BYKdb

Dataset for cluster orphancd of phylum acidobacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

255 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1F2U8T6      ------------------------------------------------------------
A0A2V8BV42      ------------------------------------------------------------
A0A2V8F916      ------------------------------------------------------------
A0A1Q7K833      ------------------------------------------------------------
A0A1Q8AMY4      ------------------------------------------------------------
A0A2V8BM40      ------------------------------------------------------------
A0A2V8CRT6      ------------------------------------------------------------
A0A1F2VH76      ------------------------------------------------------------
A0A1F2R0X5      ------------------------------------------------------------
A0A2V8B278      ------------------------------------------------------------
A0A2V8CEF9      ------------------------------------------------------------
A0A2V8KZG2      ------------------------------------------------------------
A0A2V8TKR9      ------------------------------------------------------------
A0A1Q7LG57      ------------------------------------------------------------
A0A2V8MKQ7      ------------------------------------------------------------
A0A1Q7L5B1      ------------------------------------------------------------
A0A2V9DKV4      ------------------------------------------------------------
A0A2V9EVA0      ------------------------------------------------------------
A0A7C5ZU39      ------------------------------------------------------------
A0A3N5YN96      ------------------------------------------------------------
A0A1Q7Y646      ------------------------------------------------------------
A0A2V8QZU0      ------------------------------------------------------------
A0A2V8RSQ9      ------------------------------------------------------------
A0A2V9L2P7      ------------------------------------------------------------
A0A2V7UMX0      ------------------------------------------------------------
A0A136K497      ------------------------------------------------------------
A0A399W9E4      ------------------------------------------------------------
A0A321LMC5      ------------------------------------------------------------
A0A2V8X713      ------------------------------------------------------------
A0A2V8ZLE9      ------------------------------------------------------------
A0A2V8Y4D3      ------------------------------------------------------------
A0A2V8Z2X8      ------------------------------------------------------------
A0A2V9C3F6      ------------------------------------------------------------
A0A2V9QMU9      ------------------------------------------------------------
A0A2V9QY75      ------------------------------------------------------------
A0A2V9SVU9      ------------------------------------------------------------
A0A2V8W5N5      ------------------------------------------------------------
A0A2V8XG53      ------------------------------------------------------------
A0A6A7LB89      ------------------------------------------------------------
A0A352EZH8      ------------------------------------------------------------
A0A0B6X033      ------------------------------------------------------------
A0A2V8R0I3      ------------------------------------------------------------
A0A2V8N1U8      ------------------------------------------------------------
A0A2V8QL35      ------------------------------------------------------------
A0A352FU10      ------------------------------------------------------------
A0A2V8LCU0      ------------------------------------------------------------
A0A1Q7NGT0      ------------------------------------------------------------
A0A2V8MLP9      ------------------------------------------------------------
A0A2V8PQZ0      ------------------------------------------------------------
A0A3B9MKY6      ------------------------------------------------------------
A0A3D5SKZ1      ------------------------------------------------------------
A0A2V8NRW2      ------------------------------------------------------------
A0A2V9XV04      ------------------------------------------------------------
A0A2V9CBY1      ------------------------------------------------------------
A0A2V9D656      ------------------------------------------------------------
A0A7C2L7W9      ------------------------------------------------------------
A0A7C2XG00      ------------------------------------------------------------
A0A2V9J901      ------------------------------------------------------------
A0A2V8QJ59      ------------------------------------------------------------
A0A1Q7HTA7      ------------------------------------------------------------
A0A2V8YMQ4      ------------------------------------------------------------
A0A2V8W380      ------------------------------------------------------------
A0A2V8ZIV5      ------------------------------------------------------------
A0A7C2M3P5      ------------------------------------------------------------
A0A2V8LBV1      ------------------------------------------------------------
A0A2V8GAF9      ------------------------------------------------------------
A0A7C5I7P7      ------------------------------------------------------------
A0A2V8CN98      ------------------------------------------------------------
A0A1Q7LC46      ------------------------------------------------------------
A0A1Q8BDC5      ------------------------------------------------------------
A0A2V9Q1Y8      ------------------------------------------------------------
A0A2V8JXG1      ------------------------------------------------------------
A0A350D2W9      ------------------------------------------------------------
A0A2V9I4J1      ------------------------------------------------------------
A0A2V8PQZ9      ------------------------------------------------------------
A0A2V8D8B1      ------------------------------------------------------------
A0A3B9LSB4      ------------------------------------------------------------
A0A2V9H7U2      ------------------------------------------------------------
A0A2V8NJB5      ------------------------------------------------------------
A0A2V9JMZ4      ------------------------------------------------------------
A0A2V9MDJ6      ------------------------------------------------------------
A0A2V8QJT6      ------------------------------------------------------------
A0A2V8FSM8      -----------------------MSQELQSLARHSYPTSTQPLSTIDLPPTAVSIEPPGP
A0A359M0J2      -----MHPEDPNSGTSHRPQALTPIVLPRNAQPALYTPFPSEPAPEAPATNWVQFHLAIL
A0A2V8JLJ1      ------------------------------------------------------------
A0A5M8SND8      -----------------MPHGTSGLRAAVVRRTIDAGAPLMPYTGTTGFDGDSLKIAADA
A0A2V9GAQ1      MTEENKLVPRENGSLGGSDLLPVPIRLPVWELSPREPHLYDYLLILRKHQWLILSFLHRE
A0A497EDQ8      ------------------------------------------------------------
G8NS05          ----------------------------MIPSRPENFSAEPDSRAASAGPAATDATLSEA
A0A2V8KZ20      ----------------------------MKNFENLTISDYIDIARRRIWYVVTTTTLVAA
A0A3D0NWU2      ------------------------------------------------------------
A0A2V8EPD9      ------------------------------------------------------------
A0A3N5NSX5      ------------------------------------------------------------
A0A2V8MUA1      ------------------------------------------------------------
A0A2V8MBH9      ------------------------------------------------------------
A0A3N5ZPQ7      ------------------------------------------------------------
A0A3N5P5F2      ------------------------------------------------------------
A0A7C2EFE5      ------------------------------------------------------------
A0A2V9G1P7      ---------------------------------------------PTIKELYELDAVSDA
A0A2V9BCK9      ------------------------------------------------------------
A0A2V9TMX2      -------------------------------------------MYQATSKVAIFPEVPNV
A0A7C4DQP8      ------------------------------------------------------------
A0A2V8N2J7      --------------------------------------------------------MAST
A0A3N6BI26      ------------------------------------------------------------
A0A2V9JMM3      -------------------------------------------------------MQLTE
A0A2V9M815      -------------------------------------------------------MQLTE
A0A2V9A795      ------------------------------------------------------------
A0A355ESH9      ------------------------------------------------------------
A0A3D0NW85      ------------------------------------------------------------
A0A353CAT5      ------------------------------------------------------------
A0A2V9HB55      ------------------------------------------------------------
A0A2V8CU57      ------------------------------------------------------------
A0A2V8BDI4      ------------------------------------------------------------
A0A2V8F8T3      ------------------------------------------------------------
A0A2W0B5E2      ------------------------------------------------------------
A0A2V8NMG8      ------------------------------------------------------------
A0A2V8TBM7      ------------------------------------------------------------
A0A1Q7HEZ8      ------------------------------------------------------------
A0A1Q7JW36      ------------------------------------------------------------
A0A1Q7MUR4      ------------------------------------------------------------
A0A3N5PFU4      ------------------------------------------------------------
A0A3M1SNQ5      ------------------------------------------------------------
A0A7C2C0C1      ------------------------------------------------------------
A0A4R1LDF1      ------------------------------------------------------------
A0A1F2T1R8      ------------------------------------------------------------
A0A2V9BW09      ------------------------------------------------------------
A0A3M1SSE1      ------------------------------------------------------------
A0A2V9GQV7      ------------------------------------------------------------
A0A7C5AUB2      ------------------------------------------------------------
A0A2V8YCY6      ------------------------------------------------------------
A0A2V8EGM3      ------------------------------------------------------------
A0A2V8FGH1      ------------------------------------------------------------
A0A2V7YV88      ------------------------------------------------------------
A0A2V8D468      ------------------------------------------------------------
A0A1F2R977      ------------------------------------------------------------
A0A2U3LF12      ------------------------------------------------------------
A0A7C5MF19      ------------------------------------------------------------
A0A3N5G7M6      ------------------------------------------------------------
A0A1F2S3Q7      ------------------------------------------------------------
A0A2V8GVG4      ------------------------------------------------------------
A0A2V8PJQ0      ------------------------------------------------------------
A0A2V8H566      ------------------------------------------------------------
A0A2V8UVN4      ------------------------------------------------------------
A0A1Q7RB73      ------------------------------------------------------------
A0A2V9K0H7      ------------------------------------------------------------
A0A321LXF5      ------------------------------------------------------------
A0A5M8SBZ0      ------------------------------------------------------------
A0A1Q7JFB1      ------------------------------------------------------------
A0A2V9LS17      ------------------------------------------------------------
A0A7C2YLF6      ------------------------------------------------------------
A0A2V7X0V9      ------------------------------------------------------------
A0A2V9X518      ------------------------------------------------------------
A0A2V9VC62      ------------------------------------------------------------
A0A2V9S1P8      ------------------------------------------------------------
A0A2V9RTW2      ------------------------------------------------------------
A0A2V9TGF1      ------------------------------------------------------------
A0A2V9XEV6      ------------------------------------------------------------
A0A2V9Y3Q6      ------------------------------------------------------------
A0A2V9R269      ------------------------------------------------------------
A0A2V9PTS3      ------------------------------------------------------------
A0A2V9NPF4      ------------------------------------------------------------
A0A2V9PNZ0      ------------------------------------------------------------
A0A2V9AGR3      ------------------------------------------------------------
A0A2V9G0N7      ------------------------------------------------------------
A0A2V9GQ44      ------------------------------------------------------------
A0A2V9HRN3      ------------------------------------------------------------
A0A2V8WG13      ------------------------------------------------------------
A0A2V8X987      ------------------------------------------------------------
A0A1Q7KX94      ------------------------------------------------------------
A0A2V8XHT0      ------------------------------------------------------------
A0A2V8DMJ9      ------------------------------------------------------------
A0A2V8GGF6      ------------------------------------------------------------
A0A2V8HKU7      ------------------------------------------------------------
A0A1Q6Y875      ------------------------------------------------------------
A0A523DJA9      ------------------------------------------------------------
A0A2V8I604      ------------------------------------------------------------
A0A2V8J066      ------------------------------------------------------------
A0A1I6MMC5      ------------------------------------------------------------
A0A2V9D5W7      ------------------------------------------------------------
A0A2V9D4I4      ------------------------------------------------------------
A0A2V9D6L7      ------------------------------------------------------------
A0A2V8ZJV2      ------------------------------------------------------------
A0A2V9AWB5      ------------------------------------------------------------
A0A2V8Z1Y8      ------------------------------------------------------------
A0A1Q8AX10      ------------------------------------------------------------
A0A2V9A773      ------------------------------------------------------------
A0A2V9AND3      ------------------------------------------------------------
A0A2V9BTJ7      ------------------------------------------------------------
A0A2V8W2M7      ------------------------------------------------------------
A0A2V8XNW2      ------------------------------------------------------------
A0A1Q7CJC1      ------------------------------------------------------------
A0A2V9UEM7      ------------------------------------------------------------
A0A7C4DTF2      ------------------------------------------------------------
A0A1Q7V300      ------------------------------------------------------------
A0A2V9ZCI3      ------------------------------------------------------------
A0A2V9WCB3      ------------------------------------------------------------
A0A2V9VQW5      ------------------------------------------------------------
A0A2V9WTP3      ------------------------------------------------------------
A0A2V9NLA9      ------------------------------------------------------------
A0A2V9RKJ9      ------------------------------------------------------------
A0A2V9RN95      ------------------------------------------------------------
A0A2V9N406      ------------------------------------------------------------
A0A2V9U6D9      ------------------------------------------------------------
A0A2V8DZN4      ------------------------------------------------------------
A0A3N5YKY1      ------------------------------------------------------------
A0A2G6HQA4      ------------------------------------------------------------
A0A2V7ZTY7      ------------------------------------------------------------
A0A2V7ZVL9      ------------------------------------------------------------
A0A1Q7QYI4      ------------------------------------------------------------
A0A2V8G9Y9      ------------------------------------------------------------
A0A143PNR5      ------------------------------------------------------------
A0A6A7L078      ------------------------------------------------------------
A0A143PXU3      ------------------------------------------------------------
A0A2V8D8G9      ------------------------------------------------------------
A0A2V8ESQ4      ------------------------------------------------------------
A0A1E3Y5Q0      ------------------------------------------------------------
A0A2W4TWK5      ------------------------------------------------------------
A0A3N5NYV3      ------------------------------------------------------------
A0A2V2RJF9      ------------------------------------------------------------
A0A2G6HNT3      ------------------------------------------------------------
A0A2V7YWD4      ------------------------------------------------------------
A0A2V2R8T6      ------------------------------------------------------------
A0A1Q7RGF1      ------------------------------------------------------------
A0A2V9BLX2      ------------------------------------------------------------
A0A2V9ZA03      ------------------------------------------------------------
A0A3N5ZNH4      ------------------------------------------------------------
A0A2V8GEZ2      ------------------------------------------------------------
A0A3N5ZFD3      ------------------------------------------------------------
G8NXD3          ------------------------------------------------------------
A0A2V9VR38      ------------------------------------------------------------
A0A2V9EY04      ------------------------------------------------------------
A0A2V9HAK9      ------------------------------------------------------------
A0A1Q7FS15      ------------------------------------------------------------
A0A1Q7K9P1      ------------------------------------------------------------
A0A1Q7N989      ------------------------------------------------------------
A0A2V9G7Y0      ------------------------------------------------------------
A0A2V8T7Z1      ------------------------------------------------------------
A0A2V7U8G5      ------------------------------------------------------------
A0A2V7UNP9      ------------------------------------------------------------
A0A2V7VLD7      ------------------------------------------------------------
A0A2V7XGA3      ------------------------------------------------------------
A0A2V7YAG6      ------------------------------------------------------------
A0A2V7VK33      ------------------------------------------------------------
A0A7C5EWK9      ------------------------------------------------------------
A0A3M1VTE1      ------------------------------------------------------------
A0A2V7TTM7      ------------------------------------------------------------
A0A2V8VI82      ------------------------------------------------------------
A0A2V7U4P9      ------------------------------------------------------------
A0A2V7TQY5      ------------------------------------------------------------
A0A2V7TU87      ------------------------------------------------------------
A0A2V8SEH0      ------------------------------------------------------------
A0A2V8VU54      ------------------------------------------------------------
A0A1Q7RML7      ------------------------------------------------------------
A0A1Q7ZIQ5      ------------------------------------------------------------
A0A2V8TKD8      ------------------------------------------------------------
                                                                            

A0A1F2U8T6      ------------------------------------------------------------
A0A2V8BV42      ------------------------------------------------------------
A0A2V8F916      ------------------------------------------------------------
A0A1Q7K833      ------------------------------------------------------------
A0A1Q8AMY4      ------------------------------------------------------------
A0A2V8BM40      ------------------------------------------------------------
A0A2V8CRT6      ------------------------------------------------------------
A0A1F2VH76      ------------------------------------------------------------
A0A1F2R0X5      ------------------------------------------------------------
A0A2V8B278      ------------------------------------------------------------
A0A2V8CEF9      ------------------------------------------------------------
A0A2V8KZG2      ------------------------------------------------------------
A0A2V8TKR9      ------------------------------------------------------------
A0A1Q7LG57      ------------------------------------------------------------
A0A2V8MKQ7      ------------------------------------------------------------
A0A1Q7L5B1      ------------------------------------------------------------
A0A2V9DKV4      ------------------------------------------------------------
A0A2V9EVA0      ------------------------------------------------------------
A0A7C5ZU39      ------------------------------------------------------------
A0A3N5YN96      ------------------------------------------------------------
A0A1Q7Y646      ------------------------------------------------------------
A0A2V8QZU0      ------------------------------------------------------------
A0A2V8RSQ9      ------------------------------------------------------------
A0A2V9L2P7      ------------------------------------------------------------
A0A2V7UMX0      ------------------------------------------------------------
A0A136K497      ------------------------------------------------------------
A0A399W9E4      ------------------------------------------------------------
A0A321LMC5      ------------------------------------------------------------
A0A2V8X713      ------------------------------------------------------------
A0A2V8ZLE9      ------------------------------------------------------------
A0A2V8Y4D3      ------------------------------------------------------------
A0A2V8Z2X8      ------------------------------------------------------------
A0A2V9C3F6      ------------------------------------------------------------
A0A2V9QMU9      ------------------------------------------------------------
A0A2V9QY75      ------------------------------------------------------------
A0A2V9SVU9      ------------------------------------------------------------
A0A2V8W5N5      ------------------------------------------------------------
A0A2V8XG53      ------------------------------------------------------------
A0A6A7LB89      ------------------------------------------------------------
A0A352EZH8      ------------------------------------------------------------
A0A0B6X033      ------------------------------------------------------------
A0A2V8R0I3      ------------------------------------------------------------
A0A2V8N1U8      ------------------------------------------------------------
A0A2V8QL35      ------------------------------------------------------------
A0A352FU10      ------------------------------------------------------------
A0A2V8LCU0      ------------------------------------------------------------
A0A1Q7NGT0      ------------------------------------------------------------
A0A2V8MLP9      ------------------------------------------------------------
A0A2V8PQZ0      ------------------------------------------------------------
A0A3B9MKY6      ------------------------------------------------------------
A0A3D5SKZ1      ------------------------------------------------------------
A0A2V8NRW2      ------------------------------------------------------------
A0A2V9XV04      ------------------------------------------------------------
A0A2V9CBY1      ------------------------------------------------------------
A0A2V9D656      ------------------------------------------------------------
A0A7C2L7W9      ------------------------------------------------------------
A0A7C2XG00      ------------------------------------------------------------
A0A2V9J901      ------------------------------------------------------------
A0A2V8QJ59      ------------------------------------------------------------
A0A1Q7HTA7      ------------------------------------------------------------
A0A2V8YMQ4      ------------------------------------------------------------
A0A2V8W380      ------------------------------------------------------------
A0A2V8ZIV5      ------------------------------------------------------------
A0A7C2M3P5      ------------------------------------------------------------
A0A2V8LBV1      ------------------------------------------------------------
A0A2V8GAF9      ------------------------------------------------------------
A0A7C5I7P7      ------------------------------------------------------------
A0A2V8CN98      ------------------------------------------------------------
A0A1Q7LC46      ------------------------------------------------------------
A0A1Q8BDC5      ------------------------------------------------------------
A0A2V9Q1Y8      ------------------------------------------------------------
A0A2V8JXG1      ------------------------------------------------------------
A0A350D2W9      ------------------------------------------------------------
A0A2V9I4J1      ------------------------------------------------------------
A0A2V8PQZ9      ------------------------------------------------------------
A0A2V8D8B1      ------------------------------------------------------------
A0A3B9LSB4      ------------------------------------------------------------
A0A2V9H7U2      ------------------------------------------------------------
A0A2V8NJB5      ------------------------------------------------------------
A0A2V9JMZ4      ------------------------------------------------------------
A0A2V9MDJ6      ------------------------------------------------------------
A0A2V8QJT6      ------------------------------------------------------------
A0A2V8FSM8      GLKRDYSGPVEYWQIVRRHKGAVLLATVAGALLGFAMTLSEPRIYQAKTTLEYQGINEEF
A0A359M0J2      KRRFWWVLALGFLGTGVGFLVFLPQDPQYMAATTIELQPINENFLGAFDPLSGSFSSQNL
A0A2V8JLJ1      ------------------------------------------------------------
A0A5M8SND8      ERGGLFEAWRIVRAEYRTVLLAMGVGLVLALSVGLFKAPMFTSRCELVIESPNGDFLGTR
A0A2V9GAQ1      NANILPFQGTDSYDIMMDQDNYIETQSKILTSETLALQTIRNNGLSARPEFSSPNGPSEA
A0A497EDQ8      ------------------------------------------------------------
G8NS05          LMTIRKRKYVILAAALLGMIYGFYKGSTQPHLFESYGDIEIRSGSSDQYRIAGSTGAGGN
A0A2V8KZ20      GTVLFALRLPAIYKSETTIAISSRFLPENYMPTIDRQTITDRMDFARQQLQSRTFLEGIV
A0A3D0NWU2      ------------------------------------------------------------
A0A2V8EPD9      ------------------------------------------------------------
A0A3N5NSX5      ---------------------------------------------------ARRLTRAAT
A0A2V8MUA1      ------------------------------------------------------------
A0A2V8MBH9      ------------------------------------------------------------
A0A3N5ZPQ7      ------------------------------------------------------------
A0A3N5P5F2      ------------------------------------------------------------
A0A7C2EFE5      ------------------------------------------------------------
A0A2V9G1P7      YLRTQYSILASESLARRAIDQLHLETLREFNSRKWWQLWPETRKPSTTQTFAVGPVPQVR
A0A2V9BCK9      ------MKATKMYEKFFGLRESPFNVNPDPRYLFLTPSTQEALASLAYGIRGRKGIILLT
A0A2V9TMX2      LGFKDAENIAPDYEYEATLETQVAILRSDALALKVIEGMRLYQDPRFTAVKQSSPESPMG
A0A7C4DQP8      ------------------------------------------------------------
A0A2V8N2J7      AGNSLSVFSILDALRRRKFILMISKILLTAGFAIFAHLQPDRFRATALIAAAQTTPPEYL
A0A3N6BI26      ----------------------------------MTSQLSWLKRTVSNLRPGRSDAPKTG
A0A2V9JMM3      VAKGASILAILDAARRRKFYVIVPALVLTVCVGAFASRLPNSYRAQALLAVERPPASDLL
A0A2V9M815      VAKGASILAILDAARRRKFYVIVPALVLTVCVGAFASRLPNSYRAQALLAVERPPASDLL
A0A2V9A795      ------------------------------------------------------------
A0A355ESH9      -----------------------------VRSLDLMADPSFNPGAAAAKE-------RTG
A0A3D0NW85      ---------------------------RGFLRAIGLASSPDAQSDASLSEFAASPNSGLM
A0A353CAT5      ----------------------------MLRAIGLASDTTKDTTSTADSVNSLNS--GLV
A0A2V9HB55      ---------------------------KILTSETLALQTIRNNGLSARPEFSSPS--GPS
A0A2V8CU57      ------------------------------------------------------------
A0A2V8BDI4      ---------------------------MDLPRMSGRSDATSSWRSAATSIWGRKP--RPR
A0A2V8F8T3      ---------------------------MDLPRMSGRSDATSSWRSAATSIWGRKP--RPR
A0A2W0B5E2      ------------------------------------------------------------
A0A2V8NMG8      ------------------------------------------------------------
A0A2V8TBM7      ------------------------------------------------------------
A0A1Q7HEZ8      ------------------------------------------------------------
A0A1Q7JW36      ------------------------------------------------------------
A0A1Q7MUR4      ------------------------------------------------------------
A0A3N5PFU4      ------------------------------------------------------------
A0A3M1SNQ5      ------------------------------------------------------------
A0A7C2C0C1      ------------------------------------------------------------
A0A4R1LDF1      ------------------------------------------------------------
A0A1F2T1R8      ------------------------------------------------------------
A0A2V9BW09      ------------------------------------------------------------
A0A3M1SSE1      ------------------------------------------------------------
A0A2V9GQV7      ------------------------------------------------------------
A0A7C5AUB2      ------------------------------------------------------------
A0A2V8YCY6      ------------------------------------------------------------
A0A2V8EGM3      ------------------------------------------------------------
A0A2V8FGH1      ------------------------------------------------------------
A0A2V7YV88      ------------------------------------------------------------
A0A2V8D468      ------------------------------------------------------------
A0A1F2R977      ------------------------------------------------------------
A0A2U3LF12      ------------------------------------------------------------
A0A7C5MF19      ------------------------------------------------------------
A0A3N5G7M6      ------------------------------------------------------------
A0A1F2S3Q7      ------------------------------------------------------------
A0A2V8GVG4      ------------------------------------------------------------
A0A2V8PJQ0      ------------------------------------------------------------
A0A2V8H566      ------------------------------------------------------------
A0A2V8UVN4      ------------------------------------------------------------
A0A1Q7RB73      ------------------------------------------------------------
A0A2V9K0H7      ------------------------------------------------------------
A0A321LXF5      ------------------------------------------------------------
A0A5M8SBZ0      ------------------------------------------------------------
A0A1Q7JFB1      ------------------------------------------------------------
A0A2V9LS17      ------------------------------------------------------------
A0A7C2YLF6      ------------------------------------------------------------
A0A2V7X0V9      ------------------------------------------------------------
A0A2V9X518      ------------------------------------------------------------
A0A2V9VC62      ------------------------------------------------------------
A0A2V9S1P8      ------------------------------------------------------------
A0A2V9RTW2      ------------------------------------------------------------
A0A2V9TGF1      ------------------------------------------------------------
A0A2V9XEV6      ------------------------------------------------------------
A0A2V9Y3Q6      ------------------------------------------------------------
A0A2V9R269      ------------------------------------------------------------
A0A2V9PTS3      ------------------------------------------------------------
A0A2V9NPF4      ------------------------------------------------------------
A0A2V9PNZ0      ------------------------------------------------------------
A0A2V9AGR3      ------------------------------------------------------------
A0A2V9G0N7      ------------------------------------------------------------
A0A2V9GQ44      ------------------------------------------------------------
A0A2V9HRN3      ------------------------------------------------------------
A0A2V8WG13      ------------------------------------------------------------
A0A2V8X987      ------------------------------------------------------------
A0A1Q7KX94      ------------------------------------------------------------
A0A2V8XHT0      ------------------------------------------------------------
A0A2V8DMJ9      ------------------------------------------------------------
A0A2V8GGF6      ------------------------------------------------------------
A0A2V8HKU7      ------------------------------------------------------------
A0A1Q6Y875      ------------------------------------------------------------
A0A523DJA9      ------------------------------------------------------------
A0A2V8I604      ------------------------------------------------------------
A0A2V8J066      ------------------------------------------------------------
A0A1I6MMC5      ------------------------------------------------------------
A0A2V9D5W7      ------------------------------------------------------------
A0A2V9D4I4      ------------------------------------------------------------
A0A2V9D6L7      ------------------------------------------------------------
A0A2V8ZJV2      ------------------------------------------------------------
A0A2V9AWB5      ------------------------------------------------------------
A0A2V8Z1Y8      ------------------------------------------------------------
A0A1Q8AX10      ------------------------------------------------------------
A0A2V9A773      ------------------------------------------------------------
A0A2V9AND3      ------------------------------------------------------------
A0A2V9BTJ7      ------------------------------------------------------------
A0A2V8W2M7      ------------------------------------------------------------
A0A2V8XNW2      ------------------------------------------------------------
A0A1Q7CJC1      ------------------------------------------------------------
A0A2V9UEM7      ------------------------------------------------------------
A0A7C4DTF2      ------------------------------------------------------------
A0A1Q7V300      ------------------------------------------------------------
A0A2V9ZCI3      ------------------------------------------------------------
A0A2V9WCB3      ------------------------------------------------------------
A0A2V9VQW5      ------------------------------------------------------------
A0A2V9WTP3      ------------------------------------------------------------
A0A2V9NLA9      ------------------------------------------------------------
A0A2V9RKJ9      ------------------------------------------------------------
A0A2V9RN95      ------------------------------------------------------------
A0A2V9N406      ------------------------------------------------------------
A0A2V9U6D9      ------------------------------------------------------------
A0A2V8DZN4      ------------------------------------------------------------
A0A3N5YKY1      ------------------------------------------------------------
A0A2G6HQA4      ------------------------------------------------------------
A0A2V7ZTY7      ------------------------------------------------------------
A0A2V7ZVL9      ------------------------------------------------------------
A0A1Q7QYI4      ------------------------------------------------------------
A0A2V8G9Y9      ------------------------------------------------------------
A0A143PNR5      ------------------------------------------------------------
A0A6A7L078      ------------------------------------------------------------
A0A143PXU3      ------------------------------------------------------------
A0A2V8D8G9      ------------------------------------------------------------
A0A2V8ESQ4      ------------------------------------------------------------
A0A1E3Y5Q0      ------------------------------------------------------------
A0A2W4TWK5      ------------------------------------------------------------
A0A3N5NYV3      ------------------------------------------------------------
A0A2V2RJF9      ------------------------------------------------------------
A0A2G6HNT3      ------------------------------------------------------------
A0A2V7YWD4      ------------------------------------------------------------
A0A2V2R8T6      ------------------------------------------------------------
A0A1Q7RGF1      ------------------------------------------------------------
A0A2V9BLX2      ------------------------------------------------------------
A0A2V9ZA03      ------------------------------------------------------------
A0A3N5ZNH4      ------------------------------------------------------------
A0A2V8GEZ2      ------------------------------------------------------------
A0A3N5ZFD3      ------------------------------------------------------------
G8NXD3          ------------------------------------------------------------
A0A2V9VR38      ------------------------------------------------------------
A0A2V9EY04      ------------------------------------------------------------
A0A2V9HAK9      ------------------------------------------------------------
A0A1Q7FS15      ------------------------------------------------------------
A0A1Q7K9P1      ------------------------------------------------------------
A0A1Q7N989      ------------------------------------------------------------
A0A2V9G7Y0      ------------------------------------------------------------
A0A2V8T7Z1      ------------------------------------------------------------
A0A2V7U8G5      ------------------------------------------------------------
A0A2V7UNP9      ------------------------------------------------------------
A0A2V7VLD7      ------------------------------------------------------------
A0A2V7XGA3      ------------------------------------------------------------
A0A2V7YAG6      ------------------------------------------------------------
A0A2V7VK33      ------------------------------------------------------------
A0A7C5EWK9      ------------------------------------------------------------
A0A3M1VTE1      ------------------------------------------------------------
A0A2V7TTM7      ------------------------------------------------------------
A0A2V8VI82      ------------------------------------------------------------
A0A2V7U4P9      ------------------------------------------------------------
A0A2V7TQY5      ------------------------------------------------------------
A0A2V7TU87      ------------------------------------------------------------
A0A2V8SEH0      ------------------------------------------------------------
A0A2V8VU54      ------------------------------------------------------------
A0A1Q7RML7      ------------------------------------------------------------
A0A1Q7ZIQ5      ------------------------------------------------------------
A0A2V8TKD8      ------------------------------------------------------------
                                                                            

A0A1F2U8T6      ------------------------------------------------------------
A0A2V8BV42      ------------------------------------------------------------
A0A2V8F916      ------------------------------------------------------------
A0A1Q7K833      ------------------------------------------------------------
A0A1Q8AMY4      ------------------------------------------------------------
A0A2V8BM40      ------------------------------------------------------------
A0A2V8CRT6      ------------------------------------------------------------
A0A1F2VH76      ------------------------------------------------------------
A0A1F2R0X5      ------------------------------------------------------------
A0A2V8B278      ------------------------------------------------------------
A0A2V8CEF9      ------------------------------------------------------------
A0A2V8KZG2      ------------------------------------------------------------
A0A2V8TKR9      ------------------------------------------------------------
A0A1Q7LG57      ------------------------------------------------------------
A0A2V8MKQ7      ------------------------------------------------------------
A0A1Q7L5B1      ------------------------------------------------------------
A0A2V9DKV4      ------------------------------------------------------------
A0A2V9EVA0      ------------------------------------------------------------
A0A7C5ZU39      ------------------------------------------------------------
A0A3N5YN96      ------------------------------------------------------------
A0A1Q7Y646      ------------------------------------------------------------
A0A2V8QZU0      ------------------------------------------------------------
A0A2V8RSQ9      ------------------------------------------------------------
A0A2V9L2P7      ------------------------------------------------------------
A0A2V7UMX0      ------------------------------------------------------------
A0A136K497      ------------------------------------------------------------
A0A399W9E4      ------------------------------------------------------------
A0A321LMC5      ------------------------------------------------------------
A0A2V8X713      ------------------------------------------------------------
A0A2V8ZLE9      ------------------------------------------------------------
A0A2V8Y4D3      ------------------------------------------------------------
A0A2V8Z2X8      ------------------------------------------------------------
A0A2V9C3F6      ------------------------------------------------------------
A0A2V9QMU9      ------------------------------------------------------------
A0A2V9QY75      ------------------------------------------------------------
A0A2V9SVU9      ------------------------------------------------------------
A0A2V8W5N5      ------------------------------------------------------------
A0A2V8XG53      ------------------------------------------------------------
A0A6A7LB89      ------------------------------------------------------------
A0A352EZH8      ------------------------------------------------------------
A0A0B6X033      ------------------------------------------------------------
A0A2V8R0I3      ------------------------------------------------------------
A0A2V8N1U8      ------------------------------------------------------------
A0A2V8QL35      ------------------------------------------------------------
A0A352FU10      ------------------------------------------------------------
A0A2V8LCU0      ------------------------------------------------------------
A0A1Q7NGT0      ------------------------------------------------------------
A0A2V8MLP9      ------------------------------------------------------------
A0A2V8PQZ0      ------------------------------------------------------------
A0A3B9MKY6      ------------------------------------------------------------
A0A3D5SKZ1      ------------------------------------------------------------
A0A2V8NRW2      ------------------------------------------------------------
A0A2V9XV04      ------------------------------------------------------------
A0A2V9CBY1      ------------------------------------------------------------
A0A2V9D656      ------------------------------------------------------------
A0A7C2L7W9      ------------------------------------------------------------
A0A7C2XG00      ------------------------------------------------------------
A0A2V9J901      ------------------------------------------------------------
A0A2V8QJ59      ------------------------------------------------------------
A0A1Q7HTA7      ------------------------------------------------------------
A0A2V8YMQ4      ------------------------------------------------------------
A0A2V8W380      ------------------------------------------------------------
A0A2V8ZIV5      ------------------------------------------------------------
A0A7C2M3P5      ------------------------------------------------------------
A0A2V8LBV1      ------------------------------------------------------------
A0A2V8GAF9      ------------------------------------------------------------
A0A7C5I7P7      ------------------------------------------------------------
A0A2V8CN98      ------------------------------------------------------------
A0A1Q7LC46      ------------------------------------------------------------
A0A1Q8BDC5      ------------------------------------------------------------
A0A2V9Q1Y8      ------------------------------------------------------------
A0A2V8JXG1      ------------------------------------------------------------
A0A350D2W9      ------------------------------------------------------------
A0A2V9I4J1      ------------------------------------------------------------
A0A2V8PQZ9      ------------------------------------------------------------
A0A2V8D8B1      ------------------------------------------------------------
A0A3B9LSB4      ------------------------------------------------------------
A0A2V9H7U2      ------------------------------------------------------------
A0A2V8NJB5      ------------------------------------------------------------
A0A2V9JMZ4      ------------------------------------------------------------
A0A2V9MDJ6      ------------------------------------------------------------
A0A2V8QJT6      ------------------------------------------------------------
A0A2V8FSM8      LDMKKVNPVVDTSYLDSDISTQVKILESRALISRVREKMATRPQPERLQPPDRLGMWRTA
A0A359M0J2      NAQTQISILRSYSLLSAALERMER-----------------ESTLTAAAPAGRFAALRRR
A0A2V8JLJ1      ------------------------------------------------------------
A0A5M8SND8      SISPVADDPASEGGLTDVQTQLRVIQSDQLIDRVIAKLESQGKLGPLELEATHRSFASRL
A0A2V9GAQ1      VALGSLANQKRPPELGQFLGSLTV------------------------------------
A0A497EDQ8      ------------------------------------------------------------
G8NS05          RLPTEVAILKSDTLLLTVAEDLDLANNQDFLGMTQRPPHVNIEDPNVRQATIGRMQAIVS
A0A2V8KZ20      EEFHLAGPDGVEKAAEVIRNKIEI---TVL------------------------------
A0A3D0NWU2      ------------------------------------------------------------
A0A2V8EPD9      ------------------------------------------------------------
A0A3N5NSX5      PSGATAGQPSATDLANAFLGAVHV---EQV------------------------------
A0A2V8MUA1      ------------------------------------------------------------
A0A2V8MBH9      ------------------------------------------------------------
A0A3N5ZPQ7      ------------------------------------------------------------
A0A3N5P5F2      ------------------------------------------------------------
A0A7C2EFE5      ------------------------------------------------------------
A0A2V9G1P7      DRELS------ERVLERFLDRLTI---DPV------------------------------
A0A2V9BCK9      GEVGTGKTTLLNRLLDWLRHEQAV---TAF------------------------------
A0A2V9TMX2      EPSMQPDPVQAAGLLGAFRGGLSV---QPV------------------------------
A0A7C4DQP8      ------------------------------------------------------------
A0A2V8N2J7      R-HVAPPPLNIEDHLWTVREVLYS---EPVLKAAARESKRYRSNKGDLSPQQLDEFKQAI
A0A3N6BI26      ADESGAGRDKNRDVLDTFRDRLEV---AQV------------------------------
A0A2V9JMM3      KMGGTPGPPGIQEQLRVIRETLFA---RPLLQEVLKEFTLYGPATD--PDWATEDMKKRI
A0A2V9M815      RMGGTPGPPSIQEQLRVIRETLFA---RPLLQEVLKEFKLYGPATD--PDWATEDMKKRI
A0A2V9A795      ---------MYQRVLERFQDRLTI---EPV---------------------------S--
A0A355ESH9      ATTAEEDEATLGKLAQQLKGGLTV---DPV---------------------------R--
A0A3D0NW85      SADEIAEAIRLAPFVDVIKRNLSI---EPV---------------------------RES
A0A353CAT5      SADEIAEAIRLAPYVEIIRNNLTV---EPV---------------------------REP
A0A2V9HB55      EAIAVGSLANQKRPPGLGEFLGSL---SVK---------------------------RVP
A0A2V8CU57      ------------------------------------------------------------
A0A2V8BDI4      HRRCA---RRRPRPSWRSPRERQW---RST---------------------------RRP
A0A2V8F8T3      HRRCA---RRRPRPSWRSPRERQW---RST---------------------------RRP
A0A2W0B5E2      ------------------------------------------------------------
A0A2V8NMG8      ------------------------------------------------------------
A0A2V8TBM7      ------------------------------------------------------------
A0A1Q7HEZ8      ------------------------------------------------------------
A0A1Q7JW36      ------------------------------------------------------------
A0A1Q7MUR4      ------------------------------------------------------------
A0A3N5PFU4      ------------------------------------------------------------
A0A3M1SNQ5      ------------------------------------------------------------
A0A7C2C0C1      ------------------------------------------------------------
A0A4R1LDF1      ------------------------------------------------------------
A0A1F2T1R8      ------------------------------------------------------------
A0A2V9BW09      ------------------------------------------------------------
A0A3M1SSE1      ------------------------------------------------------------
A0A2V9GQV7      ------------------------------------------------------------
A0A7C5AUB2      ------------------------------------------------------------
A0A2V8YCY6      ------------------------------------------------------------
A0A2V8EGM3      ------------------------------------------------------------
A0A2V8FGH1      ------------------------------------------------------------
A0A2V7YV88      ------------------------------------------------------------
A0A2V8D468      ------------------------------------------------------------
A0A1F2R977      ------------------------------------------------------------
A0A2U3LF12      ------------------------------------------------------------
A0A7C5MF19      ------------------------------------------------------------
A0A3N5G7M6      ------------------------------------------------------------
A0A1F2S3Q7      ------------------------------------------------------------
A0A2V8GVG4      ------------------------------------------------------------
A0A2V8PJQ0      ------------------------------------------------------------
A0A2V8H566      ------------------------------------------------------------
A0A2V8UVN4      ------------------------------------------------------------
A0A1Q7RB73      ------------------------------------------------------------
A0A2V9K0H7      ------------------------------------------------------------
A0A321LXF5      ------------------------------------------------------------
A0A5M8SBZ0      ------------------------------------------------------------
A0A1Q7JFB1      ------------------------------------------------------------
A0A2V9LS17      ------------------------------------------------------------
A0A7C2YLF6      ------------------------------------------------------------
A0A2V7X0V9      ------------------------------------------------------------
A0A2V9X518      ------------------------------------------------------------
A0A2V9VC62      ------------------------------------------------------------
A0A2V9S1P8      ------------------------------------------------------------
A0A2V9RTW2      ------------------------------------------------------------
A0A2V9TGF1      ------------------------------------------------------------
A0A2V9XEV6      ------------------------------------------------------------
A0A2V9Y3Q6      ------------------------------------------------------------
A0A2V9R269      ------------------------------------------------------------
A0A2V9PTS3      ------------------------------------------------------------
A0A2V9NPF4      ------------------------------------------------------------
A0A2V9PNZ0      ------------------------------------------------------------
A0A2V9AGR3      ------------------------------------------------------------
A0A2V9G0N7      ------------------------------------------------------------
A0A2V9GQ44      ------------------------------------------------------------
A0A2V9HRN3      ------------------------------------------------------------
A0A2V8WG13      ------------------------------------------------------------
A0A2V8X987      ------------------------------------------------------------
A0A1Q7KX94      ------------------------------------------------------------
A0A2V8XHT0      ------------------------------------------------------------
A0A2V8DMJ9      ------------------------------------------------------------
A0A2V8GGF6      ------------------------------------------------------------
A0A2V8HKU7      ------------------------------------------------------------
A0A1Q6Y875      ------------------------------------------------------------
A0A523DJA9      ------------------------------------------------------------
A0A2V8I604      ------------------------------------------------------------
A0A2V8J066      ------------------------------------------------------------
A0A1I6MMC5      ------------------------------------------------------------
A0A2V9D5W7      ------------------------------------------------------------
A0A2V9D4I4      ------------------------------------------------------------
A0A2V9D6L7      ------------------------------------------------------------
A0A2V8ZJV2      ------------------------------------------------------------
A0A2V9AWB5      ------------------------------------------------------------
A0A2V8Z1Y8      ------------------------------------------------------------
A0A1Q8AX10      ------------------------------------------------------------
A0A2V9A773      ------------------------------------------------------------
A0A2V9AND3      ------------------------------------------------------------
A0A2V9BTJ7      ------------------------------------------------------------
A0A2V8W2M7      ------------------------------------------------------------
A0A2V8XNW2      ------------------------------------------------------------
A0A1Q7CJC1      ------------------------------------------------------------
A0A2V9UEM7      ------------------------------------------------------------
A0A7C4DTF2      ------------------------------------------------------------
A0A1Q7V300      ------------------------------------------------------------
A0A2V9ZCI3      ------------------------------------------------------------
A0A2V9WCB3      ------------------------------------------------------------
A0A2V9VQW5      ------------------------------------------------------------
A0A2V9WTP3      ------------------------------------------------------------
A0A2V9NLA9      ------------------------------------------------------------
A0A2V9RKJ9      ------------------------------------------------------------
A0A2V9RN95      ------------------------------------------------------------
A0A2V9N406      ------------------------------------------------------------
A0A2V9U6D9      ------------------------------------------------------------
A0A2V8DZN4      ------------------------------------------------------------
A0A3N5YKY1      ------------------------------------------------------------
A0A2G6HQA4      ------------------------------------------------------------
A0A2V7ZTY7      ------------------------------------------------------------
A0A2V7ZVL9      ------------------------------------------------------------
A0A1Q7QYI4      ------------------------------------------------------------
A0A2V8G9Y9      ------------------------------------------------------------
A0A143PNR5      ------------------------------------------------------------
A0A6A7L078      ------------------------------------------------------------
A0A143PXU3      ------------------------------------------------------------
A0A2V8D8G9      ------------------------------------------------------------
A0A2V8ESQ4      ------------------------------------------------------------
A0A1E3Y5Q0      ------------------------------------------------------------
A0A2W4TWK5      ------------------------------------------------------------
A0A3N5NYV3      ------------------------------------------------------------
A0A2V2RJF9      ------------------------------------------------------------
A0A2G6HNT3      ------------------------------------------------------------
A0A2V7YWD4      ------------------------------------------------------------
A0A2V2R8T6      ------------------------------------------------------------
A0A1Q7RGF1      ------------------------------------------------------------
A0A2V9BLX2      ------------------------------------------------------------
A0A2V9ZA03      ------------------------------------------------------------
A0A3N5ZNH4      ------------------------------------------------------------
A0A2V8GEZ2      ------------------------------------------------------------
A0A3N5ZFD3      ------------------------------------------------------------
G8NXD3          ------------------------------------------------------------
A0A2V9VR38      ------------------------------------------------------------
A0A2V9EY04      ------------------------------------------------------------
A0A2V9HAK9      ------------------------------------------------------------
A0A1Q7FS15      ------------------------------------------------------------
A0A1Q7K9P1      ------------------------------------------------------------
A0A1Q7N989      ------------------------------------------------------------
A0A2V9G7Y0      ------------------------------------------------------------
A0A2V8T7Z1      ------------------------------------------------------------
A0A2V7U8G5      ------------------------------------------------------------
A0A2V7UNP9      ------------------------------------------------------------
A0A2V7VLD7      ------------------------------------------------------------
A0A2V7XGA3      ------------------------------------------------------------
A0A2V7YAG6      ------------------------------------------------------------
A0A2V7VK33      ------------------------------------------------------------
A0A7C5EWK9      ------------------------------------------------------------
A0A3M1VTE1      ------------------------------------------------------------
A0A2V7TTM7      ------------------------------------------------------------
A0A2V8VI82      ------------------------------------------------------------
A0A2V7U4P9      ------------------------------------------------------------
A0A2V7TQY5      ------------------------------------------------------------
A0A2V7TU87      ------------------------------------------------------------
A0A2V8SEH0      ------------------------------------------------------------
A0A2V8VU54      ------------------------------------------------------------
A0A1Q7RML7      ------------------------------------------------------------
A0A1Q7ZIQ5      ------------------------------------------------------------
A0A2V8TKD8      ------------------------------------------------------------
                                                                            

