BYKdb

Dataset for cluster tadcd of phylum armatimonadetes

[Download (right click)] [Edit] [Sequences] [Repertoires]

8 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3D4ZY98      -------------------------------METSARTLEVKDYVRIFTKRWLLILIITA
A0A7C3N1I4      ---MNQPEPRNQGTNSYLPAQVEGTQLYAEQPYYGAEVWTVADVLSVLRRYALLIGVVFA
A0A7C5BMB1      MKRFGTNNETEHNGNGKSVSDDGIDKLVSQRQFNEPETEELREYIDILYRRRKIVVFTLL
A0A3D0NA47      ------------------------MEHVAAEESRPRHLGLPDYIRILSKRKWFILIVTAV
A0A7C7PWR2      -----------------------MAAGEPTLSRELPEVDARMYLWIIYKRIWLIVTLIAL
A0A7C3S9U8      --------------MAEAVQRP---------EVPEEDVIDLRQIVRILQRRWKIVVAVPV
A0A068NY62      --------------MTNPKRITDDLRSGGGYDVDEQERTELLHYGGVLRRRWPAMLVVAL
A0A7C4V1U4      ---------------MDAYRNQSWPAPSAGYE-DDQPIDLKFYLEALLRHKWLILFLTVA
                                                              :  .    :     

A0A3D4ZY98      AVGMMATLFAL-RAPSYRAEALVLIRTEPIQRL-----------------------EVME
A0A7C3N1I4      ACVGAAYIYNARQTPIYSASADILVDVGGTTQG---------------------------
A0A7C5BMB1      AILIIGIVYTLTRTPIYESSARIVVVTNNNTSP---------------------------
A0A3D0NA47      GMLV-GGLLALSSERLYEATSLVIIQQRPQGFF---------------------------
A0A7C7PWR2      SLVV-AAAYLNTRITMYEAKALVRLEQKVMPFN--------------------------A
A0A7C3S9U8      LTVIATLGYLRTAPRIYEAISILRVQPSTQPLVLTGLPIPMPRQPQQIDLKTIERLITTR
A0A068NY62      AVFGLVAAYTMLQRKVYEASTKL--------VV-----------------------VTKG
A0A7C4V1U4      LSLG-ATGYVLTAKRVYSATARVQVQQSSGRYI-----------------------TITG
                                * : : :                                     

A0A3D4ZY98      GEAIESRDVQSELTLDTHARIVTSYSVASRTAAKLAARESGQKM--EVEPAEIIKTLQVI
A0A7C3N1I4      ---SSEVDPVAEMLNAGRARSIQTQVEVLKRRPIVEAALKSMK---PPLSRKRKPDLKVE
A0A7C5BMB1      -QLGDNIQMINDLRALVRSRSIDTQLEIISSPDVLNNAFE------NIDPKLRAKGFRSD
A0A3D0NA47      WVTGEEAGMPPNVAMETHARIVRSSDVTQLASEKLQQLPTDSRV--IATSTEIQDALNVS
A0A7C7PWR2      FAMQQTGATRRELPLSTAARLITSQLCAQHAQELIQEENPDI----IIPVEEILRSIEVE
A0A7C3S9U8      LTAQEAVRILKGRRLRAIERLVYANSTIHDALKTARNKVGDEKKLEELAAEVLMKAIKTK
A0A068NY62      ASIGGGDTLLATLGAIRQSRTVDTQVEIINSFDLIDRAFR------TMTPAERMNGFKSL
A0A7C4V1U4      QPAYGGSPVDAAESLKTQVKFVYSSLTLGEAVRYLREQQG------IVVPPDAFRGLKVM
                                   . : :                                :   

