BYKdb

Dataset for cluster orphancd of phylum cyanobacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

39 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A355DU96      ------------------------------------------------------------
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
A0A5B8NQW4      ------------------------------------------------------------
A0A2T1EZA0      MFWEEKPPKDINRITTIDARVKGHSLRVAIIIGSTFPAVHNVTTTGAPPEAFPGGTARPL
A0A1U7JBN8      --------------------------------------------------MPF---PPSS
A0A2W4VXF4      --------------------------------------------------MPFSSKPAAR
A0A2W7AI98      --------------------------------------------------MPFSSKPAAR
A0A4R4INQ3      ------------------------------------------------------------
L8M1L4          ------------------------------------------------------------
A0A4P5VLH9      ------------------------------------------------------------
A0A2W6ZN45      ------------------------------------------------------MLTEAG
A0A081GP61      -----------------------------------------MGGFPPSGAAGRFQAPYPD
K9P6R9          ------------------------------------------------------------
A0A0A2B4S6      ------------------------------------------------------------
K9SGV8          ------------------------------------------------------------
B0CA08          ------------------------------------------------------------
B0BZC6          ------------------------------------------------------------
A0A1D8TTM0      ------------------------------------------------------------
A0A563VX16      ------------------------------------------------------------
A0A0V7ZGW0      ------------------------------------------------------------
A0A355DPN1      ------------------------------------------------------------
A0A0V7ZMP6      ------------------------------------------------------------
A0A4V2X515      ------------------------------------------------------------
A0A433W046      ------------------------------------------------------------
K9TU02          ------------------------------------------------------------
A0A2T1FMA8      ------------------------------------------------------------
A0A2P8QV10      ------------------------------------------------------------
B8HQ70          ------------------------------------------------------------
A0A2S6V636      ------------------------------------------------------------
A0A1D9G3S3      ------------------------------------------------------------
A0A1D8TWE6      ------------------------------------------------------------
A0A1U7N3U5      ------------------------------------------------------------
A0A1B7WWU1      ------------------------------------------------------------
A0A2T1CC83      ------------------------------------------------------------
A0A2N6LHT1      ------------------------------------------------------------
A0A328V843      ------------------------------------------------------------
A0A0D6KL48      ------------------------------------------------------------
A0A2T1DKP1      ------------------------------------------------------------
                                                                            

A0A355DU96      ------------------------------------------------------------
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
A0A5B8NQW4      ------------------------------------------------------------
A0A2T1EZA0      SLPGTGASGPGLFDPSSQQSPLSPMGESQSGGGGLGGIVRTVKRR--QSIFLITFALVTG
A0A1U7JBN8      THEINGNGHGHAKPGFMTVMAPPS-LVEQRDEVDFNQLVGVFRRRA-----GIFFGVAAL
A0A2W4VXF4      EVNGNGNGQGHASQSFVPVTAPPSPLIDDGDDFDLNHLVAVLGRRA-----GIFWGVAAL
A0A2W7AI98      EVNGNGNGQGHASQSFVPVTAPPSPLIDDGDDFDLNHLVAVLGRRA-----GIFGGVAAL
A0A4R4INQ3      ---------MADTSLDNERLSVEHRVENRANATDLRQLFTVLLRR--RLLILSLFCI---
L8M1L4          ---------MNNTIVRSDFVNLPAQETGFSLSDFKQILYRRWKPA--LALGIMAFGVVL-
A0A4P5VLH9      ------------------------------------------------------------
A0A2W6ZN45      SPTPHSPFGTGSTQVAASALSPTANQPDDASTNVLFKLIRSLKRR--QALFLFVFFVTTA
A0A081GP61      QPLQSPLTPTAEAQAGSGGLG---------------GLVRTIRRR--QTVFLLTFAVVTG
K9P6R9          ---------MGETQSGGGGLG---------------GLVRTVKRR--QSIFLITFAVVTG
A0A0A2B4S6      ------------------------------------------------------------
K9SGV8          -------------------------------MNQLQQYLFIIRRRWPVATLVFVSAVLVT
B0CA08          ----------------------------------MSNYWLMLKRRG-LPAGFTFLTVLSL
B0BZC6          -----------------------------MNESVSKVIKIIYRNRW-TTVGTFLSVFTGI
A0A1D8TTM0      ----------------------------------MNRLIAIAIRHW-KPVIGLNIVLSAI
A0A563VX16      -----------MEQRIENYMNQNVYDLDNSTELGYGEIFSIFWRRR-SYFIGICGGVLAC
A0A0V7ZGW0      -----------------------------------MKVSAIIQRLW-LPLLGLNGVIVGS
A0A355DPN1      -------------------------------------------------MLGVFCGVLAI
A0A0V7ZMP6      ----------------------------------MKKATKIAVRHW-KFVLAWNKIILGI
A0A4V2X515      ----------------------------------MKQIFSIARKHW-LPLLGFNSAVLAA
A0A433W046      ----------------------------------MKQIFSIARKHW-LPLLGFNTAVLAA
K9TU02          ----------------------------------MKQIFSIARKHW-LPLLGFNTAVLAA
A0A2T1FMA8      ----------------------------------MKQIFSIARKHW-LPLLGFNTAVLAA
A0A2P8QV10      ----------------------------------MKQIFSIARKHW-LPLLGFNSAVLAA
B8HQ70          ----------------------------------MFQITSTLRRHW-KPLIALNTVLIGS
A0A2S6V636      ----------------------------------MNHIVNIIRRHW-MPLLLLNGVVLAA
A0A1D9G3S3      ----------------------------------MKKVAAILNRHW-TILLVFNSLVLGA
A0A1D8TWE6      ----------------------------------MKKVAGILNRHW-TFLLVFNSLVLGA
A0A1U7N3U5      ----------------------------------MKKVAAILNRHW-TILLVFNSLVLAA
A0A1B7WWU1      ------------------------------------------------------------
A0A2T1CC83      ------------------------------------------------------------
A0A2N6LHT1      ------------------------------------------------------------
A0A328V843      ------------------------------------------------------------
A0A0D6KL48      ------------------------------------------------------------
A0A2T1DKP1      ------------------------------------------------------------
                                                                            

A0A355DU96      ------------------------------------------------------------
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
A0A5B8NQW4      ------------------------------------------------------------
A0A2T1EZA0      VLAINTLRQRIFSPVYQGGFQMQISNPFDNPGTGGGGGGSVESIARSEIK----TDVPSL
A0A1U7JBN8      SLAGFTLWHLSRPPAYSGSASLLVEPVTAVNTPGLETVTGAPSP-SGSGL-----DYTSQ
A0A2W4VXF4      SFGGLTLWHLTRPPVYNGSANLLVEPVTVVNTPGLEAVMELPGARSASGL-----DYTSQ
A0A2W7AI98      SFGGLTLWHLTRPPVYNGSANLLVEPVTVVNTPGLEAVMELPGARSASGL-----DYTSQ
A0A4R4INQ3      PLSASSFLALMAKPTYQSSMQLLVSSNLYQGQNSNAQGGVEESDF-TDSNL--KVDYTAQ
L8M1L4          ------IPKLLSTPQYRSEAKILLKSP-----QNQQSAEVQLNALNSRRNYYNLKDLSTD
A0A4P5VLH9      -------------------------------MEASRGGESKLETI-ARQTQ--KNDVPSL
A0A2W6ZN45      LLAANALRQRIVAPVYIGGFQMLITDPLANVGPS-TPSSGVVESL-AKTTSLGNSDVPTL
A0A081GP61      ALAINTLRQRIFSPVYQGGFQMQISNPFED--KNGGGGGGSVEAI-ARTPL--KPDVPSL
K9P6R9          VLAINTLRQRIFSPVYQGGFQMQISNPFDNPGSGGGGGGGSVETI-ARSEI--KTDVPSL
A0A0A2B4S6      --------------------MLISDPLNNNKNNSANSIGGVFEQLALNST---DNDLPTL
K9SGV8          TFHAIFVMK----PRYRASGEMLVTPGDQAIAITNVGVSKTVNQPRSLSG----GYLNTE
B0CA08          ALLQAFQEK----PIYEAVGQLKFEE-SQRSSKLIGLDSAVDDESRQQSSLRWQRSLDTE
B0BZC6          VVYLLITPR-----LYSAKVRLILDQ---RPATSISPLGRDIAQTPGDNN-K---GLATQ
A0A1D8TTM0      ALYNASKVT----EVWAARAKLIIPKSSSDLNANLGTLGDFRDRGVSFSQ-Q-VNPLNNL
A0A563VX16      MIPLVLTQK----PVYRSSMQMLVEP-NYEDKDNRGDFDPIESSI--------EIDYATQ
A0A0V7ZGW0      VIMIATFSQ----KTWTANAQLILPDTTTNLDASLGTLGQLKEQGVAFTN-E-LNPLKVL
A0A355DPN1      AIPIALNKE----PTYQSSMQLLIEP-----YVQQKQEGKPQTEEQFTDS-NVEVDYATQ
A0A0V7ZMP6      AVANIALLP----RVWISKSLLILPTSTSNVDADLDNSDDLKTKEVGFSQ-Q-VNPLNVI
A0A4V2X515      TIYAAFYASTSIPPVWTANAKLNLPQ-TGGLSANLGPLGSTQTTALNFKD---VSPLDVQ
A0A433W046      TIYAAFYASTSIPPVWTANAKLNLPQ-TGGLSANLGPLGSTQTTALNFKD---VSPLDVQ
K9TU02          TIYAAFYASTSIPPVWTANAKLNLPQ-TGGLSANLGPLGSTQTTALNFKD---VSPLDVQ
A0A2T1FMA8      TIYAAFYASTSIPPVWTANAKLNLPQ-TGGLSANLGPLGSTQTTALNFKD---VSPLDVQ
A0A2P8QV10      TIYAAFYASTSIPPVWTANAKLNLPQ-TGGLSANLGPLGSTQTTALNFKD---VSPLDVQ
B8HQ70          TALIAAFYP----RTWQASARFVVPINTNQLSADIGTLGQLRPGDGVVPS-DLMNPVTLQ
A0A2S6V636      TLYSVIYTKTNVAPVWKATAKLNLPQPTTRLDTNLGTLGQIQNTALGFTR-E-LNPLQIQ
A0A1D9G3S3      SFGAFSLLK----PFWIAKAQLILPE-TGKLQASLGTLGSLTKGDSKLAT-K-SHPLNMQ
A0A1D8TWE6      SFGAFSLLK----PFWIAKAQLILPE-TGKLQASLGTLGSLTKGDSKLAT-K-SHPLNMQ
A0A1U7N3U5      SFGAFSLLK----PFWIAKAQLILPE-TGKLQASLGTLGSLTKGDSKLAT-K-SHPLNMQ
A0A1B7WWU1      ------------------------------------------------------------
A0A2T1CC83      ------------------------------------------------------------
A0A2N6LHT1      ------------------------------------------------------------
A0A328V843      ------------------------------------------------------------
A0A0D6KL48      ------------------------------------------------------------
A0A2T1DKP1      ------------------------------------------------------------
                                                                            