A0A1F2U8T6      --------------------------------------------------MGRAGQARGP
A0A2V8BV42      --------------------------------------------MADLPPNARADSSPGV
A0A2V8F916      --------------------------------------------MADLPPNARADSAPGV
A0A1Q7K833      ------------------------------------------------------------
A0A1Q8AMY4      ------------------------------------------------------------
A0A2V8BM40      ----------------------------------------------MPDHRQRTSSGTGS
A0A2V8CRT6      ------------------------------------------------------------
A0A1F2VH76      ------------------------------------MNGPNTPANLQAGTH---ALTPLS
A0A1F2R0X5      ------------------------------------MSESASGGAHRPSTTSASASHPTG
A0A2V8B278      ------------------------------------MAEPKAPHPLRPATT---ADHPAA
A0A2V8CEF9      ------------------------------------MAELKAPHSLRPATT---ADHPAA
A0A2V8KZG2      ------------------------------------------------------------
A0A2V8TKR9      ------------------------------------------------------------
A0A1Q7LG57      ------------------------------------------------------------
A0A2V8MKQ7      ------------------------------------------------------------
A0A1Q7L5B1      ------------------------------------------------------------
A0A2V9DKV4      ------------------------------------------------------------
A0A2V9EVA0      ------------------------------------------------------------
A0A7C5ZU39      ------------------------------------------------------------
A0A3N5YN96      ------------------------------------------------------------
A0A1Q7Y646      ------------------------------------------------------------
A0A2V8QZU0      ------------------------------------------------------------
A0A2V8RSQ9      ------------------------------------------------------------
A0A2V9L2P7      ------------------------------------------------------------
A0A2V7UMX0      ------------------------------------------------------------
A0A136K497      ------------------------------------------------------------
A0A399W9E4      ------------------------------------------------------------
A0A321LMC5      ------------------------------------------------------------
A0A2V8X713      ------------------------------------------------------------
A0A2V8ZLE9      ------------------------------------------------------------
A0A2V8Y4D3      ------------------------------------------------------------
A0A2V8Z2X8      ------------------------------------------------------------
A0A2V9C3F6      ------------------------------------------------------------
A0A2V9QMU9      ------------------------------------------------------------
A0A2V9QY75      ------------------------------------------------------------
A0A2V9SVU9      ------------------------------------------------------------
A0A2V8W5N5      ------------------------------------------------------------
A0A2V8XG53      ------------------------------------------------------------
A0A6A7LB89      ------------------------------------------------------------
A0A352EZH8      ------------------------------------------------------------
A0A0B6X033      ------------------------------------------------------------
A0A2V8R0I3      ------------------------------------------------------------
A0A2V8N1U8      ------------------------------------------------------------
A0A2V8QL35      ------------------------------------------------------------
A0A352FU10      ------------------------------------------------------------
A0A2V8LCU0      ------------------------------------------------------------
A0A1Q7NGT0      ------------------------------------------------------------
A0A2V8MLP9      ------------------------------------------------------------
A0A2V8PQZ0      ------------------------------------------------------------
A0A3B9MKY6      ------------------------------------------------------------
A0A3D5SKZ1      ------------------------------------------------------------
A0A2V8NRW2      ------------------------------------------------------------
A0A2V9XV04      ------------------------------------------------------------
A0A2V9CBY1      ------------------------------------------------------------
A0A2V9D656      ------------------------------------------------------------
A0A7C2L7W9      ------------------------------------------------------------
A0A7C2XG00      ------------------------------------------------------------
A0A2V9J901      ------------------------------------------------------------
A0A2V8QJ59      ------------------------------------------------------------
A0A1Q7HTA7      ------------------------------------------------------------
A0A2V8YMQ4      ------------------------------------------------------------
A0A2V8W380      ------------------------------------------------------------
A0A2V8ZIV5      ------------------------------------------------------------
A0A7C2M3P5      ------------------------------------------------------------
A0A2V8LBV1      ------------------------------------------------------------
A0A2V8GAF9      ------------------------------------------------------------
A0A7C5I7P7      ------------------------------------------------------------
A0A2V8CN98      ------------------------------------------------------------
A0A1Q7LC46      ------------------------------------------------------------
A0A1Q8BDC5      ---------------------------------------------------MLANPVLSE
A0A2V9Q1Y8      ------------------------------------------------------------
A0A2V8JXG1      ------------------------------------------------------------
A0A350D2W9      ------------------------------------------------------------
A0A2V9I4J1      ------------------------------------------------------------
A0A2V8PQZ9      --------------------------------------MKSEKDLRASSTLPAAPNFGQR
A0A2V8D8B1      ------------------------------------------------------------
A0A3B9LSB4      ------------------------------------------------------------
A0A2V9H7U2      ------------------------------------------------------------
A0A2V8NJB5      ------------------------------------------------------MNLVLD
A0A2V9JMZ4      ----------------------------------------------------MTVQLLLD
A0A2V9MDJ6      ----------------------------------------------------MTVQLLLD
A0A2V8QJT6      --------------------------------------------------------MLEA
A0A2V8FSM8      LRLNAPTADGLWKQALGSAADGVRVRSSGTNRIIDMSCDSTNGQIAADFCNTLAQEYIDQ
A0A359M0J2      LGFVPLEPLEATREATFIAARSVMPRIVPGTRIIQITASSTIPEVAANLVNAVAAEYVYQ
A0A2V8JLJ1      ----------------------------------------------------------ME
A0A5M8SND8      LMRPKLTANERAYRIHKYVASHLGVRQVGPTRAVDISFSFPDPAFAALLCNTMASEYIAY
A0A2V9GAQ1      -KR------------------------VPNSHLMDVSFESTDPQLAARIVNAHISSYIEQ
A0A497EDQ8      -------------------------------------MIGRNPDRVAEWLNVYVEQYIAA
G8NS05          VAN------------------------IPKTDIIRISCSTFNAKLSADIINKLIDAYIKR
A0A2V8KZ20      -----------------------------TANTFKLGFPAADPFSAQAVTKRLTERIIQL
A0A3D0NWU2      ------------------------------------------------------------
A0A2V8EPD9      -------------------------------------------------MTRLADALLRA
A0A3N5NSX5      ----------------------------RGSRLFNVSITSSDPQFAARAADALAAEYVQF
A0A2V8MUA1      ----------------------------------------------------------MQ
A0A2V8MBH9      ------------------------------------------------------------
A0A3N5ZPQ7      ----------------------------------------MDPAQASRLCSYPCAAFPTP
A0A3N5P5F2      ---------------------------------------------------------IER
A0A7C2EFE5      --------------------------------------------------------YLEH
A0A2V9G1P7      ----------------------------NRSRLVAVRFDSHDPELAARVVNTLAADYVDQ
A0A2V9BCK9      ---------------------------IFNTRLSVTEFFDCLTADFGISCQSPSKSHVLL
A0A2V9TMX2      ----------------------------PSTRLIQVSYTHSDPRFATEITNALVKTFIEE
A0A7C4DQP8      ------------------------------------------------------------
A0A2V8N2J7      GIK------------------------VDSEHSFQLTYEAGDRYDAMNVTNKLAELFVQN
A0A3N6BI26      ----------------------------PNSRLVEIRWVSPDPTLAAAVSDTLAEEFIEQ
A0A2V9JMM3      RIQ------------------------VEGTDAFYIGFEDGDRQAVAEVANRLAELFVKS
A0A2V9M815      RIQ------------------------VEGTDAFYIGFEDGDRQAVAEVANRLAELFVKS
A0A2V9A795      -----------------------------RSRLVTVQFDSNNADLSARVVNTLAEDYIDQ
A0A355ESH9      -----------------------------NTQLVRLSFRSSSREFSAKAANAFAESFIDM
A0A3D0NW85      RVT------------------------VKDTRLIEVAFRNTDPQLAAFVVNGIGETFAAS
A0A353CAT5      RAT------------------------FKDTRLIEISFRHTNPELAAFVVNGLGETFAST
A0A2V9HB55      -----------------------------NSRLMDVSFESTDPQLAARVVNAHIASYIEQ
A0A2V8CU57      ------------------------------------------------------------
A0A2V8BDI4      -----------------------------DRAIVARSRGRCSAASTAR----DGSCFSED
A0A2V8F8T3      -----------------------------DRAIVARSRGRCSAASTAR----DGSCFSED
A0A2W0B5E2      ------------------------------------------------------------
A0A2V8NMG8      ------------------------------------------------------------
A0A2V8TBM7      ------------------------------------------------------------
A0A1Q7HEZ8      ------------------------------------------------------------
A0A1Q7JW36      ------------------------------------------------------------
A0A1Q7MUR4      ------------------------------------------------------------
A0A3N5PFU4      ------------------------------------------------------------
A0A3M1SNQ5      ------------------------------------------------------------
A0A7C2C0C1      ------------------------------------------------------------
A0A4R1LDF1      ------------------------------------------------------------
A0A1F2T1R8      ------------------------------------------------------------
A0A2V9BW09      ------------------------------------------------------------
A0A3M1SSE1      ------------------------------------------------------------
A0A2V9GQV7      ------------------------------------------------------------
A0A7C5AUB2      ------------------------------------------------------------
A0A2V8YCY6      ------------------------------------------------------------
A0A2V8EGM3      ------------------------------------------------------------
A0A2V8FGH1      ------------------------------------------------------------
A0A2V7YV88      ------------------------------------------------------------
A0A2V8D468      ------------------------------------------------------------
A0A1F2R977      ------------------------------------------------------------
A0A2U3LF12      ------------------------------------------------------------
A0A7C5MF19      ------------------------------------------------------------
A0A3N5G7M6      ------------------------------------------------------------
A0A1F2S3Q7      ------------------------------------------------------------
A0A2V8GVG4      ------------------------------------------------------------
A0A2V8PJQ0      ------------------------------------------------------------
A0A2V8H566      ------------------------------------------------------------
A0A2V8UVN4      ------------------------------------------------------------
A0A1Q7RB73      ------------------------------------------------------------
A0A2V9K0H7      ------------------------------------------------------------
A0A321LXF5      ------------------------------------------------------------
A0A5M8SBZ0      ------------------------------------------------------------
A0A1Q7JFB1      ------------------------------------------------------------
A0A2V9LS17      ------------------------------------------------------------
A0A7C2YLF6      ------------------------------------------------------------
A0A2V7X0V9      ------------------------------------------------------------
A0A2V9X518      ------------------------------------------------------------
A0A2V9VC62      ------------------------------------------------------------
A0A2V9S1P8      ------------------------------------------------------------
A0A2V9RTW2      ------------------------------------------------------------
A0A2V9TGF1      ------------------------------------------------------------
A0A2V9XEV6      ------------------------------------------------------------
A0A2V9Y3Q6      ------------------------------------------------------------
A0A2V9R269      ------------------------------------------------------------
A0A2V9PTS3      ------------------------------------------------------------
A0A2V9NPF4      ------------------------------------------------------------
A0A2V9PNZ0      ------------------------------------------------------------
A0A2V9AGR3      ------------------------------------------------------------
A0A2V9G0N7      ------------------------------------------------------------
A0A2V9GQ44      ------------------------------------------------------------
A0A2V9HRN3      ------------------------------------------------------------
A0A2V8WG13      ------------------------------------------------------------
A0A2V8X987      ------------------------------------------------------------
A0A1Q7KX94      ------------------------------------------------------------
A0A2V8XHT0      ------------------------------------------------------------
A0A2V8DMJ9      ------------------------------------------------------------
A0A2V8GGF6      ------------------------------------------------------------
A0A2V8HKU7      ------------------------------------------------------------
A0A1Q6Y875      ------------------------------------------------------------
A0A523DJA9      ------------------------------------------------------------
A0A2V8I604      ------------------------------------------------------------
A0A2V8J066      ------------------------------------------------------------
A0A1I6MMC5      ------------------------------------------------------------
A0A2V9D5W7      ------------------------------------------------------------
A0A2V9D4I4      ------------------------------------------------------------
A0A2V9D6L7      ------------------------------------------------------------
A0A2V8ZJV2      ------------------------------------------------------------
A0A2V9AWB5      ------------------------------------------------------------
A0A2V8Z1Y8      ------------------------------------------------------------
A0A1Q8AX10      ------------------------------------------------------------
A0A2V9A773      ------------------------------------------------------------
A0A2V9AND3      ------------------------------------------------------------
A0A2V9BTJ7      ------------------------------------------------------------
A0A2V8W2M7      ------------------------------------------------------------
A0A2V8XNW2      ------------------------------------------------------------
A0A1Q7CJC1      ------------------------------------------------------------
A0A2V9UEM7      ------------------------------------------------------------
A0A7C4DTF2      ------------------------------------------------------------
A0A1Q7V300      ------------------------------------------------------------
A0A2V9ZCI3      ------------------------------------------------------------
A0A2V9WCB3      ------------------------------------------------------------
A0A2V9VQW5      ------------------------------------------------------------
A0A2V9WTP3      ------------------------------------------------------------
A0A2V9NLA9      ------------------------------------------------------------
A0A2V9RKJ9      ------------------------------------------------------------
A0A2V9RN95      ------------------------------------------------------------
A0A2V9N406      ------------------------------------------------------------
A0A2V9U6D9      ------------------------------------------------------------
A0A2V8DZN4      ------------------------------------------------------------
A0A3N5YKY1      ------------------------------------------------------------
A0A2G6HQA4      ------------------------------------------------------------
A0A2V7ZTY7      ------------------------------------------------------------
A0A2V7ZVL9      ------------------------------------------------------------
A0A1Q7QYI4      ------------------------------------------------------------
A0A2V8G9Y9      ------------------------------------------------------------
A0A143PNR5      ------------------------------------------------------------
A0A6A7L078      ------------------------------------------------------------
A0A143PXU3      ------------------------------------------------------------
A0A2V8D8G9      ------------------------------------------------------------
A0A2V8ESQ4      ------------------------------------------------------------
A0A1E3Y5Q0      ------------------------------------------------------------
A0A2W4TWK5      ------------------------------------------------------------
A0A3N5NYV3      ------------------------------------------------------------
A0A2V2RJF9      ------------------------------------------------------------
A0A2G6HNT3      ------------------------------------------------------------
A0A2V7YWD4      ------------------------------------------------------------
A0A2V2R8T6      ------------------------------------------------------------
A0A1Q7RGF1      ------------------------------------------------------------
A0A2V9BLX2      ------------------------------------------------------------
A0A2V9ZA03      ------------------------------------------------------------
A0A3N5ZNH4      ------------------------------------------------------------
A0A2V8GEZ2      ------------------------------------------------------------
A0A3N5ZFD3      ------------------------------------------------------------
G8NXD3          ------------------------------------------------------------
A0A2V9VR38      ------------------------------------------------------------
A0A2V9EY04      ------------------------------------------------------------
A0A2V9HAK9      ------------------------------------------------------------
A0A1Q7FS15      ------------------------------------------------------------
A0A1Q7K9P1      ------------------------------------------------------------
A0A1Q7N989      ------------------------------------------------------------
A0A2V9G7Y0      ------------------------------------------------------------
A0A2V8T7Z1      ------------------------------------------------------------
A0A2V7U8G5      ------------------------------------------------------------
A0A2V7UNP9      ------------------------------------------------------------
A0A2V7VLD7      ------------------------------------------------------------
A0A2V7XGA3      ------------------------------------------------------------
A0A2V7YAG6      ------------------------------------------------------------
A0A2V7VK33      ------------------------------------------------------------
A0A7C5EWK9      ------------------------------------------------------------
A0A3M1VTE1      ------------------------------------------------------------
A0A2V7TTM7      ------------------------------------------------------------
A0A2V8VI82      ------------------------------------------------------------
A0A2V7U4P9      ------------------------------------------------------------
A0A2V7TQY5      ------------------------------------------------------------
A0A2V7TU87      ------------------------------------------------------------
A0A2V8SEH0      ------------------------------------------------------------
A0A2V8VU54      ------------------------------------------------------------
A0A1Q7RML7      ------------------------------------------------------------
A0A1Q7ZIQ5      ------------------------------------------------------------
A0A2V8TKD8      ------------------------------------------------------------
                                                                            

A0A1F2U8T6      LS------THAVHKDVHILDLLAVIYRYRRMAFSVFILTTIALMIQGYSGVRLYQAKAQL
A0A2V8BV42      FAPPPAGAPYAPDGDIHLLDRFAILYRYRRIAVSVFILTTAVLMIQGYTNVKVFQARAQL
A0A2V8F916      FAPPPAGAPYAPDGDIHLLDRFAILYRYRRIAVSVFILTTAVLMIQGYTNVKVFQARAQL
A0A1Q7K833      --------MYSPDTDVHILDRLAVLYRYRRIAIAVFVLTTAAMMIQGYTTEKIFRAQARL
A0A1Q8AMY4      --------MYSPDTDVHILDRLAVLYRYRRIAIAVFVLTTAAMMIQGYTTEKIFRAQARL
A0A2V8BM40      NPPAPAPLAYAADNDVHILDRLAVIYRYRYIATAVFVLATSAIMIQSYTSLELFRAQARL
A0A2V8CRT6      --------------------------------------------------LELFRAQARL
A0A1F2VH76      QE-------------THLLDRLSVLFKYRRAAMAVFVLVVAWNMVDSYTTIPQYQAQSRV
A0A1F2R0X5      TAGHSPASSYAPQSEVHLLDRLVVLYRYRWLCLTVFVLVSGAMIIQGYTTVRMYRAQARL
A0A2V8B278      AA---PTSTYTPDTDVHILDRLAVLYRYRRVAIAVFILTTVAMMIQGYSSTQMYRAQARL
A0A2V8CEF9      AA---PTSTYTPDTDVHILDRLAVLYRYRRVAIAVFILTTVAMMIQGYSSIQMYRAQARL
A0A2V8KZG2      ------------------------------------------------------------
A0A2V8TKR9      ------------------------------------------------------------
A0A1Q7LG57      ------------------------------------------------------------
A0A2V8MKQ7      ------------------------------------------------------------
A0A1Q7L5B1      ------------------------------------------------------------
A0A2V9DKV4      ------------------------------------------------------------
A0A2V9EVA0      ------------------------------------------------------------
A0A7C5ZU39      ------------------------------------------------------------
A0A3N5YN96      ------------------------------------------------------------
A0A1Q7Y646      ------------------------------------------------------------
A0A2V8QZU0      ------------------------------------------------------------
A0A2V8RSQ9      ------------------------------------------------------------
A0A2V9L2P7      ------------------------------------------------------------
A0A2V7UMX0      ------------------------------------------------------------
A0A136K497      ------------------------------------------------------------
A0A399W9E4      ------------------------------------------------------------
A0A321LMC5      ------------------------------------------------------------
A0A2V8X713      ------------------------------------------------------------
A0A2V8ZLE9      ------------------------------------------------------------
A0A2V8Y4D3      ------------------------------------------------------------
A0A2V8Z2X8      ------------------------------------------------------------
A0A2V9C3F6      ------------------------------------------------------------
A0A2V9QMU9      ------------------------------------------------------------
A0A2V9QY75      ------------------------------------------------------------
A0A2V9SVU9      ------------------------------------------------------------
A0A2V8W5N5      ------------------------------------------------------------
A0A2V8XG53      ------------------------------------------------------------
A0A6A7LB89      ------------------------------------------------------------
A0A352EZH8      ------------------------------------------------------------
A0A0B6X033      ------------------------------------------------------------
A0A2V8R0I3      ------------------------------------------------------------
A0A2V8N1U8      ------------------------------------------------------------
A0A2V8QL35      ------------------------------------------------------------
A0A352FU10      ------------------------------------------------------------
A0A2V8LCU0      ------------------------------------------------------------
A0A1Q7NGT0      ------------------------------------------------------------
A0A2V8MLP9      ------------------------------------------------------------
A0A2V8PQZ0      ------------------------------------------------------------
A0A3B9MKY6      ------------------------------------------------------------
A0A3D5SKZ1      ------------------------------------------------------------
A0A2V8NRW2      ------------------------------------------------------------
A0A2V9XV04      ------------------------------------------------------------
A0A2V9CBY1      ------------------------------------------------------------
A0A2V9D656      ------------------------------------------------------------
A0A7C2L7W9      ------------------------------------------------------------
A0A7C2XG00      ------------------------------------------------------------
A0A2V9J901      ------------------------------------------------------------
A0A2V8QJ59      ------------------------------------------------------------
A0A1Q7HTA7      ------------------------------------------------------------
A0A2V8YMQ4      ------------------------------------------------------------
A0A2V8W380      ------------------------------------------------------------
A0A2V8ZIV5      ------------------------------------------------------------
A0A7C2M3P5      ------------------------------------------------------------
A0A2V8LBV1      ------------------------------------------------------------
A0A2V8GAF9      ------------------------------------------------------------
A0A7C5I7P7      ------------------------------------------------------------
A0A2V8CN98      ---------------------MSEFLTRRVQEDQLRRDQDALAQLLAQGPDSLGFSERLA
A0A1Q7LC46      ------------------------------------------------------------
A0A1Q8BDC5      IRELHQKKQSGILV---LTGGAGERVEVFFREGMIDAASSNMDARRLGDYLAKQEYLHAR
A0A2V9Q1Y8      ---------------------------------MIR------------------------
A0A2V8JXG1      ------------------------------------------------------------
A0A350D2W9      ------------------------------------------------------------
A0A2V9I4J1      --------------------------------------------------------MEAS
A0A2V8PQZ9      GTAIPATAMAATAT----------------------------------------------
A0A2V8D8B1      -----MPCPLKSAR----------------------------------------------
A0A3B9LSB4      ------------------------------------------------------------
A0A2V9H7U2      ------------------------------------------------------------
A0A2V8NJB5      EIRQLGENRENGFL---TLSRNGHRVVMFYREGMIQAVSSNLTSHRLGDYLVKAGYLTAR
A0A2V9JMZ4      HIRPILEGSKDGTL---LLGNQSEIIKVFCRQGLIEAVSSNLEQYHLGQHLVTEGFMEAS
A0A2V9MDJ6      HIRPILEGSKDGTL---LLGNQSEIIKVFCRQGLIEAVSSNLEQYHLGQHLVTEGFMEAS
A0A2V8QJT6      ENDRKMAEAEYNAA----------------------------------------------
A0A2V8FSM8      SLEARWKTTEYTGQ---WLTKQLDDLKI-----KLEKQEEGLQAYANATGLIMTSE----
A0A359M0J2      NQQFRSNSVQRTTQ---WIAGQLEETKF-----KLEQAEQKLQDFVRKSGNVFVNS----
A0A2V8JLJ1      GLVRQFKAAAEAAK----------------------------------------------
A0A5M8SND8      NTEARWAMSERTGE---GLSRRLEEVRA-----HLKESQKNLQDYAQRSGLLFGPPVPGT
A0A2V9GAQ1      NFRSKYEATTRAST---WLTDQLTELKI-----RVQKAEDARIAYERRN-QIWTLDDK--
A0A497EDQ8      NIEDGIDKTRKIYK---VIQSRLDPLRL-----QVEAGQRKLMSFQEGHDSLGFADEQ--
G8NS05          SFTSRVSSTQRASG---WLTSQLDELKH-----QVETSQNQVIDLQKRI-GVLSIDPT--
A0A2V8KZ20      NDSFRKEKVQVADQ---FLEEQLEQAGN-----ELSEAERKLLQLRNGAFPGVTTDVVTP
A0A3D0NWU2      -SASQRGEGMNIPD---LYENKIFQDTM-----RLNNERKAKLQ----------------
A0A2V8EPD9      NRQNQLAASAAATA----------------------------------------------
A0A3N5NSX5      NLEYRTDATRKSLD---FLAGEIAKQQT-----KVEDSERAMAEYRESN-NALSLEDR--
A0A2V8MUA1      ATNEVAQSDNKIRE---FYQKHFPGLPE-----DQAAILQTLNDLGRER-VTVENSIESI
A0A2V8MBH9      --------------------------------------EEKLVSYAKNN-QILSLDAS--
A0A3N5ZPQ7      KATEVNRFESSMDN----------------------------------------------
A0A3N5P5F2      NLQFKFDASKDAAD---WLTNQLDAQRK-----NVEETELALQRYREQN-NATSTN----
A0A7C2EFE5      TYHIRIRSSQSMTA---FMESQLAELKA-----KMERSSRALSEFEREL-NVINPEEK--
A0A2V9G1P7      SLEARWQATQKAAE---WLSQQLVGVKA-----KLEKSEDALQGYARHN-GLVFLETDKG
A0A2V9BCK9      GLNRWLLDRYRAGETAVLIVDEAQNLSQ-----QLLEEIRLLSNLETST-EKL-------
A0A2V9TMX2      NFRTKYNSASQTSE---WLGKELADLQL-----KVQTSEEKLVRYQKDH-GILGVDEK--
A0A7C4DQP8      -------------H---ILDERLRQLQE-----ELTRAQAERF-----------------
A0A2V8N2J7      ASAKREQKTSEAAN---VINEQVDDLKN-----RLQRQNDQIQNY-KTK-AVHALPDH--
A0A3N6BI26      NLQTKFEANTRATE---FLKKQLQDMKG-----KVEKSEQELVKYAREN-NIVNIGPDR-
A0A2V9JMM3      TSASQEQNVEEAAG---LLDQELARLRD-----KLADEDEEIKEYK--------------
A0A2V9M815      TSASQEQNVEEAAG---LLDQELARLRD-----KLADEDEEIKEYK--------------
A0A2V9A795      SLEARWAATQKAAD---WLSQQLVGVKS-----KLEKSEEQLQDYARHN-GLVFLETDKG
A0A355ESH9      GVEDRYASAGKAST---FLGSQIETLKQ-----EVAEKEAQLQAFSRSS-DIVTLDPQ--
A0A3D0NW85      NQEQRSGTSRKTSD---FLQQRIADLQS-----DIRRDELKLVELERTE-GILKTPGD--
A0A353CAT5      NQEQRSGTSRKTSD---FLQKRISDLQA-----DIRNDEVRLVELERSE-GILKTPGD--
A0A2V9HB55      NFSSKYEATTRASA---WLADQLTELKI-----KVQRAEDARIAYERQN-QIWTLDDK--
A0A2V8CU57      --MSRLEDALRRAE----LANRQAKMKT-----EAEAA-------VKTP-AVAAWSEP--
A0A2V8BDI4      TSMSRLEDALRRAE----LANRQAKMKT-----EAEAA-------VKTP-AVAA------
A0A2V8F8T3      TSMSRLEDALRRAE----LANRQAKMKT-----EAEAA-------VKTP-AVAAWSEP--
A0A2W0B5E2      ------------------------------------------------------------
A0A2V8NMG8      ------------------------------------------------------------
A0A2V8TBM7      ------------------------------------------------------------
A0A1Q7HEZ8      ------------------------------------------------------------
A0A1Q7JW36      ------------------------------------------------------------
A0A1Q7MUR4      ------------------------------------------------------------
A0A3N5PFU4      ------------------------------------------------------------
A0A3M1SNQ5      ------------------------------------------------------------
A0A7C2C0C1      ------------------------------------------------------------
A0A4R1LDF1      ------------------------------------------------------------
A0A1F2T1R8      ------------------------------------------------------------
A0A2V9BW09      ------------------------------------------------------------
A0A3M1SSE1      ------------------------------------------------------------
A0A2V9GQV7      ------------------------------------------------------------
A0A7C5AUB2      ------------------------------------------------------------
A0A2V8YCY6      ------------------------------------------------------------
A0A2V8EGM3      ------------------------------------------------------------
A0A2V8FGH1      ------------------------------------------------------------
A0A2V7YV88      ------------------------------------------------------------
A0A2V8D468      ------------------------------------------------------------
A0A1F2R977      ------------------------------------------------------------
A0A2U3LF12      ------------------------------------------------------------
A0A7C5MF19      ------------------------------------------------------------
A0A3N5G7M6      ------------------------------------------------------------
A0A1F2S3Q7      ------------------------------------------------------------
A0A2V8GVG4      ------------------------------------------------------------
A0A2V8PJQ0      ------------------------------------------------------------
A0A2V8H566      ------------------------------------------------------------
A0A2V8UVN4      ------------------------------------------------------------
A0A1Q7RB73      ------------------------------------------------------------
A0A2V9K0H7      ------------------------------------------------------------
A0A321LXF5      ------------------------------------------------------------
A0A5M8SBZ0      ------------------------------------------------------------
A0A1Q7JFB1      ------------------------------------------------------------
A0A2V9LS17      ------------------------------------------------------------
A0A7C2YLF6      ------------------------------------------------------------
A0A2V7X0V9      ------------------------------------------------------------
A0A2V9X518      ------------------------------------------------------------
A0A2V9VC62      ------------------------------------------------------------
A0A2V9S1P8      ------------------------------------------------------------
A0A2V9RTW2      ------------------------------------------------------------
A0A2V9TGF1      ------------------------------------------------------------
A0A2V9XEV6      ------------------------------------------------------------
A0A2V9Y3Q6      ------------------------------------------------------------
A0A2V9R269      ------------------------------------------------------------
A0A2V9PTS3      ------------------------------------------------------------
A0A2V9NPF4      ------------------------------------------------------------
A0A2V9PNZ0      ------------------------------------------------------------
A0A2V9AGR3      ------------------------------------------------------------
A0A2V9G0N7      ------------------------------------------------------------
A0A2V9GQ44      ------------------------------------------------------------
A0A2V9HRN3      ------------------------------------------------------------
A0A2V8WG13      ------------------------------------------------------------
A0A2V8X987      ------------------------------------------------------------
A0A1Q7KX94      ------------------------------------------------------------
A0A2V8XHT0      ------------------------------------------------------------
A0A2V8DMJ9      ------------------------------------------------------------
A0A2V8GGF6      ------------------------------------------------------------
A0A2V8HKU7      ------------------------------------------------------------
A0A1Q6Y875      ------------------------------------------------------------
A0A523DJA9      ------------------------------------------------------------
A0A2V8I604      ------------------------------------------------------------
A0A2V8J066      ------------------------------------------------------------
A0A1I6MMC5      ------------------------------------------------------------
A0A2V9D5W7      ------------------------------------------------------------
A0A2V9D4I4      ------------------------------------------------------------
A0A2V9D6L7      ------------------------------------------------------------
A0A2V8ZJV2      ------------------------------------------------------------
A0A2V9AWB5      ------------------------------------------------------------
A0A2V8Z1Y8      ------------------------------------------------------------
A0A1Q8AX10      ------------------------------------------------------------
A0A2V9A773      ------------------------------------------------------------
A0A2V9AND3      ------------------------------------------------------------
A0A2V9BTJ7      ------------------------------------------------------------
A0A2V8W2M7      ------------------------------------------------------------
A0A2V8XNW2      ------------------------------------------------------------
A0A1Q7CJC1      ------------------------------------------------------------
A0A2V9UEM7      ------------------------------------------------------------
A0A7C4DTF2      ------------------------------------------------------------
A0A1Q7V300      ------------------------------------------------------------
A0A2V9ZCI3      ------------------------------------------------------------
A0A2V9WCB3      ------------------------------------------------------------
A0A2V9VQW5      ------------------------------------------------------------
A0A2V9WTP3      ------------------------------------------------------------
A0A2V9NLA9      ------------------------------------------------------------
A0A2V9RKJ9      ------------------------------------------------------------
A0A2V9RN95      ------------------------------------------------------------
A0A2V9N406      ------------------------------------------------------------
A0A2V9U6D9      ------------------------------------------------------------
A0A2V8DZN4      ------------------------------------------------------------
A0A3N5YKY1      ------------------------------------------------------------
A0A2G6HQA4      ------------------------------------------------------------
A0A2V7ZTY7      ------------------------------------------------------------
A0A2V7ZVL9      ------------------------------------------------------------
A0A1Q7QYI4      ------------------------------------------------------------
A0A2V8G9Y9      ------------------------------------------------------------
A0A143PNR5      ------------------------------------------------------------
A0A6A7L078      ------------------------------------------------------------
A0A143PXU3      ------------------------------------------------------------
A0A2V8D8G9      ------------------------------------------------------------
A0A2V8ESQ4      ------------------------------------------------------------
A0A1E3Y5Q0      ------------------------------------------------------------
A0A2W4TWK5      ------------------------------------------------------------
A0A3N5NYV3      ------------------------------------------------------------
A0A2V2RJF9      ------------------------------------------------------------
A0A2G6HNT3      ------------------------------------------------------------
A0A2V7YWD4      ------------------------------------------------------------
A0A2V2R8T6      ------------------------------------------------------------
A0A1Q7RGF1      ------------------------------------------------------------
A0A2V9BLX2      ------------------------------------------------------------
A0A2V9ZA03      ------------------------------------------------------------
A0A3N5ZNH4      ------------------------------------------------------------
A0A2V8GEZ2      ------------------------------------------------------------
A0A3N5ZFD3      ------------------------------------------------------------
G8NXD3          ------------------------------------------------------------
A0A2V9VR38      ------------------------------------------------------------
A0A2V9EY04      ------------------------------------------------------------
A0A2V9HAK9      ------------------------------------------------------------
A0A1Q7FS15      ------------------------------------------------------------
A0A1Q7K9P1      ------------------------------------------------------------
A0A1Q7N989      ------------------------------------------------------------
A0A2V9G7Y0      ------------------------------------------------------------
A0A2V8T7Z1      ------------------------------------------------------------
A0A2V7U8G5      ------------------------------------------------------------
A0A2V7UNP9      ------------------------------------------------------------
A0A2V7VLD7      ------------------------------------------------------------
A0A2V7XGA3      ------------------------------------------------------------
A0A2V7YAG6      ------------------------------------------------------------
A0A2V7VK33      ------------------------------------------------------------
A0A7C5EWK9      ------------------------------------------------------------
A0A3M1VTE1      ------------------------------------------------------------
A0A2V7TTM7      ------------------------------------------------------------
A0A2V8VI82      ------------------------------------------------------------
A0A2V7U4P9      ------------------------------------------------------------
A0A2V7TQY5      ------------------------------------------------------------
A0A2V7TU87      ------------------------------------------------------------
A0A2V8SEH0      ------------------------------------------------------------
A0A2V8VU54      ------------------------------------------------------------
A0A1Q7RML7      ------------------------------------------------------------
A0A1Q7ZIQ5      ------------------------------------------------------------
A0A2V8TKD8      ------------------------------------------------------------
                                                                            

A0A1F2U8T6      LIEDERSTAMPGI--ATGQYYEDPVPYYNTQHRILRSRELARRVVRRLQLGTHPEFNGTA
A0A2V8BV42      LIEDERSTAVPGLNSSENTYYEDPEPYYNTQFRILKGRDLVRRVVRRLKLGTIPEFNGTA
A0A2V8F916      LIEDERSTAVPGLNSSENTYYEDPEPYYNTQFRILKGRDLVRRVVRRLKLGTIPEFNGTA
A0A1Q7K833      LIEDERSTAVPGM-SPEN-FYQDPDLYYKTQYRILKGRDLTRRVVRRLNLGSVPEFNGTA
A0A1Q8AMY4      LIEDERSTAVPGM-SPEN-FYQDPDLYYKTQYRILKGRDLTRRVVRRLNLGSVPEFNGTA
A0A2V8BM40      LIEDERSTAVPGV-SADNSYYEDPDLYYKTQYRILKGRDLTRRVVRKLNMAAIPEFNGTA
A0A2V8CRT6      LIEDERSTAVPGV-SADNSYYEDPDLYYKTQYRILKGRDLTRRVVRKLNVAAIPEFNGTA
A0A1F2VH76      LIDEDTAGLGTPADISQNFTLQDPEVYLQTQLRIIRGRELARRTAKKLELHTVPEFNGQG
A0A1F2R0X5      QIDDERSTAIPGLQSDQNTFYEDPEPYYQTQYRILRGRDLTRRVVQRLRLDTVPEFNGTA
A0A2V8B278      LIEDERATAVPGITTAENTYYEDPDLYYKTQYRILKGRDLARRVVKRVNLGAVPEFNGTA
A0A2V8CEF9      LIEDERATAVPGITTAENTYYEDPDLYYKTQYRILKGRDLARRVVKRVNLGAVPEFNGTA
A0A2V8KZG2      ------------------------------------------------------------
A0A2V8TKR9      ------------------------------------------------------------
A0A1Q7LG57      ------------------------------------------------------------
A0A2V8MKQ7      ------------------------------------------------------------
A0A1Q7L5B1      ------------------------------------------------------------
A0A2V9DKV4      ------------------------------------------------------------
A0A2V9EVA0      ------------------------------------------------------------
A0A7C5ZU39      ------------------------------------------------------------
A0A3N5YN96      ------------------------------------------------------------
A0A1Q7Y646      ------------------------------------------------------------
A0A2V8QZU0      ------------------------------------------------------------
A0A2V8RSQ9      ------------------------------------------------------------
A0A2V9L2P7      ------------------------------------------------------------
A0A2V7UMX0      ------------------------------------------------------------
A0A136K497      ------------------------------------------------------------
A0A399W9E4      ------------------------------------------------------------
A0A321LMC5      ------------------------------------------------------------
A0A2V8X713      ------------------------------------------------------------
A0A2V8ZLE9      ------------------------------------------------------------
A0A2V8Y4D3      ------------------------------------------------------------
A0A2V8Z2X8      ------------------------------------------------------------
A0A2V9C3F6      ------------------------------------------------------------
A0A2V9QMU9      ------------------------------------------------------------
A0A2V9QY75      ------------------------------------------------------------
A0A2V9SVU9      ------------------------------------------------------------
A0A2V8W5N5      ------------------------------------------------------------
A0A2V8XG53      ------------------------------------------------------------
A0A6A7LB89      ------------------------------------------------------------
A0A352EZH8      ------------------------------------------------------------
A0A0B6X033      ------------------------------------------------------------
A0A2V8R0I3      ------------------------------------------------------------
A0A2V8N1U8      ------------------------------------------------------------
A0A2V8QL35      ------------------------------------------------------------
A0A352FU10      ------------------------------------------------------------
A0A2V8LCU0      ------------------------------------------------------------
A0A1Q7NGT0      ------------------------------------------------------------
A0A2V8MLP9      ------------------------------------------------------------
A0A2V8PQZ0      ------------------------------------------------------------
A0A3B9MKY6      ------------------------------------------------------------
A0A3D5SKZ1      ------------------------------------------------------------
A0A2V8NRW2      ------------------------------------------------------------
A0A2V9XV04      ------------------------------------------------------------
A0A2V9CBY1      ------------------------------------------------------------
A0A2V9D656      ------------------------------------------------------------
A0A7C2L7W9      ------------------------------------------------------------
A0A7C2XG00      ------------------------------------------------------------
A0A2V9J901      ------------------------------------------------------------
A0A2V8QJ59      ------------------------------------------------------------
A0A1Q7HTA7      ------------------------------------------------------------
A0A2V8YMQ4      ------------------------------------------------------------
A0A2V8W380      ------------------------------------------------------------
A0A2V8ZIV5      ------------------------------------------------------------
A0A7C2M3P5      ------------------------------------------------------------
A0A2V8LBV1      ------------------------------------------------------------
A0A2V8GAF9      ------------------------------------------------------------
A0A7C5I7P7      ------------------------------------------------------------
A0A2V8CN98      AIGAVQGSADLTRALSELTTKRADRRA---------------------------------
A0A1Q7LC46      ------------------------------------------------------------
A0A1Q8BDC5      DLDAAHSEAQRHQILIGEAVVRKRLL----------------------------------
A0A2V9Q1Y8      ------------------------------------------------------------
A0A2V8JXG1      ------------------------------------------------------------
A0A350D2W9      ------------------------------------------------------------
A0A2V9I4J1      AVQPLLAESRRQGVPIGEAALRSKLL----------------------------------
A0A2V8PQZ9      ------------------------------------------------------------
A0A2V8D8B1      ------------------------------------------------------------
A0A3B9LSB4      ------------------------------------------------------------
A0A2V9H7U2      ------------------------------------------------------------
A0A2V8NJB5      DIQSVLKSAQRKHALFGEAAVRERHL----------------------------------
A0A2V9JMZ4      AVQPLLAESRRQGVPIGEAALRSKLL----------------------------------
A0A2V9MDJ6      AVQPLLAESRRQGVPIGEAALRSKLL----------------------------------
A0A2V8QJT6      ---------KAPGAAGALAEAGAKE-----------------------------------
A0A2V8FSM8      --KNNVQEAQLGDLEKELSVARADRI----------------------------------
A0A359M0J2      --EDTLANSKLRQLQAELTAAQTDRI----------------------------------
A0A2V8JLJ1      --AAAAAT----------------------------------------------------
A0A5M8SND8      SEETDVSENRLTELQSELSGAEAARM----------------------------------
A0A2V9GAQ1      --QNITSQ-RLGDINRQLTDAQSERM----------------------------------
A0A497EDQ8      --KSVITE-QVDLLTKEYAQAKAERI----------------------------------
G8NS05          --HNQISS-SLEELTTAAGTAQIARI----------------------------------
A0A2V8KZ20      DVVRDLQA-QLAKLDAQVESANDQRKVLQRRLEEHRQ-----------------------
A0A3D0NWU2      ------------------------------------------------------------
A0A2V8EPD9      ------------------------------------------------------------
A0A3N5NSX5      --QNTVVS-SLNQVNDEYTRIRTVRI----------------------------------
A0A2V8MUA1      TTETKLLE-QRRQEQQKFKIAMSSRAPAGPSRAEGQA-----------------------
A0A2V8MBH9      --QNTVVE-RLAGLNKQLLEAENDRK----------------------------------
A0A3N5ZPQ7      --RKAILE-YMKQIEV--------------------------------------------
A0A3N5P5F2      --DPEVIQ-RLSGLNAAVMEARTARL----------------------------------
A0A7C2EFE5      --TSILSA-RLLQLNSEFTSAQADRV----------------------------------
A0A2V9G1P7      ASQNVANE-RLQQLQEQLTKAQSERY----------------------------------
A0A2V9BCK9      --LQIVLS-GQPELEEKLKHAQLRQF----------------------------------
A0A2V9TMX2      --QNIVTE-KLGELNKELTEAETDRI----------------------------------
A0A7C4DQP8      ------------------------------------------------------------
A0A2V8N2J7      --IDNTIK-AIDSLKEQIQDRETKIAEEQAKRASIER-----------------------
A0A3N6BI26      --GSMVLQ-TLEDLNRQMTTVEGELI----------------------------------
A0A2V9JMM3      --QKVGEE-LPEHLGTNLKLVEALEMRLQAKRDSIGENQARR------------------
A0A2V9M815      --QKVGEE-LPEHLGTNLKLVEALEMRLQAKRDSIGENQARR------------------
A0A2V9A795      ASQNVANE-RLQQLQEELTKAEAERY----------------------------------
A0A355ESH9      --SNVTLR-RLETLNTALMDAKKERI----------------------------------
A0A3D0NW85      --QTIVLE-RLAGLNKDLLTAENERKTAEAQFLSVRNN----------------------
A0A353CAT5      --QTIVLE-RLGGLNKDLLTAENDRKTAEAEYNSVKGS----------------------
A0A2V9HB55      --QNITSQ-RLSDINKQLTDAQSERM----------------------------------
A0A2V8CU57      --EAVTAP-FAAAGSEPESAAAPPVVAAWSEPETVTAPLAA-------------------
A0A2V8BDI4      ------------------------------------------------------------
A0A2V8F8T3      --EAVTAP-FAAAWSEPESAAPLPAVAAWSEPETVTAPLAAAAWSEPESAAVLPAVAAWS
A0A2W0B5E2      ------------------------------------------------------------
A0A2V8NMG8      ------------------------------------------------------------
A0A2V8TBM7      ------------------------------------------------------------
A0A1Q7HEZ8      ------------------------------------------------------------
A0A1Q7JW36      ------------------------------------------------------------
A0A1Q7MUR4      ------------------------------------------------------------
A0A3N5PFU4      ------------------------------------------------------------
A0A3M1SNQ5      ------------------------------------------------------------
A0A7C2C0C1      ------------------------------------------------------------
A0A4R1LDF1      ------------------------------------------------------------
A0A1F2T1R8      ------------------------------------------------------------
A0A2V9BW09      ------------------------------------------------------------
A0A3M1SSE1      ------------------------------------------------------------
A0A2V9GQV7      ------------------------------------------------------------
A0A7C5AUB2      ------------------------------------------------------------
A0A2V8YCY6      ------------------------------------------------------------
A0A2V8EGM3      ------------------------------------------------------------
A0A2V8FGH1      ------------------------------------------------------------
A0A2V7YV88      ------------------------------------------------------------
A0A2V8D468      ------------------------------------------------------------
A0A1F2R977      ------------------------------------------------------------
A0A2U3LF12      ------------------------------------------------------------
A0A7C5MF19      ------------------------------------------------------------
A0A3N5G7M6      ------------------------------------------------------------
A0A1F2S3Q7      ------------------------------------------------------------
A0A2V8GVG4      ------------------------------------------------------------
A0A2V8PJQ0      ------------------------------------------------------------
A0A2V8H566      ------------------------------------------------------------
A0A2V8UVN4      ------------------------------------------------------------
A0A1Q7RB73      ------------------------------------------------------------
A0A2V9K0H7      ------------------------------------------------------------
A0A321LXF5      ------------------------------------------------------------
A0A5M8SBZ0      ------------------------------------------------------------
A0A1Q7JFB1      ------------------------------------------------------------
A0A2V9LS17      ------------------------------------------------------------
A0A7C2YLF6      ------------------------------------------------------------
A0A2V7X0V9      ------------------------------------------------------------
A0A2V9X518      ------------------------------------------------------------
A0A2V9VC62      ------------------------------------------------------------
A0A2V9S1P8      ------------------------------------------------------------
A0A2V9RTW2      ------------------------------------------------------------
A0A2V9TGF1      ------------------------------------------------------------
A0A2V9XEV6      ------------------------------------------------------------
A0A2V9Y3Q6      ------------------------------------------------------------
A0A2V9R269      ------------------------------------------------------------
A0A2V9PTS3      ------------------------------------------------------------
A0A2V9NPF4      ------------------------------------------------------------
A0A2V9PNZ0      ------------------------------------------------------------
A0A2V9AGR3      ------------------------------------------------------------
A0A2V9G0N7      ------------------------------------------------------------
A0A2V9GQ44      ------------------------------------------------------------
A0A2V9HRN3      ------------------------------------------------------------
A0A2V8WG13      ------------------------------------------------------------
A0A2V8X987      ------------------------------------------------------------
A0A1Q7KX94      ------------------------------------------------------------
A0A2V8XHT0      ------------------------------------------------------------
A0A2V8DMJ9      ------------------------------------------------------------
A0A2V8GGF6      ------------------------------------------------------------
A0A2V8HKU7      ------------------------------------------------------------
A0A1Q6Y875      ------------------------------------------------------------
A0A523DJA9      ------------------------------------------------------------
A0A2V8I604      ------------------------------------------------------------
A0A2V8J066      ------------------------------------------------------------
A0A1I6MMC5      ------------------------------------------------------------
A0A2V9D5W7      ------------------------------------------------------------
A0A2V9D4I4      ------------------------------------------------------------
A0A2V9D6L7      ------------------------------------------------------------
A0A2V8ZJV2      ------------------------------------------------------------
A0A2V9AWB5      ------------------------------------------------------------
A0A2V8Z1Y8      ------------------------------------------------------------
A0A1Q8AX10      ------------------------------------------------------------
A0A2V9A773      ------------------------------------------------------------
A0A2V9AND3      ------------------------------------------------------------
A0A2V9BTJ7      ------------------------------------------------------------
A0A2V8W2M7      ------------------------------------------------------------
A0A2V8XNW2      ------------------------------------------------------------
A0A1Q7CJC1      ------------------------------------------------------------
A0A2V9UEM7      ------------------------------------------------------------
A0A7C4DTF2      ------------------------------------------------------------
A0A1Q7V300      ------------------------------------------------------------
A0A2V9ZCI3      ------------------------------------------------------------
A0A2V9WCB3      ------------------------------------------------------------
A0A2V9VQW5      ------------------------------------------------------------
A0A2V9WTP3      ------------------------------------------------------------
A0A2V9NLA9      ------------------------------------------------------------
A0A2V9RKJ9      ------------------------------------------------------------
A0A2V9RN95      ------------------------------------------------------------
A0A2V9N406      ------------------------------------------------------------
A0A2V9U6D9      ------------------------------------------------------------
A0A2V8DZN4      ------------------------------------------------------------
A0A3N5YKY1      ------------------------------------------------------------
A0A2G6HQA4      ------------------------------------------------------------
A0A2V7ZTY7      ------------------------------------------------------------
A0A2V7ZVL9      ------------------------------------------------------------
A0A1Q7QYI4      ------------------------------------------------------------
A0A2V8G9Y9      ------------------------------------------------------------
A0A143PNR5      ------------------------------------------------------------
A0A6A7L078      ------------------------------------------------------------
A0A143PXU3      ------------------------------------------------------------
A0A2V8D8G9      ------------------------------------------------------------
A0A2V8ESQ4      ------------------------------------------------------------
A0A1E3Y5Q0      ------------------------------------------------------------
A0A2W4TWK5      ------------------------------------------------------------
A0A3N5NYV3      ------------------------------------------------------------
A0A2V2RJF9      ------------------------------------------------------------
A0A2G6HNT3      ------------------------------------------------------------
A0A2V7YWD4      ------------------------------------------------------------
A0A2V2R8T6      ------------------------------------------------------------
A0A1Q7RGF1      ------------------------------------------------------------
A0A2V9BLX2      ------------------------------------------------------------
A0A2V9ZA03      ------------------------------------------------------------
A0A3N5ZNH4      ------------------------------------------------------------
A0A2V8GEZ2      ------------------------------------------------------------
A0A3N5ZFD3      ------------------------------------------------------------
G8NXD3          ------------------------------------------------------------
A0A2V9VR38      ------------------------------------------------------------
A0A2V9EY04      ------------------------------------------------------------
A0A2V9HAK9      ------------------------------------------------------------
A0A1Q7FS15      ------------------------------------------------------------
A0A1Q7K9P1      ------------------------------------------------------------
A0A1Q7N989      ------------------------------------------------------------
A0A2V9G7Y0      ------------------------------------------------------------
A0A2V8T7Z1      ------------------------------------------------------------
A0A2V7U8G5      ------------------------------------------------------------
A0A2V7UNP9      ------------------------------------------------------------
A0A2V7VLD7      ------------------------------------------------------------
A0A2V7XGA3      ------------------------------------------------------------
A0A2V7YAG6      ------------------------------------------------------------
A0A2V7VK33      ------------------------------------------------------------
A0A7C5EWK9      ------------------------------------------------------------
A0A3M1VTE1      ------------------------------------------------------------
A0A2V7TTM7      ------------------------------------------------------------
A0A2V8VI82      ------------------------------------------------------------
A0A2V7U4P9      ------------------------------------------------------------
A0A2V7TQY5      ------------------------------------------------------------
A0A2V7TU87      ------------------------------------------------------------
A0A2V8SEH0      ------------------------------------------------------------
A0A2V8VU54      ------------------------------------------------------------
A0A1Q7RML7      ------------------------------------------------------------
A0A1Q7ZIQ5      ------------------------------------------------------------
A0A2V8TKD8      ------------------------------------------------------------
                                                                            