A0A3D4ZY98      P-----------QDPDRLVIQSTSSERDRAREFANETAETFVQISAELRRKDVTAAREFL
A0A7C3N1I4      NI----------KDTDIIRVTVEDPSPKVAAGFANAVANAYIAKSQASNRRSATVTRVFL
A0A7C5BMB1      HLPSWACKVSAKKNTDIIIVTARAFDPKAAAELANNVSKSYFEQDLERSRRATRQAREYA
A0A3D0NA47      V-----------IEPDLLRIDATSPDRRRALLFANYTAFAFVERNLEDRQRESRDAREFL
A0A7C7PWR2      T-----------TEPDLVEISCRSTVPERAVLIVNAVAQAFVDNRTQEARAEASQTRRFL
A0A7C3S9U8      T-----------IEPDLVEVRVRHPDPELAALVANSIAEAMVQRFTREAQRDATQERRYI
A0A068NY62      TAPAWSYEIKSRAETDVILIDSRSFRPDLAARFANAIAQTYLDEDLKRNSQATRQAWEYV
A0A7C4V1U4      P-----------EEPDVIAISVEHESPRMAAALANAIATAYRDQNTLQARRQARGAQEYI
                             :.* : :         *  ..*  : :                . : 

A0A3D4ZY98      EEQIGNLHARLLTLEEELAKYQHQVGIVVPEVEATSAVAQLQDYQRELNSAT-------T
A0A7C3N1I4      EQQLADKKRELDEATNRLKSYKETSGIASLDAETTGRMQRLAATEDQLASAQTQVRSIEA
A0A7C5BMB1      EEQLAVLHRDLAKANTELSEYKRKTGLIAPDAQISKIAERMANLQMEIDAVQANIAAGRN
A0A3D0NA47      ERQVAQYGTEVESIIEEMTAFARDSGFVDIDSEIGQAVQSLAAYENEERQAQ-------R
A0A7C7PWR2      EQQLTKMQSELARIQRQMEEFKRRTGIMDVNAQMEAILTAVANYESEAANAR-------V
A0A7C3S9U8      ERSLKTLEEQLRNLEAQIAREKKRLGIVDIPEETKALLTSLRTYELEWHDAQAQRDAATA
A0A068NY62      QREMATSRNQLAIASADLAHYKQKTGLVAAADQVSGLAKAELEVQGSLDSSRADMLAAER
A0A7C4V1U4      RQRLDEIRSDLARVEEQMKPLKIRQHI--PWNETGDMTRA-MQIAAYEDQAR----QAEM
                   :      :      :        :     :                           

A0A3D4ZY98      QLEALNSKQAELRRQLQGEPQILEIPGREPDPERIVVEAQLRQERLGLTGLQARYQDEHP
A0A7C3N1I4      QLRAVRAQLSTAEQTYLASTSS------SVDPVVTSMEGTIATLEVQRAGLLREFQPTAP
A0A7C5BMB1      DLEATKQGILQEKADVITSSTI------TRNPLFDEVVTRLDRLQSQRAEMLQEYTPQSR
A0A3D0NA47      ELMAAEARLAELRQVRGSQGDYLVGEAPAPNPEWTTLQASLTEARIGLEKLQSQYTGGNP
A0A7C7PWR2      ELSSARSQLAALRARLNAEQRIEWVDLPQEHPLLQALKEQLIEKQVELIQLRSRYTDEHP
A0A7C3S9U8      EVERLRRQIEREQPIVSVDVL-------KEDPIFKQMRDQLATLELERAKLLALFTPEHP
A0A068NY62      NLARLKGQLRALSPEIDFQRTI------AENPEFALVRANVLQLEGRLVELSQEFTPNSP
A0A7C4V1U4      EVASLRNRVRVLRGQLAAHPRFRQMERPAEDPFLTGLRQEKVRLEVELAKLRADYKETDP
                ::                             *    :             :   :     

