMP6      LREQLKKLPTKQGILMDLQRRYDMTKKIYNGLVTQAEKVRLSAFDTYPSFQLLDEPFVNN
A0A433W046      LNTELSFITKNQAQLLDLQRKYEIAEGVYKGIIAQSEQSKTNPFNAYPNVQTLNEPTIDP
K9TU02          LNTELSFITKNQAQLLDLQRKYEIAEGVYKGIIAQSEQSKTNPFNAYPNVQTLNEPTIDP
A0A2P8QV10      LNTELNFITKNQAQLLDLQRKYEIAEGVYKGIIAQSEQSKTNPFNAYPNVQTLNEPTIDP
A0A6J4NIB3      LTGELGHISRNQGQLLDLQRQYEVAQGAHNGIIAQIEQAKTSPFNAYPNIQTLDEPTAGA
A0A6P0VB93      LNDTLKTLPAAQAQLVELQQQYNIAEGVYNGLVAQVQETKLNAFSSYPSVQVFEEPRADS
A0A6P0W0Y0      LNDTLKTLPAAQAQLVELQQQYNIAEGVYNGLVAQVQETKLNAFSSYPSVQVFEEPRADS
A0A846BJ08      LNDTLKTLPAAQAQLVELQQQYDIAEGVYNGLVAQVQETKLNAFSSYPSVQVFEEPRADS
A0A6M0AB25      LGSTLKTLPAAQARLVQLQQQYDIAEGVYNGLVAQVQQSKLNAFSSYPSVQVFEKPRADS
A0A1D8TTM0      LGSILKTLPAAQARLVQLQQQYDIAEGVYNGLVAQVQQSKLNAFSSYPSVQVFEEPRADS
A0A846GII1      LGSTLKTIPAAQARLVQLQQQYDIAEGVYNGLVAQVQQSKLNAFSSYPSVQVFEKPRADS
B8HQ70          QVTALNRLSNKQVQLLELQREYSIAEGVYKGVMAQFQQAKISTLSSYPSVQVLDGPLNSP
A0A2S6V636      VNAELNNIAQNRAQLINLQRQYEIAEGVYKSILAQVEQTKTNPFNVYPNVQTLDAPAIDP
A0A6P0IXR4      MKSTLTVIPVHQSRLLELKRQYDVAAGVYNGLVAQMEQVNLDAFSAYPNVQVLDPPTVDE
A0A845XP18      MKNTLTVIPVHQSRLLELTRQYDVAAGVYNGLVAQMEQVNLDAFSAYPNVQVLDPPTVDE
A0A845ZT65      MKNTLTVIPVHQSRLLELTRQYDVAAGVYNGLVAQMEQVNLDAFSAYPNVQVLDPPTVDE
A0A1D8TWE6      MKSTLTVIPVHQSRLLELKRQYDVAAGVYNGLVAQIEQVNLDAFSAYPNVQVLDPPTVDE
A0A845WQ93      MKSTLTVIPVHQSRLLELKRQYDVAAGVYNGLVAQMEQVNLDAFSAYPNVQVLDPPTVDE
A0A1D9G3S3      IKSTLTVIPVHQSRLLELTRQYDVAAGVYNGLVAQMEQVNLDAFSAYPNVQVLDPPTVDE
A0A6P0KRF3      MKSTLTVIPVHQSRLLELTRQYDVAAGVYNGLVAQMEQVNLDAFSAYPNVQVLDPPTVDE
A0A6P0LQ61      MKSTLTVIPVHQSRLLELTRQYDVAAGVYNGLVAQMEQVNLDAFSAYPNVQVLDPPTVDE
A0A6L9YP52      MKSTLTVIPVHQSRLLELKRQYDVAAGVYNGLVAQIEQVNLDAFSAYPNVQVLDPPTVDE
A0A6P0L3X9      IKSTLTVIPVHQSRLLELKRQYNVAAGVYNGLVAQMEQVNLDAFSAYPNVQVLDPPTVDE
A0A6M0A6X4      MKSTLTVIPVHQSRLLELKRQYDVAAGVYNGLVAQMEQVNLDAFSAYPNVQVLDPPTVDE
A0A1U7N3U5      IKSTLTVIPVHQSRLLELKRQYDVAAGVYNGLVAQMEQVNLDAFSAYPNVQVLDPPTVDE
A0A6L9ZB93      IKSTLTVIPVHQSRLLELKRQYDVAAGVYNGLVAQMEQVNLDAFSAYPNVQVLDPPTVDE
A0A6P0S980      IKSTLTVIPVHQSRLLELKRQYDVAAGVYNGLVAQMEQVNLDAFSAYPNVQVLDPPTVDE
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
A0A846CZ70      -------------WLLELTRQYDVAAGVYNGLVAQMEQVNLDAFSAYPNVQVLDPPTVDE
A0A846E3I8      IKNTLTVIPVHQSRLLELTRQYDVAAGVYNGLVAQMEQVNLDAFSAYPNVQVLDPPTVDE
A0A355DU96      -------------------------------------------------------ASIPE
A0A846A9P3      ------------------------------------------------------------
A0A5B8NQW4      ------------------------------------------------------------
A0A6P0XUL2      ------------------------------------------------------------
                                                                            

A0A846FUP5      RPIAPNMKKAFIQSFILGFLLVMILPLGFGIFDTRLKS---SWEIEDLLES-RLIGEVPK
A0A6P0ITZ8      SPKQPNPKLVLVIATAAGIAIAVGMVLLLEVMDNTLHD---ASEAEALLKL-PRLGLLPK
A0A6P0SLN0      KPSGPGRRPIALGTILASVFGSAALISFLENRDPLLSP----RDLQ-AISI-PVLRSIPP
A0A2T1DKP1      RSSNRKMGLALGGGV--GILLAVAAAFAADLLDRSVKT---LKEVKDLFGY-TLLGVVPL
A0A2T1CC83      K-GNSGRAVLMGMGLIMGAFLANLSVILLEMQDRSISS---LAEIKKKFPY-QTVGITRL
A0A0D6KL48      KSVSPIIPLNLALGGILGIILGAGTALVLESIDNSLKT---VEEAKRLLDY-PLLGAIPQ
A0A1B7WWU1      LPVSPKIPLNLALGGFLGVLLGAGTALLLESMNQSLKN---IEEANRLLGF-PLLGTIPQ
A0A328V843      EGKTAKVPLLAL-GVMGGLVASTTLLLLMEMGDKSLRT---VAETRDLFGY-TLLGIIPS
A0A2N6LHT1      QPSLPNKRTVLAIAIVVGTALATGIVLLLELMDHTLKD---ASEAEELLKL-PLLGVLPR
A0A2T1EZA0      SPVEPNIQRNLLRAIMIGLLAGLGAAILRERTDNVFHT---PMEVEKDLQL-PVLGLIPY
A0A6M0AN00      FKTGPNMTQDLLLGAVVGLFLGGVAAFVREAMDDGIHT---SDDLKNQVAL-PLLGMIPE
A0A1U7JBN8      IAQTSNLPRNLLLSTVLSLMLGGVAALLRDRLDQAFHS---VDDLVKATQL-PNLAGVPN
A0A2W4VXF4      VTEMTNLPRKLLLSTVVGLLLGGVAALVRDRADTAFHS---ADELVKATQL-PNLALVPN
A0A2W7AI98      ITEMTNLPRKLLLSTVVGLLLGGVAALVRDRADTAFHS---ADELVKATQL-PNLALVPN
A0A2P8QVH5      VYMGTGRIMLLVSGAVFGLVLGIGAAFLLEALDDTIHS---CDELQKLSSL-PVLGITPK
A0A433W4W4      VYMGTGRIMLLVSGAVFGLVLGIGAAFLLEALDDTIHS---CDELQKLSSL-PVLGITPK
K9U5W1          VYMGTGRIMLLVSGAVFGLVLGIGAAFLLEALDDTIHS---CDELQKLSSL-PVLGITPK
L8M1L4          QPISPNIQKALVSSLVAGGLWAIAIAFLLHQLDN-------------RIKLVEEVKRITH
A0A7G8GTF0      IPFSPRPKRDFIVAFVFSLVSGAAIAYVFDLRQNVFYS---SKSVFSSIKL-ASIIHIPF
A0A7G8H3H8      IPFSPRPKRDLLVGFVFSLVSSAVIAYFLDLRQNVFYS---SKSVFSSIKL-PGIIHIPF
A0A4P5VLH9      IPVEPNLQSNLLRALMLGLVSGLGAAILRERTDNVFHT---PMETERELQL-PVLGLIPY
A0A2W6ZN45      VPIEPDLSREFLRALFIGLAVGIAAVLLREKTDDAYHT---PKEASQELGL-PILGLIPY
A0A081GP61      SPVEPDIQRNLLRAIMIGLLAGLGAAILRERTDNVFHT---PMEVEKELQL-PVLGLIPY
K9P6R9          SPVEPNIQRNLLRAIMIGLLAGLGAAILRERTDNVFHT---PMEVEKDLQL-PVLGLIPY
A0A6G3Z347      RASSASAKRNLVMGTVLGILLGSGVAILVDRVRGKIHT---IDELKEVSQL-PLLGTIPY
A0A7T1IAR0      NPVAPKLRQGLTKAILFGLIAGMGAAILRDRFDHVFRR---SGEVRDQLKL-PLLGHIPH
A0A6P0S1R8      EPSGPGRLPIALGTILASAFGSVALILFLENRDPLLSP----KDLQ-AISI-PVLRSIPP
A0A0A2B4S6      VPVSPDIPLNLSLSLIFGPVLGLIVGLIRDKVDHVYHS---PDEVKENLNL-PLLAELPY
K9SGV8          DIVTPRRPRNVSLGLLLGLSAAGGAVFLLEAFDKKIKSTAAARELL---GF-PLLGVIPN
B0CA08          EPSKTTFISAAMRGGLAGILLASGVVYVLERIDRKLKS---KDEIRQVYPY-RVLGEIPL
B0BZC6          LPSYPNIPSFLVLGMMAAVALSAGVTLSAEGMDGRLRD---LESIAENTNV-PVLGVIPK
A0A6P0M090      KPLGDKKLKVLALGVMLGVTLATTAVLLLEMRDRSIKT---LKEVKQLLRY-PVLGVIPV
A0A563VX16      QISPNITQDLVLGGIVSVFLGAVSVVIMEASDNKIRVS----RQLQEKVNF-PLLGTTPG
A0A6G3Z709      NPVASNSRLYVIAGGFVGVLMAIAVAFLLDLLDSSIKTVKEIKEL--FAGY-TLLGIIPL
A0A0V7ZGW0      KPTSPKKSLIAIGGILTSVFASLALILFSESRNPLLKQ----KDLQ-DIEL-PLLARIPI
A0A355DPN1      QMGPDTRRDLMLSVVVGLFLGGLAAFGREALDDAVHSS----EELKRQVAL-PLLGIIPE
A0A0V7ZMP6      EASSPNIQLIILGAVLISIFGSVAIILLQERRDPLISP----KDIQ-QKNF-PVLASVPY
A0A433W046      RPSIPNLRLITTGGILAAIFGSMALIFFLENRNPLLKP----KDLQ-QVEL-PVLGSIPH
K9TU02          RPSIPNLRLITTGGILAAIFGSMALIFFLENRNPLLKP----KDLQ-QVEL-PVLGSIPH
A0A2P8QV10      RPSIPNLRLITTGGILAAIFGSMALIFFLENRNPLLKP----KDLQ-QVEL-PVLGSIPH
A0A6J4NIB3      APKGNKRWLIVLGGTLASFLGSAALLLFLESRKPLLSP----RDLQ-QVEF-PLLGRIPR
A0A6P0VB93      EPSGPGRLPIALGTILASAFGSVALILFLENRDPLLSP----KDLQ-AISI-PVLRSIPP
A0A6P0W0Y0      EPSGPGRLPIALGTILASAFGSAALILFLENRDPLLSP----KDLQ-AISI-PVLRSIPP
A0A846BJ08      EPSGPGRLPIALGTILASAFGSVALILFLENRDPLLSP----KDLQ-AISI-PVLRSIPP
A0A6M0AB25      KPSGPGRRPIALGTILASMFGSAAIVLFLESRNPLLSL----QDLQ-ATNL-PILRSIPY
A0A1D8TTM0      KPSGPGRRPIALGTILASVFGSAAIVLFLESRNPLLSL----QDLQ-AISI-PVLRSIPP
A0A846GII1      KPSGPGRRPIALGTILASVFGSTAIVLFLESRNPLLSL----QDLQ-ATNF-PVLRSIPY
B8HQ70          RPE-PRRMLIILGGLMAIAFGSSALVLLLESRNPLLSP----ADIQ-KVKQ-PILAKLPR