A0A1F2U8T6      TPPVTLVTAVRAAAA------RALRGLTLLSAAVEEEAPTPDETPAEAALVGNFLSRVVV
A0A2V8BV42      VPPPTPVSMINDFQT------RLMGLLRKPAAPAPQEAPKVDETPDESALVSSFIGRVTV
A0A2V8F916      VPPPTPVSMINDFQT------RLMGLLRKPAAPAPQEAPKVDETPDESALVSSFIGRVTV
A0A1Q7K833      EPPSTPSTMLRDFQQ------RVVHLIKPSALAETQEVPKVDETPDESSMVNAFIGRVNV
A0A1Q8AMY4      EPPSTPSTMLRDFQQ------RVVHLIKPSALAETQEVPKVDETPDESSMVNAFIGRVNV
A0A2V8BM40      EPPVTPLTIAHDLEK------RIVAFVRPAA-SEATDTRKIDEAPSESGLVNAFIGQVTV
A0A2V8CRT6      EPPVTPLTIAHDLEK------RIVAFVRPAA-SEATDTRKIDEAPSESGLVDAFIGQVTV
A0A1F2VH76      AKPTALAEAISTVKTYAYWPVRIVLGSTPAPSPVATA-----ESGDPEAYADALIGHLGV
A0A1F2R0X5      ERAPTPISMLRDFER------RLVSLVRRAPAQPQEEPPKLDETTDESALVGAFIGRVGV
A0A2V8B278      EKPSTPATLLHDLKQ------KIVGLVRPAPAPENTESPKVDETADESALVSAFLSRVDV
A0A2V8CEF9      QKPSTPATLLHDLKQ------KIVGLVRPAPAPENTESPKVDETADESALVSAFLSRVDV
A0A2V8KZG2      ------------------------------------------------------------
A0A2V8TKR9      ------------------------------------------------------------
A0A1Q7LG57      ------------------------------------------------------------
A0A2V8MKQ7      ------------------------------------------------------------
A0A1Q7L5B1      ------------------------------------------------------------
A0A2V9DKV4      ------------------------------------------------------------
A0A2V9EVA0      ------------------------------------------------------------
A0A7C5ZU39      ------------------------------------------------------------
A0A3N5YN96      ------------------------------------------------------------
A0A1Q7Y646      ------------------------------------------------------------
A0A2V8QZU0      ------------------------------------------------------------
A0A2V8RSQ9      ------------------------------------------------------------
A0A2V9L2P7      ------------------------------------------------------------
A0A2V7UMX0      ------------------------------------------------------------
A0A136K497      ------------------------------------------------------------
A0A399W9E4      ------------------------------------------------------------
A0A321LMC5      ------------------------------------------------------------
A0A2V8X713      ------------------------------------------------------------
A0A2V8ZLE9      ------------------------------------------------------------
A0A2V8Y4D3      ------------------------------------------------------------
A0A2V8Z2X8      ------------------------------------------------------------
A0A2V9C3F6      ------------------------------------------------------------
A0A2V9QMU9      ------------------------------------------------------------
A0A2V9QY75      ------------------------------------------------------------
A0A2V9SVU9      ------------------------------------------------------------
A0A2V8W5N5      ------------------------------------------------------------
A0A2V8XG53      ------------------------------------------------------------
A0A6A7LB89      ------------------------------------------------------------
A0A352EZH8      ------------------------------------------------------------
A0A0B6X033      ------------------------------------------------------------
A0A2V8R0I3      ------------------------------------------------------------
A0A2V8N1U8      ------------------------------------------------------------
A0A2V8QL35      ------------------------------------------------------------
A0A352FU10      ------------------------------------------------------------
A0A2V8LCU0      ------------------------------------------------------------
A0A1Q7NGT0      ------------------------------------------------------------
A0A2V8MLP9      ------------------------------------------------------------
A0A2V8PQZ0      ------------------------------------------------------------
A0A3B9MKY6      ------------------------------------------------------------
A0A3D5SKZ1      ------------------------------------------------------------
A0A2V8NRW2      ------------------------------------------------------------
A0A2V9XV04      ------------------------------------------------------------
A0A2V9CBY1      ------------------------------------------------------------
A0A2V9D656      ------------------------------------------------------------
A0A7C2L7W9      ------------------------------------------------------------
A0A7C2XG00      ------------------------------------------------------------
A0A2V9J901      ------------------------------------------------------------
A0A2V8QJ59      ------------------------------------------------------------
A0A1Q7HTA7      ------------------------------------------------------------
A0A2V8YMQ4      ------------------------------------------------------------
A0A2V8W380      ------------------------------------------------------------
A0A2V8ZIV5      ------------------------------------------------------------
A0A7C2M3P5      ------------------------------------------------------------
A0A2V8LBV1      ------------------------------------------------------------
A0A2V8GAF9      ------------------------------------------------------------
A0A7C5I7P7      ------------------------------------------------------------
A0A2V8CN98      ------------------------------------------------------------
A0A1Q7LC46      --------------MKKESLYEFAKAGDLDAVPQVQSNAA-------LTDLLKKQRDSSA
A0A1Q8BDC5      ---------------GQAEVIVAVRQQATEVLEHVFKNNFAVDSF---------------
A0A2V9Q1Y8      ------------------------------------------------------------
A0A2V8JXG1      ------------------------------------------------------------
A0A350D2W9      ------------------------------------------------------------
A0A2V9I4J1      ---------------EPAELADVIRRQAFQLLRHALEKQFSVQSF---------------
A0A2V8PQZ9      -----------------------------------------------FQPTRTLSARASL
A0A2V8D8B1      ---------------TSSCRSWPISTGPGQSDRTALDTVPAILANQFVQQQKSELAELQR
A0A3B9LSB4      ------------------------------------------------------------
A0A2V9H7U2      ---------------------------------------------------------LKT
A0A2V8NJB5      ---------------EPVELAEVVRRQSLELLQHVLTNDFSIDDF---------------
A0A2V9JMZ4      ---------------EPAELADVIRRQAFQLLRHALEKQFSVQSF---------------
A0A2V9MDJ6      ---------------EPAELADVIRRQAFQLLRHALEKQFSVQSF---------------
A0A2V8QJT6      -----------------------------------------------IEVTDSELAKLRQ
A0A2V8FSM8      ---------------AKQSKYEMSSSSPPAALPEILDDPSQRTSQTTLYDLRAKLALLRV
A0A359M0J2      ---------------NKENRLNVAKGKPVETLPGEIAGG--------LSTQQGALDSLKR
A0A2V8JLJ1      -----------------------------------------------ATAEAAKAASIQV
A0A5M8SND8      ---------------AAESRLKTAESSGAESVAEVVND-----DS--LRDLQAKITELQR
A0A2V9GAQ1      ---------------KKESLYQFAKSGNLDAIPQVQSN-----LA--LTELLKKRGEVSS
A0A497EDQ8      ---------------DVETKLNALNQLRARHVSEVAFPEVLEDAT--ISNLMQRRGEVEV
G8NS05          ---------------LAESRYRVLSGMDPNSLDQTVANTTNNVAATQLATLRSQRETDMA
A0A2V8KZ20      ---------------LKIALNASSPPPPPAAHTESTTAAAIETPP--PSPLETELANRQA
A0A3D0NWU2      -------------------------------------------DD--IRNIDKQIQQAET
A0A2V8EPD9      ------------------------------------------------------LATPES
A0A3N5NSX5      ---------------QKEALYNQIKSLPPSSVGDAPAVGAS--PA--VQSLRTRLAELQR
A0A2V8MUA1      ---------------RQPSRAEQLIAAKRDQLAAERLKHTDDWPD--IRALKRDIKQLEE
A0A2V8MBH9      ---------------MAEAEYNAAKAPGAATALAEGA------KD--INESESKLADLKQ
A0A3N5ZPQ7      ---------------QEKTGSLYLVHGAADHTELTEMKEVIRVYF--HGGLVSAMSSSLP
A0A3N5P5F2      ---------------EKEAALTQLRAIQHDKAALASAPAVVANAS--VQRLNQELADLQR
A0A7C2EFE5      ---------------RKEAAYGSVRSGSLEAAAGSDQA-----QD--LRTLLARRNQARE
A0A2V9G1P7      ---------------EKEALYRLVQTGESGALPGVFEN-----KL--IQDLSERLAELKR
A0A2V9BCK9      ----------------RQRITVRARTGPLSLQET---------HG--YIAERLRIAGANG
A0A2V9TMX2      ---------------QKEADYKLAVNGDPEMFMKTSPDGRGGSGL--LDKLREKEADLET
A0A7C4DQP8      ---------------ERESRYRLVEAGHFSALPGG-ES-----KV--IEDLLVRLADLRR
A0A2V8N2J7      ---------------ELQDLESKGVLEQPMVHEKTPDE-----AK--LDELRIQLAELQT
A0A3N6BI26      ---------------GKTADYQAVRDATPESFPQSLRT-----PS--ISLLEERLFGLQQ
A0A2V9JMM3      -------AQVLEEMKGLQKEPAQEIQRELPVEEPTAEQ-----KA--LDEKRLKLKELEA
A0A2V9M815      -------AQVLEEMKGLQKEPAQEIQRELPVEEPTAEQ-----KA--LDEKRLKLKELEA
A0A2V9A795      ---------------EKEALYRLVQSGDYGSLPGVVEN-----KL--IQDLSERLAELKR
A0A355ESH9      ---------------EKEAHYHEVMTGPLDAVADSLAP-----GV--ISGLRTQQLQMEQ
A0A3D0NW85      -------PERVSALAEAESARYITERENFLLNYRNETQ-----KT--IAGLTANRAKLLE
A0A353CAT5      -------PERLKSLAEAESARYITERENFILNNRTETD-----KA--IAGLAATRAKLLE
A0A2V9HB55      ---------------KKESLYQFAKSGNLDAVPQIQSN-----LA--LTELLKKRSEVSS
A0A2V8CU57      --------------------------AAWSEPETVTAP-----FA--VAGWSEPESAAAP
A0A2V8BDI4      --------------------------------------------------WSEPESAAAL
A0A2V8F8T3      EPETVTAPLAAAAWSEPESTAVLPAVAAWSEPETVTAP-----FA--VAGWSEPESAAAP
A0A2W0B5E2      ------------------------------------------------------------
A0A2V8NMG8      ------------------------------------------------------------
A0A2V8TBM7      ------------------------------------------------------------
A0A1Q7HEZ8      ------------------------------------------------------------
A0A1Q7JW36      ------------------------------------------------------------
A0A1Q7MUR4      ------------------------------------------------------------
A0A3N5PFU4      ------------------------------------------------------------
A0A3M1SNQ5      ------------------------------------------------------------
A0A7C2C0C1      ------------------------------------------------------------
A0A4R1LDF1      ------------------------------------------------------------
A0A1F2T1R8      ------------------------------------------------------------
A0A2V9BW09      ------------------------------------------------------------
A0A3M1SSE1      ------------------------------------------------------------
A0A2V9GQV7      ------------------------------------------------------------
A0A7C5AUB2      ------------------------------------------------------------
A0A2V8YCY6      ------------------------------------------------------------
A0A2V8EGM3      ------------------------------------------------------------
A0A2V8FGH1      ------------------------------------------------------------
A0A2V7YV88      ------------------------------------------------------------
A0A2V8D468      ------------------------------------------------------------
A0A1F2R977      ------------------------------------------------------------
A0A2U3LF12      ------------------------------------------------------------
A0A7C5MF19      ------------------------------------------------------------
A0A3N5G7M6      ------------------------------------------------------------
A0A1F2S3Q7      ------------------------------------------------------------
A0A2V8GVG4      ------------------------------------------------------------
A0A2V8PJQ0      ------------------------------------------------------------
A0A2V8H566      ------------------------------------------------------------
A0A2V8UVN4      ------------------------------------------------------------
A0A1Q7RB73      ------------------------------------------------------------
A0A2V9K0H7      ------------------------------------------------------------
A0A321LXF5      ------------------------------------------------------------
A0A5M8SBZ0      ------------------------------------------------------------
A0A1Q7JFB1      ------------------------------------------------------------
A0A2V9LS17      ------------------------------------------------------------
A0A7C2YLF6      ------------------------------------------------------------
A0A2V7X0V9      ------------------------------------------------------------
A0A2V9X518      ------------------------------------------------------------
A0A2V9VC62      ------------------------------------------------------------
A0A2V9S1P8      ------------------------------------------------------------
A0A2V9RTW2      ------------------------------------------------------------
A0A2V9TGF1      ------------------------------------------------------------
A0A2V9XEV6      ------------------------------------------------------------
A0A2V9Y3Q6      ------------------------------------------------------------
A0A2V9R269      ------------------------------------------------------------
A0A2V9PTS3      ------------------------------------------------------------
A0A2V9NPF4      ------------------------------------------------------------
A0A2V9PNZ0      ------------------------------------------------------------
A0A2V9AGR3      ------------------------------------------------------------
A0A2V9G0N7      ------------------------------------------------------------
A0A2V9GQ44      ------------------------------------------------------------
A0A2V9HRN3      ------------------------------------------------------------
A0A2V8WG13      ------------------------------------------------------------
A0A2V8X987      ------------------------------------------------------------
A0A1Q7KX94      ------------------------------------------------------------
A0A2V8XHT0      ------------------------------------------------------------
A0A2V8DMJ9      ------------------------------------------------------------
A0A2V8GGF6      ------------------------------------------------------------
A0A2V8HKU7      ------------------------------------------------------------
A0A1Q6Y875      ------------------------------------------------------------
A0A523DJA9      ------------------------------------------------------------
A0A2V8I604      ------------------------------------------------------------
A0A2V8J066      ------------------------------------------------------------
A0A1I6MMC5      ------------------------------------------------------------
A0A2V9D5W7      ------------------------------------------------------------
A0A2V9D4I4      ------------------------------------------------------------
A0A2V9D6L7      ------------------------------------------------------------
A0A2V8ZJV2      ------------------------------------------------------------
A0A2V9AWB5      ------------------------------------------------------------
A0A2V8Z1Y8      ------------------------------------------------------------
A0A1Q8AX10      ------------------------------------------------------------
A0A2V9A773      ------------------------------------------------------------
A0A2V9AND3      ------------------------------------------------------------
A0A2V9BTJ7      ------------------------------------------------------------
A0A2V8W2M7      ------------------------------------------------------------
A0A2V8XNW2      ------------------------------------------------------------
A0A1Q7CJC1      ------------------------------------------------------------
A0A2V9UEM7      ------------------------------------------------------------
A0A7C4DTF2      ------------------------------------------------------------
A0A1Q7V300      ------------------------------------------------------------
A0A2V9ZCI3      ------------------------------------------------------------
A0A2V9WCB3      ------------------------------------------------------------
A0A2V9VQW5      ------------------------------------------------------------
A0A2V9WTP3      ------------------------------------------------------------
A0A2V9NLA9      ------------------------------------------------------------
A0A2V9RKJ9      ------------------------------------------------------------
A0A2V9RN95      ------------------------------------------------------------
A0A2V9N406      ------------------------------------------------------------
A0A2V9U6D9      ------------------------------------------------------------
A0A2V8DZN4      ------------------------------------------------------------
A0A3N5YKY1      ------------------------------------------------------------
A0A2G6HQA4      ------------------------------------------------------------
A0A2V7ZTY7      ------------------------------------------------------------
A0A2V7ZVL9      ------------------------------------------------------------
A0A1Q7QYI4      ------------------------------------------------------------
A0A2V8G9Y9      ------------------------------------------------------------
A0A143PNR5      ------------------------------------------------------------
A0A6A7L078      ------------------------------------------------------------
A0A143PXU3      ------------------------------------------------------------
A0A2V8D8G9      ------------------------------------------------------------
A0A2V8ESQ4      ------------------------------------------------------------
A0A1E3Y5Q0      ------------------------------------------------------------
A0A2W4TWK5      ------------------------------------------------------------
A0A3N5NYV3      ------------------------------------------------------------
A0A2V2RJF9      ------------------------------------------------------------
A0A2G6HNT3      ------------------------------------------------------------
A0A2V7YWD4      ------------------------------------------------------------
A0A2V2R8T6      ------------------------------------------------------------
A0A1Q7RGF1      ------------------------------------------------------------
A0A2V9BLX2      ------------------------------------------------------------
A0A2V9ZA03      ------------------------------------------------------------
A0A3N5ZNH4      ------------------------------------------------------------
A0A2V8GEZ2      ------------------------------------------------------------
A0A3N5ZFD3      ------------------------------------------------------------
G8NXD3          ------------------------------------------------------------
A0A2V9VR38      ------------------------------------------------------------
A0A2V9EY04      ------------------------------------------------------------
A0A2V9HAK9      ------------------------------------------------------------
A0A1Q7FS15      ------------------------------------------------------------
A0A1Q7K9P1      ------------------------------------------------------------
A0A1Q7N989      ------------------------------------------------------------
A0A2V9G7Y0      ------------------------------------------------------------
A0A2V8T7Z1      ------------------------------------------------------------
A0A2V7U8G5      ------------------------------------------------------------
A0A2V7UNP9      ------------------------------------------------------------
A0A2V7VLD7      ------------------------------------------------------------
A0A2V7XGA3      ------------------------------------------------------------
A0A2V7YAG6      ------------------------------------------------------------
A0A2V7VK33      ------------------------------------------------------------
A0A7C5EWK9      ------------------------------------------------------------
A0A3M1VTE1      ------------------------------------------------------------
A0A2V7TTM7      ------------------------------------------------------------
A0A2V8VI82      ------------------------------------------------------------
A0A2V7U4P9      ------------------------------------------------------------
A0A2V7TQY5      ------------------------------------------------------------
A0A2V7TU87      ------------------------------------------------------------
A0A2V8SEH0      ------------------------------------------------------------
A0A2V8VU54      ------------------------------------------------------------
A0A1Q7RML7      ------------------------------------------------------------
A0A1Q7ZIQ5      ------------------------------------------------------------
A0A2V8TKD8      ------------------------------------------------------------
                                                                            

A0A1F2U8T6      TPVPDSKLVDVFFTAADPAVTALAATTLAEEYVAQNLELKQQSTQNMLEWLENEVAAQQT
A0A2V8BV42      EPIRTSRLVDVTFMSADPNFAALAVNTLVDEYTEQNLAIKLESSQNMLNWLAKELDKQQQ
A0A2V8F916      EPIRTSRLVDVTFMSADPNFAALAVNTLVDEYTEQNLAIKLESSQNMLNWLAKELDKQQQ
A0A1Q7K833      EPVTGSKLVDVTFDSMDPKFAQLAANTLVDEYVEQNLALKQQSTQNMIDWLDKELERQQQ
A0A1Q8AMY4      EPVTGSKLVDVTFDSMDPKFAQLAANTLVDEYVEQNLALKQQSTQNMIDWLDKELERQQQ
A0A2V8BM40      EPVPGSKLVDVLFDSRDPKFAQAAANALVDEYVEQNLQVKLQSTQNMIEWLDKELEKQQQ
A0A2V8CRT6      EPVPGSKLVDVLFDSRDPKFAQAAANALVDEYVEQNLQVKLQSTQNMIEWLDKELEKQQQ
A0A1F2VH76      NQIRGSRLVDLLFTAADPAFAAKAANAYAEEYVAQNLELKAANLDKSLEWLTGEVGRQEG
A0A1F2R0X5      EPVRGSRLVDVTFLSVEPKFAAEAANALAEEYVEQNLQVKLQTAQNMLDWLGKELATQQQ
A0A2V8B278      APVSGSKLVDVTFDSMDRRFAATAANTLVDEFVDQNLQVKLQSTENMIDWLDKELDKQQQ
A0A2V8CEF9      APVSGSKLVDVTFDSMDPRFAATAANTLVDEFVEQNLQVKLQSTENMIDWLDKELDKQQH
A0A2V8KZG2      ------------------------------------------------------------
A0A2V8TKR9      ------------------------------------------------------------
A0A1Q7LG57      ------------------------------------------------------------
A0A2V8MKQ7      ------------------------------------------------------------
A0A1Q7L5B1      ------------------------------------------------------------
A0A2V9DKV4      ------------------------------------------------------------
A0A2V9EVA0      ------------------------------------------------------------
A0A7C5ZU39      ------------------------------------------------------------
A0A3N5YN96      ------------------------------------------------------------
A0A1Q7Y646      ------------------------------------------------------------
A0A2V8QZU0      ------------------------------------------------------------
A0A2V8RSQ9      ------------------------------------------------------------
A0A2V9L2P7      ------------------------------------------------------------
A0A2V7UMX0      ------------------------------------------------------------
A0A136K497      ------------------------------------------------------------
A0A399W9E4      ------------------------------------------------------------
A0A321LMC5      ------------------------------------------------------------
A0A2V8X713      ------------------------------------------------------------
A0A2V8ZLE9      ------------------------------------------------------------
A0A2V8Y4D3      ------------------------------------------------------------
A0A2V8Z2X8      ------------------------------------------------------------
A0A2V9C3F6      ------------------------------------------------------------
A0A2V9QMU9      ------------------------------------------------------------
A0A2V9QY75      ------------------------------------------------------------
A0A2V9SVU9      ----------------------------------MNSQMKEVDAQIQVEMKKIVSRVRSD
A0A2V8W5N5      ------------------------------------------------------------
A0A2V8XG53      ------------------------------------------------------------
A0A6A7LB89      ------------------------------------------------------------
A0A352EZH8      ------------------------------------------------------------
A0A0B6X033      ------------------------------------------------------------
A0A2V8R0I3      ------------------------------------------------------------
A0A2V8N1U8      ------------------------------------------------------------
A0A2V8QL35      ------------------------------------------------------------
A0A352FU10      ------------------------------------------------------------
A0A2V8LCU0      ------------------------------------------------------------
A0A1Q7NGT0      ------------------------------------------------------------
A0A2V8MLP9      ------------------------------------------------------------
A0A2V8PQZ0      ------------------------------------------------------------
A0A3B9MKY6      ------------------------------------------------------------
A0A3D5SKZ1      ------------------------------------------------------------
A0A2V8NRW2      ------------------------------------------------------------
A0A2V9XV04      ------------------------------------------------------------
A0A2V9CBY1      ------------------------------------------------------------
A0A2V9D656      ------------------------------------------------------------
A0A7C2L7W9      ------------------------------------------------------------
A0A7C2XG00      ------------------------------------------------------------
A0A2V9J901      ------------------------------------------------------------
A0A2V8QJ59      ------------------------------------------------------------
A0A1Q7HTA7      ------------------------------------------------------------
A0A2V8YMQ4      ------------------------------------------------------------
A0A2V8W380      ------------------------------------------------------------
A0A2V8ZIV5      ------------------------------------------------------------
A0A7C2M3P5      ------------------------------------------------------------
A0A2V8LBV1      ------------------------------------------------------------
A0A2V8GAF9      ------------------------------------------------------------
A0A7C5I7P7      --------------------VQSRLVSVQAAKA---------------------------
A0A2V8CN98      ------LLYRYTDDHPAVRRVTTDIDELEHQTI---------------------------
A0A1Q7LC46      EYTD--ALAQYGPNFPKVQRLKTELKDIEDSIEKE---------------------KRKV
A0A1Q8BDC5      ------RNSLKSYYAPARIAYPQVLLEVCRSKNEP-------------------------
A0A2V9Q1Y8      ------------------------------------------------------------
A0A2V8JXG1      -----------------MAAIRDQIAASRGLLEDK-------------------------
A0A350D2W9      -----------------MQRLKAELDTARDLLKNE---------------------TGGL
A0A2V9I4J1      ------QVSATGFSVPAQIHFENLLLEVARGDSKP-------------------------
A0A2V8PQZ9      NLRSSSTSTRAHSLQPPLRN-SDRLSTLRAWGEET-------------------------
A0A2V8D8B1      QQAQ--LSDKLGDKHPDMVKNRHAIQTAEAKIQGE---------------------IAKV
A0A3B9LSB4      -------MVDATEEAPEVKEVDQQIAELERQVKDV-----------------RSRKSVTL
A0A2V9H7U2      QNVD--ALEQYGPKHPKVERLRSQVNEIQSLIDTE---------------------RKRM
A0A2V8NJB5      ------TNSVRSFYTPANITFAGLFLELCRNNAKS-------------------------
A0A2V9JMZ4      ------QVSATGFSVPAQIHFENLLLEVARGDSKP-------------------------
A0A2V9MDJ6      ------QVSATGFSVPAQIHFENLLLEVARGDSKP-------------------------
A0A2V8QJT6      KRAQ--LLIEATEEAPEVKEIDQQIDVLQKHLADT-----------------RARGAATL
A0A2V8FSM8      TYTT---------SYAEVRKVMAQIAAIESSLEGT---------------------RENV
A0A359M0J2      QRAD--LLTTLMPGHYKVQRIQAQIDELEQSLERE---------------------RVNI
A0A2V8JLJ1      QAAK--EPKPEEKPRPFLPEFNLSLDTVPAEVQLQ-------------------------
A0A5M8SND8      QKAD--LLTIYTPEHEKVQRVQAQLTPLQNALEQH---------------------RSRI
A0A2V9GAQ1      DYTD--ALNQYGPNFPKVQRLQAQLKDYDLSIEKE---------------------KKYI
A0A497EDQ8      ELLD--KLGTYKEGHPAIKELRVRLEGIDQAIERQ---------------------IQTL
G8NS05          NYAKLTAPGNLGPNHPQVKAAHAQIEELDKAIKQE---------------------QDRV
A0A2V8KZ20      QLAA--ASVRYTPRHPEVVRLTQEVRELEGLVRQFKAAAEAAKAAAAATATAEAAKAASI
A0A3D0NWU2      EKSE--LLVRYTPEYPEVKKMEERIASLKESRTRT--EQEVSSIIDRDQKRIEREAVGGA
A0A2V8EPD9      EPAQDAAAPSVAPVGPVARAASPAPVVVAPAAPVV---------------------LAPV
A0A3N5NSX5      QKVQ--LNERYGPKNPQVIENDNAIADTTQQLQTA---------------------LTAA
A0A2V8MUA1      QVATDRAAETSAEKNAEETTEKRELGETPGPAPADEVAASTLLPQLDFSIDFSDFEIQLR
A0A2V8MBH9      KRAQ--LLVDATEEAPEVKEVDQQIAELQKHLHES-----------------RARNTNTL
A0A3N5ZPQ7      EYRL--GQYCLKEGIIDPPDLHKQIKGRDHRPLGEAIVAAGLAEPVEIQQLLQKQAIDVF
A0A3N5P5F2      QDAQ--LSRQYGERHPEMIKVRTAIQQIRQKLDAE---------------------LHNA
A0A7C2EFE5      RFAE--LKAHYGANHPEYRKAAAQLAEVEALLGEA---------------------RRKI
A0A2V9G1P7      EHAQ--LSTTFNPDYPRVKEIQSQIDEIAASLREE---------------------RQRA
A0A2V9BCK9      EPIF--APGAVESVYNYARGIPRVINVLCEHALIN--------------------SFADQ
A0A2V9TMX2      QYAM--ATTQFGSGYPRVTELNNQLKQVRAAIEAE---------------------KTKL
A0A7C4DQP8      ERAE--LATLFTGEYPRVRQLDNQIGELEQLLAAE---------------------RARM
A0A2V8N2J7      RYTA--QHPVVVAKKREISDLERTIASQPKKGRSE-----------PSPTYLRYSQLKSE
A0A3N6BI26      NLAS--LSAQFGSEWPAVIQVRQQIQEVEKQLLRE---------------------KKET
A0A2V9JMM3      KYTE--QYPEIPRLRKEIADLEQAVAAGPRRKSRSDATAATSRRYPGPDASMRYLALKGE
A0A2V9M815      KYTE--QYPEIPRLRKEIADLEQAVAAGPRRKSRSDATAATSRRYPGPDASMRYLALKGE
A0A2V9A795      ELAQ--LSTKFNAGYPRVKEIQSQIDETEAALKEE---------------------RQRA
A0A355ESH9      DYET--KLKTFKPEWPEMVSLKSQIETGKQHIDSVIRE-------------M----VQKA
A0A3D0NW85      EFLP--TAPEVKEIDSQIKSLEDSLANATEKAQAEIQA-------------YRGRTADNL
A0A353CAT5      EYKE--SAPEIKEIDSQIASLERSLKTATDRANAEIAT-------------FRERTAKTL
A0A2V9HB55      DYTD--ALNQYGPNFPKVQRLQAQLKDYDQSIEKE---------------------KKNI
A0A2V8CU57      PVVA--AWSE-----PETVTAPFAVAGWSEPESAA---------------------APPV
A0A2V8BDI4      PAVA--AWSE-----PETVTAPFAVAGWSEPESAA---------------------APPV
A0A2V8F8T3      PVVA--AWSE-----PETVTAPFAVAGWSEPESAA---------------------APPV
A0A2W0B5E2      ------------------------------------------------------------
A0A2V8NMG8      ------------------------------------------------------------
A0A2V8TBM7      ------------------------------------------------------------
A0A1Q7HEZ8      ------------------------------------------------------------
A0A1Q7JW36      ------------------------------------------------------------
A0A1Q7MUR4      ------------------------------------------------------------
A0A3N5PFU4      ------------------------------------------------------------
A0A3M1SNQ5      ------------------------------------------------------------
A0A7C2C0C1      ------------------------------------------------------------
A0A4R1LDF1      ------------------------------------------------------------
A0A1F2T1R8      ------------------------------------------------------------
A0A2V9BW09      ------------------------------------------------------------
A0A3M1SSE1      ------------------------------------------------------------
A0A2V9GQV7      ------------------------------------------------------------
A0A7C5AUB2      ------------------------------------------------------------
A0A2V8YCY6      ------------------------------------------------------------
A0A2V8EGM3      ------------------------------------------------------------
A0A2V8FGH1      ------------------------------------------------------------
A0A2V7YV88      ------------------------------------------------------------
A0A2V8D468      ------------------------------------------------------------
A0A1F2R977      ------------------------------------------------------------
A0A2U3LF12      ------------------------------------------------------------
A0A7C5MF19      ------------------------------------------------------------
A0A3N5G7M6      ------------------------------------------------------------
A0A1F2S3Q7      ------------------------------------------------------------
A0A2V8GVG4      ------------------------------------------------------------
A0A2V8PJQ0      ------------------------------------------------------------
A0A2V8H566      ------------------------------------------------------------
A0A2V8UVN4      ------------------------------------------------------------
A0A1Q7RB73      ------------------------------------------------------------
A0A2V9K0H7      ------------------------------------------------------------
A0A321LXF5      ------------------------------------------------------------
A0A5M8SBZ0      ------------------------------------------------------------
A0A1Q7JFB1      ------------------------------------------------------------
A0A2V9LS17      ------------------------------------------------------------
A0A7C2YLF6      ------------------------------------------------------------
A0A2V7X0V9      ------------------------------------------------------------
A0A2V9X518      ------------------------------------------------------------
A0A2V9VC62      ------------------------------------------------------------
A0A2V9S1P8      ------------------------------------------------------------
A0A2V9RTW2      ------------------------------------------------------------
A0A2V9TGF1      ------------------------------------------------------------
A0A2V9XEV6      ------------------------------------------------------------
A0A2V9Y3Q6      ------------------------------------------------------------
A0A2V9R269      ------------------------------------------------------------
A0A2V9PTS3      ------------------------------------------------------------
A0A2V9NPF4      ------------------------------------------------------------
A0A2V9PNZ0      ------------------------------------------------------------
A0A2V9AGR3      ------------------------------------------------------------
A0A2V9G0N7      ------------------------------------------------------------
A0A2V9GQ44      ------------------------------------------------------------
A0A2V9HRN3      ------------------------------------------------------------
A0A2V8WG13      ------------------------------------------------------------
A0A2V8X987      ------------------------------------------------------------
A0A1Q7KX94      ------------------------------------------------------------
A0A2V8XHT0      ------------------------------------------------------------
A0A2V8DMJ9      ------------------------------------------------------------
A0A2V8GGF6      ------------------------------------------------------------
A0A2V8HKU7      ------------------------------------------------------------
A0A1Q6Y875      ------------------------------------------------------------
A0A523DJA9      ------------------------------------------------------------
A0A2V8I604      ------------------------------------------------------------
A0A2V8J066      ------------------------------------------------------------
A0A1I6MMC5      ------------------------------------------------------------
A0A2V9D5W7      ------------------------------------------------------------
A0A2V9D4I4      ------------------------------------------------------------
A0A2V9D6L7      ------------------------------------------------------------
A0A2V8ZJV2      ------------------------------------------------------------
A0A2V9AWB5      ------------------------------------------------------------
A0A2V8Z1Y8      ------------------------------------------------------------
A0A1Q8AX10      ------------------------------------------------------------
A0A2V9A773      ------------------------------------------------------------
A0A2V9AND3      ------------------------------------------------------------
A0A2V9BTJ7      ------------------------------------------------------------
A0A2V8W2M7      ------------------------------------------------------------
A0A2V8XNW2      ------------------------------------------------------------
A0A1Q7CJC1      ------------------------------------------------------------
A0A2V9UEM7      ------------------------------------------------------------
A0A7C4DTF2      ------------------------------------------------------------
A0A1Q7V300      ------------------------------------------------------------
A0A2V9ZCI3      ------------------------------------------------------------
A0A2V9WCB3      ------------------------------------------------------------
A0A2V9VQW5      ------------------------------------------------------------
A0A2V9WTP3      ------------------------------------------------------------
A0A2V9NLA9      ------------------------------------------------------------
A0A2V9RKJ9      ------------------------------------------------------------
A0A2V9RN95      ------------------------------------------------------------
A0A2V9N406      ------------------------------------------------------------
A0A2V9U6D9      ------------------------------------------------------------
A0A2V8DZN4      ------------------------------------------------------------
A0A3N5YKY1      ------------------------------------------------------------
A0A2G6HQA4      ------------------------------------------------------------
A0A2V7ZTY7      ------------------------------------------------------------
A0A2V7ZVL9      ------------------------------------------------------------
A0A1Q7QYI4      ------------------------------------------------------------
A0A2V8G9Y9      ------------------------------------------------------------
A0A143PNR5      ------------------------------------------------------------
A0A6A7L078      ------------------------------------------------------------
A0A143PXU3      ------------------------------------------------------------
A0A2V8D8G9      ------------------------------------------------------------
A0A2V8ESQ4      ------------------------------------------------------------
A0A1E3Y5Q0      ------------------------------------------------------------
A0A2W4TWK5      ------------------------------------------------------------
A0A3N5NYV3      ------------------------------------------------------------
A0A2V2RJF9      ------------------------------------------------------------
A0A2G6HNT3      ------------------------------------------------------------
A0A2V7YWD4      ------------------------------------------------------------
A0A2V2R8T6      ------------------------------------------------------------
A0A1Q7RGF1      ------------------------------------------------------------
A0A2V9BLX2      ------------------------------------------------------------
A0A2V9ZA03      ------------------------------------------------------------
A0A3N5ZNH4      ------------------------------------------------------------
A0A2V8GEZ2      ------------------------------------------------------------
A0A3N5ZFD3      ------------------------------------------------------------
G8NXD3          ------------------------------------------------------------
A0A2V9VR38      ------------------------------------------------------------
A0A2V9EY04      ------------------------------------------------------------
A0A2V9HAK9      ------------------------------------------------------------
A0A1Q7FS15      ------------------------------------------------------------
A0A1Q7K9P1      ------------------------------------------------------------
A0A1Q7N989      ------------------------------------------------------------
A0A2V9G7Y0      ------------------------------------------------------------
A0A2V8T7Z1      ------------------------------------------------------------
A0A2V7U8G5      ------------------------------------------------------------
A0A2V7UNP9      ------------------------------------------------------------
A0A2V7VLD7      ------------------------------------------------------------
A0A2V7XGA3      ------------------------------------------------------------
A0A2V7YAG6      ------------------------------------------------------------
A0A2V7VK33      ------------------------------------------------------------
A0A7C5EWK9      ------------------------------------------------------------
A0A3M1VTE1      ------------------------------------------------------------
A0A2V7TTM7      ------------------------------------------------------------
A0A2V8VI82      ------------------------------------------------------------
A0A2V7U4P9      ------------------------------------------------------------
A0A2V7TQY5      ------------------------------------------------------------
A0A2V7TU87      ------------------------------------------------------------
A0A2V8SEH0      ------------------------------------------------------------
A0A2V8VU54      ------------------------------------------------------------
A0A1Q7RML7      ------------------------------------------------------------
A0A1Q7ZIQ5      ------------------------------------------------------------
A0A2V8TKD8      ------------------------------------------------------------
                                                                            

A0A1F2U8T6      KVEQSERDLAEYREMENAMSL-DDKNNIVVSRLNALNEASIRARTVRIEKESVNNQLKAI
A0A2V8BV42      KVRESEQALAEYRDKQNAMSL-DDKQNIVTTRLTALNDALIHARTAKVQKEALYNQVKSM
A0A2V8F916      KVRESEQALAEYRDKQNAMSL-DDKQNIVTTRLTALNDALIHARTAKVQKEALYNQVKSM
A0A1Q7K833      KTEESERALADYRERQNALSL-DERQNIVLVRLNKLNDDVMLARSRKAQKQAVYDQLRSL
A0A1Q8AMY4      KTEESERALADYRERQNALSL-DERQNIVLVRLNKLNDDVMLARSRKAQKQAVYDQLRSL
A0A2V8BM40      KVGESERGLADYRERQNAMSL-DEKQNLVVVRLNKLNDDLMLARSRRAQKQAVYDQLRSI
A0A2V8CRT6      KVGESERGLADYRERQNAMSL-DEKQNLVVVRLNKLNDDLMLARSRRAQKQAVYDQLRSI
A0A1F2VH76      LVKASERALADYRERQDAGGLAEGSGNIVVARLTQLNDEVTRARTNRLTKENVWNQVRSA
A0A1F2R0X5      KVEESERSLAEYREKENALSL-DDKQNIVLARLNQLNDLVTKAKTQRIQREALYNQVKSI
A0A2V8B278      KVQDSERGLAEYRERQNALSL-DDKQNIVLARLNKLNDDVMMARSRRIQKETLFNQIKSV
A0A2V8CEF9      KVQDSERALAEYRERQNALSL-DDKQNLVLARLNKLNDDVMMARSRRIQKETLFNQIKSA
A0A2V8KZG2      ------------------------------------------------------------
A0A2V8TKR9      ------------------------------------------------------------
A0A1Q7LG57      ------------------------------------------------------------
A0A2V8MKQ7      ------------------------------------------------------------
A0A1Q7L5B1      ----------------------------------------------MSRIHEALKQAAHG
A0A2V9DKV4      ------------------------------------------------------------
A0A2V9EVA0      ----------------------------------------------MSRIFEALQKIQSQ
A0A7C5ZU39      -----------------------------------------------MRFKETLRKRLRE
A0A3N5YN96      ----------------------------------------------MSRIQRVLDKAERE
A0A1Q7Y646      ----------------------------------------------MGRVYDALKRASAT
A0A2V8QZU0      ----------------------------------------------MGRVYEALKRAAEQ
A0A2V8RSQ9      ----------------------------------------------MGRVYEALKRAAAH
A0A2V9L2P7      -------------------------MNQLLIEHNLLKRDFDSNQALYESLLQHLKDANVS
A0A2V7UMX0      ----------------------------------------------MLRSTVGEWRCGLL
A0A136K497      -----------------------------------------------MSVLQALQRKNIE
A0A399W9E4      -----------------------------------------------MSVLQALQRKNSE
A0A321LMC5      --------------------------------------------MPMGRVYKALVKAGRI
A0A2V8X713      ----------------------------------------------MSRIHEALKKAEEE
A0A2V8ZLE9      ----------------------------------------------MSRIHEALKRAEEQ
A0A2V8Y4D3      ----------------------------------------------MSRIHEALKRAEEQ
A0A2V8Z2X8      ----------------------------------------------MSRIHEALKRAEEA
A0A2V9C3F6      ----------------------------------------------MSRIHEALKKAEEQ
A0A2V9QMU9      ------------------------------------------------------------
A0A2V9QY75      ---------------------------------------------------QKLKEAGVT
A0A2V9SVU9      YLAALQRETMLRAALDKQKQE-ANKLNESAIDYSLLKRDVETNRTLYEGLLEKLKEAGVT
A0A2V8W5N5      ----------------------------------------------MSRIHEALKKAHEE
A0A2V8XG53      ----------------------------------------------MSRIHEALKKAHEE
A0A6A7LB89      ---------------MALLVA-KIRQHRASAWLGGWRRSFATARVKMSRIGDALLRASEA
A0A352EZH8      ----------------------------------------------MGRVYDALRRSGTD
A0A0B6X033      ----------------------------------------------MGRVFDALRRAAEL
A0A2V8R0I3      ---------------MSSCAS-VATLQRRLKMSGQPSAVPVLGEEPMGRVYDALKRAESA
A0A2V8N1U8      ----------------------------------------------MGRVYDALKRADAQ
A0A2V8QL35      ----------------------------------------------MGRVYDALKRAESP
A0A352FU10      ----------------------------------------------MGRVYDALKRAESA
A0A2V8LCU0      ----------------------------------------------MGRIYDALKRAESN
A0A1Q7NGT0      ----------------------------------------------MGRIYDALKRAESA
A0A2V8MLP9      ----------------------------------------------MGRIYDALKRAESA
A0A2V8PQZ0      ----------------------------------------------MGRIYDALKRAESA
A0A3B9MKY6      ----------------------------------------------MGRVFDAIKRASAA
A0A3D5SKZ1      ----------------------------------------------MGRVFDAIKRASAA
A0A2V8NRW2      ----------------------------------------------MGRVYDALKRASTA
A0A2V9XV04      ----------------------------------------------MSRIHEALKKAEQE
A0A2V9CBY1      ----------------------------------------------MSRVYEALKNAQEQ
A0A2V9D656      ----------------------------------------------MSRVYEALKNAQDQ
A0A7C2L7W9      ----------------------------------------------------KLNDVKLL
A0A7C2XG00      ------------------------------------------------------------
A0A2V9J901      ------------------------------------------------------------
A0A2V8QJ59      ------------------------------------------------------------
A0A1Q7HTA7      ------------------------------------------------------------
A0A2V8YMQ4      ------------------------------------------------------------
A0A2V8W380      ------------------------------------------------------------
A0A2V8ZIV5      ------------------------------------------------------------
A0A7C2M3P5      -------------------------------------------------RETLLRRAFAD
A0A2V8LBV1      ------------------------------------------------------------
A0A2V8GAF9      ------------------------------------MFALDCAGCRGGAGDGSARYVIPR
A0A7C5I7P7      ------------------------------------------------------------
A0A2V8CN98      ------------------------------------PGLIRGLLAELGTQRRGLASQLET
A0A1Q7LC46      ------------------------------------LEVLESDYREARQRETLLSEALDQ
A0A1Q8BDC5      ------------------------------------FECKEGTRIVLSNGTDLSVFPWYP
A0A2V9Q1Y8      ------------------------------------KSRARPRKSAAVCVVIIWQPXXXE
A0A2V8JXG1      ---------------------------------------LKADYERVVRDENALKAALAE
A0A350D2W9      ------------------------------------VKAAYSEYQAALKKENSLKDLFER
A0A2V9I4J1      ------------------------------------FQVYPWQLVVMNNGKDLTHLPWYP
A0A2V8PQZ9      ------------------------------------MGRIYDALKRAESAPRTPKPSVNR
A0A2V8D8B1      ------------------------------------VESMKHDYQTALTQEQSLMHALDQ
A0A3B9LSB4      ------------------------------------LTNLETDYRQTLAREQALRKAFEQ
A0A2V9H7U2      ------------------------------------VERLRNDYVAARGREKLLAAAVAK
A0A2V8NJB5      ------------------------------------FEASGTRTVVLRSGQDLSELPW--
A0A2V9JMZ4      ------------------------------------FQVYPWQLVVMNNGKDLTHLPWYP
A0A2V9MDJ6      ------------------------------------FQVYPWQLVVMKNGKDLTHLPWYP
A0A2V8QJT6      ------------------------------------LKNLETKYRQAADREEALRKSFNQ
A0A2V8FSM8      ------------------------------------ATRIRKEYEGALRREKLLETAYAE
A0A359M0J2      ------------------------------------VERLKNDYEAALKREQMLTSAYSR
A0A2V8JLJ1      ------------------------------------IDQLDRDVSKLKQGREPLQARIAA
A0A5M8SND8      ------------------------------------MARIKSDYSSAVKHEELLQSAYRQ
A0A2V9GAQ1      ------------------------------------LDVLESDYREAQQRESLLMQALDQ
A0A497EDQ8      ------------------------------------RLGMETRFDMVKRREQSLFENIQG
G8NS05          ------------------------------------IAQAKQTFIAAQANEQQTRAALED
A0A2V8KZ20      QVQAAKEPKPEEKPRPFLSEF-NLSLDTVPAEVQLQIDQLDRDVSKLKQGREPLQARIAA
A0A3D0NWU2      ------------------------------------LTALRAQLDAKRKEEAQAQAAYDR
A0A2V8EPD9      ------------------------------------VVPIAPVAPVAAAPAPAAPVALAA
A0A3N5NSX5      ------------------------------------VAAIRSEYQTARATELRLADALKQ
A0A2V8MUA1      ------------------------------------LEKLARDLKQRQEAEEEIVRKINQ
A0A2V8MBH9      ------------------------------------LTNLETKYRQSLAREESLRKSFNQ
A0A3N5ZPQ7      ------------------------------------RRALENGFRIESFEPMSVHLGIPL
A0A3N5P5F2      ------------------------------------VQAVEGEYVGAQAREESLTRELEA
A0A7C2EFE5      ------------------------------------AERVEIEYREAVNREQMLRQAVNQ
A0A2V9G1P7      ------------------------------------ADRMVNDYSAAVRRENLVQQALDD
A0A2V9BCK9      ------------------------------------QRPVPTHLVDEVAREFELGSLEPT
A0A2V9TMX2      ------------------------------------QQKMRDDYLAALQRENLLDSAFNK
A0A7C4DQP8      ------------------------------------AERVGNEYRAALAREQMLVRAFAE
A0A2V8N2J7      ------------------------------------LEGIQQRIAAYQRDQENLSAQMDT
A0A3N6BI26      ------------------------------------INRVQSEYRVAVNRRQMLLGALNR
A0A2V9JMM3      ------------------------------------LEGIDQRLRSYAPEEKALQAEIAS
A0A2V9M815      ------------------------------------LEGIDQRLRSYAPEEKALQAEIAS
A0A2V9A795      ------------------------------------ADKITNEYFAALRREGLVKEALEG
A0A355ESH9      ------------------------------------RSNASSNYQAVLRQEQSLAAELET
A0A3D0NW85      ------------------------------------LKVLETQYRRAQEKENKIRSAFNV
A0A353CAT5      ------------------------------------IDVLETKYRRAKEKEDKIRAAFDV
A0A2V9HB55      ------------------------------------LAVLESDYREAQQRESLLTQALDE
A0A2V8CU57      ------------------------------------VAAW--------------------
A0A2V8BDI4      ------------------------------------VAAW--------------------
A0A2V8F8T3      ------------------------------------VAAW--------------------
A0A2W0B5E2      ------------------------------------------------------------
A0A2V8NMG8      ------------------------------------------------------------
A0A2V8TBM7      ------------------------------------------------------------
A0A1Q7HEZ8      ------------------------------------------------------------
A0A1Q7JW36      ------------------------------------------------------------
A0A1Q7MUR4      ------------------------------------------------------------
A0A3N5PFU4      ------------------------------------------------------------
A0A3M1SNQ5      -----------------------------------------------MKILKALQRRKQE
A0A7C2C0C1      -----------------------------------------------MKILKALQRRKQE
A0A4R1LDF1      ---------------------------------------------------MTISLRKEQ
A0A1F2T1R8      ----------------------------------------------MPTLDRHL------
A0A2V9BW09      --------------------------------------------------SLALRGNEQL
A0A3M1SSE1      ----------------------------------------------------------DI
A0A2V9GQV7      ------------------------------------------------------------
A0A7C5AUB2      ----------------------------------------------MSRVYDALRRGGQA
A0A2V8YCY6      ---------------------------------------------------MCPSHRCRK
A0A2V8EGM3      ----------------------------------------------MARSMNHPRPDSTS
A0A2V8FGH1      ----------------------------------------------MGRIDEALRRSTAK
A0A2V7YV88      -----------------------------------------------DYLDQSIKSDEE-
A0A2V8D468      ------------------------------------------------------------
A0A1F2R977      ------------------------------------------MALVMSRIDEALKRVTRA
A0A2U3LF12      ------------------------------------MRPETPKLKDDGITPEERRHFQEH
A0A7C5MF19      ----------------------------------------------MSRFFQALERVRKR
A0A3N5G7M6      ------------------------------------------------------------
A0A1F2S3Q7      ------------------------------------------------------------
A0A2V8GVG4      ------------------------------------------------------------
A0A2V8PJQ0      -------------------------------------------------LDDTVKSLDD-
A0A2V8H566      -------------------------------------------------------MSPED
A0A2V8UVN4      ----------------------------------------------MSKIFEALQKSEGE
A0A1Q7RB73      ------------------------------------------------------------
A0A2V9K0H7      ----------------------------------------------MSRLHEALKKAEQQ
A0A321LXF5      ----------------------------------------------MSRFFNESRKASRH
A0A5M8SBZ0      ---------------------------------------MPQMRNLMSRIHEALIRAEQE
A0A1Q7JFB1      ------------------------------------------------------------
A0A2V9LS17      ----------------------------------------------MSRIHEALKRAEQE
A0A7C2YLF6      ----------------------------------------------MSRIHEALKKAEQE
A0A2V7X0V9      ----------------------------------------------MSRIHEALKKAEEE
A0A2V9X518      ------------------------------------------------------------
A0A2V9VC62      ----------------------------------------------MSRIHEALKRAEQE
A0A2V9S1P8      ----------------------------------------------MSRIHEALKKAEEQ
A0A2V9RTW2      ----------------------------------------------MSRIHEALKRAEEQ
A0A2V9TGF1      ----------------------------------------------MSRIHEALKRAEEQ
A0A2V9XEV6      ----------------------------------------------MSRIHEALKRAEQE
A0A2V9Y3Q6      ----------------------------------------------MSRIHEALKRAEQE
A0A2V9R269      ----------------------------------------------MSRIHEALKKAEQE
A0A2V9PTS3      ----------------------------------------------MSRIHEALKKAEQE
A0A2V9NPF4      ----------------------------------------------MSRIHEALKKAEQE
A0A2V9PNZ0      ----------------------------------------------MSRIHEALKKAEQE
A0A2V9AGR3      ----------------------------------------------MSRIHEALRKAEQE
A0A2V9G0N7      ----------------------------------------------MSRIHDALKKATEE
A0A2V9GQ44      ----------------------------------------------MSRIHDALKKAAEE
A0A2V9HRN3      ----------------------------------------------MSRIHDALKKAAEE
A0A2V8WG13      ----------------------------------------------MSRIHEALKKAAQE
A0A2V8X987      ----------------------------------------------MSRIHEALKKAAQE
A0A1Q7KX94      ----------------------------------------------MSRIHEALKKAAEE
A0A2V8XHT0      ----------------------------------------------MSRIHEALKKAAEE
A0A2V8DMJ9      ------------------------------------MADGARRGNRCRR-CRVDRRGQSS
A0A2V8GGF6      ------------------------------------MGTVRARGHHDRHWSDVHRRRVAL
A0A2V8HKU7      ------------------------------------MGTVRARGRHDRHWSDVHRRRVAL
A0A1Q6Y875      ------------------------------------------------------------
A0A523DJA9      ----------------------------------------------MNSRANNVRVIDRA
A0A2V8I604      ----------------------------------------------MSRIQDILNKAERD
A0A2V8J066      ----------------------------------------------MSRIQDILNKAERE
A0A1I6MMC5      ----------------------------------------------MSKIYEALLRAEIE
A0A2V9D5W7      ----------------------------------------------MTRIHEALTKAGQE
A0A2V9D4I4      ----------------------------------------------MSRIHEAMQKAAQE
A0A2V9D6L7      ----------------------------------------------MSRIHEAIQKAAQE
A0A2V8ZJV2      ----------------------------------------------MSRIHEALKRAAEE
A0A2V9AWB5      ----------------------------------------------MSRIHEALKKAAEE
A0A2V8Z1Y8      ----------------------------------------------MSRIHEALKKAALE
A0A1Q8AX10      ----------------------------------------------MSRIHEALKRAEQE
A0A2V9A773      ----------------------------------------------MSRIHEALKKAEEQ
A0A2V9AND3      ----------------------------------------------MSRIHEALKRAEEQ
A0A2V9BTJ7      ----------------------------------------------MSRIHEALKKAAQE
A0A2V8W2M7      ----------------------------------------------MSRIHEALKKAVEE
A0A2V8XNW2      ----------------------------------------------MSRIHEALKKAVEE
A0A1Q7CJC1      ------------------------------------------------------------
A0A2V9UEM7      ----------------------------------------------MSRIHDALKRAEQE
A0A7C4DTF2      ----------------------------------------------MSRIHEALKRAEME
A0A1Q7V300      ----------------------------------------------MSRIHEALKKAEQE
A0A2V9ZCI3      ----------------------------------------------MSRIHEALKKAEQE
A0A2V9WCB3      ----------------------------------------------MSRIHEALKKAEQE
A0A2V9VQW5      ----------------------------------------------MSRIHEALKRAEQE
A0A2V9WTP3      ----------------------------------------------MSRIHEALKKAEQE
A0A2V9NLA9      ----------------------------------------------MSRIHEALKKAEEQ
A0A2V9RKJ9      ----------------------------------------------MSRIHEALKKAEEQ
A0A2V9RN95      ------------------------------------------------------------
A0A2V9N406      ----------------------------------------------MSRIHEALKKAEEQ
A0A2V9U6D9      ----------------------------------------------MSRIHEALKKAEEQ
A0A2V8DZN4      ------------------------------------------------------------
A0A3N5YKY1      ------------------------------------------------------------
A0A2G6HQA4      ----------------------------------------------MDKFSKIMEKAGVD
A0A2V7ZTY7      ----------------------------------------------MSRLEAALWRAETL
A0A2V7ZVL9      ----------------------------------------------MSRLEAALWRAETL
A0A1Q7QYI4      ----------------------------------------------MSRLEAALRRAQAL
A0A2V8G9Y9      ----------------------------------------------MTRLAEALRRAED-
A0A143PNR5      ----------------------------------------------MSRIDEALRRARGE
A0A6A7L078      ----------------------------------------------MGRIDEALRRAGGG
A0A143PXU3      ----------------------------------------------MSRIDDALRRARGE
A0A2V8D8G9      ----------------------------------------------MSRIDQALRIREVA
A0A2V8ESQ4      ----------------------------------------------MSRIDQALRMREVA
A0A1E3Y5Q0      ----------------------------------------------MRRAAEARQPISPD
A0A2W4TWK5      ----------------------------------------------MGRIDEAMRRAGGA
A0A3N5NYV3      ----------------------------------------------MSRLAEALKRASAE
A0A2V2RJF9      ------------------------------------------------------------
A0A2G6HNT3      ------------------------------------------------------------
A0A2V7YWD4      ------------------------------------------------------------
A0A2V2R8T6      ------------------------------------------------------------
A0A1Q7RGF1      ------------------------------------------------------------
A0A2V9BLX2      ------------------------------------------------------------
A0A2V9ZA03      ------------------------------------------------------------
A0A3N5ZNH4      ------------------------------------------------------------
A0A2V8GEZ2      ------------------------------------------------------------
A0A3N5ZFD3      ------------------------------------------------------------
G8NXD3          ------------------------------------------------------------
A0A2V9VR38      ------------------------------------------------------------
A0A2V9EY04      ------------------------------------------------------------
A0A2V9HAK9      ------------------------------------------------------------
A0A1Q7FS15      ------------------------------------------------------------
A0A1Q7K9P1      ------------------------------------------------------------
A0A1Q7N989      ------------------------------------------------------------
A0A2V9G7Y0      ------------------------------------------------------------
A0A2V8T7Z1      ------------------------------------------------------------
A0A2V7U8G5      ------------------------------------------------------------
A0A2V7UNP9      ------------------------------------------------------------
A0A2V7VLD7      ------------------------------------------------------------
A0A2V7XGA3      ------------------------------------------------------------
A0A2V7YAG6      ------------------------------------------------------------
A0A2V7VK33      ------------------------------------------------------------
A0A7C5EWK9      ------------------------------------------------------------
A0A3M1VTE1      ------------------------------------------------------------
A0A2V7TTM7      ------------------------------------------------------------
A0A2V8VI82      ------------------------------------------------------------
A0A2V7U4P9      ------------------------------------------------------------
A0A2V7TQY5      ------------------------------------------------------------
A0A2V7TU87      ------------------------------------------------------------
A0A2V8SEH0      ------------------------------------------------------------
A0A2V8VU54      ------------------------------------------------------------
A0A1Q7RML7      ------------------------------------------------------------
A0A1Q7ZIQ5      ------------------------------------------------------------
A0A2V8TKD8      ------------------------------------------------------------
                                                                            

