BYKdb

Dataset for cluster orphancd of phylum cyanobacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

61 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A355DU96      ------------------------------------------------------------
A0A2N6LHT1      ------------------------------------------------------------
A0A328V843      ------------------------------------------------------------
A0A2T1DKP1      ------------------------------------------------------------
A0A0D6KL48      ------------------------------------------------------------
A0A6M0AN00      ------------------------------------------------------------
A0A6P0ITZ8      ------------------------------------------------------------
A0A6P0SLN0      ------------------------------------------------------------
A0A2T1CC83      ------------------------------------------------------------
A0A1B7WWU1      ------------------------------------------------------------
A0A6P0S1R8      ------------------------------------------------------------
A0A0A2B4S6      ------------------------------------------------------------
K9SGV8          ------------------------------------------------------------
B0CA08          ------------------------------------------------------------
B0BZC6          ------------------------------------------------------------
A0A6G3Z709      ------------------------------------------------------------
A0A6P0M090      ------------------------------------------------------------
A0A563VX16      ------------------------------------------------------------
A0A0V7ZGW0      ------------------------------------------------------------
A0A355DPN1      ------------------------------------------------------------
A0A6J4NIB3      ------------------------------------------------------------
A0A6M0AB25      ------------------------------------------------------------
A0A1D8TTM0      ------------------------------------------------------------
A0A6P0VB93      ------------------------------------------------------------
A0A6P0W0Y0      ------------------------------------------------------------
A0A0V7ZMP6      ------------------------------------------------------------
A0A433W046      ------------------------------------------------------------
K9TU02          ------------------------------------------------------------
A0A2T1FMA8      ------------------------------------------------------------
A0A2P8QV10      ------------------------------------------------------------
B8HQ70          ------------------------------------------------------------
A0A2S6V636      ------------------------------------------------------------
A0A6P0IXR4      ------------------------------------------------------------
A0A1D9G3S3      ------------------------------------------------------------
A0A6P0KRF3      ------------------------------------------------------------
A0A6P0LQ61      ------------------------------------------------------------
A0A1D8TWE6      ------------------------------------------------------------
A0A6L9YP52      ------------------------------------------------------------
A0A6P0L3X9      ------------------------------------------------------------
A0A6M0A6X4      ------------------------------------------------------------
A0A1U7N3U5      ------------------------------------------------------------
A0A6L9ZB93      ------------------------------------------------------------
A0A6P0S980      ------------------------------------------------------------
A0A2T1EZA0      MFWEEKPPKDINRITTIDARVKGHSLRVAIIIGSTFPAVHNVTTTGAPPEAFPGGTARPL
A0A1U7JBN8      ----------------------------------------------MPF---PPSSTHEI
A0A2W4VXF4      ----------------------------------------------MPFSSKPAAREVNG
A0A2W7AI98      ----------------------------------------------MPFSSKPAAREVNG
A0A6G3Z347      ------------------------------------------------------------
A0A2P8QVH5      ------------------------------------------------------------
A0A2T1FT70      ------------------------------------------------------------
A0A433W4W4      ------------------------------------------------------------
K9U5W1          ------------------------------------------------------------
L8M1L4          ------------------------------------------------------------
A0A4P5VLH9      ------------------------------------------------------------
A0A2W6ZN45      -----------------------------------------------MLTEAGSPTPHSP
A0A081GP61      ----------------------------------MGGFPPSGAAGRFQAPYPDQPLQSPL
K9P6R9          ------------------------------------------------------------
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
A0A5B8NQW4      ------------------------------------------------------------
A0A6P0XUL2      ------------------------------------------------------------
                                                                            

A0A355DU96      ------------------------------------------------------------
A0A2N6LHT1      ------------------------------------------------------------
A0A328V843      ------------------------------------------------------------
A0A2T1DKP1      ------------------------------------------------------------
A0A0D6KL48      ------------------------------------------------------------
A0A6M0AN00      ------------------------------------------------------------
A0A6P0ITZ8      ------------------------------------------------------------
A0A6P0SLN0      ------------------------------------------------------------
A0A2T1CC83      ------------------------------------------------------------
A0A1B7WWU1      ------------------------------------------------------------
A0A6P0S1R8      ------------------------------------------------------------
A0A0A2B4S6      ------------------------------------------------------------
K9SGV8          -------------------------------MNQLQQYLFIIRRRWPVATLVFVSAVLVT
B0CA08          ----------------------------------MSNYWLMLKRRG-LPAGFTFLTVLSL
B0BZC6          -----------------------------MNESVSKVIKIIYRNRW-TTVGTFLSVFTGI
A0A6G3Z709      ------------------------------------------------------------
A0A6P0M090      ----------------------------------IDQLRPLVDA----------------
A0A563VX16      -----------MEQRIENYMNQNVYDLDNSTELGYGEIFSIFWRRR-SYFIGICGGVLAC
A0A0V7ZGW0      -----------------------------------MKVSAIIQRLW-LPLLGLNGVIVGS
A0A355DPN1      -------------------------------------------------MLGVFCGVLAI
A0A6J4NIB3      ------------------------------------------------------------
A0A6M0AB25      ------------------------------------------------------------
A0A1D8TTM0      ----------------------------------MNRLIAIAIRHW-KPVIGLNIVLSAI
A0A6P0VB93      ----------------------------------MNRFVAIALRHW-KPVLGLNIVLFAI
A0A6P0W0Y0      ----------------------------------MNRFVAIALRHW-KPVLGLNIVLFAI
A0A0V7ZMP6      ----------------------------------MKKATKIAVRHW-KFVLAWNKIILGI
A0A433W046      ----------------------------------MKQIFSIARKHW-LPLLGFNTAVLAA
K9TU02          ----------------------------------MKQIFSIARKHW-LPLLGFNTAVLAA
A0A2T1FMA8      ----------------------------------MKQIFSIARKHW-LPLLGFNTAVLAA
A0A2P8QV10      ----------------------------------MKQIFSIARKHW-LPLLGFNSAVLAA
B8HQ70          ----------------------------------MFQITSTLRRHW-KPLIALNTVLIGS
A0A2S6V636      ----------------------------------MNHIVNIIRRHW-MPLLLLNGVVLAA
A0A6P0IXR4      ------------------------------------------------------------
A0A1D9G3S3      ----------------------------------MKKVAAILNRHW-TILLVFNSLVLGA
A0A6P0KRF3      ----------------------------------MKKVAAILNRHW-TLLLVFNSLVLGA
A0A6P0LQ61      ----------------------------------MKKVAAILNRHW-TLLLVFNSLVLGA
A0A1D8TWE6      ----------------------------------MKKVAGILNRHW-TFLLVFNSLVLGA
A0A6L9YP52      ----------------------------------MKKVAAILNRHW-TLLLVFNSLVLGG
A0A6P0L3X9      ----------------------------------MKKVAAILNRHW-TILLVFNLLVLGA
A0A6M0A6X4      ----------------------------------MKKVAAILNRHW-TLLLVFNSLVLGA
A0A1U7N3U5      ----------------------------------MKKVAAILNRHW-TILLVFNSLVLAA
A0A6L9ZB93      ----------------------------------MKKVAAILNRHW-TILLVFNSLVLAA
A0A6P0S980      ----------------------------------MKKVAAILNRHW-TILLVFNSLVLAA
A0A2T1EZA0      SLPGTGASGPGLFDPSSQQSPLSPMGESQSGGGGLGGIVRTVKRR--QSIFLITFALVTG
A0A1U7JBN8      NGNGHGHAKPGFMTVMAPPS-LV----EQRDEVDFNQLVGVFRRR--AGIFFGVAAL---
A0A2W4VXF4      NGNGQGHASQSFVPVTAPPSPLI----DDGDDFDLNHLVAVLGRR--AGIFWGVAAL---
A0A2W7AI98      NGNGQGHASQSFVPVTAPPSPLI----DDGDDFDLNHLVAVLGRR--AGIFGGVAAL---
A0A6G3Z347      ---MTSELQSPPANMLAPAP-------AQEGGLKLGRFASALKRN--ILLIAGITTL---
A0A2P8QVH5      --MADTSLDNERLSVEHRVE-------NRANATDLRQLFTVLLRR--RLLILSLFCI---
A0A2T1FT70      --MADTSLDNERLSVEHRVE-------NRANATDLRQLFTVLLRR--RLLILSLFCI---
A0A433W4W4      --MADTSLDNERLSVEHRVE-------NRANATDLRQLFTVLLRR--RLLILSLFCI---
K9U5W1          --MADTSLDNERLSVEHRVE-------NRANATDLRQLFTVLLRR--RLLILSLFCI---
L8M1L4          --MNNTIVRSDFVNLPAQET-------GFSLSDFKQILYRRWKPA--LALGIMAFGVVL-
A0A4P5VLH9      ------------------------------------------------------------
A0A2W6ZN45      FGTGSTQVAASALSPTANQP-------DDASTNVLFKLIRSLKRR--QALFLFVFFVTTA
A0A081GP61      TPTAEAQAGSGGLG----------------------GLVRTIRRR--QTVFLLTFAVVTG
K9P6R9          --MGETQSGGGGLG----------------------GLVRTVKRR--QSIFLITFAVVTG
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
A0A5B8NQW4      ------------------------------------------------------------
A0A6P0XUL2      ------------------------------------------------------------
                                                                            

A0A355DU96      ------------------------------------------------------------
A0A2N6LHT1      ------------------------------------------------------------
A0A328V843      ------------------------------------------------------------
A0A2T1DKP1      ------------------------------------------------------------
A0A0D6KL48      ------------------------------------------------------------
A0A6M0AN00      ------------------------------------------------------------
A0A6P0ITZ8      ------------------------------------------------------------
A0A6P0SLN0      ------------------------------------------------------------
A0A2T1CC83      ------------------------------------------------------------
A0A1B7WWU1      ------------------------------------------------------------
A0A6P0S1R8      ------------------------------------------------------------
A0A0A2B4S6      --------------------MLISDPLNNNKNNSANSIGGVFEQL-ALNST--DNDLPTL
K9SGV8          TFHAIFVMK----PRYRASGEMLVTPGDQAIAITNVGVSKTVNQP-RSLS---GGYLNTE
B0CA08          ALLQAFQEK----PIYEAVGQLKFEESQRSSKLIGLDSAVDDESR-QQSSLRWQRSLDTE
B0BZC6          VVYLLITPR-----LYSAKVRLILDQRPATSISPLGRDIAQTPGD-N------NKGLATQ
A0A6G3Z709      ------------------------------------------------------------
A0A6P0M090      -----------------------------------------------------QNPLSTE
A0A563VX16      MIPLVLTQK----PVYRSSMQMLVEPNYEDKDNR----GDFDPIE-SSIEIDYATQLNLM
A0A0V7ZGW0      VIMIATFSQ----KTWTANAQLILPDTTTNLDASLGTLGQLKEQG-VAFTNE-LNPLKVL
A0A355DPN1      AIPIALNKE----PTYQSSMQLLIEPYVQQKQE-----GKPQTEE-QFTDSNVEVDYATQ
A0A6J4NIB3      ------------------------------------------------------------
A0A6M0AB25      ------------------------------------------------------------
A0A1D8TTM0      ALYNASKVT----EVWAARAKLIIPKSSSDLNANLGTLGDFRDRG-VSFSQQ-VNPLNNL
A0A6P0VB93      ALYSASKVT----EVWAARAKLILPQSSSALNANLGTLGDIKNTG-IAFSQQ-VNPLKNL
A0A6P0W0Y0      ALYSASKVT----EVWAARAKLILPQSSSALNANLGTLGDIKNTG-IAFSQQ-VNPLKNL
A0A0V7ZMP6      AVANIALLP----RVWISKSLLILPTSTSNVDADLDNSDDLKTKE-VGFSQQ-VNPLNVI
A0A433W046      TIYAAFYASTSIPPVWTANAKLNLPQ-TGGLSANLGPLGSTQTTA-LNFKD--VSPLDVQ
K9TU02          TIYAAFYASTSIPPVWTANAKLNLPQ-TGGLSANLGPLGSTQTTA-LNFKD--VSPLDVQ
A0A2T1FMA8      TIYAAFYASTSIPPVWTANAKLNLPQ-TGGLSANLGPLGSTQTTA-LNFKD--VSPLDVQ
A0A2P8QV10      TIYAAFYASTSIPPVWTANAKLNLPQ-TGGLSANLGPLGSTQTTA-LNFKD--VSPLDVQ
B8HQ70          TALIAAFYP----RTWQASARFVVPINTNQLSADIGTLGQLRPGD-GVVPSDLMNPVTLQ
A0A2S6V636      TLYSVIYTKTNVAPVWKATAKLNLPQPTTRLDTNLGTLGQIQNTA-LGFTRE-LNPLQIQ
A0A6P0IXR4      ------------------------------------------------------------
A0A1D9G3S3      SFGAFSLLK----PFWIAKAQLILPE-TGKLQASLGTLGSLTKGD-SKLATK-SHPLNMQ
A0A6P0KRF3      SFGAFSLLK----PFWIAKAQLILPE-TGKLQASLGTLGSLTKGD-SKLATK-SHPLNMQ
A0A6P0LQ61      SFGAFSLLK----PFWIAKAQLILPE-TGKLQASLGTLGSLTKGD-SKLATK-SHPLNMQ
A0A1D8TWE6      SFGAFSLLK----PFWIAKAQLILPE-TGKLQASLGTLGSLTKGD-SKLATK-SHPLNMQ
A0A6L9YP52      SFGAFSLLK----PFWIAKAQLILPE-TGKLQASLGTLGSLTKGD-SKLATK-SHPLNMQ
A0A6P0L3X9      SFGAFSLLK----PFWIAKAQLILPE-TGKLQASLGTLGSLTKGD-SKLATK-SHPLNMQ
A0A6M0A6X4      SFGAFSLLK----PFWIAKAQLILPE-TGKLQASLGTLGSLTKGD-SKLATK-SHPLNMQ
A0A1U7N3U5      SFGAFSLLK----PFWIAKAQLILPE-TGKLQASLGTLGSLTKGD-SKLATK-SHPLNMQ
A0A6L9ZB93      SFGAFSLLK----PFWIAKAQLILPE-TGKLQASLGTLGSLTKGD-SKLATK-SHPLNMQ
A0A6P0S980      SFGAFSLLK----PFWIAKAQLILPE-TGKLQASLGTLGSLTKGD-SKLATK-SHPLNMQ
A0A2T1EZA0      VLAINTLRQRIFSPVYQGGFQMQISNPFDNP-GTGGGGGGSVESI-ARSEI--KTDVPSL
A0A1U7JBN8      SLAGFTLWHLSRPPAYSGSASLLVEPVT----AVNTPGLETVTGA-PSP-SGSGLDYTSQ
A0A2W4VXF4      SFGGLTLWHLTRPPVYNGSANLLVEPVT----VVNTPGLEAVMEL-PGARSASGLDYTSQ
A0A2W7AI98      SFGGLTLWHLTRPPVYNGSANLLVEPVT----VVNTPGLEAVMEL-PGARSASGLDYTSQ
A0A6G3Z347      TASAAVFKAITDTPTYESSLELLTPPITL---ETQIISTLNPEALSNQSEVVNVAIDETK
A0A2P8QVH5      PLSASSFLALMAKPTYQSSMQLLVSSNLYQGQNSNAQGGVEESDF-TDSNL--KVDYTAQ
A0A2T1FT70      PLSASSFLALMAKPTYQSSMQLLVSSNLYQGQNSNAQGGVEESDF-TDSNL--KVDYTAQ
A0A433W4W4      PLSASSFLALMAKPTYQSSMQLLVSSNLYQGQNSNAQGGVEESDF-TDSNL--KVDYTAQ
K9U5W1          PLSASSFLALMAKPTYQSSMQLLVSSNLYQGQNSNAQGGVEESDF-TDSNL--KVDYTAQ
L8M1L4          ------IPKLLSTPQYRSEAKILLKSP-----QNQQSAEVQLNALNSRRNYYNLKDLSTD
A0A4P5VLH9      -------------------------------MEASRGGESKLETI-ARQTQ--KNDVPSL
A0A2W6ZN45      LLAANALRQRIVAPVYIGGFQMLITDPLANVGPS-TPSSGVVESL-AKTTSLGNSDVPTL
A0A081GP61      ALAINTLRQRIFSPVYQGGFQMQISNPFED--KNGGGGGGSVEAI-ARTPL--KPDVPSL
K9P6R9          VLAINTLRQRIFSPVYQGGFQMQISNPFDNPGSGGGGGGGSVETI-ARSEI--KTDVPSL
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
A0A5B8NQW4      ------------------------------------------------------------
A0A6P0XUL2      ------------------------------------------------------------
                                                                            

