BYKdb

Dataset for cluster orphancd of phylum cyanobacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

43 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1B7WWU1      ------------------------------------------------------------
A0A2T1CC83      ------------------------------------------------------------
A0A2T1EZA0      MFWEEKPPKDINRITTIDARVKGHSLRVAIIIGSTFPAVHNVTTTGAPPEAFPGGTARPL
A0A6G3Z709      ------------------------------------------------------------
A0A1U7JBN8      --------------------------------------------------MPF---PPSS
A0A2W4VXF4      --------------------------------------------------MPFSSKPAAR
A0A2W7AI98      --------------------------------------------------MPFSSKPAAR
A0A0A2B4S6      ------------------------------------------------------------
A0A6G3Z347      ------------------------------------------------------------
A0A2P8QVH5      ------------------------------------------------------------
A0A2T1FT70      ------------------------------------------------------------
A0A433W4W4      ------------------------------------------------------------
K9U5W1          ------------------------------------------------------------
L8M1L4          ------------------------------------------------------------
A0A4P5VLH9      ------------------------------------------------------------
A0A2W6ZN45      ------------------------------------------------------MLTEAG
A0A081GP61      -----------------------------------------MGGFPPSGAAGRFQAPYPD
K9P6R9          ------------------------------------------------------------
K9SGV8          ------------------------------------------------------------
B0CA08          ------------------------------------------------------------
B0BZC6          ------------------------------------------------------------
A0A1D8TTM0      ------------------------------------------------------------
A0A563VX16      ------------------------------------------------------------
A0A0V7ZGW0      ------------------------------------------------------------
A0A355DPN1      ------------------------------------------------------------
A0A0V7ZMP6      ------------------------------------------------------------
A0A433W046      ------------------------------------------------------------
K9TU02          ------------------------------------------------------------
A0A2T1FMA8      ------------------------------------------------------------
A0A2P8QV10      ------------------------------------------------------------
B8HQ70          ------------------------------------------------------------
A0A2S6V636      ------------------------------------------------------------
A0A1D9G3S3      ------------------------------------------------------------
A0A1D8TWE6      ------------------------------------------------------------
A0A1U7N3U5      ------------------------------------------------------------
A0A2N6LHT1      ------------------------------------------------------------
A0A328V843      ------------------------------------------------------------
A0A0D6KL48      ------------------------------------------------------------
A0A2T1DKP1      ------------------------------------------------------------
A0A355DU96      ------------------------------------------------------------
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
A0A5B8NQW4      ------------------------------------------------------------
                                                                            

A0A1B7WWU1      ------------------------------------------------------------
A0A2T1CC83      ------------------------------------------------------------
A0A2T1EZA0      SLPGTGASGPGLFDPSSQQSPLSPMGESQSGGGGLGGIVRTVKRR--QSIFLITFALVTG
A0A6G3Z709      ------------------------------------------------------------
A0A1U7JBN8      THEINGNGHGHAKPGFMTVMAPPS-LVEQRDEVDFNQLVGVFRRRA-----GIFFGVAAL
A0A2W4VXF4      EVNGNGNGQGHASQSFVPVTAPPSPLIDDGDDFDLNHLVAVLGRRA-----GIFWGVAAL
A0A2W7AI98      EVNGNGNGQGHASQSFVPVTAPPSPLIDDGDDFDLNHLVAVLGRRA-----GIFGGVAAL
A0A0A2B4S6      ------------------------------------------------------------
A0A6G3Z347      ----------MTSELQSPPANMLAPAPAQEGGLKLGRFASALKRN--ILLIAGITTL---
A0A2P8QVH5      ---------MADTSLDNERLSVEHRVENRANATDLRQLFTVLLRR--RLLILSLFCI---
A0A2T1FT70      ---------MADTSLDNERLSVEHRVENRANATDLRQLFTVLLRR--RLLILSLFCI---
A0A433W4W4      ---------MADTSLDNERLSVEHRVENRANATDLRQLFTVLLRR--RLLILSLFCI---
K9U5W1          ---------MADTSLDNERLSVEHRVENRANATDLRQLFTVLLRR--RLLILSLFCI---
L8M1L4          ---------MNNTIVRSDFVNLPAQETGFSLSDFKQILYRRWKPA--LALGIMAFGVVL-
A0A4P5VLH9      ------------------------------------------------------------
A0A2W6ZN45      SPTPHSPFGTGSTQVAASALSPTANQPDDASTNVLFKLIRSLKRR--QALFLFVFFVTTA
A0A081GP61      QPLQSPLTPTAEAQAGSGGLG---------------GLVRTIRRR--QTVFLLTFAVVTG
K9P6R9          ---------MGETQSGGGGLG---------------GLVRTVKRR--QSIFLITFAVVTG
K9SGV8          -------------------------------MNQLQQYLFIIRRRWPVATLVFVSAVLVT
B0CA08          ----------------------------------MSNYWLMLKRRG-LPAGFTFLTVLSL
B0BZC6          -----------------------------MNESVSKVIKIIYRNRW-TTVGTFLSVFTGI
A0A1D8TTM0      ----------------------------------MNRLIAIAIRHW-KPVIGLNIVLSAI
A0A563VX16      -----------MEQRIENYMNQNVYDLDNSTELGYGEIFSIFWRRR-SYFIGICGGVLAC
A0A0V7ZGW0      -----------------------------------MKVSAIIQRLW-LPLLGLNGVIVGS
A0A355DPN1      -------------------------------------------------MLGVFCGVLAI
A0A0V7ZMP6      ----------------------------------MKKATKIAVRHW-KFVLAWNKIILGI
A0A433W046      ----------------------------------MKQIFSIARKHW-LPLLGFNTAVLAA
K9TU02          ----------------------------------MKQIFSIARKHW-LPLLGFNTAVLAA
A0A2T1FMA8      ----------------------------------MKQIFSIARKHW-LPLLGFNTAVLAA
A0A2P8QV10      ----------------------------------MKQIFSIARKHW-LPLLGFNSAVLAA
B8HQ70          ----------------------------------MFQITSTLRRHW-KPLIALNTVLIGS
A0A2S6V636      ----------------------------------MNHIVNIIRRHW-MPLLLLNGVVLAA
A0A1D9G3S3      ----------------------------------MKKVAAILNRHW-TILLVFNSLVLGA
A0A1D8TWE6      ----------------------------------MKKVAGILNRHW-TFLLVFNSLVLGA
A0A1U7N3U5      ----------------------------------MKKVAAILNRHW-TILLVFNSLVLAA
A0A2N6LHT1      ------------------------------------------------------------
A0A328V843      ------------------------------------------------------------
A0A0D6KL48      ------------------------------------------------------------
A0A2T1DKP1      ------------------------------------------------------------
A0A355DU96      ------------------------------------------------------------
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
A0A5B8NQW4      ------------------------------------------------------------
                                                                            

A0A1B7WWU1      ------------------------------------------------------------
A0A2T1CC83      ------------------------------------------------------------
A0A2T1EZA0      VLAINTLRQRIFSPVYQGGFQMQISNPFDNPGTGGGGGGSVESIARSEI----KTDVPSL
A0A6G3Z709      ------------------------------------------------------------
A0A1U7JBN8      SLAGFTLWHLSRPPAYSGSASLLVEPVTAVNTPGLETVTGAPSP-SGS-----GLDYTSQ
A0A2W4VXF4      SFGGLTLWHLTRPPVYNGSANLLVEPVTVVNTPGLEAVMELPGARSAS-----GLDYTSQ
A0A2W7AI98      SFGGLTLWHLTRPPVYNGSANLLVEPVTVVNTPGLEAVMELPGARSAS-----GLDYTSQ
A0A0A2B4S6      --------------------MLISDPLNNNKNNSANSIGGVFEQLALNST---DNDLPTL
A0A6G3Z347      TASAAVFKAITDTPTYESSLELLTPPITL---ETQIISTLNPEALSNQSEVVNVAIDETK
A0A2P8QVH5      PLSASSFLALMAKPTYQSSMQLLVSSNLYQGQNSNAQGGVEESDF-TDSNL--KVDYTAQ
A0A2T1FT70      PLSASSFLALMAKPTYQSSMQLLVSSNLYQGQNSNAQGGVEESDF-TDSNL--KVDYTAQ
A0A433W4W4      PLSASSFLALMAKPTYQSSMQLLVSSNLYQGQNSNAQGGVEESDF-TDSNL--KVDYTAQ
K9U5W1          PLSASSFLALMAKPTYQSSMQLLVSSNLYQGQNSNAQGGVEESDF-TDSNL--KVDYTAQ
L8M1L4          ------IPKLLSTPQYRSEAKILLKSP-----QNQQSAEVQLNALNSRRNYYNLKDLSTD
A0A4P5VLH9      -------------------------------MEASRGGESKLETI-ARQTQ--KNDVPSL
A0A2W6ZN45      LLAANALRQRIVAPVYIGGFQMLITDPLANVGPS-TPSSGVVESL-AKTTSLGNSDVPTL
A0A081GP61      ALAINTLRQRIFSPVYQGGFQMQISNPFED--KNGGGGGGSVEAI-ARTPL--KPDVPSL
K9P6R9          VLAINTLRQRIFSPVYQGGFQMQISNPFDNPGSGGGGGGGSVETI-ARSEI--KTDVPSL
K9SGV8          TFHAIFVMK----PRYRASGEMLVTPGDQAIAITNVGVSKTVNQPRSLSG----GYLNTE
B0CA08          ALLQAFQEK----PIYEAVGQLKFEE-SQRSSKLIGLDSAVDDESRQQSSLRWQRSLDTE
B0BZC6          VVYLLITPR-----LYSAKVRLILDQRPATSISPLGRDIAQTPGDN-------NKGLATQ
A0A1D8TTM0      ALYNASKVT----EVWAARAKLIIPKSSSDLNANLGTLGDFRDRGVSFSQ-Q-VNPLNNL
A0A563VX16      MIPLVLTQK----PVYRSSMQMLVEP-NYEDKDNRGDFDPIESSI--------EIDYATQ
A0A0V7ZGW0      VIMIATFSQ----KTWTANAQLILPDTTTNLDASLGTLGQLKEQGVAFTN-E-LNPLKVL
A0A355DPN1      AIPIALNKE----PTYQSSMQLLIEP-----YVQQKQEGKPQTEEQFTDS-NVEVDYATQ
A0A0V7ZMP6      AVANIALLP----RVWISKSLLILPTSTSNVDADLDNSDDLKTKEVGFSQ-Q-VNPLNVI
A0A433W046      TIYAAFYASTSIPPVWTANAKLNLPQ-TGGLSANLGPLGSTQTTALNFKD---VSPLDVQ
K9TU02          TIYAAFYASTSIPPVWTANAKLNLPQ-TGGLSANLGPLGSTQTTALNFKD---VSPLDVQ
A0A2T1FMA8      TIYAAFYASTSIPPVWTANAKLNLPQ-TGGLSANLGPLGSTQTTALNFKD---VSPLDVQ
A0A2P8QV10      TIYAAFYASTSIPPVWTANAKLNLPQ-TGGLSANLGPLGSTQTTALNFKD---VSPLDVQ
B8HQ70          TALIAAFYP----RTWQASARFVVPINTNQLSADIGTLGQLRPGDGVVPS-DLMNPVTLQ
A0A2S6V636      TLYSVIYTKTNVAPVWKATAKLNLPQPTTRLDTNLGTLGQIQNTALGFTR-E-LNPLQIQ
A0A1D9G3S3      SFGAFSLLK----PFWIAKAQLILPE-TGKLQASLGTLGSLTKGDSKLAT-K-SHPLNMQ
A0A1D8TWE6      SFGAFSLLK----PFWIAKAQLILPE-TGKLQASLGTLGSLTKGDSKLAT-K-SHPLNMQ
A0A1U7N3U5      SFGAFSLLK----PFWIAKAQLILPE-TGKLQASLGTLGSLTKGDSKLAT-K-SHPLNMQ
A0A2N6LHT1      ------------------------------------------------------------
A0A328V843      ------------------------------------------------------------
A0A0D6KL48      ------------------------------------------------------------
A0A2T1DKP1      ------------------------------------------------------------
A0A355DU96      ------------------------------------------------------------
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
A0A5B8NQW4      ------------------------------------------------------------
                                                                            