A0A1F2U8T6      RDTRSVDAIPVITQNLQIQALRNQLGDLQRQKANLTERYGDKHPEMVKVNAQLADGQRQL
A0A2V8BV42      SGTTAPDAIPVIAQNTQVQALKTKLNELQRDKSRLEERYGPKHLAVQANATAILDTQRQV
A0A2V8F916      SGTTAPDAIPVIAQNTQVQALKTKLNELQRDKSRLEERYGPKHLAVQANATAILDTQRQV
A0A1Q7K833      TASQHLDTIPVIAQNPDVGAAKAKVTAAQTDRARTAERYGEKHPNMQKVNADVAEAQRQY
A0A1Q8AMY4      TASQHLDTIPVIAQNPDVGAAKAKVTAAQTDRARTAERYGEKHPNMQKVNADVAEAQRQY
A0A2V8BM40      GAGEPVDTIQVIATSPEVSAAKGKVFAIQSEKARIAERYGDKHPTMQKAMADLTEAQRQY
A0A2V8CRT6      GAGEPVDTIQVIATSPEVAAAKGKVFAIQSEKARIAERYGDKHPTMQKAIADLTEAQRQY
A0A1F2VH76      --GQDTETITTILQNPMVLSLRNRVSEVERDRGRISERYGPRHPEYEKVTTQLADVKLQL
A0A1F2R0X5      AGGAAPDSIPIIAQNPNVQALKNKLSSLQQDKVRLLERYGDKHPQVIAVNASLQDTQRQL
A0A2V8B278      S-TQAPDTIPAIAQNASVAAAKSRVVEMQRARAQVADRYGERHPNMQKANADLSEAQRQY
A0A2V8CEF9      S-TQAPDTIPAIAQNASVAAAKSRVVEMQRARAQVADRYGERHPNMQKANADLSEAQRQY
A0A2V8KZG2      ------------------------------------------------------------
A0A2V8TKR9      ------------------------------------------------------------
A0A1Q7LG57      --MRDSNVLVVDRAKPPLLPYRPSFPMNSAIGLFSGL---------------------FL
A0A2V8MKQ7      ------------------------------------------------------------
A0A1Q7L5B1      RE----------------------------------------------------------
A0A2V9DKV4      ------------------------------------------------------------
A0A2V9EVA0      QT----------------------------------------------------------
A0A7C5ZU39      SGAQKPASAVKSAMKAGAPSSTASSNLIPERDIKIGV-----------------------
A0A3N5YN96      GQVRRTTSEV-----------PPAADTAAAGRVSSPVSPQPPVASRRAVPPE------PP
A0A1Q7Y646      QGGVTKRSNE----QKRRNGNSNAARQNGNGN-----------------------HAFED
A0A2V8QZU0      NGSKAKKEEKLAHDSRDERPPAPAAETNGHGRPHAAPGASAPVVGVNRDADDAAEFLFRR
A0A2V8RSQ9      GDAKSKRPDD-AGPSRVDNTNGNAQHANGNGAAHTRAPVADPLFD-------------RP
A0A2V9L2P7      AGLRATNIHFIDSAAVPTVPVRPQKGRNIAFAMAVGL---------------------AL
A0A2V7UMX0      SQ----------------------------------------------------------
A0A136K497      NP-----------------TTSKPRVVAFDANGKRNA---------------------PP
A0A399W9E4      NP-----------------TSTKPKVVAFDAPGRRNL---------------------PP
A0A321LMC5      TE-----------------------------QFQQPE---------------------GA
A0A2V8X713      KS----------------------------------------------------------
A0A2V8ZLE9      KP----------------------------------------------------------
A0A2V8Y4D3      RP----------------------------------------------------------
A0A2V8Z2X8      GP----------------------------------------------------------
A0A2V9C3F6      KP----------------------------------------------------------
A0A2V9QMU9      ------------MARVPIEPAEPDVPRNLSFALVLGL---------------------TT
A0A2V9QY75      AGLRSNNIREVDIARTPGAPAEPNIARNLVFAFALGL---------------------SS
A0A2V9SVU9      AGLRSNNIRPVDEARVPMYPAEPNVPRNLSFALALGL---------------------TT
A0A2V8W5N5      RH----------------------------------------------------------
A0A2V8XG53      RH----------------------------------------------------------
A0A6A7LB89      AQ-----ERGEPVHRDVAGAAALRPSGEDPSHVAPW------------------------
A0A352EZH8      GSAIVFEPQPSSSDYRGEIRTHRLVPSAQQIEEELFS---------------------AS
A0A0B6X033      DSRKREHRARPSDAQARAEEIESLLQRSEIFSSQARE---------------------PQ
A0A2V8R0I3      QR-HNHKPSDFSGRHNGDADNVSLF-TPKNEQEHPWS---------------------AS
A0A2V8N1U8      RQ-FK--PSTPSVRRHGNSDNVAYF-VPKNGHEHPWE---------------------TA
A0A2V8QL35      ER-RIT-ASKSAIRQNGNSGNVLYPGWPGNGHDHPWE---------------------RN
A0A352FU10      ER-QVT-SSKSSVRQNGNSGNVLYPGWPGNGHDHPWE---------------------RN
A0A2V8LCU0      QR-DFTSTNKSSVSRNGNPDNVSYF-VQKNGHEHPWE---------------------KA
A0A1Q7NGT0      PR-----TPKPSVNRPGNPDNIAYF-VPK--HVHPWE---------------------RQ
A0A2V8MLP9      QR-----TPKPSVNRNGNPDNVAYF-VPK--HVHPWE---------------------RR
A0A2V8PQZ0      QR-----TPKPSVNRNGNPDNVAYF-VPK--HVHPWE---------------------RR
A0A3B9MKY6      DQGGEQKRHQPDLERHGESPSVPGLPSARQIEEQLPS---------------------RS
A0A3D5SKZ1      DQGGEQKRHQPDLERHGESPSVPGLPSARQIEEQLPS---------------------RS
A0A2V8NRW2      KDENGAGRKKEDQKRRNGTAAGRKLSAVLPVVNGDEH---------------------PW
A0A2V9XV04      RA----------------------------------------------------------
A0A2V9CBY1      RTIRGPLEAEVTAQESSVGGPVHNGKTASRIREILSA---------------------LT
A0A2V9D656      QTIRGP------------------------------------------------------
A0A7C2L7W9      STLTTTNVQILDKAEVPLRPARPRKLFNIGLSVLVGL---------------------IL
A0A7C2XG00      ------------------------------------------------------------
A0A2V9J901      ------------------------------------------------------------
A0A2V8QJ59      ------------------------------------------------------------
A0A1Q7HTA7      ------------------------------------------------------------
A0A2V8YMQ4      ------------------------------------------------------------
A0A2V8W380      ------------------------------------------------------------
A0A2V8ZIV5      --------------QYNILKREVDTNKQLYEGLLQTL-------------KQTGVS---A
A0A7C2M3P5      QQAQAGRVAEKS-VQYNILKREVDTNKQLYEGLLQRL-------------KEAGMS---A
A0A2V8LBV1      ------------------MKREVETSRQLYEAMMQKV-------------KEYSIA---S
A0A2V8GAF9      HRGPAGLPPRPD----DAVQHSAAYDRGAHATSVASN-------------RVDGGVGHDR
A0A7C5I7P7      -------------VHYNILKREVDTNRQLYESMLQKV-------------KEAGIA---S
A0A2V8CN98      GGRELQGIPQRA-IEDARLRRDVSIAENLFTSVQQRY-------------SEARLA---E
A0A1Q7LC46      AKVEANQMSEKL-VEYNILKREAEANKALYEGLMTKM-------------KETAIS---A
A0A1Q8BDC5      EELSLLSEIKVP-STVQELAKTTGMKETNIRKVLGVF-------------QTLGII----
A0A2V9Q1Y8      QKQQENKLNESA-IEFSLLKRDFETNRTLYEGLLQKL-------------KEAGVT---A
A0A2V8JXG1      AKAGAAQENQRA-IQYSLLKQDVDTAKSLYTEFLQKT-------------NQAYLE---V
A0A350D2W9      QKDEAFRLNSNA-ILYNGLKIEIENKKSLLESLLKRQ-------------SETGVSARLR
A0A2V9I4J1      QELSVLSELRRS-RTLQDLATATGLEYVRLTKILDVF-------------RKLQVV----
A0A2V8PQZ9      NGNPDN-------IAYFVPKHVHPWERQSFTGMPQGY-------------DSASTA----
A0A2V8D8B1      QKADALALNRKG-IGYGALQRDAASNRQIFEALMQRT-------------KETGIS---G
A0A3B9LSB4      QRGETLSQNEAA-INYRIIQQEIDTNKTLLDSLLQRS-------------KENDVI---M
A0A2V9H7U2      EKVGVGALSQLL-IQHNLLKREFDTNQQLYDSLLQRL-------------KDATVS---A
A0A2V8NJB5      --------------------------------------------------YPEELGVLRE
A0A2V9JMZ4      QELSVLSELRRS-RTLQDLATATGLEYVRLTKILDVF-------------RKLQVV----
A0A2V9MDJ6      QELSVLSELRRS-RTLQDLATATGLEYVRLTKILDVF-------------RKLQVV----
A0A2V8QJT6      QKGETVTQNEAA-INYRILQQEIETNKGLLDNLLQRS-------------KENDVV---L
A0A2V8FSM8      KVHQLASKAEET-AHYNLLKRDVDGTRKMYESLTQRL-------------KEASMA---S
A0A359M0J2      QASAVTGQANVA-AEYGTLKREVDILRQSFNALLQQS-------------NQVSIG---S
A0A2V8JLJ1      YQNRLNPPAPVA-EELARLTRNYDEARQHYNVLAEKR-------------SNSKMAATAD
A0A5M8SND8      QVSVVTDKHNKA-IQYGIFKHQVDSDEKLYESMLEQV-------------NRASVA---S
A0A2V9GAQ1      QKTETNQMAEKL-VEYNILKREAEANKTLYDGLMTKL-------------KETAIS---Q
A0A497EDQ8      LRNQTIELSKTS-LEYDRLEETYLQNRRFLDDMLARS-------------NEADLS---A
G8NS05          QKSEAYKLRDDL-VQYTLLQRDFESNRTLYEGLLEKL-------------QTARVQ---A
A0A2V8KZ20      YQNRLNPPAPVA-EELARLTRNYDEARQHYNVLAEKR-------------SNSKMAATAD
A0A3D0NWU2      EAALANIQGQAQ-TRLTTLKRDIETKRNLLDTYTQRL-------------KEQELAIANS
A0A2V8EPD9      AAPVPAAAAAPV--------------------------------------ARVAPAVHVA
A0A3N5NSX5      SQGAAMELNRKN-VGYTVLEREAQSNRGIYEALLQRQ-------------NELQIV---S
A0A2V8MUA1      YRSRVNAPPEVL-DELAGLQRQRQVANQRYELLSGKK-------------FSSDLAGRVD
A0A2V8MBH9      QKGETVTQNEAA-INYRILQQEIETNKGLLDNLLQRS-------------KENDVV---L
A0A3N5ZPQ7      KAR----------LDVLLLDLARTAANTFEPGLYEKIGLIAEHTFATLPWQPAELAVLDC
A0A3N5P5F2      QKADVLAINRKS-IGYAALERDAASNRQIFEALLQRA-------------KETGIS---S
A0A7C2EFE5      TKAEFDRLNARS-FEYQTLKREADSDKALYEELVRKI-------------REAGIN---A
A0A2V9G1P7      QQKQVNLIAEKS-VQYNILKREVDTNKQLYEGLLLQL-------------KEAGVS---A
A0A2V9BCK9      TQPTSTACPENTLAAESPLEDFIGSIGAVPSARLDHC-------------GTQGRE----
A0A2V9TMX2      QKQEANKLNESATIEYTVLKRDAETNRQLYQDLLQRL-------------KEAGVS---A
A0A7C4DQP8      QQQRRNQVAERS-VQYNILKREVETNRQLYEALLQRL-------------KEAGVS---S
A0A2V8N2J7      YSRRLESTPQHE-KVIDDMERELKVGEMQFHALLDKQ-------------LDTKLAKGFE
A0A3N6BI26      QKAEANQLNQDS-IQYNILQREVDTNRQLYEGLLQRL-------------KETGIS---A
A0A2V9JMM3      LRQRVASAPKHE-RALAEMTREQALTRSQYQGLLEKQ-------------NEMKMAERLR
A0A2V9M815      LRQRVASAPKHE-RALAEMTREQALTRSQYQGLLEKQ-------------NEMKMAERLR
A0A2V9A795      QQKQVNVIAEKA-VQYNILKREVETNKQLYEGLLQRL-------------KEAGVS---A
A0A355ESH9      IKRQAIDQNSSA-VQFTNLKVEIQTRRELLDELLRRQ-------------SETEVAVRLQ
A0A3D0NW85      QFQEAQGQNAGA-VMIKLLQQNIETNKGFLDNLRKQQ-------------SSNDIA---S
A0A353CAT5      QVNEAQGQNAGA-VMLKLLQQSIETNKGFLDNLRKQQ-------------SSNDIA---T
A0A2V9HB55      QKAETNHMAEKL-VEYNILKREAEANKTLYEGLMTKL-------------KETAIS---Q
A0A2V8CU57      --SEPETVTAPL-AVAAWSEPESAAAPPVVAGWSEPE-------------TVTA------
A0A2V8BDI4      --SEPETVTAPL-AVAAWSEPESAAAPPVVAGWSEPE-------------TVTA------
A0A2V8F8T3      --SEPETVTAPL-AVAAWSEPESAAAPPVVAGWSEPE-------------TVTA------
A0A2W0B5E2      ------------------------------------------------------------
A0A2V8NMG8      ------------------------------------------------------------
A0A2V8TBM7      ------------------------------------------------------------
A0A1Q7HEZ8      ------------------------------------------------------------
A0A1Q7JW36      ------------------------------------------------------------
A0A1Q7MUR4      ------------------------------------------------------------
A0A3N5PFU4      ------------------------------------------------------------
A0A3M1SNQ5      NERIVPFERKYQ--------------------------------------PESYAPTTFP
A0A7C2C0C1      NERIVPFERKYE--------------------------------------PESCAPTTFP
A0A4R1LDF1      NIAAINLQSESF--------------------------------------QLIDAPREAT
A0A1F2T1R8      ------------------------------------------------------------
A0A2V9BW09      GPQLPASPGKHP--------------------------------------VGFED-----
A0A3M1SSE1      PVSPRRLLTVMM--------------------------------------ALFLSACFGI
A0A2V9GQV7      ------------------------------------------------------------
A0A7C5AUB2      GDEGGPVPRAAG--------------------------------------RL--------
A0A2V8YCY6      PSGPCAPL----------------------------------------------------
A0A2V8EGM3      SGRRCSPA----------------------------------------------------
A0A2V8FGH1      KDTQVKAVEVPP--------------------------------------DDMFVSPWNF
A0A2V7YV88      ------------------------------------------------------------
A0A2V8D468      ------------------------------------------------------------
A0A1F2R977      PSPSPRRAESAE--------------------------------------SRATSFG---
A0A2U3LF12      RL----------------------------------------------------------
A0A7C5MF19      HQPQMEAPAPTV--------------------------------------TH--------
A0A3N5G7M6      ------------------------------------------------------------
A0A1F2S3Q7      ------------------------------------------------------------
A0A2V8GVG4      ------------------------------------------------------------
A0A2V8PJQ0      ------------------------------------------------------------
A0A2V8H566      RSTALEAVVRDG--------------------------------------RI--------
A0A2V8UVN4      VAQEALPVLTDG--------------------------------------GSQLGGVKVV
A0A1Q7RB73      ------------------------------------------------------------
A0A2V9K0H7      KTENGSPLDLER--------------------------------------PTVIPGD---
A0A321LXF5      VTVGPRNVDLQE--------------------------------------HI--------
A0A5M8SBZ0      HNGRPGAPANVT--------------------------------------LP--------
A0A1Q7JFB1      ------------------------------------------------------------
A0A2V9LS17      MEGRSIPSVGTQ--------------------------------------IAEL------
A0A7C2YLF6      RAGMERPADATP--------------------------------------EDYLEPGALH
A0A2V7X0V9      RAASQGGAQLEP--------------------------------------TP--------
A0A2V9X518      -----------------------------------------------------MDVP---
A0A2V9VC62      RAASQGGR-VDS--------------------------------------APVMDLPASP
A0A2V9S1P8      RVASQGGRPVEP--------------------------------------VQPADAA---
A0A2V9RTW2      RAASQGGQ-VPS--------------------------------------SQTPEAV---
A0A2V9TGF1      RAASQGGQ-VPS--------------------------------------SQTPEAV---
A0A2V9XEV6      RAASQGGH-VES--------------------------------------LHPMDVP---
A0A2V9Y3Q6      RATSQGGH-LEP--------------------------------------LHTTEGP---
A0A2V9R269      RAMLHPSQRVEM---------------------------------------PAV------
A0A2V9PTS3      RAMSQSPGAIET--------------------------------------SPAV------
A0A2V9NPF4      RAMSQSPGAIET--------------------------------------APAV------
A0A2V9PNZ0      RAMSQSPGAIET--------------------------------------APAV------
A0A2V9AGR3      RASSAAVGRKDE--------------------------------------LPAINTD---
A0A2V9G0N7      KASQSPASPAQT--------------------------------------FVDVREG---
A0A2V9GQ44      KASQSPASPAQT--------------------------------------FVDVREG---
A0A2V9HRN3      RASKSPASAAQT--------------------------------------FVDVTEG---
A0A2V8WG13      RSSQVATGTVPD--------------------------------------LADVATG---
A0A2V8X987      RSTQIGAGLDRD--------------------------------------VADVAAE---
A0A1Q7KX94      RSAQLAAGLETG--------------------------------------VVEVTGE---
A0A2V8XHT0      RSAQLAAGLETG--------------------------------------VVEVTGE---
A0A2V8DMJ9      PGAWKRTDRSAD--------------------------------------GARTSMMRAQ
A0A2V8GGF6      HRERQRAHRPAD--------------------------------------GAWTGVMASE
A0A2V8HKU7      HRERQRAHRPAD--------------------------------------GAWTGVMTSE
A0A1Q6Y875      ------------------------------------------------------------
A0A523DJA9      PVPSTPFTPNAR--------------------------------------RDWRT-----
A0A2V8I604      GAVRRTRPLGSE--------------------------------------TSAAA-----
A0A2V8J066      GSARRTRSIGTD--------------------------------------APVGTPPSPV
A0A1I6MMC5      RLTTKD------------------------------------------------------
A0A2V9D5W7      YPAAQAID-SLF--------------------------------------QL--------
A0A2V9D4I4      RAAAPATEIAPF--------------------------------------PF--------
A0A2V9D6L7      RSAAPATDFAPL--------------------------------------PF--------
A0A2V8ZJV2      RAAQLAAGSEAS--------------------------------------SA--------
A0A2V9AWB5      RAARLTFDVDPR--------------------------------------EG--------
A0A2V8Z1Y8      RSAQL-VTELES--------------------------------------AE--------
A0A1Q8AX10      RAPIQSANEAKP--------------------------------------SD--------
A0A2V9A773      RPPAWKPADPTP--------------------------------------L---------
A0A2V9AND3      RPPSWKPAEPTP--------------------------------------L---------
A0A2V9BTJ7      RSAQLAAGTAPS--------------------------------------FL--------
A0A2V8W2M7      RVSHLSVGESLN--------------------------------------LA--------
A0A2V8XNW2      RVSHLSVGESLN--------------------------------------LA--------
A0A1Q7CJC1      ------------------------------------------------------------
A0A2V9UEM7      RATSMGGQLEPA--------------------------------------LEQPELQ---
A0A7C4DTF2      RAAQQAQS-ETS--------------------------------------VS-ARFE---
A0A1Q7V300      RATS-----------------------------------------------E-SIPQ---
A0A2V9ZCI3      RAASQGSQIDSS--------------------------------------HV-GEM----
A0A2V9WCB3      RAATQAMAVPPP--------------------------------------MA-AMP----
A0A2V9VQW5      RAASQGTRTDG----------------------------------------T-PVMD---
A0A2V9WTP3      RAASQGGPVPSN--------------------------------------FS-GAES---
A0A2V9NLA9      RSAEHEMHIEPP--------------------------------------LA-SAPE---
A0A2V9RKJ9      RSAEHEMHIEPP--------------------------------------LA-SAPE---
A0A2V9RN95      ------------------------------------------------------------
A0A2V9N406      RAASQGGNIEP----------------------------------------A-SISE---
A0A2V9U6D9      RAASQGGSIEP----------------------------------------A-PIAE---
A0A2V8DZN4      ------------------------------------------------------------
A0A3N5YKY1      MQVFATPSAATH--------------------------------------PNVPPTVGVG
A0A2G6HQA4      TSYNLHSKKRKN--------------------------------------SLPGKKRRSV
A0A2V7ZTY7      NDEPAAPPTVSG--------------------------------------GQGSRDCATG
A0A2V7ZVL9      NDEPAAPPTVSG--------------------------------------GQGSRDCATG
A0A1Q7QYI4      NDQSDA------------------------------------------------------
A0A2V8G9Y9      HSGAEA------------------------------------------------------
A0A143PNR5      QPEHRATDFEAD---------------------------------------------APW
A0A6A7L078      ASTLEREDGGSD--------------------------------------QPSPPPASPW
A0A143PXU3      QPEQAATD----------------------------------------------ADIDMP
A0A2V8D8G9      SGAAAPETGTNQ--------------------------------------SRGSSSLN--
A0A2V8ESQ4      SGAAAPETGTNQ--------------------------------------SRGSSSLN--
A0A1E3Y5Q0      AGDAAGG-----------------------------------------------PTVGWP
A0A2W4TWK5      SATVEEAAQPAV--------------------------------------PVELPTEAFP
A0A3N5NYV3      QESDGAEQQEPI--------------------------------------KREKPPTSHP
A0A2V2RJF9      ------------------------------------------------------------
A0A2G6HNT3      ------------------------------------------------------------
A0A2V7YWD4      ------------------------------------------------------------
A0A2V2R8T6      ------------------------------------------------------------
A0A1Q7RGF1      ------------------------------------------------------------
A0A2V9BLX2      ------------------------------------------------------------
A0A2V9ZA03      ------------------------------------------------------------
A0A3N5ZNH4      ------------------------------------------------------------
A0A2V8GEZ2      ------------------------------------------------------------
A0A3N5ZFD3      ------------------------------------------------------------
G8NXD3          ------------------------------------------------------------
A0A2V9VR38      ------------------------------------------------------------
A0A2V9EY04      ------------------------------------------------------------
A0A2V9HAK9      ------------------------------------------------------------
A0A1Q7FS15      ------------------------------------------------------------
A0A1Q7K9P1      ------------------------------------------------------------
A0A1Q7N989      ------------------------------------------------------------
A0A2V9G7Y0      ------------------------------------------------------------
A0A2V8T7Z1      ------------------------------------------------------------
A0A2V7U8G5      ------------------------------------------------------------
A0A2V7UNP9      ------------------------------------------------------------
A0A2V7VLD7      ------------------------------------------------------------
A0A2V7XGA3      ------------------------------------------------------------
A0A2V7YAG6      ------------------------------------------------------------
A0A2V7VK33      ------------------------------------------------------------
A0A7C5EWK9      ------------------------------------------------------------
A0A3M1VTE1      ------------------------------------------------------------
A0A2V7TTM7      ------------------------------------------------------------
A0A2V8VI82      ------------------------------------------------------------
A0A2V7U4P9      ------------------------------------------------------------
A0A2V7TQY5      ------------------------------------------------------------
A0A2V7TU87      ------------------------------------------------------------
A0A2V8SEH0      ------------------------------------------------------------
A0A2V8VU54      ------------------------------------------------------------
A0A1Q7RML7      ------------------------------------------------------------
A0A1Q7ZIQ5      ------------------------------------------------------------
A0A2V8TKD8      ------------------------------------------------------------
                                                                            

A0A1F2U8T6      DVGTAKALESVRNEYERALIEERTLAAHLEEAKRDAQDLSRKSVGYNVLEREAKSHRTVY
A0A2V8BV42      DVETSRALQSVKNDFETAVLEERVLAQNLDAAKGDAQDLSRKSVGYNVMERESKSNRLVY
A0A2V8F916      DVETSRALQSVKNDFETAVLEERVLAQNLDAAKGDAQDLSRKSVGYNVMERESKSNRLVY
A0A1Q7K833      DLAVNRAASAIKNEYETAQLEEQAYSRGLDSAKADAQDLSKKSVDYNVMEREAKTNRDIF
A0A1Q8AMY4      DLAVNRAASAIKNEYETAQLEEQAYSRGLDSAKADAQDLSKKSVDYNVMEREAKTNRDIF
A0A2V8BM40      DTAVTRAAQAIKNDYETAVLEEQTFSRGLDSAKSAAQDLSRKSVDYNVMERDAKTNREIY
A0A2V8CRT6      DTAVTRAAQAIKNDYETAVLEEQTFSRGLDSAKSAAQDLSRKSVDYNVMERDAKTNREIY
A0A1F2VH76      EAEIKKAIQTAKSEYEAAVVQERTLTQALNEQKAAATDLSRKGVDYTLILREAESNREIY
A0A1F2R0X5      DQETARAVQSVRNEFETSVLEERTLSQNLEAAKVEASDLNRKGIGYGVMEREAQSNRQVY
A0A2V8B278      DFEVARARASIKNDYESALIEEQTMARGLENAKADMQDLSKKSVDYNVMQRDSQTNRQIY
A0A2V8CEF9      DFEVARARASIKNDYESALIEEQTMARGLENAKADMQDLSKKSVDYNVMQRDSQTNRQIY
A0A2V8KZG2      ------------------------------------------------------------
A0A2V8TKR9      ------------------------------------------------------------
A0A1Q7LG57      GFGFVILRDRLDRRITAPGDAQAYLDLPE-------------------------------
A0A2V8MKQ7      ------------------------------------------------------------
A0A1Q7L5B1      ------------PALFPGEAKPNHSVVAE-------------------------------
A0A2V9DKV4      ----------------------------M-------------------------------
A0A2V9EVA0      -PVVPGAETIPPEPVAFWTEQREEELRPT-------------------------------
A0A7C5ZU39      -------PNSTNINNGIHIESDVTGIAYE-------------------------------
A0A3N5YN96      MQVFATPSAATHPNVPPTVGVGGASAVPP-------------------------------
A0A1Q7Y646      SPLFAPLGAAHNSASTAHT-EEGVGSALS-------------------------------
A0A2V8QZU0      SKHFQSPESATVSASNEHTVTPG-GSALP-------------------------------
A0A2V8RSQ9      SAFFHAPDAAHSSASTEHTAQAGVGSALP-------------------------------
A0A2V9L2P7      GMGLAFVREALANSIKGAQEVENLIAAPA-------------------------------
A0A2V7UMX0      -VKGFRLPEAKPGAQPGKSARTKAGLPDQ-------------------------------
A0A136K497      DILGTELTIGSPRSAFDGQPNSSLGTALP-------------------------------
A0A399W9E4      DLLGTGLAIGSPRSAFDGQPNSSLGTALP-------------------------------
A0A321LMC5      VFGDAIGPDFFDERDDSFIKESGSTRNSQ-------------------------------
A0A2V8X713      ---------------PTRSAPGAGPLDFA-------------------------------
A0A2V8ZLE9      ---------------PAWKPSEPTPLGFG-------------------------------
A0A2V8Y4D3      ---------------SAWKPAEPTPFGVA-------------------------------
A0A2V8Z2X8      ---------------SAWRPSEPTPLGIV-------------------------------
A0A2V9C3F6      ---------------PAWRPTDPTPLNYV-------------------------------
A0A2V9QMU9      GVSLAFLLEGIDNTVRTPEQAQAISGLPS-------------------------------
A0A2V9QY75      GIGLAFLLEGLDNTVRTPEQAQAISGLPS-------------------------------
A0A2V9SVU9      GVGLAFLLEGIDNTVRTPEQAQALSALPS-------------------------------
A0A2V8W5N5      --SSQAADTVTLSVETPRTQVIAGIGLRA-------------------------------
A0A2V8XG53      --SSQAADTVTLSVETPRTQVIAGIGLRA-------------------------------
A0A6A7LB89      ------------TFDESQPSRPHRSSLAD-------------------------------
A0A352EZH8      SILNRTEDTVTSSAFTAHTAYATGGTALP-------------------------------
A0A0B6X033      LFSAS--------AEHADVATAIGSALPE-------------------------------
A0A2V8R0I3      PFTAM--PAAIDSAPTAHTAEETGGPALP-------------------------------
A0A2V8N1U8      PTIGA--PAAIDSASTAHTAEATGGPALP-------------------------------
A0A2V8QL35      AFTGM--PSAYDSASTAHTAEAASGPALP-------------------------------
A0A352FU10      AFTGM--ASAYDSASTAHTSEAASGPALP-------------------------------
A0A2V8LCU0      PFTGM--PSAFSSASTAHTAEATGGPALP-------------------------------
A0A1Q7NGT0      SFTGM--PQGYDSASTAHTEEATGGPALP-------------------------------
A0A2V8MLP9      PFTGM--PAGIDSASTAHTEEATGGPALP-------------------------------
A0A2V8PQZ0      PFTGM--PAGIDSASTAHTEEATGGPALP-------------------------------
A0A3B9MKY6      SFLSVSHETAQNSASSAHTADIPGGLALP-------------------------------
A0A3D5SKZ1      SFLSVSHETAQNSASSAHTADIPGGLALP-------------------------------
A0A2V8NRW2      DSSPLFSRAAHESASTAHTEERAGS-ALS-------------------------------
A0A2V9XV04      ------------------------STQGE-------------------------------
A0A2V9CBY1      AEGAPPQEQRTIRGPLEAEATPQESSVGG-------------------------------
A0A2V9D656      ---------------LEAEATPQESGVGE-------------------------------
A0A7C2L7W9      GVGLALFVEYLDNTVKSAEDVDRLLGL---------------------------------
A0A7C2XG00      ------------------------------------------------------------
A0A2V9J901      ------------------------------------------------------------
A0A2V8QJ59      ------------------------------------------------------------
A0A1Q7HTA7      ------------------------------------------------------------
A0A2V8YMQ4      ---------------------------------------------------MAMGQAFAG
A0A2V8W380      ----------MDSAEPPAKPVK--PRTLLNLSVALFL-----------GLALGICAALFQ
A0A2V8ZIV5      SLKATNI-RIVDSAVPPVKPAT--PKIPLNLTVASLL-----------GLGLGISAAFLQ
A0A7C2M3P5      GMKASHV-RVVDPAQPPDKPAK--PSLALNLLLALVL-----------GLGLGLAAVFLQ
A0A2V8LBV1      AITANNV-RVVDPATPPGAPYK--PDIYMYTMLGLAT-----------GVFLSILLIVRQ
A0A2V8GAF9      LGLDCRWRSPCRHRKRANRPVGGWPARVTREDVSTQL-----------------------
A0A7C5I7P7      AMRASTY-RVVDAAQAPERPYR--PRPARMALFGLLG-----------GLVLGFGFVLVR
A0A2V8CN98      ASSIADV-RVLDAAVAPETPVK--NTAVRLLIMGLFA-----------GLGFGVVGAVVI
A0A1Q7LC46      GLRSSNI-RIVDPAMVPTSPAR--PAKARNIMLAFLV-----------GLIGGIGLALMR
A0A1Q8BDC5      --------ETFADAEAPI------------------------------------------
A0A2V9Q1Y8      GLRSNNI-RQVDIARTPAGPAE--PNIPRNLGFALAL-----------GLTSGIGLAFLL
A0A2V8JXG1      AQQQSNI-RVISPARMPKGPVS--PNRQRTILIGLLL-----------SLSGGIGLAWLL
A0A350D2W9      GLRTSNI-RVIDRADLPINPSS--PKKLRNLLLALFL-----------GLFGGAGLAFVM
A0A2V9I4J1      --------DIVDEETG--------------------------------------------
A0A2V8PQZ9      --------HTEEATGGPALPDG--PASRD-------------------------------
A0A2V8D8B1      ALKTSNI-RVVDNAETPRVPAS--PNKLANMMLAFIG-----------GSVLAVALVFFF
A0A3B9LSB4      ASKPNNI-SIVDYAVTPDGPIG--PNRSSTVSMALFL-----------SLGLGVGLALLL
A0A2V9H7U2      GLRATNI-HLVDPARPPKVPVR--PQKLYNIAVSIAV-----------GLILGVMLAFVK
A0A2V8NJB5      LTHPTTVAGLVASTGMKETPLR--RILGVFDQLGIIE----------------------L
A0A2V9JMZ4      --------DIVDEETG--------------------------------------------
A0A2V9MDJ6      --------DIVDEETG--------------------------------------------
A0A2V8QJT6      AGRPNNI-SVVDYAIVPDLPVG--PARLRTVMFAFLL-----------ALAFGAALALFL
A0A2V8FSM8      ALRANNV-RVVDPAEEPEAPYK--PDVVRRITFGLIF-----------GAMFGVAFSVLR
A0A359M0J2      AIPVSSV-RVIDTAKPNNTQMS--PSLFRELARGLGL-----------GLLLGYGCAFLH
A0A2V8JLJ1      SSDNNEMFKVIDAAFLPRQAIG--PNRRLIAALGGAA-----------GLVLGLAIAFLR
A0A5M8SND8      AAGSSNI-QIFSGAQPPLRPDS--SGLITYSFGGLFF-----------GFLAGSAWVFTR
A0A2V9GAQ1      GLRSSNI-RVVDPEMIPSTPAR--PAKARNMVLAFLV-----------GLVGGIGLALMR
A0A497EDQ8      TAWMNNI-RVIEKATPPSGPFS--PNLRRAVALGGVL-----------GLFLGIGLVLGL
G8NS05          GLDSTEI-DIIDQAVPPAQPSL--KSKSSIMMLNTII-----------GIVLGAILGFIL
A0A2V8KZ20      SSDNNEMFKVIDAAFLPRQAIG--PNRRLIAALGGAA-----------GLVLGFGIAFLR
A0A3D0NWU2      TPDNIKM----AAAAETAPRVG--PNRTRNIIVALLL-----------SLAAGIGLAFLL
A0A2V8EPD9      VPPAAKPTAPAAPAAVPKPPIA--PARPVAASASNAP-----------------AASAAP
A0A3N5NSX5      NSGGNNV-RLMDRAVVPGSPFT--PDVRRNYMLGALT-----------GLLLSLGLVLAI
A0A2V8MUA1      TDINNQTFKVIDPANLPIRPFG--PNRERMIMIGCLA-----------SFALGLALVFAR
A0A2V8MBH9      AGRPNNI-SIVDYAITPDFPVG--PARMRSVMLAFVL-----------ALALGVGLALFL
A0A3N5ZPQ7      LLQPKNLEELMGETGLPESQLV--ACLQTLRALGMIE----------------------I
A0A3N5P5F2      ELKTNNI-RIADPADVPRVPIS--PNKQRDLLFGVMV-----------GLVAAIGMAFLF
A0A7C2EFE5      SFQSSNI-RIADPARPSLEPVS--PNLALNLTLAVLL-----------ATVFGIGVAVVS
A0A2V9G1P7      SLKASNI-RLVDSAQPPAKPVK--PKILLNLAVAMFL-----------GLGLGIGTALFQ
A0A2V9BCK9      --RMSRIHEALKRAEQERAPIQ--SANEAKPSDSLLAEGAHRDGGEWSALGMVSPVGPGI
A0A2V9TMX2      GLRSSNI-RIVDIARVPTQPIS--PNVHRSLVLGFLL-----------ALGLGVGLALVR
A0A7C4DQP8      GIKSSNI-RVVDRATPPRRPAK--PNLLLNLLLGTAF-----------GLGLGIGAALLA
A0A2V8N2J7      QSEGGIAFAVVEPAGLPRAPFS--PQRVRLVALGVVA-----------GLGLGLALIFVL
A0A3N6BI26      GMRASNI-HVVDHAEVPEAPYS--PQRAADLALGLGV-----------GLFLAIGLAFLM
A0A2V9JMM3      QKGQSLVFKVVEPASVPSAPSS--PKRERILLLGFVG-----------SLGLGVVLAFLV
A0A2V9M815      QKGQSLVFKVVEPASVPSAPSS--PKRERILLLGFVG-----------SLGLGVVLAFLV
A0A2V9A795      SLKASNI-RIVDSAEPPAKPAK--PRIPLNLAVAALL-----------GLGLGISTAFLQ
A0A355ESH9      DTRESNV-RIIDHALVPDGPFR--PSLRKDLTYGLLI-----------GLLFGIGVALFL
A0A3D0NW85      QGSDNNI-RVAQYAIPPKNPVS--PSRTTTVLAALLL-----------STLFGMGLALFL
A0A353CAT5      QGTDNNI-RVAAFAIPPDTPVA--PRRLTTVLAALFL-----------STLFGMGLALFL
A0A2V9HB55      GLRSSNI-RVVDPAMIPSTPAR--PAKTRNLALAFLV-----------GLVGGIGLALLR
A0A2V8CU57      --PFAVA-GWSEPESATAPPAV--AAWSEAVTAPFAV------------VASSEPETVTA
A0A2V8BDI4      --PFAVA-GWSEPESATAPPAV--AAWSEAVTAPFAV------------VASSEKETVTA
A0A2V8F8T3      --PFAVA-GWSEPESATAPPAV--AAWSEAVTAPFAV------------VASSEPETVTA
A0A2W0B5E2      ------------------------------------------------------------
A0A2V8NMG8      ------------------------------------------------------------
A0A2V8TBM7      ------------------------------------------------------------
A0A1Q7HEZ8      ------------------------------------------------------------
A0A1Q7JW36      ------------------------------------------------------------
A0A1Q7MUR4      ------------------------------------------------------------
A0A3N5PFU4      ------------------------------------------------------------
A0A3M1SNQ5      LGDIKIGAPTSSEPEIASNDSP--------------------------------------
A0A7C2C0C1      LGDIKIGAPSSSEPEIASNDNP--------------------------------------
A0A4R1LDF1      TLQGGVNGRTKLASSYLPTGGA--------------------------------------
A0A1F2T1R8      ------------------------------------------------------------
A0A2V9BW09      ------------------------------------------------------------
A0A3M1SSE1      GLAFFLEYLDDTIKTAEDVENY--------------------------------------
A0A2V9GQV7      ------------------------------------------------------------
A0A7C5AUB2      ------------------------------------------------------------
A0A2V8YCY6      ------------------------------------------------------------
A0A2V8EGM3      ------------------------------------------------------------
A0A2V8FGH1      AGPPEPVAQGPVRDGALDEPSS--------------------------------------
A0A2V7YV88      ------------------------------------------------------------
A0A2V8D468      -----------IPFSPNKTLTL--------------------------------------
A0A1F2R977      -------DSSLDHYPAEHHSVP--------------------------------------
A0A2U3LF12      ------------------------------------------------------------
A0A7C5MF19      ----------------PEPTPA--------------------------------------
A0A3N5G7M6      ------------------------------------------------------------
A0A1F2S3Q7      ------------------------------------------------------------
A0A2V8GVG4      ------------------------------------------------------------
A0A2V8PJQ0      -----VDRYIHLPTLALIPAAR--------------------------------------
A0A2V8H566      --------AAVTSPFVRVEPPP--------------------------------------
A0A2V8UVN4      DKILRETTGERRPADASDGAAE--------------------------------------
A0A1Q7RB73      ------------------------------------------------------------
A0A2V9K0H7      --------------------GK--------------------------------------
A0A321LXF5      -------SRLREGLETHSRPSS--------------------------------------
A0A5M8SBZ0      --------------PFNTSALL--------------------------------------
A0A1Q7JFB1      ------------------------------------------------------------
A0A2V9LS17      -----AEAGTAVPEKLPQSATG--------------------------------------
A0A7C2YLF6      RPVESMVPAVET------------------------------------------------
A0A2V7X0V9      -----VGAESPVMPDMASHRVP--------------------------------------
A0A2V9X518      -----AVEAAGMPPVIERAPLS--------------------------------------
A0A2V9VC62      EPLPGMAEAADATRTAPTAPIP--------------------------------------
A0A2V9S1P8      -----VAEPLAATP---PAPQG--------------------------------------
A0A2V9RTW2      -----LSDTPTEAQVVASPSTG--------------------------------------
A0A2V9TGF1      -----LSDTPTEAQVVASPSTG--------------------------------------
A0A2V9XEV6      -----AVEAAGMPPVIERAPLS--------------------------------------
A0A2V9Y3Q6      -----VMDPIQASTVVEHPPVA--------------------------------------
A0A2V9R269      -----LETPEMPAGAVAGAVGR--------------------------------------
A0A2V9PTS3      -----LEAPPETTPFLRSEPTE--------------------------------------
A0A2V9NPF4      -----LEAPLETTPFLRSEPTE--------------------------------------
A0A2V9PNZ0      -----LEAPLETTPFLRSEPTE--------------------------------------
A0A2V9AGR3      -----ALSSSPVAPRN-GKLF---------------------------------------
A0A2V9G0N7      -----ISRFAQARNEV-GT-----------------------------------------
A0A2V9GQ44      -----ISRFAQARNEV-GT-----------------------------------------
A0A2V9HRN3      -----ISRFAQARNEV-GT-----------------------------------------
A0A2V8WG13      -----LESPFGNKMQA-GEPAV--------------------------------------
A0A2V8X987      -----IHRPVTVEPVV-AVLAE--------------------------------------
A0A1Q7KX94      -----LRRPITQGPGI-AQPTA--------------------------------------
A0A2V8XHT0      -----LRRPITQGPGI-AQPTA--------------------------------------
A0A2V8DMJ9      GRMLTDVESLIEAP----------------------------------------------
A0A2V8GGF6      GRALTDPGEIPAAPPMERDAVL--------------------------------------
A0A2V8HKU7      GRALTDPGEIPAAPPMERDAVL--------------------------------------
A0A1Q6Y875      ------------------------------------------------------------
A0A523DJA9      AVAIGLLFAVGLLFVVEYLDDT--------------------------------------
A0A2V8I604      ALAAPAPMARPIVEPPAPPPPI--------------------------------------
A0A2V8J066      AAPPPTPVHRPIVE---PTPIA--------------------------------------
A0A1I6MMC5      EVSQATTVPLPVRERDYAELSA--------------------------------------
A0A2V9D5W7      DSTRPIESESKDAPPS---GIG--------------------------------------
A0A2V9D4I4      DAEPAPERELKTVASASANGAV--------------------------------------
A0A2V9D6L7      DVELAPER--KSVAPASVIGCV--------------------------------------
A0A2V8ZJV2      D--VRSELEL-LRRGPECTGPA--------------------------------------
A0A2V9AWB5      DGEVRSEPESPLTQGIDLLPPV--------------------------------------
A0A2V8Z1Y8      V--LGEIRRS-VPGPLETEVPR--------------------------------------
A0A1Q8AX10      S--LLAEGAH-RDGGEWSALGM--------------------------------------
A0A2V9A773      --------GF-GDDGIAVAAGA--------------------------------------
A0A2V9AND3      --------RF-G--GERLAPGV--------------------------------------
A0A2V9BTJ7      E--VA-DVPR-TAVPLRELDEP--------------------------------------
A0A2V8W2M7      A--IAGSMQA-PAVPARQVAEQ--------------------------------------
A0A2V8XNW2      A--IAGSMQA-PAVPARQVAEQ--------------------------------------
A0A1Q7CJC1      ------------------------------------------------------------
A0A2V9UEM7      PVGMPEHAHMQTAVMP--------------------------------------------
A0A7C4DTF2      STAVPFERATPAAEAP--------------------------------------------
A0A1Q7V300      MVADQVVLEAIASSEN-----V--------------------------------------
A0A2V9ZCI3      PVMDPASVATGVAAAP--------------------------------------------
A0A2V9WCB3      MSEQPVFADTPPVPAMP-------------------------------------------
A0A2V9VQW5      LPATESVPAMPETAQASKAAAP--------------------------------------
A0A2V9WTP3      PVTEPRVIDADTAARVAAVAPA--------------------------------------
A0A2V9NLA9      VVPDP--ISMPVAAVPPLADER--------------------------------------
A0A2V9RKJ9      VVPDP--VSMPVAAVPPLADER--------------------------------------
A0A2V9RN95      ------------------------------------------------------------
A0A2V9N406      MVNES--AATAVAPAV-----E--------------------------------------
A0A2V9U6D9      MVNDP--AATAVAPAV-----E--------------------------------------
A0A2V8DZN4      ------------------------------------------------------------
A0A3N5YKY1      GASAVPPAAAFPGAAGPTAAPA--------------------------------------
A0A2G6HQA4      TSFNPPPVHDREPEKREDSLPG--------------------------------------
A0A2V7ZTY7      GQRPPDRTSAGQRPPDSAKAKR--------------------------------------
A0A2V7ZVL9      GKRPPDRTSAGQRPPDSAKAKR--------------------------------------
A0A1Q7QYI4      --------------PEADPKAE--------------------------------------
A0A2V8G9Y9      --------------PTSDSRVL--------------------------------------
A0A143PNR5      EFAEGTSARARS--GRPDARPE--------------------------------------
A0A6A7L078      VFPSDELGRAAPFEGSTPSSVE--------------------------------------
A0A143PXU3      WQFADSPAAPPRASHPPEQRPT--------------------------------------
A0A2V8D8G9      ----------QYPNEEPDRHPL--------------------------------------
A0A2V8ESQ4      ----------QYPNEEPDRHPL--------------------------------------
A0A1E3Y5Q0      AAPAPVEAFSSEGAERPRPRPV--------------------------------------
A0A2W4TWK5      AEPGQR----PEPSERPVRHAR--------------------------------------
A0A3N5NYV3      KLA--V----AEATAKLESAVQ--------------------------------------
A0A2V2RJF9      ------------------------------------------------------------
A0A2G6HNT3      ------------------------------------------------------------
A0A2V7YWD4      ------------------------------------------------------------
A0A2V2R8T6      ------------------------------------------------------------
A0A1Q7RGF1      ------------------------------------------------------------
A0A2V9BLX2      ------------------------------------------------------------
A0A2V9ZA03      ------------------------------------------------------------
A0A3N5ZNH4      ------------------------------------------------------------
A0A2V8GEZ2      ------------------------------------------------------------
A0A3N5ZFD3      ------------------------------------------------------------
G8NXD3          ------------------------------------------------------------
A0A2V9VR38      ------------------------------------------------------------
A0A2V9EY04      ------------------------------------------------------------
A0A2V9HAK9      ------------------------------------------------------------
A0A1Q7FS15      ------------------------------------------------------------
A0A1Q7K9P1      ------------------------------------------------------------
A0A1Q7N989      ------------------------------------------------------------
A0A2V9G7Y0      ------------------------------------------------------------
A0A2V8T7Z1      ------------------------------------------------------------
A0A2V7U8G5      ------------------------------------------------------------
A0A2V7UNP9      ------------------------------------------------------------
A0A2V7VLD7      ------------------------------------------------------------
A0A2V7XGA3      ------------------------------------------------------------
A0A2V7YAG6      ------------------------------------------------------------
A0A2V7VK33      ------------------------------------------------------------
A0A7C5EWK9      ------------------------------------------------------------
A0A3M1VTE1      ------------------------------------------------------------
A0A2V7TTM7      ------------------------------------------------------------
A0A2V8VI82      ------------------------------------------------------------
A0A2V7U4P9      ------------------------------------------------------------
A0A2V7TQY5      ------------------------------------------------------------
A0A2V7TU87      ------------------------------------------------------------
A0A2V8SEH0      ------------------------------------------------------------
A0A2V8VU54      ------------------------------------------------------------
A0A1Q7RML7      ------------------------------------------------------------
A0A1Q7ZIQ5      ------------------------------------------------------------
A0A2V8TKD8      ------------------------------------------------------------
                                                                            