A0A2S6V636      KPEEPSKRAIALGGILAGLFGSISLIFFLEKRNPMLRP----KDLE-QVEF-PVLGRISR
A0A6P0IXR4      KPAGPKKLLIIANGFLASAVGSIALVLLLERRNPLLSP----KDLK-AIKF-PMVVNIPH
A0A845XP18      KPAGPKKLLIIANGFLASAVGSIALVLLLERRNPLLSP----KDLQ-AIKF-PMVVNIPH
A0A845ZT65      KPAGPKKLLIIANGFLASAVGSIALVLLLERRNPLLSP----KDLQ-AIKF-PMVVNIPH
A0A1D8TWE6      KPAGPKKLLIIANGFLASAVGSIALVLLLERRNPLLSP----KDLQ-AIKF-PMVVNIPH
A0A845WQ93      KPAGPKKLLIIANGFLASAVGSIALVLLLERRNPLLSP----KDLQ-AIKF-PMVVNIPH
A0A1D9G3S3      KPAGPKKLLIIANGFLASAVGSIALVLLLERRNPLLSP----KDLQ-AIKF-PMVVNIPH
A0A6P0KRF3      KPAGPKKLLIIANGFLASAVGSIALVLLLERRNPLLSP----KDLQ-AIKF-PMVVNIPH
A0A6P0LQ61      KPAGPKKLLIIANGFLASAVGSIALVLLLEQRNPLLSP----KDLQ-AIKF-PMVVNIPD
A0A6L9YP52      KPAGPKKLLIIANGFLASAVGSIALVLLLERRNPLLSP----KDLK-AIKF-PMVVNIPH
A0A6P0L3X9      KPAGPKKLLIIANGFLASAVGSIALVLLLERRNPLLSP----KDLQ-AIKF-PMVVNIPH
A0A6M0A6X4      KPAGPKKLLIIANGFLASAVGSIALVLLLERRNPLLSP----KDLK-AIKF-PMVVNIPH
A0A1U7N3U5      KPAGPKKLLIIANGFLASAVGSIALVLLLERRNPLLSP----KDLK-AIKF-PMVVNIPH
A0A6L9ZB93      KPAGPKKLLIIANGFLASAVGSIALVLLLERRNPLLSP----KDLK-AIKF-PMVVNIPH
A0A6P0S980      KPAGPKKLLIIANGFLASAVGSIALVLLLERRNPLLSP----KDLK-AIKF-PMVVNIPH
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
A0A846CZ70      KPAGPKKLLIIANGFLASAVGSIALVLLLERRNPLL-S---PKDLQAI-KF-PMVVNIPH
A0A846E3I8      KPAGPKKLLIIANGFLASAVGSIALVLLLERRNPLL-S---PKDLQAI-KF-PMVVNIPH
A0A355DU96      APVSPKKKLILVGGIVAGSLLYIVTAFVLDLMDPSIKT---AKEIRQLFKY-TWLGMIPE
A0A846A9P3      --------KLLVAGAGAGIFLGIAVAFFLDLIDRTVKT---VRDAEALFGY-TLLGVIPK
A0A5B8NQW4      -----------------------------------MKT---VQEIKDKLGY-TLLGSIP-
A0A6P0XUL2      ------------------LLAGAGAATLAEKLDNKFHS---PDELKQSTGL-PILGTIPF
                                                                            

A0A846FUP5      LSSVK---------KSDRSLVVVKDLSEVASES-------------------FRGIFSQF
A0A6P0ITZ8      IPAQA----------------LSLEQPKRFLAD-------------IRLMEPYRLLLTTM
A0A6P0SLN0      FKHLV----------------LDVDPSFGTAME-------------------FQRLASAV
A0A2T1DKP1      LNGKP-----------------VRQRSHFEGTAHPIPRVYVRELPFSSAAEAYQMLQANL
A0A2T1CC83      EPPMY-----------QGKIVTRDEPDSFSSEV-------------------YRMIQANL
A0A0D6KL48      AEKAK-----GSEGVGEVELPVLNNPYSPVSSA-------------------FEMLQTNL
A0A1B7WWU1      HGEKN----PKNPQEGRQELPLLDDPYSPVSTS-------------------FEMLQTNL
A0A328V843      FAAPPFYRYLTGGDRSSVQVPVVDTPGSLISEI-------------------YRMIQANL
A0A2N6LHT1      LPGHA----------------IALEPSAQFLDH-------------VGLVEPYRTLFKNL
A0A2T1EZA0      LPLEP-------------------------GVDIATSISKMSSSERFAIKESLRSLFTTF
A0A6M0AN00      LPEGK----------------ISKPVLNLSLSQSERALPMMELLGWRPFQEALDMIYVNI
A0A1U7JBN8      APALQ-----------KQPLLMVPNLSATMADVLTQNQSPHKLYTSFSFAEAFYSLEANL
A0A2W4VXF4      APALQ-----------KQPLLMVPDLTATMADVLTQNQSPDNLYTSFSFAEAFYSLDTNL
A0A2W7AI98      APALQ-----------KQPLLMVPDLTATMADVLTQNHSPDNLYTSFSFAEAFYSLDTNL
A0A2P8QVH5      LPNFELKKPSIALPFFKQQSLTSQRIQALNWFPFR---------------ESMDLIYQNI
A0A433W4W4      LPNFELKKPSIALPFFKQQSLTSQRIQALNWFPFR---------------ESMDLIYQNI
K9U5W1          LPNFELKKPSIALPFFKQQSLTSQRIQALNWFPFR---------------ESMDLIYQNI
L8M1L4          LPLLG------AVPQVFDPLIVIEDNTVKQSYSYRYSSFTESLRAI-----AMNISYTVV
A0A7G8GTF0      VPVLN------KLKSFSISKIDNDQNGPSDRIMINLFGSAKNVDSLIEYENSFRKLYSII
A0A7G8H3H8      LPVLN------NLKSFTFSRVKIDQDNLNQRVMINLSDLPEDVDSLVEFENSFRKLYSII
A0A4P5VLH9      LPLES------GVDVST----SISKMSASERFAIK---------------ESLRSLFTTF
A0A2W6ZN45      LPIVS------SDSILK----SLKELPGTERFAIK---------------ESLRSLFTTF
A0A081GP61      LPLEP------GVDIAT----SISKMSSSERFAIK---------------ESLRSLFTTF
K9P6R9          LPLEP------GVDIAT----SISKMSSSERFAIK---------------ESLRSLFTTF
A0A6G3Z347      EKLLEN-EQSLALSISQLSQ----MGFAMNLFPSQQEPSDSHKPTFTPFLESFRILATNI
A0A7T1IAR0      LPFFQGVAETGRFQVEELDRDSASLGSMAGPYLTGSTPGAQVYQRFA-YKEAFRNLYTSL
A0A6P0S1R8      FKHLV----------------LDIDPSFGTAIE-------------------FQRLASAV
A0A0A2B4S6      IESFVNLRENNESIFNVEDKLNATKNEKSSESY-----------------LGYQRFFYQE
K9SGV8          FKKVPLFPVASGNRIGRTVPELVVREAPNSPIS-----------------EAFRMLQTNL
B0CA08          FDESE---------AESLKLPTLSDPASHLSEA-------------------YRMLQSSL
B0BZC6          QKNSRLFPSLPFAELYNNLPLLESVRALSKNIE-------------------YKN-----
A0A6P0M090      FKHKKLSRRRDDLFFGGELPVTEQPHSMVSEV--------------------YRMIQANL
A0A563VX16      LSKIK-------------------DSQFSVRLP-------------------FFSGNDQE
A0A6G3Z709      VKEPTRSETEAIGDQSYPRLLVNQPTHIRVREA-------------------YQMLQANL
A0A0V7ZGW0      FKSAP----------------LGLTMESDAQIP-------------------FQRLASTI
A0A355DPN1      LPRTG-------------------GSGLLVHLP-------------------FRRTQVAA
A0A0V7ZMP6      MKGLD----------------TSMGEGINEKVE-------------------FQRLASAI
A0A433W046      LKQPS----------------MERNLAAEIDIE-------------------FQRLASSI
K9TU02          LKQPS----------------MERNLAAEIDIE-------------------FQRLASSI
A0A2P8QV10      LKQPS----------------MERNLAAEIDIE-------------------FQRLASSI
A0A6J4NIB3      LKRPD----------------MERILEADVEIE-------------------FNRLAAAV
A0A6P0VB93      FKHLV----------------LDIDPSFGTAIE-------------------FQRLASAV
A0A6P0W0Y0      FKHLV----------------LDIDPSFGTAIE-------------------FQRLASAV
A0A846BJ08      FKHLV----------------LDIDPSFGTAIE-------------------FQRLASAV
A0A6M0AB25      FKHLV----------------VNIAPRVETEIE-------------------FQRLASAV
A0A1D8TTM0      FKHLV----------------LDVDPSFGTAIE-------------------FQRLASAV
A0A846GII1      VKHLV----------------VGVPSRVETEIE-------------------FQRLASAV
B8HQ70          LKAPS----------------QVWNLDAEPLLG-------------------FHRLASAI
A0A2S6V636      LKRAD----------------MERNLSGEVAIE-------------------LQRLASAV
A0A6P0IXR4      LRHAG----------------MGLELGTETDVE-------------------FQRLASVI
A0A845XP18      LRHAG----------------MGLELGTETDVE-------------------FQRLASVI
A0A845ZT65      LRHAG----------------MGLELGTETDVE-------------------FQRLASVI
A0A1D8TWE6      LRHAG----------------MGLELGTETDVE-------------------FQRLASVI
A0A845WQ93      LRHAG----------------MGLELGTKTDVE-------------------FQRLASVI
A0A1D9G3S3      LRHAG----------------MGLELGTETDVE-------------------FQRLASVI
A0A6P0KRF3      LRHAG----------------MGLELGTETDVE-------------------FQRLASVI
A0A6P0LQ61      LRHAG----------------MGLELGTETDVE-------------------FQRLASVI
A0A6L9YP52      LRHAG----------------MGLELGTETDVE-------------------FQRLASVI
A0A6P0L3X9      LRHAG----------------MGLELGTETDVE-------------------FQRLASVI
A0A6M0A6X4      LRHAG----------------MGLELGTETDVE-------------------FQRLASVI
A0A1U7N3U5      LRHAG----------------MGLELGTETDVE-------------------FQRLASVI
