BYKdb

Dataset for cluster tadcd of phylum candidate-division-ksb1

[Download (right click)] [Edit] [Sequences] [Repertoires]

16 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1W9SG22      --------------------MYQENERQSGMKDYIRVLYRGKWIIIISFLTVVTFVSYYT
A0A1F4RMF3      MMMNSNGKGQYSGNGHANAYGSDMQERQVSIKDYIRVLYKARWVIIISFLLVVISTAYYT
A0A3N9NPA0      --MNDHASRQTSDNGSMTPMPIETNPSRITWRDYIRIFYRGRYAILVTFLVIFIGSVFFT
A0A3N9PQN5      --MNEHLS-VIPNGNSAAPAGLNGANSRVTWRDYIRIFYRGRYAILVTFLIIFLGSIILT
A0A3A0DV40      --------MGLDTFAFEDDGAME--GQKLDLGRYVQALKRRWWLALIIAAAVAIPWTIYV
A0A3A0DR05      --------------------MKEKIARQTPLADYLRVLYRGRWIILASFLAVMAITVYLG
A0A3N9NDM0      ----MDNIDLFKEMELEGFRLQNNQKLSTVLIDYIKIMFRRKWLIALCTIAVVVPITIWI
A0A660YJ49      --------------MEEFFDEPQVEQSSVDLTRFVRAIFKSWWFIGIVTVVISVPWLYYV
A0A3N5J836      ---------------------MEGKDTTHQLSEFLRILFRGRWIIAVSFLAVVGAVTFLT
A0A660YPG8      ---------------MENFQE----EQQLTLQDYLSIIYRGRWIIIISFLAVMISTIYFT
A0A661X6L5      --------MESKVPNMPDMNDFEDQEQPLQLSDYLRIMYRGRWIITFSFIAVFIATLIYT
A0A496TPL0      -----------MQNVNGTFSGLE--ENPVRLTDYLRILRRGKWIIILSFVAVVGSTAYFS
A0A660YT75      -----------MQNVNGTFSGLE--ENPVRLTDYLRILRRGKWIIILSFVAVVGSTAYFS
A0A496TXX1      --------MDAEKFFLEDIQQEE--EEGLDLQRYLRGLYRRKWMLLAIFLVILIPWLIYV
A0A496T729      --------MDAEKFFLEDIQQEE--EEGLDLQRYLRGLYRRKWMLLAIFLVILIPWLIYV
A0A496U1T9      --------MDAEKFFLEDIQQEE--EEGLDLQRYLRGLYRRKWMLLAIFLVILIPWLIYV
                                                 ::  : . .:        :        

A0A1W9SG22      FTETPIYRSTVKVMVKDNGGVQKTLFNVTDFMEKEKKINNQVEILNSRTIAENVANKL--
A0A1F4RMF3      FTTEPVYEATAKLMIEEEGGMAQSMFDLTSMMKKETMINNQVEILKSRTLAENVIRDL--
A0A3N9NPA0      FSMQPLYEASVRLMLVDQSSVGPSLFDFTSMITKETMMNNQVEILKSRTLAEHVVRDL--
A0A3N9PQN5      FTMRPIYEASVRLMLVDQSSVGQSLFDFTSMMTKETMMNNQVEILKSRTLAERVIRDL--
A0A3A0DV40      KQEKPVYEATATISFRNISAIK----------NPETMMQRIVEELNSRTFAEQVVAALGL
A0A3A0DR05      MTAVPLYQASAKVMFKTESNIGLPGFEAMGYWQTETMISNQVEIIGGRALAKAVAQKL--
A0A3N9NDM0      MHVPPSYRADATIIYEEANDTAF-LLDLGQTFYSKSAIVNMIEQIQSRTLAEEVVRSL--
A0A660YJ49      KTQPPLYEATALITFDNVKDISPTKIE------------NRILRLKSRSFAEEVTADLGL
A0A3N5J836      YRMRPEYSSSASILILNRDMVETEFLNSRPGPVPKSRNLNALEILRSRTIVEDVIRSL--
A0A660YPG8      FTAKPVYESSATVMIKQEGSVQQQLFDVGSFMKQETMINNQREILTSRTLAEMVIKKL--
A0A661X6L5      FKTPPTYEATTTLLIETNNSVEQSLFNLTSFGNQANMLTNQMEILKSRNIAERVVRNL--
A0A496TPL0      FTTTPTYEAQCMVIVDSQSRVERTLFDVGPFSQQVTMINNQVQILKSRLLAEKVISSL--
A0A660YT75      FTTTPTYEAQCMVIVDSQSRVERTLFDVGPFSQQVTMINNQVQILKSRLLAEKVISSL--
A0A496TXX1      KKQPPQYEASALIRFKTYGSDNVGLLN-----------ETRITELTSRTFAEKVVAQLGL
A0A496T729      KKQPPQYEASALIRFKTYGSDNVGLLN-----------ETRITELTSRTFAEKVVAQLGL
A0A496U1T9      KKQPPQYEASALIRFKTYGSDNVGLLN-----------ETRITELTSRTFAEKVVAQLGL
                    * * :   :                               : .* :.: *   *  