A0A355DU96      ------------------------------------------------------------
A0A2N6LHT1      ------------------------------------------------------------
A0A328V843      ------------------------------------------------------------
A0A2T1DKP1      ------------------------------------------------------------
A0A0D6KL48      ------------------------------------------------------------
A0A6M0AN00      ------------------------------------------------------------
A0A6P0ITZ8      ------------------------------------------------------------
A0A6P0SLN0      ------------------------------------------------------------
A0A2T1CC83      ------------------------------------------------------------
A0A1B7WWU1      ------------------------------------------------------------
A0A6P0S1R8      ------------------------------------------------------------
A0A0A2B4S6      IELLKSPILLNPISKD----------YGIPFNKFSKSLKISTPGGLRT--QSMAQ-----
K9SGV8          MQIMRSKEVIQRALEI--------VERPISYGEFLGSFGVN---------VIPGT-----
B0CA08          ILTMKSPRRLSMLALA---IESQGLFSRPSVEQIKSGLDIS---------QFDET-----
B0BZC6          EELVRSKSVLTKAIVLFNQSNQDSAIEKVTLGEVKPEVATE---------VIPGT-----
A0A6G3Z709      ---MEPRTLLGKVDAK----------------------------------PISGT-----
A0A6P0M090      VEVIYSHPLLQQIIDQLNLTDNEGLPLEPE--ALKKKLTVK---------IVGGT-----
A0A563VX16      RSSQLLGRAVVKLRPS---YPDITT-EEIQ--NYLVVSQVR----EQEDKKEVGT-----
A0A0V7ZGW0      TSIITSDDAIRPVLLS---DPEKDKFRSLS--SYKKLFKVK---------PTDQS-----
A0A355DPN1      LNLMRSSQLIQKAVDR---LHPKYPEIQVT--DIKESFSLTGVQEEDTDIKDTQT-----
A0A6J4NIB3      -------------HAV---DPERPLYSSLG--SYRRLFEVT---------PQELS-----
A0A6M0AB25      ---MTSNDTISQVWEF---DPEKSLYPRLS--EYKSLFDVS---------PEGES-----
A0A1D8TTM0      SSIMTSNDTISQVWEF---DPEKSLYPRLS--GYKSLFDVS---------PEGES-----
A0A6P0VB93      SSIMTSNDAISQIWES---DPEKALYPRLS--EYKSLFDVS---------PEGES-----
A0A6P0W0Y0      SSIMTSNDAISQIWES---DPEKALYPRLS--EYKSLFDVS---------PEGES-----
A0A0V7ZMP6      SSIATSDNVLKKVWEQ---DPQKTSYKQLS--EYRGLFDVS---------PENDS-----
A0A433W046      LAILTSDAVMKRVQAV---DPEKSLYSKVS--SFSQLFVVT---------PQPAT-----
K9TU02          LAILTSDAVMKRVQAV---DPEKSLYSKVS--SFSQLFVVT---------PQPAT-----
A0A2T1FMA8      LAILTSDAVMKRVQAV---DPEKSLYSKVS--SFSQLFVVT---------PQPAT-----
A0A2P8QV10      LAILTSDAVMKRVQAV---DPEKSLYSKVS--SFSQLFVVT---------PQPAT-----
B8HQ70          AEIVKSPTLIGQVLAV---DPER-DQHTLQ--SFMPLFEAK---------PQSLS-----
A0A2S6V636      MAILMSDTVMERTLAV---DPEKSLFPRLS--DYKLAFSAT---------PQEQS-----
A0A6P0IXR4      ------------------------------------------------------------
A0A1D9G3S3      ASILTSDALMRRLLES---DPEKTDFQRLV--QYKKLFAVS---------PDQES-----
A0A6P0KRF3      ASILTSDALMRRLLES---DPEKTDFQRLV--QYKKLFAIS---------PDQES-----
A0A6P0LQ61      ASILTSDALMRRLLES---DPEKTDFQRLV--QYKKLFAIS---------PDQES-----
A0A1D8TWE6      ASILTSDALMSRLLES---DLEKTDFQRLV--QYKKLFAIS---------PDQES-----
A0A6L9YP52      ASILTSDALMRRLLES---DPEKTDFQRLV--QYKKLFAVS---------PDQES-----
A0A6P0L3X9      ASILNSDALMRRLLES---DPEKTDFKRLV--QYKKLFAVS---------PDEES-----
A0A6M0A6X4      ASILTSDALMRRLLES---DPEKTDFQRLV--QYKKLFAVS---------PDQES-----
A0A1U7N3U5      ASILNSDALMRRLLES---DPEKTDFQRLV--QYKKLFAVS---------PDQES-----
A0A6L9ZB93      ASILNSDALMRRLLES---DPEKTDFQRLV--QYKKLFAVS---------PDQES-----
A0A6P0S980      ASILNSDALMRRLLES---DPEKTDFQRLV--QYKKLFAVS---------PDQES-----
A0A2T1EZA0      IVLMRSPLLLGPVAQR----------QGVPLRALESNLSIN---------QESAR-----
A0A1U7JBN8      IRVLRGPAVINPILAK-----IQQRYPDITYNSLLNGLNIV---------QEGES-----
A0A2W4VXF4      IRVLRGPDVIKPILVN-----IQRQHPEITYTTLLNDLVIS---------QEGES-----
A0A2W7AI98      IRVLRGPDVIKPILVN-----IQRQHPEITYTTLLNDLVIS---------QEGES-----
A0A6G3Z347      LKILKSPRVMEPIVVR-----LQERYLDIDYGEVVGSLDIY---------PTSTG-----
A0A2P8QVH5      LSVMTSPKLVERAVEL-----LRPEYPNITVEEINGKPAKV---------KQSPLKVTQV
A0A2T1FT70      LSVMTSPKLVERAVEL-----LRPEYPNITVEEINGKPAKV---------KQSPLKVTQV
A0A433W4W4      LSVMTSPKLVERAVEL-----LRPEYPNITVEEINGKPAKV---------KQSPLKVTQV
K9U5W1          LSVMTSPKLVERAVEL-----LRPEYPNITVEEINGKPAKV---------KQSPLKVTQV
L8M1L4          ILVLKSYSLINKAIEK-----YPETFSGLSAAEVRTKLNIF---------PAMINDIPT-
A0A4P5VLH9      IVLMRSPLLVKPVADR----------MGVSINDLISNLSIA---------P-AGN--VE-
A0A2W6ZN45      IQLLTSPVVLKPIAEA----------QAIPLGSLIGSLAIG---------STRAD--SQ-
A0A081GP61      IVLMRSPLLLGPVAQR----------QGVPLDLLAANLSIN---------PESAA--VE-
K9P6R9          IVLMRSPLLLGPVAQR----------QGVSLGALESNLSIN---------QESAQ--VE-
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
A0A5B8NQW4      ------------------------------------------------------------
A0A6P0XUL2      ------------------------------------------------------------
                                                                            

A0A355DU96      ------------------------------------------------------------
A0A2N6LHT1      ------------------------------------------------------------
A0A328V843      ------------------------------------------------------------
A0A2T1DKP1      ------------------------------------------------------------
A0A0D6KL48      ------------------------------------------------------------
A0A6M0AN00      ------------------------------------------------------------
A0A6P0ITZ8      ------------------------------------------------------------
A0A6P0SLN0      ------------------------------------------------------------
A0A2T1CC83      ------------------------------------------------------------
A0A1B7WWU1      ------------------------------------------------------------
A0A6P0S1R8      ------------------------------------------------------------
A0A0A2B4S6      -----------GVLRISFKGENPRIVNSMLVSISKAYLKSALDQKQQRLSDGLIFLNNQS
K9SGV8          -----------DVLRFSYTSGDPKLAVEAANSMMQSYAENNIERNRAAVRAARLFIEEQL
B0CA08          -----------NVVQIRFKSYNREFPKNIVNLLMQQYVDNTPKSKQASTQSAISFIEKQL
B0BZC6          -----------QIIEITFRHTDPGVTSSLLNLIASSVIQENAETIRSEARATRQFLENQI
A0A6G3Z709      -----------DVMRITVRSEDPQEAADIANQVIDSYRRQNIDSNREEAAAARLFIEDQL
A0A6P0M090      -----------DVVRLSYKGKNSEKGAAVINQLMRLYIENQILSKKSEAAKAREFITNQL
A0A563VX16      -----------KIFQAVYKDEDAEKTQRVLEAIQEVYLEYNLEQQDKRLREGLSFINQEI
A0A0V7ZGW0      -----------TNIQLQVTASEPELAKQRAKRLIESYQERLNELRQGTANAREQFTQRQL
A0A355DPN1      -----------KIVKVVYTSNDPIKTQDVLAAIQTVYQDYNLQQQQVRLTEGLAFINDQL
A0A6J4NIB3      -----------TLLLVEAEGSSPELARFRAATVIEFYQQRLNELRRNDADVREKFARLEL
A0A6M0AB25      -----------TIISLSAEGSTPELARQRTAALIGAFQQRLNELRLDDAVQRSQFMRKEL
A0A1D8TTM0      -----------TIISLSAEGSTPELARQRTAALIEAFQQRLNELRLDDAVQRSQFMRKEL
A0A6P0VB93      -----------TVISLSAEGSTPELARQRTAALIETFQQRLNELRQDDAVQRSQFTQKEL
A0A6P0W0Y0      -----------TVISLSAEGSTPELARQRTAALIETFQQRLNELRQDDAVQRSQFTQKEL
A0A0V7ZMP6      -----------TVISLSVEGSTPKLATERAQNLIASLKERLQELRQDRVISQSEFIQDEV
A0A433W046      -----------TLIEVEAQGSRPDIAYKRLFTFLEVYQQRLNELRRKDAEVRVQYTQEEL
K9TU02          -----------TLIEVEAQGSRPDIAYKRLFTFLEVYQQRLNELRRKDAEVRVQYTQEEL
A0A2T1FMA8      -----------TLIEVEAQGSRPDIAYKRLFTFLEVYQQRLNELRRKDAEVRVQYTQEEL
A0A2P8QV10      -----------TLIEVEAQGSRPDLAYKRLFTFLEVYQQRLNELRRKDAEVRVQYTQEEL
B8HQ70          -----------PLMTVEVKGTTPELAHQRLSTWIKLYQKRLTYLRENDASTRQTLPQQEL
A0A2S6V636      -----------TIINLQVKASSPDIAQRRLSNLINIYQLRLNELRHQDTNVRKQFSQTDL
A0A6P0IXR4      ------------------------------------------------------------
A0A1D9G3S3      -----------TTIWLNASGDSPELARDRVKALISAYQERLNELRQADGTTRVEFNKKAL
A0A6P0KRF3      -----------TTIWLNASGDSPELARDRVKALISAYQERLNELRQADGTTRVEFNKKAL
A0A6P0LQ61      -----------TTIWLNASGDSPELARDRVRALISAYQERLNELRQADGTTRVEFNKKAL
A0A1D8TWE6      -----------TTIWLNARGDSPELARDRVKALISAYQDRLNELRQADGSTRVEFNKKAL
A0A6L9YP52      -----------TTIWLNASGDSPELARDRVRALISAYQERLNELRQADGTTRVEFNKKAL
A0A6P0L3X9      -----------TTIWLNATGDSPKLARDRVKALISAYQERLNELRQADGTTRVEFNKKAL
A0A6M0A6X4      -----------TTIWLNATGDSPELARDRVKALISAYQERLNELRQADGTTRVEFNKKAL
A0A1U7N3U5      -----------TTIWLNATGDSPKLARDRVKALISAYQERLNELRQADGTTRVEFNKKAL
A0A6L9ZB93      -----------TTIWLNATGDSPKLARDRVKALISAYQERLNELRQADGTTRVEFNKKAL
A0A6P0S980      -----------TTIWLNATGDSPKLARDRVKALISAYQERLNELRQADGTTRVEFNKKAL
A0A2T1EZA0      ---------VDNVLNVSLRWPDPAKGKAILRQLAKDYTSFSLTQRQAAVNSGVRFLDEQA
A0A1U7JBN8      -----------KVLRISYSNADPAVAAFVLNQVVEGFVNYSVQDRQGDLRRGLTFLDEQL
A0A2W4VXF4      -----------KVLRISYSDADPEVVTTVMSEVVKGFVAYSVQDRQGELRRGLEFLDEQL
A0A2W7AI98      -----------KVLRISYRDADPEVVTTVMSEVVEGFVAYSVQDRQGELRRGLEFLDEQL
A0A6G3Z347      -----------DTLTVQYKGVDAEKVLYVLEVVAEFYLKFSLEDRQNDIFRGIDFVDEQL
A0A2P8QVH5      ESGTKTLQTLSQVFEVTFVAGDPIKSQKVLQALQNVYQIYNLEQQKLRLTNGLAFVNEQL
A0A2T1FT70      ESGTKTLQTLSQVFEVTFVAGDPIKSQKVLQALQNVYQIYNLEQQKLRLTNGLAFVNEQL
A0A433W4W4      ESGTKTLQTLSQVFEVTFVAGDPIKSQKVLQALQNVYQIYNLEQQKLRLTNGLAFVNEQL
K9U5W1          ESGTKTLQTLSQVFEVTFVAGDPIKSQKVLQALQNVYQIYNLEQQKLRLTNGLAFVNEQL
L8M1L4          -----------DILNISFVDSAPEVAQGVLDALSEVYVEYSLERERSQALNAIQFIEEQL
A0A4P5VLH9      -----------EVLNVNLRWRDPAKGRLILNELSKDYTKFSKSQRESTLNSGVEFLEQQA
A0A2W6ZN45      -----------GVLNIQLRWSDPVQGRKILTALADSYPKYALIQRQEKLGQGLEFLGQQA
A0A081GP61      -----------NVLNISLRWPDPVKGKAILRQLAKDYTAFSLTQRQAAVNSGVRFLDQQA
K9P6R9          -----------NVLNVSLSWPDPAKGKAILRQLAKDYTAFSLTQRQAAVNSGVRFLDEQA
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
A0A5B8NQW4      ------------------------------------------------------------
A0A6P0XUL2      ------------------------------------------------------------
                                                                            