A0A355DU96      ------------------------------------------------------------
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
A0A5B8NQW4      ------------------------------------------------------------
A0A2T1EZA0      IVLMRSPLLLGPVAQRQGV----------PLRALESNLSIN---------QESAR-----
A0A1U7JBN8      IRVLRGPAVINPILAKIQQRYPDI-----TYNSLLNGLNIV---------QEGES-----
A0A2W4VXF4      IRVLRGPDVIKPILVNIQRQHPEI-----TYTTLLNDLVIS---------QEGES-----
A0A2W7AI98      IRVLRGPDVIKPILVNIQRQHPEI-----TYTTLLNDLVIS---------QEGES-----
A0A4R4INQ3      LSVMTSPKLVERAVELLRPEYPNI-----TVEEINGKPAKV---------KQSPLKVTQV
L8M1L4          ILVLKSYSLINKAIEKYPETFSGL-----SAAEVRTKLNIF---------PAMINDIPT-
A0A4P5VLH9      IVLMRSPLLVKPVADR-----MGV-----SINDLISNLSIA---------P-AGN--VE-
A0A2W6ZN45      IQLLTSPVVLKPIAEA-----QAI-----PLGSLIGSLAIG---------STRAD--SQ-
A0A081GP61      IVLMRSPLLLGPVAQR-----QGV-----PLDLLAANLSIN---------PESAA--VE-
K9P6R9          IVLMRSPLLLGPVAQR-----QGV-----SLGALESNLSIN---------QESAQ--VE-
A0A0A2B4S6      IELLKSPILLNPI----------SKDYGIPFNKFSKSLKISTPGGLRT--QSMAQ-----
K9SGV8          MQIMRSKEVIQRALEIVERPISYG--------EFLGSFGVN---------VIPGT-----
B0CA08          ILTMKSPRRLSMLALAIESQGLFS---RPSVEQIKSGLDIS---------QFDET-----
B0BZC6          EELVRSKSVLTKAIVLFNQSNQDSAIEKVTLGEVKPEVATE---------VIPGT-----
A0A1D8TTM0      SSIMTSNDTISQVWEFDPEKSLYP-----RLSGYKSLFDVS---------PEGES-----
A0A563VX16      LNLMRSSQLLGRAVVKLRPSYPDI-----TTEEIQNYLVVSQVREQEDK-KEVGT-----
A0A0V7ZGW0      TSIITSDDAIRPVLLSDPEKDKFR-----SLSSYKKLFKVK---------PTDQS-----
A0A355DPN1      LNLMRSSQLIQKAVDRLHPKYPEI-----QVTDIKESFSLTGVQEEDTDIKDTQT-----
A0A0V7ZMP6      SSIATSDNVLKKVWEQDPQKTSYK-----QLSEYRGLFDVS---------PENDS-----
A0A4V2X515      LAILTSDAVMKRVQAVDPEKSLYS-----KVSSFSQLFVVT---------PQPAT-----
A0A433W046      LAILTSDAVMKRVQAVDPEKSLYS-----KVSSFSQLFVVT---------PQPAT-----
K9TU02          LAILTSDAVMKRVQAVDPEKSLYS-----KVSSFSQLFVVT---------PQPAT-----
A0A2T1FMA8      LAILTSDAVMKRVQAVDPEKSLYS-----KVSSFSQLFVVT---------PQPAT-----
A0A2P8QV10      LAILTSDAVMKRVQAVDPEKSLYS-----KVSSFSQLFVVT---------PQPAT-----
B8HQ70          AEIVKSPTLIGQVLAVDPERDQ-H-----TLQSFMPLFEAK---------PQSLS-----
A0A2S6V636      MAILMSDTVMERTLAVDPEKSLFP-----RLSDYKLAFSAT---------PQEQS-----
A0A1D9G3S3      ASILTSDALMRRLLESDPEKTDFQ-----RLVQYKKLFAVS---------PDQES-----
A0A1D8TWE6      ASILTSDALMSRLLESDLEKTDFQ-----RLVQYKKLFAIS---------PDQES-----
A0A1U7N3U5      ASILNSDALMRRLLESDPEKTDFQ-----RLVQYKKLFAVS---------PDQES-----
A0A1B7WWU1      ------------------------------------------------------------
A0A2T1CC83      ------------------------------------------------------------
A0A2N6LHT1      ------------------------------------------------------------
A0A328V843      ------------------------------------------------------------
A0A0D6KL48      ------------------------------------------------------------
A0A2T1DKP1      ------------------------------------------------------------
                                                                            

A0A355DU96      ------------------------------------------------------------
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
A0A5B8NQW4      ------------------------------------------------------------
A0A2T1EZA0      ---------VDNVLNVSLRWPDPAKGKAILRQLAKDYTSFSLTQRQAAVNSGVRFLDEQA
A0A1U7JBN8      -----------KVLRISYSNADPAVAAFVLNQVVEGFVNYSVQDRQGDLRRGLTFLDEQL
A0A2W4VXF4      -----------KVLRISYSDADPEVVTTVMSEVVKGFVAYSVQDRQGELRRGLEFLDEQL
A0A2W7AI98      -----------KVLRISYRDADPEVVTTVMSEVVEGFVAYSVQDRQGELRRGLEFLDEQL
A0A4R4INQ3      ESGTKTLQTLSQVFEVTFVAGDPIKSQKVLQALQNVYQIYNLEQQKLRLTNGLAFVNEQL
L8M1L4          -----------DILNISFVDSAPEVAQGVLDALSEVYVEYSLERERSQALNAIQFIEEQL
A0A4P5VLH9      -----------EVLNVNLRWRDPAKGRLILNELSKDYTKFSKSQRESTLNSGVEFLEQQA
A0A2W6ZN45      -----------GVLNIQLRWSDPVQGRKILTALADSYPKYALIQRQEKLGQGLEFLGQQA
A0A081GP61      -----------NVLNISLRWPDPVKGKAILRQLAKDYTAFSLTQRQAAVNSGVRFLDQQA
K9P6R9          -----------NVLNVSLSWPDPAKGKAILRQLAKDYTAFSLTQRQAAVNSGVRFLDEQA
A0A0A2B4S6      -----------GVLRISFKGENPRIVNSMLVSISKAYLKSALDQKQQRLSDGLIFLNNQS
K9SGV8          -----------DVLRFSYTSGDPKLAVEAANSMMQSYAENNIERNRAAVRAARLFIEEQL
B0CA08          -----------NVVQIRFKSYNREFPKNIVNLLMQQYVDNTPKSKQASTQSAISFIEKQL
B0BZC6          -----------QIIEITFRHTDPGVTSSLLNLIASSVIQENAETIRSEARATRQFLENQI
A0A1D8TTM0      -----------TIISLSAEGSTPELARQRTAALIEAFQQRLNELRLDDAVQRSQFMRKEL
A0A563VX16      -----------KIFQAVYKDEDAEKTQRVLEAIQEVYLEYNLEQQDKRLREGLSFINQEI
A0A0V7ZGW0      -----------TNIQLQVTASEPELAKQRAKRLIESYQERLNELRQGTANAREQFTQRQL
A0A355DPN1      -----------KIVKVVYTSNDPIKTQDVLAAIQTVYQDYNLQQQQVRLTEGLAFINDQL
A0A0V7ZMP6      -----------TVISLSVEGSTPKLATERAQNLIASLKERLQELRQDRVISQSEFIQDEV
A0A4V2X515      -----------TLIEVEAQGSRPDIAYKRLFTFLEVYQQRLNELRRKDAEVRVQYTQEEL
A0A433W046      -----------TLIEVEAQGSRPDIAYKRLFTFLEVYQQRLNELRRKDAEVRVQYTQEEL
K9TU02          -----------TLIEVEAQGSRPDIAYKRLFTFLEVYQQRLNELRRKDAEVRVQYTQEEL
A0A2T1FMA8      -----------TLIEVEAQGSRPDIAYKRLFTFLEVYQQRLNELRRKDAEVRVQYTQEEL
A0A2P8QV10      -----------TLIEVEAQGSRPDLAYKRLFTFLEVYQQRLNELRRKDAEVRVQYTQEEL
B8HQ70          -----------PLMTVEVKGTTPELAHQRLSTWIKLYQKRLTYLRENDASTRQTLPQQEL
A0A2S6V636      -----------TIINLQVKASSPDIAQRRLSNLINIYQLRLNELRHQDTNVRKQFSQTDL
A0A1D9G3S3      -----------TTIWLNASGDSPELARDRVKALISAYQERLNELRQADGTTRVEFNKKAL
A0A1D8TWE6      -----------TTIWLNARGDSPELARDRVKALISAYQDRLNELRQADGSTRVEFNKKAL
A0A1U7N3U5      -----------TTIWLNATGDSPKLARDRVKALISAYQERLNELRQADGTTRVEFNKKAL
A0A1B7WWU1      ------------------------------------------------------------
A0A2T1CC83      ------------------------------------------------------------
A0A2N6LHT1      ------------------------------------------------------------
A0A328V843      ------------------------------------------------------------
A0A0D6KL48      ------------------------------------------------------------
A0A2T1DKP1      ------------------------------------------------------------
                                                                            