A0A1B7WWU1      ------------------------------------------------------------
A0A2T1CC83      ------------------------------------------------------------
A0A2T1EZA0      IVLMRSPLLLGPVAQRQGV----------PLRALESNLSIN---------QESAR-----
A0A6G3Z709      ---MEPRTLLGKVDAK----------------------------------PISGT-----
A0A1U7JBN8      IRVLRGPAVINPILAKIQQRYPDI-----TYNSLLNGLNIV---------QEGES-----
A0A2W4VXF4      IRVLRGPDVIKPILVNIQRQHPEI-----TYTTLLNDLVIS---------QEGES-----
A0A2W7AI98      IRVLRGPDVIKPILVNIQRQHPEI-----TYTTLLNDLVIS---------QEGES-----
A0A0A2B4S6      IELLKSPILLNPISKDYGI----------PFNKFSKSLKIS---------TPGGLRTQSM
A0A6G3Z347      LKILKSPRVMEPIVVRLQERYLDI-----DYGEVVGSLDIY---------PTSTG-----
A0A2P8QVH5      LSVMTSPKLVERAVELLRPEYPNI-----TVEEINGKPAKV---------KQSPLKVTQV
A0A2T1FT70      LSVMTSPKLVERAVELLRPEYPNI-----TVEEINGKPAKV---------KQSPLKVTQV
A0A433W4W4      LSVMTSPKLVERAVELLRPEYPNI-----TVEEINGKPAKV---------KQSPLKVTQV
K9U5W1          LSVMTSPKLVERAVELLRPEYPNI-----TVEEINGKPAKV---------KQSPLKVTQV
L8M1L4          ILVLKSYSLINKAIEKYPETFSGL-----SAAEVRTKLNIF---------PAMINDIPT-
A0A4P5VLH9      IVLMRSPLLVKPVADR-----MGV-----SINDLISNLSIA---------P-AGN--VE-
A0A2W6ZN45      IQLLTSPVVLKPIAEA-----QAI-----PLGSLIGSLAIG---------STRAD--SQ-
A0A081GP61      IVLMRSPLLLGPVAQR-----QGV-----PLDLLAANLSIN---------PESAA--VE-
K9P6R9          IVLMRSPLLLGPVAQR-----QGV-----SLGALESNLSIN---------QESAQ--VE-
K9SGV8          MQIMRSKEVIQRALEIVERPISYG--------EFLGSFGVN---------VIPGT-----
B0CA08          ILTMKSPRRLSMLALAIESQGLFS---RPSVEQIKSGLDIS---------QFDET-----
B0BZC6          EELVRSKSVLTKAIVLFNQSNQDSAIEKVTLGEVKPEVATE---------VIPGT-----
A0A1D8TTM0      SSIMTSNDTISQVWEFDPEKSLYP-----RLSGYKSLFDVS---------PEGES-----
A0A563VX16      LNLMRSSQLLGRAVVKLRPSYPDI-----TTEEIQNYLVVSQVREQEDK-KEVGT-----
A0A0V7ZGW0      TSIITSDDAIRPVLLSDPEKDKFR-----SLSSYKKLFKVK---------PTDQS-----
A0A355DPN1      LNLMRSSQLIQKAVDRLHPKYPEI-----QVTDIKESFSLTGVQEEDTDIKDTQT-----
A0A0V7ZMP6      SSIATSDNVLKKVWEQDPQKTSYK-----QLSEYRGLFDVS---------PENDS-----
A0A433W046      LAILTSDAVMKRVQAVDPEKSLYS-----KVSSFSQLFVVT---------PQPAT-----
K9TU02          LAILTSDAVMKRVQAVDPEKSLYS-----KVSSFSQLFVVT---------PQPAT-----
A0A2T1FMA8      LAILTSDAVMKRVQAVDPEKSLYS-----KVSSFSQLFVVT---------PQPAT-----
A0A2P8QV10      LAILTSDAVMKRVQAVDPEKSLYS-----KVSSFSQLFVVT---------PQPAT-----
B8HQ70          AEIVKSPTLIGQVLAVDPERDQ-H-----TLQSFMPLFEAK---------PQSLS-----
A0A2S6V636      MAILMSDTVMERTLAVDPEKSLFP-----RLSDYKLAFSAT---------PQEQS-----
A0A1D9G3S3      ASILTSDALMRRLLESDPEKTDFQ-----RLVQYKKLFAVS---------PDQES-----
A0A1D8TWE6      ASILTSDALMSRLLESDLEKTDFQ-----RLVQYKKLFAIS---------PDQES-----
A0A1U7N3U5      ASILNSDALMRRLLESDPEKTDFQ-----RLVQYKKLFAVS---------PDQES-----
A0A2N6LHT1      ------------------------------------------------------------
A0A328V843      ------------------------------------------------------------
A0A0D6KL48      ------------------------------------------------------------
A0A2T1DKP1      ------------------------------------------------------------
A0A355DU96      ------------------------------------------------------------
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
A0A5B8NQW4      ------------------------------------------------------------
                                                                            

A0A1B7WWU1      ------------------------------------------------------------
A0A2T1CC83      ------------------------------------------------------------
A0A2T1EZA0      ---------VDNVLNVSLRWPDPAKGKAILRQLAKDYTSFSLTQRQAAVNSGVRFLDEQA
A0A6G3Z709      -----------DVMRITVRSEDPQEAADIANQVIDSYRRQNIDSNREEAAAARLFIEDQL
A0A1U7JBN8      -----------KVLRISYSNADPAVAAFVLNQVVEGFVNYSVQDRQGDLRRGLTFLDEQL
A0A2W4VXF4      -----------KVLRISYSDADPEVVTTVMSEVVKGFVAYSVQDRQGELRRGLEFLDEQL
A0A2W7AI98      -----------KVLRISYRDADPEVVTTVMSEVVEGFVAYSVQDRQGELRRGLEFLDEQL
A0A0A2B4S6      AQ---------GVLRISFKGENPRIVNSMLVSISKAYLKSALDQKQQRLSDGLIFLNNQS
A0A6G3Z347      -----------DTLTVQYKGVDAEKVLYVLEVVAEFYLKFSLEDRQNDIFRGIDFVDEQL
A0A2P8QVH5      ESGTKTLQTLSQVFEVTFVAGDPIKSQKVLQALQNVYQIYNLEQQKLRLTNGLAFVNEQL
A0A2T1FT70      ESGTKTLQTLSQVFEVTFVAGDPIKSQKVLQALQNVYQIYNLEQQKLRLTNGLAFVNEQL
A0A433W4W4      ESGTKTLQTLSQVFEVTFVAGDPIKSQKVLQALQNVYQIYNLEQQKLRLTNGLAFVNEQL
K9U5W1          ESGTKTLQTLSQVFEVTFVAGDPIKSQKVLQALQNVYQIYNLEQQKLRLTNGLAFVNEQL
L8M1L4          -----------DILNISFVDSAPEVAQGVLDALSEVYVEYSLERERSQALNAIQFIEEQL
A0A4P5VLH9      -----------EVLNVNLRWRDPAKGRLILNELSKDYTKFSKSQRESTLNSGVEFLEQQA
A0A2W6ZN45      -----------GVLNIQLRWSDPVQGRKILTALADSYPKYALIQRQEKLGQGLEFLGQQA
A0A081GP61      -----------NVLNISLRWPDPVKGKAILRQLAKDYTAFSLTQRQAAVNSGVRFLDQQA
K9P6R9          -----------NVLNVSLSWPDPAKGKAILRQLAKDYTAFSLTQRQAAVNSGVRFLDEQA
K9SGV8          -----------DVLRFSYTSGDPKLAVEAANSMMQSYAENNIERNRAAVRAARLFIEEQL
B0CA08          -----------NVVQIRFKSYNREFPKNIVNLLMQQYVDNTPKSKQASTQSAISFIEKQL
B0BZC6          -----------QIIEITFRHTDPGVTSSLLNLIASSVIQENAETIRSEARATRQFLENQI
A0A1D8TTM0      -----------TIISLSAEGSTPELARQRTAALIEAFQQRLNELRLDDAVQRSQFMRKEL
A0A563VX16      -----------KIFQAVYKDEDAEKTQRVLEAIQEVYLEYNLEQQDKRLREGLSFINQEI
A0A0V7ZGW0      -----------TNIQLQVTASEPELAKQRAKRLIESYQERLNELRQGTANAREQFTQRQL
A0A355DPN1      -----------KIVKVVYTSNDPIKTQDVLAAIQTVYQDYNLQQQQVRLTEGLAFINDQL
A0A0V7ZMP6      -----------TVISLSVEGSTPKLATERAQNLIASLKERLQELRQDRVISQSEFIQDEV
A0A433W046      -----------TLIEVEAQGSRPDIAYKRLFTFLEVYQQRLNELRRKDAEVRVQYTQEEL
K9TU02          -----------TLIEVEAQGSRPDIAYKRLFTFLEVYQQRLNELRRKDAEVRVQYTQEEL
A0A2T1FMA8      -----------TLIEVEAQGSRPDIAYKRLFTFLEVYQQRLNELRRKDAEVRVQYTQEEL
A0A2P8QV10      -----------TLIEVEAQGSRPDLAYKRLFTFLEVYQQRLNELRRKDAEVRVQYTQEEL
B8HQ70          -----------PLMTVEVKGTTPELAHQRLSTWIKLYQKRLTYLRENDASTRQTLPQQEL
A0A2S6V636      -----------TIINLQVKASSPDIAQRRLSNLINIYQLRLNELRHQDTNVRKQFSQTDL
A0A1D9G3S3      -----------TTIWLNASGDSPELARDRVKALISAYQERLNELRQADGTTRVEFNKKAL
A0A1D8TWE6      -----------TTIWLNARGDSPELARDRVKALISAYQDRLNELRQADGSTRVEFNKKAL
A0A1U7N3U5      -----------TTIWLNATGDSPKLARDRVKALISAYQERLNELRQADGTTRVEFNKKAL
A0A2N6LHT1      ------------------------------------------------------------
A0A328V843      ------------------------------------------------------------
A0A0D6KL48      ------------------------------------------------------------
A0A2T1DKP1      ------------------------------------------------------------
A0A355DU96      ------------------------------------------------------------
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
A0A5B8NQW4      ------------------------------------------------------------
                                                                            

