BYKdb

Dataset for cluster tadcd of phylum candidate-division-ksb1

[Download (right click)] [Edit] [Sequences] [Repertoires]

19 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3N9NDM0      ----MDNIDLFKEMELEGFRLQNNQKLSTVLIDYIKIMFRRKWLIALCTIAVVVPITIWI
A0A660YJ49      --------------MEEFFDEPQVEQSSVDLTRFVRAIFKSWWFIGIVTVVISVPWLYYV
A0A3A0DV40      --------MGLDTFAFEDDG--AMEGQKLDLGRYVQALKRRWWLALIIAAAVAIPWTIYV
A0A6A0HWZ1      --------MGLDTFAFEDDG--TMEGQKLDLGRYVQALKRRWWLALIIAAAVAIPWTIYV
A0A3N5J836      ---------------------MEGKDTTHQLSEFLRILFRGRWIIAVSFLAVVGAVTFLT
A0A660YPG8      ---------------MENFQ----EEQQLTLQDYLSIIYRGRWIIIISFLAVMISTIYFT
A0A661X6L5      --------MESKVPNMPDMNDFEDQEQPLQLSDYLRIMYRGRWIITFSFIAVFIATLIYT
A0A496TXX1      --------MDAEKFFLEDIQ--QEEEEGLDLQRYLRGLYRRKWMLLAIFLVILIPWLIYV
A0A496T729      --------MDAEKFFLEDIQ--QEEEEGLDLQRYLRGLYRRKWMLLAIFLVILIPWLIYV
A0A496U1T9      --------MDAEKFFLEDIQ--QEEEEGLDLQRYLRGLYRRKWMLLAIFLVILIPWLIYV
A0A3A0DR05      ------------------MK--EKIARQTPLADYLRVLYRGRWIILASFLAVMAITVYLG
A0A6A0HKF6      ------------------MK--EKIIRRTPIADYVRILYRSRWLILASFLGVMFITLYLN
A0A6A0HPL4      ------------------ME--ELHERQISFNDYIRILYRGRWIILASFLAVMLITGYIT
A0A496TPL0      -----------MQNVNGTFS--GLEENPVRLTDYLRILRRGKWIIILSFVAVVGSTAYFS
A0A660YT75      -----------MQNVNGTFS--GLEENPVRLTDYLRILRRGKWIIILSFVAVVGSTAYFS
A0A1W9SG22      --------------------MYQENERQSGMKDYIRVLYRGKWIIIISFLTVVTFVSYYT
A0A1F4RMF3      MMMNSNGKGQYSGNGHANAYGSDMQERQVSIKDYIRVLYKARWVIIISFLLVVISTAYYT
A0A3N9NPA0      --MNDHASRQTSDNGSMTPMPIETNPSRITWRDYIRIFYRGRYAILVTFLVIFIGSVFFT
A0A3N9PQN5      --MNEHLS-VIPNGNSAAPAGLNGANSRVTWRDYIRIFYRGRYAILVTFLIIFLGSIILT
                                                 ::  : . .:        :        

A0A3N9NDM0      MHVPPSYRADATIIYEEANDTA-FLLDLGQTFYSKSAIVNMIEQIQSRTLAEEVVRSL--
A0A660YJ49      KTQPPLYEATALITFDNVKDIS------------PTKIENRILRLKSRSFAEEVTADL--
A0A3A0DV40      KQEKPVYEATATISFRNISAIK----------NPETMMQRIVEELNSRTFAEQVVAAL--
A0A6A0HWZ1      KQEKPVYEATATISFRNISAIK----------NPETMMQRIVEELNSRTFAEQVVAAL--
A0A3N5J836      YRMRPEYSSSASILILNRDMVETEFLNSRPGPVPKSRNLNALEILRSRTIVEDVIRSLAD
A0A660YPG8      FTAKPVYESSATVMIKQEGSVQQQLFDVGSFMKQETMINNQREILTSRTLAEMVIKKLQN
A0A661X6L5      FKTPPTYEATTTLLIETNNSVEQSLFNLTSFGNQANMLTNQMEILKSRNIAERVVRNLEK
A0A496TXX1      KKQPPQYEASALIRFKTYGSDNVGLLN-----------ETRITELTSRTFAEKVVAQL--
A0A496T729      KKQPPQYEASALIRFKTYGSDNVGLLN-----------ETRITELTSRTFAEKVVAQL--
A0A496U1T9      KKQPPQYEASALIRFKTYGSDNVGLLN-----------ETRITELTSRTFAEKVVAQL--
A0A3A0DR05      MTAVPLYQASAKVMFKTESNIGLPGFEAMGYWQTETMISNQVEIIGGRALAKAVAQKLMQ
A0A6A0HKF6      LTAVPLYQANAKVMVKMESNMALPIFGGSA-WQMETTISNQVEIIKGRALAKAVAQRLLD
A0A6A0HPL4      FTTKPVFEATAKLMIEEKGGMEGQIFDIGGFIKKETMVNNQVEILRSRSLAETTIERLQK
A0A496TPL0      FTTTPTYEAQCMVIVDSQSRVERTLFDVGPFSQQVTMINNQVQILKSRLLAEKVISSLLE
A0A660YT75      FTTTPTYEAQCMVIVDSQSRVERTLFDVGPFSQQVTMINNQVQILKSRLLAEKVISSLLE
A0A1W9SG22      FTETPIYRSTVKVMVKDNGGVQKTLFNVTDFMEKEKKINNQVEILNSRTIAENVANKLIN
A0A1F4RMF3      FTTEPVYEATAKLMIEEEGGMAQSMFDLTSMMKKETMINNQVEILKSRTLAENVIRDLMA
A0A3N9NPA0      FSMQPLYEASVRLMLVDQSSVGPSLFDFTSMITKETMMNNQVEILKSRTLAEHVVRDLRK
A0A3N9PQN5      FTMRPIYEASVRLMLVDQSSVGQSLFDFTSMMTKETMMNNQVEILKSRTLAERVIRDLRK
                    * : :   :                               : .* :.: .   *  