A0A1F2U8T6      ESLLQRTNELRVSSNSRANNVRLVERGEVPGSPVTPSGRRTWGLSVVVGLFAAIAVAYGL
A0A2V8BV42      ESLLQREKELRVSSNSRQNNVRIVDKAEVPQSPMTAGGRRTWMMSSLVGLVLAIGVAFGL
A0A2V8F916      ESLLQREKELRVSSNSRQNNVRIVDKAEVPQSPMTAGGRRTWMMSSLVGLVLAIGVAFGL
A0A1Q7K833      QALMTREKELRVSSNSRQNNVRVVDHAEVPRGPLAPTGRRTWLLSLAVGLVLAVGVAYGL
A0A1Q8AMY4      QALMTREKELRVSSNSRQNNVRVVDHAEVPRGPLAPTGRRTWLLSLAVGLVLAVGVAYGL
A0A2V8BM40      STLLTRERELRVSSNSRQNNVRVIDHAEAPGGAMSPSGRRTWLLALGIGLALGIGLAYGL
A0A2V8CRT6      STLLTRERELRVSSNSRQNNVRVIDHAEAPGGAMSPSGRRTWLLALGIGLALGIGLAYGL
A0A1F2VH76      NSLLTREKELRVVANSRTNNIRLVDRAQVPGSPSSPNHRQDWIYALAFGLVFALGAAFGI
A0A1F2R0X5      EALLQREKELRVASNSRANNVRLVDRAEVPGSPVTPGGRRTWLLSIVVGLVLAVGVAMGL
A0A2V8B278      DALLTRERELRVASNSRANNVRVVDRAEVPKAPLAPTGRRTWLLSLAVGLTLAIAVAYGL
A0A2V8CEF9      DALLTRERELRVASNSRANNVRVVDRAEVPKAPLAPTGRRTWLLSLAVGLTLAIAVAYGL
A0A2V8KZG2      ------------------------------------------------------------
A0A2V8TKR9      ------------------------------------------------------------
A0A1Q7LG57      --------LGVIPFDQGGLAGQI----------AGRLHSHRP------------------
A0A2V8MKQ7      ------------------------------------------------------------
A0A1Q7L5B1      --------AGHGNRHEWLNRRVP-------------------------------------
A0A2V9DKV4      --------RTVGSRPYFQGRRNQ-------------------------------------
A0A2V9EVA0      --------SSFAPSEPSPRPSLT-------------------------------------
A0A7C5ZU39      --------TSASHEANHNDLENF---------THVTR-----------------------
A0A3N5YN96      --------AAAFPGAAGPTAAPA---------SPATAPASFPGNGGHQPLPIVVPNPVLA
A0A1Q7Y646      --------DVIASRAAGATLDAA---------GSARAIEFVS------------------
A0A2V8QZU0      --------AA-ASRAAGATLGAD---------GSARTPEFVT------------------
A0A2V8RSQ9      --------GGVAARVAGATVDAV---------GSTRDATYTS------------------
A0A2V9L2P7      --------LAIVPDVSS---------------SVTRSGLFAK------------------
A0A2V7UMX0      --------EVHGPQALGSREPAGRER------STDPAVPQAR------------------
A0A136K497      --------DVETGLTAGAKPNADTLTR-----SARRPLPDCV------------------
A0A399W9E4      --------DVETGLTAGAKPNADTLTR-----SHRRPLPDCV------------------
A0A321LMC5      --------PASSRREARASAAASNLRVGEFARNNQGFVEPRQ------------------
A0A2V8X713      --------G--DVAEPSPLGTLY---------PQMPGGAPTP------------------
A0A2V8ZLE9      --------GNVNTAVAREALHSP---------TPTPKGIPTV------------------
A0A2V8Y4D3      --------GGEGGSASAVSRALY---------SPKWGEIPAP------------------
A0A2V8Z2X8      --------G--AGGVAGAHRILS---------SPIRAEMPMA------------------
A0A2V9C3F6      --------G--ESEVAAASGVLH---------SPRRGEMPAT------------------
A0A2V9QMU9      --------LGIIPDGSKLSIESS---------ARRRLSLTSS------------------
A0A2V9QY75      --------LGMIPLGSKIGAEAG---------AKQGLVVASS------------------
A0A2V9SVU9      --------LGLIPLGLKAGVEMS---------MKQRLSVASS------------------
A0A2V8W5N5      --------PAAETRARTETIPAP---------SRSAPELRFD------------------
A0A2V8XG53      --------PAAETRARTETIPAP---------PRSAPELRFD------------------
A0A6A7LB89      --------VSRMNRSATTIRPSV---------TPRRRHELLA------------------
A0A352EZH8      --------AGQSSGAVGATLDAA---------RPAR-VSGLV------------------
A0A0B6X033      --------NGWASRVAGATVDAE---------RSAR-VASFP------------------
A0A2V8R0I3      --------GGPASRDAGATLGAV---------GSAR-AARFR------------------
A0A2V8N1U8      --------GGPASRDAGATLGAV---------SSTR-AAEFQ------------------
A0A2V8QL35      --------AGTASRDAGATLGAV---------GSAR-AIEFS------------------
A0A352FU10      --------AGTASRDAGATLGAV---------GSAR-AVEFS------------------
A0A2V8LCU0      --------GGPAFRDAGATLGAV---------GSAR-AAEFS------------------
A0A1Q7NGT0      --------GGPASRDAGATLGAV---------GSAR-AAEFS------------------
A0A2V8MLP9      --------GGPASRDAGATLGAV---------GSAR-AAEFS------------------
A0A2V8PQZ0      --------GGPASRDAGATLGAV---------GSAR-AAEFS------------------
A0A3B9MKY6      --------GGKASRDAGATLGAA---------GAAR-VDGFA------------------
A0A3D5SKZ1      --------GGKASRDAGATLGAA---------GAAR-VDGFA------------------
A0A2V8NRW2      --------GVTASRAAGATLDAA---------GTARALPEFM------------------
A0A2V9XV04      --------RVPSSYATTPVADVP---------GYDDIEVNRV------------------
A0A2V9CBY1      --------PVHNGKTASRIPEIL---------SAVTAEVAPP------------------
A0A2V9D656      --------PVHNGKAASRIPEIL---------SAVRPEGAPP------------------
A0A7C2L7W9      -------------PVLGLVPALE---------SLERRRWAAL------------------
A0A7C2XG00      --------------------------------SLERRGWAAL------------------
A0A2V9J901      ------------------------------------------------------------
A0A2V8QJ59      ------------------------------------------------------------
A0A1Q7HTA7      ------------------------------------------------------------
A0A2V8YMQ4      CWI-----IQSFLGPGRMERRVTLARAGTALIK---------------------------
A0A2V8W380      ERM-----DDTLKGDDDVERLLGLPSLALIPVV-------------------------AP
A0A2V8ZIV5      ERL-----DDTLKGADDVERLFGLPALALIPSV-------------------------HH
A0A7C2M3P5      EHF-----DNSLKTSEDVERFLHLPVLALIPSL-------------------------ES
A0A2V8LBV1      ARV-----DRTIQSPGEAPTYLKVRELGVILSA-----------EADSTLGRPGRSKHIP
A0A2V8GAF9      --------DQTATSSESARRADAAARLREFVRA---------------------------
A0A7C5I7P7      ERA-----DRTLQQPGDLTLYLNLPELGVIPSG---------------------------
A0A2V8CN98      DRF-----DPRVRYPAQVTTDMGLRILGALPHV---------------------------
A0A1Q7LC46      EYL-----DNTVKTPDDIESLARLPSLAVVPQF---------------------------
A0A1Q8BDC5      --------PGALTRRDALVRTSEFPLEELVPVVSNAT-----------------------
A0A2V9Q1Y8      EGI-----DNTVRTPEQAQLISGLPSLGMIPLG---------------------------
A0A2V8JXG1      ERF-----DDSIRSVDDVNRYTQLPALAVIPAI---------------------------
A0A350D2W9      EYL-----DNTVKSAEEVGRYTGLPTLGVVPVFGDDSNRAYGYYYSYGQKKGEEKGKGGK
A0A2V9I4J1      --------QDDTKGSAAVGGQSRFPFEHLIPEISNAV-----------------------
A0A2V8PQZ9      --------AGATLGAVGSARAAEFSSREVLAAR---------------------------
A0A2V8D8B1      EYA-----DNRIKSPNEIKAHLGLPFLGMIPSLTDQ------------------------
A0A3B9LSB4      EYF-----DDTLRSSEEVERLLQLPALGVIPSA---------------------------
A0A2V9H7U2      EAL-----DSSIKSIEEAERVVNAPALAVVPLE---------------------------
A0A2V8NJB5      KSE-----NEFLSEHVAIVKRSGFPFDGLIPVISNAV-----------------------
A0A2V9JMZ4      --------QDDTKGSAAVGGQSRFPFEHLIPEISNAV-----------------------
A0A2V9MDJ6      --------QDDTKGSAAVGGQSRFPFEHLIPEISNAV-----------------------
A0A2V8QJT6      EYL-----DDTVHSTDDVERFLRLPALAVIPAM-----------------------SSAS
A0A2V8FSM8      ERA-----DRTLQDPGDVSYYLGVPELGVVPVG---------------------------
A0A359M0J2      ERVYRKRQERRFAAPGNSGRLLNVPELGVIPSN----------------AAPERFGKQFF
A0A2V8JLJ1      EFT-----DSSLHTEDELAAAIKLPILASIPTV---------------------------
A0A5M8SND8      SAA-----NRTFHSPGQSAVQVQLRELGVIPRH---------------------------
A0A2V9GAQ1      EYL-----DNTVKTPDDVETHSRLPSLAVVPQF---------------------------
A0A497EDQ8      DFL-----DHTLRTPDQVERYLGLEVLAALPKL---------------------------
G8NS05          ESL-----DTNLHSVAEIEAVSGLHSLALIPRARRTGIDTSNLSV---------------
A0A2V8KZ20      EFT-----DSSLHTEDELAAAIKLPILASIPTV---------------------------
A0A3D0NWU2      DYL-----DDSVKNSEEIGRQLGLPTLALIPHY-----------------------FGSE
A0A2V8EPD9      RPA-----GAKRAPAWSREASIEKPIVHAAPT----------------------------
A0A3N5NSX5      DYL-----DDTVKTPEDITRRLKLPFLGLVPAVK--------------------------
A0A2V8MUA1      ELL-----DSTLSDEDTAASELKLPVLACVPNI-----------------------PAGR
A0A2V8MBH9      EYL-----DDSIHSTDDVEKFLRLPALAVIPSM-----------------------SGGV
A0A3N5ZPQ7      REE-----ETEEERSVALTVRERLPLEQLVPEAADAL-----------------------
A0A3N5P5F2      EYL-----DNKIKSPPEIRTYLNLPCLGLVPRIAGKH-----------------------
A0A7C2EFE5      DAL-----DTSVRDPEQLRRMTNAEVIGSLPEV-----------------------KGWR
A0A2V9G1P7      ERM-----DNTLKGDDDVERLFGLPSLALIPVVPPSDSDQHGIHRFLPRDKAFEFKGNGA
A0A2V9BCK9      ESP-----NSHHLRLDELRRRCATPGWKLNPDY---------------------------
A0A2V9TMX2      ETF-----DSTVRSMEEVRAVSTLPALGTIPLQLVT--------------------DERF
A0A7C4DQP8      EHV-----DSSIKSSEEIERYLQIPTLAFIPAEDSLVGRRGAVYG-----------RRPQ
A0A2V8N2J7      EQN-----DTTFGNVDDFESFSTLPVAGIVPNIQNRNKKR--------------------
A0A3N6BI26      EYL-----DNTLKTPEDMEQSLGLPSLGVIPAMA----------------------DLPA
A0A2V9JMM3      EQL-----DTSFDSADDFKTFTNLPLLAVIPSVR----------------------SKSR
A0A2V9M815      EQL-----DTSFDSADDFKTFTNLPLLAVIPSVR----------------------SKSR
A0A2V9A795      ERL-----DDTLKGADDVERVFGLSALALIPSVHHLNGDRPSV-------------SSLL
A0A355ESH9      EFL-----DRTVKSPEEVERRFSIATLAVIQDIAETGKAYGSPAYGYGYGYGYGYGDPPT
A0A3D0NW85      EYL-----DDTIGTTEEIESYLQLPALAAIPSI------------------------DSM
A0A353CAT5      EYL-----DDTIRTTEEIENYLQLPALAAIPTI------------------------DSM
A0A2V9HB55      EYL-----DNTVKTPDDIETLARLPSLAVVPQFTGS--------------------NGHA
A0A2V8CU57      PFV-----VVAPSGPENVQ-----PPLPPLPTW-DF--------------------DGSV
A0A2V8BDI4      PFV-----VAAPSGPENVQ-----PPLPPLPTW-DF--------------------DGSV
A0A2V8F8T3      PFV-----VAAPSGPENVQ-----PPLPPLPTW-DF--------------------DGSV
A0A2W0B5E2      ------------------------------------------------------------
A0A2V8NMG8      ------------------------------------------------------------
A0A2V8TBM7      ------------------------------------------------------------
A0A1Q7HEZ8      ------------------------------------------------------------
A0A1Q7JW36      ------------------------------------------------------------
A0A1Q7MUR4      ------------------------------------------------------------
A0A3N5PFU4      ------------------------------------------------------------
A0A3M1SNQ5      --------ITFTQAETLVFPRVEIDPEIVHQR----------------------------
A0A7C2C0C1      --------ITFTQAETLVFPKLEIDPEIVHQR----------------------------
A0A4R1LDF1      --------SDLLYQPRHNHNLADVQSDIILAH----------------------------
A0A1F2T1R8      ------------------------------------------------------------
A0A2V9BW09      ------------------------------------------------------------
A0A3M1SSE1      --------LGLPVLVVIPSMNAAQKRRLLLVE----------------------------
A0A2V9GQV7      ----------------------NGNAARLVLR----------------------------
A0A7C5AUB2      ----------------------LPGLEDLLNN----------------------------
A0A2V8YCY6      ------------------------------------------------------------
A0A2V8EGM3      ------------------------------------------------------------
A0A2V8FGH1      --------TGLHVIWPSLLARFKNEWRDRLAI----------------------------
A0A2V7YV88      ----------------------------LTER----------------------------
A0A2V8D468      --------ELTFVVGLMFAVGLALFVEYLDDR----------------------------
A0A1F2R977      --------WTGEGREGNVEPPAPVRPEPAGRR----------------------------
A0A2U3LF12      ------------------------------------------------------------
A0A7C5MF19      --------QHAPTAEVEEAAPPPKPPEGLIPS----------------------------
A0A3N5G7M6      -----------------------SARPLLVDR----------------------------
A0A1F2S3Q7      -------------------MHSMATRDTLLVS----------------------------
A0A2V8GVG4      -------------------MAKKAQLDQHLVT----------------------------
A0A2V8PJQ0      --------SEKRLREGEAPTAGASTALAMVED----------------------------
A0A2V8H566      --------GSARFRHAGAGAAGRLREKLVVAR----------------------------
A0A2V8UVN4      --------DLPAAATAIDVAGLESARRAAAET----------------------------
A0A1Q7RB73      -----------------------------MER----------------------------
A0A2V9K0H7      --------GVAVLPPAELPSGAAELRVLLMER----------------------------
A0A321LXF5      --------SQVRQVLAPLEDANNIASQVVAAR----------------------------
A0A5M8SBZ0      --------QPQALGMPSMVESEKTHSDNAFSR----------------------------
A0A1Q7JFB1      ------------------------------------------------------------
A0A2V9LS17      --------IEPAALSELEEPGSDLTLEVLESQ----------------------------
A0A7C2YLF6      -----------------PLAAPALTFDLLQAR----------------------------
A0A2V7X0V9      --------DPVAVAAMMPAFGSPFSVDTMLAR----------------------------
A0A2V9X518      --------TAASAAAAGPAFSNAFTFDTLLAR----------------------------
A0A2V9VC62      --------GAPGNGQKVPSFATSFTFDTLLAR----------------------------
A0A2V9S1P8      --------TTASVGASIPSFGSPYTLDTLLAR----------------------------
A0A2V9RTW2      --------VAP------PSFAAPFTFDTLLAR----------------------------
A0A2V9TGF1      --------VAP------PSFAAPFTLDTLLAR----------------------------
A0A2V9XEV6      --------TAASAAAAGPAFSNAFTFDTLLAR----------------------------
A0A2V9Y3Q6      --------PSTGI----PPFSNPFTFDTLLAR----------------------------
A0A2V9R269      -----------------GIPGMATGMEALMTR----------------------------
A0A2V9PTS3      -----------------ARFASGGIAESLLAR----------------------------
A0A2V9NPF4      -----------------ARFASGGIAESLLAR----------------------------
A0A2V9PNZ0      -----------------ARFASGGIAESLAAR----------------------------
A0A2V9AGR3      ---------APTTGIRDVMAPP--SFEVLASR----------------------------
A0A2V9G0N7      ---------APKNGSGNAVKQPCVRFEQLLKR----------------------------
A0A2V9GQ44      ---------APKNGSGNAVKQPCVRFEQLLKR----------------------------
A0A2V9HRN3      ---------APKNGTSTAVKQPCVRFEQLLKR----------------------------
A0A2V8WG13      --------RSARVSEGSSF----LDFDDLLRR----------------------------
A0A2V8X987      ---------QPRATIGGGHTGS-MRYEEIVRR----------------------------
A0A1Q7KX94      ---------APRVPTGDNQDVP-FHYEELIKR----------------------------
A0A2V8XHT0      ---------APRVPTGDNQDVP-FHYEELIKR----------------------------
A0A2V8DMJ9      --------------HGLGLSQRPALCDVTADR----------------------------
A0A2V8GGF6      --------FSRAFRHGSG-------------R----------------------------
A0A2V8HKU7      --------FSRAFRHGSG-------------R----------------------------
A0A1Q6Y875      ----------------------------MRQR----------------------------
A0A523DJA9      --------IKTPDDVGRRLHLPMLGLVPVGPG----------------------------
A0A2V8I604      --------EPPAAPGWSAAAAVAPPVVQIDRR----------------------------
A0A2V8J066      --------ERREARARLAEQASPHREVNLDRH----------------------------
A0A1I6MMC5      --------GPGWPDVDVVASSVLNGLPSDPAK----------------------------
A0A2V9D5W7      --------SPRRVNILAPAATDPLELDDLRKR----------------------------
A0A2V9D4I4      --------TETQISTSAAPSPEPLRFEDLQRQ----------------------------
A0A2V9D6L7      ----------TPVSTSASTSAEPLEFDDLQRR----------------------------
A0A2V8ZJV2      --------VSARGTTSGNEN-TLLCFEELGKR----------------------------
A0A2V9AWB5      --------PSTRTEAVDSSTIASFSFEELNKR----------------------------
A0A2V8Z1Y8      --------PQAPPRIAGSREPAPSCFGELVKR----------------------------
A0A1Q8AX10      --------VSPVGPGIESPNSHHLRLDELRRR----------------------------
A0A2V9A773      --------MQSPRREEMPTAGRCLRLEELRQR----------------------------
A0A2V9AND3      --------LQPSLQQEMPTARRCLGLEELRRR----------------------------
A0A2V9BTJ7      --------TS--PERSPAKGGSFLRYEDLIKG----------------------------
A0A2V8W2M7      --------PARVTPPPPSEAGAFLRFDDLVKR----------------------------
A0A2V8XNW2      --------PARVTPPPPSEAGAFLRFDDLVKR----------------------------
A0A1Q7CJC1      ------------------------------------------------------------
A0A2V9UEM7      -----------------PIQGSSFSYESLLAR----------------------------
A0A7C4DTF2      -----------------ATEPAPLTLETLLER----------------------------
A0A1Q7V300      --------VPARSAISASAAVAATTSDILVAR----------------------------
A0A2V9ZCI3      -------------GPATPAFSSQFTFDTLLAR----------------------------
A0A2V9WCB3      ----------ASMGLGMPTFGGGLNMDTLLAR----------------------------
A0A2V9VQW5      --------GTPGNGQGTPSFTTSFTFDTLLAR----------------------------
A0A2V9WTP3      --------VSAHASPGLPPFGSPFSLETMLAR----------------------------
A0A2V9NLA9      --------DRRTVSAAMPSFGTGLSVESLLSR----------------------------
A0A2V9RKJ9      --------DRRTVSAAMPSFGTGLSVESLLSR----------------------------
A0A2V9RN95      ----------------MPSFASPFTFDALLAR----------------------------
A0A2V9N406      --------HTPSAVSAVPSFSSPFTFDTLLAS----------------------------
A0A2V9U6D9      --------HTPSAVSAMPSFSSPFTFDTLLAR----------------------------
A0A2V8DZN4      --------MRSPAAALTGASAPAAPGLSVAHR----------------------------
A0A3N5YKY1      --------SPAAAPASFPGNGGHQPLPIVVPN----------------------------
A0A2G6HQA4      --------KKRRPEPSFSTRRNSSPVHQRKPE----------------------------
A0A2V7ZTY7      --------VEQALAAITAPAPDAAPARVTPDG----------------------------
A0A2V7ZVL9      --------VEQALAAIMAPAPDAAPARVTPDG----------------------------
A0A1Q7QYI4      --------RMSRALAALADTPPPVSTASSPTN----------------------------
A0A2V8G9Y9      --------SQPAG-EPLTRVPDTLSVQRADQDW-------------------------VA
A0A143PNR5      --------TPNALIPEESGVPDEVTLPPASSA----------------------------
A0A6A7L078      --------ARSETATNPSSVAH-VPRRPSTDP----------------------------
A0A143PXU3      --------SAPARVPEVARVDVKPLPEQVQRS----------------------------
A0A2V8D8G9      --------EEPASPDSFESAQPFRP--ASTSR----------------------------
A0A2V8ESQ4      --------EEPASPDSFESAQPFRP--ASTSR----------------------------
A0A1E3Y5Q0      --------TTVPEILPSRPPASGAPSSPVGER----------------------------
A0A2W4TWK5      --------PAMDAPVVDDEPEPALP--PLEGR----------------------------
A0A3N5NYV3      --------AEAASVATEAESEATAP--RVTSS----------------------------
A0A2V2RJF9      ------------------------------------------------------------
A0A2G6HNT3      ----------------------------MEKFSKIMEKAGVETSYKLHNKEKESFRPKKR
A0A2V7YWD4      ------------------------------------------------------------
A0A2V2R8T6      ------------------------------------------------------------
A0A1Q7RGF1      -------------------------MSKYFDQTFKTRDAGTDPEKLQITGIDKFLETGSS
A0A2V9BLX2      -------------------------MSKYFDQTFKTRDAGTDPEKLQITGIDKFLETGSS
A0A2V9ZA03      ----------------------------------------------------MMKDLGLT
A0A3N5ZNH4      ------------------------------------------------------------
A0A2V8GEZ2      ---------------------------------------------------MHDFASSVE
A0A3N5ZFD3      --------------------------------------------------MAEALSASPA
G8NXD3          ----------------------------MITLNLREYQTIEPHLMIASASNGDAGSPHKH
A0A2V9VR38      ------------------------------------------------------------
A0A2V9EY04      -------------------------------MSKFFNETQKANQWAQSKLPEPDRDVREM
A0A2V9HAK9      ------------------------------------------------------------
A0A1Q7FS15      -------------------------------MSKFFNETQKANQWTQQKLANQDMDVKEM
A0A1Q7K9P1      -------------------------------MSKFFNETQKANQWTQQKLANQDMDVKEM
A0A1Q7N989      -------------------------------MSKFFNETQKANQWTQQKLANQDMDVKEM
A0A2V9G7Y0      -------------------------------MSKFFNETQKAHQWAQQKLVNQDLDVRQI
A0A2V8T7Z1      ------------------------------------------------------------
A0A2V7U8G5      ------------------------------------MPMARSR-GPRPVSLD--FELHRL
A0A2V7UNP9      ----------------------------------------MRT-NSRPVSMSQYLELERR
A0A2V7VLD7      ----------------------------------------MRT-NSRPVSMSQYLELERR
A0A2V7XGA3      ------------------------------------MTTPTTLGDPASLSAVRTSEPSPR
A0A2V7YAG6      -----------------------MAWLPPWRQAGPDMSMPTTL-DPAPMGAARAPEDSRR
A0A2V7VK33      -----------------------------------------------------------M
A0A7C5EWK9      ------------------MSKIFRAFEKAWEHRHASPLAVIQQEPAEESTATPANGRSVA
A0A3M1VTE1      ---------------------------------------------MTAGGSGRGADRGSP
A0A2V7TTM7      --------------------------------------MYRVGNPLLKSRSLVPASEDDD
A0A2V8VI82      --------------------------------------MREAETGSGAGTQPDAGQPTRT
A0A2V7U4P9      --------------------------------------MSIKPPEEMLSSAVPAGEKGGP
A0A2V7TQY5      ------------------------------------------------MRARRGRGPPGA
A0A2V7TU87      ------------------------------------------------------------
A0A2V8SEH0      -----------------------------------------------MNATLTPRQPEGS
A0A2V8VU54      ------------------------------------------------MSGYIDAKPDGS
A0A1Q7RML7      ------------------------------------------------MSAFSGGDRDHT
A0A1Q7ZIQ5      ------------------------------------------------MSAFSGGDRDHT
A0A2V8TKD8      ------------------------------------------------MSAFSGGDRDHT
                                                                            

A0A1F2U8T6      DYMNDTVKTPEDVTRFLKMTFLGLVPSVRGDK-HPLMASWDTPKHFGEAFRNL-RTA-II
A0A2V8BV42      DYMNDTIKTPEDVTRRLKLPFLGLVPSVRGDK-HPLLTSAHVPHDFGEAFRAL-RTS-LI
A0A2V8F916      DYMNDTIKTPEDVTRRLKLPFLGLVPSVRGDK-HPLLTSAHVPHDFGEAFRAL-RTS-LI
A0A1Q7K833      DYMNDTIKTPEDVARRLKLPFLGLVPSVRGDK-HPVLASSHVPHDFGESFRAL-RTS-LM
A0A1Q8AMY4      DYMNDTIKTPEDVARRLKLPFLGLVPSVRGDK-HPVLASSHVPHDFGESFRAL-RTS-LM
A0A2V8BM40      DYMNDTIKTPEDIARRLRLPFLGLVPSVRGDA-HPVLASSNVPHNFGESFRAL-RTS-LT
A0A2V8CRT6      DYMNDTIKTPEDIARRLRLPFLGLVPSVRGDA-HPVLASSNVPHNFGESFRAL-RTS-LT
A0A1F2VH76      DYLDDTVKTPEDITRRLKLRFLGLVPAVRGDR-HPLLSGP-VPHDFGEAFRTL-RTA-LV
A0A1F2R0X5      DYMNDTIKTPEDVTKRLRLPFLGLVPSVRGAKQQPLLTSSHAPVDFSESFRSL-RTT-LL
A0A2V8B278      DYMNDTIKTPEEVTRRLRLPFLGLVPSVRGDK-HPLLASSHVPHDFGESFRAL-RTA-LV
A0A2V8CEF9      DYMNDTIKTPEEVTRRLRLPFLGLVPSVRGDK-HPLLASSHVPHDFGESFRAL-RTA-LI
A0A2V8KZG2      ------------------------------------------------------------
A0A2V8TKR9      ---------------------------------------------------ML-------
A0A1Q7LG57      -TRTLTSDTAPDS----------------SANWPELATWKRKPSFLAECARTT-LTS-IL
A0A2V8MKQ7      -------------------------------------MVGDARSPVAESYRHL-RTS-LL
A0A1Q7L5B1      -TSEERAAAVSDFLGLNDLWQRCRKPGWTLDPTYSAFSNSKSFTSCAEQFSKL-RTR-LY
A0A2V9DKV4      -T----------ILGLNDLWQRCRKPGWTLDPTYSAFSNSKSFTSCAEQFSKL-RTR-LY
A0A2V9EVA0      -SFAPGLNALRQR---------CAKPAWKLHKDSLVLFNEQSFDRCAEQFRIL-RAR-LY
A0A7C5ZU39      -THYLEESNINSR----------------------LVAITQPNSIYSEEYRRI-RNR-II
A0A3N5YN96      GGRRARSVTLHPL----------------------LAAALEFGSPAAEQFRAL-RTR-IG
A0A1Q7Y646      --RQISTARVEPH----------------------LVAITQPRSPYCEQFRSL-RTR-LL
A0A2V8QZU0      --LDISAARVEPH----------------------LIAITQPRSAHAERFRSL-RTR-VL
A0A2V8RSQ9      --IEVVTSRVEPH----------------------LVAITDPRSPHAEQYRSL-RTR-VL
A0A2V9L2P7      -RSEVKAKKAEMV---------------------ELSVLKNPGASISEAFRTL-RTS-IL
A0A2V7UMX0      -VAEIPWKKIDGR----------------------LVSLTAPTSPEAHQYRVL-GHQ-LE
A0A136K497      -SWTVDAERVEPR----------------------LVAITSPNSSYCEEYRSL-RTH-VL
A0A399W9E4      -SWTVDAERVEPR----------------------LVAITSPNSSYCEEYRSL-RTN-VL
A0A321LMC5      -SFSIHDLRVDQH----------------------LAGLIERDDLARERYNTL-AVR-LI
A0A2V8X713      -EFCLGLEELRGR---------CAKPGWKMNPDYDVFSAKQTSFPCAEQFRTL-RAR-LY
A0A2V8ZLE9      -GRGLRLEELRQR---------CIKPGWELNPDCDVFSTKQSSSLCAEQFRTL-RSH-LY
A0A2V8Y4D3      -GRRLRLEELRQR---------SSKPGWKLNPDYDAFSPQHSSALCAEQFRTL-RSR-LY
A0A2V8Z2X8      -GRCLGLEELRHR---------CIKPGWKLNPDYDVFSTKQSSALCAEQFRTL-RSR-LD
A0A2V9C3F6      -GRCLRLEELRQR---------CIKPGWRLNPDYDVFSTQQSSALCAEQFRTL-RSR-LY
A0A2V9QMU9      -REAIE-----------------------------LVTQSRPQSQMAEAYRAL-RTA-LL
A0A2V9QY75      -KEPVE-----------------------------LITQARPQSQMAESYRAL-RTS-LL
A0A2V9SVU9      -KEVVE-----------------------------LITQSRPQSQMAESYRAL-RTS-LL
A0A2V8W5N5      -SLVAHCTRREWQ----------------PEPGKNVFSNAAATACGAEQFRTL-RSR-LY
A0A2V8XG53      -SLVAHCTRREWQ----------------PEPGKNVFSNAAATACGAEQFRTL-RSR-LY
A0A6A7LB89      -TFRGVNPEIEER----------------------IVASGSVSAEGVEQYRQL-AAT-TH
A0A352EZH8      -SYDVDATRVEPH----------------------LVAITQPRSAYCEQFRSL-RTR-VL
A0A0B6X033      -ALDVSAARADQH----------------------LIAITQPQSPECEQFRSL-RTH-VL
A0A2V8R0I3      -SRDILAARVEPH----------------------LVAITQPRSPECEQFRAL-RTR-LL
A0A2V8N1U8      -SQDISAARVEPH----------------------LVAITSPRSPECEQFRSL-RTR-LL
A0A2V8QL35      -SREVSAARVEPH----------------------LVALTDPRSVACEQFRAL-RTQ-LL
A0A352FU10      -SREISTARVEPH----------------------LVAITDPRSPECEQFRAL-RTR-LL
A0A2V8LCU0      -SREISAARVEPH----------------------LVAVTSPHSPECEQFRAL-RTR-LL
A0A1Q7NGT0      -SREVLAARVEPH----------------------LLAITEPRSAECEQYRSL-RTR-LL
A0A2V8MLP9      -SREVLVARVEPH----------------------LLAITEPRSPECEQYRSL-RTR-LL
A0A2V8PQZ0      -SREVLVARVEPH----------------------LLAITEPRSPECEQYRSL-RTR-LL
A0A3B9MKY6      -TYDISPARVEPH----------------------LVAVSQPRSPYCEQFRSL-RTK-LL
A0A3D5SKZ1      -TYDISPARVEPH----------------------LVAVSQPRSPYCEQFRSL-RTK-LL
A0A2V8NRW2      -SLDISAARVEPH----------------------LIAVTQPRSAYCEQFRSL-RTR-VL
A0A2V9XV04      -PPSLGMPELGGPSSLEMLLGRCPQPGWNPDLQTMLFMNGNDSAKGTEEYRTL-RSR-LY
A0A2V9CBY1      -ARSLQLEELQQR---------CAKPGWKPQLRWNVFSNERSCKRQAEQFHTL-RAR-LY
A0A2V9D656      -ARLLQLEELQQR---------CAKPVWKPQLRWNVFPKERPCGRQAEQFHSL-RAR-LY
A0A7C2L7W9      -PRVHRAKEEERP----------------------ILISQRQRSSFAEAFRTL-RTS-VL
A0A7C2XG00      -PRVHRAKEEERP----------------------ILISQRQRSSFAEAFRTL-RTS-VL
A0A2V9J901      -----------------------------------MAPAIQTHAEVLEAFRSL-RTS-IL
A0A2V8QJ59      ------------------------------------------------------------
A0A1Q7HTA7      ------------------------------------------------------------
A0A2V8YMQ4      ------------------------------------------------------EDS-VL
A0A2V8W380      ANGNHLGIHRFLPRDKSLVLAGNGSGKNSRS-WHLIDRDGAQHAALGEAFRSL-RTS-VL
A0A2V8ZIV5      LNGDRSSVRKLLDSASTLRSSQNGTASTPGAYWHRIDQRGKPQAALVEAFRSL-RAS-VL
A0A7C2M3P5      LNGR----RRAYGLPTPKRLASRSVLPAAAPAWHLVSGNGEGSTKLGEAFRSL-RTS-VL
A0A2V8LBV1      SLQSLIQLGKPAGNGSFSKAVRKYAGENRAPKRVELMTWEKRSSLFAECFRTT-AAS-LL
A0A2V8GAF9      -------------------------NGERFQIAEQLVSLIAPGSFAADQYRAL-RHN-LE
A0A7C5I7P7      -------KTAITERLAGKGAAGLLPGKSGEADKLELVTWKRKPSLIAESFRAT-LTS-IL
A0A2V8CN98      -------------------------------KKRAGASDDESGALVIETMRGV-RLS-LI
A0A1Q7LC46      ----------TGLNGSKGRGVLPGLSSNGHERRIELVAQHLPKSQMSEAFRAL-RTS-IL
A0A1Q8BDC5      -------------------------------LAEKLQIARSEMSFTSEQFKNL-KVQ-LR
A0A2V9Q1Y8      -------------SRTAAEANPTGLSVAASKEAVELITISRPQSQMSESYRAL-RTS-LL
A0A2V8JXG1      GANNSLLNGRRRKDNAGELLALDSGDKPTAKMQRARLMEFDGRSPASEAYRAL-RTA-LL
A0A350D2W9      EDSGKP-------------------------KNIELIVHFAPESAFAENYRSL-RTA-LL
A0A2V9I4J1      -------------------------------LSEKLEVLKNEFSFVSEQFKAL-KVR-IN
A0A2V8PQZ9      -------------------------------VEPHLLAITEPRSAECEQYRSL-RTC-LL
A0A2V8D8B1      -------------------------------VEGTPLLDNGVNAGFAEAFRMV-RTN-LV
A0A3B9LSB4      ---------NASARRRLMGASGALQKRNGHSDSPELLMNVDGHSPLAEAYRHL-RTS-VL
A0A2V9H7U2      -----------REIPHRAARSLTRNNGTSKPGDAELALLKQPSSALAESFRTL-LTS-VV
A0A2V8NJB5      -------------------------------VSDKLEVLKNSSSFISEQFRNL-KVR-I-
A0A2V9JMZ4      -------------------------------LSEKLEVLKNEFSFVSEQFKAL-KVR-IN
A0A2V9MDJ6      -------------------------------LSEKLEVLKNEFSFVSEQFKAL-KVR-IN
A0A2V8QJT6      APRRLLSSATSLQKRNSSNG-----------ANPELLLNINGRSALAEAYRQL-RTS-VL
A0A2V8FSM8      EPIDLPRSGVRSPAAALTGASAPAAPGLSVAHRVELISFRQKTSLLAESFRTT-LTS-IL
A0A359M0J2      RIRVRRRKSKPLSLTGTGTAAPAAETPPSNPRLEFLEIWKGKPSIVAESFRLT-LTS-LT
A0A2V8JLJ1      DEKRTRKRKSASVLRLQEHKGGSGPSPLRHVDNKITDAILNPSCSAREHYRFL-HSQ-LL
A0A5M8SND8      ---SLSSNKAFARLLRSTDSGGEPALMAYRANQAELAGFAERSGMVAESFRML-LAS-IM
A0A2V9GAQ1      ---------TGSNGSGKHHGPLLGFSSNGHEKRMELVAHHLPKSQMSEAFRAL-RTS-IL
A0A497EDQ8      --------------------------------------TDDNSRALREAFQTL-RTA-LM
G8NS05          -------------------------------IQRNLATLSSPKSQFTEAFRGL-RTS-LL
A0A2V8KZ20      DEKRTRKRKSASVLRLQEHKGGSGHSPLRHVDNKITDAILNPSCSAREHYRFL-HSQ-LL
A0A3D0NWU2      KKRLRLAAENGGS------------------PGTSLVALEERHSPMAEAYRHL-RTS-LL
A0A2V8EPD9      ---------GSSLIAVPASADQLTLWRSDPETAGKLVGTDGFLPSAMEQYRKL-AAI-LH
A0A3N5NSX5      -------------------------------GNNHPLLSQEVPHEFGEAFRAL-RTS-LV
A0A2V8MUA1      KKRRERTNSKAGMVAVSVGHDSINKFSLDYADIRIKKVVLDPLTVSGEQFRVV-RAQ-LS
A0A2V8MBH9      ARRRRLLSSATALQKRNGNTS----------GTPELLLNVNGRSALAESYRQL-RTS-VL
A0A3N5ZPQ7      -------------------------------LSQQLETVTNEHSFASEQFASL-KVR-IK
A0A3N5P5F2      -------------------------------GSSPLLLNNGAPDSFAEAFRAV-RSN-VL
A0A7C2EFE5      GRPSSVRASEGAL------------------VATGSEETAHSVTLYEEAIRTL-RNS-VL
A0A2V9G1P7      GKNSHS-------------------------YWHRIDRDETQHASLVEAFRNL-RTS-VL
A0A2V9BCK9      -----------------------------------AVFCKQSLAVCAEQFRTL-RSR-LY
A0A2V9TMX2      RKRRLTISPDGERS-----------------GMLALVTYERPKSEAAEAYRAL-RTS-IL
A0A7C4DQP8      ISGSLLAGRRTQKPNGKPAPGLN--------LWLRIDRAETQHSVLAEAFAGL-RTS-VL
A0A2V8N2J7      -------------------------------TQPSVVTVEEPDSIAAEQYRIL-AMR-VQ
A0A3N6BI26      GSSRLLASRNESGDS----------------KTDLPAAISPARFRVWEAYRSL-RTS-IL
A0A2V9JMM3      SGRKLPEGGKGDPHLPQPNLRHL--------QKNRVVTVTDPGAIASEQYSIL-AMK-LR
A0A2V9M815      SGRKLPEGGKGDPHLPQPNLRHL--------QKNRVVTVTDPGAIASEQYSIL-AMK-LR
A0A2V9A795      GRTNLLRSGQNGTASNPAA------------RWHRIDQGQRPQPALIEAFRSL-RAS-VL
A0A355ESH9      GEPSRVRPTKGKAKVAGGGWLEKKKGTPGPQAQIELVPHERPRTLISESYRSL-RTA-LL
A0A3D0NW85      PKRKLLLVGGSDRPDEE--------TEP---LNSELLINADPRSSLAEAYRQL-RTS-IL
A0A353CAT5      PKRRLLLVGNAERPAE---------DDP---ANSELLIYADSRSSLAEAYRQL-RTS-IL
A0A2V9HB55      KKRGLLQGPAAN-------------GHE---MRIELAAQHLPKSQMSEAFRAL-RTS-IL
A0A2V8CU57      AAAELVEAPDEPKVVTPSDWKTYRFGAV---ASRKTIVDPDVESSLVEQYRRL-AAS-LH
A0A2V8BDI4      AAAELVEAPDEPKVVTPSDWKTYRFGAV---ASRKTIVDPDVESSLVEQYRRL-AAS-LH
A0A2V8F8T3      AAAELVEAPDEPKVVTPSDWKTYRFGAV---ASRKTIVDPDVESSLVEQYRRL-AAS-LH
A0A2W0B5E2      -------------------------------------MAAQATSEQSEAYRAL-RTS-VL
A0A2V8NMG8      -----------------------------------------------------------M
A0A2V8TBM7      ------------------------------------------------------RTS-LL
A0A1Q7HEZ8      ------------------------------------MSLKAPASFAAEQYQGL-RIT-IE
A0A1Q7JW36      ------------------------------------MSLKAPASFAAEQYQGL-RIT-IE
A0A1Q7MUR4      ------------------------------------MSLKAPASFAAEQYQGL-RIT-IE
A0A3N5PFU4      ----------------------------MNTFATQLVSLTNPASFAAEQYQNL-RLK-IE
A0A3M1SNQ5      -----------------------------------LISIKAPNSGYCEEYRNL-RTH-IL
A0A7C2C0C1      -----------------------------------LISIKAPNSGYCEEYRNL-RTH-IL
A0A4R1LDF1      ----------------------ALTQEQEKCVY-----------FPLERYRLL-STR-VL
A0A1F2T1R8      ------------------------------------VSLTEPASFAAEQYQGL-RLT-IE
A0A2V9BW09      ------------------VKRVRWPMDSEKRIV----AWADPHAIGAEKFRVL-RYR-LQ
A0A3M1SSE1      ------------------SSDNEPASKNRSELL---IYDNSRSSSLSEAYRQL-RTS-IL
A0A2V9GQV7      --------------------------------------EDGSLNAALEAYRGL-RTR-LM
A0A7C5AUB2      ------------------VQEIPYTPAPDFFVI----DPTRPRDAHSEEFRTL-RTK-LN
A0A2V8YCY6      ------------------------------------------------------------
A0A2V8EGM3      ----------------------------------------------SEQFRRL-AAT-LL
A0A2V8FGH1      --------------------------------------GIDVEPGLAEQFRRL-AAT-LL
A0A2V7YV88      ---------------LGLMTLAHIGFAPAGKGKRAELVALDGQSPASEAYKAL-RTN-LL
A0A2V8D468      --IKTPDEIWMHLGLKTLGLVPRVTPELVGTHS---LINNGAPPNLAEAFRAL-RTS-VM
A0A1F2R977      ------------------VQLGPFDPSIAGKLV-----TGSMRPVSQEEYRRL-AAV-LH
A0A2U3LF12      ------------------------------------TVLSDPQSIASQQYGIL-TLK-IQ
A0A7C5MF19      ------------------LRAVLLSLDGGTPLL----PFDGSDPVAAEQYKLA-RTK-IL
A0A3N5G7M6      ----------------------------------------EISTGFGEAFRAF-RTN-VR
A0A1F2S3Q7      --------------------------------------LTAPASFAAEQYQGL-RLA-VE
A0A2V8GVG4      --------------------------------------LTSPGSFAAEQYQGL-RLT-IE
A0A2V8PJQ0      -----------------------------------------VRSHVAESYRHL-RTS-LL
A0A2V8H566      ----------------------------------------NINQGVLEQYRKL-AAS-LH
A0A2V8UVN4      ----------VEAVPGIRTVALHLSVETPVLPF------DVRDGRAGEQYRTA-RTK-LL
A0A1Q7RB73      ------------------CSQSLWNPARNMMLF----FDRRNPVVGVEEFRTL-RSH-LT
A0A2V9K0H7      ------------------CSQSLWNPDRKMMLF----FDRRNPVVGVEEFRTL-RSH-LS
A0A321LXF5      ---------------LENCRSIRLPRDNEQLLL--VPQYNLPMQQAMEAYQTL-RTR-LV
A0A5M8SBZ0      ------------------VSRPDWQAANGNMLF---LQEESQVTPWAEQFRAI-RSR-LY
A0A1Q7JFB1      ------------------------------------MVTERPEQSTIEQYRKL-AAT-LH
A0A2V9LS17      ------------------VRRFKWNPNVKTMLF----FGEENYALGTEEFRTL-RSH-LF
A0A7C2YLF6      ------------------CRKVSWTPDARINLFGAVRGSDGRARSGTEEFRTL-RSR-LY
A0A2V7X0V9      ------------------CPQMEWKPDLGTMLF----MNGDDSKRGTEEFRTL-RSR-LY
A0A2V9X518      ------------------CAQSEWNPDPKSMLF----FNDDERKYGAEEFRTL-RSR-LY
A0A2V9VC62      ------------------SAQADWKPDPTTMLF----FSQEDNALGTEQFRTL-RSR-LY
A0A2V9S1P8      ------------------CPQGRWSPDRKTMLF----FNPEEQEYGNEEFRTL-RSR-LY
A0A2V9RTW2      ------------------ASQHDWTPDTNTMLF----FKAEEQGFGTEEFRTL-RSR-LY
A0A2V9TGF1      ------------------ASQHDWTPDTNTMLF----FKAEEQGFGTEEFRTL-RSR-LY
A0A2V9XEV6      ------------------CAQSEWNPDPKSMLF----FNDDERKYGAEEFRTL-RSR-LY
A0A2V9Y3Q6      ------------------CAQTNWSPDAKSMLF----FNSDERKYGVEEFRTL-RSR-LY
A0A2V9R269      ------------------SRETRWSPDPKKMLF----FGTEEHASGMEEFRTL-RSR-LY
A0A2V9PTS3      ------------------SRQTAWNPDLKCMLF----FSGEEHGSGMEEFRTL-RTR-LY
A0A2V9NPF4      ------------------SRQTAWNPDLKSMLF----FSGEEHGSGMEEFRTL-RTR-LY
A0A2V9PNZ0      ------------------SRQTAWNPDLKCMLF----FSGEEHGSGMEEFRTL-RTR-LY
A0A2V9AGR3      ------------------CVHLNWRLDPQVSLV----DGGESETGGAERFRTL-RSR-LF
A0A2V9G0N7      ------------------CAHPKWTLDPARSVF----GGPDSKKLGAEPFRTL-RSR-LS
A0A2V9GQ44      ------------------CAHPKWTLDPARSVF----GGPDSKKFGAEPFRTL-RSR-LS
A0A2V9HRN3      ------------------CAHPKWTLDPARSVF----GGTDSKKFGAEPFRTL-RSR-LS
A0A2V8WG13      ------------------CAHPNWHLDPRLNIF----LKTDEGRIGRERFRTL-RSR-LY
A0A2V8X987      ------------------CSRPDWRLDPRASAF----QDSNSGHSGAERFRTL-RSR-LS
A0A1Q7KX94      ------------------CAQVEWRLDPVSSVF----LNSKPGEGGPERFRTL-RSR-LY
A0A2V8XHT0      ------------------CAQVEWRLDPVSSVF----LNSKPGEGGPERFRTL-RSR-LY
A0A2V8DMJ9      --------------------------ARISEKL---VSLVARDSCAADQYRAL-RQT-VE
A0A2V8GGF6      --------------------------EAIDEEI---VSLVDPASFAADQYRSL-RHS-IE
A0A2V8HKU7      --------------------------EAIDEEI---VSLVDPASFAADQYRSL-RHS-IE
A0A1Q6Y875      ------------------CAKPAWKLHKDSLVL---F-NEQSFDQCAEQFRIL-RAR-LY
A0A523DJA9      ------------------AHPPVLPAEVSDEF--------------GEAFRSL-RTS-LV
A0A2V8I604      ------------------LAAAL-----------------APQSLAAEQYRSV-RTR-IR
A0A2V8J066      ------------------LVAAL-----------------APQSLAAEQYRSL-RTR-IS
A0A1I6MMC5      ------------------IAVKRWKPLLHQLPA---L---GERGASVEQFRTL-RSR-VQ
A0A2V9D5W7      ------------------CSYPEWSFDPAVDVF---S-DQGRSALGAEQFRTL-RSR-LC
A0A2V9D4I4      ------------------CTRSEWRPDPRCTVF---S-NPALSTLCAEQFRTL-RSR-LY
A0A2V9D6L7      ------------------CTRPRWRPEPNSTIF---S-NPALSTIGAEQFRTL-RSR-LY
A0A2V8ZJV2      ------------------CVKLEWQIDPHNSVF---V-NARPGQEGSERFRTL-RSR-LD
A0A2V9AWB5      ------------------CARKEWRLDPLNSVF---L-NSKPGEEGPERFRTL-RLR-LY
A0A2V8Z1Y8      ------------------CAHPEWWPYRGSSVF---G-DPAAGHAGAEKFSTL-RSR-LY
A0A1Q8AX10      ------------------CATPGWKLNPDYAVF---C--KQSLAVCAEQFRTL-RSR-LY
A0A2V9A773      ------------------CIKPGWKLSPDYDVF---S-TKQSSALCAEQFRTL-RSR-LY
A0A2V9AND3      ------------------CLKPGWKLNADYDVF---S-TKQSSALCAEEFRTL-RSR-LY
A0A2V9BTJ7      ------------------CARPIWKTDARMSVF---E-GGDDGHVGAERFRTL-RSR-LY
A0A2V8W2M7      ------------------CAHPTWKPDMRFSLF---HRTDDDAKIGTERFRTL-RSR-LY
A0A2V8XNW2      ------------------CAHPTWKPDMRFSLF---HRTDDDAKIGTERFRTL-RSR-LY
A0A1Q7CJC1      ---------------------------MRFSLF---HRTDDDAKIGTERFRTL-RSR-LY
A0A2V9UEM7      ------------------CPVSNWNPDTRTMLF---FQE-DENRKGAEEFRTL-RSR-LY
A0A7C4DTF2      ------------------CPQGEWHPDPKTMLF---LQP-HSHSAGTEEFRTL-RAR-LY
A0A1Q7V300      ------------------SRRTEWRPNPKTMLF---FSG-EEHLYGMEEFRTL-RSR-LY
A0A2V9ZCI3      ------------------CVSVNWHPDEKTMLF---FTK-EDHAPGMEEFRTL-RSR-LY
A0A2V9WCB3      ------------------CPRTEWTPDPGSMLF---MNG-DDHARGTEEFRTL-RSR-LY
A0A2V9VQW5      ------------------CAQGEWKPDEKTMLF---FNP-EENALGTEQFRTL-RSR-LY
A0A2V9WTP3      ------------------CAAVQWSPDPKTMLF---LNG-DDNARGSEEFRTL-RSR-LY
A0A2V9NLA9      ------------------CVAGHWTPDRKTMLF---FNG-DEQGYGTEEFRTL-RSR-LY
A0A2V9RKJ9      ------------------CVAGHWTPDRKTMLF---FNG-DEQGYGTEEFRTL-RSR-LY
A0A2V9RN95      ------------------SAQARWSPDSKTMLF---FNS-DEQGYGMEEFRTL-RSR-LY
A0A2V9N406      ------------------CAQARWSPDSKTMLF---FNSDDEQGYGMEEFRTL-RSR-LY
A0A2V9U6D9      ------------------CAQARWSPDSKTMLF---FNSEDEQGYGMEEFRTL-RSR-LY
A0A2V8DZN4      ---------------------VEL------------ISFRQKTSLLAESFRTTLTSI-LF
A0A3N5YKY1      ------PVLAGGRRARSVTLHPLL------------AAALEFGSPAAEQFRALRTRI-GQ
A0A2G6HQA4      -------------KTIEEDWEERF------------YSANHSVDSLTEIFKTLRARI-LL
A0A2V7ZTY7      ------------------VVAERL------------VTTDGLDFSTVEQYRKL-AAT-LH
A0A2V7ZVL9      ------------------VVAERL------------VTTDRLDFSTVEQYRKL-AAT-LH
A0A1Q7QYI4      ------VRTAGFY-------AEKL------------VVTERPEQSTIEQYRKL-AAT-LH
A0A2V8G9Y9      ELEIQKHRTLGVFHGFGANAVDKL------------IVTPTVPHAAVEQYRKL-AAS-LH
A0A143PNR5      TGAIPEGGLFVSLDG------DER------------MVGAGLRQAVVEEYRKL-ASS-LH
A0A6A7L078      GGLRRADGELAVFRGFSPAVLDRL------------VVNDSTSPALSEEFRKL-AAT-LH
A0A143PXU3      ---------------VDDVPTARL------------VSAADANPVLIEQFRNL-AAA-LN
A0A2V8D8G9      ---------------RTATRRAKLPNSADIQAR---LVTGALSTVSLEQYRRL-AAV-LH
A0A2V8ESQ4      ---------------RTATRRAKLPNSADIQAR---LVTGALSTVSLEQYRRL-AAV-LH
A0A1E3Y5Q0      ---------------IAADLANKI------------VVDSGMDAGSREQYRRM-AAT-LH
A0A2W4TWK5      ---------------IAPALERKV------------VIDRELDPVSREQYRRL-AMA-LH
A0A3N5NYV3      ---------------VTSLIAEKL------------VVTPSISPVSLEQYRRL-AAT-LH
A0A2V2RJF9      ------DSDSDNGSSRQKHLAKQENPPASPTEAIDLLTHYNPTSVASEAFKTV-RTS-LL
A0A2G6HNT3      VQPKPVASVAREKKRPRPVHHPELKESIEEDWEKRLYNANYSVDSLTEIFKTL-RARILL
A0A2V7YWD4      ------MDVVRTKSMTATLVTDSEAATDREDLDPRLVSFLKPESFEADQYRML-RYA-ME
A0A2V2R8T6      -------------AGAARAGGFVSFEISPARVEPHLVAIRQPQSAYAEQFRSL-RTR-IL
A0A1Q7RGF1      FKNSAPGMGASGDLGESRLGQCRKMKIPAVGKLLGQFGSGPALEAAEESYRAL-RTR-LL
A0A2V9BLX2      FKNSAPGMGASGDLGESRLGQCRKMKIPAVGKLLGQFGSGPALEAAEESYRAL-RTR-LL
A0A2V9ZA03      RNAAASPRMLHDLDSDLAVSNEPPGIEVEVPPNPRLVAMMEREGVGAEKFRVL-AAR-LQ
A0A3N5ZNH4      --MPSLGVIPTIAKPGRTQKFLAAKNSEEDENSTALLNANELRFRVWESYRSL-RTS-IL
A0A2V8GEZ2      QPFRIAPVDRGNG-----------VRATIDRLPGKVVLSPDTPSAVVEQYRRL-AAT-LH
A0A3N5ZFD3      EPRSAAAQPRATGPMAVFHGFDPSVRERIVTGHAETNGNLAVMTVATEQYRRL-AAT-LH
G8NXD3          QNAVVDRPASDQSDAINWLNMVPKLERLPQKHRTTIAFESGADSRACEQFRLM-QHR-LV
A0A2V9VR38      -MFGHDPARFQVSPRGAQSQTVGDRYLQGSRRTRHPSQAAVPNGGVLPRSAYF-PAA-VE
A0A2V9EY04      LESIKQGSILETATANAQLPQCQQVQVGNGNATHLVLRQDQSSKVALEAYRAL-RTR-LM
A0A2V9HAK9      -ESLKQGPPINAPPAEARLARSRQVTLGNGNATRLVLRQDDSLDAALEAYRGL-RAK-LM
A0A1Q7FS15      LESLKQGPASGTQLADARLNECRQVHVGNGNGARLVLHQGEASRAALEAYRGL-RTR-LM
A0A1Q7K9P1      LESLKQGPASGTQLADARLNECRQVHVGNGNGARLVLHQGEASRAALEAYRGL-RTR-LM
A0A1Q7N989      LESLKQGPASGTQLADARLNECRQVHVGNGNGARLVLHQGEASRAALEAYRGL-RTR-LM
A0A2V9G7Y0      LASLKQGPANDAPPAGARLAHCRHVALGNGNAARLLLRQDDFLIAALEAYRGL-RTR-LM
A0A2V8T7Z1      --MMSRPSIEAERSVVSHPAARATAPAPPQKVEGHVVALTAPGSFEAEQYRTL-NLV-LE
A0A2V7U8G5      STPPTSG-----------------EVVPALEVEDHLACLLSPQSFEADQYRVL-RQF-LT
A0A2V7UNP9      SPGDARGEPLIADSAESRPGRDSREAAPVPEVEEHLASLLSPYSFEADQYRLL-RQS-V-
A0A2V7VLD7      SPGDARGEPLIADSAESRPGRDSREAAPVPEVEEHLASLLSPYSFEADQYRLL-RQS-V-
A0A2V7XGA3      AQAETAR---------------TARAAILTEVDDHLVAVHSPQSFEADQYRIL-RHF-LD
A0A2V7YAG6      SNGGTGT---------------TVGGAVSRDLDEHLVSLLNPQSFEADQYRIL-RHF-VD
A0A2V7VK33      LSISPTRDPEAPPSAPTRGRGSNEPPRTAPLLEERLVSLGQPWSLEADQYRML-RCE-IE
A0A7C5EWK9      AEKQEDQAP-----CVISLAARAQSRRIKPVAGAPVLPFDGTSPQAAEQYKII-RTK-IL
A0A3M1VTE1      TRYAIGAGV--------GARPRRPRPRITLAPTEELVVAREPNCPAAEAYLRL-RSA-LL
A0A2V7TTM7      VTREAPAGR--PRPSVGPSPENSKIAAAALRVDERLVSLRSPNSFEADQYRVL-RHF-LE
A0A2V8VI82      VRSAPSHGP-------------------AGPIDQRLVSLLAPDSFEAEQYRTL-RHV-VE
A0A2V7U4P9      VSETPRRGP-------------GGGSAVRSTPADHLVSLVAPTSFEAEQYRIL-RHA-IE
A0A2V7TQY5      RRRHRRIEAPGRRQLPAGRRAGGRWVVTAPRIDQHLISLLQPRSFEAEQYRVL-RHV-IE
A0A2V7TU87      -------------------MSRHR----MATLDERLVSLVAPHSYEAEQYRGL-RHL-VE
A0A2V8SEH0      AHAARRAGPRRPEAAAPAARPIGS----SGAADEHLVSLLVPNSIEGEQYRAL-RHQ-IE
A0A2V8VU54      VDLMGRSRT---------ATETQG----VRGLDPHLVSLVAPASFEAEQYRAL-RSR-LE
A0A1Q7RML7      SDRSERACP---------APSAGG----LRGLDRHLVSLVAPASFEAEHYRML-RAR-LE
A0A1Q7ZIQ5      SDRSERACP---------APSAGG----LRGLDRHLVSLVAPASFEAEHYRML-RAR-LE
A0A2V8TKD8      SDRSERACP---------AQSAGG----LRGLDRHLVSLVAPASFEAEHYRML-RAR-IE
                                                                            