A0A1W9SG22      ----------------------------------INSTYAN-NLIILGNTPDNGKKKFGL
A0A1F4RMF3      ----------------------------------MASEYAD-ELRYLGNSPEGKEKKPGI
A0A3N9NPA0      ----------------------------------RKSSIAS-QLEVL--------ERADT
A0A3N9PQN5      ----------------------------------RKSSIAQ-ELDIL--------QRPDT
A0A3A0DV40      AVTLEQESEHEKFLIRNRIFAQLSSTYNPRAGKYVLRVPGDGQFMLAMIDEDADVEIPLR
A0A3A0DR05      ----------------------------------MQSEQAH-ELPILGANKHLQSRSGRF
A0A3N9NDM0      --------------------------------------PED-MIKTFK------------
A0A660YJ49      TLKMKKEN-HLPPLKRHEVFSHFSTTHNPVPGDYKLRFYPT-GYCAFYYNNVR-----LD
A0A3N5J836      ----------------------------------ADSPYRG-ELEIMR------------
A0A660YPG8      ---------------QNSPYADSLEVLGNGPDSKRKSFMGL-ILSLFKKGDEN-------
A0A661X6L5      ----------------------------------EKSDVRD-SISFFQ------------
A0A496TPL0      ----------------------------------LESGLQD-SLSLFRVE----------
A0A660YT75      ----------------------------------LESGLQD-SLSLFRVE----------
A0A496TXX1      TLEMLAET-KERPLRRQKVFEQFSTTTDPISGEYLLEFKDD-VFSLFQLNELDKAPRLLV
A0A496T729      TLEMLAET-KERPLRRQKVFEQFSTTTDPISGEYLLEFKDD-VFSLFQLNELDKAPRLLV
A0A496U1T9      TLEMLAET-KERPLRRQKVFEQFSTTTDPISGEYLLEFKDD-VFSLFQLNELDKAPRLLV
                                                                            

A0A1W9SG22      KKKLKKIVKSVFVNEEEVTIPESEIKEA---------LFNRVVGEIRRN-LKIEPIRNTD
A0A1F4RMF3      IASTRSWLAGLIKNKDDHGLEVSE--ED---------DFDRYVAGLRGS-INVSPIRNTD
A0A3N9NPA0      VKAAFSLARLLRSKKTEW----VE--SE---------IFDDQVVTFRKR-LGVRHIRNTD
A0A3N9PQN5      VKAAFSISRLLGSNRKPW----AE--AE---------IFDDQVQQLRES-LIVRHIRNTD
A0A3A0DV40      TGDVFRAASDTISVNGISFQLA-DPQKLPQKVTFVVAPFKKVVSSLQQR-VQPGLNQSLT
A0A3A0DR05      SRFLNALFGSSAADDSRNEMQEPVLLEVETV-----------ARELPGY-ISVAPIRSTD
A0A3N9NDM0      -------------------------LPERLPEHLSRDQFI--VRLIREE-LQVEHVRGGD
A0A660YJ49      SLHVSNFVSDTVFYNGLRFSLRDDVVGRRSVIRFTINPFQATVNSLRSR-EKITNSRTGN
A0A3N5J836      -----------------------EAAPSGMPITFDNR-----VSTLRNK-VGVTLQKDTD
A0A660YPG8      ---------------------EPEPFNNL-------------VRNFREGVITVLPKRDTD
A0A661X6L5      ------------------------PLEDGTELTFNDR-----VEIVMKS-MDVEPKRDTD
A0A496TPL0      ---------------------NPEDLHVGYRRYF--------VRHLQEA-LSIEPVRDTD
A0A660YT75      ---------------------NPEDLHVGYRRYF--------ARHLQEA-LSIEPVRDTD
A0A496TXX1      SDSLSKIIDQTYDVNGFSFRINPDILKERSRIHFRVKNFRRTVDNFRKQ-IKVRFNRTGT
A0A496T729      SDSLSKIIDQTYDVNGFSFRINPDILKERSRIHFRVKNFRRTVDNFRKQ-IKVRFNRTGT
A0A496U1T9      SDSLSKIIDQTYDVNGFSFRINPDILKERSRIHFRVKNFRRTVDNFRKQ-IKVRFNRTGT
                                                          .  .          .   