A0A355DU96      ------------------------------------------------------------
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
A0A5B8NQW4      ------------------------------------------------------------
A0A2T1EZA0      PAIEERVQKLSQEMLKFRERNNFVDPAA-AAGQILGAREGLVNQLRTLQNEQVQLDSQLK
A0A1U7JBN8      QEKWQEVAAIEGDLSEFQKRYDLVDVNA-TSESVTQRLNQMLADQEQLRVELSALAPLYE
A0A2W4VXF4      QEKWQEVDTIESDLSEFQKRYDLVNVTT-TAESVAQRLNQMLSDQEQLRVQLTSLGPLYE
A0A2W7AI98      QEKWQEVDTIESDLSEFQKRYDLVNVTT-TAESVAQRLNQMLSDQEQLRVQLTSLGPLYE
A0A4R4INQ3      PKIRKDVSQAEANLENFRKQNKLLDPEV-QAKNLLDALAAVESERRTIRAQFQDQQARYN
L8M1L4          PKAEEELNKAAFAIRSFRQKNNLVDPDE-YVGRVADFRQSLEEELKRGEIALDIAQTKYR
A0A4P5VLH9      PRLRNNVTKLEAQLLDFRQKYNVLDPSG-LAEKIVSNRDDLVAKSMALQVEHNDLKSKLA
A0A2W6ZN45      PALQQRVNSLQRTLKQFRESNSFLEPLA-QGGSIISSRDGLLGQLRTLQVEQAELETQLA
A0A081GP61      PAIEARVQKLSNEMLRFRERNNFVDPAT-AAGQILGARDGLVNQLRDLQNEQVQLDSQLQ
K9P6R9          PAIEERVQKLSQEMLKFRQRNNFVDPAT-AAGQILGAREGLVNQLRTLQNEQVQLDSQLK
A0A0A2B4S6      PKLEGKNKQVQKELSDFRERNQLIEPTV-EGQELKTRLDYLENELDNIKNERVKLNNLLN
K9SGV8          PKAEQDVENAEQQLRAFREQYNFVSASA-EAEATIDRFRSTESRIEDMQVSLAKIDAQSD
B0CA08          PQVKQRVNSAETALRKFKETYQIADLEI-AKSANATNLSQLQTALDEIDRELVEVQTQQL
B0BZC6          PRRQQELVKVESSISQFKQQYNIVSLEETDNKRLTQSIAEAEKVAEEISANLRQVQARGL
A0A1D8TTM0      EQAAENLRQTQAALVAFKASSNLVSAED-QTREMVTAINTLTTEQAQVLAQAQASKAQVE
A0A563VX16      PEVRQKLTNAERNLEVMLTRYNLIAPQT-EAIDISKLLTNTRQQREELKAQYKQTQSKYE
A0A0V7ZGW0      KDAERNLQLVKSKLAQFKKSTGFVSDEE-QTKNLVTAINTLRTTQTDVLAQAKATATRSQ
A0A355DPN1      PTARDNVIQAEKALEQFRETQNLIDPVQ-QATTITDALSTVEQEQQAIRAQYQETQARYR
A0A0V7ZMP6      RQAHRKLMDAQKKLNKFKEAGNVISDEH-DAKQKVITINALNKSRVEALAEAKAAQAQTR
A0A4V2X515      EQARLNLNQAQANLSNFQRSTGLVNSPE-QSGGLISAINNLKTTQATLIAQGQANATQAQ
A0A433W046      EQARLNLNQAQANLSNFQRSTGLVNSPE-QSGGLISAINNLKTTQATLIAQGQANATQAQ
K9TU02          EQARLNLNQAQANLSNFQRSTGLVNSPE-QSGGLISAINNLKTTQATLIAQGQANATQAQ
A0A2T1FMA8      EQARLNLNQAQANLSNFQRSTGLVNSPE-QSGGLISAINNLKTTQATLIAQGQANATQAQ
A0A2P8QV10      EQARLNLNQAQANLSNFQRSTGLVDSPE-QSKGLISAINNLKTTQATLIAQGQANATQAQ
B8HQ70          QEASNNLRRTQTQLSVFRQANNITDINE-QIRGLVNSISDLKTEYARALAQAQASNAQQQ
A0A2S6V636      EEAQAQLAKAQAELASFQQATGLTEVAE-QTRALIAQQRELRTTYTNVLSQAQANQAQAQ
A0A1D9G3S3      ERAKQKLDQSQEALAKFQESSGLVNSKA-QTEGLVRAITDLSISQAQAQAEAQASQHQLQ
A0A1D8TWE6      ERAKQKLDQSQEALAKFQESSGLVNSKA-QTEGLVRAITDLSISQAQAQAQAQASQHQLQ
A0A1U7N3U5      ERAKQKLDQSQEALAKFQESSGLVNSKA-QTEGLVRAITDLSISQAQAQAQAQASQHQLQ
A0A1B7WWU1      ------------------------------------------------------------
A0A2T1CC83      ------------------------------------------------------------
A0A2N6LHT1      ----KQLQEAEQKENRYRQSSGIVSFDE-QTKSLVESLATLEEQENTLSAQLQELRSKEA
A0A328V843      --------------QYFKQRNYVVDLGT-EFAISVQEMAQLNRNITTLEAELNAVQSLVN
A0A0D6KL48      ------------------------------------------------------------
A0A2T1DKP1      ------------------------------------------------------------
                                                                            

A0A355DU96      ------------------------------------------------------------
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
A0A5B8NQW4      ------------------------------------------------------------
A0A2T1EZA0      SIQTGKLQ-FTPSGAPTALEQLGRNS---------VLVPGRGDSAAEAASGTKTPL----
A0A1U7JBN8      NLREQVG--FDP-NTAIRVANLNESP------------------------TYQALL----
A0A2W4VXF4      NLRSQVG--FEP-SVAIGVANLNESP------------------------TYQGLL----
A0A2W7AI98      NLRSQVG--FEP-SVAIGVANLNESP------------------------TYQGLL----
A0A4R4INQ3      KLQQ---QISRSPQQALIASRLSQSP------------------------RYQSLL----
L8M1L4          TISNQLIELGQDPETIVTTSVLGQDG------------------------VYQSLA----
A0A4P5VLH9      SVQSGRLNWTPSGAP-TPIQQLGRQG-------TVIPGRSDANDSNEIGAGQTTPN----
A0A2W6ZN45      SVRSGKLITLPSPGS-SGSGVVGQGSPAAGNPQLGLATRPRADSVAPSSNTVVTPQ----
A0A081GP61      SIQSGKLQFSSSGAP-TAIQQLGRNS-------VLVPGRANQNQGAEVAKGTPTPL----
K9P6R9          SIQTGKLQFTPSGAP-TALEQLGRNS-------VLVPGRG--NSAAEASSGTKTPL----
A0A0A2B4S6      SIENGSLTAYGFKQAITTDLNLNERI------------------------PTEGVSFINL
K9SGV8          QLGNLVADEIDSVEQALLRTALSQSP------------------------HTAGVM----
B0CA08          SLQNMLK--VNP-QQAI----LGIST------------------------AHKNIS----
B0BZC6          ALSKVID--QSSGKESYLSAKAGQNP------------------------ELISLR----
A0A1D8TTM0      TLSARLE--LNP-QQAIRSLSLGENQ------------------------DYQFFR----
A0A563VX16      SLEQQLA--TTG-NVDSVDSRLSLSS------------------------RYQNLL----
A0A0V7ZGW0      ELSRTLG--MAP-QQAINSLRLSENK------------------------EYQALR----
A0A355DPN1      VLQQQLE--RSP-QEALTSSRLSQSP------------------------RYQALL----
A0A0V7ZMP6      ILSARLS--LPP-QTALKSLQTKGTE------------------------TSLSIR----
A0A4V2X515      AAAVSLG--ITP-QQAMNSLRLGENK------------------------EYQATR----
A0A433W046      AAAVSLG--ITP-QQAMNSLRLGENK------------------------EYQATR----
K9TU02          AAAVSLG--ITP-QQAMNSLRLGENK------------------------EYQATR----
A0A2T1FMA8      AAAVSLG--ITP-QQAMNSLRLGENK------------------------EYQATR----
A0A2P8QV10      AAAVSLG--ITP-QQAMNSLRLGENK------------------------EYQATR----
B8HQ70          ALSQHLR--LTP-QAAMTTLRLGENK------------------------EYQLVR----
A0A2S6V636      AASERLG--INA-QQAMNSLRLGENR------------------------EYQAIR----
A0A1D9G3S3      ILSTRLG--LTP-KQAIRSLGLAENR------------------------DYQFVR----
A0A1D8TWE6      ILSTRLG--LTP-KQAIRSLGLAENR------------------------DYQFVR----
A0A1U7N3U5      ILSTRLG--LTP-KQAIRSLGLAENR------------------------DYQFVR----
A0A1B7WWU1      ------------------------------------------------------------
A0A2T1CC83      ------------------------------------------------------------
A0A2N6LHT1      SLQQVTD--AKALNQAYAAVRGGQDE------------------------ELKALR----
A0A328V843      SLGNQVG--LN-LEEAIAVNTLSQSP------------------------VVRAAL----
A0A0D6KL48      ------M--KLNTDTAVELTTLSQSP------------------------GVQQVL----
A0A2T1DKP1      ------------------------------------------------------------
                                                                            