A0A3D4ZY98      AVSEAKRRIEALEARIAALPETRDVT---QMQTNPRLPALKAELDGTRVNIAETRSRISR
A0A7C3N1I4      EVQALDDQIAEARKTLQARVRQRMTTSGQTVAANPMRMALMQQVADLEAQADAQQARIRA
A0A7C5BMB1      EIRALDERIKIEEERLKTVAGNVVAS--RTESRNPIRDSLLKRYAEGIATNAALTARNRA
A0A3D0NA47      LVLDQQALVEELAARLAD-TPQLVRA--ESTRANPATTGIEGEIKAAGVAVQEARARVAA
A0A7C7PWR2      DVQRVKDELSAIQNRLSNHLERTVTL--KRANPNPIYDALRQQLVTTQLRTVQLEARERA
A0A7C3S9U8      DVQQVEERIKTLRESLAKQARQLVKE--REVAPNPAYQLLYQQLVTAEANRFAAEARLQA
A0A068NY62      EVTQVKQELQVQKDKLKALARTTVST--EEKVRNPLLDKLASDYAEATATQVVASERAKA
A0A7C4V1U4      RILTIQDKINSIQNQIDEQSKKTFKT--VTTEEDPNYNLLASQLFMTENSLAEAEAKALA
                 :   .  :      :                 :*    :                .   

A0A3D4ZY98      LQSIVTGLRADTVDLPLELAAIERLESQINLARRTYETFLAQLEQSKLREAIKQGSATVI
A0A7C3N1I4      LEPMVRAERRAVSELPERERRLAALTRDVANLEQAYTTLQAKHQEVSVMEQAKLASASLL
A0A7C5BMB1      LLYAMNSQKTFLATLPEKERKLTDLIQSVELLKGTYQNLSQRYYSLLLSERAMIPNGQLI
A0A3D0NA47      AQGVLGGVQERIKDLPDARQQWQGLTDRLDAAREAYLSLQGELRQARLSEAVKKGNARVV
A0A7C7PWR2      FNELVKRERAKLTELLDKKQQWDQLQELASVTRETYKMLVARLQDAKIQEAAKLGDAHIA
A0A7C3S9U8      LSRFLPELRKRLEALPENQRRLGALLRKAQAAEQVYTNLLMRLEEARIREVTKTGDLVIA
A0A068NY62      LGGQLVKDQAALRQYPEQERHLAELQQRVDVLYRTFNMLSDRYYALLIEWRSSLPNGLVA
A0A7C4V1U4      LRNLASQKRAQSPQLTEDQMNLARLQRQADVLQRTYTVLLERLQEERINEAQQLGNVNII
                        .               *         .:  :        :       .  : 

A0A3D4ZY98      DRAV-EVEELRASLGRTFGFGIALGLFVGLLAALLLEAL---DDT-FHSPEDLAYYTDVP
A0A7C3N1I4      EPAEVPGAPIKPRKGLNLAVGALMGLMLGTMLAFFLDMLEKADDS-VKSPDEAERALGLP
A0A7C5BMB1      SKAAPSSTPTYPNKKRNFALFFVLGIMIASIAAVTIEKL---DVR-VHDQQSVEQIANTP
A0A3D0NA47      DQAQEP-REIQTSLLHSLLFALAIGLFIGVGLSILLEAL---DDT-IYSVDDLQRVSDLY
A0A7C7PWR2      DLAS-AARQLTVNRVRTLLFSAMLGLILGIGLAVLLEFL---DTT-IRSPEEVERLIGVK
A0A7C3S9U8      DLAAPPHEPVSPRPLLSLAIALVLGLMLGVMAAFLAEGL---NET-VTTADEIQERLGIP
A0A068NY62      ALARPPSAHSSPRTSLNLTFGIIIALVLGLGVGVLLERL---DTK-LHSPEEAERATGLP
A0A7C4V1U4      DFAQIPTRPVRPVPEKTIPLAAAVGLLLGVGLAMLREFL---GSSVVATTDDIEKTAKLL
                  *             .: .   :.:.:.   ..  : *   .   .   :.        