A0A6L9ZB93      LRHAG----------------MGLELGTETDVE-------------------FQRLASVI
A0A6P0S980      LRHAG----------------MGLELGTETDVE-------------------FQRLASVI
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      --------------------------MSFLPVR---------DAPRSPLSESFRMLQANL
A0A846CZ70      LR--------HAGMGLELGTETDV---------------------------EFQRLASVI
A0A846E3I8      LR--------HAGMGLELGTETDV---------------------------EFQRLASVI
A0A355DU96      SR--------KKGLFWQQKINGNVPQLVVRDVP---------HGITS---EAYRMLEANL
A0A846A9P3      SDIDSEELPILNDLSLQKSNQQISPRIVTFDAS---------STSSSFVYGAYQMLQANL
A0A5B8NQW4      ---------------LFGKQASELP-M-----Q---------DQPRSAVSEAFRMLQANL
A0A6P0XUL2      QK------------ELKDRKKSNIPQM-----E---------PLATSPCWEACLSLQTNI
                                                                            

A0A846FUP5      EIL-----------------------ESGNTNGIIMVTSTLPNEGKSLIASNLAATFANH
A0A6P0ITZ8      ELR------------------------AQKRLQLIVVSSAVSGEGKSVVASHLAAVSARF
A0A6P0SLN0      SMK-------------------------PIENRRLMISSATSGEGKTTVTLGLASALITL
A0A2T1DKP1      RFL-----------------------RSDKEIKTVVVTSSVAQEGKSEVAANLAASMAQV
A0A2T1CC83      KFL-----------------------TNDKPPKVILVTSSVPEEGKSTVTANLAAAISQL
A0A0D6KL48      SFS-----------------------ISDKMLKVIAISSSIPGEGKSFVAANLAVAVAQL
A0A1B7WWU1      GFT-----------------------VSDKELRVILVTSATPGEGKSFVAANLALAGAYV
A0A328V843      KFL-----------------------GSDRKVRVIVVSSSVPQEGKSTVSANLAAAIAQL
A0A2N6LHT1      EFR------------------------SSEPLRSIVVSSTITGEGKSVVGSHLAAISAML
A0A2T1EZA0      RLL-----------------------RADNNIRMVGITSSTQGEGKSTAVAVFSRTLADL
A0A6M0AN00      QLL-----------------------NPGSEWKSLMVTSALSGEGKSTLALGLALSAARL
A0A1U7JBN8      RML-----------------------SSDTPIQVVALTSSEPGEGKSTICAHLAIAAANM
A0A2W4VXF4      RML-----------------------SSDTPMQVIALTSAVPGEGKSTICAHLAIAAANM
A0A2W7AI98      RML-----------------------SSDTPMQVIALTSSVPGEGKSTICAHLAIAAANL
A0A2P8QVH5      QIL-----------------------GSPLSFKSLLLTSALTGEGKSTLAAGMALSVARL
A0A433W4W4      QIL-----------------------GSPLSFKSLLLTSALTGEGKSTLAAGMALSVARL
K9U5W1          QIL-----------------------GSPLSFKSLLLTSALTGEGKSTLAAGMALSVARL
L8M1L4          D---------------------------TRKIKSLVTTSSTSSEGKTTVTYNLALALTEL
A0A7G8GTF0      KFV-----------------------HYDKNIKSIVFTSSVASEGKSLIVSSFAIFLSQL
A0A7G8H3H8      KFV-----------------------HYDKDLKSIVFTSSVTSEGKSLLVSSFAIFLSQL
A0A4P5VLH9      RLL-----------------------RSDRDIRLVAVTSSTQGEGKSTAVTIFARTLADL
A0A2W6ZN45      RLL-----------------------RADREIRLVVITSSTQNEGKSTAASVFGNTLADL
A0A081GP61      RLL-----------------------RADNNIRMVGITSSTQGEGKSTAVTVFASTLADL
K9P6R9          RLL-----------------------RADNNIRMVGITSSTQGEGKSTAVAVFSRTLADL
A0A6G3Z347      ELS-----------------------NPDDPVRTLAITSAIPNMGKSTVTFHLAHAIAAT
A0A7T1IAR0      RFL-----------------------STDQKLLTVGLTSSTPGEGKSLVNVLLAKTVSEM
A0A6P0S1R8      SMK-------------------------PLKNRRLMITSATAGEGKTTITLGLASGLITL
A0A0A2B4S6      AFR--------------GMYTSIKFINTQNSLKILSISSCIPSEGKSLISTMFAKTISEL
K9SGV8          KFL-----------------------SLKKRLKVIVVTSSVPREGKSTIAANLAATIAEL
B0CA08          KFH-----------------------GLEHSPRVLMMTSAINQEGKSTTCANLAVSLAQM
B0BZC6          ----------------------------STESKVLVITSAISGEGKSFVATNLAVLSAML
A0A6P0M090      KFL-----------------------RSDHPLKVIVVTSSVSKEGKSTVSANLAAAMAQL
A0A563VX16      TIPLQVIEWLPFRESLDLVYENIQLMSQNSLINSIAITSSIAGEGKSTITLGLALSAARR
A0A6G3Z709      KFL-----------------------QSDNELQTVVISSAVPGEGKSEVSANLAAALAQV
A0A0V7ZGW0      SLM-------------------------SLENHRLMVTSSTAGEGKTTVTLGLAKALMVL
A0A355DPN1      ASTLPMVYWLPFRESLDLIYKHIQLLNSAATLRSIVVTSALPSEGKSTFVVGLAFSAARL
A0A0V7ZMP6      SLL-------------------------HLENKSLMIASANSGEGKTTVTLGLANALLEL
A0A433W046      LML---------------------------EHPCLMVTSATAGEGKTTVTLGLALALVNF
K9TU02          LML---------------------------EHPCLMVTSATAGEGKTTVTLGLALALVNF
A0A2P8QV10      LML---------------------------EHPCLMVTSATAGEGKTTVTLGLALALVNF
A0A6J4NIB3      SSL-------------------------MLDSDRLMVASSMYGEGKTTVTLGLALALVKL
A0A6P0VB93      SMK-------------------------PLKNRRLMITSATAGEGKTTITLGLASGLITL
A0A6P0W0Y0      SMK-------------------------PLKNRRLMITSATAGEGKTTITLGLASGLITL
A0A846BJ08      SMK-------------------------PLKNRRLMITSATAGEGKTTITLGLASGLITL
A0A6M0AB25      SMK-------------------------PLKNRRLMIASATSGEGKTTVTLGLASALITL
A0A1D8TTM0      SMK-------------------------PLKNRRLMISSATSGEGKTTVTLGLASALITL
A0A846GII1      SMK-------------------------PLKNRCLTIASATSGEGKTTVTLGLASALITL
B8HQ70          SFL-------------------------DLATPRLMITSAMYGEGKTTIAIGLAAALARL
A0A2S6V636      LML---------------------------EHQRLLVTSSTSGEGKTTVTLGLALALVNF
A0A6P0IXR4      SLR-------------------------SGEDRRILITSAMVSEGKTTVTLGLATALVDL
A0A845XP18      SLR-------------------------SGEDRRILITSAMVSEGKTTVTLGLATALVDL
A0A845ZT65      SLR-------------------------SGEDRRILITSAMVSEGKTTVTLGLATALVDL
A0A1D8TWE6      SLR-------------------------SGEDRRILITSAMVSEGKTTVTLGLATALVDL
A0A845WQ93      SLR-------------------------SGEDRRILITSAMVSEGKTTVTLGLATALVDL
A0A1D9G3S3      SLR-------------------------SGEDRRILITSAMVSEGKTTVTLGLATALVDL
A0A6P0KRF3      SLR-------------------------SGEDRRILITSAMVSEGKTTVTLGLATALVDL
A0A6P0LQ61      SLR-------------------------SGEDRRILITSAMVSEGKTTVTLGLATALVDL
A0A6L9YP52      SLR-------------------------SGEDRRILITSAMVSEGKTTVTLGLARALVDL
A0A6P0L3X9      SLR-------------------------SGEDRRILITSAMVSEGKTTVTLGLARALVDL
A0A6M0A6X4      SLR-------------------------SGEDRRILITSAMVSEGKTTVTLGLARALVDL
A0A1U7N3U5      SLR-------------------------SGEDRRILITSAMVSEGKTTVTLGLARALVDL
A0A6L9ZB93      SLR-------------------------SGEDRRILITSAMVSEGKTTVTLGLARALVDL
A0A6P0S980      SLR-------------------------SGEDRRILITSAMVSEGKTTVTLGLARALVDL
A0A1Q8BLE0      ----------------------------MRAVSRIVITSPGPEEGKSTTAANLAIAFAQQ
A0A2T2S1W0      RFS-----------------------QADRRLQAIAVASSVPGEGKSTLVANLGLALAEV
A0A846CZ70      SLR-----------------------SGED--RRILITSAMVSEGKTTVTLGLATALVDL
A0A846E3I8      SLR-----------------------SGED--RRILITSAMVSEGKTTVTLGLATALVDL
A0A355DU96      KFL-----------------------SPDQVLKRIVVTSSVAQEGKSTVSANLAIAMAQV
A0A846A9P3      KFM-----------------------SSDKKNRAIAITSSVPKEGKSEVSANLAAALAQN
A0A5B8NQW4      KFS-----------------------RVDEKLKVIVVTSSVPNEGKSTVTGNLGLALAEL
A0A6P0XUL2      SFV-----------------------SPDTPLRYIVISSAVPSEGKSTIALYLAQAAAAI
                                                  :  :*     **:     :.      