A0A3N9NDM0      ------------------------------------------------------------
A0A660YJ49      ---GLTLKMKKENHLPPLK---RHEVFSHFSTTHNPVPGDYKLRFYPTGYCAFYYNNVRL
A0A3A0DV40      -----GLAVTLEQESEHEKFLIRNRIFAQLSSTYNPRAGKYVLRVPGDGQFMLAMIDEDA
A0A6A0HWZ1      -----GLAVTLEQESEHEKFLIRNRIFAQLSSTYNPRAGKYVLRVPGDGQFMLAMIDEDA
A0A3N5J836      SPYRGELEIMREAAPSGM------------------------------------------
A0A660YPG8      SPYADSLEVL---GNGPDS---KRKSFMGLILSL--------------------------
A0A661X6L5      SDVRDSISFFQPLEDGTE------------------------------------------
A0A496TXX1      ---GLTLEMLAETKERPLR---RQKVFEQFSTTTDPISGEYLLEFKDDVFSLFQLNELDK
A0A496T729      ---GLTLEMLAETKERPLR---RQKVFEQFSTTTDPISGEYLLEFKDDVFSLFQLNELDK
A0A496U1T9      ---GLTLEMLAETKERPLR---RQKVFEQFSTTTDPISGEYLLEFKDDVFSLFQLNELDK
A0A3A0DR05      SEQAHELPI-LGANKHLQS---RSGRFSRFLNAL--------------------------
A0A6A0HKF6      SEHARQLPILLGAPAHAEH---QGSRLSRIMAAF--------------------------
A0A6A0HPL4      SPIAEQLELLHPHIEAEAN---LLAYAGQWIFGL--------------------------
A0A496TPL0      SGLQDSLSLF--RVENPED---LHVGYRRY------------------------------
A0A660YT75      SGLQDSLSLF--RVENPED---LHVGYRRY------------------------------
A0A1W9SG22      STYANNLIILGNTPDNGKKKFGLKKKLKKIVKSVFVNEEEVTI-----------------
A0A1F4RMF3      SEYADELRYLGNSPEGKEKKPGIIASTRSWLAGLIKNKDDHGL-----------------
A0A3N9NPA0      SSIASQLEVL--------ERADTVKAAFSLARLLRSKKTEW-------------------
A0A3N9PQN5      SSIAQELDIL--------QRPDTVKAAFSISRLLGSNRKPW-------------------
                                                                            

A0A3N9NDM0      ------------------------PEDMIKTFKLPERLPEHLSRDQFIVRLIRE-ELQVE
A0A660YJ49      D-----SLHVSNFVSDTVFYNGLRFSLRDDVVGRRSVIRFTINPFQATVNSLRS-REKIT
A0A3A0DV40      DVEIPLRTGDVFRAASDTISVNGISFQLADPQKLPQKVTFVVAPFKKVVSSLQQ-RVQPG
A0A6A0HWZ1      DVEIPLRTGDVFRAASDTISVNGISFQLADPQKLPQKVTFVVAPFKKVVSSLQQ-RVQPG
A0A3N5J836      -----------------------------------------PITFDNRVSTLRN-KVGVT
A0A660YPG8      ---------------------------------FKKGDENEPEPFNNLVRNFREGVITVL
A0A661X6L5      ------------------------------------------LTFNDRVEIVMK-SMDVE
A0A496TXX1      APRLLVSDSLSKIIDQTYDVNGFSFRINPDILKERSRIHFRVKNFRRTVDNFRK-QIKVR
A0A496T729      APRLLVSDSLSKIIDQTYDVNGFSFRINPDILKERSRIHFRVKNFRRTVDNFRK-QIKVR
A0A496U1T9      APRLLVSDSLSKIIDQTYDVNGFSFRINPDILKERSRIHFRVKNFRRTVDNFRK-QIKVR
A0A3A0DR05      ------------------------FGSSAADDSRNEMQEPVLLEVETVARELPG-YISVA
A0A6A0HKF6      ------------------------SGDEAEGDSARPAAPVRLREIEAVARHLPR-LLEVT
A0A6A0HPL4      ------------------------FGGTAE--------PVEEPSLTDIVEELRN-RIVVT
A0A496TPL0      -----------------------------------------------FVRHLQE-ALSIE
A0A660YT75      -----------------------------------------------FARHLQE-ALSIE
A0A1W9SG22      -----------------------------------PESEIKEALFNRVVGEIRR-NLKIE
A0A1F4RMF3      -----------------------------------EVSE--EDDFDRYVAGLRG-SINVS
A0A3N9NPA0      -------------------------------------VE--SEIFDDQVVTFRK-RLGVR
A0A3N9PQN5      -------------------------------------AE--AEIFDDQVQQLRE-SLIVR
                                                                .  .        

