BYKdb

Dataset for cluster orphancd of phylum cyanobacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

63 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A355DU96      ------------------------------------------------------------
A0A2N6LHT1      ------------------------------------------------------------
A0A328V843      ------------------------------------------------------------
A0A2T1DKP1      ------------------------------------------------------------
A0A0D6KL48      ------------------------------------------------------------
A0A6M0AN00      ------------------------------------------------------------
A0A6P0ITZ8      ------------------------------------------------------------
A0A6P0SLN0      ------------------------------------------------------------
A0A2T1CC83      ------------------------------------------------------------
A0A1B7WWU1      ------------------------------------------------------------
A0A6P0S1R8      ------------------------------------------------------------
A0A0A2B4S6      ------------------------------------------------------------
K9SGV8          ------------------------------------------------------------
B0CA08          ------------------------------------------------------------
B0BZC6          ------------------------------------------------------------
A0A6G3Z709      ------------------------------------------------------------
A0A6P0M090      ------------------------------------------------------------
A0A563VX16      ------------------------------------------------------------
A0A0V7ZGW0      ------------------------------------------------------------
A0A355DPN1      ------------------------------------------------------------
A0A6J4NIB3      ------------------------------------------------------------
A0A6M0AB25      ------------------------------------------------------------
A0A1D8TTM0      ------------------------------------------------------------
A0A6P0VB93      ------------------------------------------------------------
A0A6P0W0Y0      ------------------------------------------------------------
A0A0V7ZMP6      ------------------------------------------------------------
A0A433W046      ------------------------------------------------------------
K9TU02          ------------------------------------------------------------
A0A2T1FMA8      ------------------------------------------------------------
A0A2P8QV10      ------------------------------------------------------------
B8HQ70          ------------------------------------------------------------
A0A2S6V636      ------------------------------------------------------------
A0A6P0IXR4      ------------------------------------------------------------
A0A1D9G3S3      ------------------------------------------------------------
A0A6P0KRF3      ------------------------------------------------------------
A0A6P0LQ61      ------------------------------------------------------------
A0A1D8TWE6      ------------------------------------------------------------
A0A6L9YP52      ------------------------------------------------------------
A0A6P0L3X9      ------------------------------------------------------------
A0A6M0A6X4      ------------------------------------------------------------
A0A1U7N3U5      ------------------------------------------------------------
A0A6L9ZB93      ------------------------------------------------------------
A0A6P0S980      ------------------------------------------------------------
A0A2T1EZA0      MFWEEKPPKDINRITTIDARVKGHSLRVAIIIGSTFPAVHNVTTTGAPPEAFPGGTARPL
A0A1U7JBN8      --------------------------------------------------MPF---PPSS
A0A2W4VXF4      --------------------------------------------------MPFSSKPAAR
A0A2W7AI98      --------------------------------------------------MPFSSKPAAR
A0A6G3Z347      ------------------------------------------------------------
A0A2P8QVH5      ------------------------------------------------------------
A0A2T1FT70      ------------------------------------------------------------
A0A433W4W4      ------------------------------------------------------------
K9U5W1          ------------------------------------------------------------
L8M1L4          ------------------------------------------------------------
A0A7G8GTF0      ------------------------------------------------------------
A0A7G8H3H8      ------------------------------------------------------------
A0A4P5VLH9      ------------------------------------------------------------
A0A2W6ZN45      ---------------------------------------------------MLTEAGSPT
A0A081GP61      --------------------------------------MGGFPPSGAAGRFQAPYPDQPL
K9P6R9          ------------------------------------------------------------
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
A0A5B8NQW4      ------------------------------------------------------------
A0A6P0XUL2      ------------------------------------------------------------
                                                                            

A0A355DU96      ------------------------------------------------------------
A0A2N6LHT1      ------------------------------------------------------------
A0A328V843      ------------------------------------------------------------
A0A2T1DKP1      ------------------------------------------------------------
A0A0D6KL48      ------------------------------------------------------------
A0A6M0AN00      ------------------------------------------------------------
A0A6P0ITZ8      ------------------------------------------------------------
A0A6P0SLN0      ------------------------------------------------------------
A0A2T1CC83      ------------------------------------------------------------
A0A1B7WWU1      ------------------------------------------------------------
A0A6P0S1R8      ------------------------------------------------------------
A0A0A2B4S6      ------------------------------------------------------------
K9SGV8          -------------------------------MNQLQQYLFIIRRRWPVATLVFVSAVLVT
B0CA08          ----------------------------------MSNYWLMLKRRG-LPAGFTFLTVLSL
B0BZC6          -----------------------------MNESVSKVIKIIYRNRW-TTVGTFLSVFTGI
A0A6G3Z709      ------------------------------------------------------------
A0A6P0M090      ----------------------------------IDQLRPLVDA----------------
A0A563VX16      -----------MEQRIENYMNQNVYDLDNSTELGYGEIFSIFWRRR-SYFIGICGGVLAC
A0A0V7ZGW0      -----------------------------------MKVSAIIQRLW-LPLLGLNGVIVGS
A0A355DPN1      -------------------------------------------------MLGVFCGVLAI
A0A6J4NIB3      ------------------------------------------------------------
A0A6M0AB25      ------------------------------------------------------------
A0A1D8TTM0      ----------------------------------MNRLIAIAIRHW-KPVIGLNIVLSAI
A0A6P0VB93      ----------------------------------MNRFVAIALRHW-KPVLGLNIVLFAI
A0A6P0W0Y0      ----------------------------------MNRFVAIALRHW-KPVLGLNIVLFAI
A0A0V7ZMP6      ----------------------------------MKKATKIAVRHW-KFVLAWNKIILGI
A0A433W046      ----------------------------------MKQIFSIARKHW-LPLLGFNTAVLAA
K9TU02          ----------------------------------MKQIFSIARKHW-LPLLGFNTAVLAA
A0A2T1FMA8      ----------------------------------MKQIFSIARKHW-LPLLGFNTAVLAA
A0A2P8QV10      ----------------------------------MKQIFSIARKHW-LPLLGFNSAVLAA
B8HQ70          ----------------------------------MFQITSTLRRHW-KPLIALNTVLIGS
A0A2S6V636      ----------------------------------MNHIVNIIRRHW-MPLLLLNGVVLAA
A0A6P0IXR4      ------------------------------------------------------------
A0A1D9G3S3      ----------------------------------MKKVAAILNRHW-TILLVFNSLVLGA
A0A6P0KRF3      ----------------------------------MKKVAAILNRHW-TLLLVFNSLVLGA
A0A6P0LQ61      ----------------------------------MKKVAAILNRHW-TLLLVFNSLVLGA
A0A1D8TWE6      ----------------------------------MKKVAGILNRHW-TFLLVFNSLVLGA
A0A6L9YP52      ----------------------------------MKKVAAILNRHW-TLLLVFNSLVLGG
A0A6P0L3X9      ----------------------------------MKKVAAILNRHW-TILLVFNLLVLGA
A0A6M0A6X4      ----------------------------------MKKVAAILNRHW-TLLLVFNSLVLGA
A0A1U7N3U5      ----------------------------------MKKVAAILNRHW-TILLVFNSLVLAA
A0A6L9ZB93      ----------------------------------MKKVAAILNRHW-TILLVFNSLVLAA
A0A6P0S980      ----------------------------------MKKVAAILNRHW-TILLVFNSLVLAA
A0A2T1EZA0      SLPGTGASGPGLFDPSSQQSPLSPMGESQSGGGGLGGIVRTVKRR--QSIFLITFALVTG
A0A1U7JBN8      THEINGNGHGHAKPGFMTVMAPPS-LVEQRDEVDFNQLVGVFRRR--AGIFFGVAALSLA
A0A2W4VXF4      EVNGNGNGQGHASQSFVPVTAPPSPLIDDGDDFDLNHLVAVLGRR--AGIFWGVAALSFG
A0A2W7AI98      EVNGNGNGQGHASQSFVPVTAPPSPLIDDGDDFDLNHLVAVLGRR--AGIFGGVAALSFG
A0A6G3Z347      -------MTSELQSPPANMLAPAP---AQEGGLKLGRFASALKRN--ILLIAGITTLTAS
A0A2P8QVH5      ------MADTSLDNERLSVEHRVE---NRANATDLRQLFTVLLRR--RLLILSLFCIPLS
A0A2T1FT70      ------MADTSLDNERLSVEHRVE---NRANATDLRQLFTVLLRR--RLLILSLFCIPLS
A0A433W4W4      ------MADTSLDNERLSVEHRVE---NRANATDLRQLFTVLLRR--RLLILSLFCIPLS
K9U5W1          ------MADTSLDNERLSVEHRVE---NRANATDLRQLFTVLLRR--RLLILSLFCIPLS
L8M1L4          ----MNNTIVRSDFVNLPAQETG-----FSLSDFKQILYRRWKPA--LALGIMAFGVVLI
A0A7G8GTF0      ----------------MPENSSEN---TISLSEIAFSLKRRWK------IIFISFSLLFT
A0A7G8H3H8      ------------MSTDIPEEDLGK---SISLSEIAFALKRRWK------VVAISFSFLYI
A0A4P5VLH9      ------------------------------------------------------------
A0A2W6ZN45      PHSPFGTGSTQVAASALSPTANQP---DDASTNVLFKLIRSLKRR--QALFLFVFFVTTA
A0A081GP61      QSPLTPTAEAQAGSGGLG------------------GLVRTIRRR--QTVFLLTFAVVTG
K9P6R9          ------MGETQSGGGGLG------------------GLVRTVKRR--QSIFLITFAVVTG
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
A0A5B8NQW4      ------------------------------------------------------------
A0A6P0XUL2      ------------------------------------------------------------
                                                                            

A0A355DU96      ------------------------------------------------------------
A0A2N6LHT1      ------------------------------------------------------------
A0A328V843      ------------------------------------------------------------
A0A2T1DKP1      ------------------------------------------------------------
A0A0D6KL48      ------------------------------------------------------------
A0A6M0AN00      ------------------------------------------------------------
A0A6P0ITZ8      ------------------------------------------------------------
A0A6P0SLN0      ------------------------------------------------------------
A0A2T1CC83      ------------------------------------------------------------
A0A1B7WWU1      ------------------------------------------------------------
A0A6P0S1R8      ------------------------------------------------------------
A0A0A2B4S6      --------------------MLISDPLNNNKNNS-------ANSIGGVFEQLALNST--D
K9SGV8          TFHAIFVMK----PRYRASGEMLVTPGDQAIAIT-------NVGVSKTVNQPRSLS---G
B0CA08          ALLQAFQEK----PIYEAVGQLKFEESQRSSKLI-------GLDSAVDDESRQQSSLRWQ
B0BZC6          VVYLLITPR-----LYSAKVRLILDQRPATSISP-------LGRDIAQTPGDN------N
A0A6G3Z709      ------------------------------------------------------------
A0A6P0M090      -----------------------------------------------------------Q
A0A563VX16      MIPLVLTQK----PVYRSSMQMLVEPNYEDKDNR-----------GDFDPIESSIEIDYA
A0A0V7ZGW0      VIMIATFSQ----KTWTANAQLILPDTTTNLDAS-------LGTLGQLKEQGVAFTNE-L
A0A355DPN1      AIPIALNKE----PTYQSSMQLLIEPYVQQKQE------------GKPQTEEQFTDSNVE
A0A6J4NIB3      ------------------------------------------------------------
A0A6M0AB25      ------------------------------------------------------------
A0A1D8TTM0      ALYNASKVT----EVWAARAKLIIPKSSSDLNAN-------LGTLGDFRDRGVSFSQQ-V
A0A6P0VB93      ALYSASKVT----EVWAARAKLILPQSSSALNAN-------LGTLGDIKNTGIAFSQQ-V
A0A6P0W0Y0      ALYSASKVT----EVWAARAKLILPQSSSALNAN-------LGTLGDIKNTGIAFSQQ-V
A0A0V7ZMP6      AVANIALLP----RVWISKSLLILPTSTSNVDAD-------LDNSDDLKTKEVGFSQQ-V
A0A433W046      TIYAAFYASTSIPPVWTANAKLNLPQ-TGGLSAN-------LGPLGSTQTTALNFKD--V
K9TU02          TIYAAFYASTSIPPVWTANAKLNLPQ-TGGLSAN-------LGPLGSTQTTALNFKD--V
A0A2T1FMA8      TIYAAFYASTSIPPVWTANAKLNLPQ-TGGLSAN-------LGPLGSTQTTALNFKD--V
A0A2P8QV10      TIYAAFYASTSIPPVWTANAKLNLPQ-TGGLSAN-------LGPLGSTQTTALNFKD--V
B8HQ70          TALIAAFYP----RTWQASARFVVPINTNQLSAD-------IGTLGQLRPGDGVVPSDLM
A0A2S6V636      TLYSVIYTKTNVAPVWKATAKLNLPQPTTRLDTN-------LGTLGQIQNTALGFTRE-L
A0A6P0IXR4      ------------------------------------------------------------
A0A1D9G3S3      SFGAFSLLK----PFWIAKAQLILPE-TGKLQAS-------LGTLGSLTKGDSKLATK-S
A0A6P0KRF3      SFGAFSLLK----PFWIAKAQLILPE-TGKLQAS-------LGTLGSLTKGDSKLATK-S
A0A6P0LQ61      SFGAFSLLK----PFWIAKAQLILPE-TGKLQAS-------LGTLGSLTKGDSKLATK-S
A0A1D8TWE6      SFGAFSLLK----PFWIAKAQLILPE-TGKLQAS-------LGTLGSLTKGDSKLATK-S
A0A6L9YP52      SFGAFSLLK----PFWIAKAQLILPE-TGKLQAS-------LGTLGSLTKGDSKLATK-S
A0A6P0L3X9      SFGAFSLLK----PFWIAKAQLILPE-TGKLQAS-------LGTLGSLTKGDSKLATK-S
A0A6M0A6X4      SFGAFSLLK----PFWIAKAQLILPE-TGKLQAS-------LGTLGSLTKGDSKLATK-S
A0A1U7N3U5      SFGAFSLLK----PFWIAKAQLILPE-TGKLQAS-------LGTLGSLTKGDSKLATK-S
A0A6L9ZB93      SFGAFSLLK----PFWIAKAQLILPE-TGKLQAS-------LGTLGSLTKGDSKLATK-S
A0A6P0S980      SFGAFSLLK----PFWIAKAQLILPE-TGKLQAS-------LGTLGSLTKGDSKLATK-S
A0A2T1EZA0      VLAINTLRQRIFSPVYQGGFQMQISNPFDNPGT--------GGGGGGSVESIARSEI--K
A0A1U7JBN8      GFTLWHLSRP---PAYSGSASLLVEPVTAV-----------NTPGLETVTGAPSP-SGSG
A0A2W4VXF4      GLTLWHLTRP---PVYNGSANLLVEPVTVV-----------NTPGLEAVMELPGARSASG
A0A2W7AI98      GLTLWHLTRP---PVYNGSANLLVEPVTVV-----------NTPGLEAVMELPGARSASG
A0A6G3Z347      AAVFKAITDT---PTYESSLELLTPPITLETQII-------STLNPEALSNQSEVVN--V
A0A2P8QVH5      ASSFLALMAK---PTYQSSMQLLVSSNLYQGQNS-------NAQGGVEESDFTDSNL--K
A0A2T1FT70      ASSFLALMAK---PTYQSSMQLLVSSNLYQGQNS-------NAQGGVEESDFTDSNL--K
A0A433W4W4      ASSFLALMAK---PTYQSSMQLLVSSNLYQGQNS-------NAQGGVEESDFTDSNL--K
K9U5W1          ASSFLALMAK---PTYQSSMQLLVSSNLYQGQNS-------NAQGGVEESDFTDSNL--K
L8M1L4          PKLLST-------PQYRSEAKILLKSPQNQQS---------AEVQLNALNSRRNYYN--L
A0A7G8GTF0      FNTIYILYNWSFNRQYKGGVKILIVDPFGESSGGQ-GMPS-GGLDNQFFEELARNNT--A
A0A7G8H3H8      LNVAYTLYNWNFNRIYRGGVKLLIVDPFGENSAASGGLPSGGGLDNQFFEELARNDT--A
A0A4P5VLH9      -------------------------------MEA-------SRGGESKLETIARQTQ--K
A0A2W6ZN45      LLAANALRQRIVAPVYIGGFQMLITDPLANVGPS--------TPSSGVVESLAKTTSLGN
A0A081GP61      ALAINTLRQRIFSPVYQGGFQMQISNPFED--KN-------GGGGGGSVEAIARTPL--K
K9P6R9          VLAINTLRQRIFSPVYQGGFQMQISNPFDNPGSG-------GGGGGGSVETIARSEI--K
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
A0A5B8NQW4      ------------------------------------------------------------
A0A6P0XUL2      ------------------------------------------------------------
                                                                            