A0A355DU96      ------------------------------------------------------------
A0A2N6LHT1      ----KQLQEAEQKENRYRQSSGIVSFDE-QTKSLVESLATLEEQENTLSAQLQELRSKEA
A0A328V843      --------------QYFKQRNYVVDLGT-EFAISVQEMAQLNRNITTLEAELNAVQSLVN
A0A2T1DKP1      ------------------------------------------------------------
A0A0D6KL48      ------------------------------------------------------------
A0A6M0AN00      ------------------------------------------------------------
A0A6P0ITZ8      ------------------------------------------------------------
A0A6P0SLN0      ------------------------------------------------------------
A0A2T1CC83      ------------------------------------------------------------
A0A1B7WWU1      ------------------------------------------------------------
A0A6P0S1R8      ------------------------------------------------------------
A0A0A2B4S6      PKLEGKNKQVQKELSDFRERNQLIEPTV-EGQELKTRLDYLENELDNIKNERVKLNNLLN
K9SGV8          PKAEQDVENAEQQLRAFREQYNFVSASA-EAEATIDRFRSTESRIEDMQVSLAKIDAQSD
B0CA08          PQVKQRVNSAETALRKFKETYQIADLEI-AKSANATNLSQLQTALDEIDRELVEVQTQQL
B0BZC6          PRRQQELVKVESSISQFKQQYNIVSLEETDNKRLTQSIAEAEKVAEEISANLRQVQARGL
A0A6G3Z709      PETEKEVLRVEEALRQFKETNDIISLDQ-EASNAVSVLSNLDQEITQLQARLADLDAQSA
A0A6P0M090      PQSEANVRQAEAALRQFKERNQVVSLTE-EARSLVAVMADLDSQITTVQAQLEEANAQAA
A0A563VX16      PEVRQKLTNAERNLEVMLTRYNLIAPQT-EAIDISKLLTNTRQQREELKAQYKQTQSKYE
A0A0V7ZGW0      KDAERNLQLVKSKLAQFKKSTGFVSDEE-QTKNLVTAINTLRTTQTDVLAQAKATATRSQ
A0A355DPN1      PTARDNVIQAEKALEQFRETQNLIDPVQ-QATTITDALSTVEQEQQAIRAQYQETQARYR
A0A6J4NIB3      EDSRKNLLQAQKALTQFQEATGIVDRDA-QTEGLVEAINNLKNTQATVLAEARSNETQAK
A0A6M0AB25      EQAAENLRQAQAALAAFKASSNLVSAED-QTREMVTAINTLTTEQAQVLAQAQASKAQVE
A0A1D8TTM0      EQAAENLRQTQAALVAFKASSNLVSAED-QTREMVTAINTLTTEQAQVLAQAQASKAQVE
A0A6P0VB93      QQAVENLRQAQAALASFKASSNLVSAED-QTREMVVAINTLTTEQAQLVAQAQASKAQVE
A0A6P0W0Y0      QQAVENLRQAQAALASFKASSNLVSAED-QTREMVVAINTLTTEQAQLVAQAQASKAQVE
A0A0V7ZMP6      RQAHRKLMDAQKKLNKFKEAGNVISDEH-DAKQKVITINALNKSRVEALAEAKAAQAQTR
A0A433W046      EQARLNLNQAQANLSNFQRSTGLVNSPE-QSGGLISAINNLKTTQATLIAQGQANATQAQ
K9TU02          EQARLNLNQAQANLSNFQRSTGLVNSPE-QSGGLISAINNLKTTQATLIAQGQANATQAQ
A0A2T1FMA8      EQARLNLNQAQANLSNFQRSTGLVNSPE-QSGGLISAINNLKTTQATLIAQGQANATQAQ
A0A2P8QV10      EQARLNLNQAQANLSNFQRSTGLVDSPE-QSKGLISAINNLKTTQATLIAQGQANATQAQ
B8HQ70          QEASNNLRRTQTQLSVFRQANNITDINE-QIRGLVNSISDLKTEYARALAQAQASNAQQQ
A0A2S6V636      EEAQAQLAKAQAELASFQQATGLTEVAE-QTRALIAQQRELRTTYTNVLSQAQANQAQAQ
A0A6P0IXR4      ------------------------------------------------------------
A0A1D9G3S3      ERAKQKLDQSQEALAKFQESSGLVNSKA-QTEGLVRAITDLSISQAQAQAEAQASQHQLQ
A0A6P0KRF3      ERAKQKLDQSQEALAKFQESSGLVNSKA-QTEGLVRAITDLSISQAQAQAEAQASQHQLQ
A0A6P0LQ61      ERAKQKLDQSQEALAKFQESSGLVNSKA-QTEGLVRAITDLSISQAQAQAEAQASQHQLQ
A0A1D8TWE6      ERAKQKLDQSQEALAKFQESSGLVNSKA-QTEGLVRAITDLSISQAQAQAQAQASQHQLQ
A0A6L9YP52      ERAKQKLDQSQEALAKFQESSGLVNSKA-QTEGLVRAITDLSISQAQAQAQAQASQHQLQ
A0A6P0L3X9      ERAKQKLDQSQEALAKFQESSGLVNSKA-QTEGLVRAITDLSISQAQAQAQAQASQHQLQ
A0A6M0A6X4      ERAKQKLDQSQEGLAKFQESSGLVNSKA-QTEGLVRAITDLSISQAQAQAQAQASQHQLQ
A0A1U7N3U5      ERAKQKLDQSQEALAKFQESSGLVNSKA-QTEGLVRAITDLSISQAQAQAQAQASQHQLQ
A0A6L9ZB93      ERAKQKLDQSQEALAKFQESSGLVNSKA-QTEGLVRAITDLSISQAQAQAQAQASQHQLQ
A0A6P0S980      ERAKQKLDQSQEALAKFQESSGLVNSKA-QTEGLVRAITDLSISQAQAQAQAQASQHQLQ
A0A2T1EZA0      PAIEERVQKLSQEMLKFRERNNFVDPAA-AAGQILGAREGLVNQLRTLQNEQVQLDSQLK
A0A1U7JBN8      QEKWQEVAAIEGDLSEFQKRYDLVDVNA-TSESVTQRLNQMLADQEQLRVELSALAPLYE
A0A2W4VXF4      QEKWQEVDTIESDLSEFQKRYDLVNVTT-TAESVAQRLNQMLSDQEQLRVQLTSLGPLYE
A0A2W7AI98      QEKWQEVDTIESDLSEFQKRYDLVNVTT-TAESVAQRLNQMLSDQEQLRVQLTSLGPLYE
A0A6G3Z347      PIVRDRVEQLEAELEGLRQRSNLIDPLQ-QGEQLSQKAAEFTAEQLNLRVQIQEAEQLSQ
A0A2P8QVH5      PKIRKDVSQAEANLENFRKQNKLLDPEV-QAKNLLDALAAVESERRTIRAQFQDQQARYN
A0A2T1FT70      PKIRKDVSQAEANLENFRKQNKLLDPEV-QAKNLLDALAAVESERRTIRAQFQDQQARYN
A0A433W4W4      PKIRKDVSQAEANLENFRKQNKLLDPEV-QAKNLLDALAAVESERRTIRAQFQDQQARYN
K9U5W1          PKIRKDVSQAEANLENFRKQNKLLDPEV-QAKNLLDALAAVESERRTIRAQFQDQQARYN
L8M1L4          PKAEEELNKAAFAIRSFRQKNNLVDPDE-YVGRVADFRQSLEEELKRGEIALDIAQTKYR
A0A4P5VLH9      PRLRNNVTKLEAQLLDFRQKYNVLDPSG-LAEKIVSNRDDLVAKSMALQVEHNDLKSKLA
A0A2W6ZN45      PALQQRVNSLQRTLKQFRESNSFLEPLA-QGGSIISSRDGLLGQLRTLQVEQAELETQLA
A0A081GP61      PAIEARVQKLSNEMLRFRERNNFVDPAT-AAGQILGARDGLVNQLRDLQNEQVQLDSQLQ
K9P6R9          PAIEERVQKLSQEMLKFRQRNNFVDPAT-AAGQILGAREGLVNQLRTLQNEQVQLDSQLK
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
A0A5B8NQW4      ------------------------------------------------------------
A0A6P0XUL2      ------------------------------------------------------------
                                                                            

A0A355DU96      ------------------------------------------------------------
A0A2N6LHT1      SLQQVT--DAKALNQAYAAVRGGQDE------------------------ELKALR----
A0A328V843      SLGNQV--GLN-LEEAIAVNTLSQSP------------------------VVRAAL----
A0A2T1DKP1      ------------------------------------------------------------
A0A0D6KL48      --------MKLNTDTAVELTTLSQSP------------------------GVQQVL----
A0A6M0AN00      EAVQQK--LARSPQNALTSSRLSQSG------------------------RYQNLL----
A0A6P0ITZ8      ------------------------------------------------------------
A0A6P0SLN0      ------------------------------------------------------------
A0A2T1CC83      ------------------------------------------------------------
A0A1B7WWU1      ------------------------------------------------------------
A0A6P0S1R8      ------------------------------------------------------------
A0A0A2B4S6      SIENGSLTAYGFKQAITTDLNLNERI------------------------PTEGVSFINL
K9SGV8          QLGNLVADEIDSVEQALLRTALSQSP------------------------HTAGVM----
B0CA08          SLQNML--KVNP-QQAI----LGIST------------------------AHKNIS----
B0BZC6          ALSKVI--DQSSGKESYLSAKAGQNP------------------------ELISLR----
A0A6G3Z709      RIQGQL--GLNV-SEGLALSSLNQSD------------------------GVQESL----
A0A6P0M090      GLRNQV--GLNP-QQAIAISALSQST------------------------SVQGVL----
A0A563VX16      SLEQQL--ATTG-NVDSVDSRLSLSS------------------------RYQNLL----
A0A0V7ZGW0      ELSRTL--GMAP-QQAINSLRLSENK------------------------EYQALR----
A0A355DPN1      VLQQQL--ERSP-QEALTSSRLSQSP------------------------RYQALL----
A0A6J4NIB3      AVAARL--STTP-QQAMNSLSLSENK------------------------EYQAIR----
A0A6M0AB25      TLSARL--ELNP-EQAIRSLSLGENQ------------------------DYQFFR----
A0A1D8TTM0      TLSARL--ELNP-QQAIRSLSLGENQ------------------------DYQFFR----
A0A6P0VB93      TLSARL--ELNP-EQAIRSLNLGENQ------------------------DYQFFR----
A0A6P0W0Y0      TLSARL--ELNP-EQAIRSLNLGENQ------------------------DYQFFR----
A0A0V7ZMP6      ILSARL--SLPP-QTALKSLQTKGTE------------------------TSLSIR----
A0A433W046      AAAVSL--GITP-QQAMNSLRLGENK------------------------EYQATR----
K9TU02          AAAVSL--GITP-QQAMNSLRLGENK------------------------EYQATR----
A0A2T1FMA8      AAAVSL--GITP-QQAMNSLRLGENK------------------------EYQATR----
A0A2P8QV10      AAAVSL--GITP-QQAMNSLRLGENK------------------------EYQATR----
B8HQ70          ALSQHL--RLTP-QAAMTTLRLGENK------------------------EYQLVR----
A0A2S6V636      AASERL--GINA-QQAMNSLRLGENR------------------------EYQAIR----
A0A6P0IXR4      ------------------------------------------------------------
A0A1D9G3S3      ILSTRL--GLTP-KQAIRSLGLAENR------------------------DYQFVR----
A0A6P0KRF3      ILSTRL--GLTP-KQAIRSLGLAENR------------------------DYQFVR----
A0A6P0LQ61      ILSTRL--GLTP-KQAIRSLGLAENR------------------------DYQFVR----
A0A1D8TWE6      ILSTRL--GLTP-KQAIRSLGLAENR------------------------DYQFVR----
A0A6L9YP52      ILSTRL--GLTP-KQAIRSLGLAENR------------------------DYQFVR----
A0A6P0L3X9      ILSTRL--GLTP-KQAIRSLGLAENR------------------------DYQFVR----
A0A6M0A6X4      ILSTRL--GLTP-KQAIRSLGLAENR------------------------DYQFVR----
A0A1U7N3U5      ILSTRL--GLTP-KQAIRSLGLAENR------------------------DYQFVR----
A0A6L9ZB93      ILSTRL--GLTP-KQAIRSLGLAENR------------------------DYQFVR----
A0A6P0S980      ILSTRL--GLTP-KQAIRSLGLAENR------------------------DYQFVR----
A0A2T1EZA0      SIQTGKLQFTPSGAP-TALEQLGRNS---------VLVPGRGDSAAEAASGTKTPL----
A0A1U7JBN8      NLRE---QVGFDPNTAIRVANLNESP------------------------TYQALL----
A0A2W4VXF4      NLRS---QVGFEPSVAIGVANLNESP------------------------TYQGLL----
A0A2W7AI98      NLRS---QVGFEPSVAIGVANLNESP------------------------TYQGLL----
A0A6G3Z347      NLQRELLE----GEESAVTSALLESE------------------------RYQNLL----
A0A2P8QVH5      KLQQ---QISRSPQQALIASRLSQSP------------------------RYQSLL----
A0A2T1FT70      KLQQ---QISRSPQQALIASRLSQSP------------------------RYQSLL----
A0A433W4W4      KLQQ---QISRSPQQALIASRLSQSP------------------------RYQSLL----
K9U5W1          KLQQ---QISRSPQQALIASRLSQSP------------------------RYQSLL----
L8M1L4          TISNQLIELGQDPETIVTTSVLGQDG------------------------VYQSLA----
A0A4P5VLH9      SVQSGRLNWTPSGAP-TPIQQLGRQG-------TVIPGRSDANDSNEIGAGQTTPN----
A0A2W6ZN45      SVRSGKLITLPSPGS-SGSGVVGQGSPAAGNPQLGLATRPRADSVAPSSNTVVTPQ----
A0A081GP61      SIQSGKLQFSSSGAP-TAIQQLGRNS-------VLVPGRANQNQGAEVAKGTPTPL----
K9P6R9          SIQTGKLQFTPSGAP-TALEQLGRNS-------VLVPGRG--NSAAEASSGTKTPL----
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
A0A5B8NQW4      ------------------------------------------------------------
A0A6P0XUL2      ------------------------------------------------------------
                                                                            

A0A355DU96      ------------------------------------------------------------
A0A2N6LHT1      -----NKLAEIETQLVQARLSLTDNHPTVINLLGQRNGLRALYQQGLARVS---------
A0A328V843      -----QELENVEGELAQEQRRFRDENPRIISLKGKRDNLENLLQREIQVYL---------
A0A2T1DKP1      ----------------VEQTRYRSGHPAIANLERKVDALNALLQERIGQVV---------
A0A0D6KL48      -----TEYQKVQDELAVARTRLTEDNPKIINLENQAVALKNQLEGRVAQTI---------
A0A6M0AN00      -----NEIQRIELALVEQSRIYTEAHPTIQKLIEQRQSVFALLQEETRRVL---------
A0A6P0ITZ8      ------------------------------------------------------------
A0A6P0SLN0      ----------------------------MQALLEQREELQNQIKGYI-------------
A0A2T1CC83      ------------------------------------------------------------
A0A1B7WWU1      ------------------------------------------------------------
A0A6P0S1R8      -------------------------------------------QGQIEGYI---------
A0A0A2B4S6      DLELLDQYILVKQKLAIARTKYLEDSEIVKGLKYRVEQIEPTLKSNQ-------------
K9SGV8          -----GELQQTKQAIATQLAIYREDSPQIAVLRDQERNLEQLLRQRAKQVA---------
B0CA08          -----TSLEEIDKDLAEAKSNFREDHPAVLELLERQAQLKQLLSQKI--EK---------
B0BZC6          -----DQLSNLESQLKIRRESLTDDHPDIQKLITEKDAAQALYQQKL--AT---------
A0A6G3Z709      -----SELQNIQAELAEERSRYREGHPAIDMLERREAEAEALLGSRIQEVL---------
A0A6P0M090      -----QELQEVERQLAVGRNRYGKNHPVMIRLTKHQRSLRGHLQQQIDQIL---------
A0A563VX16      -----NELQRIDIELETQRSRFTDSNPIVQGLLTERRQKQQLLEKEA--GN---------
A0A0V7ZGW0      -----QKLTEVNTEIAVNRGTLTEEHPTVRALLQQRQKLLMALNRQL--NA---------
A0A355DPN1      -----NELQKTELAIAQQRVKFTDAEPRVEQLLEQRQRQLALLQEET--QR---------
A0A6J4NIB3      -----EEVSLVETALSQARGKFTEQSPQVQALLLQRQELRRDLNQRL--AK---------
A0A6M0AB25      -----QELSEVEALLTETQAKFTDGHPQVQALLEQRQDLQDQIERYI--FQ---------
A0A1D8TTM0      -----QELSEVEALLTETQAKFTNENPQVQALLEQREELQNQIEGYI--FQ---------
A0A6P0VB93      -----RELSKIEALLTQTQAKFTDEHPQVKALLEQREELQGQIEGYI--TQ---------
A0A6P0W0Y0      -----RELSKIEALLTQTQAKFTDEHPQVKALLEQREELQGQIEGYI--AL---------
A0A0V7ZMP6      -----EKLSKVNISLQEAQTYLTDNHPRIENLKFQQEELRNELQED---RV---------
A0A433W046      -----TQLSQLESTMAVTRSKYRDDSPQVQSLLQQRQQLLRQLNQQI--AV---------
K9TU02          -----TQLSQLESTMAVTRSKYRDDSPQVQSLLQQRQQLLRQLNQQI--AV---------
A0A2T1FMA8      -----TQLSQLESTMAVTRSKYRDDSPQVQSLLQQRQQLLRQLNQQI--AV---------
A0A2P8QV10      -----TQLSQLESTMAVTRSKYRDDSPQVQSLLQQRQQLLRQLNQQI--AV---------
B8HQ70          -----DRLAQVEADLATARGTLTDDNPRVQDLLEQRQKLTQLLDQNL--RA---------
A0A2S6V636      -----QKLSDAETALAEARSRYTDESPQVQSLLSQRQELMQLLNQQI--AI---------
A0A6P0IXR4      -----------------------------QNLLLQREQLQQQIQQYI--FL---------
A0A1D9G3S3      -----QQLTELEATLVKAQATYTYAHPEIQNLLLQREQLQQQIQQYI--FL---------
A0A6P0KRF3      -----QQLTELEATLVKAQATYTYAHPEIQNLLLQREQLQQQIQQYI--FL---------
A0A6P0LQ61      -----QQLTELEATLVKAQATYTYAHPEIQNLLLQREQLQQQIQQYI--FL---------
A0A1D8TWE6      -----QQLTELEATLVKAQTTYTYAHPEIQNLLLQREQLQQQIQQYI--FL---------
A0A6L9YP52      -----QQLTELEATLVKAQTTYTYAHPEIQNLLLQREQLQQQIQQYI--FL---------
A0A6P0L3X9      -----QQLTELEATLVKAQTTYTYAHPEIQNLLLQREQLQQQIQQYI--FL---------
A0A6M0A6X4      -----QQLTELEATLVKAQTTYTYAHPEVQNLLLQREELQQQIQQYI--FL---------
A0A1U7N3U5      -----QQLTELEATLVKAQTTYTYAHPEIQNLLLQREELQQQIQQYI--FL---------
A0A6L9ZB93      -----QQLTELEATLVKAQTTYTYAHPEIQNLLLQREELQQQIQQYI--FL---------
A0A6P0S980      -----QQLTELEGTLVKAQTTYTYAHPEIQNLLLQREQLQQQIQQYI--FL---------
A0A2T1EZA0      -----DLLNQFEQELATAKGTFKENSPIVQSLLARRNQLLPVVQRQAADAV---------
A0A1U7JBN8      -----GDLREIEQTIAAESARFQADTPMIEALTDQRQQLLPLLEAEAQRLV---------
A0A2W4VXF4      -----GDLREIEQTIAAESARFQSDTPMIEVLVDQRQQLLPLLEAEAGRLV---------
A0A2W7AI98      -----GDLREIEQTIAAESARFQSDTPMIEVLVDQRQQLLPLLEAEAGRLV---------
A0A6G3Z347      -----NQMLELDGQLAEELTLYLEDSPEIEVIREQRENLQPLLQREGIRVQ---------
A0A2P8QVH5      -----DEIQALDVTLEKLRVQYRDDYPKVQDLLKQRQNLIGLLRTEAGRSA---------
A0A2T1FT70      -----DEIQALDVTLEKLRVQYRDDYPKVQDLLKQRQNLIGLLRTEAGRSA---------
A0A433W4W4      -----DEIQALDVTLEKLRVQYRDDYPKVQDLLKQRQNLIGLLRTEAGRSA---------
K9U5W1          -----DEIQALDVTLEKLRVQYRDDYPKVQDLLKQRQNLIGLLRTEAGRSA---------
L8M1L4          -----SQLKDLETQYTLASVQFKDNYPMMQDLKLQREQLRNLLLERSTQILGEGISPAVL
A0A4P5VLH9      -----ETLDEFEQKLANARAVYKDDSPIVQSILAQRDAILPVVRKQATDAI---------
A0A2W6ZN45      -----QQLSQLDQQIATARATFKSDSPQLQTLLAQRNRIKPLVQSQGIDQL---------
A0A081GP61      -----DLLNQFEQELATAKGTYKQNSPIVQSLLARRNQLLPVVQRQASDAV---------
K9P6R9          -----DLLNQFEQELATAKGTFKENSPIVQSLLARRNQLLPVVQRQAADAV---------
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
A0A5B8NQW4      ------------------------------------------------------------
A0A6P0XUL2      ------------------------------------------------------------
                                                                            