A0A3N9NDM0      HVRGGDILKIIVQANDPNAAKNIANSYVDHIIDWNTQKNRKEISSIRNFVEGQLSVFQDK
A0A660YJ49      NSRTGNLMKITLKDTNPVLASRTVNRLANIFVEKSMAMNREEATLLSSHLQKELKVAKEE
A0A3A0DV40      LNQSLTLMSVKLTDNDPYVVTQTVNSLAKLYVDKSRVVGAGEDTKQLETLQEQVRQAQRD
A0A6A0HWZ1      LNQSLTLMSVKLTDNDPYVVTQTVNSLAKLYVDKSRVVGAGEDTKQLETLQEQVRQAQRD
A0A3N5J836      LQKDTDLLKVSVIAYSPFESAFLTNALAEQFYRYSLQTSRGEITDVRLFLEQQLDVVRQQ
A0A660YPG8      PKRDTDIIELKAKAGTPFEAALIANTWMEAYRELDVSESRSEVTGVRQFLQEQLEKVQKE
A0A661X6L5      PKRDTDILTLKYQAGSPFEAAYIANVIAQEFAKQNAETNRLEVTEMRKFIEGRLRIKAKE
A0A496TXX1      FNRTGTLMWVSLTDRDPSLVATMVNQLAQMYVEESKFFSLKKVKDVKEVVENQLKIAKEN
A0A496T729      FNRTGTLMWVSLTDRDPSLVATMVNQLAQMYVEESKFFSLKKVKDVKEVVENQLKIAKEN
A0A496U1T9      FNRTGTLMWVSLTDRDPSLVATMVNQLAQMYVEESKFFSLKKVKDVKEVVENQLKIAKEN
A0A3A0DR05      PIRSTDMILLSVVSEDPQEAMIIANAYVEAYSELNRAMSQAEVRQVKNFLENQLGVIQQQ
A0A6A0HKF6      PIRSTDMILISVTSKDPQEAMAIANAYVEAYSELNRAMSQAEVRQVKIFLENQLNLIQQQ
A0A6A0HPL4      PIRDTDMIEIKVSASSSEEAAFITNTLAKSYSERSRLSSQAEVRQVKNFLEEQLQNIEKQ
A0A496TPL0      PVRDTDVIKIKVKAPSPQEAAFLANKVAEVYQNLDREFSRGEISQVVTFLRDQLQKKEES
A0A660YT75      PVRDTDVIKIKVKAPSPQEAAFLANKVAEVYQNLDREFSRGEISQVVTFLRDQLQKKEES
A0A1W9SG22      PIRNTDMILISMTAESPTEAAYLANTVAVAYKEQNQFESQEEVRKVKDFLKDQLNNFQSQ
A0A1F4RMF3      PIRNTDMINITVSAYSPFEAAYVTDAVANAYRRMNQAQSKDEVRQVKNFLEDQLDQYRRE
A0A3N9NPA0      HIRNTDMIEIKFQAHTPTEAAFVSNAVAFAYERINQEESKAEIQQVTEFLKNQLALYQDS
A0A3N9PQN5      HIRNTDMMEIRYQAHSPEEACFIANTIALAYERINQEESKAEVQQVTDFLENQLQLYQDS
                  .   :: :      .       :         .   .  :       :   :     .

A0A3N9NDM0      LRDAEEALVTFKENNDVIQLSDASSKVLENLTEAEVAYSKARAEREALQQRKHIIEQKKQ
A0A660YJ49      LNKSDYALKRF-RKQHPVSLSKQNENTVNKLNTLEL-------AIKSNNLAKRGLEMLLR
A0A3A0DV40      YDEIDQRYTEAKRRAGGNVGGNRYEVTVAKLSEAEK-------KLEVLKQQRDGLKELLD
A0A6A0HWZ1      YDEIDQRYTEAKRRAGGNVGGNRYEVTVAKLSEAEK-------KLEVLKQQRDGLKELLD
A0A3N5J836      LSQSEEMERTYKENQGVSALDQETTQLVGQSAEFHALYNTTQTELNAQLRRQEYLRRQIA
A0A660YPG8      LAVSEEALKEYKEKEGVTALTAETEQLIQNLAQFESLYRSAQTDLQANEKRLEYLKEQLG
A0A661X6L5      LKESEERLRNFQQREKIASLDAETTQLVEQLSQAESMLEEARIDLQTKQQLLNNVNKLLD
A0A496TXX1      LDKANEELKRF-KESHFISLDTEVKQNVNELSDLEN-------EIRTIKENIESLSLLLR
A0A496T729      LDKANEELKRF-KESHFISLDTEVKQNVNELSDLEN-------EIRTIKENIESLSLLLR
A0A496U1T9      LDKANEELKRF-KESHFISLDTEVKQNVNELSDLEN-------EIRTIKENIESLSLLLR
A0A3A0DR05      LAESELALKDYLKGETPMTLTDETNGLVTKLVEFESLYKESLADLEAARERLKFIDQQLG
A0A6A0HKF6      LAESEIALKDYSREASTLTLTDEANGIVSKLVEFESLHQEALTELASSYERLAFIDRQLG
A0A6A0HPL4      LAHSEEELKSFKQNQKVVALPNETQELIRKLAEFEGLYNEALTEFNSNKQRLLYVDKQLQ
A0A496TPL0      LRAAEEALRKFQQDEGIVALSQETQEMVKQLVEFESLYQEAVTDRKTYEKRLEYLKSQLG
A0A660YT75      LRAAEEALRKFQQDEGIVALSQETQEMVKQLVEFESLYQEAVTDRKTYEKRLEYLKSQLG
A0A1W9SG22      LEKSEQALKEYKEKEKVVALPQEIDEMVSKLAEFESLYHGAKLELNANKERLVYIDEQLD
A0A1F4RMF3      LSTSEEALKNYKQEAKLVALDQETEELVRKLAEFESLYNGAKTDYQANLKRLEYINGQLQ
A0A3N9NPA0      LQVSEDALKAYQERAKVVALDHETSELVRKIAEFETLYNAAKTDLEAARQRLNYIDSELE
A0A3N9PQN5      LKVSEDELKSYQESAKVVALDHETLELVRKIAEFETLYNAAKTDLEAARQRIIYIDAELE
                    :                      : :                        :     