A0A355DU96      ------------------------------------------------------------
A0A2N6LHT1      ------------------------------------------------------------
A0A328V843      ------------------------------------------------------------
A0A2T1DKP1      ------------------------------------------------------------
A0A0D6KL48      ------------------------------------------------------------
A0A6M0AN00      ------------------------------------------------------------
A0A6P0ITZ8      ------------------------------------------------------------
A0A6P0SLN0      ------------------------------------------------------------
A0A2T1CC83      ------------------------------------------------------------
A0A1B7WWU1      ------------------------------------------------------------
A0A6P0S1R8      ------------------------------------------------------------
A0A0A2B4S6      NDLPTLIELLKSPILLNPISKD----------YGIPFNKFSKSLKISTPGGLRT--QSMA
K9SGV8          GYLNTEMQIMRSKEVIQRALEI--------VERPISYGEFLGSFGVN---------VIPG
B0CA08          RSLDTEILTMKSPRRLSMLALA---IESQGLFSRPSVEQIKSGLDIS---------QFDE
B0BZC6          KGLATQEELVRSKSVLTKAIVLFNQSNQDSAIEKVTLGEVKPEVATE---------VIPG
A0A6G3Z709      ---------MEPRTLLGKVDAK----------------------------------PISG
A0A6P0M090      NPLSTEVEVIYSHPLLQQIIDQLNLTDNEGLPLEPE--ALKKKLTVK---------IVGG
A0A563VX16      TQLNLMRSSQLLGRAVVKLRPS---YPDITT-EEIQ--NYLVVSQVR----EQEDKKEVG
A0A0V7ZGW0      NPLKVLTSIITSDDAIRPVLLS---DPEKDKFRSLS--SYKKLFKVK---------PTDQ
A0A355DPN1      VDYATQLNLMRSSQLIQKAVDR---LHPKYPEIQVT--DIKESFSLTGVQEEDTDIKDTQ
A0A6J4NIB3      -------------------HAV---DPERPLYSSLG--SYRRLFEVT---------PQEL
A0A6M0AB25      ---------MTSNDTISQVWEF---DPEKSLYPRLS--EYKSLFDVS---------PEGE
A0A1D8TTM0      NPLNNLSSIMTSNDTISQVWEF---DPEKSLYPRLS--GYKSLFDVS---------PEGE
A0A6P0VB93      NPLKNLSSIMTSNDAISQIWES---DPEKALYPRLS--EYKSLFDVS---------PEGE
A0A6P0W0Y0      NPLKNLSSIMTSNDAISQIWES---DPEKALYPRLS--EYKSLFDVS---------PEGE
A0A0V7ZMP6      NPLNVISSIATSDNVLKKVWEQ---DPQKTSYKQLS--EYRGLFDVS---------PEND
A0A433W046      SPLDVQLAILTSDAVMKRVQAV---DPEKSLYSKVS--SFSQLFVVT---------PQPA
K9TU02          SPLDVQLAILTSDAVMKRVQAV---DPEKSLYSKVS--SFSQLFVVT---------PQPA
A0A2T1FMA8      SPLDVQLAILTSDAVMKRVQAV---DPEKSLYSKVS--SFSQLFVVT---------PQPA
A0A2P8QV10      SPLDVQLAILTSDAVMKRVQAV---DPEKSLYSKVS--SFSQLFVVT---------PQPA
B8HQ70          NPVTLQAEIVKSPTLIGQVLAV---DPER-DQHTLQ--SFMPLFEAK---------PQSL
A0A2S6V636      NPLQIQMAILMSDTVMERTLAV---DPEKSLFPRLS--DYKLAFSAT---------PQEQ
A0A6P0IXR4      ------------------------------------------------------------
A0A1D9G3S3      HPLNMQASILTSDALMRRLLES---DPEKTDFQRLV--QYKKLFAVS---------PDQE
A0A6P0KRF3      HPLNMQASILTSDALMRRLLES---DPEKTDFQRLV--QYKKLFAIS---------PDQE
A0A6P0LQ61      HPLNMQASILTSDALMRRLLES---DPEKTDFQRLV--QYKKLFAIS---------PDQE
A0A1D8TWE6      HPLNMQASILTSDALMSRLLES---DLEKTDFQRLV--QYKKLFAIS---------PDQE
A0A6L9YP52      HPLNMQASILTSDALMRRLLES---DPEKTDFQRLV--QYKKLFAVS---------PDQE
A0A6P0L3X9      HPLNMQASILNSDALMRRLLES---DPEKTDFKRLV--QYKKLFAVS---------PDEE
A0A6M0A6X4      HPLNMQASILTSDALMRRLLES---DPEKTDFQRLV--QYKKLFAVS---------PDQE
A0A1U7N3U5      HPLNMQASILNSDALMRRLLES---DPEKTDFQRLV--QYKKLFAVS---------PDQE
A0A6L9ZB93      HPLNMQASILNSDALMRRLLES---DPEKTDFQRLV--QYKKLFAVS---------PDQE
A0A6P0S980      HPLNMQASILNSDALMRRLLES---DPEKTDFQRLV--QYKKLFAVS---------PDQE
A0A2T1EZA0      TDVPSLIVLMRSPLLLGPV----------AQRQGVPLRALESNLSIN---------QESA
A0A1U7JBN8      LDYTSQIRVLRGPAVINPILAK-----IQQRYPDITYNSLLNGLNIV---------QEGE
A0A2W4VXF4      LDYTSQIRVLRGPDVIKPILVN-----IQRQHPEITYTTLLNDLVIS---------QEGE
A0A2W7AI98      LDYTSQIRVLRGPDVIKPILVN-----IQRQHPEITYTTLLNDLVIS---------QEGE
A0A6G3Z347      AIDETKLKILKSPRVMEPIVVR-----LQERYLDIDYGEVVGSLDIY---------PTST
A0A2P8QVH5      VDYTAQLSVMTSPKLVERAVEL-----LRPEYPNITVEEINGKPAKV---------KQSP
A0A2T1FT70      VDYTAQLSVMTSPKLVERAVEL-----LRPEYPNITVEEINGKPAKV---------KQSP
A0A433W4W4      VDYTAQLSVMTSPKLVERAVEL-----LRPEYPNITVEEINGKPAKV---------KQSP
K9U5W1          VDYTAQLSVMTSPKLVERAVEL-----LRPEYPNITVEEINGKPAKV---------KQSP
L8M1L4          KDLSTDILVLKSYSLINKA-----------------IEKYPETFSGL---------SAAE
A0A7G8GTF0      TNIPTLIEVLKSKSVLGKL----------SASNDIFYGKLVRSIEII---------AKGE
A0A7G8H3H8      TNIPTLIEVLKSKSVLGKL----------SASNDIFYEKLVKSITIT---------PKGE
A0A4P5VLH9      NDVPSLIVLMRSPLLVKPV----------ADRMGVSINDLISNLSIA---------P-AG
A0A2W6ZN45      SDVPTLIQLLTSPVVLKPI----------AEAQAIPLGSLIGSLAIG---------STRA
A0A081GP61      PDVPSLIVLMRSPLLLGPV----------AQRQGVPLDLLAANLSIN---------PESA
K9P6R9          TDVPSLIVLMRSPLLLGPV----------AQRQGVSLGALESNLSIN---------QESA
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
A0A5B8NQW4      ------------------------------------------------------------
A0A6P0XUL2      ------------------------------------------------------------
                                                                            

A0A355DU96      ------------------------------------------------------------
A0A2N6LHT1      ------------------------------------------------------------
A0A328V843      ------------------------------------------------------------
A0A2T1DKP1      ------------------------------------------------------------
A0A0D6KL48      ------------------------------------------------------------
A0A6M0AN00      ------------------------------------------------------------
A0A6P0ITZ8      ------------------------------------------------------------
A0A6P0SLN0      ------------------------------------------------------------
A0A2T1CC83      ------------------------------------------------------------
A0A1B7WWU1      ------------------------------------------------------------
A0A6P0S1R8      ------------------------------------------------------------
A0A0A2B4S6      ----------------QGVLRISFKGENPRIVNSMLVSISKAYLKSALDQKQQRLSDGLI
K9SGV8          ----------------TDVLRFSYTSGDPKLAVEAANSMMQSYAENNIERNRAAVRAARL
B0CA08          ----------------TNVVQIRFKSYNREFPKNIVNLLMQQYVDNTPKSKQASTQSAIS
B0BZC6          ----------------TQIIEITFRHTDPGVTSSLLNLIASSVIQENAETIRSEARATRQ
A0A6G3Z709      ----------------TDVMRITVRSEDPQEAADIANQVIDSYRRQNIDSNREEAAAARL
A0A6P0M090      ----------------TDVVRLSYKGKNSEKGAAVINQLMRLYIENQILSKKSEAAKARE
A0A563VX16      ----------------TKIFQAVYKDEDAEKTQRVLEAIQEVYLEYNLEQQDKRLREGLS
A0A0V7ZGW0      ----------------STNIQLQVTASEPELAKQRAKRLIESYQERLNELRQGTANAREQ
A0A355DPN1      ----------------TKIVKVVYTSNDPIKTQDVLAAIQTVYQDYNLQQQQVRLTEGLA
A0A6J4NIB3      ----------------STLLLVEAEGSSPELARFRAATVIEFYQQRLNELRRNDADVREK
A0A6M0AB25      ----------------STIISLSAEGSTPELARQRTAALIGAFQQRLNELRLDDAVQRSQ
A0A1D8TTM0      ----------------STIISLSAEGSTPELARQRTAALIEAFQQRLNELRLDDAVQRSQ
A0A6P0VB93      ----------------STVISLSAEGSTPELARQRTAALIETFQQRLNELRQDDAVQRSQ
A0A6P0W0Y0      ----------------STVISLSAEGSTPELARQRTAALIETFQQRLNELRQDDAVQRSQ
A0A0V7ZMP6      ----------------STVISLSVEGSTPKLATERAQNLIASLKERLQELRQDRVISQSE
A0A433W046      ----------------TTLIEVEAQGSRPDIAYKRLFTFLEVYQQRLNELRRKDAEVRVQ
K9TU02          ----------------TTLIEVEAQGSRPDIAYKRLFTFLEVYQQRLNELRRKDAEVRVQ
A0A2T1FMA8      ----------------TTLIEVEAQGSRPDIAYKRLFTFLEVYQQRLNELRRKDAEVRVQ
A0A2P8QV10      ----------------TTLIEVEAQGSRPDLAYKRLFTFLEVYQQRLNELRRKDAEVRVQ
B8HQ70          ----------------SPLMTVEVKGTTPELAHQRLSTWIKLYQKRLTYLRENDASTRQT
A0A2S6V636      ----------------STIINLQVKASSPDIAQRRLSNLINIYQLRLNELRHQDTNVRKQ
A0A6P0IXR4      ------------------------------------------------------------
A0A1D9G3S3      ----------------STTIWLNASGDSPELARDRVKALISAYQERLNELRQADGTTRVE
A0A6P0KRF3      ----------------STTIWLNASGDSPELARDRVKALISAYQERLNELRQADGTTRVE
A0A6P0LQ61      ----------------STTIWLNASGDSPELARDRVRALISAYQERLNELRQADGTTRVE
A0A1D8TWE6      ----------------STTIWLNARGDSPELARDRVKALISAYQDRLNELRQADGSTRVE
A0A6L9YP52      ----------------STTIWLNASGDSPELARDRVRALISAYQERLNELRQADGTTRVE
A0A6P0L3X9      ----------------STTIWLNATGDSPKLARDRVKALISAYQERLNELRQADGTTRVE
A0A6M0A6X4      ----------------STTIWLNATGDSPELARDRVKALISAYQERLNELRQADGTTRVE
A0A1U7N3U5      ----------------STTIWLNATGDSPKLARDRVKALISAYQERLNELRQADGTTRVE
A0A6L9ZB93      ----------------STTIWLNATGDSPKLARDRVKALISAYQERLNELRQADGTTRVE
A0A6P0S980      ----------------STTIWLNATGDSPKLARDRVKALISAYQERLNELRQADGTTRVE
A0A2T1EZA0      RV--------------DNVLNVSLRWPDPAKGKAILRQLAKDYTSFSLTQRQAAVNSGVR
A0A1U7JBN8      ----------------SKVLRISYSNADPAVAAFVLNQVVEGFVNYSVQDRQGDLRRGLT
A0A2W4VXF4      ----------------SKVLRISYSDADPEVVTTVMSEVVKGFVAYSVQDRQGELRRGLE
A0A2W7AI98      ----------------SKVLRISYRDADPEVVTTVMSEVVEGFVAYSVQDRQGELRRGLE
A0A6G3Z347      ----------------GDTLTVQYKGVDAEKVLYVLEVVAEFYLKFSLEDRQNDIFRGID
A0A2P8QVH5      LKVTQVESGTKTLQTLSQVFEVTFVAGDPIKSQKVLQALQNVYQIYNLEQQKLRLTNGLA
A0A2T1FT70      LKVTQVESGTKTLQTLSQVFEVTFVAGDPIKSQKVLQALQNVYQIYNLEQQKLRLTNGLA
A0A433W4W4      LKVTQVESGTKTLQTLSQVFEVTFVAGDPIKSQKVLQALQNVYQIYNLEQQKLRLTNGLA
K9U5W1          LKVTQVESGTKTLQTLSQVFEVTFVAGDPIKSQKVLQALQNVYQIYNLEQQKLRLTNGLA
L8M1L4          VRTKLNIFPAMINDIPTDILNISFVDSAPEVAQGVLDALSEVYVEYSLERERSQALNAIQ
A0A7G8GTF0      NAGGGGLAAMRGGGGEAGILQISLNWHDRSEGKKILDLFTDTILNFSQKEKELRLQKGID
A0A7G8H3H8      NSGGGGLAAMRGGGGDAGILEISLNWHDPSEGKKILGLFTDTILNFSQKEKQLRLVKGIN
A0A4P5VLH9      NV--------------EEVLNVNLRWRDPAKGRLILNELSKDYTKFSKSQRESTLNSGVE
A0A2W6ZN45      DS--------------QGVLNIQLRWSDPVQGRKILTALADSYPKYALIQRQEKLGQGLE
A0A081GP61      AV--------------ENVLNISLRWPDPVKGKAILRQLAKDYTAFSLTQRQAAVNSGVR
K9P6R9          QV--------------ENVLNVSLSWPDPAKGKAILRQLAKDYTAFSLTQRQAAVNSGVR
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
A0A5B8NQW4      ------------------------------------------------------------
A0A6P0XUL2      ------------------------------------------------------------
                                                                            