A0A355DU96      ------------------------------------------------------------
A0A2N6LHT1      --PRNQSISSGSV----------AGDQISQDLTSQLIINDVERLALENKLKVVQTNRANL
A0A328V843      --GSSRPFSRGLL----------RVMDVKNNKIEEFVNAEIRRLDLTKQLDSLYEARDGL
A0A2T1DKP1      --SNGGPVPTGNL----------QLGDLQQGLISDLVRSEAERVGLSERLSSLSNAQSAY
A0A0D6KL48      --GNSEYMPEQNL----------QIGNLKQTLTENLVKSEVERLALTNQVAELKQVLLVN
A0A6M0AN00      --GQ---VPTQLVTTGNNLLTEGQLGGVDINLVNELITSQINLVSLQTRDQALIKTEQEI
A0A6P0ITZ8      --------------------------------SSRFILSETERSALEQKLYLVQTERIKL
A0A6P0SLN0      ---FQARAAQPGVNAT--------IGQESAALIRQLILAESQTQAYYSQGKQIQTQIDQL
A0A2T1CC83      -------------------------------------------------VGALYNSQQDL
A0A1B7WWU1      ----------------------------------------------TKQVEELQRVFIFN
A0A6P0S1R8      ---ALAQADEAEVNAT--------IGQESAALIEQLILAESQTQAYYSQSKQIQIQIDQL
A0A0A2B4S6      -----------------------------------ISALISAREIIDKNIQNAKIKIKSL
K9SGV8          ---GIPPSESIDIDAL------FQIGGLQEQSVQQFYSLDNERVGLLEEISALNDVYSNY
B0CA08          ---FAQSDAQLNFDSN-----------QEDDLRSQLIQLDIRRNGLSKQQLKLRQQLSSY
B0BZC6          ---ISPRSRLNSDGTV-----QVANEKVTQELSEKLVLSVVERNELRDKLANTRAYISKL
A0A6G3Z709      ---G----RELTVPVEDLNVGRLQLGELRQNLIAELTRLEVERIGVNNRMAQLTNSRNSF
A0A6P0M090      ---GSQSLAGTQIQIT---EGLLEVDELKQKLISDFIESEVKRRSLAEGLATLAKARIAY
A0A563VX16      ---I-LGSTNLQVSSSDNLESRGQLDSSNLELAEALASTRNELIGLESRERSLALTEQKL
A0A0V7ZGW0      ---VVPSADG--IDAN---FGGNNFKDATIELIAQLIQVESESKGLQQQVLIIQNKLERL
A0A355DPN1      ---VLGETSTQIAFSTQNLLTEGQLGSNDLTLSSQLAEAQTTLQALQARDRSLAITQQQL
A0A6J4NIB3      ---AIPGVKAETVDIT---LGGGNGKDSRVEMISKMIGAQTLAQGLQQQANQLANQEAKL
A0A6M0AB25      ---A--RAAQSGVNAT---IG-----QESAALIRQLILAESQTQAYYSQGKQIQTQIDQL
A0A1D8TTM0      ---A--RAAQPGVNAT---IG-----QESAALIRELILAESQTQAYYSQGKQIQTQIDQL
A0A6P0VB93      ---A--QADEAEVNAT---IG-----QESAALIEQLILAESQTQAYYSQSKQIQIQIDQL
A0A6P0W0Y0      ---A--QADEAEVNAT---IG-----QESAALIEQLILAESQTQAYYSQSKQIQIQIDQL
A0A0V7ZMP6      ---SDNSVSSVAINPN---L-------ADRHIVHKLILAESQAEAMSSKAQQLQIQINYL
A0A433W046      ---AIPGANAAQIDTT---L-GNGPNDSRLELMVELIRNQTLAQGTQQQAKQIQKQIDKL
K9TU02          ---AIPGANAAQIDTT---L-GNGPNDSRLELMVELIRNQTLAQGTQQQAKQIQKQIDKL
A0A2T1FMA8      ---AIPGANAAQIDTT---L-GNGPNDSRLELMVELIRNQTLAQGTQQQAKQIQKQIDKL
A0A2P8QV10      ---AIPGARPAQIDTT---L-GNGPNDSRLELMVELIRNQTLAQGAQQQAKQIQKQVDKL
B8HQ70          ---AIGNSSLAGVDRS---LAGSAAGDSRIALIADLIRTQSTANGQQSQAQQLQQQLGQQ
A0A2S6V636      ---AAPGASANQIDPT---LGGNGTRDSRIEMIAELIRAQNNAAGLQQQANQIASEINRV
A0A6P0IXR4      ---A---AGDTLVDPT---L--TDSAQGRAMLIQQLILAESAASGQQQQAEQLQQQIDQM
A0A1D9G3S3      ---A---AGDTLVDPT---L--TDSAQGRAMLIQQLILAESAASGQQQQAEQLQQQIDQI
A0A6P0KRF3      ---A---AGDTLVDPT---L--TDSAQGRAMLIQQLILAESAASGQQQQAEQLQQQIDQM
A0A6P0LQ61      ---A---AGDTLVDPT---L--TDSAQGRAMLIQQLILAESAASGQQQQAEQLQQQIDQM
A0A1D8TWE6      ---A---AGDTLVDPT---L--TDSAQGRAMLIQQLILAESAASGQQQQAEQLQQQIDQM
A0A6L9YP52      ---A---AGDTLVDPT---L--TDSAQGRAMLIQQLILAESAASGQQQQAEQLQQQIDQM
A0A6P0L3X9      ---G---AGDTLVDPT---L--TDSAQGRAMLIQQLILEESAASGQQQQAEQLQQQIDQI
A0A6M0A6X4      ---A---AGDTLVDPT---L--TDSAQGRAMLIQQLILAESAASGQQQQAEQLQQQIDQM
A0A1U7N3U5      ---A---AGDTLVDPT---L--TDSAQGRAMLIQQLILAESAASGQQQQAEQLQQQIDQI
A0A6L9ZB93      ---A---AGDTLVDPT---L--TDSAQGRAMLIQQLILAESAASGQQQQAEQLQQQIDQI
A0A6P0S980      ---A---AGDTLVDPT---L--TDSAQGRAMLIQQLILAESAASGQQQQAEQLQQQIDQI
A0A2T1EZA0      ---------------------------------------KARLLANVAQQDEINRQILLL
A0A1U7JBN8      -------------GSAVEAETLGYQGSVSQDLMQQLVNTANQMQVLQTQDQAIGQAVQLL
A0A2W4VXF4      -------------GSAVDANTLGYQGSVSRELVQQLVDTANQMQVLETQDQAIAQAVQQL
A0A2W7AI98      -------------GSAVDANTLGYQGSVSRELVQQLVDTANQMQVLETQDQAIAQAVQQL
A0A6G3Z347      ------------------------------------DQLANFTRELQVRDQALTRAITTL
A0A2P8QVH5      -----DRLPAQLSTTEKSLPKQLQLGDSDRKLVDALVDAQVVWFGLSARDQSLAKSEQQL
A0A2T1FT70      -----DRLPAQLSTTEKSLPKQLQLGDSDRKLVDALVDAQVVWFGLSARDQSLAKSEQQL
A0A433W4W4      -----DRLPAQLSTTEKSLPKQLQLGDSDRKLVDALVDAQVVWFGLSARDQSLAKSEQQL
K9U5W1          -----DRLPAQLSTTEKSLPKQLQLGDSDRKLVDALVDAQVVWFGLSARDQSLAKSEQQL
L8M1L4          DKVLVSYTQTNIVAAGDSGSQVSTSGSTLQQLAEQLLSTQTEYLSLQSQINQINQAKANV
A0A4P5VLH9      ---------------------------------------KAQLFANESQQDELNRQILLL
A0A2W6ZN45      ---------------------------------------SSQLFANQAQQNELNRQILLL
A0A081GP61      ---------------------------------------KARLLSNLAQQDEINRQILLL
K9P6R9          ---------------------------------------KARLLANVAQQDEINRQILLL
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
A0A5B8NQW4      ------------------------------------------------------------
A0A6P0XUL2      ------------------------------------------------------------
                                                                            

A0A355DU96      ------------------------------------------------------ASIPEA
A0A2N6LHT1      QARLAQLPIQQQQLTPLTRQREESAESLKLLQSKLEEARIAEAQLVGNIQIIEAAQPPTQ
A0A328V843      ERRARILPQLEQQQQELERKAEVARLTYRTLLQNLEEAQVAANKITNNARIIETANVPDE
A0A2T1DKP1      RARANALPRLEETQRELERRLKAAQTTYEVLLSRLQEVQVAENQNIGNARALSSAIVSER
A0A0D6KL48      KNRLDSLPRLEQQQLQLQRQLKVAQVTYEQLSKQLQEVEVVENQNVGNARVISEALVADK
A0A6M0AN00      RIQLREFPALIAQYNRLQPQVAIKQNTLQQLLQARQELS-IELARGGFNWQVVEAPLPGF
A0A6P0ITZ8      QNRLGQIPVLGQPFANLVRRQEEAIASLKLLQNKLEEARIAEAQLVSNIQIIERAKLPSS
A0A6P0SLN0      GSTLKTLPAAQARLVQLQQQYDIAEGVYNGLVAQVQQSKLNALSSYPSVQVFEEPRADSK
A0A2T1CC83      IKRAKVLPQLEQKDRELVRQAESAGKTYETLLNNLQEATIAANSKSGNADVVEYAAVPDK
A0A1B7WWU1      RRRLDSLPRLEQQQLQLQRQLTVAQITYQEFLKQYQLVQVLENQNVGNSRVISEALVPEL
A0A6P0S1R8      NDTLKTLPAAQAQLVELQQQYNIAEGVYNGLVAQVQETKLNAFSSYPSVQVFEEPRADSE
A0A0A2B4S6      KEKFEKQPKLISEYKTLQQKALLAAKNLEGLSSAKEKFQLEIAQRSVPWSIIAPPKVYPV
K9SGV8          RERYRELPKLEQEERRLERKVTVAESTYAELLQQLQEVRIAEQQNIGNTRILSLASTPID
B0CA08          RQQARNLPQLEQRQNELERTAKASASTYRNLLEQIQELKVTENQSPLTVSILESAT-DPE
B0BZC6          DARRKQYPVLEKTLASLQRKKEGATESVNLLRQKLDEARIAEAQLVSNLRIIEEANKPTL
A0A6G3Z709      LLRANNLPQLEKLERELERNLQAAQTTYETLLTQLQEIRVIENQTVGNVRIVSLAQVPNN
A0A6P0M090      EQRVNVLPRLEQTQQQLEQRLQAARFTYETLLKNLNELKVAENQDTANARIIEPAIVPKK
A0A563VX16      KEKLNQFPDLIAQYNSLEQEVAVHQATLKKLLESRQEIGIVINRGGFSWEIIEPPQQGLQ
A0A0V7ZGW0      QTELKNISTLQAQLLDLQRQYDIAEGVYKGIVAQLEQSKIAAFNAYPNLQVLDQPTVDPK
A0A355DPN1      RAKLNRLPELMAEYERLQPEVQIRRDTLQKLLEARQELGIEIARGGFKWQVVEPPKPGKQ
A0A6J4NIB3      TGELGHISRNQGQLLDLQRQYEVAQGAHNGIIAQIEQAKTSPFNAYPNIQTLDEPTAGAA
A0A6M0AB25      GSTLKTLPAAQARLVQLQQQYDIAEGVYNGLVAQVQQSKLNAFSSYPSVQVFEKPRADSK
A0A1D8TTM0      GSILKTLPAAQARLVQLQQQYDIAEGVYNGLVAQVQQSKLNAFSSYPSVQVFEEPRADSK
A0A6P0VB93      NDTLKTLPAAQAQLVELQQQYNIAEGVYNGLVAQVQETKLNAFSSYPSVQVFEEPRADSE
A0A6P0W0Y0      NDTLKTLPAAQAQLVELQQQYNIAEGVYNGLVAQVQETKLNAFSSYPSVQVFEEPRADSE
A0A0V7ZMP6      REQLKKLPTKQGILMDLQRRYDMTKKIYNGLVTQAEKVRLSAFDTYPSFQLLDEPFVNNE
A0A433W046      NTELSFITKNQAQLLDLQRKYEIAEGVYKGIIAQSEQSKTNPFNAYPNVQTLNEPTIDPR
K9TU02          NTELSFITKNQAQLLDLQRKYEIAEGVYKGIIAQSEQSKTNPFNAYPNVQTLNEPTIDPR
A0A2T1FMA8      NTELNFITKNQAQLLDLQRKYEIAEGVYKGIIAQSEQSKTNPFNAYPNVQTLNEPTIDPR
A0A2P8QV10      NTELNFITKNQAQLLDLQRKYEIAEGVYKGIIAQSEQSKTNPFNAYPNVQTLNEPTIDPR
B8HQ70          VTALNRLSNKQVQLLELQREYSIAEGVYKGVMAQFQQAKISTLSSYPSVQVLDGPLNSPR
A0A2S6V636      NAELNNIAQNRAQLINLQRQYEIAEGVYKSILAQVEQTKTNPFNVYPNVQTLDAPAIDPK
A0A6P0IXR4      KSTLTVIPVHQSRLLELKRQYDVAAGVYNGLVAQMEQVNLDAFSAYPNVQVLDPPTVDEK
A0A1D9G3S3      KSTLTVIPVHQSRLLELTRQYDVAAGVYNGLVAQMEQVNLDAFSAYPNVQVLDPPTVDEK
A0A6P0KRF3      KSTLTVIPVHQSRLLELTRQYDVAAGVYNGLVAQMEQVNLDAFSAYPNVQVLDPPTVDEK
A0A6P0LQ61      KSTLTVIPVHQSRLLELTRQYDVAAGVYNGLVAQMEQVNLDAFSAYPNVQVLDPPTVDEK
A0A1D8TWE6      KSTLTVIPVHQSRLLELKRQYDVAAGVYNGLVAQIEQVNLDAFSAYPNVQVLDPPTVDEK
A0A6L9YP52      KSTLTVIPVHQSRLLELKRQYDVAAGVYNGLVAQIEQVNLDAFSAYPNVQVLDPPTVDEK
A0A6P0L3X9      KSTLTVIPVHQSRLLELKRQYNVAAGVYNGLVAQMEQVNLDAFSAYPNVQVLDPPTVDEK
A0A6M0A6X4      KSTLTVIPVHQSRLLELKRQYDVAAGVYNGLVAQMEQVNLDAFSAYPNVQVLDPPTVDEK
A0A1U7N3U5      KSTLTVIPVHQSRLLELKRQYDVAAGVYNGLVAQMEQVNLDAFSAYPNVQVLDPPTVDEK
A0A6L9ZB93      KSTLTVIPVHQSRLLELKRQYDVAAGVYNGLVAQMEQVNLDAFSAYPNVQVLDPPTVDEK
A0A6P0S980      KSTLTVIPVHQSRLLELKRQYDVAAGVYNGLVAQMEQVNLDAFSAYPNVQVLDPPTVDEK
A0A2T1EZA0      SENFRNNPQKLAEFENINQRLSIAREQYSSYIQARERYRLEMARSISPWEVIGPPDFGSS
A0A1U7JBN8      RAEIQRLADLSRSYQQISRELTVAETSLDQLLASRQDLRFQMARQASPWELISPLNETSI
A0A2W4VXF4      RAEIQRLADLSRSYQQIDRELTVAESSLDRLLTSRQDLRLQMARQTAPWELISPLDESSV
A0A2W7AI98      RAEIQRLADLSRSYQQIDRELTVAESSLDRLLTSRQDLRLQMARQTAPWELISPLDESSI
A0A6G3Z347      NQQIKDLSTTTRTYNNIQRELEIATANLNQFLTKREALRIDAAQRQTPWEILTPPKQPRA
A0A2P8QVH5      RSTLLKYPQLLAEYNRLMPEIAINRKTLEQLLQTQQNLGIKIAQGGFNWQIIRDPEPGVY
A0A2T1FT70      RSTLLKYPQLLAEYNRLMPEIAINRKTLEQLLQTQQNLGIKIAQGGFNWQIIRDPEPGVY
A0A433W4W4      RSTLLKYPQLLAEYNRLMPEIAINRKTLEQLLQTQQNLGIKIAQGGFNWQIIRDPEPGVY
K9U5W1          RSTLLKYPQLLAEYNRLMPEIAINRKTLEQLLQTQQNLGIKIAQGGFNWQIIRDPEPGVY
L8M1L4          EADFQRLPQLQEIYTRLQRNIKIQSQAVDYLLQRKQELQIAAAEEITPWQILDKPYLPAQ
A0A4P5VLH9      NENFKNSPSLMKKYEELASNLKSARENYSSYLIARDNYRLQRARSTSPWQVIAPAEFNEI
A0A2W6ZN45      NKNFKQSPEEIRKYEELQQKIEVAQANYLSYIQARENFRLEVAKQTVPWQVISPPVFGDV
A0A081GP61      NQNFRNNPQKLSEFENINQRLSIAREQYSSYIQARERYRLEMARSITPWEVIGPPDFGAS
K9P6R9          SENFRNNPQKLAEFENINQRLLIAREQYSSYIQARERYRLEMARSISPWEVIGPPDFGSS
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
A0A5B8NQW4      ------------------------------------------------------------
A0A6P0XUL2      ------------------------------------------------------------
                                                                            