A0A3N9NDM0      ELLPSLGVPVSKITQ-----------------------QLKEELLDLERQYSRLQLQV--
A0A660YJ49      KLDPNVTDITSGISA---RYVYRQIPQLPIFQDDPAMSILSRNLTDLDRARNNLIKNG--
A0A3A0DV40      RAANTQVSSVSGVEREAISYVYKGIANHSLFDNNASMVVARQRLSDLESRRADELRSK--
A0A6A0HWZ1      RAANTQVSSVSGVEREAISYVYKGIANHSLFDNNASMVVARQRLSDLESRRADELRSK--
A0A3N5J836      ETKGTMVEDISSASS-------------------PLIESIQREIADKQTRIATLMANSGP
A0A660YPG8      ENKKNFLSSNLSS---------------------PVIEELQKQMGQLIADIAAYRQQIES
A0A661X6L5      ERKKALGVNLTETST-------------------PYIQALQQELADAEAKKVIYLSAIKA
A0A496TXX1      RLEKSFETTEASETR----YIYRQIARHPAFQQDPNMGILQQQLADLESQRDQLLTRV--
A0A496T729      RLEKNFETTEASETR----YIYRQIARHPAFQQDPNMGILQQQLADLESQRDQLLTRV--
A0A496U1T9      RLEKNFETAEASETR----YIYRQIARHPAFQQDPNMGILQQQLADLESQRDQLLTRV--
A0A3A0DR05      ---KRGDIAAISAT--------------------SFLDELKKEMADLQQQRAAYLAYL--
A0A6A0HKF6      ---RRIDIEAVSAT--------------------SYLEVLKTEMARLQQERALHAAYL--
A0A6A0HPL4      DNKQNFDLENISVT--------------------PYFEGLKKQIGELQGKRALYTANL--
A0A496TPL0      ELRRTLETDLADISH-------------------PLILELRQKIAESEAKLVNFKAQG--
A0A660YT75      ELRRTLETDLADISH-------------------PLILELRQKIAESEAKLVNFKAQG--
A0A1W9SG22      KNKKNINMENILNA--------------------PFLDQLSQQMAELETKRANYIAGL--
A0A1F4RMF3      QKQGNFDMESISSQ--------------------PYLQELKKQIAEKESQLASYMASM--
A0A3N9NPA0      KQNTDFDIEAISKT--------------------TALEEFTKRIAEKESKLAVYQAQT--
A0A3N9PQN5      RQNTDFDIETISKT--------------------TALEEFTKKIAEKESMLAVYQAQT--
                                                           :                

A0A3N9NDM0      ------GLDDQE----KLASMREKINQTKQDLIDELMH-NAAQENLVDPLSQIRNLLQEA
A0A660YJ49      ------FPVNNP----DVIEISERISTLENRIYDMAVN----------------------
A0A3A0DV40      -TERH------P----DVIALENEITQLYAQIQSSGRT----------------------
A0A6A0HWZ1      -TERH------P----DVIALENEITQLYAQIQSSGRT----------------------
A0A3N5J836      GTD--------V----TVAALEKEVEAIKSKLIEEVRKVASGGASAIDPMRTSQRLFDEL
A0A660YPG8      -SSLSDNKKYLS----LLQEKESRLKGIQSKIVEEKKKIIETGMGSLNPMAVSETLLTNI
A0A661X6L5      SVQEGQAVYFDD----QLKQYDEKIKALREQLNKEAQK-LVASGMVSDPLKISEDLVAKS
A0A496TXX1      -TESH------Q----DVVEINAQIKFIQLQIKDLAKK----------------------
A0A496T729      -TESH------Q----DVVEINAQIKFIQLQIKDLAKK----------------------
A0A496U1T9      -TESH------Q----DVVEINAQIKFIQLQIKDLAKK----------------------
A0A3A0DR05      -AQNGRLDENNA----RLQELDGQIERLTQKFRAELAS--FTAAGLGGPANLQDEMFMRK
A0A6A0HKF6      -INNGSYEEKNS----RLQELDGQIARLTQKYKTELAQ--AATQDLLAPEALQDEIITRK
A0A6A0HPL4      -INQGYYREDDP----QIRKFDDQIGLLNKQLREEIAK--FTKIDVLDPVSLSSNLVARK
A0A496TPL0      -IPESY-----P----DFKKENERLASLKRTLTEETKKVLLARYPVHDPLKPYQEILEKI
A0A660YT75      -IPESY-----P----DFKKENERLASLKRTLTEETKKVLLARYPVHDPLKPYQEILEKI
A0A1W9SG22      -MDEGVYDPNGQDPM--LRRYEERTKMLEEKYKSEITQ--LAAAETIDPIALSEALLQRK
A0A1F4RMF3      -AEIGAYDQIKN----EIQLRERQIDAVKEKFKQEVTK--IAASGFVDPSIVSTSLFSSK
A0A3N9NPA0      -LQKGLSSDTKKHTLREIENLQNQITALKEQFQEDVKA--VAANQFMDPAQVSSSLFTSK
A0A3N9PQN5      -IQKGLSADTKKHTLREIENLQNQIDALKERFKEDVKA--VAANQFMDPAQVSSSLFTSK
                                 .                                          