A0A1W9SG22      MILISMTAESPTEAAYLANTVAVAYKEQNQFESQEEVRKVKDFLKDQLNNFQSQLEKSEQ
A0A1F4RMF3      MINITVSAYSPFEAAYVTDAVANAYRRMNQAQSKDEVRQVKNFLEDQLDQYRRELSTSEE
A0A3N9NPA0      MIEIKFQAHTPTEAAFVSNAVAFAYERINQEESKAEIQQVTEFLKNQLALYQDSLQVSED
A0A3N9PQN5      MMEIRYQAHSPEEACFIANTIALAYERINQEESKAEVQQVTDFLENQLQLYQDSLKVSED
A0A3A0DV40      LMSVKLTDNDPYVVTQTVNSLAKLYVDKSRVVGAGEDTKQLETLQEQVRQAQRDYDEIDQ
A0A3A0DR05      MILLSVVSEDPQEAMIIANAYVEAYSELNRAMSQAEVRQVKNFLENQLGVIQQQLAESEL
A0A3N9NDM0      ILKIIVQANDPNAAKNIANSYVDHIIDWNTQKNRKEISSIRNFVEGQLSVFQDKLRDAEE
A0A660YJ49      LMKITLKDTNPVLASRTVNRLANIFVEKSMAMNREEATLLSSHLQKELKVAKEELNKSDY
A0A3N5J836      LLKVSVIAYSPFESAFLTNALAEQFYRYSLQTSRGEITDVRLFLEQQLDVVRQQLSQSEE
A0A660YPG8      IIELKAKAGTPFEAALIANTWMEAYRELDVSESRSEVTGVRQFLQEQLEKVQKELAVSEE
A0A661X6L5      ILTLKYQAGSPFEAAYIANVIAQEFAKQNAETNRLEVTEMRKFIEGRLRIKAKELKESEE
A0A496TPL0      VIKIKVKAPSPQEAAFLANKVAEVYQNLDREFSRGEISQVVTFLRDQLQKKEESLRAAEE
A0A660YT75      VIKIKVKAPSPQEAAFLANKVAEVYQNLDREFSRGEISQVVTFLRDQLQKKEESLRAAEE
A0A496TXX1      LMWVSLTDRDPSLVATMVNQLAQMYVEESKFFSLKKVKDVKEVVENQLKIAKENLDKANE
A0A496T729      LMWVSLTDRDPSLVATMVNQLAQMYVEESKFFSLKKVKDVKEVVENQLKIAKENLDKANE
A0A496U1T9      LMWVSLTDRDPSLVATMVNQLAQMYVEESKFFSLKKVKDVKEVVENQLKIAKENLDKANE
                :: :      *       :         .   .  :       :   :     .    : 

A0A1W9SG22      ALKEYKEKEKVVALPQEIDEMVSKLAEFESLYHGAKLELNANKERLVYIDEQLDKNKKNI
A0A1F4RMF3      ALKNYKQEAKLVALDQETEELVRKLAEFESLYNGAKTDYQANLKRLEYINGQLQQKQGNF
A0A3N9NPA0      ALKAYQERAKVVALDHETSELVRKIAEFETLYNAAKTDLEAARQRLNYIDSELEKQNTDF
A0A3N9PQN5      ELKSYQESAKVVALDHETLELVRKIAEFETLYNAAKTDLEAARQRIIYIDAELERQNTDF
A0A3A0DV40      RYTEAKRRAGGNVGGNRYEVTVAKLSEAEK-------KLEVLKQQRDGLKELLDRAANTQ
A0A3A0DR05      ALKDYLKGETPMTLTDETNGLVTKLVEFESLYKESLADLEAARERLKFIDQQLGKRGDIA
A0A3N9NDM0      ALVTFKENNDVIQLSDASSKVLENLTEAEVAYSKARAEREALQQR----KHIIEQKKQEL
A0A660YJ49      ALKRFRKQH-PVSLSKQNENTVNKLNTLELAIKSNNLAKRGLEMLLRKLDPNVTDITSGI
A0A3N5J836      MERTYKENQGVSALDQETTQLVGQSAEFHALYNTTQTELNAQLRRQEYLRRQIAETKGTM
A0A660YPG8      ALKEYKEKEGVTALTAETEQLIQNLAQFESLYRSAQTDLQANEKRLEYLKEQLGENKKNF
A0A661X6L5      RLRNFQQREKIASLDAETTQLVEQLSQAESMLEEARIDLQTKQQLLNNVNKLLDERKKAL
A0A496TPL0      ALRKFQQDEGIVALSQETQEMVKQLVEFESLYQEAVTDRKTYEKRLEYLKSQLGELRRTL
A0A660YT75      ALRKFQQDEGIVALSQETQEMVKQLVEFESLYQEAVTDRKTYEKRLEYLKSQLGELRRTL
A0A496TXX1      ELKRFKESH-FISLDTEVKQNVNELSDLEN-------EIRTIKENIESLSLLLRRLEKSF
A0A496T729      ELKRFKESH-FISLDTEVKQNVNELSDLEN-------EIRTIKENIESLSLLLRRLEKNF
A0A496U1T9      ELKRFKESH-FISLDTEVKQNVNELSDLEN-------EIRTIKENIESLSLLLRRLEKNF
                                     : :                            :       