A0A355DU96      PVSPKKKLILVGGIVAGSLLYIVTAFVLDLMDPSIKTAKEIRQLF--KYTWLGMI---PE
A0A2N6LHT1      PSLPNKRTVLAIAIVVGTALATGIVLLLELMDHTLKDASEAEELL--KLPLLGVL---PR
A0A328V843      GK-TAKVPLLALGVMGGLVASTTLLLLMEMGDKSLRTVAETRDLF--GYTLLGII---PS
A0A2T1DKP1      SSNRKM--GLALGGGVGILLAVAAAFAADLLDRSVKTLKEVKDLF--GYTLLGVV---PL
A0A0D6KL48      SVSPIIPLNLALGGILGIILGAGTALVLESIDNSLKTVEEAKRLL--DYPLLGAI---PQ
A0A6M0AN00      KTGPNMTQDLLLGAVVGLFLGGVAAFVREAMDDGIHTSDDLKNQV--ALPLLGMI---PE
A0A6P0ITZ8      PKQPNPKLVLVIATAAGIAIAVGMVLLLEVMDNTLHDASEAEALL--KLPRLGLL---PK
A0A6P0SLN0      PSGPGRR-PIALGTILASVFGSAALISFLENRDPLLSPRDLQ-AI--SIPVLRSI---PP
A0A2T1CC83      GNSGRAV-LMGMGLIMGAFLANLSVILLEMQDRSISSLAEIKKKF--PYQTVGITRLEPP
A0A1B7WWU1      PVSPKIPLNLALGGFLGVLLGAGTALLLESMNQSLKNIEEANRLL--GFPLLGTI---PQ
A0A6P0S1R8      PSGPGRL-PIALGTILASAFGSVALILFLENRDPLLSPKDLQ-AI--SIPVLRSI---PP
A0A0A2B4S6      PVSPDIPLNLSLSLIFGPVLGLIVGLIRDKVDHVYHSPDEVKENL--NLPLLAEL---PY
K9SGV8          IVTPRRPRNVSLGLLLGLSAAGGAVFLLEAFDKKIKSTAAARELL--GFPLLGVI---PN
B0CA08          PSKTTFISAAMRGGLAGILLASGVVYVLERIDRKLKSKDEIRQVY--PYRVLGEI---PL
B0BZC6          PSYPNIPSFLVLGMMAAVALSAGVTLSAEGMDGRLRDLESIAENT--NVPVLGVI---PK
A0A6G3Z709      PVASNSRLYVIAGGFVGVLMAIAVAFLLDLLDSSIKTVKEIK-ELFAGYTLLGII---PL
A0A6P0M090      PLGDKKLKVLALGVMLGVTLATTAVLLLEMRDRSIKTLKEVKQLL--RYPVLGVI---PV
A0A563VX16      ISPNITQ-DLVLGGIVSVFLGAVSVVIMEASDNKIRVSRQLQEKV--NFPLLGTT---PG
A0A0V7ZGW0      PTSPKKS-LIAIGGILTSVFASLALILFSESRNPLLKQKDLQ-DI--ELPLLARI---PI
A0A355DPN1      MGPDTRR-DLMLSVVVGLFLGGLAAFGREALDDAVHSSEELKRQV--ALPLLGII---PE
A0A6J4NIB3      PKGNKRW-LIVLGGTLASFLGSAALLLFLESRKPLLSPRDLQ-QV--EFPLLGRI---PR
A0A6M0AB25      PSGPGRR-PIALGTILASMFGSAAIVLFLESRNPLLSLQDLQ-AT--NLPILRSI---PY
A0A1D8TTM0      PSGPGRR-PIALGTILASVFGSAAIVLFLESRNPLLSLQDLQ-AI--SIPVLRSI---PP
A0A6P0VB93      PSGPGRL-PIALGTILASAFGSVALILFLENRDPLLSPKDLQ-AI--SIPVLRSI---PP
A0A6P0W0Y0      PSGPGRL-PIALGTILASAFGSAALILFLENRDPLLSPKDLQ-AI--SIPVLRSI---PP
A0A0V7ZMP6      ASSPNIQ-LIILGAVLISIFGSVAIILLQERRDPLISPKDIQ-QK--NFPVLASV---PY
A0A433W046      PSIPNLR-LITTGGILAAIFGSMALIFFLENRNPLLKPKDLQ-QV--ELPVLGSI---PH
K9TU02          PSIPNLR-LITTGGILAAIFGSMALIFFLENRNPLLKPKDLQ-QV--ELPVLGSI---PH
A0A2T1FMA8      PSIPNLK-LITTGGMLAAIFGSMALIFFLENRNPLLKPKDLQ-QV--ELPVLGSI---PH
A0A2P8QV10      PSIPNLR-LITTGGILAAIFGSMALIFFLENRNPLLKPKDLQ-QV--ELPVLGSI---PH
B8HQ70          PE-PRRM-LIILGGLMAIAFGSSALVLLLESRNPLLSPADIQ-KV--KQPILAKL---PR
A0A2S6V636      PEEPSKR-AIALGGILAGLFGSISLIFFLEKRNPMLRPKDLE-QV--EFPVLGRI---SR
A0A6P0IXR4      PAGPKKL-LIIANGFLASAVGSIALVLLLERRNPLLSPKDLK-AI--KFPMVVNI---PH
A0A1D9G3S3      PAGPKKL-LIIANGFLASAVGSIALVLLLERRNPLLSPKDLQ-AI--KFPMVVNI---PH
A0A6P0KRF3      PAGPKKL-LIIANGFLASAVGSIALVLLLERRNPLLSPKDLQ-AI--KFPMVVNI---PH
A0A6P0LQ61      PAGPKKL-LIIANGFLASAVGSIALVLLLEQRNPLLSPKDLQ-AI--KFPMVVNI---PD
A0A1D8TWE6      PAGPKKL-LIIANGFLASAVGSIALVLLLERRNPLLSPKDLQ-AI--KFPMVVNI---PH
A0A6L9YP52      PAGPKKL-LIIANGFLASAVGSIALVLLLERRNPLLSPKDLK-AI--KFPMVVNI---PH
A0A6P0L3X9      PAGPKKL-LIIANGFLASAVGSIALVLLLERRNPLLSPKDLQ-AI--KFPMVVNI---PH
A0A6M0A6X4      PAGPKKL-LIIANGFLASAVGSIALVLLLERRNPLLSPKDLK-AI--KFPMVVNI---PH
A0A1U7N3U5      PAGPKKL-LIIANGFLASAVGSIALVLLLERRNPLLSPKDLK-AI--KFPMVVNI---PH
A0A6L9ZB93      PAGPKKL-LIIANGFLASAVGSIALVLLLERRNPLLSPKDLK-AI--KFPMVVNI---PH
A0A6P0S980      PAGPKKL-LIIANGFLASAVGSIALVLLLERRNPLLSPKDLK-AI--KFPMVVNI---PH
A0A2T1EZA0      PVEPNIQRNLLRAIMIGLLAGLGAAILRERTDNVFHTPMEVEKDL--QLPVLGLI---PY
A0A1U7JBN8      AQTSNLPRNLLLSTVLSLMLGGVAALLRDRLDQAFHSVDDLVKAT--QLPNLAGV---PN
A0A2W4VXF4      TEMTNLPRKLLLSTVVGLLLGGVAALVRDRADTAFHSADELVKAT--QLPNLALV---PN
A0A2W7AI98      TEMTNLPRKLLLSTVVGLLLGGVAALVRDRADTAFHSADELVKAT--QLPNLALV---PN
A0A6G3Z347      -SSASAKRNLVMGTVLGILLGSGVAILVDRVRGKIHTIDELKEVS--QLPLLGTI---PY
A0A2P8QVH5      -MGTGRIMLLVSGAVFGLVLGIGAAFLLEALDDTIHSCDELQKLS--SLPVLGIT---PK
A0A2T1FT70      -MGTGRIMLLVSGAVFGLVLGIGAAFLLEALDDTIHSCDELQKLS--SLPVLGIT---PK
A0A433W4W4      -MGTGRIMLLVSGAVFGLVLGIGAAFLLEALDDTIHSCDELQKLS--SLPVLGIT---PK
K9U5W1          -MGTGRIMLLVSGAVFGLVLGIGAAFLLEALDDTIHSCDELQKLS--SLPVLGIT---PK
L8M1L4          PISPNIQKALVSSLVAGGLWAIAIAFLLHQLDNRIKLVEEVKRIT--HLPLLGAV---PQ
A0A4P5VLH9      PVEPNLQSNLLRALMLGLVSGLGAAILRERTDNVFHTPMETEREL--QLPVLGLI---PY
A0A2W6ZN45      PIEPDLSREFLRALFIGLAVGIAAVLLREKTDDAYHTPKEASQEL--GLPILGLI---PY
A0A081GP61      PVEPDIQRNLLRAIMIGLLAGLGAAILRERTDNVFHTPMEVEKEL--QLPVLGLI---PY
K9P6R9          PVEPNIQRNLLRAIMIGLLAGLGAAILRERTDNVFHTPMEVEKDL--QLPVLGLI---PY
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
A0A5B8NQW4      ----------------------------------MKTVQEIKDKL--GYTLLGSIP----
A0A6P0XUL2      -----------------LLAGAGAATLAEKLDNKFHSPDELKQST--GLPILGTIPFQKE
                                                                            

A0A355DU96      SRKKGLFWQQKING------------------------NVPQLVVRD-VPHG--------
A0A2N6LHT1      LPGHAI-------------------------------ALEPSAQFLD-HVG---------
A0A328V843      FAAPPFYRYL--TG---------------------GDRSSVQVPVVD-TPGS--------
A0A2T1DKP1      LNGKPVRQRSHFEG---------------------TAHPIPRVYVRE-LPFS--------
A0A0D6KL48      AEKAKGSEGV----------------------------GEVELPVLN-NPYS--------
A0A6M0AN00      LPEGKISKPVLNLS---------------------LSQSERALPMMELLGWR--------
A0A6P0ITZ8      IPAQAL---SLEQP------------------KRFLADIRLMEPYRL-LLTT--------
A0A6P0SLN0      FKHLVL---DVDPS------------------------FGTAMEFQR-LASA--------
A0A2T1CC83      MYQGKIVTRDEPDS----------------------------------------------
A0A1B7WWU1      HGEKNPKNPQEGRQ-----------------------------ELPL-LDDP--------
A0A6P0S1R8      FKHLVL---DIDPS------------------------FGTAIEFQR-LASA--------
A0A0A2B4S6      IESFVNLRENNESI---------FNVEDKLNATKNEKSSESYLGYQR-FFYQ--------
K9SGV8          FKKVPLFPVASGNRIGRTVPELVVREAPNSPISEAFRMLQTNLKFLS-LKKR--------
B0CA08          FDESEA---ESLKL--------PTLSDPASHLSEAYRMLQSSLKFHG-LEHS--------
B0BZC6          QKNSRL---FPSLPFAELYNNLPLLESVRA--------LSKNIEYKN-STES--------
A0A6G3Z709      VKEPTR---SETEA-------------------------IGDQSYPR-LLVN--------
A0A6P0M090      FKHKKL---SRRRDDLFFGGELPVTEQPHSMVSEVYRMIQANLKFLR-SDHP--------
A0A563VX16      LSKIK------DSQ------------------------FSVRLPFFS-GNDQET------
A0A0V7ZGW0      FKSAPL---GLTME------------------------SDAQIPFQR-LAST--------
A0A355DPN1      LPRTG------GSG------------------------LLVHLPFRR-TQVAAA------
A0A6J4NIB3      LKRPDM---ERILE------------------------ADVEIEFNR-LAAA--------
A0A6M0AB25      FKHLVV---NIAPR------------------------VETEIEFQR-LASA--------
A0A1D8TTM0      FKHLVL---DVDPS------------------------FGTAIEFQR-LASA--------
A0A6P0VB93      FKHLVL---DIDPS------------------------FGTAIEFQR-LASA--------
A0A6P0W0Y0      FKHLVL---DIDPS------------------------FGTAIEFQR-LASA--------
A0A0V7ZMP6      MKGLDT---SMGEG------------------------INEKVEFQR-LASA--------
A0A433W046      LKQPSM---ERNLA------------------------AEIDIEFQR-LASS--------
K9TU02          LKQPSM---ERNLA------------------------AEIDIEFQR-LASS--------
A0A2T1FMA8      LKQPSM---ERNLA------------------------AEIDIEFQR-LASS--------
A0A2P8QV10      LKQPSM---ERNLA------------------------AEIDIEFQR-LASS--------
B8HQ70          LKAPSQ---VWNLD------------------------AEPLLGFHR-LASA--------
A0A2S6V636      LKRADM---ERNLS------------------------GEVAIELQR-LASA--------
A0A6P0IXR4      LRHAGM---GLELG------------------------TETDVEFQR-LASV--------
A0A1D9G3S3      LRHAGM---GLELG------------------------TETDVEFQR-LASV--------
A0A6P0KRF3      LRHAGM---GLELG------------------------TETDVEFQR-LASV--------
A0A6P0LQ61      LRHAGM---GLELG------------------------TETDVEFQR-LASV--------
A0A1D8TWE6      LRHAGM---GLELG------------------------TETDVEFQR-LASV--------
A0A6L9YP52      LRHAGM---GLELG------------------------TETDVEFQR-LASV--------
A0A6P0L3X9      LRHAGM---GLELG------------------------TETDVEFQR-LASV--------
A0A6M0A6X4      LRHAGM---GLELG------------------------TETDVEFQR-LASV--------
A0A1U7N3U5      LRHAGM---GLELG------------------------TETDVEFQR-LASV--------
A0A6L9ZB93      LRHAGM---GLELG------------------------TETDVEFQR-LASV--------
A0A6P0S980      LRHAGM---GLELG------------------------TETDVEFQR-LASV--------
A0A2T1EZA0      LP----------LE----------------------PGVDIATSISK-MSSSER------
A0A1U7JBN8      APALQKQPLLMVPN----------------------LSATMADVLTQ-NQSPHK------
A0A2W4VXF4      APALQKQPLLMVPD----------------------LTATMADVLTQ-NQSPDN------
A0A2W7AI98      APALQKQPLLMVPD----------------------LTATMADVLTQ-NHSPDN------
A0A6G3Z347      EKL---------LE----------------------NEQSLALSISQ-LSQMGFAMNLFP
A0A2P8QVH5      LPNFELKKPSIALP----------------------FFKQQSLTSQR-IQALNW------
A0A2T1FT70      LPNFELKKPSIALP----------------------FFKQQSLTSQR-IQALNW------
A0A433W4W4      LPNFELKKPSIALP----------------------FFKQQSLTSQR-IQALNW------
K9U5W1          LPNFELKKPSIALP----------------------FFKQQSLTSQR-IQALNW------
L8M1L4          V-----------FD----------------------PLIVIEDNTVK-QSYSYR------
A0A4P5VLH9      LP----------LE----------------------SGVDVSTSISK-MSASER------
A0A2W6ZN45      LP----------IV----------------------SSDSILKSLKE-LPGTER------
A0A081GP61      LP----------LE----------------------PGVDIATSISK-MSSSER------
K9P6R9          LP----------LE----------------------PGVDIATSISK-MSSSER------
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      -----MSFLP-VRD----------------------------------APRS--------
A0A5B8NQW4      LFGKQASELP-MQD----------------------------------QPRS--------
A0A6P0XUL2      LKDRKKSNIPQMEP----------------------------------LATS--------
                                                                            