A0A846FUP5      GKRSLLIDFDFRRPSLHGNFEIKNSHGSLKWLKDPSSNLDSVLEDPHLGILEYC-PNFYL
A0A6P0ITZ8      SRRTLIIDADWRHPMQHNLFGLPP-QPKVKDLMDSNQTCLEAVQPTAIA-------NLSI
A0A6P0SLN0      GFRVLVVDGDFRKAELSQRLGCDR-----------YAISEVPSTPVQIR----S--GLDL
A0A2T1DKP1      GRRVLLVDADMRYPVQHHVWDLVS-TIGLSNVIVEQF--VPDVAIQEVA----P--NLYA
A0A2T1CC83      GRSVLLVDADLRRSSQHHLWGVDN-QKGLKDIVVDNVS-PLSVIRQPMP-------KLSL
A0A0D6KL48      GRRVLLVDADMRRPRQHKIWEQNN-LVGLSNILVGQTELQTTSKEALMT--------LDI
A0A1B7WWU1      GKRVLLVDADMRRPRQHRVWEIHN-LLGLSNILAGQT--QLKNAVQEVS----P--LVKM
A0A328V843      GHRVILIDGDMRQPIQHHIWGLTN-AVGLSDVLVEEATLSEAVKP--------GIDQLDI
A0A2N6LHT1      SRRTLLIDADLRRPILHTLFNLAP-RPGITDVIDSERSLEETVQRTNIP-------NLSV
A0A2T1EZA0      GLRVLVIDSDMRLPMQARYLGVEQ-GDGLSTLLSDSSRKPTDFIHSIAE-------NMDV
A0A6M0AN00      HRRVLLIDVDMRRPRLHQQLGLSN-YEGLSTLLEDDTATPSPVSISPLG----S--TIDV
A0A1U7JBN8      GRRVLLIDSDLRKPSQHLIFGHAN-RQGLSDLITQPLD-DPMDLVQVIP----GNPNLHL
A0A2W4VXF4      GRRVLLIDGDLRKPSQHLIFSQRN-HQGLSELITQGLE-NPTDLVLAIP----GNPNLHL
A0A2W7AI98      GRRVLLIDGDLRKPSQHLIFSQRN-HQGLSELITQGLE-NPTDLVLTIP----GNPNLHL
A0A2P8QVH5      QRRVLLIDADLRRSNIHKLLNLSN-DRGLSTLLTEEADVRERDCIQSVQ----P--SLDV
A0A433W4W4      QRRVLLIDADLRRSNIHKLLNLSN-DRGLSTLLTEEADVRERDCIQSVQ----P--SLDV
K9U5W1          QRRVLLIDADLRRSNIHKLLNLSN-DRGLSTLLTEEADVRERDCIQSVQ----P--SLDV
L8M1L4          DAKVLVVDADLRKPKIHKMAKISN-EQGLSEVISDN-KHSWTEVVQNVT----G--NLDV
A0A7G8GTF0      GRKVLLIDGDFRKPRLHRLLNIKL-ENGFSNLLDDN-SLQFKDVTNKIS----NFDNLDL
A0A7G8H3H8      GRKVLLIDGDLRKPRLHTLLNLKL-EKGFSDLLDDD-NYNLAKVTKKIG----DVENLDF
A0A4P5VLH9      GLKVLVVDADMRLPMQTRYLGLAN-GEGFSTILTNS-SVPLKSLIQPIQ----D--NLDI
A0A2W6ZN45      GLHVLLVDADMRLPVQHKHFAVDN-VKGLSDYLGDT-DDNIQDYIKPIT----S--NLSL
A0A081GP61      GLKVLIIDSDMRLPMQTRYLGVEP-GDGFSTLLSDS-SRKTTDLIQTIA----E--NMDV
K9P6R9          GLKVLVIDSDMRLPMQARYLGVEQ-GDGLSTLLSDS-TRKPTDFIHSIA----E--NMDV
A0A6G3Z347      GKRVLMMDTDLRRPTLHKLCNASN-DKGLSNYVTG--EFNPEDILIDLP----LEPGLFL
A0A7T1IAR0      GQRVLLIDADMRKPQVHLRLGLNN-LLGLSSLLTE--DDHWGKALVPVP----GYENWWV
A0A6P0S1R8      GFRVLVVDGDFRKAHLSQQLGYTP-SPAL----------EGQSMPVQVR----A--GLDL
A0A0A2B4S6      GLSVLLIDTDLRKPQVHARLGLDNLIGFSNLLIDSSDNYKKYIQSVPTQ----D--NFDV
K9SGV8          GQRVLLVDADMRHPAQHRIWQLPN-ENGLSDLL------TGQSPLSEVAHHVMP--TLEV
B0CA08          NHRVLLIDADIRLASQHQIWELGNQEGLTHILLNKHFNYHQELPTHKVA----D--NLEI
B0BZC6          SKRTLLIDADMRRPSIHKIFQLPQ-DPGLQDYLRGS---VKEGLPAAIHRTSVK--NLSV
A0A6P0M090      GRRVLLIDSDMRHPSQHYIWQVMN---VAGLSQVLIGEVPIELAICKAM----E--NLDI
A0A563VX16      RKKVLVIDGDLRCPTLHEKLDISN-GVGLSDLLDGVTSVPTVQEISRAG----S--TISV
A0A6G3Z709      GRRVLLIDADMRYPRQHHALKVLN---TVGLSHVITGQAKVKSAIQTVT----R--NLDV
A0A0V7ZGW0      GFRVLMVDGDFRKAKLSRQFGHVM-H-PQS---------NDLPQPMQIS----P--GLDI
A0A355DPN1      HQRVLLIDADLRRPSLHKQLNLPN-EQGLATLLVEDSSIPSPQRLSLSG----S--EIDV
A0A0V7ZMP6      GFRILIVDADFRKCELTQSLGYYG-Q-SIG---------DLQLRPINVF----E--NVDL
A0A433W046      GFRVLVIDGDLRKAEMSRRLGKNRIKSAAN---------ASPPMPVSVS----P--GFDL
K9TU02          GFRVLVIDGDLRKAEMSRRLGKNRIKSAAN---------ASPPMPVSVS----P--GFDL
A0A2P8QV10      GFRVLVIDGDLRKAEMSRRLGKNRIKSAAN---------ASPPMPVSVS----P--GFDL
A0A6J4NIB3      GFRVLVVDGDLRRADLSQRLGHPQ-A-KIG---------DAKVMPIPIY----R--GLDL
A0A6P0VB93      GFRVLVVDGDFRKAHLSQQLGYRP-S-PTL---------EEQSMPVQVR----A--GLDL
A0A6P0W0Y0      GFRVLVVDGDFRKAHLSQQLGYTP-S-PAL---------EGQSMPVQVR----A--GLDL
A0A846BJ08      GFRVLVVDGDFRKAHLSQQLGYTP-S-PAL---------EGQSMPVQVR----A--GLDL
A0A6M0AB25      GFRVLVVDGDFRKAELSQRLGCDR-F-AMS---------EVPSAPVQIR----S--GLDL
A0A1D8TTM0      GFRVLVVDGDFRKAELSQRLGWDR-Y-AMS---------EVPSTPVQIR----P--GLDL
A0A846GII1      GFRVLVVDGDFRKAELSQRLGCDR-Y-PMS---------KAPLTPVQIR----P--GLDL
B8HQ70          GFKILLVDGDLRRARLTEQLSDRY-QGSWN---------PRETAVVPLS----P--GLDL
A0A2S6V636      GFRVLIVDGDLRQAELSQRLGQPQ-K-KLK---------DGQPSPVSVC----L--GLDL
A0A6P0IXR4      GFRVLVVDGDFRQATLSQRLGHHH-D-PLK---------PGQ--PVKIQ----P--SLDL
A0A845XP18      GFRVLVVDGDFRQATLSQRLGHHH-D-PLK---------PGQ--PVKIQ----P--SLDL
A0A845ZT65      GFRVLVVDGDFRQATLSQRLGHHH-D-PLK---------PGQ--PVKIQ----P--SLDL
A0A1D8TWE6      GFRVLVVDGDFRQATLSQRLGHHH-D-PLK---------PGQ--PVKIQ----P--SLDL
A0A845WQ93      GFRVLVVDGDFRQATLSQRLGHHH-D-PLK---------PGQ--PVKIQ----P--SLDL
A0A1D9G3S3      GFRVLVVDGDFRQATLSQRLGHDH-D-PLK---------PGQ--PVKIQ----P--SLDL
A0A6P0KRF3      GFRVLVVDGDFRQATLSQRLGHDH-D-PLK---------PGQ--PVKIQ----P--SLDL
A0A6P0LQ61      GFRVLVVDGDFRQATLSQRLGHDH-D-PLK---------PGQ--PVKIQ----P--SLDL
A0A6L9YP52      GFRVLVVDGDFRQATLSQRLGHHH-D-PLK---------PGQ--PVKIQ----P--SLDL
A0A6P0L3X9      GFRVLVVDGDFRQATLSQRLGHHH-D-PLK---------PGQ--PVKIQ----P--SLDL
A0A6M0A6X4      GFRVLVVDGDFRQATLSQRLGHHH-D-PLK---------PGQ--PVKIQ----P--SLDL
A0A1U7N3U5      GFRVLVVDGDFRQATLSQRLGHHH-D-PLK---------PGQ--PVKIQ----P--SLDL
A0A6L9ZB93      GFRVLVVDGDFRQATLSQRLGHHH-D-PLK---------PGQ--PVKIQ----P--SLDL
A0A6P0S980      GFRVLVVDGDFRQATLSQRLGHHH-D-PLK---------PGQ--PVKIQ----P--SLDL
A0A1Q8BLE0      GHRVLLVDCDLRRTRIHKIFDETN-LPGLTSVLVGGETIASAIR-QTRV----P--GLNI
A0A2T2S1W0      GQHVLIVDADLRNPSQHGIWEYAN-AVGLSNLLVGESSLEQACH--PAS----E--GLDL
A0A846CZ70      GFRVLVVDGDFRQAT------LSQ-RLGHHHDPLKPGQ----PV--KIQ----P--SLDL
A0A846E3I8      GFRVLVVDGDFRQAT------LSQ-RLGHHHDPLKPGQ----PV--KIQ----P--SLDL
A0A355DU96      GRRVLLVDADMRHPMQHHIWDLAN-TVGLSEVIVHQTQFEFAVR--EVM----D--NLDV
A0A846A9P3      GDRVLLVDADMRSPSQHHLWGLVN-SVGLSHVLVGEGKLDAAIQ--TIS----Q--NLFV
A0A5B8NQW4      GNRVLIVDGDMRRPSQHQVWEEPN-SMGLSNLLVDQSDVSTVTK--ELH----P--NLEL
A0A6P0XUL2      GKKVLLVDADLRRPQVHVRTDLPN-TWGLSNLIFSNIDLSQAIQVAPFE----E--NLSI
                    :::* * *                                                

A0A846FUP5      LRTGGINRKPT-ELFNQEKLNSLLVKLKE---QFDVVILDTPPVG-LFPDALLLAQKANF
A0A6P0ITZ8      LTCSDQPSGPA-TFLQSQVMKSILAAAGD---HYDLVIVDTPPVS-SFADAHTLSRYSDG
A0A6P0SLN0      LSLRP-DEDKIAEFVARGSFEECLSSAQA-TGHYDYILIDSAPVS-LNSEAALMATVVPN
A0A2T1DKP1      LPSGIIPPNPI-ALLDSKRMASLVEGFAR---DYDLIIFDTPPLA-GKADAAILGKMTDG
A0A2T1CC83      LTSGMVESNPL-AILDSPKMSDFIGRSRR---EYDLILIDVPPLP-VTADVLTVSKLVDG
A0A0D6KL48      ITAGTIPPNPA-ALLNSQRIATFIKEATQ---EYDFVIIDCPPLT-LVADALMLSKLVDG
A0A1B7WWU1      LPAGKIPPNPV-TLLDSQCMADLVEEASK---DYDFVIIDTPPLT-AVTDPLIVGKYVDG