A0A3N9NDM0      ITIDVDLETCKAQEQALKNAVDEHDAELQMLPQQELELARLIRAKEVNDKIYGTLLEKRE
A0A660YJ49      -----KVKELEKANSDMQQQISDLKGLLDVLPDEENRLINLTRERDTNEELYNMVLKRFK
A0A3A0DV40      -----KLSNLAQEISRQGREVALLEGQLGSLPNVESTLLGLERQWKQKSDYLQSLQEQLQ
A0A6A0HWZ1      -----KLSNLAQEISRQGREVALLEGQLGSLPNVESTLLGLERQWKQKSDYLQSLQEQLQ
A0A3N5J836      LSTDVEIKALTARAEALREVMQNMDYDLERLPQKTLVLARLTRDRELNEKLYLMLNEKYE
A0A660YPG8      LTLETENTALKARTRELRSIVRQYNKRLNKLPDKSLRLARLTREATVNNNIFMMLRTKYE
A0A661X6L5      ITLTGEVDAAKAKITALRGVLDKYNARMKELPDKVLQLARLERRRQVDEQTYIMLTQKLE
A0A496TXX1      -----RLEQLYEELATAERTASNLRYKLKMLPSEQLKLAELTQKVKVNEDIYSSLLAKYQ
A0A496T729      -----RLEQLYEELATAERTASNLRYKLKMLPSEQLKLAELTQKVKVNEDIYSSLLAKYQ
A0A496U1T9      -----RLEQLYEELATAERTASNLRYKLKMLPSEQLKLAELTQKVKVNEDIYSSLLAKYQ
A0A3A0DR05      FEVEANIETLIPKVASLKHIVDDYAKKLESLPEKKLLMVRLQRSAQVDEKIFLMMKEKYE
A0A6A0HKF6      FEVEANIESLKPKVAALEKIVKDYAQKLESLPEKKLMLARLQRSAQVDEKIYLMMKEKYE
A0A6A0HPL4      IEIEANLQALQPKLDALKEITNQYSRELEALPEKSLRLARLERAATVDEKIYLMMQEKYE
A0A496TPL0      ITAETEVEALQAKEDALKKIVDQHLLKLDTLPEKSLKLARLERAKKLNENLYMMMKEKYE
A0A660YT75      ITAETEVEALQAKEDALKKIVDQHLLKLDTLPEKSLKLARLERAKKLNENLYMMMKEKYE
A0A1W9SG22      LEVEATIQSLLPQVEALKKIVAQYNLQLEKIPERGLKLARLKRAAMLDEKITLMMSEKYE
A0A1F4RMF3      IEVETELKSLEPKVKALGEIVAQYSKDLESLPAKSLQLARLVRKAQVDEKIYIMLQEKFQ
A0A3N9NPA0      IAVETELRSLTPKVDAYGKILTEYNAQLESLPAKKLELARLSRSAQVAEKLYILLQEKYQ
A0A3N9PQN5      IAVETEIRALTPKVEAFGKILTEYNLQLESLPAKKLELARRTRSAQVAEKLYILLQEKYQ
                                           :  :*     :    .     ..    :  . :

A0A3N9NDM0      EARITESGKIGDIRVIDYAELPIKPVKPQKKKIFVLALMLGLSLGVGLAFFLNSLDNSLK
A0A660YJ49      EAQISAASVTEQVNVLDPAVPPNAPISGSKKIKAIIGILFGLFLGIGAVVTKELLDKSVK
A0A3A0DV40      KGKIAVTSDKSDIEILDPAIEPEYPVNRNKKAKAATGGVAGLLLGMFVVVALEALDRSIK
A0A6A0HWZ1      KGKIAVTSDKSDIEILDPAIEPEYPVNRNKKAKAATGGVAGLLLGMFVVVALEALDRSIK
A0A3N5J836      ESRITEAGKSAGVQIVDPAKPSVEPFRPKKKLNILLGMLFGLVIGVGIAFFLEFLDDTVK
A0A660YPG8      ENRIAEAGQIGLVRIVDRATPPERPISPKKKMNLLLGFFLGLGLGLGIVFTMEYLDTSLK
A0A661X6L5      EAKIQESAQARNVRIIDKAIKPQKPVKPNKKMNIMLGILLGLGLGIGITFMMEYLDRSVR
A0A496TXX1      EAQISEAVRTEEISILDPALPPEYPVNRDKKQKAVIGGFFSLFFSIFVGVFLEFLDKTLK
A0A496T729      EAQISEAVRTEEISILDPALPPEYPVNRDKKQKAVIGGFFSLFFSIFVGVFLEFLDKTLK
A0A496U1T9      EAQISEAVRTEEISILDPALPPEYPVNRDKKQKAVIGGFFSLFFSIFVGVFLEFLDKTLK
A0A3A0DR05      ELRITEVGQLGDVRIIEPAELPETPLGPNRKLNIILGMILGLGLGVGLAFLLDMLDNSVR
A0A6A0HKF6      ELRITEVGQLGDVRIIEPAERPEVPLGPNKKLNLILGMMLGVGVGVGLAFLRDMLDNSVH
A0A6A0HPL4      ETRITEVGQLGQVRIIDTAQAPKEPVKPRKKLYLVLGALIGFGLGLGLTFLFEYIDNSVR
A0A496TPL0      ESRITRAGQIGKIRIVDPAVPPEFPISPKKKLNLILATLVGLGLGIGVVFFLEYLDNSVR
A0A660YT75      ESRITRAGQIGKIRIVDPAVPPEFPISPKKKLNLILATLVGLGLGIGVVFFLEYLDNSVR
A0A1W9SG22      ETRITEVGQLGSVRIIDAAQPNIIPIRPQIKMNIILGIIVGLGLGIGISFLLDYFDNSVR
A0A1F4RMF3      ESRITEVGQLGNVRMIDPAKEPKFPVKPKKKLNLILGILVGLGLGIGIAFVMEYMDNSLR
A0A3N9NPA0      ESRITEVGQLGNVRIVDAAKAPDKPILPKKKLNLLLGLLLGLGFGIAIAFAIEYIDDSVR
A0A3N9PQN5      ESRITEVGQMGNVRIIDPAKEDEEPISPKKKLNLFLGIIIGLGLGVAIAFVMDYVDDSVR
                : .*        : ::: *     *.    *     . . .. ..:   .  : .* ::.