A0A355DU96      --------------ITSEAYRMLEANLKFLSPD-QVLKRIVVTSSVAQEGKSTVSANLAI
A0A2N6LHT1      ---------------LVEPYRTLFKNLEFRSSE--PLRSIVVSSTITGEGKSVVGSHLAA
A0A328V843      --------------LISEIYRMIQANLKFLGSD-RKVRVIVVSSSVPQEGKSTVSANLAA
A0A2T1DKP1      --------------SAAEAYQMLQANLRFLRSD-KEIKTVVVTSSVAQEGKSEVAANLAA
A0A0D6KL48      --------------PVSSAFEMLQTNLSFSISD-KMLKVIAISSSIPGEGKSFVAANLAV
A0A6M0AN00      --------------PFQEALDMIYVNIQLLNPG-SEWKSLMVTSALSGEGKSTLALGLAL
A0A6P0ITZ8      ----------------------------MELRAQKRLQLIVVSSAVSGEGKSVVASHLAA
A0A6P0SLN0      ----------------------------VSMKP-IENRRLMISSATSGEGKTTVTLGLAS
A0A2T1CC83      --------------FSSEVYRMIQANLKFLTND-KPPKVILVTSSVPEEGKSTVTANLAA
A0A1B7WWU1      ------------YSPVSTSFEMLQTNLGFTVSD-KELRVILVTSATPGEGKSFVAANLAL
A0A6P0S1R8      ----------------------------VSMKP-LKNRRLMITSATAGEGKTTITLGLAS
A0A0A2B4S6      -----------------EAFRGMYTSIKFINTQ-NSLKILSISSCIPSEGKSLISTMFAK
K9SGV8          ------------------------------------LKVIVVTSSVPREGKSTIAANLAA
B0CA08          ------------------------------------PRVLMMTSAINQEGKSTTCANLAV
B0BZC6          -------------------------------------KVLVITSAISGEGKSFVATNLAV
A0A6G3Z709      ---------QPTHIRVREAYQMLQANLKFLQSD-NELQTVVISSAVPGEGKSEVSANLAA
A0A6P0M090      ------------------------------------LKVIVVTSSVSKEGKSTVSANLAA
A0A563VX16      -----IPLQVIEWLPFRESLDLVYENIQLMSQN-SLINSIAITSSIAGEGKSTITLGLAL
A0A0V7ZGW0      ----------------------------ISLMS-LENHRLMVTSSTAGEGKTTVTLGLAK
A0A355DPN1      -----STLPMVYWLPFRESLDLIYKHIQLLNSA-ATLRSIVVTSALPSEGKSTFVVGLAF
A0A6J4NIB3      ----------------------------VSSLM-LDSDRLMVASSMYGEGKTTVTLGLAL
A0A6M0AB25      ----------------------------VSMKP-LKNRRLMIASATSGEGKTTVTLGLAS
A0A1D8TTM0      ----------------------------VSMKP-LKNRRLMISSATSGEGKTTVTLGLAS
A0A6P0VB93      ----------------------------VSMKP-LKNRRLMITSATAGEGKTTITLGLAS
A0A6P0W0Y0      ----------------------------VSMKP-LKNRRLMITSATAGEGKTTITLGLAS
A0A0V7ZMP6      ----------------------------ISLLH-LENKSLMIASANSGEGKTTVTLGLAN
A0A433W046      ----------------------------ILML---EHPCLMVTSATAGEGKTTVTLGLAL
K9TU02          ----------------------------ILML---EHPCLMVTSATAGEGKTTVTLGLAL
A0A2T1FMA8      ----------------------------ILML---EHPCLMVTSATAGEGKTTVTLGLAL
A0A2P8QV10      ----------------------------ILML---EHPCLMVTSATAGEGKTTVTLGLAL
B8HQ70          ----------------------------ISFLD-LATPRLMITSAMYGEGKTTIAIGLAA
A0A2S6V636      ----------------------------VLML---EHQRLLVTSSTSGEGKTTVTLGLAL
A0A6P0IXR4      ----------------------------ISLRS-GEDRRILITSAMVSEGKTTVTLGLAT
A0A1D9G3S3      ----------------------------ISLRS-GEDRRILITSAMVSEGKTTVTLGLAT
A0A6P0KRF3      ----------------------------ISLRS-GEDRRILITSAMVSEGKTTVTLGLAT
A0A6P0LQ61      ----------------------------ISLRS-GEDRRILITSAMVSEGKTTVTLGLAT
A0A1D8TWE6      ----------------------------ISLRS-GEDRRILITSAMVSEGKTTVTLGLAT
A0A6L9YP52      ----------------------------ISLRS-GEDRRILITSAMVSEGKTTVTLGLAR
A0A6P0L3X9      ----------------------------ISLRS-GEDRRILITSAMVSEGKTTVTLGLAR
A0A6M0A6X4      ----------------------------ISLRS-GEDRRILITSAMVSEGKTTVTLGLAR
A0A1U7N3U5      ----------------------------ISLRS-GEDRRILITSAMVSEGKTTVTLGLAR
A0A6L9ZB93      ----------------------------ISLRS-GEDRRILITSAMVSEGKTTVTLGLAR
A0A6P0S980      ----------------------------ISLRS-GEDRRILITSAMVSEGKTTVTLGLAR
A0A2T1EZA0      ------------F-AIKESLRSLFTTFRLLRAD-NNIRMVGITSSTQGEGKSTAVAVFSR
A0A1U7JBN8      --------LYTSF-SFAEAFYSLEANLRMLSSD-TPIQVVALTSSEPGEGKSTICAHLAI
A0A2W4VXF4      --------LYTSF-SFAEAFYSLDTNLRMLSSD-TPMQVIALTSAVPGEGKSTICAHLAI
A0A2W7AI98      --------LYTSF-SFAEAFYSLDTNLRMLSSD-TPMQVIALTSSVPGEGKSTICAHLAI
A0A6G3Z347      SQQEPSDSHKPTFTPFLESFRILATNIELSNPD-DPVRTLAITSAIPNMGKSTVTFHLAH
A0A2P8QVH5      ------------F-PFRESMDLIYQNIQILGSP-LSFKSLLLTSALTGEGKSTLAAGMAL
A0A2T1FT70      ------------F-PFRESMDLIYQNIQILGSP-LSFKSLLLTSALTGEGKSTLAAGMAL
A0A433W4W4      ------------F-PFRESMDLIYQNIQILGSP-LSFKSLLLTSALTGEGKSTLAAGMAL
K9U5W1          ------------F-PFRESMDLIYQNIQILGSP-LSFKSLLLTSALTGEGKSTLAAGMAL
L8M1L4          ------------YSSFTESLRAIAMNISYTVVDTRKIKSLVTTSSTSSEGKTTVTYNLAL
A0A4P5VLH9      ------------F-AIKESLRSLFTTFRLLRSD-RDIRLVAVTSSTQGEGKSTAVTIFAR
A0A2W6ZN45      ------------F-AIKESLRSLFTTFRLLRAD-REIRLVVITSSTQNEGKSTAASVFGN
A0A081GP61      ------------F-AIKESLRSLFTTFRLLRAD-NNIRMVGITSSTQGEGKSTAVTVFAS
K9P6R9          ------------F-AIKESLRSLFTTFRLLRAD-NNIRMVGITSSTQGEGKSTAVAVFSR
A0A1Q8BLE0      --------------------------------M-RAVSRIVITSPGPEEGKSTTAANLAI
A0A2T2S1W0      --------------PLSESFRMLQANLRFSQAD-RRLQAIAVASSVPGEGKSTLVANLGL
A0A5B8NQW4      --------------AVSEAFRMLQANLKFSRVD-EKLKVIVVTSSVPNEGKSTVTGNLGL
A0A6P0XUL2      --------------PCWEACLSLQTNISFVSPD-TPLRYIVISSAVPSEGKSTIALYLAQ
                                                       :  :*     **:     :. 

A0A355DU96      AMAQVGRRVLLVDADMRHPMQHHIWDLAN-TVGLSEVIVHQTQFEFAVREV----MDNLD
A0A2N6LHT1      ISAMLSRRTLLIDADLRRPILHTLFNLAP-RPGITDVIDSERSLEETVQRTNI---PNLS
A0A328V843      AIAQLGHRVILIDGDMRQPIQHHIWGLTN-AVGLSDVLVEEATLSEAV-KPGI---DQLD
A0A2T1DKP1      SMAQVGRRVLLVDADMRYPVQHHVWDLVS-TIGLSNVIVEQFVPDVAIQEVAP----NLY
A0A0D6KL48      AVAQLGRRVLLVDADMRRPRQHKIWEQNN-LVGLSNILVGQTELQTTSKEALM----TLD
A0A6M0AN00      SAARLHRRVLLIDVDMRRPRLHQQLGLSN-YEGLSTLLEDDTATPSPVSISPL--GSTID
A0A6P0ITZ8      VSARFSRRTLIIDADWRHPMQHNLFGLPP-QPKVKDLMDSNQTCLEAVQPTAI---ANLS
A0A6P0SLN0      ALITLGFRVLVVDGDFRKAELSQRLGCDR-----------YAISEVPSTPVQI--RSGLD
A0A2T1CC83      AISQLGRSVLLVDADLRRSSQHHLWGVDN-QKGLKDIVVDNV--SPLSVIRQP--MPKLS
A0A1B7WWU1      AGAYVGKRVLLVDADMRRPRQHRVWEIHN---LLGLSNILAGQTQLKNAVQEV--SPLVK
A0A6P0S1R8      GLITLGFRVLVVDGDFRKAHLSQQLGYTP-----------SPALEGQSMPVQV--RAGLD
A0A0A2B4S6      TISELGLSVLLIDTDLRKPQVHARLGLDNLIGFSNLLIDSSDNYKKYIQSVPT--QDNFD
K9SGV8          TIAELGQRVLLVDADMRHPAQHRIWQLPN---ENGLSDLLTGQSPLSEVAHHV--MPTLE
B0CA08          SLAQMNHRVLLIDADIRLASQHQIWELGNQEGLTHILLNKHFNYHQELPTHKV--ADNLE
B0BZC6          LSAMLSKRTLLIDADMRRPSIHKIFQLPQDPGLQDYLRGSVKEGLPAAIHRTS--VKNLS
A0A6G3Z709      ALAQVGRRVLLIDADMRYPRQHHALKVLN---TVGLSHVITGQAKVKSAIQTV--TRNLD
A0A6P0M090      AMAQLGRRVLLIDSDMRHPSQHYIWQVMN---VAGLSQVLIGEVPIELAICKA--MENLD
A0A563VX16      SAARRRKKVLVIDGDLRCPTLHEKLDISN-GVGLSDLLDGVTSVPTVQEISRA--GSTIS
A0A0V7ZGW0      ALMVLGFRVLMVDGDFRKAKLSRQFGHVM-H-PQS---------NDLPQPMQI--SPGLD
A0A355DPN1      SAARLHQRVLLIDADLRRPSLHKQLNLPN-EQGLATLLVEDSSIPSPQRLSLS--GSEID
A0A6J4NIB3      ALVKLGFRVLVVDGDLRRADLSQRLGHPQ-A-KIG---------DAKVMPIPI--YRGLD
A0A6M0AB25      ALITLGFRVLVVDGDFRKAELSQRLGCDR-F-AMS---------EVPSAPVQI--RSGLD
A0A1D8TTM0      ALITLGFRVLVVDGDFRKAELSQRLGWDR-Y-AMS---------EVPSTPVQI--RPGLD
A0A6P0VB93      GLITLGFRVLVVDGDFRKAHLSQQLGYRP-S-PTL---------EEQSMPVQV--RAGLD
A0A6P0W0Y0      GLITLGFRVLVVDGDFRKAHLSQQLGYTP-S-PAL---------EGQSMPVQV--RAGLD
A0A0V7ZMP6      ALLELGFRILIVDADFRKCELTQSLGYYG-Q-SIG---------DLQLRPINV--FENVD
A0A433W046      ALVNFGFRVLVIDGDLRKAEMSRRLGKNRIKSAAN---------ASPPMPVSV--SPGFD
K9TU02          ALVNFGFRVLVIDGDLRKAEMSRRLGKNRIKSAAN---------ASPPMPVSV--SPGFD
A0A2T1FMA8      ALVNFGFRVLVIDGDLRKAEMSRRLGKNRIKSAAN---------ASPPMPVSV--SPGFD
A0A2P8QV10      ALVNFGFRVLVIDGDLRKAEMSRRLGKNRIKSAAN---------ASPPMPVSV--SPGFD
B8HQ70          ALARLGFKILLVDGDLRRARLTEQLSDRY-QGSWN---------PRETAVVPL--SPGLD
A0A2S6V636      ALVNFGFRVLIVDGDLRQAELSQRLGQPQ-K-KLK---------DGQPSPVSV--CLGLD
A0A6P0IXR4      ALVDLGFRVLVVDGDFRQATLSQRLGHHH-D-PLK---------PGQ--PVKI--QPSLD
A0A1D9G3S3      ALVDLGFRVLVVDGDFRQATLSQRLGHDH-D-PLK---------PGQ--PVKI--QPSLD
A0A6P0KRF3      ALVDLGFRVLVVDGDFRQATLSQRLGHDH-D-PLK---------PGQ--PVKI--QPSLD
A0A6P0LQ61      ALVDLGFRVLVVDGDFRQATLSQRLGHDH-D-PLK---------PGQ--PVKI--QPSLD
A0A1D8TWE6      ALVDLGFRVLVVDGDFRQATLSQRLGHHH-D-PLK---------PGQ--PVKI--QPSLD
A0A6L9YP52      ALVDLGFRVLVVDGDFRQATLSQRLGHHH-D-PLK---------PGQ--PVKI--QPSLD
A0A6P0L3X9      ALVDLGFRVLVVDGDFRQATLSQRLGHHH-D-PLK---------PGQ--PVKI--QPSLD
A0A6M0A6X4      ALVDLGFRVLVVDGDFRQATLSQRLGHHH-D-PLK---------PGQ--PVKI--QPSLD
A0A1U7N3U5      ALVDLGFRVLVVDGDFRQATLSQRLGHHH-D-PLK---------PGQ--PVKI--QPSLD
A0A6L9ZB93      ALVDLGFRVLVVDGDFRQATLSQRLGHHH-D-PLK---------PGQ--PVKI--QPSLD
A0A6P0S980      ALVDLGFRVLVVDGDFRQATLSQRLGHHH-D-PLK---------PGQ--PVKI--QPSLD
A0A2T1EZA0      TLADLGLRVLVIDSDMRLPMQARYLGVEQ-GDGLSTLLS-DSSRKPTDFIHSI--AENMD
A0A1U7JBN8      AAANMGRRVLLIDSDLRKPSQHLIFGHAN-RQGLSDLIT-QPLDDPMDLVQVIPGNPNLH
A0A2W4VXF4      AAANMGRRVLLIDGDLRKPSQHLIFSQRN-HQGLSELIT-QGLENPTDLVLAIPGNPNLH
A0A2W7AI98      AAANLGRRVLLIDGDLRKPSQHLIFSQRN-HQGLSELIT-QGLENPTDLVLTIPGNPNLH
A0A6G3Z347      AIAATGKRVLMMDTDLRRPTLHKLCNASN-DKGLSNYVTGEFNPEDILIDLPL--EPGLF
A0A2P8QVH5      SVARLQRRVLLIDADLRRSNIHKLLNLSN-DRGLSTLLTEEADVRERDCIQSV--QPSLD
A0A2T1FT70      SVARLQRRVLLIDADLRRSNIHKLLNLSN-DRGLSTLLTEEADVRERDCIQSV--QPSLD
A0A433W4W4      SVARLQRRVLLIDADLRRSNIHKLLNLSN-DRGLSTLLTEEADVRERDCIQSV--QPSLD
K9U5W1          SVARLQRRVLLIDADLRRSNIHKLLNLSN-DRGLSTLLTEEADVRERDCIQSV--QPSLD
L8M1L4          ALTELDAKVLVVDADLRKPKIHKMAKISN-EQGLSEVIS-DNKHSWTEVVQNV--TGNLD
A0A4P5VLH9      TLADLGLKVLVVDADMRLPMQTRYLGLAN-GEGFSTILT-NSSVPLKSLIQPI--QDNLD
A0A2W6ZN45      TLADLGLHVLLVDADMRLPVQHKHFAVDN-VKGLSDYLG-DTDDNIQDYIKPI--TSNLS
A0A081GP61      TLADLGLKVLIIDSDMRLPMQTRYLGVEP-GDGFSTLLS-DSSRKTTDLIQTI--AENMD
K9P6R9          TLADLGLKVLVIDSDMRLPMQARYLGVEQ-GDGLSTLLS-DSTRKPTDFIHSI--AENMD
A0A1Q8BLE0      AFAQQGHRVLLVDCDLRRTRIHKIFDETN-LPGLTSVLVGGETIASAIR-QTR--VPGLN
A0A2T2S1W0      ALAEVGQHVLIVDADLRNPSQHGIWEYAN-AVGLSNLLVGESSLEQACH--PA--SEGLD
A0A5B8NQW4      ALAELGNRVLIVDGDMRRPSQHQVWEEPN-SMGLSNLLVDQSDVSTVTK--EL--HPNLE
A0A6P0XUL2      AAAAIGKKVLLVDADLRRPQVHVRTDLPN-TWGLSNLIFSNIDLSQAIQVAPF--EENLS
                         :::* * *                                         . 