A0A1F2U8T6      A-LY-PGDG-PKTMAVTSAQPLEGKTTTACNIALALAYGGM--RVLLIDADLRRPGLHLS
A0A2V8BV42      S-KY-PATG-TKTLLVTSAQPLEGKTTTAANIAMALAYGGS--RVLLIDGDMRRPGLHRP
A0A2V8F916      S-KY-PATG-TKTLLVTSAQPLEGKTTTAANIAMALAYGGS--RVLLIDGDMRRPGLHRP
A0A1Q7K833      S-KY-PGEG-TKILVVTSAQPLEGKTTTAANIAMALAYGGS--RVLLVDADMRRPGLHRP
A0A1Q8AMY4      S-KY-PGEG-TKILVVTSAQPLEGKTTTAANIAMALAYGGS--RVLLVDADMRRPGLHRP
A0A2V8BM40      S-KY-PTDG-TKIIAVTSAQPLEGKTTTAANMALALAYGGS--RVLLIDADMRRPGLHRP
A0A2V8CRT6      S-KY-PTDG-TKIIAVTSAQPLEGKTTTAANMALALAYGGS--RVLLIDADMRRPGLHRP
A0A1F2VH76      S-QL-PGDG-PKVMAVTSAQPLEGKTTTAVNIAMALAVGGS--RVLLIDADMRRPSVHKA
A0A1F2R0X5      T-RY-SGEG-TKLMAVTSAQPLEGKTTAACNIAMALAYGGA--RVLLIDADMRRPGLHRT
A0A2V8B278      S-KY-PSAG-TKIVVVTSAQPLEGKTTTAANIAMALAYGGS--RVLLVDADMRRPGLHRP
A0A2V8CEF9      S-KY-PSAG-TKIVVVTSAQPLEGKTTTAANIAMALAYGGS--RVLLVDADMRRPGLHRP
A0A2V8KZG2      -----------------------GKTTTASNIAISLAQLGG--SVLLIDCDLRKPSIHTA
A0A2V8TKR9      --LSAAGSP-PKIVLVTSAQPGEGKSTTVVNTAISLAQLGS--SVLIIDCDLRRPSTHKI
A0A1Q7LG57      L-PSQNGDC-PGVVVLTSPSSGDGKTTVACNLAIAMAEI-GR-KVLLIDGDLRRPRLHKV
A0A2V8MKQ7      L-SS-AGTP-PRTILVTSSQPSEGKTTTAINTAFMLAQT-GA-EVLIIDGDLRRPRLHAH
A0A1Q7L5B1      E-FR-DNEP-LHTLLVTSSLPAEGKSFVSLNLALAMMRQHNR-YVLLVDGDLRAPKLATC
A0A2V9DKV4      E-FR-DNEP-LHTLLVTSSLPAEGKSFVSLNLALAMMRQHNR-YVLLVDGDLRAPKLATC
A0A2V9EVA0      R-LR-EKKP-FRTLLVTSAQAGEGKSFVSLNLARAIVHQHER-HALLIDADLRAPKLHVS
A0A7C5ZU39      K-YH-KNHN-CRSIVISSATAGEGKSVTALNLALMLAGAENL-RVLIIDSDMRNGRISYY
A0A3N5YN96      Q-VEFGGRD-CRSLVVTSPMPGDGKTVTSANLALSMAQEFHR-KVLIIDADLRKGALHRM
A0A1Q7Y646      Q-AS-ERRK-MQAFVVTSAGVGEGKTLTALNLAWLLAQTDGV-RALLIDSDLRQPCATEY
A0A2V8QZU0      H-AG-ERKK-MQAFVVTSAGVMEGKTLTAINLSWLLAQTDGV-RALLIDGDLRNPCAGDY
A0A2V8RSQ9      H-AG-ERRK-VQAIVVTSAGIAEGKTITALNLAWLLAQTDGV-RALLVDGDLRQPCAAAY
A0A2V9L2P7      L-ST-AERP-PQLLLVTSAQPHEGKTATSLNLAFTLAQM-GS-RALVVDADLRKRRIARA
A0A2V7UMX0      R-LR-REGG-LRLVAVTSPFAGDGKTTTSINVAATLAQAPGS-RTLLVDCDLRLPAVAKY
A0A136K497      H-KS-QRQH-LKSIVVASVNPSEGKSVTAVNLAWMLAQTDGV-CALIIDSDLRMPSLADY
A0A399W9E4      H-KS-QRQN-LQAIVVASANPSEGKSVTAVNLAWMLAQTDGV-RALIIDSDLRMPSLADY
A0A321LMC5      N-LA-AKHN-RRSLLVTSALEGEGKTTIATNLAWVMARQSGK-KVLLLDADLRRPSICKM
A0A2V8X713      R-LR-EKNP-IRILLVTSTLPGEGKTFVALNLALAITRQHER-GALLIDADLRASRLHVR
A0A2V8ZLE9      R-LR-EKNP-IRTLLVTSALPGEGKTFVALNLALAIARQHER-KALLIDADLRASSLHAR
A0A2V8Y4D3      R-LK-EKSP-LRTLVVTSTLPGEGKTFVALNLALAIARQHER-RALLIDADLRASRIHVG
A0A2V8Z2X8      R-LR-KKSA-IRTLLVTSTLPGEGKTFVALNLALAIARQHEK-RALLIDADLRASRLHVR
A0A2V9C3F6      R-LR-EKSP-IRTLLVTSTLPGEGKTFVALNLALAIARQHER-RALLIDADLRASRLHVR
A0A2V9QMU9      L-SS-VGAA-PKVVVVTSALPSEGKTTTSINTAIVLAQK-GN-RVLLVDADLRRPSIHKT
A0A2V9QY75      L-TS-LGAP-PKIILITSALPREGKTTTSVNTAIVLAQK-GT-RVLLIDADLRRPSIHKA
A0A2V9SVU9      L-TS-LGAP-PKVILITSALPQEGKTTTSINTAIVLAQK-GV-RVLLIDADLRRPSIHKT
A0A2V8W5N5      Q-IR-GNQP-SYTLLVTSSLPDEGKTFVAQNLSQAIVQKPRQ-RVLMIDADLRYPQLHLA
A0A2V8XG53      Q-IR-GNQP-SYTLLVTSSLPDEGKTFVAQNLSQAIVQKPRQ-RVLMIDADLRYPQLHLA
A0A6A7LB89      Q-AQ-LTHG-VRVVMITSAVLAEGKSLTATNLALTLSESYRR-RVLLVDADLRRPTLHDI
A0A352EZH8      Q-AG-EREQ-MRTFVVTSAGMGEGKTLTALNLAWLLAQSEGV-KALVIDSDLRQPCATNY
A0A0B6X033      H-AG-EKRQ-VQAVVITSAGVLEGKTVTAINLAWLLAQTDGV-RALLIDGDLRRPCALSY
A0A2V8R0I3      E-AG-ERKR-MRAFVITSPGVGEGKTLTALNLAWLLAQTDGV-KALLIDADLRQPCAAAY
A0A2V8N1U8      Q-AS-ERER-KRAFVVTSAGIGEGKTLTTLNLAWLLAQTDGV-TALVIDADLRQPCAADY
A0A2V8QL35      Q-AG-EREH-KRAFVITSAGQGEGKTLTALNLGWLLAQTDGA-TALLIDADLRQPCAAEY
A0A352FU10      Q-AG-EREH-KHAFVVTSAGMGEGKTLTALNLAWLLAQTDGA-TALLIDADLRQPCAAEY
A0A2V8LCU0      Q-AG-ERQG-KRAFVITSAGMGEGKTLTALNLAWLLAQTDGV-SALVIDADLRQPCAAEY
A0A1Q7NGT0      Q-AG-ERQR-MRAFVITSAGVGEGKTLTALNLAWLLAQTDGV-RALVIDADLRQPCAADY
A0A2V8MLP9      Q-AG-ERQR-MRAFVITSAGIGEGKTLTALNLAWLLAQTDGV-KALVIDADLRQPCAADY
A0A2V8PQZ0      Q-AG-ERQR-MRAFVITSAGIGEGKTLTALNLAWLLAQTDGV-KALVIDADLRQPCAADY
A0A3B9MKY6      Q-AG-ERKQ-MRAFVITSAGVGEGKTLTALNLAWLLAQTDGV-RALVIDSDLRQPCATEY
A0A3D5SKZ1      Q-AG-ERKQ-MRAFVITSAGVGEGKTLTALNLAWLLAQTDGV-RALVIDSDLRQPCATEY
A0A2V8NRW2      Q-AS-ERKK-MQAFVVTSAGVAEGKTLTALNLAWLLAQTDGV-RALIIDSDLRNPCAADY
A0A2V9XV04      H-IR-EKMP-LKKLLVTSALPKEGKSFTSANLAQVMVRQHGR-RALLIDADLRGPRLHQM
A0A2V9CBY1      S-LR-DTRP-IQTLLITSTIAAEGKTFVAMNLAQSIARQRGR-RALLVDADLRASRLHIA
A0A2V9D656      S-LR-DTRP-IQTLLITSTTAAEGKTFVAMNLAQSIARQPGR-RALLVDADLRASRLHIA
A0A7C2L7W9      L-SH-AEHP-PRTILFTSSGPGEGKTTTAVNTAISLA-QMGA-RVLLIDGDLRKPGLHKA
A0A7C2XG00      L-SH-AEHP-PRTILFTSSGPGEGKTTTAVNTAISLA-QMGA-RVLLIDGDLRKPGLHKA
A0A2V9J901      L----SASPVPRVILITSALPGEGKTTTAVNLGAALAS-FGS-KVVVIDCDMRRPSCHRS
A0A2V8QJ59      --------------LVTSSQPSEGKTTTAINTAFILAQTGA--EILLIDCDLRRPRLHVH
A0A1Q7HTA7      ---------------MTSATSGEGKTTTAINLAAAMAQDAEA-RVLLVDADLRAPSVAPL
A0A2V8YMQ4      L-ST-ADHP-PGSLLITSTQPGEGKTTVATNLAISLAQ-LGQ-RVLLVDADLRFPSLQRL
A0A2V8W380      L-ST-PDRP-PSSLLVTSTQPADGKTTVACNLAISLAQ-LGH-RVLLVDADLRSPSLHKL
A0A2V8ZIV5      L-ST-ADHP-PGSLLVTSTQPGEGKTTVATNLALSLAQ-LGQ-RVLLVDADLRFPSLQSL
A0A7C2M3P5      L-ST-PEQA-PRLLLTSSAQPGEGKTTVTLNLAISLAQ-LGE-RVLLVDADLRRPCIHKA
A0A2V8LBV1      FSEP-NGAP-PHVLVITSTSPRDGKSTIASNLAVALAE-TKR-RILLIDADLRRPHLHTV
A0A2V8GAF9      R-LR-RESG-LQVLAVTSPGPGDGKSVTALNVAGALAQSPHA-QILIVDADLRRPTVAEY
A0A7C5I7P7      LSGQ-NGER-PRVIALTSAGPSEGKTTAASNLAIALAE-TNR-RVLLIDADMRRPRLHEV
A0A2V8CN98      H-AY-GTAG-PLVVTITSPGPGDGKSFVSANLALACAQ-AGQ-RTLLIDGDTRRGALHRV
A0A1Q7LC46      L-SQ-ADHP-PQVILVTSALPREGKTTAAANLAVTLAQ-LGD-STVLVDADLRKPGIGRL
A0A1Q8BDC5      D-AA-SKAS-LKVLTVSSPDPRDGKSLISSALAFSFSMDPGR-RVIIVDCDLRNPSLDGY
A0A2V9Q1Y8      L-TS-LGAP-PKTILITSALPQEGKTTTSINTATVLAQ-KGT-RVLLIDADLRRPSIHKT
A0A2V8JXG1      L-SA-AGNP-PKTILVTSVRMEEGKTTTATNTAIALAQ-LGA-SVLLIDCDMRKPSVHDV
A0A350D2W9      L-SS-PQGS-LKTIMVTSPLPEEGKSATISNLAVSLAQ-TGK-KILLIDADLRRPKQHQI
A0A2V9I4J1      E-TQ-ADHA-VQTIAISSPRPQDGKSLIAVNLAFCLAQDLDR-RVILVDGDLRNPTVNRY
A0A2V8PQZ9      Q-AG-ERQR-MRAFVITSAGVGEGKTLTALNLAWLLAQTDGV-RALVIDADLRQPCAADY
A0A2V8D8B1      F-ST-VDNG-TQSICITSSGPGEGKTLVGSNLAVALGQ-TGQ-RVLLIDADMRRPRVHEV
A0A3B9LSB4      L-ST-AGRA-PRSLLVTSSLPGEGKTTTAVNTAVSLAQ-TGA-SVVIIDADMRRPRLRSI
A0A2V9H7U2      L-ST-APRP-PQVLLITSATAREGKSTTALNLAIALAQ-RGD-STLIIDADLRRPGIAES
A0A2V8NJB5      --NE-SDNP-AQVMIVSSPENGDGKSLVSANLALSYSLEVAR-RVIIVDCDLRNPSLHRY
A0A2V9JMZ4      E-TQ-ADHA-VQTIAISSPRPQDGKSLIAVNLAFCLAQDLDR-RVILVDGDLRNPTVNRY
A0A2V9MDJ6      E-TQ-ADHA-VQTIAISSPRPQDGKSLIAVNLAFCLAQDLDR-RVILVDGDLRNPTVNRY
A0A2V8QJT6      L-ST-AGRA-PKTLLVTSSLPGEGKTTTAVNTAISLAQ-TGA-SVVIIDGDMRRPRLRSI
A0A2V8FSM8      FSQR-NGAY-PRVLVLTSASPKEGKTTVVSNLAITVAE-IRR-RVLVIDADMRRPRLHKV
A0A359M0J2      RSGP-GSLA-PGLVLVTSPSPGEGKTTIAANLGVAMAE-VNR-RTVVIDMDLRRPSLHNT
A0A2V8JLJ1      A-MQ-RKKH-LKTILISSSGAGEGKTFSACCIAGMLAQEPGK-QVLLIDADLRRSTATTV
A0A5M8SND8      FGEE-GGKT-PQVLAVTSANPREGKTTVLCNLAVAMAE-IRK-RVLVIDADLRRPRLHDV
A0A2V9GAQ1      L-SQ-ADHP-PQVILVTSALPREGKTTAAANLAVTLAQ-LGD-STVIVDADLRKSGIGRL
A0A497EDQ8      L-AA-RDEG-CQILLVTSSVPSEGKTTASFNLAKVLAA-GGA-RVLLIDGDLRKPRLHHM
G8NS05          L-ST-AGKL-PKVILLTSATPSEGKTTVSTNLACVFAQ-RDV-RVLLIDADLRRPTVHHR
A0A2V8KZ20      A-MQ-RKKH-LKTILISSSGAGEGKTFSACCIAGMLAQEPGK-QVLLIDADLRRSTATTV
A0A3D0NWU2      F-SS-AGKP-PQSILVTSSQPSEGKTTTAINTAITLAQ-ADV-DVVIVDCDLRRPRIHNY
A0A2V8EPD9      H-AQ-MERG-LKVIMTSSAMPGEGKSLTSVNLALTLSDSYRK-RVLLIDVDLRRPTVQRI
A0A3N5NSX5      F-SS-GTEG-TRVIALTSAQPLEGKTTTACNMAIALAY-GGS-RVLLIDADMRRPSVSRT
A0A2V8MUA1      A-LQ-KKRN-LSRILIASAIPNEGKTFSACCLAGILAQEPRK-RVLLIDADVRTGSISHT
A0A2V8MBH9      L-ST-AGRA-PKTLLITSSLPGEGKTTTAVNTAITLAQ-TGA-SVVIIDADMRRPRLRSI
A0A3N5ZPQ7      E-SR-AGSP-HKVITVTSPHIQDGKSLVSANLAFSFARDSGT-RTILVDCDLRRPSLHRY
A0A3N5P5F2      F-SV-S-PE-CRRLVVTSTAPREGKSVVASNLAAGLAM-AGH-RVVLIDADMRRPRVHAI
A0A7C2EFE5      L-TD-FDRT-IRSILVTSPTPSEGKSTAAAHLAVAHAL-QNH-KTLLIDADLRRPSVHRS
A0A2V9G1P7      L-ST-PDRP-PSSLLVTSTQPAEGKTTVACNLAISLAQ-LGH-RVLLLDADLRYPSLHKL
A0A2V9BCK9      R-LR-DKQP-VRTLLVTSAVPGEGKTFVSLNLALAIARQHER-RALLIDGDLRASRLHVR
A0A2V9TMX2      L-SS-FGAP-PKVILVTSAMPREGKTTISANSALVLAQ-RGS-RVLLVDADLRRPGVEKL
A0A7C4DQP8      L-SA-ADRP-PRTLLVTSAQPGEGKTTVSTNLAISLAQ-LGQ-RVLLIDGDMRRPSVHLA
A0A2V8N2J7      Q-QC-DAAQ-AKTVIVTSAAGGEGKSLTAINVAMALAAATDG-RVLLMDADMRKPRIGEY
A0A3N6BI26      L-SH-SGKP-PKVIMVTSSVPGEGKTTTVANTGIVLAQ-TGA-RTLLIDLDMRKPALAST
A0A2V9JMM3      W-HL-GEAP-SRVLTVTSASGGEGKTLTAVNLSFALAESGLG-KVLLLDADLRKPRTHEY
A0A2V9M815      W-HL-GEAP-SRVLTVTSASGGEGKTLTAVNLSFALAESGLG-KVLLLDADLRKPRTHEY
A0A2V9A795      L-ST-ADHP-PGSLLITSTQPGEGKTTIATNLAISLAQ-LGQ-RVLLVDADLRFPSLQRL
A0A355ESH9      L-SS-A-RE-LKVVAVTSAMAGEGKTATASNLAVVLAQ-LGR-PVVIIDCDLRKPRIHQV
A0A3D0NW85      L-ST-AGHA-PKSLLVTSSLPSEGKTTTATNTAISLAQ-TGA-KVLIIDADMRRPRLHSV
A0A353CAT5      L-ST-AGHP-PKSLLITSSLPSEGKTTTATNTAISLAQ-TGA-RVLIIDADMRRPRLHSV
A0A2V9HB55      L-SR-ADHP-PQVILVTSALPREGKTTAAANLAVTLAQ-LGD-STVIVDADLRKPGIGRL
A0A2V8CU57      H-AQ-LQRN-VRTVMITSAVAAEGKTLTATNLALTLSHSYKR-RVLLIDADLRRPTVHEA
A0A2V8BDI4      H-AQ-LQRN-VRTVMITSAVAAEGKTLTATNLALTLSHSYKR-RVLLIDADLRRPTVHEA
A0A2V8F8T3      H-AQ-LQRN-VRTVMITSAVAAEGKTLTATNLALTLSHSYKR-RVLLIDADLRRPTVHEA
A0A2W0B5E2      L-SV-ASRA-PQTVLITSAKIGEGKSSTALNLAMALAQCGS--SVVLLDCDLRKPVLARL
A0A2V8NMG8      L-ST-AGRP-PQTLLITSSVPSEGKTTTSINTAISLAQTGA--NVLIIDADMRRPRLHSI
A0A2V8TBM7      L-SS-AGQP-PKTVLVTSSQPSEGKTTTVVNIATMLAQTGA--DVLVLDCDLRRPRVHAH
A0A1Q7HEZ8      Q-LK-RLRD-VRLIAVTSPSAGDGKTVTALNLAGVLACGSDA-RVLLIDADLRRPTVAAR
A0A1Q7JW36      Q-LK-RLRD-VRLIAVTSPSAGDGKTVTALNLAGVLACGSDA-RVLLIDADLRRPTVAAR
A0A1Q7MUR4      Q-LK-RLRD-VRLIAVTSPSAGDGKTVTALNLAGVLACGSDA-RVLLIDADLRRPTVAAR
A0A3N5PFU4      R-LR-QTRD-LRVIAVTSPGAADGKTVTSINLAGALARGAAA-RVLLVDADLRRPQVADH
A0A3M1SNQ5      H-ES-QKRH-LKVITITSINPNEGKSITALNLAWLLAQTDGI-STLLIDADLRNPSLASY
A0A7C2C0C1      H-ES-QKRH-LKVITITSINPNEGKSITALNLAWLLAQTDGI-STLLIDADLRNPSLAGY
A0A4R1LDF1      Q-VA-RNLK-SKVFLITSAIAEEGKTITAANLAFALSGASSI-RTLIIDLDLRRPSLATR
A0A1F2T1R8      R-VA-RARD-VKIIAITSPAAGDGKTVTAVNLAGALARGSDG-RVLLIDADLRRPSVATL
A0A2V9BW09      H-LR-MARA-LSKVLVTSAIPREGKTVVATNLAFTLARSSS--HVLLVDADLRLSAVHQM
A0A3M1SSE1      L-SV-AGHA-PKSLLVTSSLPAEGKTTTAVNTAITLAQTGA--KVLVIDADMRRPRIHSI
A0A2V9GQV7      R-AQ-SKSG-LHSIVITSSLPGEGKTLTTMNLGLCYAQLPQQ-RVLVIDGDMRAHGLTSM
A0A7C5AUB2      H-IQ-KLQP-VHSVVITSPCPAEGKSFTVVNLALAEAQLNDN-PTLLMDFDFRRPVLHNI
A0A2V8YCY6      -----------QVILVTSALPREGKTTAAANLAVTLAQ-LGD-STVLVDADLRKPGIGRL
A0A2V8EGM3      Q-NQ-RGEN-IRSVMITSAVPADGKTLTALNLSLILSESYKR-RVLLIDGDLRRPTISAA
A0A2V8FGH1      Q-NQ-RGEN-IRSVMITSAVPADGKTLTALNLSLILSESYKR-RVLLIDGDLRRPTISAA
A0A2V7YV88      F-ST-IDHE-LKTIVLTSAAPGEGKSRTASNLAIALAHAGQ--RTLLIDADFRRPSLHRI
A0A2V8D468      F-SS-AGGR-APTILVTSTGPGEGKTMTSCNLAVSIAQTRQ--RVLLIDADMRRPRVHEV
A0A1F2R977      Q-MQ-AEHK-VKTLMVTSALPREGKTLTVTNLALTLSEYFGR-RVLLIDGDLRHPSIHEI
A0A2U3LF12      R-WR-EQTG-GRVLVVTSAAGGEGKSLTALNLSMALASSVEG-RVLLVDCDLRRPQVHER
A0A7C5MF19      R-HH-KR---PRSIVISSAQADDGKSVTSINLAGCLALKPNT-NVLLVDGDMRRSQVAAL
A0A3N5G7M6      L-SM-LPGG-MRSVVVTSACAGDGKTLVASNLAVALALAEH--RVLLIDADLRRPTLHTA
A0A1F2S3Q7      R-LA-RARD-VRTIAVSSPAAGDGKTVTAINLAGTLARGSDD-RVLLVDADLRRPSVASL
A0A2V8GVG4      R-LR-RGRT-LQVIAVTSPAAGEGKTLTAINLAGALARGADDARVLLIDADLRRPAVAKQ
A0A2V8PJQ0      L-SS-AGQA-PKTILVTSSQPSEGKTTTAINTAFMLAQT-GA-EVLIIDCDLRRPRLHSN
A0A2V8H566      Y-AQ-SQHG-TRVLMMTSTLASEGKTLTATNLALTLSESYRR-RVLLIDADLRRPTIHDM
A0A2V8UVN4      H-HP-RQ---PRLVVISSAGSGDGKTVTSINLAGAMSLKTEA-EILLIDADLRKAQIAPL
A0A1Q7RB73      L-IR-ERQP-LQSLLVTSPLPSEGKTVVAANLAQVLVQQREQ-RVLLVDSDLRYSRMHLS
A0A2V9K0H7      L-IR-EQLP-LQSLLVTSPLPSEGKTVVAANLAQVLVQQREQ-RVLLVDSDLRYSRMHLS
A0A321LXF5      K-HE-GRHG-MRSLVISSAAPGDGKTLTAFNMALCFARIQNW-PVLLVDADLRTQGMSSL
A0A5M8SBZ0      R-IR-QKQT-LKIILVTSSLPREGKSFLSANLSQIFARQRGC-RTLLVDADLRWPRLHEY
A0A1Q7JFB1      H-AQ-TERQ-LKVVMVSSAVSGDGKTLTSTNLALTLSESYRR-RVLLIDADLRRPSVHEV
A0A2V9LS17      G-LN-ETSA-TRSLLVTSASPREGKSFISSNTAQILARQPDK-RVLLIDADLRWSRLHLF
A0A7C2YLF6      Q-MR-EKQP-MRTLLVTSALPAEGKTIVAANLAQVIVRQHER-RALLIDADLRWSRLHLN
A0A2V7X0V9      H-MR-EKMT-LKKLLVTSALPKEGKSFTSSNLAQVLVRQHGR-RVLLIDADLRGPRLHLM
A0A2V9X518      Q-MR-EKMP-LKKVLITSALPKEGKTFVAANLAQVMVRQHGR-RALLIDADLRGARLHQA
A0A2V9VC62      Q-LR-EKIS-LKKILITSALPQEGKSFVAANLAQVLVRQHGR-RVLLIDGDLRVARLHTA
A0A2V9S1P8      Q-IR-EKQS-LKKVLVTSALPKEGKSFVAANLAQVMVRQEGR-RALLIDSDLRGSRLHEA
A0A2V9RTW2      Q-MR-EKQA-LKKVLVTSALPKEGKSFVAANLAQVMVRQHGR-QALLIDADLRGARLHHL
A0A2V9TGF1      Q-MR-EKQA-LKKVLVTSALPKEGKSFVAANLAQVMVRQHGR-QALLIDADLRGARLHHL
A0A2V9XEV6      Q-MR-EKMP-LKKVLITSALPKEGKTFVAANLAQVMVRQHGR-RALLIDADLRGARLHQA
A0A2V9Y3Q6      Q-LR-EKMS-LKKLLITSALPKEGKTFVAANLAQVLVRQHGR-RALLIDADLRGARLHQA
A0A2V9R269      Q-AR-EKQP-LSKLLITSALPKEGKSFTTANLGQVMVRQHGR-RVLLIDADLRNPQLHNQ
A0A2V9PTS3      Q-IR-EKQPLLSKLLVTSPLPKEGKSFTAANLAQVIVRQHGK-RALLIDADLRCPQLHVL
A0A2V9NPF4      Q-IR-EKQPLLSKLLVTSPLPKEGKSFTAANLAQVIVRQHGK-RALLIDADLRCPQLHVL
A0A2V9PNZ0      Q-IR-EKQPLLSKLLVTSPLPKEGKSFTAANLAQVIVRQHGK-RALLIDADLRCPQLHVL
A0A2V9AGR3      Q-IA-ATRP-LRRVLITSSLPAEGKSFIAANLAQSLACRQDS-RVLLIDGDLRAPRLHLA
A0A2V9G0N7      Q-IA-GTHV-LKRIVITSSVPAEGKTFVAANLAQSIIRQPDR-RVLLIDADLRASRLHVA
A0A2V9GQ44      Q-IA-GTHV-LKRIVITSSVPAEGKTFVAANLAQSIIRQPDR-RVLLIDADLRASRLHVA
A0A2V9HRN3      Q-IA-GTRV-LKRIVITSSVPAEGKTFVAANLAQSIIRQPDR-RVLLIDADLRASRLHVA
A0A2V8WG13      Q-IA-ATRP-LKRVLVTSSVPSEGKTTVAANLAHSIMCQPDR-RVLLIDADLRCSGMHEL
A0A2V8X987      Q-IA-GTRT-LRRLLITSSVAGEGKTFVASNLGQSIVRQPGR-RVLLLDADIRMSRLHVG
A0A1Q7KX94      K-IA-STRK-LQKVLITSGVAAEGKTFVASNLAQSIVQQPEL-RVLLIDADLRSSRLHVL
A0A2V8XHT0      K-IA-STRK-LQKVLITSGVAAEGKTFVASNLAQSIVQQPEL-RVLLIDADLRSSRLHVL
A0A2V8DMJ9      R-LR-RERG-FQVIGVTSPCPGDGKTVTTLNLAGALAQSPDS-RVLVVDADLRRPSVAEY
A0A2V8GGF6      R-LR-TDAS-SRVLAITSPGPGDGKTLTTLNLAGALAQCRDL-RVLVIDADLRRPAVSEY
A0A2V8HKU7      R-LR-TDAS-SRVLAITSPGPGDGKTLTTLNLAGALAQCRDL-RVLVIDADLRRPAVSEY
A0A1Q6Y875      R-LR-EKKP-FRTLLVTSAQAGEGKSFVSLNLARAIVHQHER-HALLIDADLRAPKLHVS
A0A523DJA9      F-TA-GGSS-SRIIGVTSTQPREGKTICVANLGLVLALG-GA-RVLLIDADTRLPALHKS
A0A2V8I604      Q-AE-NGRP-LRAILVTSPGKGDGKSLTAANLALTMAQEFQQ-RVLLVDSDLRRPTVHRL
A0A2V8J066      R-ME-NGRA-VRVLIVTSPAKGDGKSLTAANLALAMAEEFSQ-RVLLIDADLRRPSVHHL
A0A1I6MMC5      E-FR-DLGV-LKTVLVSSGLPGEGKSFVSANLAISLARRKQN-RVLLIDGDMRRSSLHKL
A0A2V9D5W7      Q-LR-GNRP-VRTILITSAVAGEGKTFVAFNLAQAIVRQPDQ-RVLIIDADLRCSRLHGI
A0A2V9D4I4      Q-LR-ASQR-LGTILITSAVPGEGKTFVAANLAQAIVRQAER-RVLIIDADLRSSHLHRM
A0A2V9D6L7      Q-LR-SSQP-LRTILVTSAVAGEGKTFVVANLAEAIGRQRDR-RVLIIDADLRASRLHLM
A0A2V8ZJV2      K-IA-STRK-LKRVLLTSAVAGEGKTFVAFNLAQSIAQQPDL-RVLLVDADLRSPRLHHL
A0A2V9AWB5      K-IA-TTRK-LKRVLITSGVASEGKTFVASNLAQSIAQQPEL-RVLLIDADLRSSQLHVV
A0A2V8Z1Y8      Q-IA-EART-LRRLLLTSTVAGEGKTFVAANLAQAIIREPER-RVLLLDADLRVPQLHAV
A0A1Q8AX10      R-LR-DKQP-VRTLLVTSAVPGEGKTFVSLNLALAIARQHER-RALLIDGDLRASRLHVR
A0A2V9A773      R-LR-EKSP-IRTLLVTSTLPGEGKTFVALNLALAIARQHER-RALLIDADLRASRLHVR
A0A2V9AND3      R-LR-EKSP-IRTLLVTSTLPGEGKTFVALNLALAIARQPER-RALVIDADLRASRLHVR
A0A2V9BTJ7      Q-IG-GTRQ-LRRVVVTSSLPAEGKTFVAANLAQSIVRQPDR-KVLLIDADLRASRLHQL
A0A2V8W2M7      Q-IA-AAKQ-LRKVLVTSSVPNEGKTFVAANLAQSIVHQPDR-RVLLIDADLRAPLLHVT
A0A2V8XNW2      Q-IA-AAKQ-LRKVLVTSSVPNEGKTFVAANLAQSIVHQPDR-RVLLIDADLRAPLLHVT
A0A1Q7CJC1      Q-IA-AAKQ-LRKVLVTSSVPNEGKTFVAANLAQSIVHQPDR-RVLLIDADLRAPLLHVT
A0A2V9UEM7      Q-IR-EKLP-LKRLMVTSALPKEGKSFVAANLAQVMVRQHGR-RVLVIDADLRSPGMHRH
A0A7C4DTF2      K-VR-EKHP-LKTLLITSALPAEGKSFVAANLAQVFVRQHER-RVLLIDADLRWSRLHLS
A0A1Q7V300      Q-AR-EKHP-LSKVLVTSPLPKEGKSFVTANLGQVLVRQQGK-RVLLIDADLRNPHLHST
A0A2V9ZCI3      Q-LR-EKMP-LKKILISSSLPKEGKSFVAANLAQVMVKQHGR-RVLLIDGDLRGSRLHQT
A0A2V9WCB3      H-LR-EKMT-LRTVLVTSALPKEGKSFTSANLAQVLVRQHGR-RVLLIDADLRGPRLHLM
A0A2V9VQW5      Q-MR-EKAS-VKKILVTSALPQEGKSFVAANLAQVLVRQHGR-RVLLIDGDLRVARLHSA
A0A2V9WTP3      Q-IR-EKMT-LKKILVTSALPKEGKSFTAANLAQVMVRQHGR-RVLLIDADLRGPRLHLM
A0A2V9NLA9      Q-LR-DRLP-LKKVLVTSALPKEGKSFVAANLAQVLVQQQGR-RTLLIDGDLRGARLHNA
A0A2V9RKJ9      Q-LR-DRLP-LKKVLVTSALPKEGKSFVAANLAQVLVQQQGR-RTLLIDGDLRGARLHNA
A0A2V9RN95      Q-MR-EKQS-LKKILVTSSLPKEGKSFVAANLAQVMVRQQGR-RALLIDGDLRGPRLHQV
A0A2V9N406      Q-MR-EKQS-LKKVLVTSSLPKEGKSFVAANLAQVMVRQQGR-RALLIDGDLRGPRLHQV
A0A2V9U6D9      Q-MR-EKQS-LKKILVTSSLPKEGKSFVAANLAQVMVRQQGR-RALLIDGDLRGPRLHQV
A0A2V8DZN4      S-QR-NGAY-PRVLVLTSASPKEGKTTVVSNLAITVAE-IRR-RVLVIDADMRRPRLHKV
A0A3N5YKY1      V-EF-GGRD-CRSLVVTSPMPGDGKTVTSANLALSMAQEFHR-KVLIIDADLRKGALHRM
A0A2G6HQA4      T-KK-RNTS-AGTIMVTSAMPGEGKSFVAANLSLAFASGLDQ-YVLLVDGDLRRPSIKKL
A0A2V7ZTY7      H-AQ-VERD-LKVVMVSSAVSGDGKTLTSTNLALTLSESYHR-RVLLIDADLRRPSVHRV
A0A2V7ZVL9      H-AQ-VERD-LKVVMVSSAVSGDGKTLTSTNLALTLSESYHR-RVLLIDADLRRPSVHRV
A0A1Q7QYI4      H-AQ-TERQ-LKVVMVSSAVSGDGKTLTSTNLALTLSESYRR-RVLLIDADLRRPSVHEV
A0A2V8G9Y9      H-AQ-LERQ-IKVVMITSAAPGEGKTLTSTNLALTLSQSYRR-NVLLIDGDLRRPSVHSV
A0A143PNR5      Q-AQ-INHR-LQVVLVASAVPGEGKSLTAANVALTLTTSYSR-KVLLIDADLRRPSLHGL
A0A6A7L078      H-AQ-LSEK-TKVIMVTSGMASDGKTLTATNLALTLSESYRR-DVLLIDADLRRPSLHEI
A0A143PXU3      R-LQ-TERT-LKSLLVTSPAPGDGKSHVAVNLALTLSESYRR-KVLLVDADMRRPTLHHL
A0A2V8D8G9      E-DQ-VQRQ-LKTVMITSALPQEGKTLTLVNLALTLSESYAR-RVLVIDADLRWPGLHTV
A0A2V8ESQ4      E-DQ-VQRQ-LKTVMITSALPQEGKTLTLVNLALTLSESYAR-RVLVIDADLRWPGLHTV
A0A1E3Y5Q0      A-LQ-AESG-LRVITVASAMPGEGKTLTAANLALTLSESYQR-KVLLIDGDLRKPSQHAV
A0A2W4TWK5      A-AQ-GTGG-VKVIAVSSALANEGKSLTASNLAMTLSESYQK-RVLLIDGDLRRPSLQQI
A0A3N5NYV3      R-RQ-TESR-IKTVLVASTMAGEGKTLTAVNLALTFSESYGR-NVLLIDGDLRRPTTHAV
A0A2V2RJF9      L-SF-PETP-PHTILITSSRPGEGKTFVACNLAISLAQ-LDK-RVVLIDGDMRNPRVHRV
A0A2G6HNT3      S-KE-KNTS-AGTIMVTSAMPGEGKSFVAANLSLAFASGLDQ-YVLLVDGDLRRPSIQTL
A0A2V7YWD4      R-AC-PSDG-SRVIAITSPISGDGKTLTAVNLAGTIARGGQS-RVLMVDADLRRPSLAKV
A0A2V2R8T6      Q-AG-ERLQ-MRAFVITSAGIGEGKTLTALNLAWLLAQAEGV-RALIIDSDLRHPCAADY
A0A1Q7RGF1      R-AR-SAQG-LRSVVVTSATPGEGKTLTSLNLSLCCAQLHDL-RVLLIDADIRTSGLSRT
A0A2V9BLX2      R-AR-SAQG-LRSVVVTSATPGEGKTLTSLNLSLCCAQLHDL-RVLLIDADIRTSGLSRT
A0A2V9ZA03      Y-FR-KQRQ-LKKVVITSTIKGEGKSVVSANLAVTLAR--RQ-RTLLIDGDLRQSGLREL
A0A3N5ZNH4      L-SN-SGKP-PRTILVTSSIPGEGKTTTVANIGIVLAQ-TGA-RTLLVDLDMRKPALDDK
A0A2V8GEZ2      H-AQ-RDRQ-AKVLMISSAMPGEGKTLTATNLALTLTESFRR-RVLVIDADLRRPSMHHT
A0A3N5ZFD3      H-AQ-MEKG-LKIVMVVSSMAGEGKTLTATNLALTLSESYQR-QVLLVDADLRRPSLHRV
G8NXD3          T-AR-PAGG---VVLITSPSAEDGKSLNCQNLAWALAE-AGH-KTLLLDLDLRRPSLLAA
A0A2V9VR38      F-RR-SAQG-Y---------PQEGKTTTSINCAVVLAQ-KGV-RVLLIDADLRRPSIHKT
A0A2V9EY04      R-AQ-SRAG-VKTIAITSSLPGEGKTLTTMNLGLCYAQLPQQ-RVLVIDADLRTCGLTAL
A0A2V9HAK9      R-AQ-SKSG-LRSIVITSSLPGEGKTLTTMNLGLCYAQLPQQ-RVLVIDGDMRTRGLTSM
A0A1Q7FS15      R-AQ-AKTG-LKSIVVTSSLPGEGKTLTTMNLGLCYAQLPQQ-RVLVIDADLRTCGLTSM
A0A1Q7K9P1      R-AQ-AKTG-LKSIVVTSSLPGEGKTLTTMNLGLCYAQLPQQ-RVLVIDADLRTCGLTSM
A0A1Q7N989      R-AQ-AKTG-LKSIVVTSSLPGEGKTLTTMNLGLCYAQLPQQ-RVLVIDADLRTCGLTSM
A0A2V9G7Y0      H-AQ-AKSG-LRSIVITSSLPGEGKTLTTMNLGLCYAQLPQQ-RVLVIDGDMRTRGLTAM
A0A2V8T7Z1      R-MQ-PGRP-LRVIAVSSPAVGDGKTTTTVNLAVTMAQNPAA-RVLLVDADVRRPAVGRK
A0A2V7U8G5      E-AR-GARP-LRILAVTSPAAGDGKTTTSINLAATLAQTPGS-RVLLVDTDLRRPFVATN
A0A2V7UNP9      E-QL-AAKE-RKVIAITSPAAGDGKTTTAINLAATLAQSSRS-RVLLVDTDLRRPFVAAN
A0A2V7VLD7      E-QL-AAKE-RKVIAITSPAAGDGKTTTAINLAATLAQSSRS-RVLLVDTDLRRPFVAAN
A0A2V7XGA3      Q-DS-GGAK-RQVLAVTSPTAGDGKTTTAVNLAVTLAQSPGA-RVVLIDADLRRPFVATS
A0A2V7YAG6      Q-AK-GAVP-RQVLAVTSPTAGDGKTTTAVNLAATLSQLPGA-RVLLMDTDLRRPFVAAG
A0A2V7VK33      Y-LR-RSRS-LSIIAVTSPDVGDGKTTTSVNLAGTLSQDPGT-RVLLVDADLRRPSAAPL
A0A7C5EWK9      H-QA-AR---PRCLVVSSAQTEDGKSITALNIAGCLALKENT-SALLVDADMRRSKLPET
A0A3M1VTE1      H-ES-DGTP-PRVIVVTSGMPQEGKSLTAVNLALAFAACGDE-RVLLVDGDLRRGGLARF
A0A2V7TTM7      A-AG-AGNS-AQVLAVSSAAAGEGKTTTAINLAATLAQSPDM-RVLLMDTDLRRPSVASN
A0A2V8VI82      E-RR-GE---MSVIAVTSAAAGEGKTTTAINLAAALAQDAES-RILLVDADLRVPSAGRL
A0A2V7U4P9      R-RH-TDGV-ATTTAVTSPSGGEGKTTTAINLAGALAQAADQ-RVLLVDADLRRPGVAAQ
A0A2V7TQY5      E-GK-DG-G-LNVIAVSSATVGDGKTTTSINLAGTLAQNTTA-RVLLIDVDLRRGSVAAG
A0A2V7TU87      Q-AH-RTSA-LSVLAVSSATVGDGKTTTAINLAGALAQAADA-RVLLMDVDLRRPAIAER
A0A2V8SEH0      Q-RH-KDDG-LTVVAISSPTPADGKTTTAINLAGALAQDPQA-RVLLVDGDLRVPSVSEQ
A0A2V8VU54      S-RP-EGRA-LQVLAVTSAVVGDGKTTTAINLAGSLAQARDA-RVLLVDADLRRASAGLQ
A0A1Q7RML7      S-RQ-EGKA-LQVIAVTSATIGDGKTTTAINLAGALAQAREA-RVLLVDADLRRPSVALQ
A0A1Q7ZIQ5      S-RQ-EGKA-LQVIAVTSATIGDGKTTTAINLAGALAQAREA-RVLLVDADLRRPSVALQ
A0A2V8TKD8      A-RQ-EGKA-LQVIAVTSATIGDGKTTTAINLAGALAQAREA-RVLLVDADLRRPSVALQ
                                       **:      .            :::* * *       