A0A355DU96      ------------------------------------------------------------
A0A2N6LHT1      ----------KQLQEAEQKENRYRQSSGIVSFDE-QTKSLVESLATLEEQENTLSAQLQE
A0A328V843      --------------------QYFKQRNYVVDLGT-EFAISVQEMAQLNRNITTLEAELNA
A0A2T1DKP1      ------------------------------------------------------------
A0A0D6KL48      ------------------------------------------------------------
A0A6M0AN00      ------------------------------------------------------------
A0A6P0ITZ8      ------------------------------------------------------------
A0A6P0SLN0      ------------------------------------------------------------
A0A2T1CC83      ------------------------------------------------------------
A0A1B7WWU1      ------------------------------------------------------------
A0A6P0S1R8      ------------------------------------------------------------
A0A0A2B4S6      FLNNQSPKLEGKNKQVQKELSDFRERNQLIEPTV-EGQELKTRLDYLENELDNIKNERVK
K9SGV8          FIEEQLPKAEQDVENAEQQLRAFREQYNFVSASA-EAEATIDRFRSTESRIEDMQVSLAK
B0CA08          FIEKQLPQVKQRVNSAETALRKFKETYQIADLEI-AKSANATNLSQLQTALDEIDRELVE
B0BZC6          FLENQIPRRQQELVKVESSISQFKQQYNIVSLEETDNKRLTQSIAEAEKVAEEISANLRQ
A0A6G3Z709      FIEDQLPETEKEVLRVEEALRQFKETNDIISLDQ-EASNAVSVLSNLDQEITQLQARLAD
A0A6P0M090      FITNQLPQSEANVRQAEAALRQFKERNQVVSLTE-EARSLVAVMADLDSQITTVQAQLEE
A0A563VX16      FINQEIPEVRQKLTNAERNLEVMLTRYNLIAPQT-EAIDISKLLTNTRQQREELKAQYKQ
A0A0V7ZGW0      FTQRQLKDAERNLQLVKSKLAQFKKSTGFVSDEE-QTKNLVTAINTLRTTQTDVLAQAKA
A0A355DPN1      FINDQLPTARDNVIQAEKALEQFRETQNLIDPVQ-QATTITDALSTVEQEQQAIRAQYQE
A0A6J4NIB3      FARLELEDSRKNLLQAQKALTQFQEATGIVDRDA-QTEGLVEAINNLKNTQATVLAEARS
A0A6M0AB25      FMRKELEQAAENLRQAQAALAAFKASSNLVSAED-QTREMVTAINTLTTEQAQVLAQAQA
A0A1D8TTM0      FMRKELEQAAENLRQTQAALVAFKASSNLVSAED-QTREMVTAINTLTTEQAQVLAQAQA
A0A6P0VB93      FTQKELQQAVENLRQAQAALASFKASSNLVSAED-QTREMVVAINTLTTEQAQLVAQAQA
A0A6P0W0Y0      FTQKELQQAVENLRQAQAALASFKASSNLVSAED-QTREMVVAINTLTTEQAQLVAQAQA
A0A0V7ZMP6      FIQDEVRQAHRKLMDAQKKLNKFKEAGNVISDEH-DAKQKVITINALNKSRVEALAEAKA
A0A433W046      YTQEELEQARLNLNQAQANLSNFQRSTGLVNSPE-QSGGLISAINNLKTTQATLIAQGQA
K9TU02          YTQEELEQARLNLNQAQANLSNFQRSTGLVNSPE-QSGGLISAINNLKTTQATLIAQGQA
A0A2T1FMA8      YTQEELEQARLNLNQAQANLSNFQRSTGLVNSPE-QSGGLISAINNLKTTQATLIAQGQA
A0A2P8QV10      YTQEELEQARLNLNQAQANLSNFQRSTGLVDSPE-QSKGLISAINNLKTTQATLIAQGQA
B8HQ70          LPQQELQEASNNLRRTQTQLSVFRQANNITDINE-QIRGLVNSISDLKTEYARALAQAQA
A0A2S6V636      FSQTDLEEAQAQLAKAQAELASFQQATGLTEVAE-QTRALIAQQRELRTTYTNVLSQAQA
A0A6P0IXR4      ------------------------------------------------------------
A0A1D9G3S3      FNKKALERAKQKLDQSQEALAKFQESSGLVNSKA-QTEGLVRAITDLSISQAQAQAEAQA
A0A6P0KRF3      FNKKALERAKQKLDQSQEALAKFQESSGLVNSKA-QTEGLVRAITDLSISQAQAQAEAQA
A0A6P0LQ61      FNKKALERAKQKLDQSQEALAKFQESSGLVNSKA-QTEGLVRAITDLSISQAQAQAEAQA
A0A1D8TWE6      FNKKALERAKQKLDQSQEALAKFQESSGLVNSKA-QTEGLVRAITDLSISQAQAQAQAQA
A0A6L9YP52      FNKKALERAKQKLDQSQEALAKFQESSGLVNSKA-QTEGLVRAITDLSISQAQAQAQAQA
A0A6P0L3X9      FNKKALERAKQKLDQSQEALAKFQESSGLVNSKA-QTEGLVRAITDLSISQAQAQAQAQA
A0A6M0A6X4      FNKKALERAKQKLDQSQEGLAKFQESSGLVNSKA-QTEGLVRAITDLSISQAQAQAQAQA
A0A1U7N3U5      FNKKALERAKQKLDQSQEALAKFQESSGLVNSKA-QTEGLVRAITDLSISQAQAQAQAQA
A0A6L9ZB93      FNKKALERAKQKLDQSQEALAKFQESSGLVNSKA-QTEGLVRAITDLSISQAQAQAQAQA
A0A6P0S980      FNKKALERAKQKLDQSQEALAKFQESSGLVNSKA-QTEGLVRAITDLSISQAQAQAQAQA
A0A2T1EZA0      FLDEQAPAIEERVQKLSQEMLKFRERNNFVDPAA-AAGQILGAREGLVNQLRTLQNEQVQ
A0A1U7JBN8      FLDEQLQEKWQEVAAIEGDLSEFQKRYDLVDVNA-TSESVTQRLNQMLADQEQLRVELSA
A0A2W4VXF4      FLDEQLQEKWQEVDTIESDLSEFQKRYDLVNVTT-TAESVAQRLNQMLSDQEQLRVQLTS
A0A2W7AI98      FLDEQLQEKWQEVDTIESDLSEFQKRYDLVNVTT-TAESVAQRLNQMLSDQEQLRVQLTS
A0A6G3Z347      FVDEQLPIVRDRVEQLEAELEGLRQRSNLIDPLQ-QGEQLSQKAAEFTAEQLNLRVQIQE
A0A2P8QVH5      FVNEQLPKIRKDVSQAEANLENFRKQNKLLDPEV-QAKNLLDALAAVESERRTIRAQFQD
A0A2T1FT70      FVNEQLPKIRKDVSQAEANLENFRKQNKLLDPEV-QAKNLLDALAAVESERRTIRAQFQD
A0A433W4W4      FVNEQLPKIRKDVSQAEANLENFRKQNKLLDPEV-QAKNLLDALAAVESERRTIRAQFQD
K9U5W1          FVNEQLPKIRKDVSQAEANLENFRKQNKLLDPEV-QAKNLLDALAAVESERRTIRAQFQD
L8M1L4          FIEEQLPKAEEELNKAAFAIRSFRQKNNLVDPDE-YVGRVADFRQSLEEELKRGEIALD-
A0A7G8GTF0      FLNRQSPDLEKEVENMQLKLADFRRVHSMVDPLR-TGENIKKNENKIRDEILEIEKSRDR
A0A7G8H3H8      FLDSQSPELEKDVEKMQLKLAEFRRVNSMVDPLR-TGQNLKRNEDKIRDEVLEIEKTRDR
A0A4P5VLH9      FLEQQAPRLRNNVTKLEAQLLDFRQKYNVLDPSG-LAEKIVSNRDDLVAKSMALQVEHND
A0A2W6ZN45      FLGQQAPALQQRVNSLQRTLKQFRESNSFLEPLA-QGGSIISSRDGLLGQLRTLQVEQAE
A0A081GP61      FLDQQAPAIEARVQKLSNEMLRFRERNNFVDPAT-AAGQILGARDGLVNQLRDLQNEQVQ
K9P6R9          FLDEQAPAIEERVQKLSQEMLKFRQRNNFVDPAT-AAGQILGAREGLVNQLRTLQNEQVQ
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
A0A5B8NQW4      ------------------------------------------------------------
A0A6P0XUL2      ------------------------------------------------------------
                                                                            

A0A355DU96      ------------------------------------------------------------
A0A2N6LHT1      LRSKEASLQQVT--------------------------DAKALNQAYAAVRGGQDEELKA
A0A328V843      VQSLVNSLGNQV--------------------------GLN-LEEAIAVNTLSQSPVVRA
A0A2T1DKP1      ------------------------------------------------------------
A0A0D6KL48      --------------------------------------MKLNTDTAVELTTLSQSPGVQQ
A0A6M0AN00      ------EAVQQK--------------------------LARSPQNALTSSRLSQSGRYQN
A0A6P0ITZ8      ------------------------------------------------------------
A0A6P0SLN0      ------------------------------------------------------------
A0A2T1CC83      ------------------------------------------------------------
A0A1B7WWU1      ------------------------------------------------------------
A0A6P0S1R8      ------------------------------------------------------------
A0A0A2B4S6      LNNLLNSIENGSLT------------------------AYGFKQAITTDLNLNERIPTEG
K9SGV8          IDAQSDQLGNLVAD------------------------EIDSVEQALLRTALSQSPHTAG
B0CA08          VQTQQLSLQNML--------------------------KVNP-QQAI----LGISTAHKN
B0BZC6          VQARGLALSKVI--------------------------DQSSGKESYLSAKAGQNPELIS
A0A6G3Z709      LDAQSARIQGQL--------------------------GLNV-SEGLALSSLNQSDGVQE
A0A6P0M090      ANAQAAGLRNQV--------------------------GLNP-QQAIAISALSQSTSVQG
A0A563VX16      TQSKYESLEQQL--------------------------ATTG-NVDSVDSRLSLSSRYQN
A0A0V7ZGW0      TATRSQELSRTL--------------------------GMAP-QQAINSLRLSENKEYQA
A0A355DPN1      TQARYRVLQQQL--------------------------ERSP-QEALTSSRLSQSPRYQA
A0A6J4NIB3      NETQAKAVAARL--------------------------STTP-QQAMNSLSLSENKEYQA
A0A6M0AB25      SKAQVETLSARL--------------------------ELNP-EQAIRSLSLGENQDYQF
A0A1D8TTM0      SKAQVETLSARL--------------------------ELNP-QQAIRSLSLGENQDYQF
A0A6P0VB93      SKAQVETLSARL--------------------------ELNP-EQAIRSLNLGENQDYQF
A0A6P0W0Y0      SKAQVETLSARL--------------------------ELNP-EQAIRSLNLGENQDYQF
A0A0V7ZMP6      AQAQTRILSARL--------------------------SLPP-QTALKSLQTKGTETSLS
A0A433W046      NATQAQAAAVSL--------------------------GITP-QQAMNSLRLGENKEYQA
K9TU02          NATQAQAAAVSL--------------------------GITP-QQAMNSLRLGENKEYQA
A0A2T1FMA8      NATQAQAAAVSL--------------------------GITP-QQAMNSLRLGENKEYQA
A0A2P8QV10      NATQAQAAAVSL--------------------------GITP-QQAMNSLRLGENKEYQA
B8HQ70          SNAQQQALSQHL--------------------------RLTP-QAAMTTLRLGENKEYQL
A0A2S6V636      NQAQAQAASERL--------------------------GINA-QQAMNSLRLGENREYQA
A0A6P0IXR4      ------------------------------------------------------------
A0A1D9G3S3      SQHQLQILSTRL--------------------------GLTP-KQAIRSLGLAENRDYQF
A0A6P0KRF3      SQHQLQILSTRL--------------------------GLTP-KQAIRSLGLAENRDYQF
A0A6P0LQ61      SQHQLQILSTRL--------------------------GLTP-KQAIRSLGLAENRDYQF
A0A1D8TWE6      SQHQLQILSTRL--------------------------GLTP-KQAIRSLGLAENRDYQF
A0A6L9YP52      SQHQLQILSTRL--------------------------GLTP-KQAIRSLGLAENRDYQF
A0A6P0L3X9      SQHQLQILSTRL--------------------------GLTP-KQAIRSLGLAENRDYQF
A0A6M0A6X4      SQHQLQILSTRL--------------------------GLTP-KQAIRSLGLAENRDYQF
A0A1U7N3U5      SQHQLQILSTRL--------------------------GLTP-KQAIRSLGLAENRDYQF
A0A6L9ZB93      SQHQLQILSTRL--------------------------GLTP-KQAIRSLGLAENRDYQF
A0A6P0S980      SQHQLQILSTRL--------------------------GLTP-KQAIRSLGLAENRDYQF
A0A2T1EZA0      LDSQLKSIQTGKLQFTPSGAPTALEQLGRNS-------VLVP-GRG--DSAAEAASGTKT
A0A1U7JBN8      LAPLYENLREQV--------------------------GFDP-NTAIRVANLNESPTYQA
A0A2W4VXF4      LGPLYENLRSQV--------------------------GFEP-SVAIGVANLNESPTYQG
A0A2W7AI98      LGPLYENLRSQV--------------------------GFEP-SVAIGVANLNESPTYQG
A0A6G3Z347      AEQLSQNLQRE---------------------------LLEG-EESAVTSALLESERYQN
A0A2P8QVH5      QQARYNKLQQQI--------------------------SRSP-QQALIASRLSQSPRYQS
A0A2T1FT70      QQARYNKLQQQI--------------------------SRSP-QQALIASRLSQSPRYQS
A0A433W4W4      QQARYNKLQQQI--------------------------SRSP-QQALIASRLSQSPRYQS
K9U5W1          QQARYNKLQQQI--------------------------SRSP-QQALIASRLSQSPRYQS
L8M1L4          IAQTKYRTISNQL--IELGQDPETIV--TTS-------------------VLGQDGVYQS
A0A7G8GTF0      LLQARSEIVAGNV--SALGYKEGITDRGSGA-------------------QLTISDVDQS
A0A7G8H3H8      LLQARSEIVAGNV--SALGYQEGITDRGSGA-------------------RLTISDVDQS
A0A4P5VLH9      LKSKLASVQSGRLNWTPSGAPTPIQQLGRQG-------TVIP-GRSDANDSNEIGAGQTT
A0A2W6ZN45      LETQLASVRSGKLITLPSPGSSGSGVVGQGSPAAGNPQLGLA-TRPRADSVAPSSNTVVT
A0A081GP61      LDSQLQSIQSGKLQFSSSGAPTAIQQLGRNS-------VLVP-GRANQNQGAEVAKGTPT
K9P6R9          LDSQLKSIQTGKLQFTPSGAPTALEQLGRNS-------VLVP-GRG--NSAAEASSGTKT
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
A0A5B8NQW4      ------------------------------------------------------------
A0A6P0XUL2      ------------------------------------------------------------
                                                                            

A0A355DU96      ------------------------------------------------------------
A0A2N6LHT1      LR---------NKLAEIETQLVQARLSLTDNHPTVINLLGQRNGLRALYQQGLARVSPRN
A0A328V843      AL---------QELENVEGELAQEQRRFRDENPRIISLKGKRDNLENLLQREIQVYLGSS
A0A2T1DKP1      ----------------------VEQTRYRSGHPAIANLERKVDALNALLQERIGQVVSNG
A0A0D6KL48      VL---------TEYQKVQDELAVARTRLTEDNPKIINLENQAVALKNQLEGRVAQTIGNS
A0A6M0AN00      LL---------NEIQRIELALVEQSRIYTEAHPTIQKLIEQRQSVFALLQEETRRVLGQ-
A0A6P0ITZ8      ------------------------------------------------------------
A0A6P0SLN0      ----------------------------------MQALLEQREELQNQIKGYIFQARAAQ
A0A2T1CC83      ------------------------------------------------------------
A0A1B7WWU1      ------------------------------------------------------------
A0A6P0S1R8      -------------------------------------------------QGQIEGYIALA
A0A0A2B4S6      VSFINLDLELLDQYILVKQKLAIARTKYLEDSEIVKGLKYRVEQIEPTLKSNQ-------
K9SGV8          VM---------GELQQTKQAIATQLAIYREDSPQIAVLRDQERNLEQLLRQRAKQVAGIP
B0CA08          IS---------TSLEEIDKDLAEAKSNFREDHPAVLELLERQAQLKQLLSQKI--EKFAQ
B0BZC6          LR---------DQLSNLESQLKIRRESLTDDHPDIQKLITEKDAAQALYQQKL--ATISP
A0A6G3Z709      SL---------SELQNIQAELAEERSRYREGHPAIDMLERREAEAEALLGSRIQEVLG--
A0A6P0M090      VL---------QELQEVERQLAVGRNRYGKNHPVMIRLTKHQRSLRGHLQQQIDQILGSQ
A0A563VX16      LL---------NELQRIDIELETQRSRFTDSNPIVQGLLTERRQKQQLLEKEA--GNI-L
A0A0V7ZGW0      LR---------QKLTEVNTEIAVNRGTLTEEHPTVRALLQQRQKLLMALNRQL--NAVVP
A0A355DPN1      LL---------NELQKTELAIAQQRVKFTDAEPRVEQLLEQRQRQLALLQEET--QRVLG
A0A6J4NIB3      IR---------EEVSLVETALSQARGKFTEQSPQVQALLLQRQELRRDLNQRL--AKAIP
A0A6M0AB25      FR---------QELSEVEALLTETQAKFTDGHPQVQALLEQRQDLQDQIERYI--FQA--
A0A1D8TTM0      FR---------QELSEVEALLTETQAKFTNENPQVQALLEQREELQNQIEGYI--FQA--
A0A6P0VB93      FR---------RELSKIEALLTQTQAKFTDEHPQVKALLEQREELQGQIEGYI--TQA--
A0A6P0W0Y0      FR---------RELSKIEALLTQTQAKFTDEHPQVKALLEQREELQGQIEGYI--ALA--
A0A0V7ZMP6      IR---------EKLSKVNISLQEAQTYLTDNHPRIENLKFQQEELRNELQED---RVSDN
A0A433W046      TR---------TQLSQLESTMAVTRSKYRDDSPQVQSLLQQRQQLLRQLNQQI--AVAIP
K9TU02          TR---------TQLSQLESTMAVTRSKYRDDSPQVQSLLQQRQQLLRQLNQQI--AVAIP
A0A2T1FMA8      TR---------TQLSQLESTMAVTRSKYRDDSPQVQSLLQQRQQLLRQLNQQI--AVAIP
A0A2P8QV10      TR---------TQLSQLESTMAVTRSKYRDDSPQVQSLLQQRQQLLRQLNQQI--AVAIP
B8HQ70          VR---------DRLAQVEADLATARGTLTDDNPRVQDLLEQRQKLTQLLDQNL--RAAIG
A0A2S6V636      IR---------QKLSDAETALAEARSRYTDESPQVQSLLSQRQELMQLLNQQI--AIAAP
A0A6P0IXR4      -----------------------------------QNLLLQREQLQQQIQQYI--FLA--
A0A1D9G3S3      VR---------QQLTELEATLVKAQATYTYAHPEIQNLLLQREQLQQQIQQYI--FLA--
A0A6P0KRF3      VR---------QQLTELEATLVKAQATYTYAHPEIQNLLLQREQLQQQIQQYI--FLA--
A0A6P0LQ61      VR---------QQLTELEATLVKAQATYTYAHPEIQNLLLQREQLQQQIQQYI--FLA--
A0A1D8TWE6      VR---------QQLTELEATLVKAQTTYTYAHPEIQNLLLQREQLQQQIQQYI--FLA--
A0A6L9YP52      VR---------QQLTELEATLVKAQTTYTYAHPEIQNLLLQREQLQQQIQQYI--FLA--
A0A6P0L3X9      VR---------QQLTELEATLVKAQTTYTYAHPEIQNLLLQREQLQQQIQQYI--FLG--
A0A6M0A6X4      VR---------QQLTELEATLVKAQTTYTYAHPEVQNLLLQREELQQQIQQYI--FLA--
A0A1U7N3U5      VR---------QQLTELEATLVKAQTTYTYAHPEIQNLLLQREELQQQIQQYI--FLA--
A0A6L9ZB93      VR---------QQLTELEATLVKAQTTYTYAHPEIQNLLLQREELQQQIQQYI--FLA--
A0A6P0S980      VR---------QQLTELEGTLVKAQTTYTYAHPEIQNLLLQREQLQQQIQQYI--FLA--
A0A2T1EZA0      PL---------DLLNQFEQELATAKGTFKENSPIVQSLLARRNQLLPVVQR-----QAAD
A0A1U7JBN8      LL---------GDLREIEQTIAAESARFQADTPMIEALTDQRQQLLPLLEAEA--QRLVG
A0A2W4VXF4      LL---------GDLREIEQTIAAESARFQSDTPMIEVLVDQRQQLLPLLEAEA--GRLVG
A0A2W7AI98      LL---------GDLREIEQTIAAESARFQSDTPMIEVLVDQRQQLLPLLEAEA--GRLVG
A0A6G3Z347      LL---------NQMLELDGQLAEELTLYLEDSPEIEVIREQRENLQPLLQREG--IRVQD
A0A2P8QVH5      LL---------DEIQALDVTLEKLRVQYRDDYPKVQDLLKQRQNLIGLLRTEA--GRSAD
A0A2T1FT70      LL---------DEIQALDVTLEKLRVQYRDDYPKVQDLLKQRQNLIGLLRTEA--GRSAD
A0A433W4W4      LL---------DEIQALDVTLEKLRVQYRDDYPKVQDLLKQRQNLIGLLRTEA--GRSAD
K9U5W1          LL---------DEIQALDVTLEKLRVQYRDDYPKVQDLLKQRQNLIGLLRTEA--GRSAD
L8M1L4          LA---------SQLKDLETQYTLASVQFKDNYPMMQDLKLQREQLRNLLLE-----RSTQ
A0A7G8GTF0      LL---------KEMQKVESLLAAARSTYQPDSLMVRGLSKRLENLRPLLIS-----NQLD
A0A7G8H3H8      LL---------KEMQKVESQLAAARSTYQPDSLMVRGLSKRLENLRPLLIS-----NQLD
A0A4P5VLH9      PN---------ETLDEFEQKLANARAVYKDDSPIVQSILAQRDAILPVVRK-----QATD
A0A2W6ZN45      PQ---------QQLSQLDQQIATARATFKSDSPQLQTLLAQRNRIKPLVQS-----QGID
A0A081GP61      PL---------DLLNQFEQELATAKGTYKQNSPIVQSLLARRNQLLPVVQR-----QASD
K9P6R9          PL---------DLLNQFEQELATAKGTFKENSPIVQSLLARRNQLLPVVQR-----QAAD
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
A0A5B8NQW4      ------------------------------------------------------------
A0A6P0XUL2      ------------------------------------------------------------
                                                                            