A0A355DU96      ------------------------------------------------------------
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
A0A5B8NQW4      ------------------------------------------------------------
A0A2T1EZA0      -----DLLNQFEQELATAKGTFKENSPIVQSLLARRNQLLPVVQRQAADAV---------
A0A1U7JBN8      -----GDLREIEQTIAAESARFQADTPMIEALTDQRQQLLPLLEAEAQRLV---------
A0A2W4VXF4      -----GDLREIEQTIAAESARFQSDTPMIEVLVDQRQQLLPLLEAEAGRLV---------
A0A2W7AI98      -----GDLREIEQTIAAESARFQSDTPMIEVLVDQRQQLLPLLEAEAGRLV---------
A0A4R4INQ3      -----DEIQALDVTLEKLRVQYRDDYPKVQDLLKQRQNLIGLLRTEAGRSA---------
L8M1L4          -----SQLKDLETQYTLASVQFKDNYPMMQDLKLQREQLRNLLLERSTQILGEGISPAVL
A0A4P5VLH9      -----ETLDEFEQKLANARAVYKDDSPIVQSILAQRDAILPVVRKQATDAI---------
A0A2W6ZN45      -----QQLSQLDQQIATARATFKSDSPQLQTLLAQRNRIKPLVQSQGIDQL---------
A0A081GP61      -----DLLNQFEQELATAKGTYKQNSPIVQSLLARRNQLLPVVQRQASDAV---------
K9P6R9          -----DLLNQFEQELATAKGTFKENSPIVQSLLARRNQLLPVVQRQAADAV---------
A0A0A2B4S6      DLELLDQYILVKQKLAIARTKYLEDSEIVKGLKYRVEQIEPTLKSN--------------
K9SGV8          -----GELQQTKQAIATQLAIYREDSPQIAVLRDQERNLEQLLRQRAKQVA---------
B0CA08          -----TSLEEIDKDLAEAKSNFREDHPAVLELLERQAQLKQLLSQKIEKFA---------
B0BZC6          -----DQLSNLESQLKIRRESLTDDHPDIQKLITEKDAAQALYQQKLATIS---------
A0A1D8TTM0      -----QELSEVEALLTETQAKFTNENPQVQALLEQREELQNQIEGYIFQAR---------
A0A563VX16      -----NELQRIDIELETQRSRFTDSNPIVQGLLTERRQKQQLLEKEAGNIL---------
A0A0V7ZGW0      -----QKLTEVNTEIAVNRGTLTEEHPTVRALLQQRQKLLMALNRQLNAVV---------
A0A355DPN1      -----NELQKTELAIAQQRVKFTDAEPRVEQLLEQRQRQLALLQEETQRVL---------
A0A0V7ZMP6      -----EKLSKVNISLQEAQTYLTDNHPRIENLKFQQEELRNELQED-RVSD---------
A0A4V2X515      -----TQLSQLESTMAVTRSKYRDDSPQVQSLLQQRQQLLRQLNQQIAVAI---------
A0A433W046      -----TQLSQLESTMAVTRSKYRDDSPQVQSLLQQRQQLLRQLNQQIAVAI---------
K9TU02          -----TQLSQLESTMAVTRSKYRDDSPQVQSLLQQRQQLLRQLNQQIAVAI---------
A0A2T1FMA8      -----TQLSQLESTMAVTRSKYRDDSPQVQSLLQQRQQLLRQLNQQIAVAI---------
A0A2P8QV10      -----TQLSQLESTMAVTRSKYRDDSPQVQSLLQQRQQLLRQLNQQIAVAI---------
B8HQ70          -----DRLAQVEADLATARGTLTDDNPRVQDLLEQRQKLTQLLDQNLRAAI---------
A0A2S6V636      -----QKLSDAETALAEARSRYTDESPQVQSLLSQRQELMQLLNQQIAIAA---------
A0A1D9G3S3      -----QQLTELEATLVKAQATYTYAHPEIQNLLLQREQLQQQIQQYIFLA----------
A0A1D8TWE6      -----QQLTELEATLVKAQTTYTYAHPEIQNLLLQREQLQQQIQQYIFLA----------
A0A1U7N3U5      -----QQLTELEATLVKAQTTYTYAHPEIQNLLLQREELQQQIQQYIFLA----------
A0A1B7WWU1      ------------------------------------------------------------
A0A2T1CC83      ------------------------------------------------------------
A0A2N6LHT1      -----NKLAEIETQLVQARLSLTDNHPTVINLLGQRNGLRALYQQGLARVS---------
A0A328V843      -----QELENVEGELAQEQRRFRDENPRIISLKGKRDNLENLLQREIQVYL---------
A0A0D6KL48      -----TEYQKVQDELAVARTRLTEDNPKIINLENQAVALKNQLEGRVAQTI---------
A0A2T1DKP1      ----------------VEQTRYRSGHPAIANLERKVDALNALLQERIGQVV---------
                                                                            

A0A355DU96      ------------------------------------------------------------
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
A0A5B8NQW4      ------------------------------------------------------------
A0A2T1EZA0      ---------------------------------------KARLLANVAQQDEINRQILLL
A0A1U7JBN8      -------------GSAVEAETLGYQGSVSQDLMQQLVNTANQMQVLQTQDQAIGQAVQLL
A0A2W4VXF4      -------------GSAVDANTLGYQGSVSRELVQQLVDTANQMQVLETQDQAIAQAVQQL
A0A2W7AI98      -------------GSAVDANTLGYQGSVSRELVQQLVDTANQMQVLETQDQAIAQAVQQL
A0A4R4INQ3      -----DRLPTQLSTTEKSLPKQLQLGDSDRKLVDALVDAQVVWFGLSARDQSLAKSEQQL
L8M1L4          DKVLVSYTQTNIVAAGDSGSQVSTSGSTLQQLAEQLLSTQTEYLSLQSQINQINQAKANV
A0A4P5VLH9      ---------------------------------------KAQLFANESQQDELNRQILLL
A0A2W6ZN45      ---------------------------------------SSQLFANQAQQNELNRQILLL
A0A081GP61      ---------------------------------------KARLLSNLAQQDEINRQILLL
K9P6R9          ---------------------------------------KARLLANVAQQDEINRQILLL
A0A0A2B4S6      --------------QISALI--------------------SAREIIDKNIQNAKIKIKSL
K9SGV8          -----GIPPSESI-DIDALF---QIGGLQEQSVQQFYSLDNERVGLLEEISALNDVYSNY
B0CA08          --------------QSDAQL--NFDSNQEDDLRSQLIQLDIRRNGLSKQQLKLRQQLSSY
B0BZC6          -----PRSRLNSDGTVQVAN-----EKVTQELSEKLVLSVVERNELRDKLANTRAYISKL
A0A1D8TTM0      -----AAQP-----GVNATI-----GQESAALIRELILAESQTQAYYSQGKQIQTQIDQL
A0A563VX16      -----GSTNLQVS-SSDNLESRGQLDSSNLELAEALASTRNELIGLESRERSLALTEQKL
A0A0V7ZGW0      -----PSAD-----GIDANFGGNNFKDATIELIAQLIQVESESKGLQQQVLIIQNKLERL
A0A355DPN1      -----GETSTQIAFSTQNLLTEGQLGSNDLTLSSQLAEAQTTLQALQARDRSLAITQQQL
A0A0V7ZMP6      -----NSVSSV---AINPNL-------ADRHIVHKLILAESQAEAMSSKAQQLQIQINYL
A0A4V2X515      -----PGANAA---QIDTTL-GNGPNDSRLELMVELIRNQTLAQGTQQQAKQIQKQIDKL
A0A433W046      -----PGANAA---QIDTTL-GNGPNDSRLELMVELIRNQTLAQGTQQQAKQIQKQIDKL
K9TU02          -----PGANAA---QIDTTL-GNGPNDSRLELMVELIRNQTLAQGTQQQAKQIQKQIDKL
A0A2T1FMA8      -----PGANAA---QIDTTL-GNGPNDSRLELMVELIRNQTLAQGTQQQAKQIQKQIDKL
A0A2P8QV10      -----PGARPA---QIDTTL-GNGPNDSRLELMVELIRNQTLAQGAQQQAKQIQKQVDKL
B8HQ70          -----GNSSLA---GVDRSLAGSAAGDSRIALIADLIRTQSTANGQQSQAQQLQQQLGQQ
A0A2S6V636      -----PGASAN---QIDPTLGGNGTRDSRIEMIAELIRAQNNAAGLQQQANQIASEINRV
A0A1D9G3S3      -------AGDT---LVDPTL--TDSAQGRAMLIQQLILAESAASGQQQQAEQLQQQIDQI
A0A1D8TWE6      -------AGDT---LVDPTL--TDSAQGRAMLIQQLILAESAASGQQQQAEQLQQQIDQM
A0A1U7N3U5      -------AGDT---LVDPTL--TDSAQGRAMLIQQLILAESAASGQQQQAEQLQQQIDQI
A0A1B7WWU1      ----------------------------------------------TKQVEELQRVFIFN
A0A2T1CC83      ----------------------------------------------VGALYNSQQDLI--
A0A2N6LHT1      ------------PRNQSISSGSVAGDQISQDLTSQLIINDVERLALENKLKVVQTNRANL
A0A328V843      ------------GSSRPFSRGLLRVMDVKNNKIEEFVNAEIRRLDLTKQLDSLYEARDGL
A0A0D6KL48      ------------GNSEYMPEQNLQIGNLKQTLTENLVKSEVERLALTNQVAELKQVLLVN
A0A2T1DKP1      ------------SNGGPVPTGNLQLGDLQQGLISDLVRSEAERVGLSERLSSLSNAQSAY
                                                                            

A0A355DU96      ------------------------------------------------------ASIPEA
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
A0A5B8NQW4      ------------------------------------------------------------
A0A2T1EZA0      SENFRNNPQKLAEFENINQRLSIAREQYSSYIQARERYRLEMARSISPWEVIGPPDFGSS
A0A1U7JBN8      RAEIQRLADLSRSYQQISRELTVAETSLDQLLASRQDLRFQMARQASPWELISPLNETSI
A0A2W4VXF4      RAEIQRLADLSRSYQQIDRELTVAESSLDRLLTSRQDLRLQMARQTAPWELISPLDESSV
A0A2W7AI98      RAEIQRLADLSRSYQQIDRELTVAESSLDRLLTSRQDLRLQMARQTAPWELISPLDESSI
A0A4R4INQ3      RSTLLKYPQLLAEYNRLMPEIAINRKTLEQLLQTQQNLGIKIAQGGFNWQIIRDPEPGVY
L8M1L4          EADFQRLPQLQEIYTRLQRNIKIQSQAVDYLLQRKQELQIAAAEEITPWQILDKPYLPAQ
A0A4P5VLH9      NENFKNSPSLMKKYEELASNLKSARENYSSYLIARDNYRLQRARSTSPWQVIAPAEFNEI
A0A2W6ZN45      NKNFKQSPEEIRKYEELQQKIEVAQANYLSYIQARENFRLEVAKQTVPWQVISPPVFGDV
A0A081GP61      NQNFRNNPQKLSEFENINQRLSIAREQYSSYIQARERYRLEMARSITPWEVIGPPDFGAS
K9P6R9          SENFRNNPQKLAEFENINQRLLIAREQYSSYIQARERYRLEMARSISPWEVIGPPDFGSS
A0A0A2B4S6      KEKFEKQPKLISEYKTLQQKALLAAKNLEGLSSAKEKFQLEIAQRSVPWSIIAPPKVYPV
K9SGV8          RERYRELPKLEQEERRLERKVTVAESTYAELLQQLQEVRIAEQQNIGNTRILSLASTPID
B0CA08          RQQARNLPQLEQRQNELERTAKASASTYRNLLEQIQELKVTENQSPLTVSILESAT-DPE
B0BZC6          DARRKQYPVLEKTLASLQRKKEGATESVNLLRQKLDEARIAEAQLVSNLRIIEEANKPTL
A0A1D8TTM0      GSILKTLPAAQARLVQLQQQYDIAEGVYNGLVAQVQQSKLNAFSSYPSVQVFEEPRADSK
A0A563VX16      KEKLNQFPDLIAQYNSLEQEVAVHQATLKKLLESRQEIGIVINRGGFSWEIIEPPQQGLQ
A0A0V7ZGW0      QTELKNISTLQAQLLDLQRQYDIAEGVYKGIVAQLEQSKIAAFNAYPNLQVLDQPTVDPK
A0A355DPN1      RAKLNRLPELMAEYERLQPEVQIRRDTLQKLLEARQELGIEIARGGFKWQVVEPPKPGKQ
A0A0V7ZMP6      REQLKKLPTKQGILMDLQRRYDMTKKIYNGLVTQAEKVRLSAFDTYPSFQLLDEPFVNNE
A0A4V2X515      NTELNFITKNQAQLLDLQRKYEIAEGVYKGIIAQSEQSKTNPFNAYPNVQTLNEPTIDPR
A0A433W046      NTELSFITKNQAQLLDLQRKYEIAEGVYKGIIAQSEQSKTNPFNAYPNVQTLNEPTIDPR
K9TU02          NTELSFITKNQAQLLDLQRKYEIAEGVYKGIIAQSEQSKTNPFNAYPNVQTLNEPTIDPR
A0A2T1FMA8      NTELNFITKNQAQLLDLQRKYEIAEGVYKGIIAQSEQSKTNPFNAYPNVQTLNEPTIDPR
A0A2P8QV10      NTELNFITKNQAQLLDLQRKYEIAEGVYKGIIAQSEQSKTNPFNAYPNVQTLNEPTIDPR
B8HQ70          VTALNRLSNKQVQLLELQREYSIAEGVYKGVMAQFQQAKISTLSSYPSVQVLDGPLNSPR
A0A2S6V636      NAELNNIAQNRAQLINLQRQYEIAEGVYKSILAQVEQTKTNPFNVYPNVQTLDAPAIDPK
A0A1D9G3S3      KSTLTVIPVHQSRLLELTRQYDVAAGVYNGLVAQMEQVNLDAFSAYPNVQVLDPPTVDEK
A0A1D8TWE6      KSTLTVIPVHQSRLLELKRQYDVAAGVYNGLVAQIEQVNLDAFSAYPNVQVLDPPTVDEK
A0A1U7N3U5      KSTLTVIPVHQSRLLELKRQYDVAAGVYNGLVAQMEQVNLDAFSAYPNVQVLDPPTVDEK
A0A1B7WWU1      RRRLDSLPRLEQQQLQLQRQLTVAQITYQEFLKQYQLVQVLENQNVGNSRVISEALVPEL
A0A2T1CC83      -KRAKVLPQLEQKDRELVRQAESAGKTYETLLNNLQEATIAANSKSGNADVVEYAAVPDK
A0A2N6LHT1      QARLAQLPIQQQQLTPLTRQREESAESLKLLQSKLEEARIAEAQLVGNIQIIEAAQPPTQ
A0A328V843      ERRARILPQLEQQQQELERKAEVARLTYRTLLQNLEEAQVAANKITNNARIIETANVPDE
A0A0D6KL48      KNRLDSLPRLEQQQLQLQRQLKVAQVTYEQLSKQLQEVEVVENQNVGNARVISEALVADK
A0A2T1DKP1      RARANALPRLEETQRELERRLKAAQTTYEVLLSRLQEVQVAENQNIGNARALSSAIVSER
                                                                            