A0A3N9NDM0      SEQDVEKCLNLPVLASIPNISSNGV----------------------LRKITKKEDADNL
A0A660YJ49      TPEDVKNYLNLSILGVIPTVTF-------------------------KNLDLPDDEKAKS
A0A3A0DV40      SVDDIKGNLKLNVLGTIPQINFG------------------------EYYEFQDQEKAKL
A0A6A0HWZ1      SVDDIKGNLKLNVLGTIPQINFG------------------------EYYEFQDQEKAKL
A0A3N5J836      TGDDVER-LGMTLLGTIPLVYTEQIIKRLK-----------------KQGKQFTDADLHR
A0A660YPG8      TVEEVER-RGIPVLGSVPLISPKNL----------------------AHSLNGNNGEAKQ
A0A661X6L5      KPEDVER-LGVNVLATIPKIELDK-----------------------VEKAKQRLNEGHR
A0A496TXX1      TPDDIKRYLKLNVIGSIPKIEFD------------------------HEYELKDADKIKQ
A0A496T729      TPDDIKRYLKLNVIGSIPKIEFD------------------------HEYELKDADKIKQ
A0A496U1T9      TPDDIKRYLKLNVIGSIPKIEFD------------------------HEYELKDADKIKQ
A0A3A0DR05      TMEDLER-MGQPVLGSIPMIKEGETLARLKISKNGAPNGVHHGLSNGKVSAIENKLEQQP
A0A6A0HKF6      AIEDLER-LGQPVLGSIPLINENGAIARLRHSANGALNGASHNGTNGAAIAKNESAEFGR
A0A6A0HPL4      SIEDVEH-IGLTVLGSIPVIKEDEALKRLKVLP--------------GMNGNLDTLESKK
A0A496TPL0      TVEDVER-LQLPLLGSIPDIEPEKQNGLWRALP--------------KKKGSED--EVGR
A0A660YT75      TVEDVER-LQLPLLGSIPDIEPEKQNGLWRAIP--------------KKKGSED--EVGR
A0A1W9SG22      SADEIEK-MGISLLGSIPVISLDEAVKKIGKNGNN------------RFKKNINTNEVRT
A0A1F4RMF3      TMEDIEI-LGQSIIATIPFIKPEGS------NGAL------------SKFKQLEDAEAQD
A0A3N9NPA0      SMEDLEH-LRLSMIATIPHIKPEQS------NGLI------------AKMVKLDDPEVNA
A0A3N9PQN5      TMEDLDA-LHLPLLATIPLIKPEQG------NGLL------------AR-IKLEDPEVNA
                  :::.      ::. :* :                                        

A0A3N9NDM0      YSSKLLSQLLAKSYIFEAYRSLQLNFSLLNPDKNLKTVVITSAAPGEGKTLTSLNIAQLY
A0A660YJ49      ISSQIVTHDYSPTPVGEAYRSLRTSLLYSKRYGKIKTLVIGSAAPGEGKSFTAANLAITM
A0A3A0DV40      IDQQLVTHDYAPTPVGEAYRSLRTNILYSKSAGRIQTFVITSTAPGDGKSFTAANLSITM
A0A6A0HWZ1      IDQQLVTHDYAPTPVGEAYRSLRTNILYSKSAGRIQTFVITSTAPGDGKSFTAANLSITM
A0A3N5J836      VEAKMITRFSPKSPVSEAYRSLRTNIQFADIDKPKRVLMVTSTMSKEGKSTSIVNLAITL
A0A660YPG8      IKSRLITHFEPKSPISESYRTFRTNVQYTKVDNPVKTIVITSAGPGEGKSTTAANLAIAF
A0A661X6L5      VESRLITHIDPKSPVSEAYRTLRTNLQFSKVEKELRTILVTSAGPKEGKSTTASNLAIAM
A0A496TXX1      IDAQLVTYDYSPTPVSEAYRALRTKIMFSKQTGNIRTLVITSFAPYDGKSFTCSNLAVTL
A0A496T729      IDAQLVTYDYSPTPVSEAYRALRTKIMFSKQTGNIRTLVITSFAPYDGKSFTCSNLAVTL
A0A496U1T9      IDAQLVTYDYSPTPVSEAYRALRTKIMFSKQTGNIRTLVITSFAPYDGKSFTCSNLAVTL
A0A3A0DR05      TAARLITHVAPKSPISEAYRALRTNIQYTHIDRTLRTLLVTSPGPGDGKSTSVANLAIVM
A0A6A0HKF6      TAARLITHFAPKSPVSEAYRTLRTNIQYTHIDKPLRTLLVTSPGPGDGKSTSVANLAIVM
A0A6A0HPL4      MAARLITHFAPKSPISEAYRTFRTNLQYTKLDRELKAILVTSPGPGEGKSTSVSNLAITM
A0A496TPL0      LATRLVTHLKPKSPYSEAYRSLRTQIQYARSEKPVQTILVSSPGPGEGKSTSVTNLAITM
A0A660YT75      LATRLVTHLKPKSPYSEAYRSLRTQIQYSRSEKPVQTILVSSPGPGEGKSTSVTNLAITM
A0A1W9SG22      IAGRLITHFAPKSPISEAYRSLRTSIQYSQADKTIKSIVFTSPGPKEGKSTTVVNLAIAI
A0A1F4RMF3      ISERLVTHLRPKSPISESYRTLRTNIMFSNPDKEIKSIVITSSGPKEGKSTSISNLAITF
A0A3N9NPA0      INERLVTHLKPKSPVSEAYRTLRTNILFTAPDNPKHIIMLTSTGPREGKSTSVANLAITF
A0A3N9PQN5      ISERLVTHLRPKSPVSEAYRTLRTNILFAAPDKPKQIIMMTSTGPREGKSTSVANLAITI
                   .:::   . :   *:**::. ..         . .:. *  . :**: :  *::   