A0A355DU96      ------------------------------------------------------------
A0A2N6LHT1      QSISSGSV--------------------------AGDQISQDLTSQLIINDVERLALENK
A0A328V843      RPFSRGLL--------------------------RVMDVKNNKIEEFVNAEIRRLDLTKQ
A0A2T1DKP1      GPVPTGNL--------------------------QLGDLQQGLISDLVRSEAERVGLSER
A0A0D6KL48      EYMPEQNL--------------------------QIGNLKQTLTENLVKSEVERLALTNQ
A0A6M0AN00      --VPTQLVT----------------TGNNLLTEGQLGGVDINLVNELITSQINLVSLQTR
A0A6P0ITZ8      -------------------------------------------SSRFILSETERSALEQK
A0A6P0SLN0      PGVNATIGQ-----------------------------ESAALIRQLILAESQTQAYYSQ
A0A2T1CC83      ------------------------------------------------------------
A0A1B7WWU1      ---------------------------------------------------------TKQ
A0A6P0S1R8      QADEAEVNA-----------------T--------IGQESAALIEQLILAESQTQAYYSQ
A0A0A2B4S6      ----------------------------------------------ISALISAREIIDKN
K9SGV8          PSESIDIDA-----------------L------FQIGGLQEQSVQQFYSLDNERVGLLEE
B0CA08          SDAQLNFDS-----------------N-----------QEDDLRSQLIQLDIRRNGLSKQ
B0BZC6          RSRLNSDGT-----------------V-----QVANEKVTQELSEKLVLSVVERNELRDK
A0A6G3Z709      --RELTVPV-----------------EDLNVGRLQLGELRQNLIAELTRLEVERIGVNNR
A0A6P0M090      SLAGTQIQI-----------------T---EGLLEVDELKQKLISDFIESEVKRRSLAEG
A0A563VX16      GSTNLQVSS-----------------SDNLESRGQLDSSNLELAEALASTRNELIGLESR
A0A0V7ZGW0      SADG--IDA-----------------N---FGGNNFKDATIELIAQLIQVESESKGLQQQ
A0A355DPN1      ETSTQIAFS-----------------TQNLLTEGQLGSNDLTLSSQLAEAQTTLQALQAR
A0A6J4NIB3      GVKAETVDI-----------------T---LGGGNGKDSRVEMISKMIGAQTLAQGLQQQ
A0A6M0AB25      RAAQSGVNA-----------------T---IG-----QESAALIRQLILAESQTQAYYSQ
A0A1D8TTM0      RAAQPGVNA-----------------T---IG-----QESAALIRELILAESQTQAYYSQ
A0A6P0VB93      QADEAEVNA-----------------T---IG-----QESAALIEQLILAESQTQAYYSQ
A0A6P0W0Y0      QADEAEVNA-----------------T---IG-----QESAALIEQLILAESQTQAYYSQ
A0A0V7ZMP6      SVSSVAINP-----------------N---L-------ADRHIVHKLILAESQAEAMSSK
A0A433W046      GANAAQIDT-----------------T---L-GNGPNDSRLELMVELIRNQTLAQGTQQQ
K9TU02          GANAAQIDT-----------------T---L-GNGPNDSRLELMVELIRNQTLAQGTQQQ
A0A2T1FMA8      GANAAQIDT-----------------T---L-GNGPNDSRLELMVELIRNQTLAQGTQQQ
A0A2P8QV10      GARPAQIDT-----------------T---L-GNGPNDSRLELMVELIRNQTLAQGAQQQ
B8HQ70          NSSLAGVDR-----------------S---LAGSAAGDSRIALIADLIRTQSTANGQQSQ
A0A2S6V636      GASANQIDP-----------------T---LGGNGTRDSRIEMIAELIRAQNNAAGLQQQ
A0A6P0IXR4      -AGDTLVDP-----------------T---L--TDSAQGRAMLIQQLILAESAASGQQQQ
A0A1D9G3S3      -AGDTLVDP-----------------T---L--TDSAQGRAMLIQQLILAESAASGQQQQ
A0A6P0KRF3      -AGDTLVDP-----------------T---L--TDSAQGRAMLIQQLILAESAASGQQQQ
A0A6P0LQ61      -AGDTLVDP-----------------T---L--TDSAQGRAMLIQQLILAESAASGQQQQ
A0A1D8TWE6      -AGDTLVDP-----------------T---L--TDSAQGRAMLIQQLILAESAASGQQQQ
A0A6L9YP52      -AGDTLVDP-----------------T---L--TDSAQGRAMLIQQLILAESAASGQQQQ
A0A6P0L3X9      -AGDTLVDP-----------------T---L--TDSAQGRAMLIQQLILEESAASGQQQQ
A0A6M0A6X4      -AGDTLVDP-----------------T---L--TDSAQGRAMLIQQLILAESAASGQQQQ
A0A1U7N3U5      -AGDTLVDP-----------------T---L--TDSAQGRAMLIQQLILAESAASGQQQQ
A0A6L9ZB93      -AGDTLVDP-----------------T---L--TDSAQGRAMLIQQLILAESAASGQQQQ
A0A6P0S980      -AGDTLVDP-----------------T---L--TDSAQGRAMLIQQLILAESAASGQQQQ
A0A2T1EZA0      AVKARLLAN------------------------------------------------VAQ
A0A1U7JBN8      SAVEAETLG-------------------------YQGSVSQDLMQQLVNTANQMQVLQTQ
A0A2W4VXF4      SAVDANTLG-------------------------YQGSVSRELVQQLVDTANQMQVLETQ
A0A2W7AI98      SAVDANTLG-------------------------YQGSVSRELVQQLVDTANQMQVLETQ
A0A6G3Z347      QLANFTREL------------------------------------------------QVR
A0A2P8QVH5      RLPAQLSTT-----------------EKSLPKQLQLGDSDRKLVDALVDAQVVWFGLSAR
A0A2T1FT70      RLPAQLSTT-----------------EKSLPKQLQLGDSDRKLVDALVDAQVVWFGLSAR
A0A433W4W4      RLPAQLSTT-----------------EKSLPKQLQLGDSDRKLVDALVDAQVVWFGLSAR
K9U5W1          RLPAQLSTT-----------------EKSLPKQLQLGDSDRKLVDALVDAQVVWFGLSAR
L8M1L4          ILGEGISPAVLDKVLVSYTQTNIVAAGDSGSQVSTSGSTLQQLAEQLLSTQTEYLSLQSQ
A0A7G8GTF0      AVDAALALN------------------------------------------------KGR
A0A7G8H3H8      AVDAALALN------------------------------------------------KGR
A0A4P5VLH9      AIKAQLFAN------------------------------------------------ESQ
A0A2W6ZN45      QLSSQLFAN------------------------------------------------QAQ
A0A081GP61      AVKARLLSN------------------------------------------------LAQ
K9P6R9          AVKARLLAN------------------------------------------------VAQ
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
A0A5B8NQW4      ------------------------------------------------------------
A0A6P0XUL2      ------------------------------------------------------------
                                                                            

A0A355DU96      ------------------------------------------------------------
A0A2N6LHT1      LKVVQTNRANLQARLAQLPIQQQQLTPLTRQREESAESLKLLQSKLEEARIAEAQLVGNI
A0A328V843      LDSLYEARDGLERRARILPQLEQQQQELERKAEVARLTYRTLLQNLEEAQVAANKITNNA
A0A2T1DKP1      LSSLSNAQSAYRARANALPRLEETQRELERRLKAAQTTYEVLLSRLQEVQVAENQNIGNA
A0A0D6KL48      VAELKQVLLVNKNRLDSLPRLEQQQLQLQRQLKVAQVTYEQLSKQLQEVEVVENQNVGNA
A0A6M0AN00      DQALIKTEQEIRIQLREFPALIAQYNRLQPQVAIKQNTLQQLLQARQELS-IELARGGFN
A0A6P0ITZ8      LYLVQTERIKLQNRLGQIPVLGQPFANLVRRQEEAIASLKLLQNKLEEARIAEAQLVSNI
A0A6P0SLN0      GKQIQTQIDQLGSTLKTLPAAQARLVQLQQQYDIAEGVYNGLVAQVQQSKLNALSSYPSV
A0A2T1CC83      VGALYNSQQDLIKRAKVLPQLEQKDRELVRQAESAGKTYETLLNNLQEATIAANSKSGNA
A0A1B7WWU1      VEELQRVFIFNRRRLDSLPRLEQQQLQLQRQLTVAQITYQEFLKQYQLVQVLENQNVGNS
A0A6P0S1R8      SKQIQIQIDQLNDTLKTLPAAQAQLVELQQQYNIAEGVYNGLVAQVQETKLNAFSSYPSV
A0A0A2B4S6      IQNAKIKIKSLKEKFEKQPKLISEYKTLQQKALLAAKNLEGLSSAKEKFQLEIAQRSVPW
K9SGV8          ISALNDVYSNYRERYRELPKLEQEERRLERKVTVAESTYAELLQQLQEVRIAEQQNIGNT
B0CA08          QLKLRQQLSSYRQQARNLPQLEQRQNELERTAKASASTYRNLLEQIQELKVTENQSPLTV
B0BZC6          LANTRAYISKLDARRKQYPVLEKTLASLQRKKEGATESVNLLRQKLDEARIAEAQLVSNL
A0A6G3Z709      MAQLTNSRNSFLLRANNLPQLEKLERELERNLQAAQTTYETLLTQLQEIRVIENQTVGNV
A0A6P0M090      LATLAKARIAYEQRVNVLPRLEQTQQQLEQRLQAARFTYETLLKNLNELKVAENQDTANA
A0A563VX16      ERSLALTEQKLKEKLNQFPDLIAQYNSLEQEVAVHQATLKKLLESRQEIGIVINRGGFSW
A0A0V7ZGW0      VLIIQNKLERLQTELKNISTLQAQLLDLQRQYDIAEGVYKGIVAQLEQSKIAAFNAYPNL
A0A355DPN1      DRSLAITQQQLRAKLNRLPELMAEYERLQPEVQIRRDTLQKLLEARQELGIEIARGGFKW
A0A6J4NIB3      ANQLANQEAKLTGELGHISRNQGQLLDLQRQYEVAQGAHNGIIAQIEQAKTSPFNAYPNI
A0A6M0AB25      GKQIQTQIDQLGSTLKTLPAAQARLVQLQQQYDIAEGVYNGLVAQVQQSKLNAFSSYPSV
A0A1D8TTM0      GKQIQTQIDQLGSILKTLPAAQARLVQLQQQYDIAEGVYNGLVAQVQQSKLNAFSSYPSV
A0A6P0VB93      SKQIQIQIDQLNDTLKTLPAAQAQLVELQQQYNIAEGVYNGLVAQVQETKLNAFSSYPSV
A0A6P0W0Y0      SKQIQIQIDQLNDTLKTLPAAQAQLVELQQQYNIAEGVYNGLVAQVQETKLNAFSSYPSV
A0A0V7ZMP6      AQQLQIQINYLREQLKKLPTKQGILMDLQRRYDMTKKIYNGLVTQAEKVRLSAFDTYPSF
A0A433W046      AKQIQKQIDKLNTELSFITKNQAQLLDLQRKYEIAEGVYKGIIAQSEQSKTNPFNAYPNV
K9TU02          AKQIQKQIDKLNTELSFITKNQAQLLDLQRKYEIAEGVYKGIIAQSEQSKTNPFNAYPNV
A0A2T1FMA8      AKQIQKQIDKLNTELNFITKNQAQLLDLQRKYEIAEGVYKGIIAQSEQSKTNPFNAYPNV
A0A2P8QV10      AKQIQKQVDKLNTELNFITKNQAQLLDLQRKYEIAEGVYKGIIAQSEQSKTNPFNAYPNV
B8HQ70          AQQLQQQLGQQVTALNRLSNKQVQLLELQREYSIAEGVYKGVMAQFQQAKISTLSSYPSV
A0A2S6V636      ANQIASEINRVNAELNNIAQNRAQLINLQRQYEIAEGVYKSILAQVEQTKTNPFNVYPNV
A0A6P0IXR4      AEQLQQQIDQMKSTLTVIPVHQSRLLELKRQYDVAAGVYNGLVAQMEQVNLDAFSAYPNV
A0A1D9G3S3      AEQLQQQIDQIKSTLTVIPVHQSRLLELTRQYDVAAGVYNGLVAQMEQVNLDAFSAYPNV
A0A6P0KRF3      AEQLQQQIDQMKSTLTVIPVHQSRLLELTRQYDVAAGVYNGLVAQMEQVNLDAFSAYPNV
A0A6P0LQ61      AEQLQQQIDQMKSTLTVIPVHQSRLLELTRQYDVAAGVYNGLVAQMEQVNLDAFSAYPNV
A0A1D8TWE6      AEQLQQQIDQMKSTLTVIPVHQSRLLELKRQYDVAAGVYNGLVAQIEQVNLDAFSAYPNV
A0A6L9YP52      AEQLQQQIDQMKSTLTVIPVHQSRLLELKRQYDVAAGVYNGLVAQIEQVNLDAFSAYPNV
A0A6P0L3X9      AEQLQQQIDQIKSTLTVIPVHQSRLLELKRQYNVAAGVYNGLVAQMEQVNLDAFSAYPNV
A0A6M0A6X4      AEQLQQQIDQMKSTLTVIPVHQSRLLELKRQYDVAAGVYNGLVAQMEQVNLDAFSAYPNV
A0A1U7N3U5      AEQLQQQIDQIKSTLTVIPVHQSRLLELKRQYDVAAGVYNGLVAQMEQVNLDAFSAYPNV
A0A6L9ZB93      AEQLQQQIDQIKSTLTVIPVHQSRLLELKRQYDVAAGVYNGLVAQMEQVNLDAFSAYPNV
A0A6P0S980      AEQLQQQIDQIKSTLTVIPVHQSRLLELKRQYDVAAGVYNGLVAQMEQVNLDAFSAYPNV
A0A2T1EZA0      QDEINRQILLLSENFRNNPQKLAEFENINQRLSIAREQYSSYIQARERYRLEMARSISPW
A0A1U7JBN8      DQAIGQAVQLLRAEIQRLADLSRSYQQISRELTVAETSLDQLLASRQDLRFQMARQASPW
A0A2W4VXF4      DQAIAQAVQQLRAEIQRLADLSRSYQQIDRELTVAESSLDRLLTSRQDLRLQMARQTAPW
A0A2W7AI98      DQAIAQAVQQLRAEIQRLADLSRSYQQIDRELTVAESSLDRLLTSRQDLRLQMARQTAPW
A0A6G3Z347      DQALTRAITTLNQQIKDLSTTTRTYNNIQRELEIATANLNQFLTKREALRIDAAQRQTPW
A0A2P8QVH5      DQSLAKSEQQLRSTLLKYPQLLAEYNRLMPEIAINRKTLEQLLQTQQNLGIKIAQGGFNW
A0A2T1FT70      DQSLAKSEQQLRSTLLKYPQLLAEYNRLMPEIAINRKTLEQLLQTQQNLGIKIAQGGFNW
A0A433W4W4      DQSLAKSEQQLRSTLLKYPQLLAEYNRLMPEIAINRKTLEQLLQTQQNLGIKIAQGGFNW
K9U5W1          DQSLAKSEQQLRSTLLKYPQLLAEYNRLMPEIAINRKTLEQLLQTQQNLGIKIAQGGFNW
L8M1L4          INQINQAKANVEADFQRLPQLQEIYTRLQRNIKIQSQAVDYLLQRKQELQIAAAEEITPW
A0A7G8GTF0      LINAEKRAEDTEKRFLSIQNIIKEYESLQERLNQARSKLNGLVSAREAFELDSAQNSVPW
A0A7G8H3H8      LMNAKKRAEDVEEKFLFTQNIIREYEGLQERLAQARSKLSGLTSAREAFEFDNAQNSVPW
A0A4P5VLH9      QDELNRQILLLNENFKNSPSLMKKYEELASNLKSARENYSSYLIARDNYRLQRARSTSPW
A0A2W6ZN45      QNELNRQILLLNKNFKQSPEEIRKYEELQQKIEVAQANYLSYIQARENFRLEVAKQTVPW
A0A081GP61      QDEINRQILLLNQNFRNNPQKLSEFENINQRLSIAREQYSSYIQARERYRLEMARSITPW
K9P6R9          QDEINRQILLLSENFRNNPQKLAEFENINQRLLIAREQYSSYIQARERYRLEMARSISPW
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
A0A5B8NQW4      ------------------------------------------------------------
A0A6P0XUL2      ------------------------------------------------------------
                                                                            