A0A1B7WWU1      ------------------------------------------------------------
A0A2T1CC83      ------------------------------------------------------------
A0A2T1EZA0      PAIEERVQKLSQEMLKFRERNNFVDPAA-AAGQILGAREGLVNQLRTLQNEQVQLDSQLK
A0A6G3Z709      PETEKEVLRVEEALRQFKETNDIISLDQ-EASNAVSVLSNLDQEITQLQARLADLDAQSA
A0A1U7JBN8      QEKWQEVAAIEGDLSEFQKRYDLVDVNA-TSESVTQRLNQMLADQEQLRVELSALAPLYE
A0A2W4VXF4      QEKWQEVDTIESDLSEFQKRYDLVNVTT-TAESVAQRLNQMLSDQEQLRVQLTSLGPLYE
A0A2W7AI98      QEKWQEVDTIESDLSEFQKRYDLVNVTT-TAESVAQRLNQMLSDQEQLRVQLTSLGPLYE
A0A0A2B4S6      PKLEGKNKQVQKELSDFRERNQLIEPTV-EGQELKTRLDYLENELDNIKNERVKLNNLLN
A0A6G3Z347      PIVRDRVEQLEAELEGLRQRSNLIDPLQ-QGEQLSQKAAEFTAEQLNLRVQIQEAEQLSQ
A0A2P8QVH5      PKIRKDVSQAEANLENFRKQNKLLDPEV-QAKNLLDALAAVESERRTIRAQFQDQQARYN
A0A2T1FT70      PKIRKDVSQAEANLENFRKQNKLLDPEV-QAKNLLDALAAVESERRTIRAQFQDQQARYN
A0A433W4W4      PKIRKDVSQAEANLENFRKQNKLLDPEV-QAKNLLDALAAVESERRTIRAQFQDQQARYN
K9U5W1          PKIRKDVSQAEANLENFRKQNKLLDPEV-QAKNLLDALAAVESERRTIRAQFQDQQARYN
L8M1L4          PKAEEELNKAAFAIRSFRQKNNLVDPDE-YVGRVADFRQSLEEELKRGEIALDIAQTKYR
A0A4P5VLH9      PRLRNNVTKLEAQLLDFRQKYNVLDPSG-LAEKIVSNRDDLVAKSMALQVEHNDLKSKLA
A0A2W6ZN45      PALQQRVNSLQRTLKQFRESNSFLEPLA-QGGSIISSRDGLLGQLRTLQVEQAELETQLA
A0A081GP61      PAIEARVQKLSNEMLRFRERNNFVDPAT-AAGQILGARDGLVNQLRDLQNEQVQLDSQLQ
K9P6R9          PAIEERVQKLSQEMLKFRQRNNFVDPAT-AAGQILGAREGLVNQLRTLQNEQVQLDSQLK
K9SGV8          PKAEQDVENAEQQLRAFREQYNFVSASA-EAEATIDRFRSTESRIEDMQVSLAKIDAQSD
B0CA08          PQVKQRVNSAETALRKFKETYQIADLEI-AKSANATNLSQLQTALDEIDRELVEVQTQQL
B0BZC6          PRRQQELVKVESSISQFKQQYNIVSLEETDNKRLTQSIAEAEKVAEEISANLRQVQARGL
A0A1D8TTM0      EQAAENLRQTQAALVAFKASSNLVSAED-QTREMVTAINTLTTEQAQVLAQAQASKAQVE
A0A563VX16      PEVRQKLTNAERNLEVMLTRYNLIAPQT-EAIDISKLLTNTRQQREELKAQYKQTQSKYE
A0A0V7ZGW0      KDAERNLQLVKSKLAQFKKSTGFVSDEE-QTKNLVTAINTLRTTQTDVLAQAKATATRSQ
A0A355DPN1      PTARDNVIQAEKALEQFRETQNLIDPVQ-QATTITDALSTVEQEQQAIRAQYQETQARYR
A0A0V7ZMP6      RQAHRKLMDAQKKLNKFKEAGNVISDEH-DAKQKVITINALNKSRVEALAEAKAAQAQTR
A0A433W046      EQARLNLNQAQANLSNFQRSTGLVNSPE-QSGGLISAINNLKTTQATLIAQGQANATQAQ
K9TU02          EQARLNLNQAQANLSNFQRSTGLVNSPE-QSGGLISAINNLKTTQATLIAQGQANATQAQ
A0A2T1FMA8      EQARLNLNQAQANLSNFQRSTGLVNSPE-QSGGLISAINNLKTTQATLIAQGQANATQAQ
A0A2P8QV10      EQARLNLNQAQANLSNFQRSTGLVDSPE-QSKGLISAINNLKTTQATLIAQGQANATQAQ
B8HQ70          QEASNNLRRTQTQLSVFRQANNITDINE-QIRGLVNSISDLKTEYARALAQAQASNAQQQ
A0A2S6V636      EEAQAQLAKAQAELASFQQATGLTEVAE-QTRALIAQQRELRTTYTNVLSQAQANQAQAQ
A0A1D9G3S3      ERAKQKLDQSQEALAKFQESSGLVNSKA-QTEGLVRAITDLSISQAQAQAEAQASQHQLQ
A0A1D8TWE6      ERAKQKLDQSQEALAKFQESSGLVNSKA-QTEGLVRAITDLSISQAQAQAQAQASQHQLQ
A0A1U7N3U5      ERAKQKLDQSQEALAKFQESSGLVNSKA-QTEGLVRAITDLSISQAQAQAQAQASQHQLQ
A0A2N6LHT1      ----KQLQEAEQKENRYRQSSGIVSFDE-QTKSLVESLATLEEQENTLSAQLQELRSKEA
A0A328V843      --------------QYFKQRNYVVDLGT-EFAISVQEMAQLNRNITTLEAELNAVQSLVN
A0A0D6KL48      ------------------------------------------------------------
A0A2T1DKP1      ------------------------------------------------------------
A0A355DU96      ------------------------------------------------------------
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
A0A5B8NQW4      ------------------------------------------------------------
                                                                            

A0A1B7WWU1      ------------------------------------------------------------
A0A2T1CC83      ------------------------------------------------------------
A0A2T1EZA0      SIQTGKL-QFTPSGAPTALEQLGRNS---------VLVPGRGDSAAEAASGTKTPLDLLN
A0A6G3Z709      RIQGQL--GLNV-SEGLALSSLNQSD------------------------GVQESLSELQ
A0A1U7JBN8      NLREQV--GFDP-NTAIRVANLNESP------------------------TYQALLGDLR
A0A2W4VXF4      NLRSQV--GFEP-SVAIGVANLNESP------------------------TYQGLLGDLR
A0A2W7AI98      NLRSQV--GFEP-SVAIGVANLNESP------------------------TYQGLLGDLR
A0A0A2B4S6      SIENGSLTAYGFKQAITTDLNLNERI---------------PTEGVSFINLDLELLDQYI
A0A6G3Z347      NLQRELLE----GEESAVTSALLESE------------------------RYQNLLNQML
A0A2P8QVH5      KLQQ---QISRSPQQALIASRLSQSP------------------------RYQSLLDEIQ
A0A2T1FT70      KLQQ---QISRSPQQALIASRLSQSP------------------------RYQSLLDEIQ
A0A433W4W4      KLQQ---QISRSPQQALIASRLSQSP------------------------RYQSLLDEIQ
K9U5W1          KLQQ---QISRSPQQALIASRLSQSP------------------------RYQSLLDEIQ
L8M1L4          TISNQLIELGQDPETIVTTSVLGQDG------------------------VYQSLASQLK
A0A4P5VLH9      SVQSGRLNWTPSGAP-TPIQQLGRQG-------TVIPGRSDANDSNEIGAGQTTPNETLD
A0A2W6ZN45      SVRSGKLITLPSPGS-SGSGVVGQGSPAAGNPQLGLATRPRADSVAPSSNTVVTPQQQLS
A0A081GP61      SIQSGKLQFSSSGAP-TAIQQLGRNS-------VLVPGRANQNQGAEVAKGTPTPLDLLN
K9P6R9          SIQTGKLQFTPSGAP-TALEQLGRNS-------VLVPGRG--NSAAEASSGTKTPLDLLN
K9SGV8          QLGNLVADEIDSVEQALLRTALSQSP------------------------HTAGVMGELQ
B0CA08          SLQNML--KVNP-QQAI----LGIST------------------------AHKNISTSLE
B0BZC6          ALSKVI--DQSSGKESYLSAKAGQNP------------------------ELISLRDQLS
A0A1D8TTM0      TLSARL--ELNP-QQAIRSLSLGENQ------------------------DYQFFRQELS
A0A563VX16      SLEQQL--ATTG-NVDSVDSRLSLSS------------------------RYQNLLNELQ
A0A0V7ZGW0      ELSRTL--GMAP-QQAINSLRLSENK------------------------EYQALRQKLT
A0A355DPN1      VLQQQL--ERSP-QEALTSSRLSQSP------------------------RYQALLNELQ
A0A0V7ZMP6      ILSARL--SLPP-QTALKSLQTKGTE------------------------TSLSIREKLS
A0A433W046      AAAVSL--GITP-QQAMNSLRLGENK------------------------EYQATRTQLS
K9TU02          AAAVSL--GITP-QQAMNSLRLGENK------------------------EYQATRTQLS
A0A2T1FMA8      AAAVSL--GITP-QQAMNSLRLGENK------------------------EYQATRTQLS
A0A2P8QV10      AAAVSL--GITP-QQAMNSLRLGENK------------------------EYQATRTQLS
B8HQ70          ALSQHL--RLTP-QAAMTTLRLGENK------------------------EYQLVRDRLA
A0A2S6V636      AASERL--GINA-QQAMNSLRLGENR------------------------EYQAIRQKLS
A0A1D9G3S3      ILSTRL--GLTP-KQAIRSLGLAENR------------------------DYQFVRQQLT
A0A1D8TWE6      ILSTRL--GLTP-KQAIRSLGLAENR------------------------DYQFVRQQLT
A0A1U7N3U5      ILSTRL--GLTP-KQAIRSLGLAENR------------------------DYQFVRQQLT
A0A2N6LHT1      SLQQVT--DAKALNQAYAAVRGGQDE------------------------ELKALRNKLA
A0A328V843      SLGNQV--GLN-LEEAIAVNTLSQSP------------------------VVRAALQELE
A0A0D6KL48      --------MKLNTDTAVELTTLSQSP------------------------GVQQVLTEYQ
A0A2T1DKP1      ------------------------------------------------------------
A0A355DU96      ------------------------------------------------------------
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
A0A5B8NQW4      ------------------------------------------------------------
                                                                            