A0A355DU96      PVSPKKKLILVGGIVAGSLLYIVTAFVLDLMDPSIKTAKEIRQLFKYTWLGMIPESRKKG
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
A0A5B8NQW4      ----------------------------------MKTVQEIKDKLGYTLLGSIPLFGKQ-
A0A2T1EZA0      PVEPNIQRNLLRAIMIGLLAGLGAAILRERTDNVFHTPMEVEKDLQLPVLGLIPYLPL--
A0A1U7JBN8      AQTSNLPRNLLLSTVLSLMLGGVAALLRDRLDQAFHSVDDLVKATQLPNLAGVPNAPALQ
A0A2W4VXF4      TEMTNLPRKLLLSTVVGLLLGGVAALVRDRADTAFHSADELVKATQLPNLALVPNAPALQ
A0A2W7AI98      TEMTNLPRKLLLSTVVGLLLGGVAALVRDRADTAFHSADELVKATQLPNLALVPNAPALQ
A0A4R4INQ3      -MGTGRIMLLVSGAVFGLVLGIGAAFLLEALDDTIHSCDELQKLSSLPVLGITPKLPNFE
L8M1L4          PISPNIQKALVSSLVAGGLWAIAIAFLLHQLDNRIKLVEEVKRITHLPLLGAVPQV----
A0A4P5VLH9      PVEPNLQSNLLRALMLGLVSGLGAAILRERTDNVFHTPMETERELQLPVLGLIPYLP---
A0A2W6ZN45      PIEPDLSREFLRALFIGLAVGIAAVLLREKTDDAYHTPKEASQELGLPILGLIPYLP---
A0A081GP61      PVEPDIQRNLLRAIMIGLLAGLGAAILRERTDNVFHTPMEVEKELQLPVLGLIPYLP---
K9P6R9          PVEPNIQRNLLRAIMIGLLAGLGAAILRERTDNVFHTPMEVEKDLQLPVLGLIPYLP---
A0A0A2B4S6      PVSPDIPLNLSLSLIFGPVLGLIVGLIRDKVDHVYHSPDEVKENLNLPLLAELPYIESFV
K9SGV8          IVTPRRPRNVSLGLLLGLSAAGGAVFLLEAFDKKIKSTAAARELLGFPLLGVIPNFKKVP
B0CA08          PSKTTFISAAMRGGLAGILLASGVVYVLERIDRKLKSKDEIRQVYPYRVLGEIPLFDESE
B0BZC6          PSYPNIPSFLVLGMMAAVALSAGVTLSAEGMDGRLRDLESIAENTNVPVLGVIPKQKNSR
A0A1D8TTM0      PSGPGRRPIALGTILASVFGSAAIVLFLESRNPLLSL-QDLQ-AISIPVLRSIPPFKHLV
A0A563VX16      ISPNITQDLVLGGIVSVFLGAVSVVIMEASDNKIRVS-RQLQEKVNFPLLGTTPGLSKIK
A0A0V7ZGW0      PTSPKKSLIAIGGILTSVFASLALILFSESRNPLLKQ-KDLQ-DIELPLLARIPIFKSAP
A0A355DPN1      MGPDTRRDLMLSVVVGLFLGGLAAFGREALDDAVHSS-EELKRQVALPLLGIIPELPRTG
A0A0V7ZMP6      ASSPNIQLIILGAVLISIFGSVAIILLQERRDPLISP-KDIQ-QKNFPVLASVPYMKGLD
A0A4V2X515      PSIPNLKLITTGGMLAAIFGSMALIFFLENRNPLLKP-KDLQ-QVELPVLGSIPHLKQPS
A0A433W046      PSIPNLRLITTGGILAAIFGSMALIFFLENRNPLLKP-KDLQ-QVELPVLGSIPHLKQPS
K9TU02          PSIPNLRLITTGGILAAIFGSMALIFFLENRNPLLKP-KDLQ-QVELPVLGSIPHLKQPS
A0A2T1FMA8      PSIPNLKLITTGGMLAAIFGSMALIFFLENRNPLLKP-KDLQ-QVELPVLGSIPHLKQPS
A0A2P8QV10      PSIPNLRLITTGGILAAIFGSMALIFFLENRNPLLKP-KDLQ-QVELPVLGSIPHLKQPS
B8HQ70          PE-PRRMLIILGGLMAIAFGSSALVLLLESRNPLLSP-ADIQ-KVKQPILAKLPRLKAPS
A0A2S6V636      PEEPSKRAIALGGILAGLFGSISLIFFLEKRNPMLRP-KDLE-QVEFPVLGRISRLKRAD
A0A1D9G3S3      PAGPKKLLIIANGFLASAVGSIALVLLLERRNPLLSP-KDLQ-AIKFPMVVNIPHLRHAG
A0A1D8TWE6      PAGPKKLLIIANGFLASAVGSIALVLLLERRNPLLSP-KDLQ-AIKFPMVVNIPHLRHAG
A0A1U7N3U5      PAGPKKLLIIANGFLASAVGSIALVLLLERRNPLLSP-KDLK-AIKFPMVVNIPHLRHAG
A0A1B7WWU1      PVSPKIPLNLALGGFLGVLLGAGTALLLESMNQSLKNIEEANRLLGFPLLGTIPQHGEKN
A0A2T1CC83      GNSGRAVL-MGMGLIMGAFLANLSVILLEMQDRSISSLAEIKKKFPYQTVGI-------T
A0A2N6LHT1      PSLPNKRTVLAIAIVVGTALATGIVLLLELMDHTLKDASEAEELLKLPLLGVLPRLPGHA
A0A328V843      GK-TAKVPLLALGVMGGLVASTTLLLLMEMGDKSLRTVAETRDLFGYTLLGIIPSFAAPP
A0A0D6KL48      SVSPIIPLNLALGGILGIILGAGTALVLESIDNSLKTVEEAKRLLDYPLLGAIP--QAEK
A0A2T1DKP1      SSNR--KMGLALGGGVGILLAVAAAFAADLLDRSVKTLKEVKDLFGYTLLGVVPLLNGKP
                                                                            