A0A328V843      LTAGVTPPNPL-ALLDSRRMTSLIRNFSE---EYDFVIIDTPPLL-LAADALTLANMASG
A0A2N6LHT1      LTCGELYRLPSHLLESEAMKSLLIEAVRQ----YEFVVIDTPPLS-ACADAHTLGRQSDG
A0A2T1EZA0      LPAGPKPPDPA-KLLNSSRCKEIMEEIRA-LPGYDIIIVDAPPCL-MLADPILLGEKLDG
A0A6M0AN00      LTAGPTPIDPV-KLLGSKRMKNLMAEFQE---TYDLVLLDTPPVL-GMVDALQAASLCQG
A0A1U7JBN8      LTAGARPPAPG-RLLSSRKMQQIAEQYRC---HFDLIILDTPPLAGGMVDAKLAAAHADG
A0A2W4VXF4      LTAGARPPPPG-RLLSSRKMQQITEQYRR---HYDLIIFDTPPLA-GMIDAKLTAAHADG
A0A2W7AI98      LTAGARPPPPG-RLLSSRKMQQITEQYRR---HYDLIIFDTPPLA-GMIDAKLTAAHADG
A0A2P8QVH5      LTAGPTPTDIV-KLLSSQRMKHLIESFEQ---SYDLVLVDAPPIL-GLADASIVASLCSG
A0A433W4W4      LTAGPTPTDIV-KLLSSQRMKHLIESFEQ---SYDLVLVDAPPIL-GLADASIVASLCSG
K9U5W1          LTAGPTPTDIV-KLLSSHRMKHLIESFEQ---SYDLVLVDAPPIL-GLADASIVASLCSG
L8M1L4          ITAGANVANPI-ALL---RSQIMSELLKEWEAAYDYVLIDTPPIG-AMADAQSLVHQVDG
A0A7G8GTF0      IPAGNSLTEPT-LLFSSTRLKILMDLLHD-STSYDFILIDTPPAL-ICSDASMITRYCST
A0A7G8H3H8      ISAGLSLTEPT-ILFSSPRLQLLINSINE-SSSYDYILIDTPPSL-ICSDASLITRCCST
A0A4P5VLH9      LPAGPKPPDPA-KLLNSTRAQEVVNEIRA-LTEYDMVLFDAPPCL-MLSDPILLGEKLDG
A0A2W6ZN45      ITAGSRAPDPA-RLLNSLRCSDMVQHLRA-LPGYDLIIFDTPPCL-LLSDPVILGEKVDG
A0A081GP61      LPAGPKPPDPA-KLLNSSRCKEIMDEIRA-LPGYDIIIVDAPPCL-MLADPILLGEKLDG
K9P6R9          LPAGPKPPDPA-KLLNSSRCKEIMEEIRA-LPGYDIIIVDAPPCL-MLADPILLGEKLDG
A0A6G3Z347      LPSGPIPPDPM-KILTAQRIRNLFDYLDR---EFDFIIFDTPPLL-GFADAFIIAANTKG
A0A7T1IAR0      IPAGRRPPDPT-RLLSADRMKELIRDISQ-SGQFDLILFDTPPVL-GMADTALLTQHLDG
A0A6P0S1R8      LSIRP-HEDKIAEFVARGDFEQALNVAQA-AGDYDYVLIDSAPVS-VTSETVLMASVTSA
A0A0A2B4S6      ITSGSIPPDPT-RLLGSDSMKKFIETIRS-ENKYDYVILDTSPIL-SISDSTLIAQYCDS
K9SGV8          MPAGSKPANPVALLNSQATSNL---IDYG-SSNYDVMIVDTPPMA-VAADASILGKIADG
B0CA08          ITAGRISSNPL-PMLESEQFANFVQVQIE-H--YDYILIDAPPLV-SVADPLIIGKVVDG
B0BZC6          MTSGKFSYDNVFSFETQRAKELFTEVQQH----YDVIVIDTPPVM-ACSDALVLSQEGRQ
A0A6P0M090      LTAGVMPPNPLALLDSK---QMASLIQEF-STQYDFVIIDAPPLL-LTADALCLSPMTDG
A0A563VX16      LTSGSATSDPV-KLLSSGRLQNLIAHFEK-T--YDLVLIDTPPAI-GMVDAIKIASSCSG
A0A6G3Z709      LTAGVVPPNPVA-LLDSKRMESLLQSLAQ-A--YEVVIIDAPPLV-SYADASILGKMAEG
A0A0V7ZGW0      LPTAPNQNNKVMEFVARGGFEKYLNTIQT-NGNYDYVIVDTAPVT-STSETALMAKVIAN
A0A355DPN1      LTAGPIPPDPV-KLLSSQRMRQLMAGFEQ-S--YDLILVDTPPIL-GMVDALQAASFCNG
A0A0V7ZMP6      LAM-RVPEERIAEFVARGGFEQRLNAIKN-SAQYDYILVDSPPVA-LTSEAAIIGKIIHN
A0A433W046      LPALSIPKQKIPEFFARGSFERNIKALRE-SGGYDYVLVDSPPVG-LASETNLMSAVVCN
K9TU02          LPALSIPKQKIPEFFARGSFERNIKALRE-SGGYDYVLVDSPPVG-LASETNLMSAVVCN
A0A2P8QV10      LPALSIPKQKIPEFFARGSFERNIKALRE-SGGYDYVLVDSPPVG-LASETNLMSAVVCN
A0A6J4NIB3      LPAPAIAKDHIAEFFAQGRFEQQLSEIQD-SSNYDYVLVDSAPVS-LTIEPALMSAAVPN
A0A6P0VB93      LSLRP-HEDKIAEFVARGDFEQALNVAQA-AGDYDYVLIDSAPVN-VTSETVLMASVTSA
A0A6P0W0Y0      LSIRP-HEDKIAEFVARGDFEQALNVAQA-AGDYDYVLIDSAPVN-VTSETVLMASVTSA
A0A846BJ08      LSIRP-HEDKIAEFVARGDFEQALNVAQA-AGDYDYVLIDSAPVS-VTSETVLMASVTSA
A0A6M0AB25      LSLRP-DEDKIAEFVARGSFEECLNSAQA-TGHYDYILIDSAPVS-LTSEAALMATVVPN
A0A1D8TTM0      LSLRP-DEDKIAEFVARGSFEECLSAAQG-SGHYDYILIDSAPVS-LTSEAALMASVVPN
A0A846GII1      LSLRP-DEDKIAEFVARGSFEECLSTAQA-SGHYDYILIDSAPVS-LTSEAALMATVVPN
B8HQ70          MPAPAIPNDRIVNYVAKGGFEQQLQTLQQ-SGEYDYVLVDTAPIT-LTSETGLMTTSVNN
A0A2S6V636      LPAPALSKGKIPEFFARGSFQQYLDQIQA-DGGYDYVLVDSPPIG-LASETNLMSSVVRN
A0A6P0IXR4      LPT-SHKKGKIVELVTQGKFEQSLATAEE-SGDYDYVLIDSAPVS-MTSETALMAAVIRN
A0A845XP18      LPT-SHKKGKIVELVTQGKFEQSLATAEE-SGDYDYVLIDSAPVS-MTSETALMAAVIGN
A0A845ZT65      LPT-SHKKGKIVELVTQGKFEQSLATAEE-SGDYDYVLIDSAPVS-MTSETALMAAVIGN
A0A1D8TWE6      LPT-SHKKGKIVELVTQGKFEHSLATAEA-SGDYDYVLIDSAPVS-MTSETALMAAVIPN
A0A845WQ93      LPT-SHKKGKIVELVTQGKFEQSLTTAEA-SGDYDYVLIDSAPVS-MTSETALMAAVIRN
A0A1D9G3S3      LPT-SHKKGKIVELVTQGKFEQSLATAEE-SGDYDYVLIDSAPVS-MTSETALMAAVIRN
A0A6P0KRF3      LPT-SHKKGKIVELVTQGKFEQSLATAEE-SGDYDYVLIDSAPVS-MTSETALMAAVIRN
A0A6P0LQ61      LPT-SHKKGKIVELVTQGKFEQSLATAEE-SGDYDYVLIDSAPVS-MTSETALMAAVIRN
A0A6L9YP52      LPT-SHKKGKIVELVTQGKFEQSLATAEE-SGDYDYVLIDSAPVS-MTSETALMAAVIRN
A0A6P0L3X9      LPT-SHKKGKIVELVTQGKFEQSLATAEE-SGDYDYVLIDSAPVS-MTSETALMAAVIGN
A0A6M0A6X4      LPT-SHKKGKIVELVTQGKFEQSLATAEE-SGDYDYVLIDSAPVS-MTSETALMAAVIRN
A0A1U7N3U5      LPT-SHKKGKIVELVTQGKFEQSLATAEE-SGDYDYVLIDSAPVS-MTSETALMAAVIRN
A0A6L9ZB93      LPT-SHKKGKIVELVTQGKFEQSLATAEE-SGDYDYVLIDSAPVS-MTSETALMAAVIRN
A0A6P0S980      LPT-SHKKGKIVELVTQGKFEQSLATAEE-SGDYDYVLIDSAPVS-MTSETALMAAVIRN
A0A1Q8BLE0      LPSGPLPPNPA-ELLGSAQMTALLDKL---SENYDLLILDTPPLL-AASDAAIVSRIVDG
A0A2T2S1W0      LTAGQVPPNPV-ALLDSQRLATLLQQW---RQAYDYVLLDVPPLQ-AATDAVIVGKLTDG
A0A846CZ70      LPTSHKKGKIV-ELVTQGKFEQSLATAEE-SGDYDYVLIDSAPVS-MTSETALMAAVIGN
A0A846E3I8      LPTSHKKGKIV-ELVTQGKFEQSLATAEE-SGDYDYVLIDSAPVS-MTSETALMAAVIGN
A0A355DU96      LPSGVIPPNSL-ALLNSKRMASLVEYF---SQKYDFVIFDTPPLV-LTADAMTLGKMTDG
A0A846A9P3      LTAGVVPPNPL-ALIDSERMKSLVQDF---LSQYEYVVFDTPPLT-GIADAAVLGTAVDG
A0A5B8NQW4      LTVGAPPPNPI-ALLDSQRIADFIDKC---RQAYDYVLIDTPPMA-VGADSALLGKLAEG
A0A6P0XUL2      LTSGQVPPNPT-RALSSQKMGSLLERL---QRRFDLIIFDTPPLT-GLADAKLLAPRTDG
                :                                :: ::.* .*      :          

A0A846FUP5      IFYVCRFNKVSMFKIKHFVDKLKET-NCKLAGLVLNGIPVGR---------ASGYYHYYG
A0A6P0ITZ8      LVMVTRPNFTQKDILLQTVSELKES-STPILGFVVNGITDQT------QQYYSDSFYSYQ
A0A6P0SLN0      ILLVVWPGKSNRNPFRDTLEQLMRH-RAQILGLVVNGVETKA----------EGYLYEHR
A0A2T1DKP1      ILLVVRPGIIDSASANAAKEFLKQS-GQNVLGMVINGVDVRS----------EPDSYFYH
A0A2T1CC83      ILFVTRPGIVEHESAELAQEALATT-GQKILGMVVNGVKANE-------FDRYSYHGRYG
A0A0D6KL48      ILLVVRPGVANTGSVNATKMLLEQS-GHQVLGMVANGVTPES-----------SYGGYYA
A0A1B7WWU1      LLLVVRPGKVEYSAVNAAKSLLTQA-KLPILGMVVNGIVKES-----------GYGGYYY
A0A328V843      VLMVARPRILDRDSAKAAKEILGRS-GQRILGTVINGISKNE---------STKYFYHAQ
A0A2N6LHT1      IILVTRPGFTIKEVLQRAVSELTHN-QIPIMGVVVNGITDQT----------ERYYRYAV
A0A2T1EZA0      ILFLVGLGKVSRELAPQASRRIRAS-GVDVLGIICNQVNFPS--------RLNDYGYEYG
A0A6M0AN00      VVMVGRLERVTQSQLTQATAILR---NLNLIGIIANGVKSSN----------QNYA-YYG
A0A1U7JBN8      LLLVARLNRSERTEIQRVLADLGNTVQAPLLGLVVNGVPHSR---------QSGYDYYYG
A0A2W4VXF4      LLLVVRLNQSERSEIQRVLADLGNTAQAPLLGLVINGVPQSR---------QRGYS-YYG
A0A2W7AI98      LLLVVRLNRSERSEIQRVLADLGNTAQAPLLGLVINGVPQIR---------QRGYS-YYG
A0A2P8QVH5      TVVVERLNRVTRFDLNQSLEAL--S-KLNVIGAIINESKECN-------SRYTVYDGTSQ