A0A1B7WWU1      ------------------------------------------------------------
A0A2T1CC83      ------------------------------------------------------------
A0A2T1EZA0      QFEQELATAKGTFKENSPIVQSLLARRNQLLPVVQRQAADAV------------------
A0A6G3Z709      NIQAELAEERSRYREGHPAIDMLERREAEAEALLGSRIQEVL----------------GR
A0A1U7JBN8      EIEQTIAAESARFQADTPMIEALTDQRQQLLPLLEAEAQRLV------------------
A0A2W4VXF4      EIEQTIAAESARFQSDTPMIEVLVDQRQQLLPLLEAEAGRLV------------------
A0A2W7AI98      EIEQTIAAESARFQSDTPMIEVLVDQRQQLLPLLEAEAGRLV------------------
A0A0A2B4S6      LVKQKLAIARTKYLEDSEIVKGLKYRVEQIEPTLKSNQISAL------------------
A0A6G3Z347      ELDGQLAEELTLYLEDSPEIEVIREQRENLQPLLQREGIRVQ------------------
A0A2P8QVH5      ALDVTLEKLRVQYRDDYPKVQDLLKQRQNLIGLLRTEAGRSA--------------DRLP
A0A2T1FT70      ALDVTLEKLRVQYRDDYPKVQDLLKQRQNLIGLLRTEAGRSA--------------DRLP
A0A433W4W4      ALDVTLEKLRVQYRDDYPKVQDLLKQRQNLIGLLRTEAGRSA--------------DRLP
K9U5W1          ALDVTLEKLRVQYRDDYPKVQDLLKQRQNLIGLLRTEAGRSA--------------DRLP
L8M1L4          DLETQYTLASVQFKDNYPMMQDLKLQREQLRNLLLERSTQILGEGISPAVLDKVLVSYTQ
A0A4P5VLH9      EFEQKLANARAVYKDDSPIVQSILAQRDAILPVVRKQATDAI------------------
A0A2W6ZN45      QLDQQIATARATFKSDSPQLQTLLAQRNRIKPLVQSQGIDQL------------------
A0A081GP61      QFEQELATAKGTYKQNSPIVQSLLARRNQLLPVVQRQASDAV------------------
K9P6R9          QFEQELATAKGTFKENSPIVQSLLARRNQLLPVVQRQAADAV------------------
K9SGV8          QTKQAIATQLAIYREDSPQIAVLRDQERNLEQLLRQRAKQVA--------------GIPP
B0CA08          EIDKDLAEAKSNFREDHPAVLELLERQAQLKQLLSQKIEKFA------------------
B0BZC6          NLESQLKIRRESLTDDHPDIQKLITEKDAAQALYQQKLATIS--------------PRSR
A0A1D8TTM0      EVEALLTETQAKFTNENPQVQALLEQREELQNQIEGYIFQAR--------------AAQP
A0A563VX16      RIDIELETQRSRFTDSNPIVQGLLTERRQKQQLLEKEAGNIL--------------GSTN
A0A0V7ZGW0      EVNTEIAVNRGTLTEEHPTVRALLQQRQKLLMALNRQLNAVV--------------PSAD
A0A355DPN1      KTELAIAQQRVKFTDAEPRVEQLLEQRQRQLALLQEETQRVL--------------GETS
A0A0V7ZMP6      KVNISLQEAQTYLTDNHPRIENLKFQQEELRNELQED-RVSD--------------NSVS
A0A433W046      QLESTMAVTRSKYRDDSPQVQSLLQQRQQLLRQLNQQIAVAI--------------PGAN
K9TU02          QLESTMAVTRSKYRDDSPQVQSLLQQRQQLLRQLNQQIAVAI--------------PGAN
A0A2T1FMA8      QLESTMAVTRSKYRDDSPQVQSLLQQRQQLLRQLNQQIAVAI--------------PGAN
A0A2P8QV10      QLESTMAVTRSKYRDDSPQVQSLLQQRQQLLRQLNQQIAVAI--------------PGAR
B8HQ70          QVEADLATARGTLTDDNPRVQDLLEQRQKLTQLLDQNLRAAI--------------GNSS
A0A2S6V636      DAETALAEARSRYTDESPQVQSLLSQRQELMQLLNQQIAIAA--------------PGAS
A0A1D9G3S3      ELEATLVKAQATYTYAHPEIQNLLLQREQLQQQIQQYIFLA-----------------AG
A0A1D8TWE6      ELEATLVKAQTTYTYAHPEIQNLLLQREQLQQQIQQYIFLA-----------------AG
A0A1U7N3U5      ELEATLVKAQTTYTYAHPEIQNLLLQREELQQQIQQYIFLA-----------------AG
A0A2N6LHT1      EIETQLVQARLSLTDNHPTVINLLGQRNGLRALYQQGLARVS------------------
A0A328V843      NVEGELAQEQRRFRDENPRIISLKGKRDNLENLLQREIQVYL------------------
A0A0D6KL48      KVQDELAVARTRLTEDNPKIINLENQAVALKNQLEGRVAQTI------------------
A0A2T1DKP1      -------VEQTRYRSGHPAIANLERKVDALNALLQERIGQVV------------------
A0A355DU96      ------------------------------------------------------------
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
A0A5B8NQW4      ------------------------------------------------------------
                                                                            

A0A1B7WWU1      -------------------------------------TKQVEELQRVFIFNRRRLDSLPR
A0A2T1CC83      -------------------------------------VGALYNSQQDLI---KRAKVLPQ
A0A2T1EZA0      ------------------------------KARLLANVAQQDEINRQILLLSENFRNNPQ
A0A6G3Z709      ELTVPVEDLNVGRLQLGELRQNLIAELTRLEVERIGVNNRMAQLTNSRNSFLLRANNLPQ
A0A1U7JBN8      ----GSAVEAETLGYQGSVSQDLMQQLVNTANQMQVLQTQDQAIGQAVQLLRAEIQRLAD
A0A2W4VXF4      ----GSAVDANTLGYQGSVSRELVQQLVDTANQMQVLETQDQAIAQAVQQLRAEIQRLAD
A0A2W7AI98      ----GSAVDANTLGYQGSVSRELVQQLVDTANQMQVLETQDQAIAQAVQQLRAEIQRLAD
A0A0A2B4S6      ------------------------------ISAREIIDKNIQNAKIKIKSLKEKFEKQPK
A0A6G3Z347      ---------------------------DQLANFTRELQVRDQALTRAITTLNQQIKDLST
A0A2P8QVH5      AQLSTTEKSLPKQLQLGDSDRKLVDALVDAQVVWFGLSARDQSLAKSEQQLRSTLLKYPQ
A0A2T1FT70      AQLSTTEKSLPKQLQLGDSDRKLVDALVDAQVVWFGLSARDQSLAKSEQQLRSTLLKYPQ
A0A433W4W4      AQLSTTEKSLPKQLQLGDSDRKLVDALVDAQVVWFGLSARDQSLAKSEQQLRSTLLKYPQ
K9U5W1          AQLSTTEKSLPKQLQLGDSDRKLVDALVDAQVVWFGLSARDQSLAKSEQQLRSTLLKYPQ
L8M1L4          TNIVAAGDSGSQVSTSGSTLQQLAEQLLSTQTEYLSLQSQINQINQAKANVEADFQRLPQ
A0A4P5VLH9      ------------------------------KAQLFANESQQDELNRQILLLNENFKNSPS
A0A2W6ZN45      ------------------------------SSQLFANQAQQNELNRQILLLNKNFKQSPE
A0A081GP61      ------------------------------KARLLSNLAQQDEINRQILLLNQNFRNNPQ
K9P6R9          ------------------------------KARLLANVAQQDEINRQILLLSENFRNNPQ
K9SGV8          SESI-DIDALF---QIGGLQEQSVQQFYSLDNERVGLLEEISALNDVYSNYRERYRELPK
B0CA08          -----QSDAQL--NFDSNQEDDLRSQLIQLDIRRNGLSKQQLKLRQQLSSYRQQARNLPQ
B0BZC6          LNSDGTVQVAN-----EKVTQELSEKLVLSVVERNELRDKLANTRAYISKLDARRKQYPV
A0A1D8TTM0      -----GVNATI-----GQESAALIRELILAESQTQAYYSQGKQIQTQIDQLGSILKTLPA
A0A563VX16      LQVS-SSDNLESRGQLDSSNLELAEALASTRNELIGLESRERSLALTEQKLKEKLNQFPD
A0A0V7ZGW0      -----GIDANFGGNNFKDATIELIAQLIQVESESKGLQQQVLIIQNKLERLQTELKNIST
A0A355DPN1      TQIAFSTQNLLTEGQLGSNDLTLSSQLAEAQTTLQALQARDRSLAITQQQLRAKLNRLPE
A0A0V7ZMP6      SV---AINPNL-------ADRHIVHKLILAESQAEAMSSKAQQLQIQINYLREQLKKLPT
A0A433W046      AA---QIDTTL-GNGPNDSRLELMVELIRNQTLAQGTQQQAKQIQKQIDKLNTELSFITK
K9TU02          AA---QIDTTL-GNGPNDSRLELMVELIRNQTLAQGTQQQAKQIQKQIDKLNTELSFITK
A0A2T1FMA8      AA---QIDTTL-GNGPNDSRLELMVELIRNQTLAQGTQQQAKQIQKQIDKLNTELNFITK
A0A2P8QV10      PA---QIDTTL-GNGPNDSRLELMVELIRNQTLAQGAQQQAKQIQKQVDKLNTELNFITK
B8HQ70          LA---GVDRSLAGSAAGDSRIALIADLIRTQSTANGQQSQAQQLQQQLGQQVTALNRLSN
A0A2S6V636      AN---QIDPTLGGNGTRDSRIEMIAELIRAQNNAAGLQQQANQIASEINRVNAELNNIAQ
A0A1D9G3S3      DT---LVDPTL--TDSAQGRAMLIQQLILAESAASGQQQQAEQLQQQIDQIKSTLTVIPV
A0A1D8TWE6      DT---LVDPTL--TDSAQGRAMLIQQLILAESAASGQQQQAEQLQQQIDQMKSTLTVIPV
A0A1U7N3U5      DT---LVDPTL--TDSAQGRAMLIQQLILAESAASGQQQQAEQLQQQIDQIKSTLTVIPV
A0A2N6LHT1      ---PRNQSISSGSVAGDQISQDLTSQLIINDVERLALENKLKVVQTNRANLQARLAQLPI
A0A328V843      ---GSSRPFSRGLLRVMDVKNNKIEEFVNAEIRRLDLTKQLDSLYEARDGLERRARILPQ
A0A0D6KL48      ---GNSEYMPEQNLQIGNLKQTLTENLVKSEVERLALTNQVAELKQVLLVNKNRLDSLPR
A0A2T1DKP1      ---SNGGPVPTGNLQLGDLQQGLISDLVRSEAERVGLSERLSSLSNAQSAYRARANALPR
A0A355DU96      ------------------------------------------------------------
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
A0A5B8NQW4      ------------------------------------------------------------
                                                                            