A0A1W9SG22      NMENI-----LNAPFLDQLSQQMAELETKRANY------IAGLMDEGVYDPNGQDPM--L
A0A1F4RMF3      DMESI-----SSQPYLQELKKQIAEKESQLASY------MASMAEIGAYDQIKN----EI
A0A3N9NPA0      DIEAI-----SKTTALEEFTKRIAEKESKLAVY------QAQTLQKGLSSDTKKHTLREI
A0A3N9PQN5      DIETI-----SKTTALEEFTKKIAEKESMLAVY------QAQTIQKGLSADTKKHTLREI
A0A3A0DV40      VSSVSGVEREAISYVYKGIANHSLFDNNASM--------VVARQRLSDLESRRADEL---
A0A3A0DR05      AI--------SATSFLDELKKEMADLQQQRAAYLAY---LAQNGRLDENNARLQELD---
A0A3N9NDM0      LPSLG----VPVSKITQQLKEELLDLERQYS--------RLQLQVGLDDQEKLASMR---
A0A660YJ49      SA----------RYVYRQIPQLPIFQDDPAM--------SILSRNLTDLDRARNNLI---
A0A3N5J836      VEDIS----SASSPLIESIQREIADKQTRIA--------TLMANSGPGTDVTVAALE---
A0A660YPG8      LS--S----NLSSPVIEELQKQMGQLIADIA--------AYRQQIESSSLSDNKKYLSLL
A0A661X6L5      GVNLT----ETSTPYIQALQQELADAEAKKVIYLSAIKASVQEGQAVYFDDQLKQYD---
A0A496TPL0      ETDLA----DISHPLILELRQKIAESEAKLV--------NFKAQGIPESYPDFKKEN---
A0A660YT75      ETDLA----DISHPLILELRQKIAESEAKLV--------NFKAQGIPESYPDFKKEN---
A0A496TXX1      ETTEA----SETRYIYRQIARHPAFQQDPNM--------GILQQQLADLESQRDQLL---
A0A496T729      ETTEA----SETRYIYRQIARHPAFQQDPNM--------GILQQQLADLESQRDQLL---
A0A496U1T9      ETAEA----SETRYIYRQIARHPAFQQDPNM--------GILQQQLADLESQRDQLL---
                                  :                                         

A0A1W9SG22      RRYEERTKMLEEKYKSEITQLAAAETID---PIALSEALLQRKLEVEATIQSLLPQVEAL
A0A1F4RMF3      QLRERQIDAVKEKFKQEVTKIAASGFVD---PSIVSTSLFSSKIEVETELKSLEPKVKAL
A0A3N9NPA0      ENLQNQITALKEQFQEDVKAVAANQFMD---PAQVSSSLFTSKIAVETELRSLTPKVDAY
A0A3N9PQN5      ENLQNQIDALKERFKEDVKAVAANQFMD---PAQVSSSLFTSKIAVETEIRALTPKVEAF
A0A3A0DV40      ----RSKTERHPDVIALENEITQLYAQIQSSGRTKLSNLAQEISRQGREVALLE------
A0A3A0DR05      ----GQIERLTQKFRAELASFTAAGLGG---PANLQDEMFMRKFEVEANIETLIPKVASL
A0A3N9NDM0      ----EKINQTKQDLIDELMHNAAQENLVD--PLSQIRNLLQEAITIDVDLETCKAQEQAL
A0A660YJ49      ---KNGFPVNNPDVIEISERISTLENRIYDMAVNKVKELEKANSDMQQQISDLK------
A0A3N5J836      ----KEVEAIKSKLIEEVRKVASGGASAID-PMRTSQRLFDELLSTDVEIKALTARAEAL
A0A660YPG8      QEKESRLKGIQSKIVEEKKKIIETGMGSLN-PMAVSETLLTNILTLETENTALKARTREL
A0A661X6L5      ----EKIKALREQLNKEAQKLVASGM-VSD-PLKISEDLVAKSITLTGEVDAAKAKITAL
A0A496TPL0      ----ERLASLKRTLTEETKKVLLARYPVHD-PLKPYQEILEKIITAETEVEALQAKEDAL
A0A660YT75      ----ERLASLKRTLTEETKKVLLARYPVHD-PLKPYQEILEKIITAETEVEALQAKEDAL
A0A496TXX1      ----TRVTESHQDVVEINAQIKFIQLQIKDLAKKRLEQLYEELATAERTASNLR------
A0A496T729      ----TRVTESHQDVVEINAQIKFIQLQIKDLAKKRLEQLYEELATAERTASNLR------
A0A496U1T9      ----TRVTESHQDVVEINAQIKFIQLQIKDLAKKRLEQLYEELATAERTASNLR------
                                                      :                     