A0A355DU96      -----ASIPEAPVSPKKKLILVGGIVAGSLLYIVTAFVLDLMDPSIKTAKEIRQLF--KY
A0A2N6LHT1      QIIEAAQPPTQPSLPNKRTVLAIAIVVGTALATGIVLLLELMDHTLKDASEAEELL--KL
A0A328V843      RIIETANVPDEGK-TAKVPLLALGVMGGLVASTTLLLLMEMGDKSLRTVAETRDLF--GY
A0A2T1DKP1      RALSSAIVSERSSNRKM--GLALGGGVGILLAVAAAFAADLLDRSVKTLKEVKDLF--GY
A0A0D6KL48      RVISEALVADKSVSPIIPLNLALGGILGIILGAGTALVLESIDNSLKTVEEAKRLL--DY
A0A6M0AN00      WQVVEAPLPGFKTGPNMTQDLLLGAVVGLFLGGVAAFVREAMDDGIHTSDDLKNQV--AL
A0A6P0ITZ8      QIIERAKLPSSPKQPNPKLVLVIATAAGIAIAVGMVLLLEVMDNTLHDASEAEALL--KL
A0A6P0SLN0      QVFEEPRADSKPSGPGRR-PIALGTILASVFGSAALISFLENRDPLLSPRDLQ-AI--SI
A0A2T1CC83      DVVEYAAVPDKGNSGRAV-LMGMGLIMGAFLANLSVILLEMQDRSISSLAEIKKKFPYQT
A0A1B7WWU1      RVISEALVPELPVSPKIPLNLALGGFLGVLLGAGTALLLESMNQSLKNIEEANRLL--GF
A0A6P0S1R8      QVFEEPRADSEPSGPGRL-PIALGTILASAFGSVALILFLENRDPLLSPKDLQ-AI--SI
A0A0A2B4S6      SIIAPPKVYPVPVSPDIPLNLSLSLIFGPVLGLIVGLIRDKVDHVYHSPDEVKENL--NL
K9SGV8          RILSLASTPIDIVTPRRPRNVSLGLLLGLSAAGGAVFLLEAFDKKIKSTAAARELL--GF
B0CA08          SILESAT-DPEPSKTTFISAAMRGGLAGILLASGVVYVLERIDRKLKSKDEIRQVY--PY
B0BZC6          RIIEEANKPTLPSYPNIPSFLVLGMMAAVALSAGVTLSAEGMDGRLRDLESIAENT--NV
A0A6G3Z709      RIVSLAQVPNNPVASNSRLYVIAGGFVGVLMAIAVAFLLDLLDSSIKTVKEIK-ELFAGY
A0A6P0M090      RIIEPAIVPKKPLGDKKLKVLALGVMLGVTLATTAVLLLEMRDRSIKTLKEVKQLL--RY
A0A563VX16      EIIEPPQQGLQISPNITQ-DLVLGGIVSVFLGAVSVVIMEASDNKIRVSRQLQEKV--NF
A0A0V7ZGW0      QVLDQPTVDPKPTSPKKS-LIAIGGILTSVFASLALILFSESRNPLLKQKDLQ-DI--EL
A0A355DPN1      QVVEPPKPGKQMGPDTRR-DLMLSVVVGLFLGGLAAFGREALDDAVHSSEELKRQV--AL
A0A6J4NIB3      QTLDEPTAGAAPKGNKRW-LIVLGGTLASFLGSAALLLFLESRKPLLSPRDLQ-QV--EF
A0A6M0AB25      QVFEKPRADSKPSGPGRR-PIALGTILASMFGSAAIVLFLESRNPLLSLQDLQ-AT--NL
A0A1D8TTM0      QVFEEPRADSKPSGPGRR-PIALGTILASVFGSAAIVLFLESRNPLLSLQDLQ-AI--SI
A0A6P0VB93      QVFEEPRADSEPSGPGRL-PIALGTILASAFGSVALILFLENRDPLLSPKDLQ-AI--SI
A0A6P0W0Y0      QVFEEPRADSEPSGPGRL-PIALGTILASAFGSAALILFLENRDPLLSPKDLQ-AI--SI
A0A0V7ZMP6      QLLDEPFVNNEASSPNIQ-LIILGAVLISIFGSVAIILLQERRDPLISPKDIQ-QK--NF
A0A433W046      QTLNEPTIDPRPSIPNLR-LITTGGILAAIFGSMALIFFLENRNPLLKPKDLQ-QV--EL
K9TU02          QTLNEPTIDPRPSIPNLR-LITTGGILAAIFGSMALIFFLENRNPLLKPKDLQ-QV--EL
A0A2T1FMA8      QTLNEPTIDPRPSIPNLK-LITTGGMLAAIFGSMALIFFLENRNPLLKPKDLQ-QV--EL
A0A2P8QV10      QTLNEPTIDPRPSIPNLR-LITTGGILAAIFGSMALIFFLENRNPLLKPKDLQ-QV--EL
B8HQ70          QVLDGPLNSPRPE-PRRM-LIILGGLMAIAFGSSALVLLLESRNPLLSPADIQ-KV--KQ
A0A2S6V636      QTLDAPAIDPKPEEPSKR-AIALGGILAGLFGSISLIFFLEKRNPMLRPKDLE-QV--EF
A0A6P0IXR4      QVLDPPTVDEKPAGPKKL-LIIANGFLASAVGSIALVLLLERRNPLLSPKDLK-AI--KF
A0A1D9G3S3      QVLDPPTVDEKPAGPKKL-LIIANGFLASAVGSIALVLLLERRNPLLSPKDLQ-AI--KF
A0A6P0KRF3      QVLDPPTVDEKPAGPKKL-LIIANGFLASAVGSIALVLLLERRNPLLSPKDLQ-AI--KF
A0A6P0LQ61      QVLDPPTVDEKPAGPKKL-LIIANGFLASAVGSIALVLLLEQRNPLLSPKDLQ-AI--KF
A0A1D8TWE6      QVLDPPTVDEKPAGPKKL-LIIANGFLASAVGSIALVLLLERRNPLLSPKDLQ-AI--KF
A0A6L9YP52      QVLDPPTVDEKPAGPKKL-LIIANGFLASAVGSIALVLLLERRNPLLSPKDLK-AI--KF
A0A6P0L3X9      QVLDPPTVDEKPAGPKKL-LIIANGFLASAVGSIALVLLLERRNPLLSPKDLQ-AI--KF
A0A6M0A6X4      QVLDPPTVDEKPAGPKKL-LIIANGFLASAVGSIALVLLLERRNPLLSPKDLK-AI--KF
A0A1U7N3U5      QVLDPPTVDEKPAGPKKL-LIIANGFLASAVGSIALVLLLERRNPLLSPKDLK-AI--KF
A0A6L9ZB93      QVLDPPTVDEKPAGPKKL-LIIANGFLASAVGSIALVLLLERRNPLLSPKDLK-AI--KF
A0A6P0S980      QVLDPPTVDEKPAGPKKL-LIIANGFLASAVGSIALVLLLERRNPLLSPKDLK-AI--KF
A0A2T1EZA0      EVIGPPDFGSSPVEPNIQRNLLRAIMIGLLAGLGAAILRERTDNVFHTPMEVEKDL--QL
A0A1U7JBN8      ELISPLNETSIAQTSNLPRNLLLSTVLSLMLGGVAALLRDRLDQAFHSVDDLVKAT--QL
A0A2W4VXF4      ELISPLDESSVTEMTNLPRKLLLSTVVGLLLGGVAALVRDRADTAFHSADELVKAT--QL
A0A2W7AI98      ELISPLDESSITEMTNLPRKLLLSTVVGLLLGGVAALVRDRADTAFHSADELVKAT--QL
A0A6G3Z347      EILTPPKQPRAS-SASAKRNLVMGTVLGILLGSGVAILVDRVRGKIHTIDELKEVS--QL
A0A2P8QVH5      QIIRDPE-PGVYMGTGRIMLLVSGAVFGLVLGIGAAFLLEALDDTIHSCDELQKLS--SL
A0A2T1FT70      QIIRDPE-PGVYMGTGRIMLLVSGAVFGLVLGIGAAFLLEALDDTIHSCDELQKLS--SL
A0A433W4W4      QIIRDPE-PGVYMGTGRIMLLVSGAVFGLVLGIGAAFLLEALDDTIHSCDELQKLS--SL
K9U5W1          QIIRDPE-PGVYMGTGRIMLLVSGAVFGLVLGIGAAFLLEALDDTIHSCDELQKLS--SL
L8M1L4          QILDKPYLPAQPISPNIQKALVSSLVAGGLWAIAIAFLLHQLDN----------RI--KL
A0A7G8GTF0      RIISPPGMSHIPFSPRPKRDFIVAFVFSLVSGAAIAYVFDLRQNVFYSSKSVFSSI--KL
A0A7G8H3H8      RIISPPGMSSIPFSPRPKRDLLVGFVFSLVSSAVIAYFLDLRQNVFYSSKSVFSSI--KL
A0A4P5VLH9      QVIAPAEFNEIPVEPNLQSNLLRALMLGLVSGLGAAILRERTDNVFHTPMETEREL--QL
A0A2W6ZN45      QVISPPVFGDVPIEPDLSREFLRALFIGLAVGIAAVLLREKTDDAYHTPKEASQEL--GL
A0A081GP61      EVIGPPDFGASPVEPDIQRNLLRAIMIGLLAGLGAAILRERTDNVFHTPMEVEKEL--QL
K9P6R9          EVIGPPDFGSSPVEPNIQRNLLRAIMIGLLAGLGAAILRERTDNVFHTPMEVEKDL--QL
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
A0A5B8NQW4      ---------------------------------------------MKTVQEIKDKL--GY
A0A6P0XUL2      ----------------------------LLAGAGAATLAEKLDNKFHSPDELKQST--GL
                                                                            

A0A355DU96      -TWLGMIPESRKKGLFWQQKING------------------------NVPQLVVRDVP--
A0A2N6LHT1      -PLLGVLPRLPGHAI-------------------------------ALEPSAQFLD-H--
A0A328V843      -TLLGIIPSFAAPPFYRYL--TG---------------------GDRSSVQVPVVD-T--
A0A2T1DKP1      -TLLGVVPLLNGKPVRQRSHFEG---------------------TAHPIPRVYVRE-L--
A0A0D6KL48      -PLLGAIPQAEKAKGSEGV----------------------------GEVELPVLN-N--
A0A6M0AN00      -PLLGMIPELPEGKISKPVLNLS---------------------LSQSERALPMMELL--
A0A6P0ITZ8      -PRLGLLPKIPAQAL---SLEQP----------------------KRFLADIRLMEPY--
A0A6P0SLN0      -PVLRSIPPFKHLVL---DVDPS------------------------FGTAMEFQRLA--
A0A2T1CC83      VGITRLEPPMYQGKIVTRDEPDS-------------------------------------
A0A1B7WWU1      -PLLGTIPQHGEKNPKNPQEGRQ----------------------ELPLLDDPYSPVS--
A0A6P0S1R8      -PVLRSIPPFKHLVL---DIDPS------------------------FGTAIEFQRLA--
A0A0A2B4S6      -PLLAELPYIESFVNLRENNESI---------FNVEDKLNATKNEKSSESYLGYQRFF--
K9SGV8          -PLLGVIPNFKKVPLFPVASGNRIGRTVPELVVREAPNSPISEAFRMLQTNLKFLSLK--
B0CA08          -RVLGEIPLFDESEA---ESLKL--------PTLSDPASHLSEAYRMLQSSLKFHGLE--
B0BZC6          -PVLGVIPKQKNSRL---FPSLPFAELYNNLPLLESVRA--------LSKNIEYKNST--
A0A6G3Z709      -TLLGIIPLVKEPTR---SETEA-------------------------IGDQSYPRLL--
A0A6P0M090      -PVLGVIPVFKHKKL---SRRRDDLFFGGELPVTEQPHSMVSEVYRMIQANLKFLRSD--
A0A563VX16      -PLLGTTPGLSKIK------DSQ------------------------FSVRLPFFSGN--
A0A0V7ZGW0      -PLLARIPIFKSAPL---GLTME------------------------SDAQIPFQRLA--
A0A355DPN1      -PLLGIIPELPRTG------GSG------------------------LLVHLPFRRTQ--
A0A6J4NIB3      -PLLGRIPRLKRPDM---ERILE------------------------ADVEIEFNRLA--
A0A6M0AB25      -PILRSIPYFKHLVV---NIAPR------------------------VETEIEFQRLA--
A0A1D8TTM0      -PVLRSIPPFKHLVL---DVDPS------------------------FGTAIEFQRLA--
A0A6P0VB93      -PVLRSIPPFKHLVL---DIDPS------------------------FGTAIEFQRLA--
A0A6P0W0Y0      -PVLRSIPPFKHLVL---DIDPS------------------------FGTAIEFQRLA--
A0A0V7ZMP6      -PVLASVPYMKGLDT---SMGEG------------------------INEKVEFQRLA--
A0A433W046      -PVLGSIPHLKQPSM---ERNLA------------------------AEIDIEFQRLA--
K9TU02          -PVLGSIPHLKQPSM---ERNLA------------------------AEIDIEFQRLA--
A0A2T1FMA8      -PVLGSIPHLKQPSM---ERNLA------------------------AEIDIEFQRLA--
A0A2P8QV10      -PVLGSIPHLKQPSM---ERNLA------------------------AEIDIEFQRLA--
B8HQ70          -PILAKLPRLKAPSQ---VWNLD------------------------AEPLLGFHRLA--
A0A2S6V636      -PVLGRISRLKRADM---ERNLS------------------------GEVAIELQRLA--
A0A6P0IXR4      -PMVVNIPHLRHAGM---GLELG------------------------TETDVEFQRLA--
A0A1D9G3S3      -PMVVNIPHLRHAGM---GLELG------------------------TETDVEFQRLA--
A0A6P0KRF3      -PMVVNIPHLRHAGM---GLELG------------------------TETDVEFQRLA--
A0A6P0LQ61      -PMVVNIPDLRHAGM---GLELG------------------------TETDVEFQRLA--
A0A1D8TWE6      -PMVVNIPHLRHAGM---GLELG------------------------TETDVEFQRLA--
A0A6L9YP52      -PMVVNIPHLRHAGM---GLELG------------------------TETDVEFQRLA--
A0A6P0L3X9      -PMVVNIPHLRHAGM---GLELG------------------------TETDVEFQRLA--
A0A6M0A6X4      -PMVVNIPHLRHAGM---GLELG------------------------TETDVEFQRLA--
A0A1U7N3U5      -PMVVNIPHLRHAGM---GLELG------------------------TETDVEFQRLA--
A0A6L9ZB93      -PMVVNIPHLRHAGM---GLELG------------------------TETDVEFQRLA--
A0A6P0S980      -PMVVNIPHLRHAGM---GLELG------------------------TETDVEFQRLA--
A0A2T1EZA0      -PVLGLIPYLPLEP------GVD----------------------IAT----SISKMS-S
A0A1U7JBN8      -PNLAGVPNAPALQ------KQP----------------------LLMVPNLSATMAD--
A0A2W4VXF4      -PNLALVPNAPALQ------KQP----------------------LLMVPDLTATMAD--
A0A2W7AI98      -PNLALVPNAPALQ------KQP----------------------LLMVPDLTATMAD--
A0A6G3Z347      -PLLGTIPYEKLLE------NEQ----------------------SLALSISQLSQMGFA
A0A2P8QVH5      -PVLGITPKLPNFELKKPSIALP----------------------FFKQQSLTSQRIQ-A
A0A2T1FT70      -PVLGITPKLPNFELKKPSIALP----------------------FFKQQSLTSQRIQ-A
A0A433W4W4      -PVLGITPKLPNFELKKPSIALP----------------------FFKQQSLTSQRIQ-A
K9U5W1          -PVLGITPKLPNFELKKPSIALP----------------------FFKQQSLTSQRIQ-A
L8M1L4          VEEVKRITHLPLLG------AVP----------------------QVFDPLIVIEDNT-V
A0A7G8GTF0      -ASIIHIPFVPVLN------KLK----------------------SFSISKIDNDQNG-P
A0A7G8H3H8      -PGIIHIPFLPVLN------NLK----------------------SFTFSRVKIDQDN-L
A0A4P5VLH9      -PVLGLIPYLPLES------GVD----------------------VST----SISKMS-A
A0A2W6ZN45      -PILGLIPYLPIVS------SDS----------------------ILK----SLKELP-G
A0A081GP61      -PVLGLIPYLPLEP------GVD----------------------IAT----SISKMS-S
K9P6R9          -PVLGLIPYLPLEP------GVD----------------------IAT----SISKMS-S
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      -----------------MSFLP--------------------------------------
A0A5B8NQW4      -TLLGSIP----LFGKQASELP--------------------------------------
A0A6P0XUL2      -PILGTIPFQKELKDRKKSNIPQ-------------------------------------
                                                                            