A0A3D4ZY98      FLGMVPMLDQ---PGDELVTIVAPKSPPAEAYRVLRSNIHFAQADNPARTFLVTSAGAGE
A0A7C3N1I4      VLGVIPGLPR---SPQRLLIGSNDNSIIAESFRLLRSNVRFSNPDQPLRSIMVTSAASGE
A0A7C5BMB1      VLTLVPKVAE---TSKKLIEGKSSDSKLLESFRILRSNILFSIIDHDTVLIAVTSAGPSE
A0A3D0NA47      LLGVVPLHMD---DAGPLVTVDAPKSPSAEAYRTLRSNIRFSLFDRPARTFLITSAGSGE
A0A7C7PWR2      ALALVPYIRE-ERYQQDIVALMRSKSPPSEALRVLRSNLKFVSAGNTMKAWMITSTHARE
A0A7C3S9U8      VLASIPKTRS-ELTHEYVLDLMASRRSAAEAVRSLRANLKFLSRDKPMKVILITSTAPGE
A0A068NY62      ALTFVPEAT--TSGDRLLLGEAQPSHAFIESFRLLRNNIAFAVPDKDLRVVAVTSAAMAE
A0A7C4V1U4      PLGFIPASRRLRSLSNYLPVVDQPGHPLSEAIHSIRASLKFATVDAPARSITVSSASAGE
                 *  :*           :           *: . :* .: *   .       ::*:   *

A0A3D4ZY98      GKSMTTANLAVVFAQSGQKILLIDSDLRRPTLQRRFKVPRDTGLTNLLIGEMSLEEVVIE
A0A7C3N1I4      GKTTVAANLAIALAANGLRVILVDCDLRRASLAKLFGVENSRGLTSVVVGEMPIEE-ALQ
A0A7C5BMB1      GKSTVSANLAIAMAMDGKKVLLIDGDMRKPNLHNLFGMTRENGLSRVIAGSCRQED-AIK
A0A3D0NA47      GKSVTTANLAVAQAHSGLSVILVDADLRRPVQHKLFCVPSEVGVTNVVVGDMSVAE-ALT
A0A7C7PWR2      GKTLVSSALGIALAQGGQRVVLLDADLRHPGLHRVFGLNNAVGLTSILVGDFDLQQ-ALQ
A0A7C3S9U8      GKTFLATSLAIAWAQSGHKTVLVDFDLRRPQVHECLGLENERGLGNFLVGAATLEE-ILQ
A0A068NY62      GKSTISVNLAIAMAMDGKRVLIIDADLRRPTVHKWVGMTNEKGFTSVVRGVSSLSD-AVR
A0A7C4V1U4      GKTFVAADLAASMAVSGQKVVLVDADLRRPKIHNIFGLERSPGLAELLADGLDVED-VLQ
                **:  :  *.   * .*   :::* *:*..     . :    *.  .: .     :  : 

A0A3D4ZY98      VERVPGLYVMPTGPLPPNPADLLGSDRMIEIIAEATRFADIVIFDSPPAIVLTDAVVLSS
A0A7C3N1I4      QVQRENLRLLATGPTPPNPVEFLDSQRCHEVLKELSGMADFVILDTPPASFLTDATVLCP
A0A7C5BMB1      ATHVQNLDLLPSGPTPPNAPEMLNSRHCRNLLEHLKSIYDIVIIDCPPCVGLSDVQVVST
A0A3D0NA47      PTEVPGLRLLTSGPVPPNPAELLESEQMTAVIQELTQLADLVIFDSPPAVMLTDATVLAA
A0A7C7PWR2      PTGVDNLELLASGPIPPNPAELLDSPRMQSLIEQLKNYADVVVIDTPPAGLVTDPMVLAT
A0A7C3S9U8      KTPLKHLQAITSGPLPPNPAELLDSEQISRLMKDLRERAEVVILDTPPILAVSDTALLVP
A0A068NY62      STQWDGLQVLPSGPLPPDPTEFLNSHRSKDVFQLAANEYDVVVVDAPPCTGLSDMQVIST
A0A7C4V1U4      ATQTNNLKVITAGCPVPSPGILFDTQRMTDVIAKLSSIADVVVFDVPPILPVSDALTLAS
                      *  :.:*   *..  :: : .   ::       :.*:.* **   ::*   : .