A0A1W9SG22      KKIVAQYNLQLEKIPERGLKLARLKRAAMLDEKITLMMSEKYEETRITEVGQLGSVRIID
A0A1F4RMF3      GEIVAQYSKDLESLPAKSLQLARLVRKAQVDEKIYIMLQEKFQESRITEVGQLGNVRMID
A0A3N9NPA0      GKILTEYNAQLESLPAKKLELARLSRSAQVAEKLYILLQEKYQESRITEVGQLGNVRIVD
A0A3N9PQN5      GKILTEYNLQLESLPAKKLELARRTRSAQVAEKLYILLQEKYQESRITEVGQMGNVRIID
A0A3A0DV40      --------GQLGSLPNVESTLLGLERQWKQKSDYLQSLQEQLQKGKIAVTSDKSDIEILD
A0A3A0DR05      KHIVDDYAKKLESLPEKKLLMVRLQRSAQVDEKIFLMMKEKYEELRITEVGQLGDVRIIE
A0A3N9NDM0      KNAVDEHDAELQMLPQQELELARLIRAKEVNDKIYGTLLEKREEARITESGKIGDIRVID
A0A660YJ49      --------GLLDVLPDEENRLINLTRERDTNEELYNMVLKRFKEAQISAASVTEQVNVLD
A0A3N5J836      REVMQNMDYDLERLPQKTLVLARLTRDRELNEKLYLMLNEKYEESRITEAGKSAGVQIVD
A0A660YPG8      RSIVRQYNKRLNKLPDKSLRLARLTREATVNNNIFMMLRTKYEENRIAEAGQIGLVRIVD
A0A661X6L5      RGVLDKYNARMKELPDKVLQLARLERRRQVDEQTYIMLTQKLEEAKIQESAQARNVRIID
A0A496TPL0      KKIVDQHLLKLDTLPEKSLKLARLERAKKLNENLYMMMKEKYEESRITRAGQIGKIRIVD
A0A660YT75      KKIVDQHLLKLDTLPEKSLKLARLERAKKLNENLYMMMKEKYEESRITRAGQIGKIRIVD
A0A496TXX1      --------YKLKMLPSEQLKLAELTQKVKVNEDIYSSLLAKYQEAQISEAVRTEEISILD
A0A496T729      --------YKLKMLPSEQLKLAELTQKVKVNEDIYSSLLAKYQEAQISEAVRTEEISILD
A0A496U1T9      --------YKLKMLPSEQLKLAELTQKVKVNEDIYSSLLAKYQEAQISEAVRTEEISILD
                          :  :*     :    .     ..    :  . :: .*        : :::

A0A1W9SG22      AAQPNIIPIRPQIKMNIILGIIVGLGLGIGISFLLDYFDNSVRSADEIEK-MGISLLGSI
A0A1F4RMF3      PAKEPKFPVKPKKKLNLILGILVGLGLGIGIAFVMEYMDNSLRTMEDIEI-LGQSIIATI
A0A3N9NPA0      AAKAPDKPILPKKKLNLLLGLLLGLGFGIAIAFAIEYIDDSVRSMEDLEH-LRLSMIATI
A0A3N9PQN5      PAKEDEEPISPKKKLNLFLGIIIGLGLGVAIAFVMDYVDDSVRTMEDLDA-LHLPLLATI
A0A3A0DV40      PAIEPEYPVNRNKKAKAATGGVAGLLLGMFVVVALEALDRSIKSVDDIKGNLKLNVLGTI
A0A3A0DR05      PAELPETPLGPNRKLNIILGMILGLGLGVGLAFLLDMLDNSVRTMEDLER-MGQPVLGSI
A0A3N9NDM0      YAELPIKPVKPQKKKIFVLALMLGLSLGVGLAFFLNSLDNSLKSEQDVEKCLNLPVLASI
A0A660YJ49      PAVPPNAPISGSKKIKAIIGILFGLFLGIGAVVTKELLDKSVKTPEDVKNYLNLSILGVI
A0A3N5J836      PAKPSVEPFRPKKKLNILLGMLFGLVIGVGIAFFLEFLDDTVKTGDDVER-LGMTLLGTI
A0A660YPG8      RATPPERPISPKKKMNLLLGFFLGLGLGLGIVFTMEYLDTSLKTVEEVER-RGIPVLGSV
A0A661X6L5      KAIKPQKPVKPNKKMNIMLGILLGLGLGIGITFMMEYLDRSVRKPEDVER-LGVNVLATI
A0A496TPL0      PAVPPEFPISPKKKLNLILATLVGLGLGIGVVFFLEYLDNSVRTVEDVER-LQLPLLGSI
A0A660YT75      PAVPPEFPISPKKKLNLILATLVGLGLGIGVVFFLEYLDNSVRTVEDVER-LQLPLLGSI
A0A496TXX1      PALPPEYPVNRDKKQKAVIGGFFSLFFSIFVGVFLEFLDKTLKTPDDIKRYLKLNVIGSI
A0A496T729      PALPPEYPVNRDKKQKAVIGGFFSLFFSIFVGVFLEFLDKTLKTPDDIKRYLKLNVIGSI
A0A496U1T9      PALPPEYPVNRDKKQKAVIGGFFSLFFSIFVGVFLEFLDKTLKTPDDIKRYLKLNVIGSI
                 *     *.  . *     . . .* :.:   .  : .* ::.. :::.      ::. :