A0A355DU96      -----------------HGITSEAYRMLEANLKFLSPDQVLKRIVVTSSVAQEGKSTVSA
A0A2N6LHT1      ----------------VG--LVEPYRTLFKNLEFRSSE-PLRSIVVSSTITGEGKSVVGS
A0A328V843      ----------------PGSLISEIYRMIQANLKFLGSDRKVRVIVVSSSVPQEGKSTVSA
A0A2T1DKP1      ----------------PFSSAAEAYQMLQANLRFLRSDKEIKTVVVTSSVAQEGKSEVAA
A0A0D6KL48      ----------------PYSPVSSAFEMLQTNLSFSISDKMLKVIAISSSIPGEGKSFVAA
A0A6M0AN00      ----------------GWRPFQEALDMIYVNIQLLNPGSEWKSLMVTSALSGEGKSTLAL
A0A6P0ITZ8      --------------------------RLLLTTMELRAQKRLQLIVVSSAVSGEGKSVVAS
A0A6P0SLN0      ------SA-------------------------VSMKPIENRRLMISSATSGEGKTTVTL
A0A2T1CC83      -------------------FSSEVYRMIQANLKFLTNDKPPKVILVTSSVPEEGKSTVTA
A0A1B7WWU1      ----------------------TSFEMLQTNLGFTVSDKELRVILVTSATPGEGKSFVAA
A0A6P0S1R8      ------SA-------------------------VSMKPLKNRRLMITSATAGEGKTTITL
A0A0A2B4S6      ------YQ--------------EAFRGMYTSIKFINTQNSLKILSISSCIPSEGKSLIST
K9SGV8          ------KR--------------------------------LKVIVVTSSVPREGKSTIAA
B0CA08          ------HS--------------------------------PRVLMMTSAINQEGKSTTCA
B0BZC6          ------ES---------------------------------KVLVITSAISGEGKSFVAT
A0A6G3Z709      ------VN------QPTHIRVREAYQMLQANLKFLQSDNELQTVVISSAVPGEGKSEVSA
A0A6P0M090      ------HP--------------------------------LKVIVVTSSVSKEGKSTVSA
A0A563VX16      ------DQETIPLQVIEWLPFRESLDLVYENIQLMSQNSLINSIAITSSIAGEGKSTITL
A0A0V7ZGW0      ------ST-------------------------ISLMSLENHRLMVTSSTAGEGKTTVTL
A0A355DPN1      ------VAAASTLPMVYWLPFRESLDLIYKHIQLLNSAATLRSIVVTSALPSEGKSTFVV
A0A6J4NIB3      ------AA-------------------------VSSLMLDSDRLMVASSMYGEGKTTVTL
A0A6M0AB25      ------SA-------------------------VSMKPLKNRRLMIASATSGEGKTTVTL
A0A1D8TTM0      ------SA-------------------------VSMKPLKNRRLMISSATSGEGKTTVTL
A0A6P0VB93      ------SA-------------------------VSMKPLKNRRLMITSATAGEGKTTITL
A0A6P0W0Y0      ------SA-------------------------VSMKPLKNRRLMITSATAGEGKTTITL
A0A0V7ZMP6      ------SA-------------------------ISLLHLENKSLMIASANSGEGKTTVTL
A0A433W046      ------SS-------------------------ILML--EHPCLMVTSATAGEGKTTVTL
K9TU02          ------SS-------------------------ILML--EHPCLMVTSATAGEGKTTVTL
A0A2T1FMA8      ------SS-------------------------ILML--EHPCLMVTSATAGEGKTTVTL
A0A2P8QV10      ------SS-------------------------ILML--EHPCLMVTSATAGEGKTTVTL
B8HQ70          ------SA-------------------------ISFLDLATPRLMITSAMYGEGKTTIAI
A0A2S6V636      ------SA-------------------------VLML--EHQRLLVTSSTSGEGKTTVTL
A0A6P0IXR4      ------SV-------------------------ISLRSGEDRRILITSAMVSEGKTTVTL
A0A1D9G3S3      ------SV-------------------------ISLRSGEDRRILITSAMVSEGKTTVTL
A0A6P0KRF3      ------SV-------------------------ISLRSGEDRRILITSAMVSEGKTTVTL
A0A6P0LQ61      ------SV-------------------------ISLRSGEDRRILITSAMVSEGKTTVTL
A0A1D8TWE6      ------SV-------------------------ISLRSGEDRRILITSAMVSEGKTTVTL
A0A6L9YP52      ------SV-------------------------ISLRSGEDRRILITSAMVSEGKTTVTL
A0A6P0L3X9      ------SV-------------------------ISLRSGEDRRILITSAMVSEGKTTVTL
A0A6M0A6X4      ------SV-------------------------ISLRSGEDRRILITSAMVSEGKTTVTL
A0A1U7N3U5      ------SV-------------------------ISLRSGEDRRILITSAMVSEGKTTVTL
A0A6L9ZB93      ------SV-------------------------ISLRSGEDRRILITSAMVSEGKTTVTL
A0A6P0S980      ------SV-------------------------ISLRSGEDRRILITSAMVSEGKTTVTL
A0A2T1EZA0      SERFAIK---------------ESLRSLFTTFRLLRADNNIRMVGITSSTQGEGKSTAVA
A0A1U7JBN8      ----VLTQNQSPHKLYTSFSFAEAFYSLEANLRMLSSDTPIQVVALTSSEPGEGKSTICA
A0A2W4VXF4      ----VLTQNQSPDNLYTSFSFAEAFYSLDTNLRMLSSDTPMQVIALTSAVPGEGKSTICA
A0A2W7AI98      ----VLTQNHSPDNLYTSFSFAEAFYSLDTNLRMLSSDTPMQVIALTSSVPGEGKSTICA
A0A6G3Z347      MNLFPSQQEPSDSHKPTFTPFLESFRILATNIELSNPDDPVRTLAITSAIPNMGKSTVTF
A0A2P8QVH5      LNWFPFR---------------ESMDLIYQNIQILGSPLSFKSLLLTSALTGEGKSTLAA
A0A2T1FT70      LNWFPFR---------------ESMDLIYQNIQILGSPLSFKSLLLTSALTGEGKSTLAA
A0A433W4W4      LNWFPFR---------------ESMDLIYQNIQILGSPLSFKSLLLTSALTGEGKSTLAA
K9U5W1          LNWFPFR---------------ESMDLIYQNIQILGSPLSFKSLLLTSALTGEGKSTLAA
L8M1L4          KQSYSYRYSSFTESLRAI-----AMNISYTVVD----TRKIKSLVTTSSTSSEGKTTVTY
A0A7G8GTF0      SDRIMINLFGSAKNVDSLIEYENSFRKLYSIIKFVHYDKNIKSIVFTSSVASEGKSLIVS
A0A7G8H3H8      NQRVMINLSDLPEDVDSLVEFENSFRKLYSIIKFVHYDKDLKSIVFTSSVTSEGKSLLVS
A0A4P5VLH9      SERFAIK---------------ESLRSLFTTFRLLRSDRDIRLVAVTSSTQGEGKSTAVT
A0A2W6ZN45      TERFAIK---------------ESLRSLFTTFRLLRADREIRLVVITSSTQNEGKSTAAS
A0A081GP61      SERFAIK---------------ESLRSLFTTFRLLRADNNIRMVGITSSTQGEGKSTAVT
K9P6R9          SERFAIK---------------ESLRSLFTTFRLLRADNNIRMVGITSSTQGEGKSTAVA
A0A1Q8BLE0      -------------------------------------MRAVSRIVITSPGPEEGKSTTAA
A0A2T2S1W0      ------------VRDAPRSPLSESFRMLQANLRFSQADRRLQAIAVASSVPGEGKSTLVA
A0A5B8NQW4      ------------MQDQPRSAVSEAFRMLQANLKFSRVDEKLKVIVVTSSVPNEGKSTVTG
A0A6P0XUL2      ------------MEPLATSPCWEACLSLQTNISFVSPDTPLRYIVISSAVPSEGKSTIAL
                                                           :  :*     **:    

A0A355DU96      NLAIAMAQVGRRVLLVDADMRHPMQHHIWDLANTVGLSEVIVHQ----TQFEFAVREVMD
A0A2N6LHT1      HLAAISAMLSRRTLLIDADLRRPILHTLFNLAPRPGITDVIDSE--RSLEETVQRTNI-P
A0A328V843      NLAAAIAQLGHRVILIDGDMRQPIQHHIWGLTNAVGLSDVLVEE--ATLSEAV-KPGI-D
A0A2T1DKP1      NLAASMAQVGRRVLLVDADMRYPVQHHVWDLVSTIGLSNVIVEQ--FVPDVAIQEVAP--
A0A0D6KL48      NLAVAVAQLGRRVLLVDADMRRPRQHKIWEQNNLVGLSNILVGQ--TELQTTSKEALM--
A0A6M0AN00      GLALSAARLHRRVLLIDVDMRRPRLHQQLGLSNYEGLSTLLEDD--TATPSPVSISPLGS
A0A6P0ITZ8      HLAAVSARFSRRTLIIDADWRHPMQHNLFGLPPQPKVKDLMDSNQTCLEAVQPTAIA---
A0A6P0SLN0      GLASALITLGFRVLVVDGDFRKAELSQRLGCDR------------YAISEVPSTPVQIRS
A0A2T1CC83      NLAAAISQLGRSVLLVDADLRRSSQHHLWGVDNQKGLKDIVVDN----VSPLSVIRQPMP
A0A1B7WWU1      NLALAGAYVGKRVLLVDADMRRPRQHRVWEIHNLLGLSNILAGQTQLKNAVQ----EVSP
A0A6P0S1R8      GLASGLITLGFRVLVVDGDFRKAHLSQQLGYTP------------SPALEGQSMPVQVRA
A0A0A2B4S6      MFAKTISELGLSVLLIDTDLRKPQVHARLGLDNLIGFSNLLIDS-SDNYKKYIQSVPTQD
K9SGV8          NLAATIAELGQRVLLVDADMRHPAQHRIWQLPN---ENGLSDLL-TGQSPLSEVAHHVMP
B0CA08          NLAVSLAQMNHRVLLIDADIRLASQHQIWELGNQEGLTHILLNK-HFNYHQELPTHKVAD
B0BZC6          NLAVLSAMLSKRTLLIDADMRRPSIHKIFQLPQDPGLQDYLRGS-VKEGLPAAIHRTSVK
A0A6G3Z709      NLAAALAQVGRRVLLIDADMRYPRQHHALKVLN---TVGLSHVI-TGQAKVKSAIQTVTR
A0A6P0M090      NLAAAMAQLGRRVLLIDSDMRHPSQHYIWQVMN---VAGLSQVL-IGEVPIELAICKAME
A0A563VX16      GLALSAARRRKKVLVIDGDLRCPTLHEKLDISN-GVGLSDLLDG-VTSVPTVQEISRAGS
A0A0V7ZGW0      GLAKALMVLGFRVLMVDGDFRKAKLSRQFGHVM-H-PQS----------NDLPQPMQISP
A0A355DPN1      GLAFSAARLHQRVLLIDADLRRPSLHKQLNLPN-EQGLATLLVE-DSSIPSPQRLSLSGS
A0A6J4NIB3      GLALALVKLGFRVLVVDGDLRRADLSQRLGHPQ-A-KIG----------DAKVMPIPIYR
A0A6M0AB25      GLASALITLGFRVLVVDGDFRKAELSQRLGCDR-F-AMS----------EVPSAPVQIRS
A0A1D8TTM0      GLASALITLGFRVLVVDGDFRKAELSQRLGWDR-Y-AMS----------EVPSTPVQIRP
A0A6P0VB93      GLASGLITLGFRVLVVDGDFRKAHLSQQLGYRP-S-PTL----------EEQSMPVQVRA
A0A6P0W0Y0      GLASGLITLGFRVLVVDGDFRKAHLSQQLGYTP-S-PAL----------EGQSMPVQVRA
A0A0V7ZMP6      GLANALLELGFRILIVDADFRKCELTQSLGYYG-Q-SIG----------DLQLRPINVFE
A0A433W046      GLALALVNFGFRVLVIDGDLRKAEMSRRLGKNRIKSAAN----------ASPPMPVSVSP
K9TU02          GLALALVNFGFRVLVIDGDLRKAEMSRRLGKNRIKSAAN----------ASPPMPVSVSP
A0A2T1FMA8      GLALALVNFGFRVLVIDGDLRKAEMSRRLGKNRIKSAAN----------ASPPMPVSVSP
A0A2P8QV10      GLALALVNFGFRVLVIDGDLRKAEMSRRLGKNRIKSAAN----------ASPPMPVSVSP
B8HQ70          GLAAALARLGFKILLVDGDLRRARLTEQLSDRY-QGSWN----------PRETAVVPLSP
A0A2S6V636      GLALALVNFGFRVLIVDGDLRQAELSQRLGQPQ-K-KLK----------DGQPSPVSVCL
A0A6P0IXR4      GLATALVDLGFRVLVVDGDFRQATLSQRLGHHH-D-PLK----------PGQ--PVKIQP
A0A1D9G3S3      GLATALVDLGFRVLVVDGDFRQATLSQRLGHDH-D-PLK----------PGQ--PVKIQP
A0A6P0KRF3      GLATALVDLGFRVLVVDGDFRQATLSQRLGHDH-D-PLK----------PGQ--PVKIQP
A0A6P0LQ61      GLATALVDLGFRVLVVDGDFRQATLSQRLGHDH-D-PLK----------PGQ--PVKIQP
A0A1D8TWE6      GLATALVDLGFRVLVVDGDFRQATLSQRLGHHH-D-PLK----------PGQ--PVKIQP
A0A6L9YP52      GLARALVDLGFRVLVVDGDFRQATLSQRLGHHH-D-PLK----------PGQ--PVKIQP
A0A6P0L3X9      GLARALVDLGFRVLVVDGDFRQATLSQRLGHHH-D-PLK----------PGQ--PVKIQP
A0A6M0A6X4      GLARALVDLGFRVLVVDGDFRQATLSQRLGHHH-D-PLK----------PGQ--PVKIQP
A0A1U7N3U5      GLARALVDLGFRVLVVDGDFRQATLSQRLGHHH-D-PLK----------PGQ--PVKIQP
A0A6L9ZB93      GLARALVDLGFRVLVVDGDFRQATLSQRLGHHH-D-PLK----------PGQ--PVKIQP
A0A6P0S980      GLARALVDLGFRVLVVDGDFRQATLSQRLGHHH-D-PLK----------PGQ--PVKIQP
A0A2T1EZA0      VFSRTLADLGLRVLVIDSDMRLPMQARYLGVEQGDGLSTLLSDS-SRKPTDFIHSIAE--
A0A1U7JBN8      HLAIAAANMGRRVLLIDSDLRKPSQHLIFGHANRQGLSDLITQP-LDDPMDLVQVIPGNP
A0A2W4VXF4      HLAIAAANMGRRVLLIDGDLRKPSQHLIFSQRNHQGLSELITQG-LENPTDLVLAIPGNP
A0A2W7AI98      HLAIAAANLGRRVLLIDGDLRKPSQHLIFSQRNHQGLSELITQG-LENPTDLVLTIPGNP
A0A6G3Z347      HLAHAIAATGKRVLMMDTDLRRPTLHKLCNASNDKGLSNYVTGE--FNPEDILIDLPLEP
A0A2P8QVH5      GMALSVARLQRRVLLIDADLRRSNIHKLLNLSNDRGLSTLLTEEADVRERDCIQSVQP--
A0A2T1FT70      GMALSVARLQRRVLLIDADLRRSNIHKLLNLSNDRGLSTLLTEEADVRERDCIQSVQP--
A0A433W4W4      GMALSVARLQRRVLLIDADLRRSNIHKLLNLSNDRGLSTLLTEEADVRERDCIQSVQP--
K9U5W1          GMALSVARLQRRVLLIDADLRRSNIHKLLNLSNDRGLSTLLTEEADVRERDCIQSVQP--
L8M1L4          NLALALTELDAKVLVVDADLRKPKIHKMAKISNEQGLSEVISDN-KHSWTEVVQNVTG--
A0A7G8GTF0      SFAIFLSQLGRKVLLIDGDFRKPRLHRLLNIKLENGFSNLLDDN-SLQFKDVTNKISNFD
A0A7G8H3H8      SFAIFLSQLGRKVLLIDGDLRKPRLHTLLNLKLEKGFSDLLDDD-NYNLAKVTKKIGDVE
A0A4P5VLH9      IFARTLADLGLKVLVVDADMRLPMQTRYLGLANGEGFSTILTNS-SVPLKSLIQPIQD--
A0A2W6ZN45      VFGNTLADLGLHVLLVDADMRLPVQHKHFAVDNVKGLSDYLGDT-DDNIQDYIKPITS--
A0A081GP61      VFASTLADLGLKVLIIDSDMRLPMQTRYLGVEPGDGFSTLLSDS-SRKTTDLIQTIAE--
K9P6R9          VFSRTLADLGLKVLVIDSDMRLPMQARYLGVEQGDGLSTLLSDS-TRKPTDFIHSIAE--
A0A1Q8BLE0      NLAIAFAQQGHRVLLVDCDLRRTRIHKIFDETNLPGLTSVLVGG--ETIASAIR-QTRVP
A0A2T2S1W0      NLGLALAEVGQHVLIVDADLRNPSQHGIWEYANAVGLSNLLVGE--SSLEQACH--PASE
A0A5B8NQW4      NLGLALAELGNRVLIVDGDMRRPSQHQVWEEPNSMGLSNLLVDQ--SDVSTVTK--ELHP
A0A6P0XUL2      YLAQAAAAIGKKVLLVDADLRRPQVHVRTDLPNTWGLSNLIFSN--IDLSQAIQVAPFEE
                 :.          :::* * *                                       