A0A3N9NDM0      ARAGIRTLVMDCDLRRPMVHKALKIRQEPGLTNALIDKAAHLESYVQLFNDESLHDNLAV
A0A660YJ49      AQQKSKTLLIDADLRRGVLHNTFDCPKKPGFTNFLSGTATLSNVM-----YDTYIPNLSL
A0A3A0DV40      AQQKSNTLLIDTDLRRGVLHNTFAVPKEPGFSNYLTGSVLASEII-----HETHIPNLSV
A0A6A0HWZ1      AQQKSNTLLIDTDLRRGVLHNTFAVPKEPGFSNYLTGSVLASEII-----HETHIPNLSV
A0A3N5J836      TQMGSRVLLVDSDLRRPSLHNFFSMDKTYGLTNVLIGSLSFDEVV-----KHTEVEKLDV
A0A660YPG8      AQMGVKTLIVDTDLRRPVQHGIFGVQRGEGFTNVLYGKVNLSDAV-----RDTEIDNLQL
A0A661X6L5      AQAGNSVVLVDADLRRPLIHSVFGLDKDQGLTNYLAGSLPYEQLL-----HESFIENLKI
A0A496TXX1      AQHKTNTLLVDADLRRGVLHNTFSVPKEPGLSNFLMGMVSFEELL-----NETHVPNLTV
A0A496T729      AQHKTNTLLVDADLRRGVLHNTFSVPKEPGLSNFLMGMVSFEELL-----NETHVPNLTV
A0A496U1T9      AQHKTNTLLVDADLRRGVLHNTFSVPKEPGLSNFLMGMVSFEELL-----NETHVPNLTV
A0A3A0DR05      AQMGSKVLLIDADLRRPVLHTVFNLDRRVGLSNVLVGRADIAEAV-----SPTDIENLHI
A0A6A0HKF6      AQMGSKVLLIDADLRRPVLHTVFKLDRRIGLSNVLAGRAEIAEAI-----SPTEIDNLHV
A0A6A0HPL4      AQMGSKVLLIDSDLRRPVLHTIFKVDRRIGLSNILVGKVSVSEAV-----QKTEIDNLYV
A0A496TPL0      AQMGSKTILVDSDLRRPVLHSLFDLKRDVGLSNYLVGRAEIEEVI-----RPTSVDNLYL
A0A660YT75      AQMGSKTILVDSDLRRPVLHSLFDLKRDVGLSNYLVGRAEIEEVI-----RPTSVDNLYL
A0A1W9SG22      AQMGTNVLLVDTDLRRPVIHSIFNLNRNKGLSNCLVGKTSIEEAI----SKT-DIDNLCV
A0A1F4RMF3      SQMGTNTLLIDGDLRRPILHKLFNLDKKNGLTNVLVGRANLDEVV----QRNPDLPNLDV
A0A3N9NPA0      AQMGTKTLLIDADLRRPMLHKLFQKEKEPGLTNVLVGGTVLESVI----KTVNEVPNLFL
A0A3N9PQN5      AQTGARTLLIDADLRRPMLHKLFQKEKEPGLTNVLVGRKSLSDSV----KAVEEVPNLHL
                :.    .:::* ****   *  :   .  *::* * .     .             :* :

A0A3N9NDM0      LTCGALPPNPSEILGSKRMGDLLAQLEDMYGLIIIDAPPIISVTDSIILGQKVDGVLLVL
A0A660YJ49      ITCGTLIPNPSELLGSDRMKEFIKVVSEEFDFVIFDTPPLMAATDAVILGTLVDGVAVII
A0A3A0DV40      ISCGSLIPNPSEMLGSVQLRRFLDEMRRRYDLIIFDTPPLNAATDAVVLGTQVDGAVIVV
A0A6A0HWZ1      ISCGSLIPNPSEMLGSVQLRRFLDEMRRRYDLIIFDTPPLNAATDAVVLGTQVDGAVIVV
A0A3N5J836      ITSGDIPPNPAELVASEAMKKFIEEARARYDYVLLDSPPVVAVTDSAILATRVDGTLLVV
A0A660YPG8      LTAGVLPPNPSELLASEAMEKFLKDVNSKFGMVIFDSPPVIAVTDAAVLSAMLDGVILVV
A0A661X6L5      VPSGVLPPNPSELLATNKMKDLLKKLQDDFDIVIIDSPPVIAVTDASILSTIVDGTLLVV
A0A496TXX1      VSCGSMMPNPSELLGSLRLRKFIDEAKRRFDFVIFDTPPLNAATDAVVLGTQVDGVTLIV
A0A496T729      VSCGSMMPNPSELLGSLRLRKFIDEAKRRFDFVIFDTPPLNAATDAVVLGTQVDGVTLIV
A0A496U1T9      VSCGSMMPNPSELLGSLRLRKFIDEAKRRFDFVIFDTPPLNAATDAVVLGTQVDGVTLIV
A0A3A0DR05      MPCGALPPNPSELLGSSAMQRTLEALKQDYEVVLFDSPPVIAVTDAAVLARWVDGVFLVV
A0A6A0HKF6      MPCGTLPPNPSELLGSSAMQQTLEGLKREYETVLFDSPPVIAVTDAAVLARYVDGVFLVV
A0A6A0HPL4      LPCGTLPPNPSELLASSAMTRALEEMKDLFDIILFDSPPIIAVTDAAVLCPRLDGVILVL
A0A496TPL0      ISCGILPPNPSELLGSKRMQELIQQLKNEYDYVLFDSPPLIAVTDAVVMAPWVDGVVLVL
A0A660YT75      ISCGILPPNPSELLGSKRMQELIQQLKSEYDYVLFDSPPLIAVTDAVVMAPWVDGVVLVL
A0A1W9SG22      IPSGTLPPNPSELLGSTKMKKFISELEERFDLVLFDSPPIMAVTDAAVLSSEVDGVVMVV
A0A1F4RMF3      LSCGILPPNPAELLGSQQMRRLLTEAKEKYGIILIDTPPTIAVTDSSVLAPLVDGVLLVV
A0A3N9NPA0      LTCGVIPPNPAELLGSTLMRNLLHRAREHYEIILIDSPPIIAVTDPSVLARIVDGVVMVI
A0A3N9PQN5      LTCGVTPPNPAELLGSNLMRELLQFARGQYDTILIDTPPIIAVTDPSVLARIMDGVILVV
                :..*   ***:*::.:  :   :      :  :::*:**  :.**. ::   :**. :::