A0A1W9SG22      PVISLDEAVKKI------------GKNGNNRFKKNINTNEVRTIAGRLITHFAPKSPISE
A0A1F4RMF3      PFIKPEGS------------------NGALSKFKQLEDAEAQDISERLVTHLRPKSPISE
A0A3N9NPA0      PHIKPEQS------------------NGLIAKMVKLDDPEVNAINERLVTHLKPKSPVSE
A0A3N9PQN5      PLIKPEQG------------------NGLLAR-IKLEDPEVNAISERLVTHLRPKSPVSE
A0A3A0DV40      PQINFGEY----------------YEF--------QDQEKAKLIDQQLVTHDYAPTPVGE
A0A3A0DR05      PMIKEGETLARLKISKNGAPNGVHHGLSNGKVSAIENKLEQQPTAARLITHVAPKSPISE
A0A3N9NDM0      PNISSNGV----------------LRK------ITKKEDADNLYSSKLLSQLLAKSYIFE
A0A660YJ49      PTVTFKNL----------------DLP---------DDEKAKSISSQIVTHDYSPTPVGE
A0A3N5J836      PLVYTEQI----------------IKRLKKQGKQFTDAD-LHRVEAKMITRFSPKSPVSE
A0A660YPG8      PLISPKNL----------------AHS------LNGNNGEAKQIKSRLITHFEPKSPISE
A0A661X6L5      PKIELDKV----------------EKA-------KQRLNEGHRVESRLITHIDPKSPVSE
A0A496TPL0      PDIEPEKQ----------------NGLWRALPKKKGSEDEVGRLATRLVTHLKPKSPYSE
A0A660YT75      PDIEPEKQ----------------NGLWRAIPKKKGSEDEVGRLATRLVTHLKPKSPYSE
A0A496TXX1      PKIEFDHE----------------YEL--------KDADKIKQIDAQLVTYDYSPTPVSE
A0A496T729      PKIEFDHE----------------YEL--------KDADKIKQIDAQLVTYDYSPTPVSE
A0A496U1T9      PKIEFDHE----------------YEL--------KDADKIKQIDAQLVTYDYSPTPVSE
                * :                                           .:::   . :   *

A0A1W9SG22      AYRSLRTSIQYSQADKTIKSIVFTSPGPKEGKSTTVVNLAIAIAQMGTNVLLVDTDLRRP
A0A1F4RMF3      SYRTLRTNIMFSNPDKEIKSIVITSSGPKEGKSTSISNLAITFSQMGTNTLLIDGDLRRP
A0A3N9NPA0      AYRTLRTNILFTAPDNPKHIIMLTSTGPREGKSTSVANLAITFAQMGTKTLLIDADLRRP
A0A3N9PQN5      AYRTLRTNILFAAPDKPKQIIMMTSTGPREGKSTSVANLAITIAQTGARTLLIDADLRRP
A0A3A0DV40      AYRSLRTNILYSKSAGRIQTFVITSTAPGDGKSFTAANLSITMAQQKSNTLLIDTDLRRG
A0A3A0DR05      AYRALRTNIQYTHIDRTLRTLLVTSPGPGDGKSTSVANLAIVMAQMGSKVLLIDADLRRP
A0A3N9NDM0      AYRSLQLNFSLLNPDKNLKTVVITSAAPGEGKTLTSLNIAQLYARAGIRTLVMDCDLRRP
A0A660YJ49      AYRSLRTSLLYSKRYGKIKTLVIGSAAPGEGKSFTAANLAITMAQQKSKTLLIDADLRRG
A0A3N5J836      AYRSLRTNIQFADIDKPKRVLMVTSTMSKEGKSTSIVNLAITLTQMGSRVLLVDSDLRRP
A0A660YPG8      SYRTFRTNVQYTKVDNPVKTIVITSAGPGEGKSTTAANLAIAFAQMGVKTLIVDTDLRRP
A0A661X6L5      AYRTLRTNLQFSKVEKELRTILVTSAGPKEGKSTTASNLAIAMAQAGNSVVLVDADLRRP
A0A496TPL0      AYRSLRTQIQYARSEKPVQTILVSSPGPGEGKSTSVTNLAITMAQMGSKTILVDSDLRRP
A0A660YT75      AYRSLRTQIQYSRSEKPVQTILVSSPGPGEGKSTSVTNLAITMAQMGSKTILVDSDLRRP
A0A496TXX1      AYRALRTKIMFSKQTGNIRTLVITSFAPYDGKSFTCSNLAVTLAQHKTNTLLVDADLRRG
A0A496T729      AYRALRTKIMFSKQTGNIRTLVITSFAPYDGKSFTCSNLAVTLAQHKTNTLLVDADLRRG
A0A496U1T9      AYRALRTKIMFSKQTGNIRTLVITSFAPYDGKSFTCSNLAVTLAQHKTNTLLVDADLRRG
                :**::. ..         . .:. *  . :**: :  *::   :.    .:::* **** 