A0A355DU96      NLDVLPSGVIPPNSL-ALLNSKRMASLVEYFSQ---KYDFVIFDTPPLV-LTADAMTLGK
A0A2N6LHT1      NLSVLTCGELYRLPS-HLLESEAMKSLLIEAVR---QYEFVVIDTPPLS-ACADAHTLGR
A0A328V843      QLDILTAGVTPPNPL-ALLDSRRMTSLIRNFSE---EYDFVIIDTPPLL-LAADALTLAN
A0A2T1DKP1      NLYALPSGIIPPNPI-ALLDSKRMASLVEGFAR---DYDLIIFDTPPLA-GKADAAILGK
A0A0D6KL48      TLDIITAGTIPPNPA-ALLNSQRIATFIKEATQ---EYDFVIIDCPPLT-LVADALMLSK
A0A6M0AN00      TIDVLTAGPTPIDPV-KLLGSKRMKNLMAEFQE---TYDLVLLDTPPVL-GMVDALQAAS
A0A6P0ITZ8      NLSILTCSDQPSGPA-TFLQSQVMKSILAAAGD---HYDLVIVDTPPVS-SFADAHTLSR
A0A6P0SLN0      GLDLLSLRP-DEDKIAEFVARGSFEECLSSAQA-TGHYDYILIDSAPVS-LNSEAALMAT
A0A2T1CC83      KLSLLTSGMVESNPL-AILDSPKMSDFIGRSRR---EYDLILIDVPPLP-VTADVLTVSK
A0A1B7WWU1      LVKMLPAGKIPPNPV-TLLDSQCMADLVEEASK---DYDFVIIDTPPLT-AVTDPLIVGK
A0A6P0S1R8      GLDLLSI-RPHEDKIAEFVARGDFEQALNVAQA-AGDYDYVLIDSAPVS-VTSETVLMAS
A0A0A2B4S6      NFDVITSGSIPPDPT-RLLGSDSMKKFIETIRS-ENKYDYVILDTSPIL-SISDSTLIAQ
K9SGV8          TLEVMPAGSKPANPVALLNSQATSNL---IDYG-SSNYDVMIVDTPPMA-VAADASILGK
B0CA08          NLEIITAGRISSNPL-PMLESEQFANFVQVQIE-H--YDYILIDAPPLV-SVADPLIIGK
B0BZC6          NLSVMTSGKFSYDNVFSFETQRAKELFTEVQQH----YDVIVIDTPPVM-ACSDALVLSQ
A0A6G3Z709      NLDVLTAGVVPPNPV-ALLDSKRMESLLQSLAQ-A--YEVVIIDAPPLV-SYADASILGK
A0A6P0M090      NLDILTAGVMPPNPLALLDSK---QMASLIQEF-STQYDFVIIDAPPLL-LTADALCLSP
A0A563VX16      TISVLTSGSATSDPV-KLLSSGRLQNLIAHFEK-T--YDLVLIDTPPAI-GMVDAIKIAS
A0A0V7ZGW0      GLDILPTAPNQNNKVMEFVARGGFEKYLNTIQT-NGNYDYVIVDTAPVT-STSETALMAK
A0A355DPN1      EIDVLTAGPIPPDPV-KLLSSQRMRQLMAGFEQ-S--YDLILVDTPPIL-GMVDALQAAS
A0A6J4NIB3      GLDLLPAPAIAKDHIAEFFAQGRFEQQLSEIQD-SSNYDYVLVDSAPVS-LTIEPALMSA
A0A6M0AB25      GLDLLSLRP-DEDKIAEFVARGSFEECLNSAQA-TGHYDYILIDSAPVS-LTSEAALMAT
A0A1D8TTM0      GLDLLSLRP-DEDKIAEFVARGSFEECLSAAQG-SGHYDYILIDSAPVS-LTSEAALMAS
A0A6P0VB93      GLDLLSLRP-HEDKIAEFVARGDFEQALNVAQA-AGDYDYVLIDSAPVN-VTSETVLMAS
A0A6P0W0Y0      GLDLLSIRP-HEDKIAEFVARGDFEQALNVAQA-AGDYDYVLIDSAPVN-VTSETVLMAS
A0A0V7ZMP6      NVDLLAM-RVPEERIAEFVARGGFEQRLNAIKN-SAQYDYILVDSPPVA-LTSEAAIIGK
A0A433W046      GFDLLPALSIPKQKIPEFFARGSFERNIKALRE-SGGYDYVLVDSPPVG-LASETNLMSA
K9TU02          GFDLLPALSIPKQKIPEFFARGSFERNIKALRE-SGGYDYVLVDSPPVG-LASETNLMSA
A0A2T1FMA8      GFDLLPALSIPKQKIPEFFARGSFERNIKALRE-SGGYDYVLVDSPPVG-LASETNLMSA
A0A2P8QV10      GFDLLPALSIPKQKIPEFFARGSFERNIKALRE-SGGYDYVLVDSPPVG-LASETNLMSA
B8HQ70          GLDLMPAPAIPNDRIVNYVAKGGFEQQLQTLQQ-SGEYDYVLVDTAPIT-LTSETGLMTT
A0A2S6V636      GLDLLPAPALSKGKIPEFFARGSFQQYLDQIQA-DGGYDYVLVDSPPIG-LASETNLMSS
A0A6P0IXR4      SLDLLPT-SHKKGKIVELVTQGKFEQSLATAEE-SGDYDYVLIDSAPVS-MTSETALMAA
A0A1D9G3S3      SLDLLPT-SHKKGKIVELVTQGKFEQSLATAEE-SGDYDYVLIDSAPVS-MTSETALMAA
A0A6P0KRF3      SLDLLPT-SHKKGKIVELVTQGKFEQSLATAEE-SGDYDYVLIDSAPVS-MTSETALMAA
A0A6P0LQ61      SLDLLPT-SHKKGKIVELVTQGKFEQSLATAEE-SGDYDYVLIDSAPVS-MTSETALMAA
A0A1D8TWE6      SLDLLPT-SHKKGKIVELVTQGKFEHSLATAEA-SGDYDYVLIDSAPVS-MTSETALMAA
A0A6L9YP52      SLDLLPT-SHKKGKIVELVTQGKFEQSLATAEE-SGDYDYVLIDSAPVS-MTSETALMAA
A0A6P0L3X9      SLDLLPT-SHKKGKIVELVTQGKFEQSLATAEE-SGDYDYVLIDSAPVS-MTSETALMAA
A0A6M0A6X4      SLDLLPT-SHKKGKIVELVTQGKFEQSLATAEE-SGDYDYVLIDSAPVS-MTSETALMAA
A0A1U7N3U5      SLDLLPT-SHKKGKIVELVTQGKFEQSLATAEE-SGDYDYVLIDSAPVS-MTSETALMAA
A0A6L9ZB93      SLDLLPT-SHKKGKIVELVTQGKFEQSLATAEE-SGDYDYVLIDSAPVS-MTSETALMAA
A0A6P0S980      SLDLLPT-SHKKGKIVELVTQGKFEQSLATAEE-SGDYDYVLIDSAPVS-MTSETALMAA
A0A2T1EZA0      NMDVLPAGPKPPDPA-KLLNSSRCKEIMEEIRA-LPGYDIIIVDAPPCL-MLADPILLGE
A0A1U7JBN8      NLHLLTAGARPPAPG-RLLSSRKMQQIAEQYRC---HFDLIILDTPPLAGGMVDAKLAAA
A0A2W4VXF4      NLHLLTAGARPPPPG-RLLSSRKMQQITEQYRR---HYDLIIFDTPPLA-GMIDAKLTAA
A0A2W7AI98      NLHLLTAGARPPPPG-RLLSSRKMQQITEQYRR---HYDLIIFDTPPLA-GMIDAKLTAA
A0A6G3Z347      GLFLLPSGPIPPDPM-KILTAQRIRNLFDYLDR---EFDFIIFDTPPLL-GFADAFIIAA
A0A2P8QVH5      SLDVLTAGPTPTDIV-KLLSSQRMKHLIESFEQ---SYDLVLVDAPPIL-GLADASIVAS
A0A2T1FT70      SLDVLTAGPTPTDIV-KLLSSQRMKHLIESFEQ---SYDLVLVDAPPIL-GLADASIVAS
A0A433W4W4      SLDVLTAGPTPTDIV-KLLSSQRMKHLIESFEQ---SYDLVLVDAPPIL-GLADASIVAS
K9U5W1          SLDVLTAGPTPTDIV-KLLSSHRMKHLIESFEQ---SYDLVLVDAPPIL-GLADASIVAS
L8M1L4          NLDVITAGANVANPI-ALL---RSQIMSELLKEWEAAYDYVLIDTPPIG-AMADAQSLVH
A0A7G8GTF0      NLDLIPAGNSLTEPT-LLFSSTRLKILMDLLHD-STSYDFILIDTPPAL-ICSDASMITR
A0A7G8H3H8      NLDFISAGLSLTEPT-ILFSSPRLQLLINSINE-SSSYDYILIDTPPSL-ICSDASLITR
A0A4P5VLH9      NLDILPAGPKPPDPA-KLLNSTRAQEVVNEIRA-LTEYDMVLFDAPPCL-MLSDPILLGE
A0A2W6ZN45      NLSLITAGSRAPDPA-RLLNSLRCSDMVQHLRA-LPGYDLIIFDTPPCL-LLSDPVILGE
A0A081GP61      NMDVLPAGPKPPDPA-KLLNSSRCKEIMDEIRA-LPGYDIIIVDAPPCL-MLADPILLGE
K9P6R9          NMDVLPAGPKPPDPA-KLLNSSRCKEIMEEIRA-LPGYDIIIVDAPPCL-MLADPILLGE
A0A1Q8BLE0      GLNILPSGPLPPNPA-ELLGSAQMTALLDKLSE---NYDLLILDTPPLL-AASDAAIVSR
A0A2T2S1W0      GLDLLTAGQVPPNPV-ALLDSQRLATLLQQWRQ---AYDYVLLDVPPLQ-AATDAVIVGK
A0A5B8NQW4      NLELLTVGAPPPNPI-ALLDSQRIADFIDKCRQ---AYDYVLIDTPPMA-VGADSALLGK
A0A6P0XUL2      NLSILTSGQVPPNPT-RALSSQKMGSLLERLQR---RFDLIIFDTPPLT-GLADAKLLAP
                 .  :.                               :: ::.* .*      :      

A0A355DU96      MTDGILLVARPKVVDRVSATASKEFL-LRSGQQVLGLVINGVSVEG----------EPDS
A0A2N6LHT1      QSDGIILVTRPGFTIKEVLQRAVSEL-THNQIPIMGVVVNGITDQT----------E---
A0A328V843      MASGVLMVARPRILDRDSAKAAKEIL-GRSGQRILGTVINGISKNE----------S---
A0A2T1DKP1      MTDGILLVVRPGIIDSASANAAKEFL-KQSGQNVLGMVINGVDVRS----------EPD-
A0A0D6KL48      LVDGILLVVRPGVANTGSVNATKMLL-EQSGHQVLGMVANGVTPES----------SYGG
A0A6M0AN00      LCQGVVMVGRLERVTQSQLTQATAIL-RN--LNLIGIIANGVKSSN----------Q---
A0A6P0ITZ8      YSDGLVMVTRPNFTQKDILLQTVSEL-KESSTPILGFVVNGITDQT------QQYYS---
A0A6P0SLN0      VVPNILLVVWPGKSNRNPFRDTLEQL-MRHRAQILGLVVNGVETKA----------E---
A0A2T1CC83      LVDGILFVTRPGIVEHESAELAQEAL-ATTGQKILGMVVNGVKANE---FDRYSYHG---
A0A1B7WWU1      YVDGLLLVVRPGKVEYSAVNAAKSLL-TQAKLPILGMVVNGIVKE-----------S---
A0A6P0S1R8      VTSAILLIVWPGKSNRNPFRDTIEQL-VSHKANILGLVVNGIETQT----------K---
A0A0A2B4S6      YCDSLLMVVSLNNVDMDLPLLAKNKL-KKTNRPLIGFVSNQIKKPKTFSKNRYYGYS---
K9SGV8          IADGIVMLCRVGVADTNNLTFSKELL-EQSGQNILGMVVNASLPED----------D---
B0CA08          VVDGILLVARPGHLEREYAQKAHELL-IHSNLSVLGTVINGILNKN----------E---
B0BZC6          EGRQTVVVARLDVTPKQVLNRSIDIL-NSNNVNVVGLAINGVTAST----------D---
A0A6G3Z709      MAEGVLLVVRPGVVDYAQGRIAKEIL-AQSNQRVLGMVANGVNPSN----------E---
A0A6P0M090      MTDGLLLVARPGVLDFANANVAKQML-DSSGQTVLGLVANGVIQKD----------E---
A0A563VX16      SCSGTVVVARLEKANFAELMETYGLL-GRIN--VLGMVANDSREVQ----------Q---
A0A0V7ZGW0      VIANVLPVIRLGISDRYMVQETIEQL-MRHNANIIGLALNGIEQRS----------E---
A0A355DPN1      FCNGVVIVGRISRVTQSELTEAIAML-SHLNA--IGIVANGANGST----------N---
A0A6J4NIB3      AVPNVLYVVRPGISDRYSVADGFEQL-MRGNARITGLVVNGVDSRT----------E---
A0A6M0AB25      VVPNVLLVVWLGKSNRNPFRDTLEQL-MRHKAQILGLVVNGVDTQP----------E---
A0A1D8TTM0      VVPNVLLVVWLGKSNRNPFRDTLEQL-MRHRAQILGLVVNGVDTQP----------E---
A0A6P0VB93      VTSAILLIVWPGKSNRNPFRDTIEQL-VSHKANILGLVVNGIETQT----------K---
A0A6P0W0Y0      VTSAILLIVWPGKSNRNPFRDTIEQL-VSHKANILGLVVNGIETQT----------K---
A0A0V7ZMP6      IIHNILFVVRTGISSRNCFHDSVEQL-KRYRAEVIGLTVNDVDSHN----------E---
A0A433W046      VVCNVLFVLRSGTSDRYPVMNSLEQL-TRYNARIMGLVVNGSDSHT----------S---
K9TU02          VVCNVLFVLRSGTSDRYPVMNSLEQL-TRYNARIMGLVVNGSDSHT----------S---
A0A2T1FMA8      VVCNVLFVLRSGTSDRYPVMNSLEQL-TRYNARIMGLVVNGSDSHT----------S---
A0A2P8QV10      VVCNVLFVLRSGTSDRYPVMNSLEQL-TRYNARIMGLVVNGSDSHT----------S---
B8HQ70          SVNNLLFVVRPGTSSRYSVLDSFEEL-SLRKVNVVGVTINGIETNS----------E---
A0A2S6V636      VVRNVLFVVRSGKSDRYAVMDGFEQL-AQHHAQIMGLVVNYVEPKD----------V---
A0A6P0IXR4      VIRNLLFVVRPEISKRDFVSDSLEQL-AQHNAQLLGLVVNGVETKS----------K---
A0A1D9G3S3      VIRNLLFVVRPEISKRDFVSDSLEQL-AQHNAQLLGLVVNGVETKS----------K---
A0A6P0KRF3      VIRNLLFVVRPEISKRDFVSDSLEQL-AQHNAQLLGLVVNGVETKS----------R---
A0A6P0LQ61      VIRNLLFVVRPEISKRDFVSDSLEQL-AQHNAQLLGLVVNGVETKS----------R---
A0A1D8TWE6      VIPNLLFVVRPEISKRDFVSDSLEQL-AQHNAQLLGLVVNGVETKS----------K---
A0A6L9YP52      VIRNLLFVVRPEISKRDFVSDSLEQL-AQHNAQLLGLVVNGVETKS----------K---
A0A6P0L3X9      VIGNLLFVVRPEISKRDFVSDSLEQL-AQHNAQLLGLVVNGVETKS----------K---
A0A6M0A6X4      VIRNLLFVVRPEISKRDFVSDSLEQL-AQHNAQLLGLVVNGVETKS----------K---
A0A1U7N3U5      VIRNLLFVVRPEISKRDFVSDSLEQL-AQHNAQLLGLVVNGVETKS----------K---
A0A6L9ZB93      VIRNLLFVVRPEISKRDFVSDSLEQL-AQHNAQLLGLVVNGVETKS----------K---
A0A6P0S980      VIRNLLFVVRPEISKRDFVSDSLEQL-AQHNAQLLGLVVNGVETKS----------K---
A0A2T1EZA0      KLDGILFLVGLGKVSRELAPQASRRI-RASGVDVLGIICNQVNFP--------SRLN---
A0A1U7JBN8      HADGLLLVARLNRSERTEIQRVLADLGNTVQAPLLGLVVNGVPH---------SRQS---
A0A2W4VXF4      HADGLLLVVRLNQSERSEIQRVLADLGNTAQAPLLGLVINGVPQ---------SRQR---
A0A2W7AI98      HADGLLLVVRLNRSERSEIQRVLADLGNTAQAPLLGLVINGVPQ---------IRQR---
A0A6G3Z347      NTKGVLLTATLGQITFSQLQSALDEL-DIAKIPVLGAVANGSQPE-----------N---
A0A2P8QVH5      LCSGTVVVERLNRVTRFDLNQSLEAL---SKLNVIGAIINESKECN-------SRYT---
A0A2T1FT70      LCSGTVVVERLNRVTRFDLNQSLEAL---SKLNVIGAIINESKECN-------SRYT---
A0A433W4W4      LCSGTVVVERLNRVTRFDLNQSLEAL---SKLNVIGAIINESKECN-------SRYT---
K9U5W1          LCSGTVVVERLNRVTRFDLNQSLEAL---SKLNVIGAIINESKECN-------SRYT---
L8M1L4          QVDGVMLVTGINKVNQKAIVNTLEVL-QSSNCNLIGFIANMVEKDL----------D---
A0A7G8GTF0      YCSTSLYIVSLRNVKKNIAIKAIDDF-TTVYDNCLGAISNSTKFEL-------TSPD---
A0A7G8H3H8      CCSTSLYIVSLRNVKKNMAIEALKSF-TESNDKCLGIISNSTKFEL-------NSVD---
A0A4P5VLH9      KLDGILFLVGLGKVSRELAPQACRRI-KATGVDVLGLICNQVNFP--------SRLN---
A0A2W6ZN45      KVDGILYLVGLGRVGREIAPQAIKRI-KATGVDILGLMCNQVAYP--------TRLN---
A0A081GP61      KLDGILFLVGLGKVSRELAPQASRRI-KATGVDVLGIICNQVNFP--------SRLN---
K9P6R9          KLDGILFLVGLGKVSRELAPQASRRI-RASGVDVLGIICNQVNFP--------SRLN---
A0A1Q8BLE0      IVDGALVVVRAGRTERSALQTAVQQL-ATVGARVLGTVLNDPDAEV----------P---
A0A2T2S1W0      LTDGTLLVVRPGVAECDAVEASRDTL-ARLQQPVVGMVANGVNPRN----------E---
A0A5B8NQW4      LAEGTLLVVRPNMADLTSATGAKEML-QRSGQPVLGMVINGVNPSD----------E---
A0A6P0XUL2      RTDGMVMVVGLGMTERSIFQRALDEL-KIARVPVLGLVANGVKGYT----------P---
                     :                   :         *   *                    