A0A3N9NDM0      RSGKITREAAQKAKKILENSKIHIAGTLLNDVDLKKVYGYYKDYYYYSNKKMAVES----
A0A660YJ49      RSGMTNRENIKRKLELFETVQTTVVGAVLNCAGVDVAHEGYSYYRY--------------
A0A3A0DV40      RSGKTNREVARKKIEMFQNVQAKILGVILNGTTVDLAHEGYSYYQY--------------
A0A6A0HWZ1      RSGKTNREVARKKIEMFQNVQAKILGVILNGTTVDLAHEGYSYYQY--------------
A0A3N5J836      SSGMVSKREVQRAAGLLKNVRSSVMGVVLNGLDIKKIYGSYYYYFHYYQYYYYYGSEHKS
A0A660YPG8      KSGTTKDDALTRAKILLNNVNAEFLGVLVIGIDINRMYGSYYY-----------------
A0A661X6L5      YAGQTERDAIKRAIMMLSSVSARLLGTVLNGFDVQGIYGSYYYYYY---HHYYGPSKKKK
A0A496TXX1      RAGKTNRNIARQKLDLFDNVPATIIGVIINGAEKDLAHEGYSYYHY--------------
A0A496T729      RAGKTNRNIARQKLDLFDNVPATIIGVIINGAEKDLAHEGYSYYHY--------------
A0A496U1T9      RAGKTNRNIARQKLDLFDNVPATIIGVIINGAEKDLAHEGYSYYHY--------------
A0A3A0DR05      KAGHTSKEAAFRSYALLNQVKAKVLGTLLNSVKVESMYGSYYYYYH---YHYYTQNSNGK
A0A6A0HKF6      KSGHTSKEAAFRSYTLLNQARAKVLGTLLNSVKIESMYGSYYYYYH---YHYYANNSNGK
A0A6A0HPL4      KSGQTDRDAAFRAYTLLKNVNARLLGSLLNGVQIESMYGSYYYYYH---YYYYGKG-DGK
A0A496TPL0      RSGKTDRDAAVRAFELLRNVKANVLGTLLNDVLPSYMYGSYYYYYY---YYYYSSE-DGK
A0A660YT75      RSGKTDRDAAVRAFELLRNVKANVLGTLLNDVLPSYMYGSYYYYYY---YYYYSSE-DGK
A0A1W9SG22      KEGQTNRDAVMRCYNILKSVPNQLLGAVMNGINVNGFSDYYYYYQY-----HYYGKEDKK
A0A1F4RMF3      KSGGTQRDAFLRAQEQLHRVGAHILGVILNSIQASNVYGSYYYYYY---YHYYYGQDGEK
A0A3N9NPA0      RIASTQRGAAQMAVEQLRRVEAPLIGVMLNGISASNFYGSFYYQQY---Y-YYYTKDGNK
A0A3N9PQN5      RTASTQRGATLMAVEQLRRVQAPLVGVVLNGISTGNFYGSLYYQQY---Y-YYYTTDGQK
                  .             :      . * ::                               

A0A3N9NDM0      --------------------------
A0A660YJ49      --------------------------
A0A3A0DV40      --------------------------
A0A6A0HWZ1      --------------------------
A0A3N5J836      GKSRKKKSASADYQEVT---------
A0A660YPG8      --------------------------
A0A661X6L5      SRRFF---------------------
A0A496TXX1      --------------------------
A0A496T729      --------------------------
A0A496U1T9      --------------------------
A0A3A0DR05      LPKTQRKLLSWPWS------------
A0A6A0HKF6      LPKTQRKLLSWPWG------------
A0A6A0HPL4      KSKTRRSRHSSASAA-----------
A0A496TPL0      TKKRKKKHHHHTQLYTS---------
A0A660YT75      TKKRKKKHHHHTQLYTS---------
A0A1W9SG22      KKRIFRREKV----------------
A0A1F4RMF3      KRSKSRRRKAHKKTHPSDQTIREGDA
A0A3N9NPA0      KRTKKRNRKPFKHLA-----------
A0A3N9PQN5      KRRKVKKQQQSV--------------
                                          

© 1998-2021Legal notice