A0A1W9SG22      VIHSIFNLNRNKGLSNCLVGKT----SIEEAISKT-DIDNLCVIPSGTLPPNPSELLGST
A0A1F4RMF3      ILHKLFNLDKKNGLTNVLVGRA----NLDEVVQRNPDLPNLDVLSCGILPPNPAELLGSQ
A0A3N9NPA0      MLHKLFQKEKEPGLTNVLVGGT----VLESVIKTVNEVPNLFLLTCGVIPPNPAELLGST
A0A3N9PQN5      MLHKLFQKEKEPGLTNVLVGRK----SLSDSVKAVEEVPNLHLLTCGVTPPNPAELLGSN
A0A3A0DV40      VLHNTFAVPKEPGFSNYLTGSV----LASEIIHETHI-PNLSVISCGSLIPNPSEMLGSV
A0A3A0DR05      VLHTVFNLDRRVGLSNVLVGRA----DIAEAVSPTDI-ENLHIMPCGALPPNPSELLGSS
A0A3N9NDM0      MVHKALKIRQEPGLTNALIDKAAHLESYVQLFNDESLHDNLAVLTCGALPPNPSEILGSK
A0A660YJ49      VLHNTFDCPKKPGFTNFLSGTA----TLSNVMYDTYI-PNLSLITCGTLIPNPSELLGSD
A0A3N5J836      SLHNFFSMDKTYGLTNVLIGSL----SFDEVVKHTEV-EKLDVITSGDIPPNPAELVASE
A0A660YPG8      VQHGIFGVQRGEGFTNVLYGKV----NLSDAVRDTEI-DNLQLLTAGVLPPNPSELLASE
A0A661X6L5      LIHSVFGLDKDQGLTNYLAGSL----PYEQLLHESFI-ENLKIVPSGVLPPNPSELLATN
A0A496TPL0      VLHSLFDLKRDVGLSNYLVGRA----EIEEVIRPTSV-DNLYLISCGILPPNPSELLGSK
A0A660YT75      VLHSLFDLKRDVGLSNYLVGRA----EIEEVIRPTSV-DNLYLISCGILPPNPSELLGSK
A0A496TXX1      VLHNTFSVPKEPGLSNFLMGMV----SFEELLNETHV-PNLTVVSCGSMMPNPSELLGSL
A0A496T729      VLHNTFSVPKEPGLSNFLMGMV----SFEELLNETHV-PNLTVVSCGSMMPNPSELLGSL
A0A496U1T9      VLHNTFSVPKEPGLSNFLMGMV----SFEELLNETHV-PNLTVVSCGSMMPNPSELLGSL
                  *  :   .  *::* * .         . .       :* ::..*   ***:*::.: 

