BYKdb

Dataset for cluster orphancd of phylum candidatus-atribacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3D3DCV6      MEVKKLSPKLKKLDKEFENIFIVQNDLKSPISEAFRTLRTNIRFSSLDKPLKTLLITSPI
A0A7C2R115      -------------------MFVVQNDPKSPISEAFRTLRTNIKFSSLDKPIKTLLITSPI
                                   :*:**** ***************.*******:*********

A0A3D3DCV6      PEAGKSFVSVNLALTIAQNENKVILVDADLRRPVIHKIFEGNNKPGLTNILVEDKKIEEV
A0A7C2R115      PEAGKSSISINLALTMAQDKYKVILVDTDLRKPTIHKIFEQDNKTGLTNILVEDKKIKDV
                ****** :*:*****:**:: ******:***.*.****** :**.************::*

A0A3D3DCV6      IRRVSGIDPNLYYIPSGPIPPNPSELLGSNKMQEVIEELQKQADLILFDSPPVIAVTDTL
A0A7C2R115      MRKMSDVDPNLYFIPSGPIPPNPSELLGSNKMKELLKELQEQADFVIFDSPPVIAVTDAL
                :*.:*.:*****:*******************:*:::***:***:::***********:*

A0A3D3DCV6      VLANQVNGVVLVLDVGEVSRDVAKQAKILLEKVKAKILGVILNKVDMGSEG----YYYYY
A0A7C2R115      VLATQVDGVVLVLNFGEVPREAAIQTKELLNKVKANILGVVLNKIDMEKEGQYYPYYYYY
                ***.**:******:.***.*:.* *:* **:****:****:***:** .**    *****

A0A3D3DCV6      YYDDERKKRRSQ--
A0A7C2R115      YYGDETKKKKQKRK
                **.** **...:  

© 1998-2021Legal notice