A0A3D4ZY98      KIDRTILVAECDHVNRTAFIEMIRLIRNARGNILGAILNKMRLSTADYY----YYYYYYD
A0A7C3N1I4      QVDGVLIVARTRQTKQAAIRRVMNQLLMTKGNLVGMCLNRMPMSGHGYY---YNYYMYGD
A0A7C5BMB1      LADGVVLVVAMNETRKPHLKIASHVLSRVSAPLIGVVLNKIDSLGNSYY---YKYYSNYT
A0A3D0NA47      KLDRTIVVAESGQITERALADVERLFRHARADILGIVLNKLRITGGDYH------YYYYY
A0A7C7PWR2      HADGVLLVLEPGRVSREALKRIKDLMEMAHGRIVGAVMNKITPKSSYYYYYAYADYYYYR
A0A7C3S9U8      YADGVIAVVVPGQTLRPMLRQLKEQVAIAQGHLIGAVLNKVAPPHGGYY---YRYYSRY-
A0A068NY62      IVDGVVLVAALDSTSKPMMHATMRMLRQAGAPLLGLVINRIKHSNKGYYGY-YGYYGYYG
A0A7C4V1U4      KTDGLILVVEQSRVAKAALADVRRMCDLAKVRIIGAVLNKAETGGGYYYGYHYKYYTDY-
                  *  : *          :         .   ::*  :*.       *:      *    

A0A3D4ZY98      YAKETPVSRPLDGAPTPAPEIDVEEPLEVLXRCGPPRPAPTRSSGLRSSPGKRRRASSTS
A0A7C3N1I4      YRAYCDQPRSRKGRRR-----------------EALRATRAPELGREGQDSKDGRGHAGL
A0A7C5BMB1      YLESCQKTSPKNGKRR-----------------KTIKRWPAFKS----------------
A0A3D0NA47      YSDYSEEPQSPRGARN-----------------ASGSERKAQDLIDLNSSDERGRDDLEA
A0A7C7PWR2      YYRYYRHYYSAERTKE-----------------GTSAPTQSGS-----------------
A0A7C3S9U8      YGESE-------------------------------------------------------
A0A068NY62      YSSYQDD-------PA-----------------AEEKVAKTKRSRTSKK-----------
A0A7C4V1U4      YKHYKSDGSDQKALPT-----------------ASDATPPSERQQTGSQPNE--------
                *                                                           

A0A3D4ZY98      CTAIRRPSRRPRLRPHCRLTTCRSRSRRRKRRRSPTAPGATATRTATATATATTAAACSM
A0A7C3N1I4      ------------------------------------------------------------
A0A7C5BMB1      ------------------------------------------------------------
A0A3D0NA47      ------------------------------------------------------------
A0A7C7PWR2      ------------------------------------------------------------
A0A7C3S9U8      ------------------------------------------------------------
A0A068NY62      ------------------------------------------------------------
A0A7C4V1U4      ------------------------------------------------------------
                                                                            

A0A3D4ZY98      TCSGQTMTTSERTPVFLSPVENRNLRTQ
A0A7C3N1I4      ----------------------------
A0A7C5BMB1      ----------------------------
A0A3D0NA47      ----------------------------
A0A7C7PWR2      ----------------------------
A0A7C3S9U8      ----------------------------
A0A068NY62      ----------------------------
A0A7C4V1U4      ----------------------------
                                            

© 1998-2021Legal notice