A0A355DU96      VLPSGVIPPNSL-ALLNSKRMASLVEYFSQ--KYDFVIFDTPPLV-LTADAMTLGKMTDG
A0A2N6LHT1      VLTCGELYRLPS-HLLESEAMKSLLIEAVR--QYEFVVIDTPPLS-ACADAHTLGRQSDG
A0A328V843      ILTAGVTPPNPL-ALLDSRRMTSLIRNFSE--EYDFVIIDTPPLL-LAADALTLANMASG
A0A2T1DKP1      ALPSGIIPPNPI-ALLDSKRMASLVEGFAR--DYDLIIFDTPPLA-GKADAAILGKMTDG
A0A0D6KL48      IITAGTIPPNPA-ALLNSQRIATFIKEATQ--EYDFVIIDCPPLT-LVADALMLSKLVDG
A0A6M0AN00      VLTAGPTPIDPV-KLLGSKRMKNLMAEFQE--TYDLVLLDTPPVL-GMVDALQAASLCQG
A0A6P0ITZ8      ILTCSDQPSGPA-TFLQSQVMKSILAAAGD--HYDLVIVDTPPVS-SFADAHTLSRYSDG
A0A6P0SLN0      LLSLRP-DEDKIAEFVARGSFEECLSSAQATGHYDYILIDSAPVS-LNSEAALMATVVPN
A0A2T1CC83      LLTSGMVESNPL-AILDSPKMSDFIGRSRR--EYDLILIDVPPLP-VTADVLTVSKLVDG
A0A1B7WWU1      MLPAGKIPPNPV-TLLDSQCMADLVEEASK--DYDFVIIDTPPLT-AVTDPLIVGKYVDG
A0A6P0S1R8      LLSI-RPHEDKIAEFVARGDFEQALNVAQAAGDYDYVLIDSAPVS-VTSETVLMASVTSA
A0A0A2B4S6      VITSGSIPPDPT-RLLGSDSMKKFIETIRSENKYDYVILDTSPIL-SISDSTLIAQYCDS
K9SGV8          VMPAGSKPANPVALLNSQATSNL---IDYGSSNYDVMIVDTPPMA-VAADASILGKIADG
B0CA08          IITAGRISSNPL-PMLESEQFANFVQVQIEH--YDYILIDAPPLV-SVADPLIIGKVVDG
B0BZC6          VMTSGKFSYDNVFSFETQRAKELFTEVQQH---YDVIVIDTPPVM-ACSDALVLSQEGRQ
A0A6G3Z709      VLTAGVVPPNPV-ALLDSKRMESLLQSLAQA--YEVVIIDAPPLV-SYADASILGKMAEG
A0A6P0M090      ILTAGVMPPNPLALLDSK---QMASLIQEFSTQYDFVIIDAPPLL-LTADALCLSPMTDG
A0A563VX16      VLTSGSATSDPV-KLLSSGRLQNLIAHFEKT--YDLVLIDTPPAI-GMVDAIKIASSCSG
A0A0V7ZGW0      ILPTAPNQNNKVMEFVARGGFEKYLNTIQTNGNYDYVIVDTAPVT-STSETALMAKVIAN
A0A355DPN1      VLTAGPIPPDPV-KLLSSQRMRQLMAGFEQS--YDLILVDTPPIL-GMVDALQAASFCNG
A0A6J4NIB3      LLPAPAIAKDHIAEFFAQGRFEQQLSEIQDSSNYDYVLVDSAPVS-LTIEPALMSAAVPN
A0A6M0AB25      LLSLRP-DEDKIAEFVARGSFEECLNSAQATGHYDYILIDSAPVS-LTSEAALMATVVPN
A0A1D8TTM0      LLSLRP-DEDKIAEFVARGSFEECLSAAQGSGHYDYILIDSAPVS-LTSEAALMASVVPN
A0A6P0VB93      LLSLRP-HEDKIAEFVARGDFEQALNVAQAAGDYDYVLIDSAPVN-VTSETVLMASVTSA
A0A6P0W0Y0      LLSIRP-HEDKIAEFVARGDFEQALNVAQAAGDYDYVLIDSAPVN-VTSETVLMASVTSA
A0A0V7ZMP6      LLAM-RVPEERIAEFVARGGFEQRLNAIKNSAQYDYILVDSPPVA-LTSEAAIIGKIIHN
A0A433W046      LLPALSIPKQKIPEFFARGSFERNIKALRESGGYDYVLVDSPPVG-LASETNLMSAVVCN
K9TU02          LLPALSIPKQKIPEFFARGSFERNIKALRESGGYDYVLVDSPPVG-LASETNLMSAVVCN
A0A2T1FMA8      LLPALSIPKQKIPEFFARGSFERNIKALRESGGYDYVLVDSPPVG-LASETNLMSAVVCN
A0A2P8QV10      LLPALSIPKQKIPEFFARGSFERNIKALRESGGYDYVLVDSPPVG-LASETNLMSAVVCN
B8HQ70          LMPAPAIPNDRIVNYVAKGGFEQQLQTLQQSGEYDYVLVDTAPIT-LTSETGLMTTSVNN
A0A2S6V636      LLPAPALSKGKIPEFFARGSFQQYLDQIQADGGYDYVLVDSPPIG-LASETNLMSSVVRN
A0A6P0IXR4      LLPT-SHKKGKIVELVTQGKFEQSLATAEESGDYDYVLIDSAPVS-MTSETALMAAVIRN
A0A1D9G3S3      LLPT-SHKKGKIVELVTQGKFEQSLATAEESGDYDYVLIDSAPVS-MTSETALMAAVIRN
A0A6P0KRF3      LLPT-SHKKGKIVELVTQGKFEQSLATAEESGDYDYVLIDSAPVS-MTSETALMAAVIRN
A0A6P0LQ61      LLPT-SHKKGKIVELVTQGKFEQSLATAEESGDYDYVLIDSAPVS-MTSETALMAAVIRN
A0A1D8TWE6      LLPT-SHKKGKIVELVTQGKFEHSLATAEASGDYDYVLIDSAPVS-MTSETALMAAVIPN
A0A6L9YP52      LLPT-SHKKGKIVELVTQGKFEQSLATAEESGDYDYVLIDSAPVS-MTSETALMAAVIRN
A0A6P0L3X9      LLPT-SHKKGKIVELVTQGKFEQSLATAEESGDYDYVLIDSAPVS-MTSETALMAAVIGN
A0A6M0A6X4      LLPT-SHKKGKIVELVTQGKFEQSLATAEESGDYDYVLIDSAPVS-MTSETALMAAVIRN
A0A1U7N3U5      LLPT-SHKKGKIVELVTQGKFEQSLATAEESGDYDYVLIDSAPVS-MTSETALMAAVIRN
A0A6L9ZB93      LLPT-SHKKGKIVELVTQGKFEQSLATAEESGDYDYVLIDSAPVS-MTSETALMAAVIRN
A0A6P0S980      LLPT-SHKKGKIVELVTQGKFEQSLATAEESGDYDYVLIDSAPVS-MTSETALMAAVIRN
A0A2T1EZA0      VLPAGPKPPDPA-KLLNSSRCKEIMEEIRALPGYDIIIVDAPPCL-MLADPILLGEKLDG
A0A1U7JBN8      LLTAGARPPAPG-RLLSSRKMQQIAEQYRC--HFDLIILDTPPLAGGMVDAKLAAAHADG
A0A2W4VXF4      LLTAGARPPPPG-RLLSSRKMQQITEQYRR--HYDLIIFDTPPLA-GMIDAKLTAAHADG
A0A2W7AI98      LLTAGARPPPPG-RLLSSRKMQQITEQYRR--HYDLIIFDTPPLA-GMIDAKLTAAHADG
A0A6G3Z347      LLPSGPIPPDPM-KILTAQRIRNLFDYLDR--EFDFIIFDTPPLL-GFADAFIIAANTKG
A0A2P8QVH5      VLTAGPTPTDIV-KLLSSQRMKHLIESFEQ--SYDLVLVDAPPIL-GLADASIVASLCSG
A0A2T1FT70      VLTAGPTPTDIV-KLLSSQRMKHLIESFEQ--SYDLVLVDAPPIL-GLADASIVASLCSG
A0A433W4W4      VLTAGPTPTDIV-KLLSSQRMKHLIESFEQ--SYDLVLVDAPPIL-GLADASIVASLCSG
K9U5W1          VLTAGPTPTDIV-KLLSSHRMKHLIESFEQ--SYDLVLVDAPPIL-GLADASIVASLCSG
L8M1L4          VITAGANVANPI-ALLRSQIMSELLKEWEA--AYDYVLIDTPPIG-AMADAQSLVHQVDG
A0A4P5VLH9      ILPAGPKPPDPA-KLLNSTRAQEVVNEIRALTEYDMVLFDAPPCL-MLSDPILLGEKLDG
A0A2W6ZN45      LITAGSRAPDPA-RLLNSLRCSDMVQHLRALPGYDLIIFDTPPCL-LLSDPVILGEKVDG
A0A081GP61      VLPAGPKPPDPA-KLLNSSRCKEIMDEIRALPGYDIIIVDAPPCL-MLADPILLGEKLDG
K9P6R9          VLPAGPKPPDPA-KLLNSSRCKEIMEEIRALPGYDIIIVDAPPCL-MLADPILLGEKLDG
A0A1Q8BLE0      ILPSGPLPPNPA-ELLGSAQMTALLDKLSE--NYDLLILDTPPLL-AASDAAIVSRIVDG
A0A2T2S1W0      LLTAGQVPPNPV-ALLDSQRLATLLQQWRQ--AYDYVLLDVPPLQ-AATDAVIVGKLTDG
A0A5B8NQW4      LLTVGAPPPNPI-ALLDSQRIADFIDKCRQ--AYDYVLIDTPPMA-VGADSALLGKLAEG
A0A6P0XUL2      ILTSGQVPPNPT-RALSSQKMGSLLERLQR--RFDLIIFDTPPLT-GLADAKLLAPRTDG
                 :.                              :: ::.* .*      :          