A0A433W4W4      TVVVERLNRVTRFDLNQSLEAL--S-KLNVIGAIINESKECN-------SRYTVYDGTSQ
K9U5W1          TVVVERLNRVTRFDLNQSLEAL--S-KLNVIGAIINESKECN-------SRYTVYDGTSQ
L8M1L4          VMLVTGINKVNQKAIVNTLEVLQSS-NCNLIGFIANMVEKDL----------DYYSYSYY
A0A7G8GTF0      SLYIVSLRNVKKNIAIKAIDDFTTV-YDNCLGAISNSTKFEL-------TSPDDYSKQYS
A0A7G8H3H8      SLYIVSLRNVKKNMAIEALKSFTES-NDKCLGIISNSTKFEL-------NSVDSYSKAYS
A0A4P5VLH9      ILFLVGLGKVSRELAPQACRRIKAT-GVDVLGLICNQVNFP--------SRLNDYGYEYG
A0A2W6ZN45      ILYLVGLGRVGREIAPQAIKRIKAT-GVDILGLMCNQVAYP--------TRLNDYGYEYG
A0A081GP61      ILFLVGLGKVSRELAPQASRRIKAT-GVDVLGIICNQVNFP--------SRLNDYGYEYG
K9P6R9          ILFLVGLGKVSRELAPQASRRIRAS-GVDVLGIICNQVNFP--------SRLNDYGYEYG
A0A6G3Z347      VLLTATLGQITFSQLQSALDELDIA-KIPVLGAVANGSQPEN-------VKSYNYYQYYQ
A0A7T1IAR0      LILLVSLDGVDRNLPKEALARISAT-GAPLLGLITNAIKEEE-------TSPNE--TLYQ
A0A6P0S1R8      ILLIVWPGKSNRNPFRDTIEQLVSH-KANILGLVVNGIETQT----------KSYS--YE
A0A0A2B4S6      LLMVVSLNNVDMDLPLLAKNKLKKT-NRPLIGFVSNQIKKPKTFSKNRYYGYSNYSNNYG
K9SGV8          IVMLCRVGVADTNNLTFSKELLEQS-GQNILGMVVNASLPED----------DPYGYYYS
B0CA08          ILLVARPGHLEREYAQKAHELLIHS-NLSVLGTVINGILNKN----------ELYS--YY
B0BZC6          TVVVARLDVTPKQVLNRSIDILNSN-NVNVVGLAINGVTAST----------DKYY-RYL
A0A6P0M090      LLLVARPGVLDFANANVAKQMLDSS-GQTVLGLVANGVIQKD----------ESIGYFYQ
A0A563VX16      TVVVARLEKANFAELMETYGLLGRI-N--VLGMVANDSREVQ----------QRYA---K
A0A6G3Z709      VLLVVRPGVVDYAQGRIAKEILAQS-NQRVLGMVANGVNPSN----------EPDGHFYY
A0A0V7ZGW0      VLPVIRLGISDRYMVQETIEQLMRH-NANIIGLALNGIEQRS----------EGYI--YK
A0A355DPN1      VVIVGRISRVTQSELTEAIAMLSHL-NA--IGIVANGANGST----------NRYIAYAE
A0A0V7ZMP6      ILFVVRTGISSRNCFHDSVEQLKRY-RAEVIGLTVNDVDSHN----------EKYIYSYN
A0A433W046      VLFVLRSGTSDRYPVMNSLEQLTRY-NARIMGLVVNGSDSHT----------SVYRYGYG
K9TU02          VLFVLRSGTSDRYPVMNSLEQLTRY-NARIMGLVVNGSDSHT----------SVYRYGYG
A0A2P8QV10      VLFVLRSGTSDRYPVMNSLEQLTRY-NARIMGLVVNGSDSHT----------SVYRYGYG
A0A6J4NIB3      VLYVVRPGISDRYSVADGFEQLMRG-NARITGLVVNGVDSRT----------EGYR--YG
A0A6P0VB93      ILLIVWPGKSNRNPFRDTIEQLVSH-KANILGLVVNGIETQT----------KSYS--YE
A0A6P0W0Y0      ILLIVWPGKSNRNPFRDTIEQLVSH-KANILGLVVNGIETQT----------KSYS--YE
A0A846BJ08      ILLIVWPGKSNRNPFRDTIEQLVSH-KANILGLVVNGIETQT----------KSYS--YE
A0A6M0AB25      VLLVVWLGKSNRNPFRDTLEQLMRH-KAQILGLVVNGVDTQP----------EGYF--YE
A0A1D8TTM0      VLLVVWLGKSNRNPFRDTLEQLMRH-RAQILGLVVNGVDTQP----------EGYL--YG
A0A846GII1      ILLVVWPGKSNRNPFRDTLEQLARH-RAEIIGLVVNGVDTQA----------ESYL--YG
B8HQ70          LLFVVRPGTSSRYSVLDSFEELSLR-KVNVVGVTINGIETNS----------EEYY--YG
A0A2S6V636      VLFVVRSGKSDRYAVMDGFEQLAQH-HAQIMGLVVNYVEPKD----------VGYR--YG
A0A6P0IXR4      LLFVVRPEISKRDFVSDSLEQLAQH-NAQLLGLVVNGVETKS----------KPYL--YR
A0A845XP18      LLFVVRPEISKRDFVSDSLEQLAQH-NAQLLGLVVNGVETKS----------KPYL--YR
A0A845ZT65      LLFVVRPEISKRDFVSDSLEQLAQH-NAQLLGLVVNGVETKS----------KPYL--YR
A0A1D8TWE6      LLFVVRPEISKRDFVSDSLEQLAQH-NAQLLGLVVNGVETKS----------KPYL--YR
A0A845WQ93      LLFVVRPEISKRDFVSDSLEQLAQH-NAQLLGLVVNGVETKS----------KPYL--YR
A0A1D9G3S3      LLFVVRPEISKRDFVSDSLEQLAQH-NAQLLGLVVNGVETKS----------KPYL--YR
A0A6P0KRF3      LLFVVRPEISKRDFVSDSLEQLAQH-NAQLLGLVVNGVETKS----------RPYL--YR
A0A6P0LQ61      LLFVVRPEISKRDFVSDSLEQLAQH-NAQLLGLVVNGVETKS----------RPYL--YR
A0A6L9YP52      LLFVVRPEISKRDFVSDSLEQLAQH-NAQLLGLVVNGVETKS----------KPYL--YR
A0A6P0L3X9      LLFVVRPEISKRDFVSDSLEQLAQH-NAQLLGLVVNGVETKS----------KPYL--YR
A0A6M0A6X4      LLFVVRPEISKRDFVSDSLEQLAQH-NAQLLGLVVNGVETKS----------KPYL--YR
A0A1U7N3U5      LLFVVRPEISKRDFVSDSLEQLAQH-NAQLLGLVVNGVETKS----------KPYL--YR
A0A6L9ZB93      LLFVVRPEISKRDFVSDSLEQLAQH-NAQLLGLVVNGVETKS----------KPYL--YR
A0A6P0S980      LLFVVRPEISKRDFVSDSLEQLAQH-NAQLLGLVVNGVETKS----------KPYL--YR
A0A1Q8BLE0      ALVVVRAGRTERSALQTAVQQLATV-GARVLGTVLNDPDAEVPKYARYYGYYYNNYYDYS
A0A2T2S1W0      TLLVVRPGVAECDAVEASRDTLARL-QQPVVGMVANGVNPRNERSSYYHYYN--YGNNNG
A0A846CZ70      LLFVVRPEISKRDFVSDSLEQLAQH-NAQLLGLVVNGVETKSKP----------YLYRSS
A0A846E3I8      LLFVVRPEISKRDFVSDSLEQLAQH-NAQLLGLVVNGVETKSKP----------YLYRSS
A0A355DU96      ILLVARPKVVDRVSATASKEFLLRS-GQQVLGLVINGVSVEGEPDS--------YFHHAK
A0A846A9P3      VLLVARTRFVDSASATAAKSLLARS-GANVLGLVANGVDTKDEPQSVYA-----YYSRAP
A0A5B8NQW4      TLLVVRPNMADLTSATGAKEMLQRS-GQPVLGMVINGVNPSDEPDSYYYYYAQGYYYETK
A0A6P0XUL2      MVMVVGLGMTERSIFQRALDELKIA-RVPVLGLVANGVKGYTPNYSTYY---KRYYHKTA
                 .                   :         *   *                        

A0A846FUP5      YGSYSNYEYKNYYKPKKKAGVRGRKPRPIPNKAAKAKAKTA-------------------
A0A6P0ITZ8      PQSQFRQTHGKEASNNCAVISRGVDHADS-------------------------------
A0A6P0SLN0      IVETS-------------------------------------------------------
A0A2T1DKP1      TRERGKRNVAALDTITDSIPTEVER-----------------------------------
A0A2T1CC83      KKYFEKGNVQYESQNNLNGSQNLSNMPEGNNANSSVSRAKL-------------------
A0A0D6KL48      KSYYGAKQSHKNGKVDASISKIRIL-----------------------------------
A0A1B7WWU1      SSGYYGGKGERNKQNAEASVR---------------------------------------
A0A328V843      RYFPLQKSHRRDRSAPPKISSRSSS-----------------------------------
A0A2N6LHT1      NSYEPLSSRRLSRGSSA-------------------------------------------
A0A2T1EZA0      YYYHYAYASASGYAK------------SASEPSTGGFGSYVQRYRDSYMKGAATNSYISA
A0A6M0AN00      SRNSHGAIEQNQPVSDLQVSPQLERQFSNHVKSR--------------------------
A0A1U7JBN8      YYGRPRVAAGIED-G---------------------------------------------
A0A2W4VXF4      YYGRPAVASGIDERG---------------------------------------------
A0A2W7AI98      YYGRPVVASGIDERG---------------------------------------------
A0A2P8QVH5      DNLERGFTTNPNLAG-----------------------------RGIF------------
A0A433W4W4      DNLERGFTTNPNLAG-----------------------------RGIF------------
K9U5W1          DNLERGFTTNPNLAG-----------------------------RGIF------------
L8M1L4          SHYYNQPSNGNGNGNGNGNGNGNGNGNGNGNREAGSMNSIMQQFRRR-------------
A0A7G8GTF0      SYYSRSSMFKSSNEE---------SGQENLVSSASSLKRLMRRASNTSFVNKTINSATKM
A0A7G8H3H8      SYYNNSSLFNAPNAK---------SVLTKTSKFPSILKSLVYNKRTPIIVRKAIESSSRF
A0A4P5VLH9      YYYHYAYANDSGSSS------TYGKNGEGLGRYARDVGNLVRGYRDSYVT--------DR
A0A2W6ZN45      YHYNYSYAG----------------------------------YRDTYSQRLASKDVAEA