A0A1B7WWU1      LEQQQLQLQRQLTVAQITYQEFLKQYQLVQVLENQNVGNSRVISEALVPELPVSPKIPLN
A0A2T1CC83      LEQKDRELVRQAESAGKTYETLLNNLQEATIAANSKSGNADVVEYAAVPDKGNSGRAVL-
A0A2T1EZA0      KLAEFENINQRLSIAREQYSSYIQARERYRLEMARSISPWEVIGPPDFGSSPVEPNIQRN
A0A6G3Z709      LEKLERELERNLQAAQTTYETLLTQLQEIRVIENQTVGNVRIVSLAQVPNNPVASNSRLY
A0A1U7JBN8      LSRSYQQISRELTVAETSLDQLLASRQDLRFQMARQASPWELISPLNETSIAQTSNLPRN
A0A2W4VXF4      LSRSYQQIDRELTVAESSLDRLLTSRQDLRLQMARQTAPWELISPLDESSVTEMTNLPRK
A0A2W7AI98      LSRSYQQIDRELTVAESSLDRLLTSRQDLRLQMARQTAPWELISPLDESSITEMTNLPRK
A0A0A2B4S6      LISEYKTLQQKALLAAKNLEGLSSAKEKFQLEIAQRSVPWSIIAPPKVYPVPVSPDIPLN
A0A6G3Z347      TTRTYNNIQRELEIATANLNQFLTKREALRIDAAQRQTPWEILTPPKQPRA-SSASAKRN
A0A2P8QVH5      LLAEYNRLMPEIAINRKTLEQLLQTQQNLGIKIAQGGFNWQIIRDPEPGVY-MGTGRIML
A0A2T1FT70      LLAEYNRLMPEIAINRKTLEQLLQTQQNLGIKIAQGGFNWQIIRDPEPGVY-MGTGRIML
A0A433W4W4      LLAEYNRLMPEIAINRKTLEQLLQTQQNLGIKIAQGGFNWQIIRDPEPGVY-MGTGRIML
K9U5W1          LLAEYNRLMPEIAINRKTLEQLLQTQQNLGIKIAQGGFNWQIIRDPEPGVY-MGTGRIML
L8M1L4          LQEIYTRLQRNIKIQSQAVDYLLQRKQELQIAAAEEITPWQILDKPYLPAQPISPNIQKA
A0A4P5VLH9      LMKKYEELASNLKSARENYSSYLIARDNYRLQRARSTSPWQVIAPAEFNEIPVEPNLQSN
A0A2W6ZN45      EIRKYEELQQKIEVAQANYLSYIQARENFRLEVAKQTVPWQVISPPVFGDVPIEPDLSRE
A0A081GP61      KLSEFENINQRLSIAREQYSSYIQARERYRLEMARSITPWEVIGPPDFGASPVEPDIQRN
K9P6R9          KLAEFENINQRLLIAREQYSSYIQARERYRLEMARSISPWEVIGPPDFGSSPVEPNIQRN
K9SGV8          LEQEERRLERKVTVAESTYAELLQQLQEVRIAEQQNIGNTRILSLASTPIDIVTPRRPRN
B0CA08          LEQRQNELERTAKASASTYRNLLEQIQELKVTENQSPLTVSILESAT-DPEPSKTTFISA
B0BZC6          LEKTLASLQRKKEGATESVNLLRQKLDEARIAEAQLVSNLRIIEEANKPTLPSYPNIPSF
A0A1D8TTM0      AQARLVQLQQQYDIAEGVYNGLVAQVQQSKLNAFSSYPSVQVFEEPRADSKPSGPGRRPI
A0A563VX16      LIAQYNSLEQEVAVHQATLKKLLESRQEIGIVINRGGFSWEIIEPPQQGLQISPNITQDL
A0A0V7ZGW0      LQAQLLDLQRQYDIAEGVYKGIVAQLEQSKIAAFNAYPNLQVLDQPTVDPKPTSPKKSLI
A0A355DPN1      LMAEYERLQPEVQIRRDTLQKLLEARQELGIEIARGGFKWQVVEPPKPGKQMGPDTRRDL
A0A0V7ZMP6      KQGILMDLQRRYDMTKKIYNGLVTQAEKVRLSAFDTYPSFQLLDEPFVNNEASSPNIQLI
A0A433W046      NQAQLLDLQRKYEIAEGVYKGIIAQSEQSKTNPFNAYPNVQTLNEPTIDPRPSIPNLRLI
K9TU02          NQAQLLDLQRKYEIAEGVYKGIIAQSEQSKTNPFNAYPNVQTLNEPTIDPRPSIPNLRLI
A0A2T1FMA8      NQAQLLDLQRKYEIAEGVYKGIIAQSEQSKTNPFNAYPNVQTLNEPTIDPRPSIPNLKLI
A0A2P8QV10      NQAQLLDLQRKYEIAEGVYKGIIAQSEQSKTNPFNAYPNVQTLNEPTIDPRPSIPNLRLI
B8HQ70          KQVQLLELQREYSIAEGVYKGVMAQFQQAKISTLSSYPSVQVLDGPLNSPRPE-PRRMLI
A0A2S6V636      NRAQLINLQRQYEIAEGVYKSILAQVEQTKTNPFNVYPNVQTLDAPAIDPKPEEPSKRAI
A0A1D9G3S3      HQSRLLELTRQYDVAAGVYNGLVAQMEQVNLDAFSAYPNVQVLDPPTVDEKPAGPKKLLI
A0A1D8TWE6      HQSRLLELKRQYDVAAGVYNGLVAQIEQVNLDAFSAYPNVQVLDPPTVDEKPAGPKKLLI
A0A1U7N3U5      HQSRLLELKRQYDVAAGVYNGLVAQMEQVNLDAFSAYPNVQVLDPPTVDEKPAGPKKLLI
A0A2N6LHT1      QQQQLTPLTRQREESAESLKLLQSKLEEARIAEAQLVGNIQIIEAAQPPTQPSLPNKRTV
A0A328V843      LEQQQQELERKAEVARLTYRTLLQNLEEAQVAANKITNNARIIETANVPDEGK-TAKVPL
A0A0D6KL48      LEQQQLQLQRQLKVAQVTYEQLSKQLQEVEVVENQNVGNARVISEALVADKSVSPIIPLN
A0A2T1DKP1      LEETQRELERRLKAAQTTYEVLLSRLQEVQVAENQNIGNARALSSAIVSERSSNR--KMG
A0A355DU96      ---------------------------------------------ASIPEAPVSPKKKLI
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
A0A5B8NQW4      ------------------------------------------------------------
                                                                            

A0A1B7WWU1      LALGGFLGVLLGAGTALLLESMNQSLKNIEEANRLLG-FPLLGTIPQHGEKNPKNPQ---
A0A2T1CC83      MGMGLIMGAFLANLSVILLEMQDRSISSLAEIKKKFP-YQTVGI-------TRLEPP---
A0A2T1EZA0      LLRAIMIGLLAGLGAAILRERTDNVFHTPMEVEKDLQ-LPVLGLIPYLPL----------
A0A6G3Z709      VIAGGFVGVLMAIAVAFLLDLLDSSIKTVKEIKELFAGYTLLGIIPLVKEPTRS------
A0A1U7JBN8      LLLSTVLSLMLGGVAALLRDRLDQAFHSVDDLVKATQ-LPNLAGVPNAPALQKQPLLMVP
A0A2W4VXF4      LLLSTVVGLLLGGVAALVRDRADTAFHSADELVKATQ-LPNLALVPNAPALQKQPLLMVP
A0A2W7AI98      LLLSTVVGLLLGGVAALVRDRADTAFHSADELVKATQ-LPNLALVPNAPALQKQPLLMVP
A0A0A2B4S6      LSLSLIFGPVLGLIVGLIRDKVDHVYHSPDEVKENLN-LPLLAELPYIESFVNLRENNES
A0A6G3Z347      LVMGTVLGILLGSGVAILVDRVRGKIHTIDELKEVSQ-LPLLGTIPYEKL---------L
A0A2P8QVH5      LVSGAVFGLVLGIGAAFLLEALDDTIHSCDELQKLSS-LPVLGITPKLPNFELKKPSIAL
A0A2T1FT70      LVSGAVFGLVLGIGAAFLLEALDDTIHSCDELQKLSS-LPVLGITPKLPNFELKKPSIAL
A0A433W4W4      LVSGAVFGLVLGIGAAFLLEALDDTIHSCDELQKLSS-LPVLGITPKLPNFELKKPSIAL
K9U5W1          LVSGAVFGLVLGIGAAFLLEALDDTIHSCDELQKLSS-LPVLGITPKLPNFELKKPSIAL
L8M1L4          LVSSLVAGGLWAIAIAFLLHQLDNRIKLVEEVKRITH-LPLLGAVPQV-----------F
A0A4P5VLH9      LLRALMLGLVSGLGAAILRERTDNVFHTPMETERELQ-LPVLGLIPYLP----------L
A0A2W6ZN45      FLRALFIGLAVGIAAVLLREKTDDAYHTPKEASQELG-LPILGLIPYLP----------I
A0A081GP61      LLRAIMIGLLAGLGAAILRERTDNVFHTPMEVEKELQ-LPVLGLIPYLP----------L
K9P6R9          LLRAIMIGLLAGLGAAILRERTDNVFHTPMEVEKDLQ-LPVLGLIPYLP----------L
K9SGV8          VSLGLLLGLSAAGGAVFLLEAFDKKIKSTAAARELLG-FPLLGVIPNFKKVPLFPVASGN
B0CA08          AMRGGLAGILLASGVVYVLERIDRKLKSKDEIRQVYP-YRVLGEIPLFDESEAESLKLPT
B0BZC6          LVLGMMAAVALSAGVTLSAEGMDGRLRDLESIAENTN-VPVLGVIPKQKNSRLFPSLPFA
A0A1D8TTM0      ALGTILASVFGSAAIVLFLESRN-PLLSLQDLQ-AIS-IPVLRSIPPFKHLVLDVDP---
A0A563VX16      VLGGIVSVFLGAVSVVIMEASDN-KIRVSRQLQEKVN-FPLLGTTPGLSKIK---DS---
A0A0V7ZGW0      AIGGILTSVFASLALILFSESRN-PLLKQKDLQ-DIE-LPLLARIPIFKSAPLGLTM---
A0A355DPN1      MLSVVVGLFLGGLAAFGREALDD-AVHSSEELKRQVA-LPLLGIIPELPRTG---GS---
A0A0V7ZMP6      ILGAVLISIFGSVAIILLQERRD-PLISPKDIQ-QKN-FPVLASVPYMKGLDTSMGE---
A0A433W046      TTGGILAAIFGSMALIFFLENRN-PLLKPKDLQ-QVE-LPVLGSIPHLKQPSMERNL---
K9TU02          TTGGILAAIFGSMALIFFLENRN-PLLKPKDLQ-QVE-LPVLGSIPHLKQPSMERNL---
A0A2T1FMA8      TTGGMLAAIFGSMALIFFLENRN-PLLKPKDLQ-QVE-LPVLGSIPHLKQPSMERNL---
A0A2P8QV10      TTGGILAAIFGSMALIFFLENRN-PLLKPKDLQ-QVE-LPVLGSIPHLKQPSMERNL---
B8HQ70          ILGGLMAIAFGSSALVLLLESRN-PLLSPADIQ-KVK-QPILAKLPRLKAPSQVWNL---
A0A2S6V636      ALGGILAGLFGSISLIFFLEKRN-PMLRPKDLE-QVE-FPVLGRISRLKRADMERNL---
A0A1D9G3S3      IANGFLASAVGSIALVLLLERRN-PLLSPKDLQ-AIK-FPMVVNIPHLRHAGMGLEL---
A0A1D8TWE6      IANGFLASAVGSIALVLLLERRN-PLLSPKDLQ-AIK-FPMVVNIPHLRHAGMGLEL---
A0A1U7N3U5      IANGFLASAVGSIALVLLLERRN-PLLSPKDLK-AIK-FPMVVNIPHLRHAGMGLEL---
A0A2N6LHT1      LAIAIVVGTALATGIVLLLELMDHTLKDASEAEELLK-LPLLGVLPRLPGHAI-------
A0A328V843      LALGVMGGLVASTTLLLLMEMGDKSLRTVAETRDLFG-YTLLGIIPSFAAPPFYRYLTGG
A0A0D6KL48      LALGGILGIILGAGTALVLESIDNSLKTVEEAKRLLD-YPLLGAIP--QAEKAKGSEGVG
A0A2T1DKP1      LALGGGVGILLAVAAAFAADLLDRSVKTLKEVKDLFG-YTLLGVVPLLNGKPVRQRSHFE
A0A355DU96      LVGGIVAGSLLYIVTAFVLDLMDPSIKTAKEIRQLFK-YTWLGMIPESRKKGLFWQQ---
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
A0A5B8NQW4      -------------------------MKTVQEIKDKLG-YTLLGSIPLFGKQ---------
                                                                            