A0A355DU96      ILLVARPKVVDRVSATASKEFL-LRSGQQVLGLVINGVSVEGEPDSYFHHAKAYYKEELI
A0A2N6LHT1      IILVTRPGFTIKEVLQRAVSEL-THNQIPIMGVVVNGITDQTE-----RYYRYAVNSYEP
A0A328V843      VLMVARPRILDRDSAKAAKEIL-GRSGQRILGTVINGISKNES-----TKYFYHAQRYFP
A0A2T1DKP1      ILLVVRPGIIDSASANAAKEFL-KQSGQNVLGMVINGVDVRSEPD---SYFYHTRER---
A0A0D6KL48      ILLVVRPGVANTGSVNATKMLL-EQSGHQVLGMVANGVTPESSYGGYYAKSYYGAKQ---
A0A6M0AN00      VVMVGRLERVTQSQLTQATAIL-RN--LNLIGIIANGVKSSNQ-----NYAYYGSRN---
A0A6P0ITZ8      LVMVTRPNFTQKDILLQTVSEL-KESSTPILGFVVNGITDQTQQYYSDSFYSYQPQSQFR
A0A6P0SLN0      ILLVVWPGKSNRNPFRDTLEQL-MRHRAQILGLVVNGVETKA----------EGYLYEHR
A0A2T1CC83      ILFVTRPGIVEHESAELAQEAL-ATTGQKILGMVVNGVKANEFDR-------YSYHGRYG
A0A1B7WWU1      LLLVVRPGKVEYSAVNAAKSLL-TQAKLPILGMVVNGIVKES--GYGGYYYSSGYYGGKG
A0A6P0S1R8      ILLIVWPGKSNRNPFRDTIEQL-VSHKANILGLVVNGIETQT----------KSYS--YE
A0A0A2B4S6      LLMVVSLNNVDMDLPLLAKNKL-KKTNRPLIGFVSNQIKKPKTFSKNRYYGYSNYSNNYG
K9SGV8          IVMLCRVGVADTNNLTFSKELL-EQSGQNILGMVVNASLPED----------DPYGYYYS
B0CA08          ILLVARPGHLEREYAQKAHELL-IHSNLSVLGTVINGILNKN----------ELYSYYSR
B0BZC6          TVVVARLDVTPKQVLNRSIDIL-NSNNVNVVGLAINGVTAST----------DKYY-RYL
A0A6G3Z709      VLLVVRPGVVDYAQGRIAKEIL-AQSNQRVLGMVANGVNPSN----------EPDGHFYY
A0A6P0M090      LLLVARPGVLDFANANVAKQML-DSSGQTVLGLVANGVIQKD----------ESIGYFYQ
A0A563VX16      TVVVARLEKANFAELMETYGLL-GRIN--VLGMVANDSREVQ----------QRYA---K
A0A0V7ZGW0      VLPVIRLGISDRYMVQETIEQL-MRHNANIIGLALNGIEQRS----------EGYI--YK
A0A355DPN1      VVIVGRISRVTQSELTEAIAML-SHLNA--IGIVANGANGST----------NRYIAYAE
A0A6J4NIB3      VLYVVRPGISDRYSVADGFEQL-MRGNARITGLVVNGVDSRT----------EGYR--YG
A0A6M0AB25      VLLVVWLGKSNRNPFRDTLEQL-MRHKAQILGLVVNGVDTQP----------EGYF--YE
A0A1D8TTM0      VLLVVWLGKSNRNPFRDTLEQL-MRHRAQILGLVVNGVDTQP----------EGYL--YG
A0A6P0VB93      ILLIVWPGKSNRNPFRDTIEQL-VSHKANILGLVVNGIETQT----------KSYS--YE
A0A6P0W0Y0      ILLIVWPGKSNRNPFRDTIEQL-VSHKANILGLVVNGIETQT----------KSYS--YE
A0A0V7ZMP6      ILFVVRTGISSRNCFHDSVEQL-KRYRAEVIGLTVNDVDSHN----------EKYIYSYN
A0A433W046      VLFVLRSGTSDRYPVMNSLEQL-TRYNARIMGLVVNGSDSHT----------SVYRYGYG
K9TU02          VLFVLRSGTSDRYPVMNSLEQL-TRYNARIMGLVVNGSDSHT----------SVYRYGYG
A0A2T1FMA8      VLFVLRSGTSDRYPVMNSLEQL-TRYNARIMGLVVNGSDSHT----------SVYRYGYG
A0A2P8QV10      VLFVLRSGTSDRYPVMNSLEQL-TRYNARIMGLVVNGSDSHT----------SVYRYGYG
B8HQ70          LLFVVRPGTSSRYSVLDSFEEL-SLRKVNVVGVTINGIETNS----------EEYY--YG
A0A2S6V636      VLFVVRSGKSDRYAVMDGFEQL-AQHHAQIMGLVVNYVEPKD----------VGYR--YG
A0A6P0IXR4      LLFVVRPEISKRDFVSDSLEQL-AQHNAQLLGLVVNGVETKS----------KPYL--YR
A0A1D9G3S3      LLFVVRPEISKRDFVSDSLEQL-AQHNAQLLGLVVNGVETKS----------KPYL--YR
A0A6P0KRF3      LLFVVRPEISKRDFVSDSLEQL-AQHNAQLLGLVVNGVETKS----------RPYL--YR
A0A6P0LQ61      LLFVVRPEISKRDFVSDSLEQL-AQHNAQLLGLVVNGVETKS----------RPYL--YR
A0A1D8TWE6      LLFVVRPEISKRDFVSDSLEQL-AQHNAQLLGLVVNGVETKS----------KPYL--YR
A0A6L9YP52      LLFVVRPEISKRDFVSDSLEQL-AQHNAQLLGLVVNGVETKS----------KPYL--YR
A0A6P0L3X9      LLFVVRPEISKRDFVSDSLEQL-AQHNAQLLGLVVNGVETKS----------KPYL--YR
A0A6M0A6X4      LLFVVRPEISKRDFVSDSLEQL-AQHNAQLLGLVVNGVETKS----------KPYL--YR
A0A1U7N3U5      LLFVVRPEISKRDFVSDSLEQL-AQHNAQLLGLVVNGVETKS----------KPYL--YR
A0A6L9ZB93      LLFVVRPEISKRDFVSDSLEQL-AQHNAQLLGLVVNGVETKS----------KPYL--YR
A0A6P0S980      LLFVVRPEISKRDFVSDSLEQL-AQHNAQLLGLVVNGVETKS----------KPYL--YR
A0A2T1EZA0      ILFLVGLGKVSRELAPQASRRI-RASGVDVLGIICNQVNFPSRLNDYGYEYGYYYHYAYA
A0A1U7JBN8      LLLVARLNRSERTEIQRVLADLGNTVQAPLLGLVVNGVP---HSRQSGYDYYYGYYGRPR
A0A2W4VXF4      LLLVVRLNQSERSEIQRVLADLGNTAQAPLLGLVINGVP---QSRQRGYS-YYGYYGRPA
A0A2W7AI98      LLLVVRLNRSERSEIQRVLADLGNTAQAPLLGLVINGVP---QIRQRGYS-YYGYYGRPV
A0A6G3Z347      VLLTATLGQITFSQLQSALDEL-DIAKIPVLGAVANGSQ-PENVKSYNY-YQYYQQSVSA
A0A2P8QVH5      TVVVERLNRVTRFDLNQSLEAL---SKLNVIGAIINESK--------------ECNSRYT
A0A2T1FT70      TVVVERLNRVTRFDLNQSLEAL---SKLNVIGAIINESK--------------ECNSRYT
A0A433W4W4      TVVVERLNRVTRFDLNQSLEAL---SKLNVIGAIINESK--------------ECNSRYT
K9U5W1          TVVVERLNRVTRFDLNQSLEAL---SKLNVIGAIINESK--------------ECNSRYT
L8M1L4          VMLVTGINKVNQKAIVNTLEVL-QSSNCNLIGFIANMVE---KDLDY-YSYSYYSHYYNQ
A0A4P5VLH9      ILFLVGLGKVSRELAPQACRRI-KATGVDVLGLICNQVNFPSRLNDYGYEYGYYYHYAYA
A0A2W6ZN45      ILYLVGLGRVGREIAPQAIKRI-KATGVDILGLMCNQVAYPTRLNDYGYEYGYHYNYSYA
A0A081GP61      ILFLVGLGKVSRELAPQASRRI-KATGVDVLGIICNQVNFPSRLNDYGYEYGYYYHYAYA
K9P6R9          ILFLVGLGKVSRELAPQASRRI-RASGVDVLGIICNQVNFPSRLNDYGYEYGYYYHYAYA
A0A1Q8BLE0      ALVVVRAGRTERSALQTAVQQL-ATVGARVLGTVLNDPDAEVPKYARYYGYYYNNYYDYS
A0A2T2S1W0      TLLVVRPGVAECDAVEASRDTL-ARLQQPVVGMVANGVNPRNERSSYYH------YYNYG
A0A5B8NQW4      TLLVVRPNMADLTSATGAKEML-QRSGQPVLGMVINGVNPSDEPDSYYYYYAQGYYYETK
A0A6P0XUL2      MVMVVGLGMTERSIFQRALDEL-KIARVPVLGLVANGVKGYTPNYSTYY---KRYYHKTA
                 :                   :         *   *                        

A0A355DU96      TSTIPDSKTKKNHIRF--------------------------------------------
A0A2N6LHT1      L---------SSRRLSRGSSA---------------------------------------
A0A328V843      LQKSHRRDRSAPPKISSRSSS---------------------------------------
A0A2T1DKP1      ----GKRNVAALDTITD-SIPTEVER----------------------------------
A0A0D6KL48      ----SHKNGKVDASISKIRIL---------------------------------------
A0A6M0AN00      ----SHGAIEQNQPVSDLQVSPQLERQFSNHVKSR-------------------------
A0A6P0ITZ8      QTHGKEASNNCAVISRGVDHADS-------------------------------------
A0A6P0SLN0      IVETS-------------------------------------------------------
A0A2T1CC83      KKYFEKGNVQYESQNNLNGSQNLSNMPEGNNANSSVSRAKL-------------------
A0A1B7WWU1      ERNKQNAEASVR------------------------------------------------
A0A6P0S1R8      SRVVETSS----------------------------------------------------
A0A0A2B4S6      YNSNYISYYADNKIRDKFTKRNLTFENSKDNFLISKIKKFRNKVLDFISWLDR-------
K9SGV8          YYYNYSSKPGQRQRQEASRQDQDQNQQETINQ----------------------------
B0CA08          YGHNSNQEKTAIKRNLLKQVISK-------------------------------------
B0BZC6          KEDYALAA----------------------------------------------------
A0A6G3Z709      LRQDAHESAEILEESALLPVGNAS------------------------------------
A0A6P0M090      SQEYFHYGSVRRLAQRQAQTKKTSNVSRR-------------------------------
A0A563VX16      NKRYLPSAEV--------------------------------------------------
A0A0V7ZGW0      HDSSQVNS----------------------------------------------------
A0A355DPN1      QNGSPLFQLN--------------------------------------------------
A0A6J4NIB3      RQRELLAAEA--------------------------------------------------
A0A6M0AB25      CKKAPISS----------------------------------------------------
A0A1D8TTM0      HKIAEVSS----------------------------------------------------
A0A6P0VB93      SRVVETSS----------------------------------------------------
A0A6P0W0Y0      SRVVETSS----------------------------------------------------
A0A0V7ZMP6      VNQQIQ------------------------------------------------------
A0A433W046      RQRELLEHEA--------------------------------------------------
K9TU02          RQRELLEHEA--------------------------------------------------
A0A2T1FMA8      RQRELLEHEA--------------------------------------------------
A0A2P8QV10      RQRELLEHEA--------------------------------------------------
B8HQ70          KQRELAATEL--------------------------------------------------
A0A2S6V636      RQRELIETEA--------------------------------------------------
A0A6P0IXR4      SSDTLVKS----------------------------------------------------
A0A1D9G3S3      SSDSLVKS----------------------------------------------------
A0A6P0KRF3      SSDTLVKS----------------------------------------------------
A0A6P0LQ61      SSDTLVKS----------------------------------------------------
A0A1D8TWE6      SSDSLVKS----------------------------------------------------
A0A6L9YP52      SSDTLVKS----------------------------------------------------
A0A6P0L3X9      SSDTLVKS----------------------------------------------------
A0A6M0A6X4      SSDTLVKS----------------------------------------------------
A0A1U7N3U5      SSDSLVKS----------------------------------------------------
A0A6L9ZB93      SSDSLVKS----------------------------------------------------
A0A6P0S980      SSDTLVKS----------------------------------------------------
A0A2T1EZA0      SASGYAKSASE------PSTGGFGSYVQRYRDSYMKGAATNSYISARYNEGESDVKTYFR
A0A1U7JBN8      VAAGIED-G---------------------------------------------------
A0A2W4VXF4      VASGIDERG---------------------------------------------------
A0A2W7AI98      VASGIDERG---------------------------------------------------
A0A6G3Z347      EKNGNSKNPSD-------------------------------------------------
A0A2P8QVH5      VYDGTSQDNLERGFTTNPNLAGRGIF----------------------------------
A0A2T1FT70      VYDGTSQDNLERGFTTNPNLAGRGIF----------------------------------
A0A433W4W4      VYDGTSQDNLERGFTTNPNLAGRGIF----------------------------------
K9U5W1          VYDGTSQDNLERGFTTNPNLAGRGIF----------------------------------
L8M1L4          PSNGNGNGNGN-------------------------------------------------
A0A4P5VLH9      NDSGSSSTYGKNGEGLGRYARDVGNLVRGYRDSYVT--------DRYISDGSSAAVQRYH
A0A2W6ZN45      G----------------------------YRDTYSQRLASKDVAEALPDN----------
A0A081GP61      SASGYAKSANQ-----GKSYGGFGSYVQRYRDSYMKGAPSNAYFNAHQQNGDLDVRSYYQ
K9P6R9          SASGYAKSASE------PSTGGFGSYVQRYRDSYMKGAATNSYISARYNEGESDVKTYFR
A0A1Q8BLE0      NAT---------------EYSNGNGAKA--------------------------------
A0A2T2S1W0      NNNGGPPRQGWRRWLPGNPFARNGKGSQ--------------------------------
A0A5B8NQW4      EEEESGKKALF-------GFGRGKSNQS--------------------------------
A0A6P0XUL2      KFDLMENIQNF-------VSPK--------------------------------------
                                                                            

A0A355DU96      ------------------------------------------------------------
A0A2N6LHT1      ------------------------------------------------------------
A0A328V843      ------------------------------------------------------------
A0A2T1DKP1      ------------------------------------------------------------
A0A0D6KL48      ------------------------------------------------------------
A0A6M0AN00      ------------------------------------------------------------
A0A6P0ITZ8      ------------------------------------------------------------
A0A6P0SLN0      ------------------------------------------------------------
A0A2T1CC83      ------------------------------------------------------------
A0A1B7WWU1      ------------------------------------------------------------
A0A6P0S1R8      ------------------------------------------------------------
A0A0A2B4S6      ------------------------------------------------------------
K9SGV8          ------------------------------------------------------------
B0CA08          ------------------------------------------------------------
B0BZC6          ------------------------------------------------------------
A0A6G3Z709      ------------------------------------------------------------
A0A6P0M090      ------------------------------------------------------------
A0A563VX16      ------------------------------------------------------------
A0A0V7ZGW0      ------------------------------------------------------------
A0A355DPN1      ------------------------------------------------------------
A0A6J4NIB3      ------------------------------------------------------------
A0A6M0AB25      ------------------------------------------------------------
A0A1D8TTM0      ------------------------------------------------------------
A0A6P0VB93      ------------------------------------------------------------
A0A6P0W0Y0      ------------------------------------------------------------
A0A0V7ZMP6      ------------------------------------------------------------
A0A433W046      ------------------------------------------------------------
K9TU02          ------------------------------------------------------------
A0A2T1FMA8      ------------------------------------------------------------
A0A2P8QV10      ------------------------------------------------------------
B8HQ70          ------------------------------------------------------------
A0A2S6V636      ------------------------------------------------------------
A0A6P0IXR4      ------------------------------------------------------------
A0A1D9G3S3      ------------------------------------------------------------
A0A6P0KRF3      ------------------------------------------------------------
A0A6P0LQ61      ------------------------------------------------------------
A0A1D8TWE6      ------------------------------------------------------------
A0A6L9YP52      ------------------------------------------------------------
A0A6P0L3X9      ------------------------------------------------------------
A0A6M0A6X4      ------------------------------------------------------------
A0A1U7N3U5      ------------------------------------------------------------
A0A6L9ZB93      ------------------------------------------------------------
A0A6P0S980      ------------------------------------------------------------
A0A2T1EZA0      EDEDQATAPVA---TNGGIGPSASSTSPLPPADSVPSRRHRPSREG-----GGGPMGWLR
A0A1U7JBN8      ------------------------------------------------------------
A0A2W4VXF4      ------------------------------------------------------------
A0A2W7AI98      ------------------------------------------------------------
A0A6G3Z347      -------------------------------------------TQDDESAWYTTPLSWLK
A0A2P8QVH5      ------------------------------------------------------------
A0A2T1FT70      ------------------------------------------------------------
A0A433W4W4      ------------------------------------------------------------
K9U5W1          ------------------------------------------------------------
L8M1L4          ---------------GNGNGNGNGNGNGNREAGSMNSIMQQFRRR---------------
A0A4P5VLH9      EEGVSRELRQSKLKSGNGNDANQVNGTEPSDQANHPKG----------------------
A0A2W6ZN45      -------------PSDQAQSSAASGSAAKPDSNQSGSSGGLNRLKG-----------WFR
A0A081GP61      QEDGSGASAATRPPSEDSKGSGVSIRSSLPDSGRESTGSHAGDSQGVRKGASQGPIGWLR
K9P6R9          EDEDQASVPVA---TNGGIGPSAGSSSSLPPAESVPSRRHRPSREG-----GDGPMGWLR
A0A1Q8BLE0      ------------------------------------------------------------
A0A2T2S1W0      ------------------------------------------------------------
A0A5B8NQW4      ------------------------------------------------------------
A0A6P0XUL2      ------------------------------------------------------------
                                                                            

A0A355DU96      ---------
A0A2N6LHT1      ---------
A0A328V843      ---------
A0A2T1DKP1      ---------
A0A0D6KL48      ---------
A0A6M0AN00      ---------
A0A6P0ITZ8      ---------
A0A6P0SLN0      ---------
A0A2T1CC83      ---------
A0A1B7WWU1      ---------
A0A6P0S1R8      ---------
A0A0A2B4S6      ---------
K9SGV8          ---------
B0CA08          ---------
B0BZC6          ---------
A0A6G3Z709      ---------
A0A6P0M090      ---------
A0A563VX16      ---------
A0A0V7ZGW0      ---------
A0A355DPN1      ---------
A0A6J4NIB3      ---------
A0A6M0AB25      ---------
A0A1D8TTM0      ---------
A0A6P0VB93      ---------
A0A6P0W0Y0      ---------
A0A0V7ZMP6      ---------
A0A433W046      ---------
K9TU02          ---------
A0A2T1FMA8      ---------
A0A2P8QV10      ---------
B8HQ70          ---------
A0A2S6V636      ---------
A0A6P0IXR4      ---------
A0A1D9G3S3      ---------
A0A6P0KRF3      ---------
A0A6P0LQ61      ---------
A0A1D8TWE6      ---------
A0A6L9YP52      ---------
A0A6P0L3X9      ---------
A0A6M0A6X4      ---------
A0A1U7N3U5      ---------
A0A6L9ZB93      ---------
A0A6P0S980      ---------
A0A2T1EZA0      RRFGNRG--
A0A1U7JBN8      ---------
A0A2W4VXF4      ---------
A0A2W7AI98      ---------
A0A6G3Z347      KSSGNKR--
A0A2P8QVH5      ---------
A0A2T1FT70      ---------
A0A433W4W4      ---------
K9U5W1          ---------
L8M1L4          ---------
A0A4P5VLH9      ---------
A0A2W6ZN45      R--------
A0A081GP61      QRFGRGSQR
K9P6R9          RRFGNRG--
A0A1Q8BLE0      ---------
A0A2T2S1W0      ---------
A0A5B8NQW4      ---------
A0A6P0XUL2      ---------
                         

© 1998-2021Legal notice