A0A355DU96      LFWQQ---KINGNVPQLVVRDVPHGITSEAYRMLEAN-----------------------
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      -------------MSFLPVRDAPRSPLSESFRMLQAN-----------------------
A0A5B8NQW4      -------------ASELPMQDQPRSAVSEAFRMLQAN-----------------------
A0A2T1EZA0      ---------------------EPGVDIATSISKMSSS--------ERFAIKESLRSLFTT
A0A1U7JBN8      KQPLL-----------------MVPNLSATMADVLTQNQSPHKLYTSFSFAEAFYSLEAN
A0A2W4VXF4      KQPLL-----------------MVPDLTATMADVLTQNQSPDNLYTSFSFAEAFYSLDTN
A0A2W7AI98      KQPLL-----------------MVPDLTATMADVLTQNHSPDNLYTSFSFAEAFYSLDTN
A0A4R4INQ3      LKKPSIAL-------------PFFKQQSLTSQRIQAL-------NWF-PFRESVDLIYQN
L8M1L4          -------F-------------DPLIVIEDNTVKQSYS-------YRYSSFTESLRAIAMN
A0A4P5VLH9      -------L-------------ESGVDVSTSISKMSAS-------ERF-AIKESLRSLFTT
A0A2W6ZN45      -------I-------------VSSDSILKSLKELPGT-------ERF-AIKESLRSLFTT
A0A081GP61      -------L-------------EPGVDIATSISKMSSS-------ERF-AIKESLRSLFTT
K9P6R9          -------L-------------EPGVDIATSISKMSSS-------ERF-AIKESLRSLFTT
A0A0A2B4S6      NLRENNESIFNVEDKLNATKNEKSSESYLGYQRFFYQ--------------EAFRGMYTS
K9SGV8          LFPVASGNRIGRTVPELVVREAPNSPISEAFRMLQTN-----------------------
B0CA08          AESLKLPTLSDPASHLSEAYRMLQSSLK--FHGLEHS-----------------------
B0BZC6          LFPSLPFAELYNNLPLLESVRALSKNIE--YKNSTES-----------------------
A0A1D8TTM0      LDVDP----------------SFGTAIE--FQRLASA-----------------------
A0A563VX16      ---DS----------------QFSVRLP--FFSGNDQETIPLQVIEWLPFRESLDLVYEN
A0A0V7ZGW0      LGLTM----------------ESDAQIP--FQRLAST-----------------------
A0A355DPN1      ---GS----------------GLLVHLP--FRRTQVAAASTLPMVYWLPFRESLDLIYKH
A0A0V7ZMP6      TSMGE----------------GINEKVE--FQRLASA-----------------------
A0A4V2X515      MERNL----------------AAEIDIE--FQRLASS-----------------------
A0A433W046      MERNL----------------AAEIDIE--FQRLASS-----------------------
K9TU02          MERNL----------------AAEIDIE--FQRLASS-----------------------
A0A2T1FMA8      MERNL----------------AAEIDIE--FQRLASS-----------------------
A0A2P8QV10      MERNL----------------AAEIDIE--FQRLASS-----------------------
B8HQ70          QVWNL----------------DAEPLLG--FHRLASA-----------------------
A0A2S6V636      MERNL----------------SGEVAIE--LQRLASA-----------------------
A0A1D9G3S3      MGLEL----------------GTETDVE--FQRLASV-----------------------
A0A1D8TWE6      MGLEL----------------GTETDVE--FQRLASV-----------------------
A0A1U7N3U5      MGLEL----------------GTETDVE--FQRLASV-----------------------
A0A1B7WWU1      PKNPQEGRQ------ELPLLDDPYSPVSTSFEMLQTN-----------------------
A0A2T1CC83      RLEPPMYQG------KIVTRDEPDSFSSEVYRMIQAN-----------------------
A0A2N6LHT1      I--------ALEP--SAQFLDHVG--LVEPYRTLFKN-----------------------
A0A328V843      FYRYLTGGDRSSV--QVPVVDTPGSLISEIYRMIQAN-----------------------
A0A0D6KL48      AKGSEGVGEVELP-----VLNNPYSPVSSAFEMLQTN-----------------------
A0A2T1DKP1      VRQRSHFEGTAHPIPRVYVRELPFSSAAEAYQMLQAN-----------------------
                                                                            

A0A355DU96      LKFLSPD-QVLKRIVVTSSVAQEGKSTVSANLAIAMAQVGRRVLLVDADMRHPMQHHIWD
A0A1Q8BLE0      ------M-RAVSRIVITSPGPEEGKSTTAANLAIAFAQQGHRVLLVDCDLRRTRIHKIFD
A0A2T2S1W0      LRFSQAD-RRLQAIAVASSVPGEGKSTLVANLGLALAEVGQHVLIVDADLRNPSQHGIWE
A0A5B8NQW4      LKFSRVD-EKLKVIVVTSSVPNEGKSTVTGNLGLALAELGNRVLIVDGDMRRPSQHQVWE
A0A2T1EZA0      FRLLRAD-NNIRMVGITSSTQGEGKSTAVAVFSRTLADLGLRVLVIDSDMRLPMQARYLG
A0A1U7JBN8      LRMLSSD-TPIQVVALTSSEPGEGKSTICAHLAIAAANMGRRVLLIDSDLRKPSQHLIFG
A0A2W4VXF4      LRMLSSD-TPMQVIALTSAVPGEGKSTICAHLAIAAANMGRRVLLIDGDLRKPSQHLIFS
A0A2W7AI98      LRMLSSD-TPMQVIALTSSVPGEGKSTICAHLAIAAANLGRRVLLIDGDLRKPSQHLIFS
A0A4R4INQ3      IQILGSP-LPFKSLLLTSALTGEGKSTLAAGMALSVARLQRRVLLIDADLRRSNIHKLLN
L8M1L4          ISYTVVDTRKIKSLVTTSSTSSEGKTTVTYNLALALTELDAKVLVVDADLRKPKIHKMAK
A0A4P5VLH9      FRLLRSD-RDIRLVAVTSSTQGEGKSTAVTIFARTLADLGLKVLVVDADMRLPMQTRYLG
A0A2W6ZN45      FRLLRAD-REIRLVVITSSTQNEGKSTAASVFGNTLADLGLHVLLVDADMRLPVQHKHFA
A0A081GP61      FRLLRAD-NNIRMVGITSSTQGEGKSTAVTVFASTLADLGLKVLIIDSDMRLPMQTRYLG
K9P6R9          FRLLRAD-NNIRMVGITSSTQGEGKSTAVAVFSRTLADLGLKVLVIDSDMRLPMQARYLG
A0A0A2B4S6      IKFINTQ-NSLKILSISSCIPSEGKSLISTMFAKTISELGLSVLLIDTDLRKPQVHARLG
K9SGV8          LKFLSLK-KRLKVIVVTSSVPREGKSTIAANLAATIAELGQRVLLVDADMRHPAQHRIWQ
B0CA08          ----------PRVLMMTSAINQEGKSTTCANLAVSLAQMNHRVLLIDADIRLASQHQIWE
B0BZC6          -----------KVLVITSAISGEGKSFVATNLAVLSAMLSKRTLLIDADMRRPSIHKIFQ
A0A1D8TTM0      --VSMKP-LKNRRLMISSATSGEGKTTVTLGLASALITLGFRVLVVDGDFRKAELSQRLG
A0A563VX16      IQLMSQN-SLINSIAITSSIAGEGKSTITLGLALSAARRRKKVLVIDGDLRCPTLHEKLD
A0A0V7ZGW0      --ISLMS-LENHRLMVTSSTAGEGKTTVTLGLAKALMVLGFRVLMVDGDFRKAKLSRQFG
A0A355DPN1      IQLLNSA-ATLRSIVVTSALPSEGKSTFVVGLAFSAARLHQRVLLIDADLRRPSLHKQLN
A0A0V7ZMP6      --ISLLH-LENKSLMIASANSGEGKTTVTLGLANALLELGFRILIVDADFRKCELTQSLG
A0A4V2X515      --ILML---EHPCLMVTSATAGEGKTTVTLGLALALLNFGFRVLVIDGDLRKAEMSRRLG
A0A433W046      --ILML---EHPCLMVTSATAGEGKTTVTLGLALALVNFGFRVLVIDGDLRKAEMSRRLG
K9TU02          --ILML---EHPCLMVTSATAGEGKTTVTLGLALALVNFGFRVLVIDGDLRKAEMSRRLG
A0A2T1FMA8      --ILML---EHPCLMVTSATAGEGKTTVTLGLALALVNFGFRVLVIDGDLRKAEMSRRLG
A0A2P8QV10      --ILML---EHPCLMVTSATAGEGKTTVTLGLALALVNFGFRVLVIDGDLRKAEMSRRLG
B8HQ70          --ISFLD-LATPRLMITSAMYGEGKTTIAIGLAAALARLGFKILLVDGDLRRARLTEQLS
A0A2S6V636      --VLML---EHQRLLVTSSTSGEGKTTVTLGLALALVNFGFRVLIVDGDLRQAELSQRLG
A0A1D9G3S3      --ISLRS-GEDRRILITSAMVSEGKTTVTLGLATALVDLGFRVLVVDGDFRQATLSQRLG
A0A1D8TWE6      --ISLRS-GEDRRILITSAMVSEGKTTVTLGLATALVDLGFRVLVVDGDFRQATLSQRLG
A0A1U7N3U5      --ISLRS-GEDRRILITSAMVSEGKTTVTLGLARALVDLGFRVLVVDGDFRQATLSQRLG
A0A1B7WWU1      LGFTVSD-KELRVILVTSATPGEGKSFVAANLALAGAYVGKRVLLVDADMRRPRQHRVWE
A0A2T1CC83      LKFLTND-KPPKVILVTSSVPEEGKSTVTANLAAAISQLGRSVLLVDADLRRSSQHHLWG
A0A2N6LHT1      LEFRSSE--PLRSIVVSSTITGEGKSVVGSHLAAISAMLSRRTLLIDADLRRPILHTLFN
A0A328V843      LKFLGSD-RKVRVIVVSSSVPQEGKSTVSANLAAAIAQLGHRVILIDGDMRQPIQHHIWG
A0A0D6KL48      LSFSISD-KMLKVIAISSSIPGEGKSFVAANLAVAVAQLGRRVLLVDADMRRPRQHKIWE
A0A2T1DKP1      LRFLRSD-KEIKTVVVTSSVAQEGKSEVAANLAASMAQVGRRVLLVDADMRYPVQHHVWD
                             :  :*    ***:     :.          :::* *:*         