A0A1B7WWU1      ---EGRQELPLLDDPYSPVSTSFEMLQTN-------------------------------
A0A2T1CC83      ---MYQGKIVTRDEPDSFSSEVYRMIQAN-------------------------------
A0A2T1EZA0      -------------EPGVDIATSISKMSSSER-------------------FAIKESLRSL
A0A6G3Z709      -------------ETEAIGDQSYPRLLVN-----------------QPTHIRVREAYQML
A0A1U7JBN8      NLSATMADVLTQNQSPHKLYTSF----------------------------SFAEAFYSL
A0A2W4VXF4      DLTATMADVLTQNQSPDNLYTSF----------------------------SFAEAFYSL
A0A2W7AI98      DLTATMADVLTQNHSPDNLYTSF----------------------------SFAEAFYSL
A0A0A2B4S6      IFNVEDKLNATKNEKSSESYLGYQRF-------------------------FYQEAFRGM
A0A6G3Z347      -------------ENEQSLALSISQLSQMGFAMNLFPSQQEPSDSHKPTFTPFLESFRIL
A0A2P8QVH5      -------------PFFKQQSLTSQRIQALNW------------------F-PFRESMDLI
A0A2T1FT70      -------------PFFKQQSLTSQRIQALNW------------------F-PFRESMDLI
A0A433W4W4      -------------PFFKQQSLTSQRIQALNW------------------F-PFRESMDLI
K9U5W1          -------------PFFKQQSLTSQRIQALNW------------------F-PFRESMDLI
L8M1L4          -------------DPLIVIEDNTVKQSYSYR------------------YSSFTESLRAI
A0A4P5VLH9      -------------ESGVDVSTSISKMSASER------------------F-AIKESLRSL
A0A2W6ZN45      -------------VSSDSILKSLKELPGTER------------------F-AIKESLRSL
A0A081GP61      -------------EPGVDIATSISKMSSSER------------------F-AIKESLRSL
K9P6R9          -------------EPGVDIATSISKMSSSER------------------F-AIKESLRSL
K9SGV8          RIGRTVPELVVREAPNSPISEAFRMLQTN-------------------------------
B0CA08          LSDPASHLSEAYRMLQSSLK--FHGLEHS-------------------------------
B0BZC6          ELYNNLPLLESVRALSKNIE--YKNSTES-------------------------------
A0A1D8TTM0      -------------SFGTAIE--FQRLASA-------------------------------
A0A563VX16      -------------QFSVRLP--FFSGNDQET-----------IPLQVIEWLPFRESLDLV
A0A0V7ZGW0      -------------ESDAQIP--FQRLAST-------------------------------
A0A355DPN1      -------------GLLVHLP--FRRTQVAAA-----------STLPMVYWLPFRESLDLI
A0A0V7ZMP6      -------------GINEKVE--FQRLASA-------------------------------
A0A433W046      -------------AAEIDIE--FQRLASS-------------------------------
K9TU02          -------------AAEIDIE--FQRLASS-------------------------------
A0A2T1FMA8      -------------AAEIDIE--FQRLASS-------------------------------
A0A2P8QV10      -------------AAEIDIE--FQRLASS-------------------------------
B8HQ70          -------------DAEPLLG--FHRLASA-------------------------------
A0A2S6V636      -------------SGEVAIE--LQRLASA-------------------------------
A0A1D9G3S3      -------------GTETDVE--FQRLASV-------------------------------
A0A1D8TWE6      -------------GTETDVE--FQRLASV-------------------------------
A0A1U7N3U5      -------------GTETDVE--FQRLASV-------------------------------
A0A2N6LHT1      -ALEP--SAQFLDHVG--LVEPYRTLFKN-------------------------------
A0A328V843      DRSSV--QVPVVDTPGSLISEIYRMIQAN-------------------------------
A0A0D6KL48      EVELP-----VLNNPYSPVSSAFEMLQTN-------------------------------
A0A2T1DKP1      GTAHPIPRVYVRELPFSSAAEAYQMLQAN-------------------------------
A0A355DU96      KINGNVPQLVVRDVPHGITSEAYRMLEAN-------------------------------
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      -----MSFLPVRDAPRSPLSESFRMLQAN-------------------------------
A0A5B8NQW4      -----ASELPMQDQPRSAVSEAFRMLQAN-------------------------------
                                                                            

A0A1B7WWU1      ---LGFTVSD-KELRVILVTSATPGEGKSFVAANLALAGAYVGKRVLLVDADMRRPRQHR
A0A2T1CC83      ---LKFLTND-KPPKVILVTSSVPEEGKSTVTANLAAAISQLGRSVLLVDADLRRSSQHH
A0A2T1EZA0      FTTFRLLRAD-NNIRMVGITSSTQGEGKSTAVAVFSRTLADLGLRVLVIDSDMRLPMQAR
A0A6G3Z709      QANLKFLQSD-NELQTVVISSAVPGEGKSEVSANLAAALAQVGRRVLLIDADMRYPRQHH
A0A1U7JBN8      EANLRMLSSD-TPIQVVALTSSEPGEGKSTICAHLAIAAANMGRRVLLIDSDLRKPSQHL
A0A2W4VXF4      DTNLRMLSSD-TPMQVIALTSAVPGEGKSTICAHLAIAAANMGRRVLLIDGDLRKPSQHL
A0A2W7AI98      DTNLRMLSSD-TPMQVIALTSSVPGEGKSTICAHLAIAAANLGRRVLLIDGDLRKPSQHL
A0A0A2B4S6      YTSIKFINTQ-NSLKILSISSCIPSEGKSLISTMFAKTISELGLSVLLIDTDLRKPQVHA
A0A6G3Z347      ATNIELSNPD-DPVRTLAITSAIPNMGKSTVTFHLAHAIAATGKRVLMMDTDLRRPTLHK
A0A2P8QVH5      YQNIQILGSP-LSFKSLLLTSALTGEGKSTLAAGMALSVARLQRRVLLIDADLRRSNIHK
A0A2T1FT70      YQNIQILGSP-LSFKSLLLTSALTGEGKSTLAAGMALSVARLQRRVLLIDADLRRSNIHK
A0A433W4W4      YQNIQILGSP-LSFKSLLLTSALTGEGKSTLAAGMALSVARLQRRVLLIDADLRRSNIHK
K9U5W1          YQNIQILGSP-LSFKSLLLTSALTGEGKSTLAAGMALSVARLQRRVLLIDADLRRSNIHK
L8M1L4          AMNISYTVVDTRKIKSLVTTSSTSSEGKTTVTYNLALALTELDAKVLVVDADLRKPKIHK
A0A4P5VLH9      FTTFRLLRSD-RDIRLVAVTSSTQGEGKSTAVTIFARTLADLGLKVLVVDADMRLPMQTR
A0A2W6ZN45      FTTFRLLRAD-REIRLVVITSSTQNEGKSTAASVFGNTLADLGLHVLLVDADMRLPVQHK
A0A081GP61      FTTFRLLRAD-NNIRMVGITSSTQGEGKSTAVTVFASTLADLGLKVLIIDSDMRLPMQTR
K9P6R9          FTTFRLLRAD-NNIRMVGITSSTQGEGKSTAVAVFSRTLADLGLKVLVIDSDMRLPMQAR
K9SGV8          ---LKFLSLK-KRLKVIVVTSSVPREGKSTIAANLAATIAELGQRVLLVDADMRHPAQHR
B0CA08          -------------PRVLMMTSAINQEGKSTTCANLAVSLAQMNHRVLLIDADIRLASQHQ
B0BZC6          --------------KVLVITSAISGEGKSFVATNLAVLSAMLSKRTLLIDADMRRPSIHK
A0A1D8TTM0      -----VSMKP-LKNRRLMISSATSGEGKTTVTLGLASALITLGFRVLVVDGDFRKAELSQ
A0A563VX16      YENIQLMSQN-SLINSIAITSSIAGEGKSTITLGLALSAARRRKKVLVIDGDLRCPTLHE
A0A0V7ZGW0      -----ISLMS-LENHRLMVTSSTAGEGKTTVTLGLAKALMVLGFRVLMVDGDFRKAKLSR
A0A355DPN1      YKHIQLLNSA-ATLRSIVVTSALPSEGKSTFVVGLAFSAARLHQRVLLIDADLRRPSLHK
A0A0V7ZMP6      -----ISLLH-LENKSLMIASANSGEGKTTVTLGLANALLELGFRILIVDADFRKCELTQ
A0A433W046      -----ILML---EHPCLMVTSATAGEGKTTVTLGLALALVNFGFRVLVIDGDLRKAEMSR
K9TU02          -----ILML---EHPCLMVTSATAGEGKTTVTLGLALALVNFGFRVLVIDGDLRKAEMSR
A0A2T1FMA8      -----ILML---EHPCLMVTSATAGEGKTTVTLGLALALVNFGFRVLVIDGDLRKAEMSR
A0A2P8QV10      -----ILML---EHPCLMVTSATAGEGKTTVTLGLALALVNFGFRVLVIDGDLRKAEMSR
B8HQ70          -----ISFLD-LATPRLMITSAMYGEGKTTIAIGLAAALARLGFKILLVDGDLRRARLTE
A0A2S6V636      -----VLML---EHQRLLVTSSTSGEGKTTVTLGLALALVNFGFRVLIVDGDLRQAELSQ
A0A1D9G3S3      -----ISLRS-GEDRRILITSAMVSEGKTTVTLGLATALVDLGFRVLVVDGDFRQATLSQ
A0A1D8TWE6      -----ISLRS-GEDRRILITSAMVSEGKTTVTLGLATALVDLGFRVLVVDGDFRQATLSQ
A0A1U7N3U5      -----ISLRS-GEDRRILITSAMVSEGKTTVTLGLARALVDLGFRVLVVDGDFRQATLSQ
A0A2N6LHT1      ---LEFRSSE--PLRSIVVSSTITGEGKSVVGSHLAAISAMLSRRTLLIDADLRRPILHT
A0A328V843      ---LKFLGSD-RKVRVIVVSSSVPQEGKSTVSANLAAAIAQLGHRVILIDGDMRQPIQHH
A0A0D6KL48      ---LSFSISD-KMLKVIAISSSIPGEGKSFVAANLAVAVAQLGRRVLLVDADMRRPRQHK
A0A2T1DKP1      ---LRFLRSD-KEIKTVVVTSSVAQEGKSEVAANLAASMAQVGRRVLLVDADMRYPVQHH
A0A355DU96      ---LKFLSPD-QVLKRIVVTSSVAQEGKSTVSANLAIAMAQVGRRVLLVDADMRHPMQHH
A0A1Q8BLE0      ---------M-RAVSRIVITSPGPEEGKSTTAANLAIAFAQQGHRVLLVDCDLRRTRIHK
A0A2T2S1W0      ---LRFSQAD-RRLQAIAVASSVPGEGKSTLVANLGLALAEVGQHVLIVDADLRNPSQHG
A0A5B8NQW4      ---LKFSRVD-EKLKVIVVTSSVPNEGKSTVTGNLGLALAELGNRVLIVDGDMRRPSQHQ
                                :  :*     **:     :.          :::* *:*      