A0A1W9SG22      KMKKFISELEERFDLVLFDSPPIMAVTDAAVLSSEVDGVVMVVKEGQTNRDAVMRCYNIL
A0A1F4RMF3      QMRRLLTEAKEKYGIILIDTPPTIAVTDSSVLAPLVDGVLLVVKSGGTQRDAFLRAQEQL
A0A3N9NPA0      LMRNLLHRAREHYEIILIDSPPIIAVTDPSVLARIVDGVVMVIRIASTQRGAAQMAVEQL
A0A3N9PQN5      LMRELLQFARGQYDTILIDTPPIIAVTDPSVLARIMDGVILVVRTASTQRGATLMAVEQL
A0A3A0DV40      QLRRFLDEMRRRYDLIIFDTPPLNAATDAVVLGTQVDGAVIVVRSGKTNREVARKKIEMF
A0A3A0DR05      AMQRTLEALKQDYEVVLFDSPPVIAVTDAAVLARWVDGVFLVVKAGHTSKEAAFRSYALL
A0A3N9NDM0      RMGDLLAQLEDMYGLIIIDAPPIISVTDSIILGQKVDGVLLVLRSGKITREAAQKAKKIL
A0A660YJ49      RMKEFIKVVSEEFDFVIFDTPPLMAATDAVILGTLVDGVAVIIRSGMTNRENIKRKLELF
A0A3N5J836      AMKKFIEEARARYDYVLLDSPPVVAVTDSAILATRVDGTLLVVSSGMVSKREVQRAAGLL
A0A660YPG8      AMEKFLKDVNSKFGMVIFDSPPVIAVTDAAVLSAMLDGVILVVKSGTTKDDALTRAKILL
A0A661X6L5      KMKDLLKKLQDDFDIVIIDSPPVIAVTDASILSTIVDGTLLVVYAGQTERDAIKRAIMML
A0A496TPL0      RMQELIQQLKNEYDYVLFDSPPLIAVTDAVVMAPWVDGVVLVLRSGKTDRDAAVRAFELL
A0A660YT75      RMQELIQQLKSEYDYVLFDSPPLIAVTDAVVMAPWVDGVVLVLRSGKTDRDAAVRAFELL
A0A496TXX1      RLRKFIDEAKRRFDFVIFDTPPLNAATDAVVLGTQVDGVTLIVRAGKTNRNIARQKLDLF
A0A496T729      RLRKFIDEAKRRFDFVIFDTPPLNAATDAVVLGTQVDGVTLIVRAGKTNRNIARQKLDLF
A0A496U1T9      RLRKFIDEAKRRFDFVIFDTPPLNAATDAVVLGTQVDGVTLIVRAGKTNRNIARQKLDLF
                 :   :      :  :::*:**  :.**. ::.  :**. :::  .             :

A0A1W9SG22      KSVPNQLLGAVMNGINVNGFSDYYYYYQ----Y--HYYGKEDKKKKRIFRREKV------
A0A1F4RMF3      HRVGAHILGVILNSIQASNVYGSYYYYY----YYHYYYGQDGEKKRSKSRRRKAHKKTHP
A0A3N9NPA0      RRVEAPLIGVMLNGISASNFYGSFYYQQ----YY-YYYTKDGNKKRTKKRNRKPFKHLA-
A0A3N9PQN5      RRVQAPLVGVVLNGISTGNFYGSLYYQQ----YY-YYYTTDGQKKRRKVKKQQQSV----
A0A3A0DV40      QNVQAKILGVILNGTTVDLAHEGYSYYQ----Y---------------------------
A0A3A0DR05      NQVKAKVLGTLLNSVKVESMYGSYYYYY----HYHYYTQNSNGKLPKTQRKLLSWPWS--
A0A3N9NDM0      ENSKIHIAGTLLNDVDLKKVYGYYKDYY----YYSNKKMAVES-----------------
A0A660YJ49      ETVQTTVVGAVLNCAGVDVAHEGYSYYR----Y---------------------------
A0A3N5J836      KNVRSSVMGVVLNGLDIKKIYGSYYYYFHYYQYYYYYGSEHKSGKSRKKKSASADYQEVT
A0A660YPG8      NNVNAEFLGVLVIGIDINRMYGSYYY----------------------------------
A0A661X6L5      SSVSARLLGTVLNGFDVQGIYGSYYYYY----YHHYYGPSKKKKSRRFF-----------
A0A496TPL0      RNVKANVLGTLLNDVLPSYMYGSYYYYY----YYYYYSSEDGKTKKRKKKHHHHTQLYTS
A0A660YT75      RNVKANVLGTLLNDVLPSYMYGSYYYYY----YYYYYSSEDGKTKKRKKKHHHHTQLYTS
A0A496TXX1      DNVPATIIGVIINGAEKDLAHEGYSYYH----Y---------------------------
A0A496T729      DNVPATIIGVIINGAEKDLAHEGYSYYH----Y---------------------------
A0A496U1T9      DNVPATIIGVIINGAEKDLAHEGYSYYH----Y---------------------------
                      . *.::                                                

A0A1W9SG22      ----------
A0A1F4RMF3      SDQTIREGDA
A0A3N9NPA0      ----------
A0A3N9PQN5      ----------
A0A3A0DV40      ----------
A0A3A0DR05      ----------
A0A3N9NDM0      ----------
A0A660YJ49      ----------
A0A3N5J836      ----------
A0A660YPG8      ----------
A0A661X6L5      ----------
A0A496TPL0      ----------
A0A660YT75      ----------
A0A496TXX1      ----------
A0A496T729      ----------
A0A496U1T9      ----------
                          

© 1998-2020Legal notice