A0A081GP61      YYYHYAYASASGYAK------SANQ-----GKSYGGFGSYVQRYRDSYMKGAPSNAYFNA
K9P6R9          YYYHYAYASASGYAK------SASE------PSTGGFGSYVQRYRDSYMKGAATNSYISA
A0A6G3Z347      QSVSAEKNGNSKNPS---------DTQDDESAWYTTPLSWLKKSSGNKR-----------
A0A7T1IAR0      RYGYAEADGEPDH-A---------QIPASSAGWMPSQLLTLRKRGKALLHWIDG------
A0A6P0S1R8      SRVVETSS----------------------------------------------------
A0A0A2B4S6      YNSNYISYYADNKIRDKFTKRNLTFENSKDNFLISKIKKFRNKVLDFISWLDR-------
K9SGV8          YYYNYSSKPGQRQRQEASRQDQDQNQQETINQ----------------------------
B0CA08          SRYGHNSNQEKTAIKRNLLKQVISK-----------------------------------
B0BZC6          KEDYALAA----------------------------------------------------
A0A6P0M090      SQEYFHYGSVRRLAQRQAQTKKTSNVSRR-------------------------------
A0A563VX16      NKRYLPSAEV--------------------------------------------------
A0A6G3Z709      LRQDAHESAEILEESALLPVGNAS------------------------------------
A0A0V7ZGW0      HDSSQVNS----------------------------------------------------
A0A355DPN1      QNGSPLFQLN--------------------------------------------------
A0A0V7ZMP6      VNQQIQ------------------------------------------------------
A0A433W046      RQRELLEHEA--------------------------------------------------
K9TU02          RQRELLEHEA--------------------------------------------------
A0A2P8QV10      RQRELLEHEA--------------------------------------------------
A0A6J4NIB3      RQRELLAAEA--------------------------------------------------
A0A6P0VB93      SRVVETSS----------------------------------------------------
A0A6P0W0Y0      SRVVETSS----------------------------------------------------
A0A846BJ08      SRVVETSS----------------------------------------------------
A0A6M0AB25      CKKAPISS----------------------------------------------------
A0A1D8TTM0      HKIAEVSS----------------------------------------------------
A0A846GII1      HKIAEVGS----------------------------------------------------
B8HQ70          KQRELAATEL--------------------------------------------------
A0A2S6V636      RQRELIETEA--------------------------------------------------
A0A6P0IXR4      SSDTLVKS----------------------------------------------------
A0A845XP18      SSDSLVKS----------------------------------------------------
A0A845ZT65      SSDSLVKS----------------------------------------------------
A0A1D8TWE6      SSDSLVKS----------------------------------------------------
A0A845WQ93      SSDSLAVRQNSSHT----------------------------------------------
A0A1D9G3S3      SSDSLVKS----------------------------------------------------
A0A6P0KRF3      SSDTLVKS----------------------------------------------------
A0A6P0LQ61      SSDTLVKS----------------------------------------------------
A0A6L9YP52      SSDTLVKS----------------------------------------------------
A0A6P0L3X9      SSDTLVKS----------------------------------------------------
A0A6M0A6X4      SSDTLVKS----------------------------------------------------
A0A1U7N3U5      SSDSLVKS----------------------------------------------------
A0A6L9ZB93      SSDSLVKS----------------------------------------------------
A0A6P0S980      SSDTLVKS----------------------------------------------------
A0A1Q8BLE0      NATEYSNGNGAKA-----------------------------------------------
A0A2T2S1W0      GPPRQGWRRWLPGNPFARNGKGSQ------------------------------------
A0A846CZ70      DSLVKS------------------------------------------------------
A0A846E3I8      DSLVKS------------------------------------------------------
A0A355DU96      AYYKEELITSTIPDSKTKKNHIRF------------------------------------
A0A846A9P3      EEYRIGGANKSASSAKLPKIFSN-------------------------------------
A0A5B8NQW4      EEEESGKKALFGFGRGKSNQS---------------------------------------
A0A6P0XUL2      KFDLMENIQNFVSPK---------------------------------------------
                                                                            

A0A846FUP5      ------------------------------------------------------------
A0A6P0ITZ8      ------------------------------------------------------------
A0A6P0SLN0      ------------------------------------------------------------
A0A2T1DKP1      ------------------------------------------------------------
A0A2T1CC83      ------------------------------------------------------------
A0A0D6KL48      ------------------------------------------------------------
A0A1B7WWU1      ------------------------------------------------------------
A0A328V843      ------------------------------------------------------------
A0A2N6LHT1      ------------------------------------------------------------
A0A2T1EZA0      RYNEGESDVKTYFREDEDQATAPVATNGGIGPSASSTSPLPPADSVPSRRHRPSREGGGG
A0A6M0AN00      ------------------------------------------------------------
A0A1U7JBN8      ------------------------------------------------------------
A0A2W4VXF4      ------------------------------------------------------------
A0A2W7AI98      ------------------------------------------------------------
A0A2P8QVH5      ------------------------------------------------------------
A0A433W4W4      ------------------------------------------------------------
K9U5W1          ------------------------------------------------------------
L8M1L4          ------------------------------------------------------------
A0A7G8GTF0      YVRFKNWVIT--------------------------------------------------
A0A7G8H3H8      YYNIKEWFID--------------------------------------------------
A0A4P5VLH9      YISDGSSAAVQRYHEEGVSRELRQSKLKSGNGNDANQVNGTEPSDQANHPKG--------
A0A2W6ZN45      LPDN-----------------------PSDQAQSSAASGSAAKPDSNQSGSSGGLNRLKG
A0A081GP61      HQQNGDLDVRSYYQQEDGSGASAATRPPSEDSKGSGVSIRSSLPDSGRESTGSHAGDSQG
K9P6R9          RYNEGESDVKTYFREDEDQASVPVA---TNGGIGPSAGSSSSLPPAESVPSRRHRPSREG
A0A6G3Z347      ------------------------------------------------------------
A0A7T1IAR0      ------------------------------------------------------------
A0A6P0S1R8      ------------------------------------------------------------
A0A0A2B4S6      ------------------------------------------------------------
K9SGV8          ------------------------------------------------------------