A0A1B7WWU1      VWEIHNLLGLSNILAGQTQLKNAVQEVS---PLVKMLPAGKIPPNPV-TLLDSQCMADLV
A0A2T1CC83      LWGVDNQKGLKDIVVDNVSPLSVIRQPM---PKLSLLTSGMVESNPL-AILDSPKMSDFI
A0A2T1EZA0      YLGVEQGDGLSTLLSDSSRKPTDFIHSIA--ENMDVLPAGPKPPDPA-KLLNSSRCKEIM
A0A6G3Z709      ALKVLNTVGLSHVITGQAKVKSAIQTVT---RNLDVLTAGVVPPNPV-ALLDSKRMESLL
A0A1U7JBN8      IFGHANRQGLSDLITQPLDDPMDLVQVIPGNPNLHLLTAGARPPAPG-RLLSSRKMQQIA
A0A2W4VXF4      IFSQRNHQGLSELITQGLENPTDLVLAIPGNPNLHLLTAGARPPPPG-RLLSSRKMQQIT
A0A2W7AI98      IFSQRNHQGLSELITQGLENPTDLVLTIPGNPNLHLLTAGARPPPPG-RLLSSRKMQQIT
A0A0A2B4S6      RLGLDNLIGFSNLLIDSSDNYKKYIQSVPTQDNFDVITSGSIPPDPT-RLLGSDSMKKFI
A0A6G3Z347      LCNASNDKGLSNYVTGEFNPEDILIDLPLE-PGLFLLPSGPIPPDPM-KILTAQRIRNLF
A0A2P8QVH5      LLNLSNDRGLSTLLTEEADVRERDCIQSVQ-PSLDVLTAGPTPTDIV-KLLSSQRMKHLI
A0A2T1FT70      LLNLSNDRGLSTLLTEEADVRERDCIQSVQ-PSLDVLTAGPTPTDIV-KLLSSQRMKHLI
A0A433W4W4      LLNLSNDRGLSTLLTEEADVRERDCIQSVQ-PSLDVLTAGPTPTDIV-KLLSSQRMKHLI
K9U5W1          LLNLSNDRGLSTLLTEEADVRERDCIQSVQ-PSLDVLTAGPTPTDIV-KLLSSHRMKHLI
L8M1L4          MAKISNEQGLSEVIS-DNKHSWTEVVQNVT-GNLDVITAGANVANPI-ALLRSQIMSELL
A0A4P5VLH9      YLGLANGEGFSTILT-NSSVPLKSLIQPIQ-DNLDILPAGPKPPDPA-KLLNSTRAQEVV
A0A2W6ZN45      HFAVDNVKGLSDYLG-DTDDNIQDYIKPIT-SNLSLITAGSRAPDPA-RLLNSLRCSDMV
A0A081GP61      YLGVEPGDGFSTLLS-DSSRKTTDLIQTIA-ENMDVLPAGPKPPDPA-KLLNSSRCKEIM
K9P6R9          YLGVEQGDGLSTLLS-DSTRKPTDFIHSIA-ENMDVLPAGPKPPDPA-KLLNSSRCKEIM
K9SGV8          IWQLPNENGLSDLLTGQSPLSEVAHHVM---PTLEVMPAGSKPANPV-ALLNSQATSNLI
B0CA08          IWELGNQEGLTHILLNKHFNYHQELPTHKVADNLEIITAGRISSNPL-PMLESEQFANFV
B0BZC6          IFQLPQDPGLQDYLRGSVKEGLPAAIHRTSVKNLSVMTSGKFSYDNVFSFETQRAKELFT
A0A1D8TTM0      RLGWDR----------YAMSEVPSTPVQIR-PGLDLLSL-RPDEDKIAEFVARGSFEECL
A0A563VX16      KLDISNGVGLSDLLDGVTSVPTVQEISRAG-STISVLTSGSATSDPV-KLLSSGRLQNLI
A0A0V7ZGW0      QFGHVM----------HPQSNDLPQPMQIS-PGLDILPTAPNQNNKVMEFVARGGFEKYL
A0A355DPN1      QLNLPNEQGLATLLVEDSSIPSPQRLSLSG-SEIDVLTAGPIPPDPV-KLLSSQRMRQLM
A0A0V7ZMP6      SLGYY----------GQSIGDLQLRPINVF-ENVDLLAM-RVPEERIAEFVARGGFEQRL
A0A433W046      RLGKNR--------IKSAANASPPMPVSVS-PGFDLLPALSIPKQKIPEFFARGSFERNI
K9TU02          RLGKNR--------IKSAANASPPMPVSVS-PGFDLLPALSIPKQKIPEFFARGSFERNI
A0A2T1FMA8      RLGKNR--------IKSAANASPPMPVSVS-PGFDLLPALSIPKQKIPEFFARGSFERNI
A0A2P8QV10      RLGKNR--------IKSAANASPPMPVSVS-PGFDLLPALSIPKQKIPEFFARGSFERNI
B8HQ70          QLSDRY---------QGSWNPRETAVVPLS-PGLDLMPAPAIPNDRIVNYVAKGGFEQQL
A0A2S6V636      RLGQPQ---------K-KLKDGQPSPVSVC-LGLDLLPAPALSKGKIPEFFARGSFQQYL
A0A1D9G3S3      RLGHDH---------D-PLKPGQ--PVKIQ-PSLDLLPT-SHKKGKIVELVTQGKFEQSL
A0A1D8TWE6      RLGHHH---------D-PLKPGQ--PVKIQ-PSLDLLPT-SHKKGKIVELVTQGKFEHSL
A0A1U7N3U5      RLGHHH---------D-PLKPGQ--PVKIQ-PSLDLLPT-SHKKGKIVELVTQGKFEQSL
A0A2N6LHT1      LFNLAPRPGITDVIDSERSLEETVQRTNI--PNLSVLTCGELYRLPS-HLLESEAMKSLL
A0A328V843      IWGLTNAVGLSDVLVEEATLSEAV-KPGI--DQLDILTAGVTPPNPL-ALLDSRRMTSLI
A0A0D6KL48      IWEQNNLVGLSNILVGQTELQTTS-KEAL--MTLDIITAGTIPPNPA-ALLNSQRIATFI
A0A2T1DKP1      VWDLVSTIGLSNVIVEQFVPDVAI-QEVA--PNLYALPSGIIPPNPI-ALLDSKRMASLV
A0A355DU96      IWDLANTVGLSEVIVHQTQFEFAVREVM---DNLDVLPSGVIPPNSL-ALLNSKRMASLV
A0A1Q8BLE0      IFDETNLPGLTSVLVGGETIASAIRQTRV--PGLNILPSGPLPPNPA-ELLGSAQMTALL
A0A2T2S1W0      IWEYANAVGLSNLLVGESSLEQACHPAS---EGLDLLTAGQVPPNPV-ALLDSQRLATLL
A0A5B8NQW4      VWEEPNSMGLSNLLVDQSDVSTVTKELH---PNLELLTVGAPPPNPI-ALLDSQRIADFI
                                                 .  :.                      

A0A1B7WWU1      EEASK--DYDFVIIDTPPLT-AVTDPLIVGKYVDGLLLVVRPGKVEYSAVNAAKSLLTQA
A0A2T1CC83      GRSRR--EYDLILIDVPPLP-VTADVLTVSKLVDGILFVTRPGIVEHESAELAQEALATT
A0A2T1EZA0      EEIRALPGYDIIIVDAPPCL-MLADPILLGEKLDGILFLVGLGKVSRELAPQASRRIRAS
A0A6G3Z709      QSLAQ--AYEVVIIDAPPLV-SYADASILGKMAEGVLLVVRPGVVDYAQGRIAKEILAQS
A0A1U7JBN8      EQYRC--HFDLIILDTPPLAGGMVDAKLAAAHADGLLLVARLNRSERTEIQRVLADLGNT
A0A2W4VXF4      EQYRR--HYDLIIFDTPPLA-GMIDAKLTAAHADGLLLVVRLNQSERSEIQRVLADLGNT
A0A2W7AI98      EQYRR--HYDLIIFDTPPLA-GMIDAKLTAAHADGLLLVVRLNRSERSEIQRVLADLGNT
A0A0A2B4S6      ETIRSENKYDYVILDTSPIL-SISDSTLIAQYCDSLLMVVSLNNVDMDLPLLAKNKLKKT
A0A6G3Z347      DYLDR--EFDFIIFDTPPLL-GFADAFIIAANTKGVLLTATLGQITFSQLQSALDELDIA
A0A2P8QVH5      ESFEQ--SYDLVLVDAPPIL-GLADASIVASLCSGTVVVERLNRVTRFDLNQSLEAL--S
A0A2T1FT70      ESFEQ--SYDLVLVDAPPIL-GLADASIVASLCSGTVVVERLNRVTRFDLNQSLEAL--S
A0A433W4W4      ESFEQ--SYDLVLVDAPPIL-GLADASIVASLCSGTVVVERLNRVTRFDLNQSLEAL--S
K9U5W1          ESFEQ--SYDLVLVDAPPIL-GLADASIVASLCSGTVVVERLNRVTRFDLNQSLEAL--S
L8M1L4          KEWEA--AYDYVLIDTPPIG-AMADAQSLVHQVDGVMLVTGINKVNQKAIVNTLEVLQSS
A0A4P5VLH9      NEIRALTEYDMVLFDAPPCL-MLSDPILLGEKLDGILFLVGLGKVSRELAPQACRRIKAT
A0A2W6ZN45      QHLRALPGYDLIIFDTPPCL-LLSDPVILGEKVDGILYLVGLGRVGREIAPQAIKRIKAT
A0A081GP61      DEIRALPGYDIIIVDAPPCL-MLADPILLGEKLDGILFLVGLGKVSRELAPQASRRIKAT
K9P6R9          EEIRALPGYDIIIVDAPPCL-MLADPILLGEKLDGILFLVGLGKVSRELAPQASRRIRAS
K9SGV8          DY--GSSNYDVMIVDTPPMA-VAADASILGKIADGIVMLCRVGVADTNNLTFSKELLEQS
B0CA08          QVQIEH--YDYILIDAPPLV-SVADPLIIGKVVDGILLVARPGHLEREYAQKAHELLIHS
B0BZC6          EVQQH---YDVIVIDTPPVM-ACSDALVLSQEGRQTVVVARLDVTPKQVLNRSIDILNSN
A0A1D8TTM0      SAAQGSGHYDYILIDSAPVS-LTSEAALMASVVPNVLLVVWLGKSNRNPFRDTLEQLMRH
A0A563VX16      AHFEKT--YDLVLIDTPPAI-GMVDAIKIASSCSGTVVVARLEKANFAELMETYGLLGRI
A0A0V7ZGW0      NTIQTNGNYDYVIVDTAPVT-STSETALMAKVIANVLPVIRLGISDRYMVQETIEQLMRH
A0A355DPN1      AGFEQS--YDLILVDTPPIL-GMVDALQAASFCNGVVIVGRISRVTQSELTEAIAMLSHL
A0A0V7ZMP6      NAIKNSAQYDYILVDSPPVA-LTSEAAIIGKIIHNILFVVRTGISSRNCFHDSVEQLKRY
A0A433W046      KALRESGGYDYVLVDSPPVG-LASETNLMSAVVCNVLFVLRSGTSDRYPVMNSLEQLTRY
K9TU02          KALRESGGYDYVLVDSPPVG-LASETNLMSAVVCNVLFVLRSGTSDRYPVMNSLEQLTRY
A0A2T1FMA8      KALRESGGYDYVLVDSPPVG-LASETNLMSAVVCNVLFVLRSGTSDRYPVMNSLEQLTRY
A0A2P8QV10      KALRESGGYDYVLVDSPPVG-LASETNLMSAVVCNVLFVLRSGTSDRYPVMNSLEQLTRY
B8HQ70          QTLQQSGEYDYVLVDTAPIT-LTSETGLMTTSVNNLLFVVRPGTSSRYSVLDSFEELSLR
A0A2S6V636      DQIQADGGYDYVLVDSPPIG-LASETNLMSSVVRNVLFVVRSGKSDRYAVMDGFEQLAQH
A0A1D9G3S3      ATAEESGDYDYVLIDSAPVS-MTSETALMAAVIRNLLFVVRPEISKRDFVSDSLEQLAQH
A0A1D8TWE6      ATAEASGDYDYVLIDSAPVS-MTSETALMAAVIPNLLFVVRPEISKRDFVSDSLEQLAQH
A0A1U7N3U5      ATAEESGDYDYVLIDSAPVS-MTSETALMAAVIRNLLFVVRPEISKRDFVSDSLEQLAQH
A0A2N6LHT1      IEAVR--QYEFVVIDTPPLS-ACADAHTLGRQSDGIILVTRPGFTIKEVLQRAVSELTHN
A0A328V843      RNFSE--EYDFVIIDTPPLL-LAADALTLANMASGVLMVARPRILDRDSAKAAKEILGRS
A0A0D6KL48      KEATQ--EYDFVIIDCPPLT-LVADALMLSKLVDGILLVVRPGVANTGSVNATKMLLEQS
A0A2T1DKP1      EGFAR--DYDLIIFDTPPLA-GKADAAILGKMTDGILLVVRPGIIDSASANAAKEFLKQS
A0A355DU96      EYFSQ--KYDFVIFDTPPLV-LTADAMTLGKMTDGILLVARPKVVDRVSATASKEFLLRS
A0A1Q8BLE0      DKLSE--NYDLLILDTPPLL-AASDAAIVSRIVDGALVVVRAGRTERSALQTAVQQLATV
A0A2T2S1W0      QQWRQ--AYDYVLLDVPPLQ-AATDAVIVGKLTDGTLLVVRPGVAECDAVEASRDTLARL
A0A5B8NQW4      DKCRQ--AYDYVLIDTPPMA-VGADSALLGKLAEGTLLVVRPNMADLTSATGAKEMLQRS
                        :: ::.* .*      :           :                   :   