A0A355DU96      LANTVGLSEVIVHQTQFEFAVREVM---DNLDVLPSGVIPPNSL-ALLNSKRMASLVEYF
A0A1Q8BLE0      ETNLPGLTSVLVGGETIASAIRQTRV--PGLNILPSGPLPPNPA-ELLGSAQMTALLDKL
A0A2T2S1W0      YANAVGLSNLLVGESSLEQACHPAS---EGLDLLTAGQVPPNPV-ALLDSQRLATLLQQW
A0A5B8NQW4      EPNSMGLSNLLVDQSDVSTVTKELH---PNLELLTVGAPPPNPI-ALLDSQRIADFIDKC
A0A2T1EZA0      VEQGDGLSTLLSDSSRKPTDFIHSIA--ENMDVLPAGPKPPDPA-KLLNSSRCKEIMEEI
A0A1U7JBN8      HANRQGLSDLITQPLDDPMDLVQVIPGNPNLHLLTAGARPPAPG-RLLSSRKMQQIAEQY
A0A2W4VXF4      QRNHQGLSELITQGLENPTDLVLAIPGNPNLHLLTAGARPPPPG-RLLSSRKMQQITEQY
A0A2W7AI98      QRNHQGLSELITQGLENPTDLVLTIPGNPNLHLLTAGARPPPPG-RLLSSRKMQQITEQY
A0A4R4INQ3      LSNERGLSTLLTEEADVRERDCIQSVQ-PSLDVLTAGPTPTDIV-KLLSSQRMKHLIETF
L8M1L4          ISNEQGLSEVIS-DNKHSWTEVVQNVT-GNLDVITAGANVANPI-ALLRSQIMSELLKEW
A0A4P5VLH9      LANGEGFSTILT-NSSVPLKSLIQPIQ-DNLDILPAGPKPPDPA-KLLNSTRAQEVVNEI
A0A2W6ZN45      VDNVKGLSDYLG-DTDDNIQDYIKPIT-SNLSLITAGSRAPDPA-RLLNSLRCSDMVQHL
A0A081GP61      VEPGDGFSTLLS-DSSRKTTDLIQTIA-ENMDVLPAGPKPPDPA-KLLNSSRCKEIMDEI
K9P6R9          VEQGDGLSTLLS-DSTRKPTDFIHSIA-ENMDVLPAGPKPPDPA-KLLNSSRCKEIMEEI
A0A0A2B4S6      LDNLIGFSNLLIDSSDNYKKYIQSVPTQDNFDVITSGSIPPDPT-RLLGSDSMKKFIETI
K9SGV8          LPNENGLSDLLTGQSPLSEVAHHVM---PTLEVMPAGSKPANPVALLNSQATSNL---ID
B0CA08          LGNQEGLTHILLNKHFNYHQELPTHKVADNLEIITAGRISSNPLP-MLESEQFANFVQVQ
B0BZC6          LPQDPGLQDYLRGSVKEGLPAAIHRTSVKNLSVMTSGKFSYDNVFSFETQRAKELFTEVQ
A0A1D8TTM0      WDR----------YAMSEVPSTPVQIR-PGLDLLSL-RPDEDKIAEFVARGSFEECLSAA
A0A563VX16      ISNGVGLSDLLDGVTSVPTVQEISRAG-STISVLTSGSATSDPV-KLLSSGRLQNLIAHF
A0A0V7ZGW0      HVM----------HPQSNDLPQPMQIS-PGLDILPTAPNQNNKVMEFVARGGFEKYLNTI
A0A355DPN1      LPNEQGLATLLVEDSSIPSPQRLSLSG-SEIDVLTAGPIPPDPV-KLLSSQRMRQLMAGF
A0A0V7ZMP6      YY----------GQSIGDLQLRPINVF-ENVDLLAM-RVPEERIAEFVARGGFEQRLNAI
A0A4V2X515      KHR--------IAIAANANPPTPVSIH-PGLDLLPAMSIPKQKIPEFFARGSFERNIKAM
A0A433W046      KNR--------IKSAANASPPMPVSVS-PGFDLLPALSIPKQKIPEFFARGSFERNIKAL
K9TU02          KNR--------IKSAANASPPMPVSVS-PGFDLLPALSIPKQKIPEFFARGSFERNIKAL
A0A2T1FMA8      KNR--------IKSAANASPPMPVSVS-PGFDLLPALSIPKQKIPEFFARGSFERNIKAL
A0A2P8QV10      KNR--------IKSAANASPPMPVSVS-PGFDLLPALSIPKQKIPEFFARGSFERNIKAL
B8HQ70          DRY---------QGSWNPRETAVVPLS-PGLDLMPAPAIPNDRIVNYVAKGGFEQQLQTL
A0A2S6V636      QPQ---------K-KLKDGQPSPVSVC-LGLDLLPAPALSKGKIPEFFARGSFQQYLDQI
A0A1D9G3S3      HDH---------D-PLKPGQ--PVKIQ-PSLDLLPT-SHKKGKIVELVTQGKFEQSLATA
A0A1D8TWE6      HHH---------D-PLKPGQ--PVKIQ-PSLDLLPT-SHKKGKIVELVTQGKFEHSLATA
A0A1U7N3U5      HHH---------D-PLKPGQ--PVKIQ-PSLDLLPT-SHKKGKIVELVTQGKFEQSLATA
A0A1B7WWU1      IHNLLGLSNILAGQTQLKNAV-QEVS--PLVKMLPAGKIPPNPV-TLLDSQCMADLVEEA
A0A2T1CC83      VDNQKGLKDIVVDNVSPLSVI-RQPM--PKLSLLTSGMVESNPL-AILDSPKMSDFIGRS
A0A2N6LHT1      LAPRPGITDVIDSERSLEETVQRTNI--PNLSVLTCGELYRLPS-HLLESEAMKSLLIEA
A0A328V843      LTNAVGLSDVLVEEATLSEAV-KPGI--DQLDILTAGVTPPNPL-ALLDSRRMTSLIRNF
A0A0D6KL48      QNNLVGLSNILVGQTELQTTS-KEAL--MTLDIITAGTIPPNPA-ALLNSQRIATFIKEA
A0A2T1DKP1      LVSTIGLSNVIVEQFVPDVAI-QEVA--PNLYALPSGIIPPNPI-ALLDSKRMASLVEGF
                                              .  :.                         

A0A355DU96      SQK--YDFVIFDTPPLV-LTADAMTLGKMTDGILLVARPKVVDRVSATASKEFLLRS-GQ
A0A1Q8BLE0      SEN--YDLLILDTPPLL-AASDAAIVSRIVDGALVVVRAGRTERSALQTAVQQLATV-GA
A0A2T2S1W0      RQA--YDYVLLDVPPLQ-AATDAVIVGKLTDGTLLVVRPGVAECDAVEASRDTLARL-QQ
A0A5B8NQW4      RQA--YDYVLIDTPPMA-VGADSALLGKLAEGTLLVVRPNMADLTSATGAKEMLQRS-GQ
A0A2T1EZA0      RALPGYDIIIVDAPPCL-MLADPILLGEKLDGILFLVGLGKVSRELAPQASRRIRAS-GV
A0A1U7JBN8      RCH--FDLIILDTPPLAGGMVDAKLAAAHADGLLLVARLNRSERTEIQRVLADLGNTVQA
A0A2W4VXF4      RRH--YDLIIFDTPPLA-GMIDAKLTAAHADGLLLVVRLNQSERSEIQRVLADLGNTAQA
A0A2W7AI98      RRH--YDLIIFDTPPLA-GMIDAKLTAAHADGLLLVVRLNRSERSEIQRVLADLGNTAQA
A0A4R4INQ3      ER--TYDLVLVDAPPVL-GLADASIIASLCSGTVVVERLDRVTRSDLTQSLEAL--S-KL
L8M1L4          EA--AYDYVLIDTPPIG-AMADAQSLVHQVDGVMLVTGINKVNQKAIVNTLEVLQSS-NC
A0A4P5VLH9      RALTEYDMVLFDAPPCL-MLSDPILLGEKLDGILFLVGLGKVSRELAPQACRRIKAT-GV
A0A2W6ZN45      RALPGYDLIIFDTPPCL-LLSDPVILGEKVDGILYLVGLGRVGREIAPQAIKRIKAT-GV
A0A081GP61      RALPGYDIIIVDAPPCL-MLADPILLGEKLDGILFLVGLGKVSRELAPQASRRIKAT-GV
K9P6R9          RALPGYDIIIVDAPPCL-MLADPILLGEKLDGILFLVGLGKVSRELAPQASRRIRAS-GV
A0A0A2B4S6      RSENKYDYVILDTSPIL-SISDSTLIAQYCDSLLMVVSLNNVDMDLPLLAKNKLKKT-NR
K9SGV8          YGSSNYDVMIVDTPPMA-VAADASILGKIADGIVMLCRVGVADTNNLTFSKELLEQS-GQ
B0CA08          IEH--YDYILIDAPPLV-SVADPLIIGKVVDGILLVARPGHLEREYAQKAHELLIHS-NL
B0BZC6          QH---YDVIVIDTPPVM-ACSDALVLSQEGRQTVVVARLDVTPKQVLNRSIDILNSN-NV
A0A1D8TTM0      QGSGHYDYILIDSAPVS-LTSEAALMASVVPNVLLVVWLGKSNRNPFRDTLEQLMRH-RA
A0A563VX16      EKT--YDLVLIDTPPAI-GMVDAIKIASSCSGTVVVARLEKANFAELMETYGLLGRI-N-
A0A0V7ZGW0      QTNGNYDYVIVDTAPVT-STSETALMAKVIANVLPVIRLGISDRYMVQETIEQLMRH-NA
A0A355DPN1      EQS--YDLILVDTPPIL-GMVDALQAASFCNGVVIVGRISRVTQSELTEAIAMLSHL-NA
A0A0V7ZMP6      KNSAQYDYILVDSPPVA-LTSEAAIIGKIIHNILFVVRTGISSRNCFHDSVEQLKRY-RA
A0A4V2X515      RDSGGYDYVLIDSPPVG-LASETNLMSAVVCNVLFVLRSGTSDRYPVMNSLEQLTRY-NA
A0A433W046      RESGGYDYVLVDSPPVG-LASETNLMSAVVCNVLFVLRSGTSDRYPVMNSLEQLTRY-NA
K9TU02          RESGGYDYVLVDSPPVG-LASETNLMSAVVCNVLFVLRSGTSDRYPVMNSLEQLTRY-NA
A0A2T1FMA8      RESGGYDYVLVDSPPVG-LASETNLMSAVVCNVLFVLRSGTSDRYPVMNSLEQLTRY-NA
A0A2P8QV10      RESGGYDYVLVDSPPVG-LASETNLMSAVVCNVLFVLRSGTSDRYPVMNSLEQLTRY-NA
B8HQ70          QQSGEYDYVLVDTAPIT-LTSETGLMTTSVNNLLFVVRPGTSSRYSVLDSFEELSLR-KV
A0A2S6V636      QADGGYDYVLVDSPPIG-LASETNLMSSVVRNVLFVVRSGKSDRYAVMDGFEQLAQH-HA
A0A1D9G3S3      EESGDYDYVLIDSAPVS-MTSETALMAAVIRNLLFVVRPEISKRDFVSDSLEQLAQH-NA
A0A1D8TWE6      EASGDYDYVLIDSAPVS-MTSETALMAAVIPNLLFVVRPEISKRDFVSDSLEQLAQH-NA
A0A1U7N3U5      EESGDYDYVLIDSAPVS-MTSETALMAAVIRNLLFVVRPEISKRDFVSDSLEQLAQH-NA
A0A1B7WWU1      SKD--YDFVIIDTPPLT-AVTDPLIVGKYVDGLLLVVRPGKVEYSAVNAAKSLLTQA-KL
A0A2T1CC83      RRE--YDLILIDVPPLP-VTADVLTVSKLVDGILFVTRPGIVEHESAELAQEALATT-GQ
A0A2N6LHT1      VRQ--YEFVVIDTPPLS-ACADAHTLGRQSDGIILVTRPGFTIKEVLQRAVSELTHN-QI
A0A328V843      SEE--YDFVIIDTPPLL-LAADALTLANMASGVLMVARPRILDRDSAKAAKEILGRS-GQ
A0A0D6KL48      TQE--YDFVIIDCPPLT-LVADALMLSKLVDGILLVVRPGVANTGSVNATKMLLEQS-GH
A0A2T1DKP1      ARD--YDLIIFDTPPLA-GKADAAILGKMTDGILLVVRPGIIDSASANAAKEFLKQS-GQ
                     :: ::.* .*      :           : :                 :      