A0A355DU96      YFHHAKAYYKEELITSTIPDSKTKKNHIRF------------------------------
A0A2N6LHT1      --RYYRYAVNSYEPL---------SSRRLSRGSSA-------------------------
A0A328V843      --TKYFYHAQRYFPLQKSHRRDRSAPPKISSRSSS-------------------------
A0A2T1DKP1      --SYFYHTRER-------GKRNVAALDTITD-SIPTEVER--------------------
A0A0D6KL48      YYAKSYYGAKQ-------SHKNGKVDASISKIRIL-------------------------
A0A6M0AN00      --NYAYYGSRN-------SHGAIEQNQPVSDLQVSPQLERQFSNHVKSR-----------
A0A6P0ITZ8      --DSFYSYQPQSQFRQTHGKEASNNCAVISRGVDHADS----------------------
A0A6P0SLN0      --GYLYEHRIVETS----------------------------------------------
A0A2T1CC83      --RYGKKYFEKGNVQYESQNNLNGSQNLSNMPEGNNANSSVSRAKL--------------
A0A1B7WWU1      --GYGGYYYSSGYYGGKGERNKQNAEASVR------------------------------
A0A6P0S1R8      --SYS--YESRVVETSS-------------------------------------------
A0A0A2B4S6      --NYSNNYGYNSNYISYYADNKIRDKFTKRNLTFENSKDNFLISKIKKFRNKVLDFISWL
K9SGV8          --PYGYYYSYYYNYSSKPGQRQRQEASRQDQDQNQQETINQ-------------------
B0CA08          --LYSYYSRYGHNSNQEKTAIKRNLLKQVISK----------------------------
B0BZC6          --KYY-RYLKEDYALAA-------------------------------------------
A0A6G3Z709      --PDGHFYYLRQDAHESAEILEESALLPVGNAS---------------------------
A0A6P0M090      --SIGYFYQSQEYFHYGSVRRLAQRQAQTKKTSNVSRR----------------------
A0A563VX16      --RYA---KNKRYLPSAEV-----------------------------------------
A0A0V7ZGW0      --GYI--YKHDSSQVNS-------------------------------------------
A0A355DPN1      --RYIAYAEQNGSPLFQLN-----------------------------------------
A0A6J4NIB3      --GYR--YGRQRELLAAEA-----------------------------------------
A0A6M0AB25      --GYF--YECKKAPISS-------------------------------------------
A0A1D8TTM0      --GYL--YGHKIAEVSS-------------------------------------------
A0A6P0VB93      --SYS--YESRVVETSS-------------------------------------------
A0A6P0W0Y0      --SYS--YESRVVETSS-------------------------------------------
A0A0V7ZMP6      --KYIYSYNVNQQIQ---------------------------------------------
A0A433W046      --VYRYGYGRQRELLEHEA-----------------------------------------
K9TU02          --VYRYGYGRQRELLEHEA-----------------------------------------
A0A2T1FMA8      --VYRYGYGRQRELLEHEA-----------------------------------------
A0A2P8QV10      --VYRYGYGRQRELLEHEA-----------------------------------------
B8HQ70          --EYY--YGKQRELAATEL-----------------------------------------
A0A2S6V636      --GYR--YGRQRELIETEA-----------------------------------------
A0A6P0IXR4      --PYL--YRSSDTLVKS-------------------------------------------
A0A1D9G3S3      --PYL--YRSSDSLVKS-------------------------------------------
A0A6P0KRF3      --PYL--YRSSDTLVKS-------------------------------------------
A0A6P0LQ61      --PYL--YRSSDTLVKS-------------------------------------------
A0A1D8TWE6      --PYL--YRSSDSLVKS-------------------------------------------
A0A6L9YP52      --PYL--YRSSDTLVKS-------------------------------------------
A0A6P0L3X9      --PYL--YRSSDTLVKS-------------------------------------------
A0A6M0A6X4      --PYL--YRSSDTLVKS-------------------------------------------
A0A1U7N3U5      --PYL--YRSSDSLVKS-------------------------------------------
A0A6L9ZB93      --PYL--YRSSDSLVKS-------------------------------------------
A0A6P0S980      --PYL--YRSSDTLVKS-------------------------------------------
A0A2T1EZA0      --DYGYEYGYYYHYAYASASGYAK------------SASEPSTGGFGSYVQRYRDSYMKG
A0A1U7JBN8      --GYDYYYGYYGRPRVAAGIED-G------------------------------------
A0A2W4VXF4      --GYS-YYGYYGRPAVASGIDERG------------------------------------
A0A2W7AI98      --GYS-YYGYYGRPVVASGIDERG------------------------------------
A0A6G3Z347      --VKSYNYYQYYQQSVSAEKNGNS------------------------------------
A0A2P8QVH5      --VYDGTSQDNLERGFTTNPNLAG-----------------------------RGIF---
A0A2T1FT70      --VYDGTSQDNLERGFTTNPNLAG-----------------------------RGIF---
A0A433W4W4      --VYDGTSQDNLERGFTTNPNLAG-----------------------------RGIF---
K9U5W1          --VYDGTSQDNLERGFTTNPNLAG-----------------------------RGIF---
L8M1L4          --YYSYSYYSHYYNQPSNGNGNGNGNGNGNGNGNGNGNGNREAGSMNSIMQQFRRR----
A0A7G8GTF0      --DYSKQYSSYYSRSSMFKSSNEE---------SGQENLVSSASSLKRLMRRASNTSFVN
A0A7G8H3H8      --SYSKAYSSYYNNSSLFNAPNAK---------SVLTKTSKFPSILKSLVYNKRTPIIVR
A0A4P5VLH9      --DYGYEYGYYYHYAYANDSGSSS------TYGKNGEGLGRYARDVGNLVRGYRDSYVT-
A0A2W6ZN45      --DYGYEYGYHYNYSYAG----------------------------------YRDTYSQR
A0A081GP61      --DYGYEYGYYYHYAYASASGYAK------SANQ-----GKSYGGFGSYVQRYRDSYMKG
K9P6R9          --DYGYEYGYYYHYAYASASGYAK------SASE------PSTGGFGSYVQRYRDSYMKG
A0A1Q8BLE0      --KYARYYGYYYNNYYDYSNAT---------------EYSNGNGAKA-------------
A0A2T2S1W0      --RSSYYH------YYNYGNNNGGPPRQGWRRWLPGNPFARNGKGSQ-------------
A0A5B8NQW4      --PDSYYYYYAQGYYYETKEEEESGKKALF-------GFGRGKSNQS-------------
A0A6P0XUL2      --NYSTYY---KRYYHKTAKFDLMENIQNF-------VSPK-------------------
                                                                            

A0A355DU96      ------------------------------------------------------------
A0A2N6LHT1      ------------------------------------------------------------
A0A328V843      ------------------------------------------------------------
A0A2T1DKP1      ------------------------------------------------------------
A0A0D6KL48      ------------------------------------------------------------
A0A6M0AN00      ------------------------------------------------------------
A0A6P0ITZ8      ------------------------------------------------------------
A0A6P0SLN0      ------------------------------------------------------------
A0A2T1CC83      ------------------------------------------------------------
A0A1B7WWU1      ------------------------------------------------------------
A0A6P0S1R8      ------------------------------------------------------------
A0A0A2B4S6      DR----------------------------------------------------------
K9SGV8          ------------------------------------------------------------
B0CA08          ------------------------------------------------------------
B0BZC6          ------------------------------------------------------------
A0A6G3Z709      ------------------------------------------------------------
A0A6P0M090      ------------------------------------------------------------
A0A563VX16      ------------------------------------------------------------
A0A0V7ZGW0      ------------------------------------------------------------
A0A355DPN1      ------------------------------------------------------------
A0A6J4NIB3      ------------------------------------------------------------
A0A6M0AB25      ------------------------------------------------------------
A0A1D8TTM0      ------------------------------------------------------------
A0A6P0VB93      ------------------------------------------------------------
A0A6P0W0Y0      ------------------------------------------------------------
A0A0V7ZMP6      ------------------------------------------------------------
A0A433W046      ------------------------------------------------------------
K9TU02          ------------------------------------------------------------
A0A2T1FMA8      ------------------------------------------------------------
A0A2P8QV10      ------------------------------------------------------------
B8HQ70          ------------------------------------------------------------
A0A2S6V636      ------------------------------------------------------------
A0A6P0IXR4      ------------------------------------------------------------
A0A1D9G3S3      ------------------------------------------------------------
A0A6P0KRF3      ------------------------------------------------------------
A0A6P0LQ61      ------------------------------------------------------------
A0A1D8TWE6      ------------------------------------------------------------
A0A6L9YP52      ------------------------------------------------------------
A0A6P0L3X9      ------------------------------------------------------------
A0A6M0A6X4      ------------------------------------------------------------
A0A1U7N3U5      ------------------------------------------------------------
A0A6L9ZB93      ------------------------------------------------------------
A0A6P0S980      ------------------------------------------------------------
A0A2T1EZA0      AATNSYISARYNEGESDVKTYFREDEDQATAPVA---TNGGIGPSASSTSPLPPADSVPS
A0A1U7JBN8      ------------------------------------------------------------
A0A2W4VXF4      ------------------------------------------------------------
A0A2W7AI98      ------------------------------------------------------------
A0A6G3Z347      ------------------------------------------------------------
A0A2P8QVH5      ------------------------------------------------------------
A0A2T1FT70      ------------------------------------------------------------
A0A433W4W4      ------------------------------------------------------------
K9U5W1          ------------------------------------------------------------
L8M1L4          ------------------------------------------------------------
A0A7G8GTF0      KTINSATKMYVRFKNWVIT-----------------------------------------
A0A7G8H3H8      KAIESSSRFYYNIKEWFID-----------------------------------------
A0A4P5VLH9      -------DRYISDGSSAAVQRYHEEGVSRELRQSKLKSGNGNDANQVNGTEPSDQANHPK
A0A2W6ZN45      LASKDVAEALPDN-----------------------PSDQAQSSAASGSAAKPDSNQSGS
A0A081GP61      APSNAYFNAHQQNGDLDVRSYYQQEDGSGASAATRPPSEDSKGSGVSIRSSLPDSGREST
K9P6R9          AATNSYISARYNEGESDVKTYFREDEDQASVPVA---TNGGIGPSAGSSSSLPPAESVPS
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
A0A5B8NQW4      ------------------------------------------------------------
A0A6P0XUL2      ------------------------------------------------------------
                                                                            

A0A355DU96      --------------------------------
A0A2N6LHT1      --------------------------------
A0A328V843      --------------------------------
A0A2T1DKP1      --------------------------------
A0A0D6KL48      --------------------------------
A0A6M0AN00      --------------------------------
A0A6P0ITZ8      --------------------------------
A0A6P0SLN0      --------------------------------
A0A2T1CC83      --------------------------------
A0A1B7WWU1      --------------------------------
A0A6P0S1R8      --------------------------------
A0A0A2B4S6      --------------------------------
K9SGV8          --------------------------------
B0CA08          --------------------------------
B0BZC6          --------------------------------
A0A6G3Z709      --------------------------------
A0A6P0M090      --------------------------------
A0A563VX16      --------------------------------
A0A0V7ZGW0      --------------------------------
A0A355DPN1      --------------------------------
A0A6J4NIB3      --------------------------------
A0A6M0AB25      --------------------------------
A0A1D8TTM0      --------------------------------
A0A6P0VB93      --------------------------------
A0A6P0W0Y0      --------------------------------
A0A0V7ZMP6      --------------------------------
A0A433W046      --------------------------------
K9TU02          --------------------------------
A0A2T1FMA8      --------------------------------
A0A2P8QV10      --------------------------------
B8HQ70          --------------------------------
A0A2S6V636      --------------------------------
A0A6P0IXR4      --------------------------------
A0A1D9G3S3      --------------------------------
A0A6P0KRF3      --------------------------------
A0A6P0LQ61      --------------------------------
A0A1D8TWE6      --------------------------------
A0A6L9YP52      --------------------------------
A0A6P0L3X9      --------------------------------
A0A6M0A6X4      --------------------------------
A0A1U7N3U5      --------------------------------
A0A6L9ZB93      --------------------------------
A0A6P0S980      --------------------------------
A0A2T1EZA0      RRHRPSREG-----GGGPMGWLRRRFGNRG--
A0A1U7JBN8      --------------------------------
A0A2W4VXF4      --------------------------------
A0A2W7AI98      --------------------------------
A0A6G3Z347      -KNPSDTQDDESAWYTTPLSWLKKSSGNKR--
A0A2P8QVH5      --------------------------------
A0A2T1FT70      --------------------------------
A0A433W4W4      --------------------------------
K9U5W1          --------------------------------
L8M1L4          --------------------------------
A0A7G8GTF0      --------------------------------
A0A7G8H3H8      --------------------------------
A0A4P5VLH9      G-------------------------------
A0A2W6ZN45      SGGLNRLKG-----------WFRR--------
A0A081GP61      GSHAGDSQGVRKGASQGPIGWLRQRFGRGSQR
K9P6R9          RRHRPSREG-----GDGPMGWLRRRFGNRG--
A0A1Q8BLE0      --------------------------------
A0A2T2S1W0      --------------------------------
A0A5B8NQW4      --------------------------------
A0A6P0XUL2      --------------------------------
                                                

© 1998-2021Legal notice