B0CA08          ------------------------------------------------------------
B0BZC6          ------------------------------------------------------------
A0A6P0M090      ------------------------------------------------------------
A0A563VX16      ------------------------------------------------------------
A0A6G3Z709      ------------------------------------------------------------
A0A0V7ZGW0      ------------------------------------------------------------
A0A355DPN1      ------------------------------------------------------------
A0A0V7ZMP6      ------------------------------------------------------------
A0A433W046      ------------------------------------------------------------
K9TU02          ------------------------------------------------------------
A0A2P8QV10      ------------------------------------------------------------
A0A6J4NIB3      ------------------------------------------------------------
A0A6P0VB93      ------------------------------------------------------------
A0A6P0W0Y0      ------------------------------------------------------------
A0A846BJ08      ------------------------------------------------------------
A0A6M0AB25      ------------------------------------------------------------
A0A1D8TTM0      ------------------------------------------------------------
A0A846GII1      ------------------------------------------------------------
B8HQ70          ------------------------------------------------------------
A0A2S6V636      ------------------------------------------------------------
A0A6P0IXR4      ------------------------------------------------------------
A0A845XP18      ------------------------------------------------------------
A0A845ZT65      ------------------------------------------------------------
A0A1D8TWE6      ------------------------------------------------------------
A0A845WQ93      ------------------------------------------------------------
A0A1D9G3S3      ------------------------------------------------------------
A0A6P0KRF3      ------------------------------------------------------------
A0A6P0LQ61      ------------------------------------------------------------
A0A6L9YP52      ------------------------------------------------------------
A0A6P0L3X9      ------------------------------------------------------------
A0A6M0A6X4      ------------------------------------------------------------
A0A1U7N3U5      ------------------------------------------------------------
A0A6L9ZB93      ------------------------------------------------------------
A0A6P0S980      ------------------------------------------------------------
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
A0A846CZ70      ------------------------------------------------------------
A0A846E3I8      ------------------------------------------------------------
A0A355DU96      ------------------------------------------------------------
A0A846A9P3      ------------------------------------------------------------
A0A5B8NQW4      ------------------------------------------------------------
A0A6P0XUL2      ------------------------------------------------------------
                                                                            

A0A846FUP5      -----------------------
A0A6P0ITZ8      -----------------------
A0A6P0SLN0      -----------------------
A0A2T1DKP1      -----------------------
A0A2T1CC83      -----------------------
A0A0D6KL48      -----------------------
A0A1B7WWU1      -----------------------
A0A328V843      -----------------------
A0A2N6LHT1      -----------------------
A0A2T1EZA0      PMGWLRRRFGNRG----------
A0A6M0AN00      -----------------------
A0A1U7JBN8      -----------------------
A0A2W4VXF4      -----------------------
A0A2W7AI98      -----------------------
A0A2P8QVH5      -----------------------
A0A433W4W4      -----------------------
K9U5W1          -----------------------
L8M1L4          -----------------------
A0A7G8GTF0      -----------------------
A0A7G8H3H8      -----------------------
A0A4P5VLH9      -----------------------
A0A2W6ZN45      -----------WFRR--------
A0A081GP61      VRKGASQGPIGWLRQRFGRGSQR
K9P6R9          -----GDGPMGWLRRRFGNRG--
A0A6G3Z347      -----------------------
A0A7T1IAR0      -----------------------
A0A6P0S1R8      -----------------------
A0A0A2B4S6      -----------------------
K9SGV8          -----------------------
B0CA08          -----------------------
B0BZC6          -----------------------
A0A6P0M090      -----------------------
A0A563VX16      -----------------------
A0A6G3Z709      -----------------------
A0A0V7ZGW0      -----------------------
A0A355DPN1      -----------------------
A0A0V7ZMP6      -----------------------
A0A433W046      -----------------------
K9TU02          -----------------------
A0A2P8QV10      -----------------------
A0A6J4NIB3      -----------------------
A0A6P0VB93      -----------------------
A0A6P0W0Y0      -----------------------
A0A846BJ08      -----------------------
A0A6M0AB25      -----------------------
A0A1D8TTM0      -----------------------
A0A846GII1      -----------------------
B8HQ70          -----------------------
A0A2S6V636      -----------------------
A0A6P0IXR4      -----------------------
A0A845XP18      -----------------------
A0A845ZT65      -----------------------
A0A1D8TWE6      -----------------------
A0A845WQ93      -----------------------
A0A1D9G3S3      -----------------------
A0A6P0KRF3      -----------------------
A0A6P0LQ61      -----------------------
A0A6L9YP52      -----------------------
A0A6P0L3X9      -----------------------
A0A6M0A6X4      -----------------------
A0A1U7N3U5      -----------------------
A0A6L9ZB93      -----------------------
A0A6P0S980      -----------------------
A0A1Q8BLE0      -----------------------
A0A2T2S1W0      -----------------------
A0A846CZ70      -----------------------
A0A846E3I8      -----------------------
A0A355DU96      -----------------------
A0A846A9P3      -----------------------
A0A5B8NQW4      -----------------------
A0A6P0XUL2      -----------------------
                                       

© 1998-2022Legal notice