A0A355DU96      QVLGLVIN--------------GVSVEGEPDSYFHHAKAYYKEELITSTIPDSKTKKNHI
A0A1Q8BLE0      RVLGTVLN--------------DPDAEVPKYARYYG---YYYNNYYDYSNATEYSN----
A0A2T2S1W0      PVVGMVAN--------------GVNPRNERSSYYHY---YNYG--------NNNGGPPRQ
A0A5B8NQW4      PVLGMVIN--------------GVNPSDEPDSYYYY---YAQGYYYETKEEEESGKKALF
A0A2T1EZA0      DVLGIICNQV------------NFP-SRLNDYGYEYGYYYHYAYASASGYAKSASE----
A0A1U7JBN8      PLLGLVVN--------------GVPHSRQSGYDYYYGYYGRPRVAAGIED-G--------
A0A2W4VXF4      PLLGLVIN--------------GVPQSRQRGYS-YYGYYGRPAVASGIDERG--------
A0A2W7AI98      PLLGLVIN--------------GVPQIRQRGYS-YYGYYGRPVVASGIDERG--------
A0A4R4INQ3      NVIGAIINDS------------K---------------ECNSRYTVYDGSTQNYLERGFT
L8M1L4          NLIGFIANMV------------E----KDLDY-YSYSYYSHYYNQPSNGNGNGNGN----
A0A4P5VLH9      DVLGLICNQV------------NFP-SRLNDYGYEYGYYYHYAYANDSGSSSTYGKNGEG
A0A2W6ZN45      DILGLMCNQV------------AYP-TRLNDYGYEYGYHYNYSYAG--------------
A0A081GP61      DVLGIICNQV------------NFP-SRLNDYGYEYGYYYHYAYASASGYAKSANQ----
K9P6R9          DVLGIICNQV------------NFP-SRLNDYGYEYGYYYHYAYASASGYAKSASE----
A0A0A2B4S6      PLIGFVSNQIKKPKTFSKNRYYGYS-NYSNNYGYNSNYISYYADNKIRDKFTKRNLTFEN
K9SGV8          NILGMVVN--------------ASL-PEDDPYGYYYSYYYNYSSKPGQRQRQEASRQDQD
B0CA08          SVLGTVIN--------------GIL-NKNELYSYYSRY---------GHNSNQEKTAIKR
B0BZC6          NVVGLAIN--------------GVT-ASTDKYYRYLKE---------DYALAA-------
A0A1D8TTM0      QILGLVVN--------------GVD-TQPEGYL--YGH---------KIAEVSS------
A0A563VX16      -VLGMVAN--------------DSR-EVQQRYA---KN---------KRYLPSAEV----
A0A0V7ZGW0      NIIGLALN--------------GIE-QRSEGYI--YKH---------DSSQVNS------
A0A355DPN1      --IGIVAN--------------GAN-GSTNRYIAYAEQ---------NGSPLFQLN----
A0A0V7ZMP6      EVIGLTVN--------------DVD-SHNEKYIYSYNV---------NQQIQ--------
A0A4V2X515      RIMGLVVN--------------GSD-SQTAVYRYGYGR---------QRELLENEA----
A0A433W046      RIMGLVVN--------------GSD-SHTSVYRYGYGR---------QRELLEHEA----
K9TU02          RIMGLVVN--------------GSD-SHTSVYRYGYGR---------QRELLEHEA----
A0A2T1FMA8      RIMGLVVN--------------GSD-SHTSVYRYGYGR---------QRELLEHEA----
A0A2P8QV10      RIMGLVVN--------------GSD-SHTSVYRYGYGR---------QRELLEHEA----
B8HQ70          NVVGVTIN--------------GIE-TNSEEYY--YGK---------QRELAATEL----
A0A2S6V636      QIMGLVVN--------------YVE-PKDVGYR--YGR---------QRELIETEA----
A0A1D9G3S3      QLLGLVVN--------------GVE-TKSKPYL--YRS---------SDSLVKS------
A0A1D8TWE6      QLLGLVVN--------------GVE-TKSKPYL--YRS---------SDSLVKS------
A0A1U7N3U5      QLLGLVVN--------------GVE-TKSKPYL--YRS---------SDSLVKS------
A0A1B7WWU1      PILGMVVN--------------GIVKE--------SGYGGYYYSSGYYGGKGERN-----
A0A2T1CC83      KILGMVVN--------------GVKANEFDRYSYHGRYGKKYFEKGNVQYESQNNLNGSQ
A0A2N6LHT1      PIMGVVVN--------------GITDQ--------TERYYRYAVNSYEPL----------
A0A328V843      RILGTVIN--------------GISKN--------ESTKYFYHAQRYFPLQKSHRRD---
A0A0D6KL48      QVLGMVAN--------------GVTPE--------SSYGGYYAKSYYGAKQSHKN-----
A0A2T1DKP1      NVLGMVIN--------------GVDVR--------SEPDSYF---YHTRERGKRNVAALD
                  :*   *                                                    

A0A355DU96      RF----------------------------------------------------------
A0A1Q8BLE0      --------------GNGAKA----------------------------------------
A0A2T2S1W0      GWRRWLPGNPFARNGKGSQ-----------------------------------------
A0A5B8NQW4      GFGR----------GKSNQS----------------------------------------
A0A2T1EZA0      --PSTGGFGSYVQRYRDSYMKGAATNSYISARYNEGESDVKTYFREDEDQATAPVATNGG
A0A1U7JBN8      ------------------------------------------------------------
A0A2W4VXF4      ------------------------------------------------------------
A0A2W7AI98      ------------------------------------------------------------
A0A4R4INQ3      TNPNLAGKGIF-------------------------------------------------
L8M1L4          ------------------------------------------------------------
A0A4P5VLH9      LGRYARDVGNLVRGYRDSYVT--------DRYISDGSSAAVQRYHEEGVSRELRQSKLKS
A0A2W6ZN45      --------------YRDTYSQRLASKDVAEALPDN-----------------------PS
A0A081GP61      -GKSYGGFGSYVQRYRDSYMKGAPSNAYFNAHQQNGDLDVRSYYQQEDGSGASAATRPPS
K9P6R9          --PSTGGFGSYVQRYRDSYMKGAATNSYISARYNEGESDVKTYFREDEDQASVPVA---T
A0A0A2B4S6      SKDNFLISKIKKFRNKVLDFISWLDR----------------------------------
K9SGV8          QNQQETINQ---------------------------------------------------
B0CA08          NLLKQVISK---------------------------------------------------
B0BZC6          ------------------------------------------------------------
A0A1D8TTM0      ------------------------------------------------------------
A0A563VX16      ------------------------------------------------------------
A0A0V7ZGW0      ------------------------------------------------------------
A0A355DPN1      ------------------------------------------------------------
A0A0V7ZMP6      ------------------------------------------------------------
A0A4V2X515      ------------------------------------------------------------
A0A433W046      ------------------------------------------------------------
K9TU02          ------------------------------------------------------------
A0A2T1FMA8      ------------------------------------------------------------
A0A2P8QV10      ------------------------------------------------------------
B8HQ70          ------------------------------------------------------------
A0A2S6V636      ------------------------------------------------------------
A0A1D9G3S3      ------------------------------------------------------------
A0A1D8TWE6      ------------------------------------------------------------
A0A1U7N3U5      ------------------------------------------------------------
A0A1B7WWU1      -------KQNAEASVR--------------------------------------------
A0A2T1CC83      NLSNMPEGNNANSSVSRAKL----------------------------------------
A0A2N6LHT1      -----SSRRLSRGSSA--------------------------------------------
A0A328V843      ---RSAPPKISSRSSS--------------------------------------------
A0A0D6KL48      ---GKVDASISKIRIL--------------------------------------------
A0A2T1DKP1      TITDSIPTEVER------------------------------------------------
                                                                            

A0A355DU96      ------------------------------------------------------
A0A1Q8BLE0      ------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------
A0A5B8NQW4      ------------------------------------------------------
A0A2T1EZA0      IGPSASSTSPLPPADSVPSRRHRPSREGGGGPMGWLRRRFGNRG----------
A0A1U7JBN8      ------------------------------------------------------
A0A2W4VXF4      ------------------------------------------------------
A0A2W7AI98      ------------------------------------------------------
A0A4R4INQ3      ------------------------------------------------------
L8M1L4          GNGNGNGNGNGNGNREAGSMNSIMQQFRRR------------------------
A0A4P5VLH9      GNGNDANQVNGTEPSDQANHPKG-------------------------------
A0A2W6ZN45      DQAQSSAASGSAAKPDSNQSGSSGGLNRLKG-----------WFRR--------
A0A081GP61      EDSKGSGVSIRSSLPDSGRESTGSHAGDSQGVRKGASQGPIGWLRQRFGRGSQR
K9P6R9          NGGIGPSAGSSSSLPPAESVPSRRHRPSREG-----GDGPMGWLRRRFGNRG--
A0A0A2B4S6      ------------------------------------------------------
K9SGV8          ------------------------------------------------------
B0CA08          ------------------------------------------------------
B0BZC6          ------------------------------------------------------
A0A1D8TTM0      ------------------------------------------------------
A0A563VX16      ------------------------------------------------------
A0A0V7ZGW0      ------------------------------------------------------
A0A355DPN1      ------------------------------------------------------
A0A0V7ZMP6      ------------------------------------------------------
A0A4V2X515      ------------------------------------------------------
A0A433W046      ------------------------------------------------------
K9TU02          ------------------------------------------------------
A0A2T1FMA8      ------------------------------------------------------
A0A2P8QV10      ------------------------------------------------------
B8HQ70          ------------------------------------------------------
A0A2S6V636      ------------------------------------------------------
A0A1D9G3S3      ------------------------------------------------------
A0A1D8TWE6      ------------------------------------------------------
A0A1U7N3U5      ------------------------------------------------------
A0A1B7WWU1      ------------------------------------------------------
A0A2T1CC83      ------------------------------------------------------
A0A2N6LHT1      ------------------------------------------------------
A0A328V843      ------------------------------------------------------
A0A0D6KL48      ------------------------------------------------------
A0A2T1DKP1      ------------------------------------------------------
                                                                      

© 1998-2020Legal notice