A0A1F2U8T6      LR-LT--NERGLSHVLGG------RARLRDVIQ--------------RTVDLNLFAIT--
A0A2V8BV42      LR-LT--NDRGLSQVLIG------QARVRDVIQ--------------RTVDPNLLAIT--
A0A2V8F916      LR-LT--NDRGLSQVLIG------QARVRDVIQ--------------RTVDPNLLAIT--
A0A1Q7K833      LR-LT--NERGLSQVLIG------QARVRDVIQ--------------RTVDPNLLAIT--
A0A1Q8AMY4      LR-LT--NERGLSQVLIG------QARVRDVIQ--------------RTVDPNLLAIT--
A0A2V8BM40      LR-LT--NERGLCQVLMG------QARVRDVIQ--------------RTVDPNLLAIT--
A0A2V8CRT6      LR-LT--NERGLCQVLMG------QARVRDVIQ--------------RTVDPNLLAIT--
A0A1F2VH76      LR-MT--NDRGLSQLLAG------QARMREVVQ--------------RTHDPNLLVIT--
A0A1F2R0X5      LR-LA--NERGLSQVLVG------QARVRDVIQ--------------RTVDPNLLAIT--
A0A2V8B278      LR-LT--NERGLSQVLIG------QARVRDVIQ--------------RTVDPNLLAIT--
A0A2V8CEF9      LR-LT--NERGLSQVLIG------QARVRDVIQ--------------RTVDPNLLAIT--
A0A2V8KZG2      FG-IS--PMPGLSTYLAQ------NGKIDDLIH--------------HA-SENLYLMP--
A0A2V8TKR9      LG-IN--PAEGLSSYLTR------NIGIDRLIH--------------KLQIPNLSLLP--
A0A1Q7LG57      FG-AP--NNWGLSDVLWGDT-PLETLPISHLVR--------------ETEVAGLSLLP--
A0A2V8MKQ7      FN-IP--NVRGLTNCLSGESRDLDAL----IQT--------------SEKQPNLKLLP--
A0A1Q7L5B1      LG-VP--GAPGLTEFLQGAA-DASSI----IQT--------------DT-EGKLFFIS--
A0A2V9DKV4      LG-VP--GAPGLTEFLQGAA-DASSI----IQT--------------DT-EGKLFFIS--
A0A2V9EVA0      LG-TP--SSPGLSDYLRGDA-DEFSI----IQS--------------GT-GENLFFIP--
A0A7C5ZU39      LG-IEE-ACPGLSDFLSGQV-AFSET----LIS--------------IE-PTKLFLLP--
A0A3N5YN96      FG-VD--NEPGLTDVLAGDV-PLEEA----LIW--------------IP-EYRLTLLP--
A0A1Q7Y646      LG-ID--EPTGLSEVLAGTA-TLEES----IIR--------------LE-PAGLYLLP--
A0A2V8QZU0      LG-LD--APTGLSEVLAGEA-TLAES----IVR--------------LE-PAGLHLLP--
A0A2V8RSQ9      LA-FD--APVGLSEVLAGQA-SLNDT----IVR--------------LD-PSGLFLLP--
A0A2V9L2P7      LQ-MS--NEKGLSGILTGGY-GLQEA----LLR--------------VEDIEGLWVLS--
A0A2V7UMX0      LR-VEGVDAPGLSEAVQARL-GLDAV----MQR--------------CPPRVDLWLLT--
A0A136K497      LG-IE--TEKGLSDILTGDA-NFKDT----IVK--------------LE-PSGLYLLA--
A0A399W9E4      LG-IE--TEKGLSDILTSDA-RLQDT----IVK--------------LE-PSGLYLLA--
A0A321LMC5      LG-LK--SPHGLVDVIERRA-AVSDS----IVA--------------IK-PHGMYVLADR
A0A2V8X713      MG-AP--SAPGLSDYLNGRA-DEFSV----LQA--------------DA-KADLFLIP--
A0A2V8ZLE9      LG-AP--AAPGLSDFLGAKV-DEFSI----LQA--------------DP-KFELFFVP--
A0A2V8Y4D3      LG-AP--SAPGLSDYLSGKA-DEFSI----LQA--------------DP-KVELFLVP--
A0A2V8Z2X8      LG-AP--SAPGLSDYLSGHA-DEFSI----LQA--------------DP-KVELFLVP--
A0A2V9C3F6      LG-AP--SAPGLSDYLSGRA-DEFSI----LQA--------------DP-KVELFLVP--
A0A2V9QMU9      LG-MG--PRTGLSSVLTGSA-NVQQT----IVR--------------SALLPSLFILP--
A0A2V9QY75      LG-MG--PRVGLSNVLTGGA-TSQQA----TVR--------------SPILPNLFILP--
A0A2V9SVU9      LG-MG--PKTGLSNVLTGNA-TLQQA----TVR--------------SSILPGLFILP--
A0A2V8W5N5      LG-AP--MAPGLTDYLRGEA-DEMAA----IQY--------------SD-NENLCFMP--
A0A2V8XG53      LG-AP--MAPGLTDYLRGEA-DEMAA----IQY--------------SD-NENLCFMP--
A0A6A7LB89      FQ-VG--NASGLSDGLRRES-PTTFP----TLE--------------IS--DALALLP--
A0A352EZH8      LA-ID--APRGLSEILGGEL-SLRDA----IVR--------------LD-PAGLYLLP--
A0A0B6X033      LG-LD--RRPGLSEVLAGEA-ELDAT----IVR--------------LE-PAGLYLLP--
A0A2V8R0I3      LG-IE--TDCGLSEVLTGVT-RLTEA----ILK--------------LN-PAGLHVLP--
A0A2V8N1U8      LG-IE--TERGLSEVLTGET-RLAEA----IVR--------------LN-PAGLHVLP--
A0A2V8QL35      LG-IQ--TEVGLSEVLTGET-KLTQA----ILK--------------LE-PSGLHLLP--
A0A352FU10      LG-IQ--TECGLSEVLTGET-KLTQA----ILK--------------LE-PSGLHLLP--
A0A2V8LCU0      LG-IE--TEVGLSEVLTGET-KLTEA----IVK--------------LK-PSGLHLLP--
A0A1Q7NGT0      LG-IE--TDCGLSEVLTGET-KLLEA----IVK--------------LQ-PSGLHLLP--
A0A2V8MLP9      LG-IE--TDCGLSEVLTGET-KLLEA----IVR--------------LR-PSGLHLLP--
A0A2V8PQZ0      LG-IQ--TDCGLSEVLTGET-KLLEA----IVR--------------LR-PSGLHLLP--
A0A3B9MKY6      LG-ID--APIGLSEVLGGAV-RPEEA----IVR--------------LD-PAGLYLLP--
A0A3D5SKZ1      LG-ID--APIGLSEVLGGAV-RPEEA----IVR--------------LD-PAGLYLLP--
A0A2V8NRW2      LG-IE--DAIGLSDVLSGEA-TLEEA----ILH--------------LN-PSGLYMMP--
A0A2V9XV04      LG-AP--KGPGLAEYLLGKA-DEASV----IQR--------------GP-MEGLFFMA--
A0A2V9CBY1      LG-AP--SAPGLSDYLAGES-DESAV----IQA--------------GA-QEGLFFIP--
A0A2V9D656      LG-AP--CAPGLSDYLAGES-DECSI----IQA--------------DS-QEGLFFIP--
A0A7C2L7W9      LN-VK--NYPGLSAYLTRPL-EVDAV----VLH--------------QP-AENLFVIP--
A0A7C2XG00      LN-VK--NYPGLSAYLTRPL-EVDAV----VLH--------------QP-AENLFVIP--
A0A2V9J901      VG-VK--NSPGFVQCLTG------HVELAEAVL------------PAPG-VPNLSVIP--
A0A2V8QJ59      FN-IS--NARGLTNCLSG-----EASEIDSVIQ------------SYAQ-LPNLKVLP--
A0A1Q7HTA7      LGLGD--SLPGLAELALG-----SRAGLDDTVR-------------WCP-PSRLCVLP--
A0A2V8YMQ4      FC-IREN--LGLVSYLT------GQEDWRTAVC------------P-SG-SPGLDLLP--
A0A2V8W380      FG-IDRS--LGLVSYLT------GQQDWRAVVH------------P-SG-SRGLDLLL--
A0A2V8ZIV5      FG-MREK--LGLVSYLT------GQQDWREAVR------------P-SG-SPGLDLLL--
A0A7C2M3P5      FK-MAGG--RGLVSYLT------GQQEWEAVVH------------P-SP-VENLDLVI--
A0A2V8LBV1      FE-MDNR--WGLTDILQADI-EIQEYPLEMLVQ------------Q-TV-VPNVYITG--
A0A2V8GAF9      LG-LGSQRSPGLVEAILD-----PQYTLQRVVR------------R-LE-GFNLSVLP--
A0A7C5I7P7      FE-LPNE--EGLSTLLQMKE-PLKGRALPAAVQ------------E-TE-VPGLFVLT--
A0A2V8CN98      LG-AVRR--PGLTDFLA------GHVSFEGLIQ------------T-LK-FGSLQFIG--
A0A1Q7LC46      LN-LGTGKYAGLSSYLA------GVSSLDLVSV------------PHPA-IPNLVAIP--
A0A1Q8BDC5      LG-VTPE--PGLLQYL-------ASTNMSPYCY------------V-RR-IESLYFLT--
A0A2V9Q1Y8      LG-MGPR--AGLSNVLT------GGTTLQQATV------------RSTL-LPNLFILP--
A0A2V8JXG1      FG-TSRT--LGLSTYLA------RNVEIDELIQ------------D-LP-GENLRMIS--
A0A350D2W9      FK-MKNH--EGLTSYLA------LDLPVQKLIK------------P-TM-VPSLYLIN--
A0A2V9I4J1      LG-VSVE--PGLSGYL-------ENGHLQPYCY------------M-RR-FKNLYIMT--
A0A2V8PQZ9      LG-IETD--CGLSEVLT------GETKLLEAIV------------K-LQ-PSGLHLLP--
A0A2V8D8B1      FE-MAQE--PGLSNLLV------GDTKTAEAVK------------Q-TR-SKGLWVLP--
A0A3B9LSB4      FG-LSDR--AGLSSILSSDV---SEADMLEMVS------------T-DE-ATGLRVLT--
A0A2V9H7U2      LD-IDDG--EGLASFLT------GAHSIEAALR------------QFSP-VPTLWVLP--
A0A2V8NJB5      LG-VTEG--PGLLQYL-------SNGRLAPHCY------------V-RR-LENLFFLT--
A0A2V9JMZ4      LG-VSVE--PGLSGYL-------ENGHLQPYCY------------M-RR-FKNLYIMT--
A0A2V9MDJ6      LG-VSVE--PGLSGYL-------ENGHLQPYCY------------M-RR-FKNLYIMT--
A0A2V8QJT6      FD-LPER--EGLSSILASDT---TADDMLRSVV------------R-DV-SSGLFIMP--
A0A2V8FSM8      FS-VDND--HGLSNLLMEPE-PLDAAALEGGCV------------P-TQ-VPNLFLLP--
A0A359M0J2      FGSIPEV--DWTSLVMDDAP---ITAERIEPLL------------QATD-FEGLSLLA--
A0A2V8JLJ1      LG-TPSREGKNLGAIL---R---GRSKVEESLE------------R-CE-DLNLYFLS--
A0A5M8SND8      FD-LPNE--RGLANMLESPS---DEVALQAMTK------------R-TF-VGGVDVLP--
A0A2V9GAQ1      LN-LASGNYAGLSSYL---A---GVSSLDLVSV------------PHPA-IPNLVAIP--
A0A497EDQ8      MK-VKNM--RGLTSLV---L---GESQLKDVIH------------GLAD-VPNLDMVT--
G8NS05          LG-LNGK--VGLTSVL---T---GSHTLEQAIQ------------NVPE-MPSLDILV--
A0A2V8KZ20      LG-TPSREGKNLGAIL---R---GRSKVEESLE------------R-CE-DLNLYFLS--
A0A3D0NWU2      FD-LENS--EGLTNYLSGDR---NTKNLIKACR---------------D-LPRLKVIT--
A0A2V8EPD9      FG-LPPV--GGLTEAL-------TADEDRQIVL------------T-RV-SDSLFVLP--
A0A3N5NSX5      LG-IENN--VGLSHLL---T---GQATARQAIH------------R-TN-VQNLWVMT--
A0A2V8MUA1      LGIIDAGRGKGLADVL---R---GSATLEESLV------------E-CS-DLNFSLLP--
A0A2V8MBH9      FD-LPER--EGLSSILSSEI---KPEDMLHAIH------------R-DE-ATGLNVLA--
A0A3N5ZPQ7      LG-IPPE--PGLIGYL-------STNLLRPYCF------------M-RQ-VQGLFVLA--
A0A3N5P5F2      FD-VELS--PGLSQLIVGSA---KAE----VIR------------R-SR-IPNLWIVP--
A0A7C2EFE5      FN-ISGA--AGLSDVLVGER---GWREL--LSR------------P-EG-LPNLAILP--
A0A2V9G1P7      FG-TSGS--LGLVSYL---T---GQQDWRAVVR------------P-SG-SRGLDLLV--
A0A2V9BCK9      MG-APSA--PGLTEYL---R---GEADEFSIIQ------------A-DS-KDDLFFIP--
A0A2V9TMX2      FG-IRAH--GGLSTLISGSS---NAEE--VILP------------S-SE-VPNLWILP--
A0A7C4DQP8      FG-LGRQ--QGLSGYL---S---GRVEWMDVVQ------------P-TG-VPGLDALV--
A0A2V8N2J7      LK-LSVPTDKGFHNLLVHSD---GNPDRYVM-----------------Q-FKQLYVIP--
A0A3N6BI26      FG-YNGN--QGISAYL---S---GNGDLSSQIR------------Q-TS-YPNLFLLP--
A0A2V9JMM3      LG-IEPR--PALSNLL-------QDPERDIYRE------------A-VR-LKDLFVIP--
A0A2V9M815      LG-IEPR--PALSNLL-------QDPERDIYRE------------A-AR-LKDLFVIP--
A0A2V9A795      FC-IREG--LGIVSYL---T---GQQDWRAAVR------------P-SG-SPGLDLLP--
A0A355ESH9      FK-LSNR--SGLVNQL---T---GTAELDAVIF------------P-TE-VPNLWVIP--
A0A3D0NW85      FG-VSNG--EGLSTILSSEM---SENEILGVIQ------------Q-EP-STKLNLLT--
A0A353CAT5      FN-ITNG--IGLSTLLSSEL---SEAEILKAIR------------T-DD-GTKLNLLT--
A0A2V9HB55      LN-LGGGKYAGLSSYL-AGV---SSLDL-VCVP------------H-PT-IANLVAIP--
A0A2V8CU57      FR-IAND--TGLVDVL-RKT---ETRRLPLCRA------------S-ET----LWILT--
A0A2V8BDI4      FR-IAND--TGLVDVL-RKT---ETRRLPLCRA------------S-ET----LWILT--
A0A2V8F8T3      FR-IAND--TGLVDVL-RKT---ETRRLPLCRA------------S-ET----LWILT--
A0A2W0B5E2      LG-IQ--NERGMSTHLTG------HDSINDVIQ------------QYKE-QPNLWLIP--
A0A2V8NMG8      FD-VE--NRNGLSTILSSEM---KEAEVLALIQ------------QHEE--SGLHLMT--
A0A2V8TBM7      FG-LP--NSRGVTNYLSG------DSQVADLVQ------------TYER-MPNLKVIT--
A0A1Q7HEZ8      LG-IGAADPRGLVDAIAD------TNVWLDQVTRQVDGF-------------NLSVIP--
A0A1Q7JW36      LG-IGAADPRGLVDAIAD------TNVWLDQVTRQVDGF-------------NLSVIP--
A0A1Q7MUR4      LG-IGAADPRGLVDAIAD------TNVWLDQVTRQVDGF-------------NLSVIP--
A0A3N5PFU4      LH-I-PQGAAGFADLVVS------ARASLGEAVRPLDGF-------------NVDVLP--
A0A3M1SNQ5      LG-IE--PDKGLAHVLSG------EIKLRESIC-----R--------LE-PSSLHLIA--
A0A7C2C0C1      LG-IK--PDKGLAHLLSG------EINLQESIC-----R--------LE-PSGLHLIA--
A0A4R1LDF1      LG-IK--ESSKASSYITA------PDWHECIW---------------GL-KPNLHALV--
A0A1F2T1R8      LG-IET-TGPGLADVLSG------NRDAAEVFR-----R--------IE-PFNLSVLP--
A0A2V9BW09      LG-IP--PMAGLGEVLQG------RLDVRAAIR-----R--------LD-PSGLYYLP--
A0A3M1SSE1      FN-IS--NREGLSNLLSS------EIKRDKVLD----------SIYFDM-SSRLYLLP--
A0A2V9GQV7      LD-HP--NSPGLAEILSG------DVAPDEAIV-----A--------TN-QKNLFILP--
A0A7C5AUB2      FQ-IE--RSPGATDYLAG------NASLSQVIR-----K--------VA-GANLYLMT--
A0A2V8YCY6      LN-LGTGKYAGLSSYLAG------VSSLDLVSV------------PHPA-IPNLVAIP--
A0A2V8EGM3      TN-LAKAE--GLSEIIAA------ADERRVPLV--------------QL-TETLTLLP--
A0A2V8FGH1      TN-LAKAE--GLSEIIAA------ADERRVPLV--------------QL-TETLTLLP--
A0A2V7YV88      FG-RI--RNVGLSNLTVQ------DADEREAIT------------AVEE-VPNLWLMT--
A0A2V8D468      FD-VE--QEPGLSNLMVG------TAQSREAMH-----P--------SG-VKDLWILP--
A0A1F2R977      LG-LP--NTTGLGDGLRS------ERVQIPFYE---------------L-SPTLTVLP--
A0A2U3LF12      LG-LK--DPSGFSDLLAL------TDREVSPFV--------------SK-AGNLHVMP--
A0A7C5MF19      LG-VP--EAPGLSDVLLG------RCPLEDAIV-----R-------LQP-LSGLFFLP--
A0A3N5G7M6      FN-VK--SEPGLTDFLIG------EGRIANLIR-----R--------TR-IPRLHLLT--
A0A1F2S3Q7      LA-IPG-GGLGLADALGS------GRGA-ADVVRTVDGC-------------LLDVIP--
A0A2V8GVG4      LA-IDE-LSQGLTEVVEN------AQTSLGAVTQKLKPF-------------NLSIVT--
A0A2V8PJQ0      FN-IS--NVRGLTNFLSG------ELPLDEVIQ------------PFEK-LPNLKLLP--
A0A2V8H566      FD-LP--NVSGLNDVLYA------RDAALRCEL-----F--------TM-TAQLCVLT--
A0A2V8UVN4      LG-IS--GEPGLADVLMG------TCRLEDAIV-----R-------LEQ-FPNLCVLP--
A0A1Q7RB73      LG-AS--RSPGLSDYLSG------AKDELAILQ-----R--------GP-LENLFFIA--
A0A2V9K0H7      LG-AS--RSPGLSDYLSG------AKDELAILQ-----R--------GP-LENLFFIA--
A0A321LXF5      LG-RA--GAAGLADILES------DCAYDQAVL-----Q--------TD-VPDLYVLP--
A0A5M8SBZ0      LG-AP--CNPGLPDYLAG------TASAFSIVQ-----Q--------SP-VPDLFFIP--
A0A1Q7JFB1      FQ-VK--NVTGLTDSLKA------ENDRRLPLI--------------QA-SAYLSLLL--
A0A2V9LS17      LG-TP--AVPGLAEYLSG------EANELSVIQ-----R--------GP-LENLYFIP--
A0A7C2YLF6      FG-TT--MKPGLSDYLMG------DADELSVVQ-----R--------GP-FENLFLIP--
A0A2V7X0V9      LG-TT--AGPGLSEYLQG------KNDEFSIMQ-----R--------GP-LENLFFIP--
A0A2V9X518      LG-TS--STPGLSEYLLG------ES-----VQ-----R--------GP-MENLFFIP--
A0A2V9VC62      LG-TT--SSPGLADYLLG------ESDEFSIMQ-----R--------GP-MENLFFLP--
A0A2V9S1P8      LG-TS--SSPGLSDYLLG------EKDEFAVMQ-----R--------GS-MENLFFIP--
A0A2V9RTW2      LG-TS--ATPGLAEYLLG------ENDEFGIMQ-----R--------GA-MENLFFIP--
A0A2V9TGF1      LG-TS--ATPGLAEYLLG------ENDEFGIMQ-----R--------GA-MENLFFIP--
A0A2V9XEV6      LG-TS--STPGLSEYLLG------ESDEFSVMQ-----R--------GP-MENLFFIP--
A0A2V9Y3Q6      LG-TN--FTPGLSEYLLG------ESDEFSIMQ-----R--------GP-MENLFFVP--
A0A2V9R269      FG-AE--IGPGLGDYLRD------EADEYSIIQ-----R--------GS-MENLFLIP--
A0A2V9PTS3      VG-AE--PGPGLSEYLAS------ESDEFSILQ-----R--------GP-MENLFLIA--
A0A2V9NPF4      VG-AE--PGPGLSEYLAS------ESDEFSILQ-----R--------GP-MENLFLIA--
A0A2V9PNZ0      VG-AE--PGPGLSEYLAS------ESDEFSILQ-----R--------GP-MENLFLIA--
A0A2V9AGR3      LC-AP--KSPGLTNCVRG------ETDEFSVIQ-----I--------GA-QSNLAFLP--
A0A2V9G0N7      LG-AP--STPGLTDYLRG------EVDEYAIIQ-----S--------GP-DENLCFIP--
A0A2V9GQ44      LG-AP--STPGLTDYLRG------EVDEYAIIQ-----S--------GP-DENLCFIP--
A0A2V9HRN3      LG-AP--STPGLTDYLRG------EVDEYAIIQ-----S--------GP-DENLCFIP--
A0A2V8WG13      LG-AP--GGPGLTDYLRG------EAEKEAVIQ-----N--------GL-EGNLCFIP--
A0A2V8X987      LG-AP--SRPGLTEYLRG------EADEYSIIQ-----K--------GM-EGNLFLIP--
A0A1Q7KX94      FG-AP--SCPGLSDYLRG------DADEYAVIQ-----K--------GT-KENLFLIP--
A0A2V8XHT0      FG-AP--SCPGLSDYLRG------DADEYAVIQ-----K--------GT-KENLFLIP--
A0A2V8DMJ9      LA-LPRTSFPGLAEAILD------PAYDLAAVVRCLDTF-------------NLSVLP--
A0A2V8GGF6      LG-LEARRSPGLADLLRD------PDYEIDQVTHRLERF-------------NLSVVP--
A0A2V8HKU7      LG-LEARRSPGLADLLRD------PDYEIDQVTHRLERF-------------NLSVVP--
A0A1Q6Y875      LG-AP--SSPGLSDYLRG------DADEFSIIQ-----S--------GT-GENLFFIP--
A0A523DJA9      LG-LA--NSIGLSHVLVG------QARIREAIQ-----R--------TH-DPNLFVVT--
A0A2V8I604      FG-LQ--QSPGLVDILMG------GSTLEESLV-----S--------IA-EHHLTILP--
A0A2V8J066      FD-LP--EAPGLTDVLMG------GATLDDALV-----T--------LA-DHHLTVLP--
A0A1I6MMC5      LG-AP--CEPGLTDYLSG------NASMFDVMQ-----RAHASDGMPSA-LSSLTFIA--
A0A2V9D5W7      FG-AP--NALGLSDYLGG------RADELAIIQ-----S--------GH-EGNLYLIP--
A0A2V9D4I4      LG-AP--AAPGLSDYLRG------DANELAVTQ-----S--------GQ-EGNLWFIP--
A0A2V9D6L7      VG-AS--AAPGLSDYLRG------DIDEVAAIQ-----S--------GQ-DSSLYLIP--
A0A2V8ZJV2      FG-AP--ICPGLSDYLRG------DVDEYAIVQ-----K--------GM-NESLFLIP--
A0A2V9AWB5      FG-TQ--GRPGLSDYLRG------DADEYAVIQ-----K--------GM-SKNLFLIP--
A0A2V8Z1Y8      LG-AP--SSPGLTDYLLG------DADECAIIQ-----Q--------GL-QPNLFLIA--
A0A1Q8AX10      MG-AP--SAPGLTEYLRG------EADEFSIIQ-----A--------DS-KDDLFFIP--
A0A2V9A773      LG-AP--SAPGLSDYLGG------RADEFSILQ-----A--------DP-KVELFLVP--
A0A2V9AND3      LG-AP--SAPGLSDYLNG------RADEYSIIQ-----A--------DP-KVELFLVP--
A0A2V9BTJ7      LG-AP--RSPGLSDYLLG------MADEFRVVQ-----K--------GS-ESNLCFIP--
A0A2V8W2M7      LG-AP--TSPGLTDYLRG------EANEYDVIQ-----H--------SS-EVNLCFIP--
A0A2V8XNW2      LG-AP--TSPGLTDYLRG------EANEYDVIQ-----H--------SS-EVNLCFIP--
A0A1Q7CJC1      LG-AP--TSPGLTDYLRG------EANEYDVIQ-----H--------SS-EVNLCFIP--
A0A2V9UEM7      LG-AS--QTPGLSEYLMG------ECDEFAIMQ-----R--------GP-MDNLFFVP--
A0A7C4DTF2      LG-TN--LYPGLSDYLRG------DADLFSIVQ-----R--------SP-QGNLFFIP--
A0A1Q7V300      LG-AE--SGPGLSEFLKG------EMDEFTIIQ-----S--------GP-MENLFLIP--
A0A2V9ZCI3      LG-CP--NTPGLSNYLMG------ENDEFAVVQ-----R--------GP-LENLFFVP--
A0A2V9WCB3      LG-TP--MGPGLSDYLQS------KNDEFSIIQ-----Q--------GP-MENLFFMP--
A0A2V9VQW5      LG-TT--SSPGLADYLMG------ESDEFSIMQ-----R--------GP-MENLFFVP--
A0A2V9WTP3      LG-TS--SAPGLSDYLQG------ANDEFSIMQ-----R--------GA-LENLLLIP--
A0A2V9NLA9      LG-TE--SSPGLTEYLLG------EADEFAILQ-----R--------GP-MDNLFFIP--
A0A2V9RKJ9      LG-TE--SSPGLTEYLLG------EADEFAILQ-----R--------GP-MDNLFFIP--
A0A2V9RN95      LG-TA--SSPGLSEYLLG------EADEFGAIQ-----R--------GP-MDNLFFIP--
A0A2V9N406      LG-TA--SSPGLSEYLLG------EVDEFGAIQ-----R--------GP-MDNLFFIP--
A0A2V9U6D9      LG-TA--SSPGLSEYLLG------EVDEFGAIQ-----R--------GP-MDNLFFIP--
A0A2V8DZN4      FS-VD--NDHGLSNLLME------PEPLDAAALEGGCVP--------TQ-VPNLFLLP--
A0A3N5YKY1      FG-VD--NEPGLTDVLAG------DVPLEEALI-----W--------IP-EYRLTLLP--
A0A2G6HQA4      FG-RD--EDFGLVNYLEH------QTALPKLIV-----R--------SR-KPKLSLLL--
A0A2V7ZTY7      FQ-LK--NAGGLSECLTA------EIE-RRLPL-----V--------QA-TPYLSLML--
A0A2V7ZVL9      FQ-LK--NAGGLSECLTA------ETE-RRLPL-----V--------QA-TPYLSLML--
A0A1Q7QYI4      FQ-VK--NVTGLTDSLKA------END-RRLPL-----I--------QA-SAYLSLLL--
A0A2V8G9Y9      FD-VP--NVLGLSDGLKS------EVE-HKLSL-----I--------QI-SEHLTVLP--
A0A143PNR5      FR-AP--ETSGLSEGLDA------ATA-SRVSA-----I--------QL-SPLLALLP--
A0A6A7L078      FQ-VP--NVSGLNEALQA------AAD-EKLST-----L--------RV-SDTLTLLP--
A0A143PXU3      FH-VS--GAHGLLDALRA------EAE-DVPAV-----V--------PV-TGTLSLLP--
A0A2V8D8G9      LD-IP--NDRGLSEALR-------DGR-HELPF-----V--------EV-SSRLSVLT--
A0A2V8ESQ4      LD-IP--NDRGLSEALR-------DGR-HELPF-----V--------EV-SSRLSVLT--
A0A1E3Y5Q0      FG-LP--VSPGLTEGVV-------GTD-AALSL-----H--------RV-SPTLTVIT--
A0A2W4TWK5      FG-LP--GEGGLTAAFAP------RSD-HRIRL-----H--------RI-TPHLTVLT--
A0A3N5NYV3      LE-VP--NILGSGIGSKQ------ETD-QKLSL-----I--------QV-SPRLSVLT--
A0A2V2RJF9      WGI---RNDTGLSRFLTSDV----KAGEVIRPS--------------KVK--GLSLIT--
A0A2G6HNT3      FGR---KENFGLVDYLQQQG----SLPELIVRS--------------RKP--KLSLLL--
A0A2V7YWD4      LGHSNVHRGWGLVDAILDRR----LSLEQIAWP--------------LQPF-NLSVVT--
A0A2V2R8T6      LGI---DAPVGLAEVLGGQA----RFEDAIVRL--------------DPA--GLYLLP--
A0A1Q7RGF1      LGF---PPGPGLVDVLSGKC----EPRNAILAT--------------DIP--NLYTLG--
A0A2V9BLX2      LGF---PPGPGLVDVLSGKC----EPRNAILAT--------------DIP--NLYALG--
A0A2V9ZA03      LTT---HGLPGITDWWQETA----DVSEFL--R--------------RVNGFPLWYLP--
A0A3N5ZNH4      FNC---RGEKGMSSYLSGN-----SDLSSLI-R--------------PTAYPNLFILP--
A0A2V8GEZ2      FGL---PNNTGLNDALLGR-----DNMPTAFEM--------------SS---RLTVLP--
A0A3N5ZFD3      FGL---PNATGLNEALTEEA----GNPPALFSI--------------SP---QLTLLA--
G8NXD3          LG----GVCPQSIEQVLKGE----VTPEAAI-R--------------SVGDLPLYIIG--
A0A2V9VR38      LGM---GPHSGLSNVLTGST----TTEQAIT-R--------------TTILPNLFVLA--
A0A2V9EY04      LDH---PCTLGLAEVLAGKA----TLEEAMVAT--------------NQK--NFFVLP--
A0A2V9HAK9      IDH---PSSPGLAEILSGDV----APDEAIVAT--------------NQK--NLFILP--
A0A1Q7FS15      LDH---PSTPGLAEVLAGEV----TPDEAIVAT--------------NQK--NLFVLP--
A0A1Q7K9P1      LDH---PSTPGLAEVLAGEV----TPDEAIVAT--------------NQK--NLFVLP--
A0A1Q7N989      LDH---PSTPGLAEVLAGEV----TPDEAIVAT--------------NQK--NLFVLP--
A0A2V9G7Y0      LDH---PNSPGLAEILSGDV----GPDEAIVAT--------------NQK--NLFILP--
A0A2V8T7Z1      LGLGK-VRLPGLVELIADPS----LGIGGLARR--------------VGPA-NLSVLL--
A0A2V7U8G5      LGL-S-PDRPGLAEAAIDEG----LQLSDVV-Q--------------STPY-NLAVLP--
A0A2V7UNP9      LGL-D-MDAPGLADAVRDEQ----IDLAAVV-Q--------------ATPY-TLAVVP--
A0A2V7VLD7      LGL-D-MDAPGLADAVRDEQ----IDLAAVV-Q--------------ATPY-NLAVVP--
A0A2V7XGA3      LGLDD-RRGPGLAATALDPK----LELEQLV-R--------------PTPF-NVDVVP--
A0A2V7YAG6      LGLED-GSAPGLATMALDPD----LELDQMV-R--------------RTPY-NFDIVP--
A0A2V7VK33      LGFGDRGDGPGLAGAILDSH----RSLASVV-R--------------ARPPFNLSVLP--
A0A7C5EWK9      LGIAR-T--PGLAE-VLEGR----VAVEQAVVR--------------LEPFSDLFFLP--
A0A3M1VTE1      L--EP-APRAGLRELLEGKV----PEEEALL----------------EVSGTRLAVVP--
A0A2V7TTM7      LALGS-SAGTGLAGAVLDPR----VELATVV-R--------------PTPF-GFSILP--
A0A2V8VI82      LGLGD-DL-PGIADAVREPG----ALLEDFVRR--------------RPPS-RLSILP--
A0A2V7U4P9      LRIAS-TA-PGLAEAVADGA----RPLDELC-Q--------------QVAGFNLWVLP--
A0A2V7TQY5      LRLRA-PEANGLVDAILTPG----LDLSAVV-R--------------ELPEFRLSVVP--
A0A2V7TU87      LGLEE-GR-HGLVDAILSHD----LKLADVARP--------------CGPL-NLAVVT--
A0A2V8SEH0      LGLGE-VAGPGLVEAILDPG----RSLDDVV-R--------------DLPLFNLSVLP--
A0A2V8VU54      LGLED-PRGAGLADAILDPD----RSLPGLV-Q--------------SLPA-NLGILP--
A0A1Q7RML7      LGLDD-PRGAGLADAILDPE----RSLESVILR--------------RLPL-NLGVLT--
A0A1Q7ZIQ5      LGLDD-PRGAGLADAILDPE----RSLESVILR--------------RLPL-NLGVLT--
A0A2V8TKD8      LGLDD-PRGSGLADAILDPE----RSIESVILR--------------RLPL-NLGLLT--
                                                                     .      