A0A1B7WWU1      -KLPILGMVVNGIVKE--------SGYGGYYYSSGYYGGKGERN------------KQNA
A0A2T1CC83      -GQKILGMVVNGVKANEFDRYSYHGRYGKKYFEKGNVQYESQNNLNGSQNLSNMPEGNNA
A0A2T1EZA0      -GVDVLGIICNQVNFPS----------RLNDYGYEYGYYYHYAYASASGYAKSA------
A0A6G3Z709      -NQRVLGMVANGVNPSNEP--------DGHFYYLRQDAHESAEILEESALLPVGNAS---
A0A1U7JBN8      VQAPLLGLVVNGVP-------------HSRQSGYDYYYGYYGRPRVAAGIED-G------
A0A2W4VXF4      AQAPLLGLVINGVP-------------QSRQRGYS-YYGYYGRPAVASGIDERG------
A0A2W7AI98      AQAPLLGLVINGVP-------------QIRQRGYS-YYGYYGRPVVASGIDERG------
A0A0A2B4S6      -NRPLIGFVSNQIKKPKTFSKNRYYGYSNYSNNYGYNSNYISYYADNKIRDKFTKRNLTF
A0A6G3Z347      -KIPVLGAVANGSQ-PE----------NVKSYNY-YQYYQQSVSAEKNGNSKNPSD----
A0A2P8QVH5      -KLNVIGAIINESK------------------------ECNSRYTVYDGTSQDNLERGFT
A0A2T1FT70      -KLNVIGAIINESK------------------------ECNSRYTVYDGTSQDNLERGFT
A0A433W4W4      -KLNVIGAIINESK------------------------ECNSRYTVYDGTSQDNLERGFT
K9U5W1          -KLNVIGAIINESK------------------------ECNSRYTVYDGTSQDNLERGFT
L8M1L4          -NCNLIGFIANMVE-------------KDLDY-YSYSYYSHYYNQPSNGNGNGNGN----
A0A4P5VLH9      -GVDVLGLICNQVNFPS----------RLNDYGYEYGYYYHYAYANDSGSSSTYGKNGEG
A0A2W6ZN45      -GVDILGLMCNQVAYPT----------RLNDYGYEYGYHYNYSYAG--------------
A0A081GP61      -GVDVLGIICNQVNFPS----------RLNDYGYEYGYYYHYAYASASGYAKSANQ----
K9P6R9          -GVDVLGIICNQVNFPS----------RLNDYGYEYGYYYHYAYASASGYAKSASE----
K9SGV8          -GQNILGMVVNASLPED----------DPYGYYYSYYYNYSSKPGQRQRQEASRQDQDQN
B0CA08          -NLSVLGTVINGILNKN----------ELYSYYSRY---------GHNSNQEKTAIKRNL
B0BZC6          -NVNVVGLAINGVTAST----------DKYYRYLKE---------DYALAA---------
A0A1D8TTM0      -RAQILGLVVNGVDTQP----------EGYL--YGH---------KIAEVSS--------
A0A563VX16      -N--VLGMVANDSREVQ----------QRYA---KN---------KRYLPSAEV------
A0A0V7ZGW0      -NANIIGLALNGIEQRS----------EGYI--YKH---------DSSQVNS--------
A0A355DPN1      -NA--IGIVANGANGST----------NRYIAYAEQ---------NGSPLFQLN------
A0A0V7ZMP6      -RAEVIGLTVNDVDSHN----------EKYIYSYNV---------NQQIQ----------
A0A433W046      -NARIMGLVVNGSDSHT----------SVYRYGYGR---------QRELLEHEA------
K9TU02          -NARIMGLVVNGSDSHT----------SVYRYGYGR---------QRELLEHEA------
A0A2T1FMA8      -NARIMGLVVNGSDSHT----------SVYRYGYGR---------QRELLEHEA------
A0A2P8QV10      -NARIMGLVVNGSDSHT----------SVYRYGYGR---------QRELLEHEA------
B8HQ70          -KVNVVGVTINGIETNS----------EEYY--YGK---------QRELAATEL------
A0A2S6V636      -HAQIMGLVVNYVEPKD----------VGYR--YGR---------QRELIETEA------
A0A1D9G3S3      -NAQLLGLVVNGVETKS----------KPYL--YRS---------SDSLVKS--------
A0A1D8TWE6      -NAQLLGLVVNGVETKS----------KPYL--YRS---------SDSLVKS--------
A0A1U7N3U5      -NAQLLGLVVNGVETKS----------KPYL--YRS---------SDSLVKS--------
A0A2N6LHT1      -QIPIMGVVVNGITDQT----------ERYYRYAVNSYEPL---------------SSRR
A0A328V843      -GQRILGTVINGISKNE----------STKYFYHAQRYFPLQKSHRRD------RSAPPK
A0A0D6KL48      -GHQVLGMVANGVTPES----------SYGGYYAKSYYGAKQSHKN--------GKVDAS
A0A2T1DKP1      -GQNVLGMVINGVDVRS----------EPDSYF---YHTRERGKRNVAALDTITDSIPTE
A0A355DU96      -GQQVLGLVINGVSVEG----------EPDSYFHHAKAYYKEELITSTIPDSKTKKNHIR
A0A1Q8BLE0      -GARVLGTVLNDPDAEV----------PKYARYYG---YYYNNYYDYSNATEYSN-----
A0A2T2S1W0      -QQPVVGMVANGVNPRN----------ERSSYYHY---YNYG--------NNNGGPPRQG
A0A5B8NQW4      -GQPVLGMVINGVNPSD----------EPDSYYYY---YAQGYYYETKEEEESGKKALFG
                     :*   *                                                 

A0A1B7WWU1      EASVR-------------------------------------------------------
A0A2T1CC83      NSSVSRAKL---------------------------------------------------
A0A2T1EZA0      SEPSTGGFGSYVQRYRDSYMKGAATNSYISARYNEGESDVKTYFREDEDQATAPVATNGG
A0A6G3Z709      ------------------------------------------------------------
A0A1U7JBN8      ------------------------------------------------------------
A0A2W4VXF4      ------------------------------------------------------------
A0A2W7AI98      ------------------------------------------------------------
A0A0A2B4S6      ENSKDNFLISKIKKFRNKVLDFISWLDR--------------------------------
A0A6G3Z347      ------------------------------------------------------------
A0A2P8QVH5      TNPNLAGRGIF-------------------------------------------------
A0A2T1FT70      TNPNLAGRGIF-------------------------------------------------
A0A433W4W4      TNPNLAGRGIF-------------------------------------------------
K9U5W1          TNPNLAGRGIF-------------------------------------------------
L8M1L4          ------------------------------------------------------------
A0A4P5VLH9      LGRYARDVGNLVRGYRDSYVT--------DRYISDGSSAAVQRYHEEGVSRELRQSKLKS
A0A2W6ZN45      --------------YRDTYSQRLASKDVAEALPDN-----------------------PS
A0A081GP61      -GKSYGGFGSYVQRYRDSYMKGAPSNAYFNAHQQNGDLDVRSYYQQEDGSGASAATRPPS
K9P6R9          --PSTGGFGSYVQRYRDSYMKGAATNSYISARYNEGESDVKTYFREDEDQASVPVA---T
K9SGV8          QQETINQ-----------------------------------------------------
B0CA08          LKQVISK-----------------------------------------------------
B0BZC6          ------------------------------------------------------------
A0A1D8TTM0      ------------------------------------------------------------
A0A563VX16      ------------------------------------------------------------
A0A0V7ZGW0      ------------------------------------------------------------
A0A355DPN1      ------------------------------------------------------------
A0A0V7ZMP6      ------------------------------------------------------------
A0A433W046      ------------------------------------------------------------
K9TU02          ------------------------------------------------------------
A0A2T1FMA8      ------------------------------------------------------------
A0A2P8QV10      ------------------------------------------------------------
B8HQ70          ------------------------------------------------------------
A0A2S6V636      ------------------------------------------------------------
A0A1D9G3S3      ------------------------------------------------------------
A0A1D8TWE6      ------------------------------------------------------------
A0A1U7N3U5      ------------------------------------------------------------
A0A2N6LHT1      LSRGSSA-----------------------------------------------------
A0A328V843      ISSRSSS-----------------------------------------------------
A0A0D6KL48      ISKIRIL-----------------------------------------------------
A0A2T1DKP1      VER---------------------------------------------------------
A0A355DU96      F-----------------------------------------------------------
A0A1Q8BLE0      -------------GNGAKA-----------------------------------------
A0A2T2S1W0      WRRWLPGNPFARNGKGSQ------------------------------------------
A0A5B8NQW4      FGR----------GKSNQS-----------------------------------------
                                                                            

A0A1B7WWU1      ------------------------------------------------------
A0A2T1CC83      ------------------------------------------------------
A0A2T1EZA0      IGPSASSTSPLPPADSVPSRRHRPSREGGGGPMGWLRRRFGNRG----------
A0A6G3Z709      ------------------------------------------------------
A0A1U7JBN8      ------------------------------------------------------
A0A2W4VXF4      ------------------------------------------------------
A0A2W7AI98      ------------------------------------------------------
A0A0A2B4S6      ------------------------------------------------------
A0A6G3Z347      ----------------------------TQDDESAWYTTPLSWLKKSSGNKR--
A0A2P8QVH5      ------------------------------------------------------
A0A2T1FT70      ------------------------------------------------------
A0A433W4W4      ------------------------------------------------------
K9U5W1          ------------------------------------------------------
L8M1L4          GNGNGNGNGNGNGNREAGSMNSIMQQFRRR------------------------
A0A4P5VLH9      GNGNDANQVNGTEPSDQANHPKG-------------------------------
A0A2W6ZN45      DQAQSSAASGSAAKPDSNQSGSSGGLNRLKG-----------WFRR--------
A0A081GP61      EDSKGSGVSIRSSLPDSGRESTGSHAGDSQGVRKGASQGPIGWLRQRFGRGSQR
K9P6R9          NGGIGPSAGSSSSLPPAESVPSRRHRPSREG-----GDGPMGWLRRRFGNRG--
K9SGV8          ------------------------------------------------------
B0CA08          ------------------------------------------------------
B0BZC6          ------------------------------------------------------
A0A1D8TTM0      ------------------------------------------------------
A0A563VX16      ------------------------------------------------------
A0A0V7ZGW0      ------------------------------------------------------
A0A355DPN1      ------------------------------------------------------
A0A0V7ZMP6      ------------------------------------------------------
A0A433W046      ------------------------------------------------------
K9TU02          ------------------------------------------------------
A0A2T1FMA8      ------------------------------------------------------
A0A2P8QV10      ------------------------------------------------------
B8HQ70          ------------------------------------------------------
A0A2S6V636      ------------------------------------------------------
A0A1D9G3S3      ------------------------------------------------------
A0A1D8TWE6      ------------------------------------------------------
A0A1U7N3U5      ------------------------------------------------------
A0A2N6LHT1      ------------------------------------------------------
A0A328V843      ------------------------------------------------------
A0A0D6KL48      ------------------------------------------------------
A0A2T1DKP1      ------------------------------------------------------
A0A355DU96      ------------------------------------------------------
A0A1Q8BLE0      ------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------
A0A5B8NQW4      ------------------------------------------------------
                                                                      

© 1998-2021Legal notice