A0A1F2U8T6      --AGPTP-SEPSELLASERMKMLLSSLAQGPF--D--WIIIDTPPVLGVSDAVVLTPLVT
A0A2V8BV42      --AGKMP-PNPSELLASERMRTLLTNLAHGPF--D--WIIIDTPPVLAVTDAVILAPMVS
A0A2V8F916      --AGKMP-PNPSELLASERMRTLLTNLAHGPF--D--WIIIDTPPVLAVTDAVILAPMVS
A0A1Q7K833      --AGRTP-PNPSELLASERMKTLLTNLSHGPF--D--WIIIDTPPVLAVTDAVILAPAVS
A0A1Q8AMY4      --AGRTP-PNPSELLASERMKTLLTNLSHGPF--D--WIIIDTPPVLAVTDAVILAPAVS
A0A2V8BM40      --AGSTP-PNPSELLASERMKTLLTNLSHGPF--D--WILIDTPPVLAVTDAVVLAPMMS
A0A2V8CRT6      --AGSTP-PNPSELLASERMKTLLTNLSHGPF--D--WILIDTPPVLAVTDAVVLAPMMS
A0A1F2VH76      --AGRTP-ANPSELLAADRMRALISGLENGPF--D--WVIIDTPPVLAVTDAVIIAPLVA
A0A1F2R0X5      --AGRPP-SNPSELLSSERMKTLITNLRSGPF--D--WIVIDTPPVLAVTDAVILAPLVN
A0A2V8B278      --AGRTP-PNPSELLSSERMKTLLTNLAHGPF--D--WIIVDTPPVLAVTDAVILAPLVS
A0A2V8CEF9      --AGRTP-PNPSELLSSERMKTLLTNLAHGPF--D--WIIVDTPPVLAVTDAVILAPLVS
A0A2V8KZG2      --AGPTP-PNPAELLSSGKMKRLIEIMAE-RY--D--HVVIDTPPLGSVTDPVILSTMVD
A0A2V8TKR9      --CGPIP-PNPAELISSARMRDLLKEMAA-RY--D--HILIDSPPMMNVTDPVILSRMVD
A0A1Q7LG57      --GGSCG-ITPTNLFYSPRMARFLKRMRK-EF--E--MVMIDAPPMIHLADARVLGRHAD
A0A2V8MKQ7      --LGPIP-PNPAELLGSDEMRRLLASLSE-KF--T--HIVVDSPPAISFTDASILSTVVD
A0A1Q7L5B1      --AGSAV-SNPTELLSTERLECFLRQMAA-LF--D--WVIIDAPPVLPVSDAIVLAGRCD
A0A2V9DKV4      --AGSAV-SNPTELLSTERLECFLRQMAA-LF--D--WVIIDAPPVLPVSDAIVLAGRCD
A0A2V9EVA0      --AGRPV-SNPTELLGSTRAKSLFERLNT-LF--D--WVIVDTSPVLPVSDATVLAPMCD
A0A7C5ZU39      --AGQSR-NDVPELLVNDAYLKLRILAER-HF--D--LVIVDTPPIGFFSDASSVIEMFD
A0A3N5YN96      --AGRPT-NQPTELLGSFEMRRAVDTLRT-HF--D--RIVIDTPPALALADVGVVGPLSD
A0A1Q7Y646      --GGEPR-DDVAELLSGPKFDKVLAEARR-MF--D--YIIIDAPPMGIFTDANLLINSAD
A0A2V8QZU0      --GGAAR-DDVAEMLSGPKFSAVLKEARR-MF--D--YVIIDAPPLGIFTDASVLINRAD
A0A2V8RSQ9      --GGTPR-DNVAELLSGPKFSAVLAELRR-SF--N--YIIIDAPPLGIFTDATVLINRAD
A0A2V9L2P7      --SGPNP-PNPAELLCSTKMQELLKQMRE-RF--D--HVIVDSPPVLPITDATILSSRVD
A0A2V7UMX0      --AGRPP-EDPYDVIRSPHFADLLEEARR-RF--D--FVVIDTPPILPVPDGREIARWVD
A0A136K497      --GGAAR-PDVAELISGPKFAEILAEARE-MF--D--YVIIDAPPLAIFTDATVLINKAD
A0A399W9E4      --GGTAR-PDVAELISGPKYAELLAEARE-MF--D--YIIIDAPPLAIFTDATVLINKAD
A0A321LMC5      SNGDIPN-LSAGDILTTSRVEGVLDELES-AF--D--FVVIDAPPITDFADAQRLAALAD
A0A2V8X713      --AGRFV-PNPAELLANGLLKGLLDRVSP-LF--D--WVILDAPPVLAVSDAGVLAGLCD
A0A2V8ZLE9      --AGRPV-PNPSELLANGMLKAFIHGISP-VF--D--WVIVDAPPVLAVADAGIIADFCD
A0A2V8Y4D3      --AGKPV-PNPSELLANGMLKSFIDGVSP-VF--E--WVIVDTPPVLAVADAGIIAEFCD
A0A2V8Z2X8      --AGRPA-PNPSELLANGMLKGFIDKIGP-IF--D--WVIVDAPPVLAVADARIIAEFCD
A0A2V9C3F6      --AGRSA-PNPSELLANGTLKRFLDGMSP-IF--D--WVIIDAPPVLAVADPSIIAEFCD
A0A2V9QMU9      --AGPPP-PNPAELLSSGNMKKVLDELRE-QY--D--HIVVDTPPTLSVTDPVILSTRAD
A0A2V9QY75      --AGTPP-PNPAELMASQQMFDLLAELRE-QY--D--HIVIDTPPTLSVTDAVVLSTRSD
A0A2V9SVU9      --AGTPP-PNPAELLASSNMKDVLAELRE-QY--D--HIVVDTPPTLSVTDAVVMSTRAD
A0A2V8W5N5      --GGKQV-TNPSELLSNGRLKILLDRLTP-IF--D--WIIVDSSPCLLVADASMVAGVSN
A0A2V8XG53      --GGKQV-TNPSELLSNGRLKILLDRLTP-IF--D--WIIVDSSPCLLVADASMVAGVSN
A0A6A7LB89      --AGRPD-PDPMAGLTSARMRQLIEEARL-KF--D--WVVIDTPPVTLMPDAKLLAGMVD
A0A352EZH8      --GGQAR-EDVAELLSGPTFAGVIAEARR-LF--D--FIIIDAPPLGIFTDANVLISRAD
A0A0B6X033      --GGSER-NDVAEMLSGPRFSSVLAEVRR-MF--D--YIVIDAPPLGIFTDATVLINRAD
A0A2V8R0I3      --GGASR-EDVAELLSGPRFARLLDEARK-LF--D--YIIIDAPPLGIFTDANLLINRAD
A0A2V8N1U8      --GGAAR-EDVAELLSGPRFGRLLDEARK-MF--D--FVIIDAPPLGVFTDANLLINRAD
A0A2V8QL35      --GGAAR-EDVAELLSGPRFGRLLEEARK-LF--D--YIIIDAPPLGVFTDANLLINRAD
A0A352FU10      --GGAAR-EDVAELLSGPRFGRLLEEARK-LF--D--YIIIDAPPLGVFTDANLLINRAD
A0A2V8LCU0      --GGAAR-EDVAELLSGPRFGRLLEEARR-LF--D--YIIIDAPPLGVFTDANLLMNRAD
A0A1Q7NGT0      --GGAAR-EDVAELLSGPRFGHLLDDARK-MF--D--YIIIDAPPLGVFTDANLLINRAD
A0A2V8MLP9      --GGAAR-EDVAELLSGPRFGHLLDDARK-MF--D--YIIIDAPPLGVFTDANLLINRAD
A0A2V8PQZ0      --GGAAR-EDVAELLSGPRFGHLLDDARK-MF--D--YIIIDAPPLGVFTDANLLINRAD
A0A3B9MKY6      --GGKAR-DDVAELLSGPSYARILTDVRR-MF--D--YIIIDAPPLGIFTDANVLMNRAD
A0A3D5SKZ1      --GGKAR-DDVAELLSGPSYARILTDVRR-MF--D--YIIIDAPPLGIFTDANVLMNRAD
A0A2V8NRW2      --GGEAR-DDVAEILSGPKFGQLLAELRR-MF--D--YIIIDAPPLGIFTDATVLINRAD
A0A2V9XV04      --SGESI-EDPAEMVASSRLKVLLQRIEP-VF--D--WIIIDSPPAIPVSDASVLAKACD
A0A2V9CBY1      --GGKPR-SNPAELLANNKLRALFSRVLA-LF--D--WIIVDAPPALPVSDASVLSGMCD
A0A2V9D656      --GGKPR-SNPAELLANNLLRALFSRVLP-LF--D--WIIVDAPPALPVADASVLAGMCD
A0A7C2L7W9      --AGAIP-PNPSELLGSAKMRELIAQVSE-RY--D--FVLVDSPPA-STPDALVLSALVD
A0A7C2XG00      --AGAIP-PNPSELLGSAKMRELIAQVSE-RY--D--FVLVDSPPA-STPDALVLSALVD
A0A2V9J901      --CGPIP-PNPAEVLSSSLAAESLRKLRA-DF--D--YVLVDSPPLLSVADGRILATMVD
A0A2V8QJ59      --SGPMP-PNPAELLGSEEMRKLLIALSK-KF--T--HVIVDSPPAISFTDASILSTFVD
A0A1Q7HTA7      --AGRTP-ANPYEVLKSAGIGEVIQAARR-RY--D--AVVVDTPPLLPVPDNRALAKWVD
A0A2V8YMQ4      --CGPVP-PNPAELLSSKSMGAFLGSAKS-EY--A--FVILDSSPLLTLADSRILASLVD
A0A2V8W380      --CGPVP-PNPSELLSSQSMGALIRSASA-EY--G--FVILDSSPMLALADSRILAPLVN
A0A2V8ZIV5      --CGPVP-PNPAELLSSKSMGAFLVSAKS-EY--A--FVILDSPPLLTLADSRILASLVD
A0A7C2M3P5      --CGPIP-PNPAELLSSERLRAFLRQALQ-RY--H--FVLLDSPPLLHVADARILAALVE
A0A2V8LBV1      --SGSGR-ESSVHLLHSKRLPDLLRRVRK-EF--D--VVLIDAPPVSQIADARVLARLSD
A0A2V8GAF9      --AGTPQ-STPYELLNSRRLEGLLSEARR-LY--D--FVLIDTPPLVPFPDCRLLGRWAD
A0A7C5I7P7      --SGPPS-VHASNLMYSPRLPELLELFRE-EF--D--TVLVDTPPMLHLADARLMARYCD
A0A2V8CN98      --GGSRI-RESPELLGSPRMVELLVRLRA-MY--P--VIIVDSPPLGAGVDPYTLGTMTG
A0A1Q7LC46      --TGPLP-PNPADLLSSHRLADAIAELRT-KF--K--FIVIDSPPIMAATDAVILSVLAD
A0A1Q8BDC5      --VGGVA-TNSIEILSLRKMKELIESLRK-DF--D--TIILDAPPFAPIADARIVTGLSD
A0A2V9Q1Y8      --AGTPP-PNPAELLASSQMLDLLAELRE-QY--D--HIIVDTPPTLSVTDAVVLSTRSD
A0A2V8JXG1      --SGPIP-PNPAELLSSDRMKRLLAQLSE-RY--D--HIVLDSPPLGSVTDAVILSTMVN
A0A350D2W9      --SGPIP-PNPAELLGSDRMSKLLALLKD-QF--D--FVLIDTPPILTVTDAQILGKLVD
A0A2V9I4J1      --AGGVC-TNPVELLSQDKMRELIQYLKT-EF--D--TIIFDAPPFAPIPDARIIMGLSD
A0A2V8PQZ9      --GGAAR-EDVAELLSGPRFGHLLDDARK-MF--D--YIIIDAPPLGVFTDANLLINRAD
A0A2V8D8B1      --AGRIP-PNPAELLGSTRFKDFVTTVGQ-HF--D--WVVIDSPPVMAVADAAVIANIAS
A0A3B9LSB4      --SGPIP-PNPAELLGSDQMRRLMATLQS-QF--S--HVVVDSPPVNSFTDGVLLSSMVD
A0A2V9H7U2      --AGPKP-PNPAQLLSSSAMESLLKELRQ-RF--K--FIVIDSPPVLPVTDAMILSTFVD
A0A2V8NJB5      --SGGIA-ENPIELLSLRRMKDLIEYLKN-DF--D--TIILDAPPLSPIADARIVTALSD
A0A2V9JMZ4      --AGGVC-TNPVELLSQDKMRELIQYLKT-EF--D--TIIFDAPPFAPIPDARIIMGLSD
A0A2V9MDJ6      --AGGVC-TNPVELLSQDKMRDLIQYLKT-EF--D--TIIFDAPPFAPIPDARIIMGLSD
A0A2V8QJT6      --SGPVP-PNPAELLGSDQMRKLLATLSE-KF--T--HIVIDSPPVNSFTDGVLIGSMVD
A0A2V8FSM8      --SGTSR-THASSLVHTERLAEIVVLARE-HF--D--MVIIDTPPMVNIADARVLARHSD
A0A359M0J2      --AKAASASTIHSIFNSPRLGELLAVLRQ-RF--A--MVLLDSPPVLQFPEARLAGRFAD
A0A2V8JLJ1      --SGPMS-SNPGELLSSAHIELVLRECAE-SF--D--WVIVDTPPILGAADVNLMAPFCD
A0A5M8SND8      --SGTSSGSSEASLFYSPSLAKIVQTARK-QY--D--VVLIDTPPCLHLADARVIGKVSD
A0A2V9GAQ1      --TGPLP-PNPADLLSSHRLVEAVAELRT-KY--K--FIIIDSPPIMAATDAVILSVQTD
A0A497EDQ8      --SGPLP-SNPPELFGKKSFKDLLATARE-NY--D--WVILDSPPTASVTDPVVAAQLVD
G8NS05          --SGPVP-PFPTEMLSSETMAELLEKCRG-IY--T--HILIDSPPLLSVTDGIILGRDAD
A0A2V8KZ20      --SGPMS-SNPGELLSSAHIELVLRECAE-SF--D--WVIVDTPPILGAADVNLMAPFCD
A0A3D0NWU2      --SGPIP-PNPAELLSSNEMRNLLQFLRS-KY--K--HVIIDSPPAISFTDAAILSTQVD
A0A2V8EPD9      --AGRPE-SDPMSGLTSDRMKRVLAQAAS-HF--D--WVLVDSPPVGLLPDASLLATLVD
A0A3N5NSX5      --AGMTP-PNPSELLASDRMKTLIANVQTGPF--D--WVLIDTPPVLAVTDAVIIAPWVS
A0A2V8MUA1      --SGTIV-QNPTEVLSSPEFERVMKDLAQ-FF--D--WIVVDSPPSLAMADADLLLRQCD
A0A2V8MBH9      --SGPIP-PNPAELLGSEQMRKLIAVLSG-AF--T--HIVIDSPPVSSFTDGVLIASMVD
A0A3N5ZPQ7      --AGGIS-DSPIELLSLRKMRELFDYLRI-EF--D--VVIIDSPPLNPISDTRLISGFSD
A0A3N5P5F2      --AGEVP-PNPAELLSAQQFEHFLNSLSA-RF--D--WVILDAPPVLAVTDASIVAHSAS
A0A7C2EFE5      --AGPPS-RRASDLIG-RGIASLLDEATR-DY--D--WVIVDAPPLLGFAEPLQLATVVD
A0A2V9G1P7      --CGPVP-PNPSEMLSSQSMSALIRSASA-EY--G--FIILDSSPMLALADSRILAPLVN
A0A2V9BCK9      --AGRSV-LNPAELLADNRMKVLIDRMAP-VF--D--WVIVDAPPVHPVGDAGVLAGLCD
A0A2V9TMX2      --AGPIP-PQPTELLGSTVMKDYISRWRN-EF--D--HIIIDTPPCLSVTDAVLLSPEAD
A0A7C4DQP8      --CGPVP-PNPAELLSGARMPALLQEAAR-QY--H--VVIVDSPPVLNVSDSRVLATQVE
A0A2V8N2J7      --GGVSQ-ANPVAALSSAKARAVFEQLKQ-KF--A--YIIVDAPPVLPIADSQILAGIVD
A0A3N6BI26      --AGFRP-PNPAELIGSERMESALRLLGD-YF--K--YILIDTPPILSVTDGLLLCPHVD
A0A2V9JMM3      --GGSDF-ENPVGVLGSERMRRLVERLRL-EF--R--FIVLDAPPILPIADPQVLAGYAD
A0A2V9M815      --GGSDF-ENPVGVLGSERMRRLVERLRL-EF--R--FIVLDAPPILPIADPQVLAGYAD
A0A2V9A795      --CGPVP-PNPAELLSSKSMGAFITSAKS-EY--G--FVILDSSPLLTLADSRIVASLVD
A0A355ESH9      --SGPMP-PNPSELLASERLRDLLRTLRS-RF--D--YVIVDTPPALAVTDATLVGIQTD
A0A3D0NW85      --SGPIP-PNPAELIGSQPMAELLVTLQK-NF--T--HVVIDSPPITSFTDGVLIASMVD
A0A353CAT5      --SGPIP-PNPAELIGSEQMASLLKVLQK-HF--T--HVVIDSPPITSFTDGVLIASMVD
A0A2V9HB55      --TGPLP-PNPADLLSSHKLADGITELRT-KF--K--FIVIDSPPIMAATDAVILSVQAD
A0A2V8CU57      --AGMPT-SDPMSALASEEMKLLLGEAIE-HF--D--WVIVDSPPVALLSDANLVAAMVD
A0A2V8BDI4      --AGMPT-SDPMSALASEEMKLLLGEAIE-HF--D--WVIVDSPPVALLSDANLVAAMVD
A0A2V8F8T3      --AGMPT-SDPMSALASEEMKLLLGEAIE-HF--D--WVIVDSPPVALLSDANLVAAMVD
A0A2W0B5E2      --SGPIP-PNPAELLCSEAMESLFGELRR-RF--K--HIIIDSPPLLAVTDATVLASAVD
A0A2V8NMG8      --SGPIP-PNPAELIGSEQMRRLITTLQS-TF--T--HIIIDSPPIASFTDGVLIASMVD
A0A2V8TBM7      --SGPVP-PNAAELLGSEEMRKLLYLLTE-NF--T--HIIIDSPPAISFTDASILSTMVD
A0A1Q7HEZ8      --AGVTR-VPIHEILRSPRLERLLQEARQ-RY--D--FIVLDTPPLLPVFDAATISKLVD
A0A1Q7JW36      --AGVTR-VPIHEILRSPRLERLLQEARQ-RY--D--FIVLDTPPLLPVFDAATISKLVD
A0A1Q7MUR4      --AGVTR-VPIHEILRSPRLERLLQEARQ-RY--D--FIVLDTPPLLPVFDAATISKLVD
A0A3N5PFU4      --AGVVA-GPIHDVFRSARLPQLLSEARA-RY--D--YVVLDTPPLVPVVDSVLLSRVVD
A0A3M1SNQ5      --GGAIK-SDSSELLSGPKFRDLLQHLKK-MF--D--YILIDAPPLAIFSDAKVSINQSD
A0A7C2C0C1      --GGAVK-SDSSELLSGPKFRDLLQYLKK-MF--D--YILIDAPPLAIFSDAKVSINQSD
A0A4R1LDF1      --LSSPA-DRPEEAVHSEGVKKVLEAARQ-EY--D--MVIIDSAPLLLAVDTHVLLPMVD
A0A1F2T1R8      --AGATR-AGVTEMLRSPRLEQLLQEARR-EY--A--YVVIDTPPLLPIFDASVLAKLAD
A0A2V9BW09      --AGHPP-PNPAELLQSPRIQELLTQISS-AF--D--WIVLDAPPVNLFADARHLANLAD
A0A3M1SSE1      --SGPVP-PNPAELIGSAQMSTLMEIFQK-EF--T--HVIIDSPPIASFTDGVLIAAMVD
A0A2V9GQV7      --AGMVS-SPPPELFAGTRWQEFLGHCGE-MF--K--VILIDAPPILPRVDFELISAACD
A0A7C5AUB2      --AGTSV-HNPLEMLNLSQTKQLIEQLPA-VF--N--WVLLDSPPLLFAADANLLATICD
A0A2V8YCY6      --TGPLP-PNPADLLSSHKLADAIVELRA-KF--K--FIVVDSPPIMAATDAVILSVHAD
A0A2V8EGM3      --GGRPN-PDPLSGISSLRMQQLLREAVE-RF--D--WVILDTPPVGVAADAGLLCPMVD
A0A2V8FGH1      --GGRPN-PDPLSGISSLRMQQLLREAVE-RF--D--WVILDTPPVGVAADAGLLCPMVD
A0A2V7YV88      --SGPIP-PNPSELLGSGRMKELIAQMLS-HF--T--HVIFDTPPINAVTDAVILAASAD
A0A2V8D468      --AGHIP-PNSAELLTSQQFKDLLSALGG-HF--D--WIVLDSPPVSAVTDAVQLSHDVS
A0A1F2R977      --AGPLH-ASSVGGLASNRMKAVIDGAAP-RF--D--WVLVDTPPIGLLSDAQFLAGLVD
A0A2U3LF12      --GGTQL-SDPVELLSSRRTREILARLRQ-EY--Q--LIVLDSPPIVPIADSHFLAGLAD
A0A7C5MF19      --RGERP-LNPAELLESPRWRNLAAVLRR-EF--H--YVLIDAPPVGLVADFDLIHDVTD
A0A3N5G7M6      --AGTLP-PNPSELLDSQRFRKFLARLGN-HY--D--WVILDSPPVMPVTDAIVLAEAAT
A0A1F2S3Q7      --AGSPR-AGISEILRSPRLDAFLQELRQ-RY--A--YIVLDTPPLLPVFDAALIAKSVD
A0A2V8GVG4      --AGTRK-GAVHQVLRSPRLDAVLAEARG-RY--D--FVVLDTPPLLPVFDSALLANAVD
A0A2V8PJQ0      --SGPIP-PNPAELLGSEQMRRLLTLLGE-KF--A--HIIVDSPPAVSFTDASILSTFVD
A0A2V8H566      --AGRPN-PDPIGGLTSERMRQLVAAGTA-EF--D--WVVIDTPPVGLLTDARLMSSMVD
A0A2V8UVN4      --SGKPT-AHPTELLDSNRWTALCASVRQ-QF--K--FVILDTPPIAAVADYDLIDAQCD
A0A1Q7RB73      --GGKAA-SNPTELIGNGRLRLLLRRLCP-AF--D--WIIMDSPPVIPVSDAKLLAEYLD
A0A2V9K0H7      --GGKAA-SNPTELIGNGRLRLLLRRLCP-AF--D--WIIMDSPPVIPVSDAKLLAEYLD
A0A321LXF5      --AGKSS-TPAPELFSRAAWKEFIGWSSE-SF--K--LVLIDSPPMLDLADFELIASPCE
A0A5M8SBZ0      --GG-PA-RSPAELMSNGKMKGLLDELEP-HF--E--WIVIDSPPVSVVSDVASLAAVSH
A0A1Q7JFB1      --AGRPD-SDPMSGLTSGRMRRLIGEAAA-TF--D--WVIIDTPPVVLLPDANLLAAMVD
A0A2V9LS17      --GGKHP-ANPAELVSNGRFKNLLRRLSP-VF--D--WIVVDTPPAIAVSDAQVLAAACD
A0A7C2YLF6      --GGSHV-ANPAELISSGRMEQLLRRMAP-LF--D--WVILDSPPAVPVSDASLLADMCD
A0A2V7X0V9      --SGTGI-EDPAELVGNGKLKTFLQRVEP-LF--D--WIIVDSPPAIPVSDASVLAKACD
A0A2V9X518      --SGRTV-SNPAELVANGRLKFLLTRVEP-LF--D--WIIIDSPPTVPVSDSSLLDNFCD
A0A2V9VC62      --CGRTV-AHPAELIANGRLKMLLQRVEP-LF--D--WIILDSPPAVPVSDASQLANFCD
A0A2V9S1P8      --SGRSI-GNPAELVANGRTRFLLNRVEP-LF--D--WIIIDSPPAVPVSDAGLLANYCD
A0A2V9RTW2      --SGRSV-SNPAELVANGRLKILLNRVEA-LF--D--WIIIDSPPAVPVSDASLLANYCD
A0A2V9TGF1      --SGRSV-SNPAELVANGRLKILLNRVEA-LF--D--WIIIDSPPAVPVSDASLLANYCD
A0A2V9XEV6      --SGRTV-SNPAELVANGRLKFLLTRVEP-LF--D--WIIIDSPPTVPVSDSSLLANFCD
A0A2V9Y3Q6      --SGRTV-SSPAELVANGRLKFLLNRVEP-LF--D--WIIIDSPPAVPVSDASLLANFCD
A0A2V9R269      --AGRIS-PNPAEMLSNGRIKTLLHRLEP-LF--D--WIIIDSPPAVPVADAAMLANHCD
A0A2V9PTS3      --AGHRS-QNPAELLANGRMKFLLERLQP-IF--D--WIIIDSPPAALVSDAGLLAKYAD
A0A2V9NPF4      --AGHRS-QNPAELLANGRMKFLLERLQP-IF--D--WIIIDSPPAALVSDAGLLARYAD
A0A2V9PNZ0      --AGHRS-QNPAELLANGRMKFLLERLQP-IF--D--WIIIDSPPAALVSDAGLLAKYAD
A0A2V9AGR3      --SGDAV-ADPAELILGGRVKKLLDFVTP-AF--D--WVILDSPPALAVHDPSLFADLCD
A0A2V9G0N7      --GGNDV-SNPSELLPSDRMRHLLDVVTP-MF--D--FVILDSPPATPVHDPIVLADLCD
A0A2V9GQ44      --GGNDV-SNPSELLPSDRMRHLLDVVTP-MF--D--FVILDSPPATPVHDPIVLADLCD
A0A2V9HRN3      --GGKDV-SNPSELLPSDRMRHLLDVVTP-MF--D--FVILDSPPASPVHDPIVLADLCD
A0A2V8WG13      --GGSEV-SNPSELLLGDRMKKLLDLVTP-IF--D--WIILDSPPALAVHDASSLADLCD
A0A2V8X987      --GGSPV-FNPSELLLHERMKRLLDLLTS-AF--D--WIIIDSPPALLVHDASILADLAD
A0A1Q7KX94      --GGSLV-SNPSELLLNERMKHLLNLVAP-SF--D--WIIIDSPPTLPVHDASILADLVD
A0A2V8XHT0      --GGSLV-SNPSELLLNERMKHLLNLVAP-SF--D--WIIIDSPPTLPVHDASILADLVD
A0A2V8DMJ9      --AGTPQ-VTPYELLNSPRLEGLLRDARR-TY--D--CVLIDTPPAVALPDCRLIERFVD
A0A2V8GGF6      --AGSPQ-PAAYELLNSTRLESSIETARR-RY--D--YVLIDTPPLVPLPDCRLLAKCVD
A0A2V8HKU7      --AGSPQ-PAAYELLNSARLESSIEEARR-RY--D--YVLIDTPPLVPLPDCRLLAKCVD
A0A1Q6Y875      --AGRPV-SNPTELLGSTRTKSLFERLNT-LF--D--WVIVDTSPVLPVSDAAVLAPTCD
A0A523DJA9      --AGQPP-PNPSELLASDRMRNLLASLATGPF--D--WIILDTPPVLAVTDSVILAPLLS
A0A2V8I604      --SGPVP-TRPAELLGSSAMRRLLDTVRT-QF--D--RVLLDMPPVAPLADVSIVASMID
A0A2V8J066      --SGVPP-SHPAELLGSAAMRRTIDTLRT-RF--D--RLILDMPPVAPLADVNIAAAVAD
A0A1I6MMC5      --GGGDA-DNAADLSSNNRFKELIVKASA-FF--D--WIIVDSSPVNVIADGVNLAHACD
A0A2V9D5W7      --GGTRI-ANPSELLANGRFKRLIERVAP-LF--D--WIIVDSTPCLPVTDANIAANSCD
A0A2V9D4I4      --GGTNI-ANPSELLSNGRLKSLLDHMAP-FF--D--WIILDSPPCLPVMDANVVADLCD
A0A2V9D6L7      --GGTKI-ANPSELLSNGRLKKLLDRVAP-LF--D--WIIIDSPPCLPVADANVVSNFCD
A0A2V8ZJV2      --GGSLV-SSPSEVLRTERMKQLLNRVTP-LF--D--WIILDSPPSLRADDAGILADLAD
A0A2V9AWB5      --GGNLV-SNPSELLLSERMKHLLNVVSP-AF--D--WIILDAPPTLPVHDASILADLVD
A0A2V8Z1Y8      --AGRAV-SNHSDLLLSKKMKHLLNYLTP-IF--D--WVIMDSPPTLPVHDASVLADLAD
A0A1Q8AX10      --AGRSV-LNPAELLADNRMKVLIDRMAP-VF--D--WVIVDAPPVHPVGDAGVLAGLCD
A0A2V9A773      --AGRPV-GNPSELLANGKLKGFLNGINS-VF--D--WVIVDAPPVLAVADAGIIAQFCD
A0A2V9AND3      --AGRPV-HNPSELLGNGLLRDFLHGMSP-IF--D--WVIVDAPPVLALADAGIVAEFCD
A0A2V9BTJ7      --AGSEA-PNPSELLLNDRMKRLLDLMTP-IF--D--WIIIDTPPALPVHDASMMADLCD
A0A2V8W2M7      --CGHPV-SNPSELLSGDRMKKLLDLVTP-VF--D--WVILDSPPSLAIHDASILADLCD
A0A2V8XNW2      --CGHPV-SNPSELLSGDRMKKLLDLVTP-VF--D--WVILDSPPSLAIHDASILADLCD
A0A1Q7CJC1      --CGHPV-SNPSELLSGDRMKKLLDLVTP-VF--D--WVILDSPPSLAIHDASILADLCD
A0A2V9UEM7      --AGRQA-TGAPELLANGRLKLFLQRVEP-LF--D--WIILDTPPVIPVADSTLLANFCE
A0A7C4DTF2      --GGRSA-SNPNELLINGRLRELLQQMAP-LF--D--WIVIDSPPAIPVSDAALLAGLAD
A0A1Q7V300      --AGTRN-ENPAELVASGRMSTLLHRLEP-LF--D--WIIVDSPPAVAVSDAALLAKYCD
A0A2V9ZCI3      --AGKQV-SSPAELVANGRLKFLLNRVES-LF--D--WIIVDSPPAVPVSDASLLANFCD
A0A2V9WCB3      --SGSGI-EDPSELIANGRLKMLLQRLEP-LF--D--WIIVDSPPAIPVSDASVLAKACD
A0A2V9VQW5      --CGRTV-THPAELIANGRLKMLLQRVEQ-LF--D--WIIVDSPPAVPVSDASQLANFCD
A0A2V9WTP3      --SGCEV-SNPAELVANGRLKFLLQRVEP-LF--D--WIIIDSPPAVPVSDASLLANSCD
A0A2V9NLA9      --CGRKV-TSPAELVANGRLKTLLNRLEP-LF--D--WMVLDSPPAVPVSDAGLLANYCD
A0A2V9RKJ9      --CGRKV-TSPAELVANGRLKTLLNRLEP-LF--D--WMVLDSPPAVPVSDAGLLANYCD
A0A2V9RN95      --SGRTV-SSPAELVANGRLKFLLNRLEP-LF--D--WIIIDSPPAVPVSDAGLLANYCD
A0A2V9N406      --SGRTV-SSPAELVANGRLKFLLNRIEP-LF--D--WIIIDSPPAVPVSDAGLLANYCD
A0A2V9U6D9      --SGRTV-SSPAELVANGRLKFLLTRVEP-LF--D--WIIIDSPPAVPVSDAGLLANYCD
A0A2V8DZN4      --SGTSR-THASSLVHTERLAEIVVLARE-HF--D--MVIIDTPPMVNIADARVLARHSD
A0A3N5YKY1      --AGRPT-NQPTELLGSFEMRRAVDTLRT-HF--D--RIVIDTPPALALADVGVVGPLSD
A0A2G6HQA4      --AGKPP-SNPSELLGSILMKDLIAELSS-RY--TDRTIIFDAPPVLLTAEARTLAHHVD
A0A2V7ZTY7      --AGRPD-SDPMSGLTSNRMRRLVGEAAA-TF--D--WVIIDTPPIVLMPDANLLAAMAD
A0A2V7ZVL9      --AGRPD-SDPMSGLTSNRMRRLVGEAAA-TF--D--WVIIDTPPVVLMPDANLLAAMAD
A0A1Q7QYI4      --AGRPD-SDPMSGLTSGRMRRLIGEAAA-TF--D--WVIIDTPPVVLLPDANLLAAMVD
A0A2V8G9Y9      --AGRPD-SDPMSGLTSDRMRRLVAEAAA-RF--D--WVLIDTPPVGFLSDANLLAAMAD
A0A143PNR5      --AGRPV-ENPVPLLTSERMGELVRDARQ-HF--D--WIVIDTPPVALLTDANLLTKECD
A0A6A7L078      --AGRPN-ADPMSSLTSERMRSIIDEASA-RF--D--WVILDTPPVGLLADGNLLADMVD
A0A143PXU3      --AGRPQ-ANPVGDLSSGRMSRLIANAGS-TY--D--WVIVDSPPAAGLADARIILETVD
A0A2V8D8G9      --AGKPG-PTPLAGLTSSRMGEVIEECAA-RF--D--WVLIDTSPVGVLPDAQVLARLVG
A0A2V8ESQ4      --AGKPG-PTPLAGLTSSRMGEVIEECAA-RF--D--WVLIDTSPVGVLPDAQVLARLVG
A0A1E3Y5Q0      --AGEPT-DDPMVTLAAERMQALITEARE-QF--D--WIVIDTPPVGLLPDAGLISGLAD
A0A2W4TWK5      --AGRPT-TDPMAVLASERMRDLLADVRE-DY--D--WVVIDTPPIGLLADANLLADVSD
A0A3N5NYV3      --AGQPD-PDPMSRLASDRMRRVLMEAAT-QF--D--WVIIDTPPVGTVPDANLLATMAD
A0A2V2RJF9      --SGSKT-PRPAELLSSHRLTQLLEQLKA-EF--D--HVIVDSPPLMPVTDAVILAAKSN
A0A2G6HNT3      --AGDTP-PNPSELLSSVLMKDLIKELSS-RYTDR--TIIFDAPPVLLTAEARILAHHVD
A0A2V7YWD4      --SRRPQ-ADTYELLASGRFGELLRDARQ-RY--D--CVVVDTPPVLPAPDSRLLAEWID
A0A2V2R8T6      --GGGVR-NDVAELLGGPTYARLLTDARR-MF--D--YVIIDAPPLGVFTDASVLISRAD
A0A1Q7RGF1      --SGSHT-TQPAELFASSHWQEFISWCSE-SF--K--LVLIDSPPVLNLTDVDLIAAACD
A0A2V9BLX2      --SGSHT-TQPAELFASSHWQEFISWCSE-SF--K--LVLIDSPPVLNLTDVDLIAAACD
A0A2V9ZA03      --AGEAM-GQPLEILQSQRMSEMLTQVAE-WF--E--WVIIDSPPLAPVADPNLWAMQAD
A0A3N5ZNH4      --AGFRP-PNPAELIGSDKMETGLKLLGE-YF--K--YVVVDSPPVLAVTDALVISPLVD
A0A2V8GEZ2      --AGCPN-PDPIGVLTSPAMRQLVKFARD-GY--D--WVLIDTPPVGLLTDAHLVAQMVD
A0A3N5ZFD3      --GGRPH-PDPMAVLTSDRMRRLMEEAAA-GF--D--WVVVDTPPVGLLPDANLLAAMVH
G8NXD3          --LDKAV-SKPVPLLRAPELSNLLKWAQK-NF--Q--WVLLDAPPVLPVADVEQLLPSAD
A0A2V9VR38      --AGTPP-PNPAELLASTNMRDLLAQLRE-QY--D--HIVIDTPPSLSVTDAVVLSPRAD
A0A2V9EY04      --AGTIS-SPPPELFTGSHWQELLGRCSE-LF--E--VVLVDTPPIIPLADFELISVACQ
A0A2V9HAK9      --AGTVS-SPSPELFIGTRWQEFLGHCGE-MF--K--VILIDAPPILHLADFELISAACD
A0A1Q7FS15      --AGTVL-SSPPELFTGTHWQEFIARCSE-LF--K--VILIDTPPILPLADFELISAACD
A0A1Q7K9P1      --AGTVL-SSPPELFTGTHWQEFIARCSE-LF--K--VILIDTPPILPLADFELISAACD
A0A1Q7N989      --AGTVL-SSPPELFTGTHWQEFIARCSE-LF--K--VILIDTPPILPLADFELISAACD
A0A2V9G7Y0      --AGTIS-SPSPELFTGTRWQEFLGQCGE-MF--K--VILIDAPPIRPLADFELISAACD
A0A2V8T7Z1      --AGRSH-ADPFDVLRSPRFEEFLRQARE-SY--D--SVVLDTPPLLMVPDCRQLSAWVD
A0A2V7U8G5      --AGAPP-ANPYQALESPRIGQLLEQARD-AY--E--YVVLDTPPVLLVPDCKLMSQWID
A0A2V7UNP9      --AGAAP-ADAYRVLESARVGQLLDTARG-SY--D--CVILDMPPVLLVPDCRLMSQWID
A0A2V7VLD7      --AGAAP-ADAYRVLESARVGQLLDTARG-SY--D--CVILDMPPVLLVPDCRLMSQWID
A0A2V7XGA3      --AGPST-PSAYRLFDSARVGQLLDQARR-RY--D--HVLVDTPPVLLVPDCRLMSQWVD
A0A2V7YAG6      --AGPAA-PNAYRVFDSPRVGELLEQARR-TY--D--YVVLDTPPVLLVPDCRLMSQWVD
A0A2V7VK33      --AGRFH-DLPFELLRSPRLADLLAEARQ-QY--D--YVVVDTPPLLLLPDCRAVAQQVD
A0A7C5EWK9      --CGEPS-SSPTELLDSGRWRALAAMLKR-EF--D--FVLIDAPPAGMVADYDLLEHVAD
A0A3M1VTE1      --AGRPV-ANPVGLLSSGRMAGLLAEWRS-RF--Q--RVVVDTPPIVPFADAGILGELSD
A0A2V7TTM7      --AGTSP-SNAYQILESPRIGQLLQEARR-SY--D--RVVLDTPPLLLVPDCRLLSQWVD
A0A2V8VI82      --AGRTS-DNPYDVLKSPRMGEIVQAARR-RY--D--TIVIDTPPIVPVPDSRVLAKWVD
A0A2V7U4P9      --AGHAV-MAPYEILRSPRVAELLAEAHS-LY--D--YVIIDTPPVIPCPDYRLLEPFID
A0A2V7TQY5      --SGRCP-AAPYEMLKSPRLGQLIGQARD-RY--E--YVVIDTPPLVPVPDARVVEKWVD
A0A2V7TU87      --AGVFS-DIPYELLRSSRLGDLLDQARR-DY--D--YVVLDTPPLVPIPDARVISKWVD
A0A2V8SEH0      --AGRSP-SAPYEVLKSPRLGDLFQEARR-RF--D--YILVDTPPIVPVPDCRVISKWVD
A0A2V8VU54      --AGRLA-PQPYEVLKSPRFGAVLEEARR-MF--D--YVVVDTPPLIPVPDCRLIARWVD
A0A1Q7RML7      --AGRLP-PAPYEALKSPRLGALFEQARR-LF--D--YIVVDTPPLVPVPDCRLLARWVD
A0A1Q7ZIQ5      --AGRLP-PAPYEALKSPRLGALFEQARR-LF--D--YIVVDTPPLVPVPDCRLLARWVD
A0A2V8TKD8      --AGRLP-PAPYEALKSPRLGALFEQARR-LF--D--YIVVDTPPLVPVPDCRLLARWVD
                                               :      ::.* .*     :         

A0A1F2U8T6      GVTFVVGAEMTRRQVAEHAIETIL-SSRPKLLGVVLN----KV-----D--FARNKYYYS
A0A2V8BV42      GVTFVVGAEMTRRRLAERALETIM-SSRPRYAAIILN----RV-----D--FARNKYYYS
A0A2V8F916      GVTFVVGAEMTRRRLAERALETIM-SSRPRYAAIILN----RV-----D--FARNKYYYS
A0A1Q7K833      GVTFVIGAEMTRRRLAERAIETIL-QTRPKYTAVVLN----KV-----D--FARNKYYYS
A0A1Q8AMY4      GVTFVIGAEMTRRRLAERAIETIL-QTRPKYTAVVLN----KV-----D--FARNKYYYS
A0A2V8BM40      GVTFVIGAEMTRRRLAERAVETVM-QARPKYAAVVLN----KV-----D--FARNKYYYS
A0A2V8CRT6      GVTFVIGAEMTRRRLAERAVETVM-QARPKYAAVVLN----KV-----D--FARNKYYYS
A0A1F2VH76      GVTFVVGSEMTRWRLAERAVETLL-SGNPRHLCAVLN----KV-----D--FARNKYYYS
A0A1F2R0X5      GVTFVIGAEMTRRRLAERAIETIM-EARPRQVGVVLN----KV-----D--FARNKYYYT
A0A2V8B278      GVTFVVGAEMTRRRLAERAIETVM-QTHPKYAAVVLN----KV-----D--FARNKYYYH
A0A2V8CEF9      GVTFVVGAEMTRRRLAERAIETVM-QTHPKYAAVVLN----KV-----D--FARNKYYYH
A0A2V8KZG2      GVVLVVHAGRNKRNAVQRACRELS-AVGARIFGVVLN----NV-----N--MKREGYADY
A0A2V8TKR9      GVILVVHGGKSPRTTVQRARQELQ-GVGAKIYGVVLN----NI-----D--LRREGYDSY
A0A1Q7LG57      GVILVMRAGQTTTESALYASQRFA-EDGTRVLGTVLN----SW-----DPKN------SH
A0A2V8MKQ7      GVILVVHGGRSSRAVVRRTKQQLM-DVGANIFGVVLN----NV-----KVE-------SH
A0A1Q7L5B1      GVIVVVRAGSTGYDVVSTALQELR-GKK--ILGVVLN----RA-----EEKEAT----YG
A0A2V9DKV4      GVIVVVRAGSTGYDVVSTALQELR-GKK--ILGVVLN----RA-----EEKEAT----YG
A0A2V9EVA0      GVILVVGAGRTSSDLARTACQELR-ESR--LLGVVLN----GV-----EDDAV-----GS
A0A7C5ZU39      ALLLIVGTNQIAGHELRRTVNLVP-KEK--LLGLVLN----RA-----NETLARSDDYES
A0A3N5YN96      GVLLVVRAGQTPRPAIERALRQVA-PAR--VLGLVLN----DV-----GEI--------S
A0A1Q7Y646      GAMLVVRAGKTRYATVERLLEQLP-RER--MLGVVLN----RS-----EETME-----DS
A0A2V8QZU0      AALIVARAGRTRYAALERLLEPLP-RER--LLGVVLN----GS-----DEQLS-----EQ
A0A2V8RSQ9      GALVVVRAGRTRYGTLDRVLEPLP-RER--LLGVVLN----GA-----DSAPD-----AQ
A0A2V9L2P7      GVIMVVENEVTTRATLSRACSVIR-HSGGKILGAVVN----KV-----DARRD-----GY
A0A2V7UMX0      GFLVVVAAHRTPRPLLAEALGVLE-PDK--VVGLVLN----GD-----DSFSS-----EY
A0A136K497      GALLVVRANRTKYGALDRILEPLP-KDR--MLGVILN----QS-----EEVLD-----ES
A0A399W9E4      GALLVVRANRTKYSALDRILEPLP-KDR--MLGVILN----QS-----EEVLD-----ES
A0A321LMC5      GTVLVVKAGRTHHSAVANALKLIP-KER--RVGVVLN----VA-----EVFNE-----EV
A0A2V8X713      GVIVVVRAGATAHDLVQTTLQEFR-GKN--LLGVVLN----RA-----EREAN-----YG
A0A2V8ZLE9      GVIVVVRAGETAHNLVKTTLQEFR-GSN--LLGVVLN----GG-----SEAAN-----YG
A0A2V8Y4D3      GVMVVVRANKTPHDLVKTTLQEFR-GNN--LLGVVLN----DA-----SEGAN-----YG
A0A2V8Z2X8      GIMVVVRAGQAGRDLVKTTLQEFR-GNN--LLGVVLN----GS-----DQDAS-----CA
A0A2V9C3F6      GVLVVVQAGETAHDLVKTTLQEFR-GNN--LLGVVLN----GA-----NEGTN-----YG
A0A2V9QMU9      AVVLVIRSGQTTRQALRRARDILL-QVNAHATGVLLN----AV-----DLNSG-----DY
A0A2V9QY75      AVVLVIRSSQTTKPALRRTRDILT-QVNARVAGVLLN----AV-----NLNSP-----DY
A0A2V9SVU9      AVVLVIRSGQTTKQALRRSRDLLM-QVNARIAGVLLN----AV-----DLNSP-----DY
A0A2V8W5N5      GVLLVVRAGSTSVDVAEKVCQQLK-GKN--IVGVVLN----GA-----EKSDL-----VD
A0A2V8XG53      GVLLVVRAGSTSVDVAEKVCQQLK-GKN--IVGVVLN----GA-----EKSDL-----VD
A0A6A7LB89      AVVLVVGAAHASFDIVKQAAKTIG-RKK--ILGVVLN----RA-----ASQPM-----PY
A0A352EZH8      GALLVVRAGKTRYAQVNELLEQLP-RER--MLGVVLN----RA-----DEELE-----SG
A0A0B6X033      AALIVVRAGYTRYSLLDRLLEPLP-RER--LLGIVLN----GV-----DETLD-----EH
A0A2V8R0I3      AAMLVVRASKTRYAVVDRLLEQLP-RER--VLGVVLN----RA-----ETRLD-----DA
A0A2V8N1U8      AAILVVRASKTRYSIVDGLLEQIP-RER--LLGVVLN----RA-----QAATD-----ET
A0A2V8QL35      AALLVVRAGVTRYAVVDRLLEQLP-RER--MLGVVLN----RA-----QGKPD-----DA
A0A352FU10      AAMLVVRAGVTRYAVVDRLLEQLP-RER--MLGVVLN----RA-----AGKTD-----DA
A0A2V8LCU0      AALLVVRASATRYSVVDRLLEQLP-RER--ILGVVLN----RA-----EAKPE-----DT
A0A1Q7NGT0      AALLVLRAAKTRYSVVDRLLEQLP-RER--MLGVVLN----RA-----EIEPD-----ET
A0A2V8MLP9      AALLVLRAAKTRYSVVDRLLEQLP-RER--MLGVVLN----RA-----EIGPD-----ET
A0A2V8PQZ0      AALLVLRAAKTRYSVVDRLLEQLP-RER--MLGVVLN----RA-----EIGPD-----ET
A0A3B9MKY6      GALLVVRSGKTRYALIDRLLEQIP-REK--LLGVVLN----RV-----DEQFD-----ET
A0A3D5SKZ1      GALLVVRSGKTRYALIDRLLEQIP-REK--LLGVVLN----RV-----DEQFD-----ET
A0A2V8NRW2      AALLVVRSGKTRYAALDRIIEQLP-RER--LLGVILN----RS-----DEQLD-----ET
A0A2V9XV04      GVLMVVRSNSTPSDVARKARMEFP-DQM--LVGVVLN----GT-----DRDEA-----EY
A0A2V9CBY1      GVIFVVRAGMTAFDMAQAACGELR-NKN--LLGVVLN----GV-----E---E-----EA
A0A2V9D656      GVIFVVRAGVAAFDMAQAACGELK-HKN--LLGVVLN----GV-----E---E-----EA
A0A7C2L7W9      GVILIIRCGETPRELVHRAHQALL-DVNARIFGVVLN----RV-----DVTQD-----GY
A0A7C2XG00      GVILIIRCGETPRELVHRAHQALL-DVNARIFGVVLN----RV-----DVTQD-----GY
A0A2V9J901      GAVLVARAFETPYDLVCRARSLLY-GAGARILGVALN----DV-----D--LRREGYGHN
A0A2V8QJ59      GVILVVHGGRSSRAVVRRAKQQLL-DIGAHIFGVVLN----NV-----KIEKTHDYYYGG
A0A1Q7HTA7      GFLLVVAAHRTPRHLLEEGLRVLE---HARVAGIVFN----GD-----D--RPSSACYGY
A0A2V8YMQ4      GVLLVAKSGATPREQIRQSQSGIR-SAGANLIGVVLN----NV-----T--LHTNGYY--
A0A2V8W380      GVLLVVRSGTTPREQLLHAQSGIR-SVGGNLIGVVLN----SV-----D--IRTNGYY--
A0A2V8ZIV5      GVLLVVKSGATPREQVMQSQSSIR-TAGANLIGVVLN----IV-----R--LHTNGYY--
A0A7C2M3P5      GVVLVVQGGTTPRELVQRAYVYAR-DVGANVIGAVLN----NL-----D--IRSDDYY--
A0A2V8LBV1      GVIFVVRSAETTRDMAMAACRQFS-EDRSRVLGTILN----MW-----D--PREHNQG--
A0A2V8GAF9      GFVLIVGANKTPRKLLAQALNLLD-P--AKLIGVVLN----GE-----D--RPLSSHYGY
A0A7C5I7P7      TVILVVRAGKTSRDTALAARQRFL-EDGTPILGTILV----DW-----S--PGRNGVG--
A0A2V8CN98      AMMLVLRTGATNLDLARTKVAMLE-NLPIRVVGAVLN----DV-----R--LGQ------
A0A1Q7LC46      GVLLIVRSGETPKAAFTRTRDLLN-SVKSRILGVVLN----AV-----D--SSAPDYY--
A0A1Q8BDC5      GLIMVLRRGKTSYADTDRAFQAID-R--NKLLGVVFN----DV-----Q--RLFKTYS--
A0A2V9Q1Y8      AVVLVIRSGQTTKPALRRSRDILA-QVNARVAGVLLN----AV-----D--LDSPDYY--
A0A2V8JXG1      GVILVVHGGRNSRQAVQRACHELS-AVGARVFGIVLN----NV-----D--LRREGHD--
A0A350D2W9      GLVLVVQAGTTPREALVQTRELID-LLKLRTLGVVVN----SL-----N--LENHGYYGR
A0A2V9I4J1      GLVLVVRRGKTPFSAIEKAFKVLD-R--KKLLGIVFN----DV-----K--PMLLHTH--
A0A2V8PQZ9      AALLVLRAAKTRYSVVDRLLEQLP-R--ERMLGVVLN----RA-----E--IEPDETA--
A0A2V8D8B1      GVVFVVGAEMTSRTVARTAVEQLA-NARGRVIGAVLN----RV-----D--LDNNAYY--
A0A3B9LSB4      GVLLVVHGGKSSRHVVRRSRQLLH-DVGAKIFGVVLN----NV-----A--LQSHDYY--
A0A2V9H7U2      GVAFVVESGVTARGAVVRARRVLE-NAGARILGLVLN----KV-----D--VRHNGYY--
A0A2V8NJB5      GCIMVIRRGKTSYRSIEGAFRVID-Q--AKLLGIVFN----DV-----K--PMLFHTY--
A0A2V9JMZ4      GLVLVVRRGKTPFSAIEKAFKVLD-R--KKLLGIVFN----DV-----K--PMLLHTH--
A0A2V9MDJ6      GLVLVVRRGKTPFSAIEKAFKVLD-R--KKLLGIVFN----DV-----K--PMLLHTH--
A0A2V8QJT6      GVLLVVHGGKSSRDVVRRSRQLLL-DVGAKIVGVVLN----NV-----S--VRSHEYY--
A0A2V8FSM8      ALILVVRSGQTTRDAARWAQARFA-EDGTAVLGTILN----FW-----N--PKTPGYA--
A0A359M0J2      GAVVVLRSRHTERDAAMIALRRMA-EDGIPLLGTILN----DW-----D--PKSGAHHSH
A0A2V8JLJ1      AILLVVQSGKTPLKVIKDSIKRVG-R--EQICGVILN----RV-----K--VARYGSY--
A0A5M8SND8      AVILVTRAGHTTWTEGRAVAQNFT-EDGTRILGTVLN----DL-----K--QSVGAYS--
A0A2V9GAQ1      GVLLVVRSGETPKKAFTRTRDLLS-SVKCRILGVVLN----AV-----D--SSAPDYY--
A0A497EDQ8      MVLAVVKYGGPRRQVVADAMRTLK-RSGVRVAGVLLN----NV-----D--IERDHYY--
G8NS05          AVVLIVRHGKSNKHTIRRARDLLL-RAGVHITGIALN----AI-----D--LNSPE-Y--
A0A2V8KZ20      AILLVVQSGKTPLKVIKDSIKRVG-R--EQICGVILN----RV-----K--VARYGSY--
A0A3D0NWU2      GVILVAMAGKSSMHLMRRFKQRLG-NIGARIYGVVLN----GI-----K--QGSVEYG--
A0A2V8EPD9      GVLLVIRSGKAPFPLVKRAVEIIT-H--QRILGVVMN----AI-----D--FKHDRNA--
A0A3N5NSX5      GVVFVIGSEMTQRRLAERAVETLL-TSRPHVLGAVLN----RV-----D--IIRNKYY--
A0A2V8MUA1      AALLVVNADKTPLKLIRDAVERMG-R--DRICGVLMN----RV-----R--NLSSSHY--
A0A2V8MBH9      GVLLVVHGGKSSRGVVRRSRQLLT-DVGAKIFGVVLN----NV-----S--ARSHDYY--
A0A3N5ZPQ7      DVILVIRRGRTPFATIEQGLKVVD-R--KKILGVVFN----DL-----D--EKESQFS--
A0A3N5P5F2      GVVFVTSADLTDRNAAVQAVSQLR-SAKANFLGVVLN----RV-----N--LSRNAFF--
A0A7C2EFE5      GVLVVARAGHTDRKAVASVINTLR-RLRANVIGIVLN----EV-----H--HRLGGGY--
A0A2V9G1P7      GVLLVVKSGTTPREQFMHAQSGIR-GVGGNLIGVVLN----NV-----D--ICT-NGY--
A0A2V9BCK9      GVIVVVRAKLTAYDLVQTTLQEFR-G--KNLLGVVLN----GA-----D--EEAT-----
A0A2V9TMX2      RVILVARSGQTTRPALRRACDLLL-QVNARVMGIVLN----AL-----N--LHSVEGY--
A0A7C4DQP8      GVVLVVKAGTTPRELAQRALAGIE-SVGGHVLGVVLN----QL-----D--ARTAD-A--
A0A2V8N2J7      KVLFVIRARQTPRELFQHAIEGFE-A--ANLLGAVLN----DV-----D--YQRSRYA--
A0A3N6BI26      GVVMVIKGGSTPKEAARKAGNHLT-SVGARILGALIN----NV-----D--MNAPEYS--
A0A2V9JMM3      GVLLVVRARRTRRELFKHAIESFR-A--TNVLGVVLN----GA-----D--YAGSRYA--
A0A2V9M815      GVLLVVRARRTRRELFKHAIESFR-A--TNVLGVVLN----GA-----D--YAGSRYA--
A0A2V9A795      GVLMVVKSGATPRDQVMQSQAGIR-SAGANLIGVVLN----SV-----T--LHT-KGY--
A0A355ESH9      GVVLTLRSHKVTREEVRLVRDRLR-QADVKILGAVLN----RY-----R--ALQAGAA--
A0A3D0NW85      GVILVVHSGKSSRQIVRRAKQLLN-DVGARIFGVVLN----NV-----D--LRSQENY--
A0A353CAT5      GVILVVHSGKSSRQVVRRTKQSLI-DVGAKIVGVVLN----NV-----N--LRSQDNY--
A0A2V9HB55      GVLLVVRSGETPKAAFTRTRDLLN-SVKCRILGVVLN----AV-----D--SSAPDYY--
A0A2V8CU57      ATILVIGAATTPYPLVRRAVESVG-A--SRIIGTVLN----RI-----E--RG--QMV--
A0A2V8BDI4      ATILVIGAATTPYPLVRRAVESVG-A--SRIIGTVLN----RI-----E--RG--QMV--
A0A2V8F8T3      TTILVIGAATTPYPLVRRAVESVG-A--SRIIGTVLN----RI-----E--RG--QMV--
A0A2W0B5E2      GVILVVESGVTPKKFVSRARNILD-GANARLLGVALN----KV-----H--MRHDGYYGS
A0A2V8NMG8      GVVLVIHGGETSRSLVRRSKQQLQ-DIGAKIFGVVLN----NV-----D--LHRHDYY--
A0A2V8TBM7      GVMLVVHGGRSSRAVVRRAKQQLQ-DVGAHIFGIVLN----NV-----K--LEGTDYY--
A0A1Q7HEZ8      GLIVVVAANQTPRKLLAEALTLLD---PATVLGLVFN----RD-----V--QPLFGYYNS
A0A1Q7JW36      GLIVVVAANQTPRKLLAEALTLLD---PATVLGLVFN----RD-----V--QPLFGYYNS
A0A1Q7MUR4      GLIVVVAANQTPRKLLAEALTLLD---PATVLGLVFN----RD-----V--QPLFGYYNS
A0A3N5PFU4      GVLVVVAANKTPRRLLEEGLNALD---SAKVLGLVFN----SD-----V--RPLYG-YDN
A0A3M1SNQ5      AAILVVRSGHTKYSTMTRILEGLP---REKMLGVVLN----DS-----E------DLLQN
A0A7C2C0C1      AAILVVRSGHTKYSTMTRILEGLP---REKMLGVVLN----DS-----E------DLLQN
A0A4R1LDF1      HALLVVRADHSPIACAQDAVKML----GDKALGCVLN----DV-----K--KMKYEE---
A0A1F2T1R8      GVLMIVAANQTPRKLLAEALNLLD---PAKVLGIVFN----QD-----D--RPLFGYYNS
A0A2V9BW09      AVVLVLRVGVTPRESTQQVSAALD---GAFIAGVVVN----GD-----V------NPLQD
A0A3M1SSE1      GVIMVVHSAKTSRQIVRRSCQLIQ-DVGAKIFGVLLN----NV-----NISSQDNYYYYQ
A0A2V9GQV7      GIVMVVRAHHGQRERLQNTASTLD---RKKLLGVVFN----AT-----D--VSAKDYHGY
A0A7C5AUB2      GTVLVVRIGATTIDSVTRAMQSLC---ENNVLGIVAN----GA-----R--AGELYSKYT
A0A2V8YCY6      GVLLVVRSGETPKVAFMRTRDLLA-SVKSRVLGVVLN----AV-----D--SSAPDYYYS
A0A2V8EGM3      GTLLVVRAGKTPYKAIEHALEAIG---RDRLLGVVLN----GV-----Q--EHDRAEAYE
A0A2V8FGH1      GTLLVVRAGKTPYKAIEHALEAIG---RDRLLGVVLN----GV-----Q--EHDRAEAYE
A0A2V7YV88      GTIVVVEQGRTTFPTLRHAKQMLD-RVGGHTLGVVMN----KV-----R--ASGGSSYSY
A0A2V8D468      GVLFVVGAGKTGRRIAQWALDQLG-LAQATMFGAILN----GI-----N--VDRHPYYYS
A0A1F2R977      GVLLVIGAAKTPYPLVQRAVAALG---PDRLIGIVLN----RV-----E--EQTITA--D
A0A2U3LF12      GVILVIRARQTRRELLQRAVESLG---ATNIVGVVLN----DV-----E--YGDTRYAYA
A0A7C5MF19      GAILVVRPDHTNRTLCLKTIEAIP---PDRLIGVVLN----CV-----S--EWFLTRPFG
A0A3N5G7M6      GVIFVTAAETTPIPASRSAVDQLR-RAPAPLLGVVLN----RA-----D--LKRRGYYTR
A0A1F2S3Q7      GVLMVVSANRTPRKLLGEALNLLD---ASKVLGIVFN----RD-----A--HPLFGYYDA
A0A2V8GVG4      GVLMVVAANQTPRKLLGEALNMLD---PGKVLGIVFN----RD-----A--KPMFGYYDA
A0A2V8PJQ0      GVILVIHSGRSSRAVVRRAKQQLLDV-GAHIFGIVLN----NV-----K--LDTHGYYYG
A0A2V8H566      AVIFVISAGRTPYRLVHRAVEAVG---RDRIFGVVLN----KV-----A--VQDLWRDYG
A0A2V8UVN4      GVVLVVRPDHTDRKLCMQAIDIVP---KDRLLGVVLN----CV-----R--D---WFLWK
A0A1Q7RB73      GVLIVVQSDATPHDLARKACQEFA---SKKIVGVVLN----RV-----K--PEYS----Y
A0A2V9K0H7      GVLIVVQSDATPHDLARKACQEFA---SKKIVGVVLN----RV-----K--PEYS----Y
A0A321LXF5      AVMLVARSGKTSLETFTKTCARVD---PKKLAGVVLN----AC-----E--EVGD----K
A0A5M8SBZ0      GIVLVVRSGFTRFGVVQHAREELK---DRPLVGVVLN----AA-----S--KNEST---A
A0A1Q7JFB1      AAILVIGAGKTPHKLIMRAIDALG---RNRILGVVLN----RV-----D--PSCLA---G
A0A2V9LS17      GVLLVVAAGSTSCEASQKTRDQFK---GRRVLGVVLN----RV-----D--PRGSSS--Y
A0A7C2YLF6      GVLLVVRSAQTPYDMAQRACQEFK---EKHLVGVVLN----DV-----E--PEDG-Y--S
A0A2V7X0V9      GVLMVVRSNATPCDVARKAREEFP---DQSLIGVVLN----GT-----S--DDAASY--A
A0A2V9X518      GVLIVVRSNTTPFDMARKARLEFQ---DKHLIGVVLN----GI-----E--ADSSPY--S
A0A2V9VC62      GVLMVVRSNATPYDTAQKARQEFQ---GKTLVGVVLN----GI-----T--RGDS-Y--S
A0A2V9S1P8      GVLMVVRSNATPFDVARKARQEFR---DKHLVGVVLN----GV-----S--TESS-Y--T
A0A2V9RTW2      GVVMVVRSNATPVDMARKARQEFR---DKHLVGVVLN----GI-----E--ADSSPY--N
A0A2V9TGF1      GVVMVVRSNATPVDMARKARQEFR---DKHLVGVVLN----GI-----E--ADSSPY--N
A0A2V9XEV6      GVLIVVRSNTTPFGMARKARLEFQ---DKHLIGVVLN----GI-----E--ADSSPY--S
A0A2V9Y3Q6      GVLIVVRSNTTPFDIARKARQEFE---DKHLVGVVLN----GI-----E--PDSSPY--S
A0A2V9R269      GVLLVVRSNSTPIDAARRARAEFT---GRNVVGVVLN----GI-----T--AEMSPY--M
A0A2V9PTS3      GVLLVVRSNTTPADAARKARQEFA---DHNIVGVVLN----GI-----T--PELSPY--S
A0A2V9NPF4      GVLLVVRSNTTPADAARKARQEFA---DHNLVGVVLN----GI-----T--PELSPY--S
A0A2V9PNZ0      GVLLVVRSNTTPADAARKARQEFA---DHNIVGVVLN----GI-----T--PELSPY--S
A0A2V9AGR3      GVLFVVKAGETSYENAVKGSSEFR---EKNLLGVVLN----QI-----Q--EADMYA--G
A0A2V9G0N7      GVLFVVRAGVTDFEVAERAVAEFR---EKNLLGVVLN----GA-----E--QGAAY---G
A0A2V9GQ44      GVLFVVRAGVTDFEVAERAVAEFR---EKNLLGVVLN----GA-----E--QGAAY---G
A0A2V9HRN3      GVLFVVRAGVTDFEVAERAVAEFR---EKNLLGVVLN----GA-----E--QGAAY---G
A0A2V8WG13      GVLFVVKAGETNHQLAEKASAEFL---KKNLLGVVLN----SA-----E--IDASY---G
A0A2V8X987      GVLFVVQAGMTHVGEAEKAAEEFQ---NKNLLGVVLN----KV-----E--KRDSY---G
A0A1Q7KX94      GVLFVIRAGSTDAAIAERTAAEFQ---GKNLLGVVLN----QV-----E--RSDSY---G
A0A2V8XHT0      GVLFVIRAGSTDAAIAERTAAEFQ---GKNLLGVVLN----QV-----E--RSDSY---G
A0A2V8DMJ9      AFLVVVAAHKTPRTLVAEALNVLD---PAKIAGVVFN----AD-----D--RSR-----P
A0A2V8GGF6      GFLLIVAAHRTPRKSLARALDMLD---PSKLIGIVFN----GD-----D--ASG-----S
A0A2V8HKU7      GFLLIVAAHRTPRKSLARALDMLD---PSKLIGIVFN----GD-----D--ASG-----S
A0A1Q6Y875      GVILVVGAGRTSSDLARTACQELR---ESRLLGVVLN----GV-----E--DDALG---S
A0A523DJA9      GMVFVVGAEMTRSAHALRAVEMLKAGGNGNVIGVVLN----RV-----D--FARNRY--Y
A0A2V8I604      GVLMIVRAGATTKPAIERALSGLD---ASKVLGIVLN----EA-----G--SDG-AG--Y
A0A2V8J066      GILLIVRAGMTQKPAIERALGGLD---TTKVLGLVLN----EV-----G--AEA-TY--Q
A0A1I6MMC5      GVLLVARGGVTKFETAQRALSQLK---ASNVLGIVLN----AV-----S--DPP-VS--G
A0A2V9D5W7      GLLLVVKAYSTPAEIAQRARQELQ---DRNVLGVVFN----SV-----Q--ESIVSY--G
A0A2V9D4I4      GLLFVVKAGSTPAEIAQRARQELG---GRNLLGVVLN----AV-----S--EKALAY--G
A0A2V9D6L7      ALLFVVKAGSTPAEIAQRARHELE---GRNVLGVVLN----SV-----S--EKGLAY--G
A0A2V8ZJV2      GVLLVIQAGSTAAQIAERTAAEFQ---GKNLLGVVLN----QV-----E--KRD-CW--N
A0A2V9AWB5      GVLFVIRAGSTHAEIVERTASEFQ---DKNLLGAVLN----QV-----E--KSD-SY--G
A0A2V8Z1Y8      GVLLVVQAGSTAVDDARKAAEEFR---NKNLLGVVLN----QV-----E--KSD-AY--I
A0A1Q8AX10      GVIVVVRAKLTAYDLVQTTLQEFR---GKNLLGVVLN----GA-----D--EEA-TY--G
A0A2V9A773      GVIVVVRAGETAHDLVKTTLQEFR---GNNLLGVVLN----GA-----N--EGA-DY--G
A0A2V9AND3      GVIVVVRAGQTSHDLVKTTLQEFR---GINLLGVVLN----GA-----N--LEA-NY--S
A0A2V9BTJ7      GVLFVVRAGATDHEMATKAAAGFQ---DKNLLGVVLN----RV-----D--GDA-GY--G
A0A2V8W2M7      GVLFVVRAGETNHETAERAASEFR---NKNLLGVVLN----RV-----E--QAA-GY--G
A0A2V8XNW2      GVLFVVRAGETNHETAERAASEFR---NKNLLGVVLN----RV-----E--QAA-GY--G
A0A1Q7CJC1      GVLFVVRAGETNHETAERAASEFR---NKNLLGVVLN----RV-----E--QAA-GY--G
A0A2V9UEM7      GVLMVVRSNSTPSDLARRAREEFQ---DKLLLGVVLN----GI-----P--ADQLPK--S
A0A7C4DTF2      GVLLVVRAAQTPFDLAQKVRQEFR---DKPLLGAVLN----CV-----P--PAA-SY--G
A0A1Q7V300      GVIMVVRSNATPFDIAQRARQEFG---DN-LVGVVLN----GI-----D--TLP-EY--S
A0A2V9ZCI3      GVLIVVRSEVTPFDMARKARMEFR---DKQLLGVVLN----GI-----D--SSSSAY--S
A0A2V9WCB3      GVLMVVRSNATPSDAARRARQEFP---ENALVGFVLN----GT-----S--EENAPY--A
A0A2V9VQW5      GVLMVVRSNATPYDTAQKARQEFQ---GKLLVGVVLN----GI-----M--RSDSYY--S
A0A2V9WTP3      GVLMVVRSNATPVDMARKARQEFP---DKVLVGVVLN----GT-----S--ADTEAY--S
A0A2V9NLA9      GVLMVVRSNSTPFDMARKARQEFS---GKQLVGVVLN----GI-----D--QGN-SY--S
A0A2V9RKJ9      GVLMVVRSNSTPFDMARKARQEFS---GKQLVGVVLN----GI-----D--QGN-SY--S
A0A2V9RN95      GVLIVVRSNATPFDIARKARQEFR---DTSLVGVVLN----GI-----D--VGS-SY--T
A0A2V9N406      GVLIVVRSNATPFDIARKARQEFR---DTSLVGVVLN----GI-----D--VGS-SY--T
A0A2V9U6D9      GVLIVVRSNATPFDIARKARQEFR---DTSLVGVVLN----GI-----D--VGS-SY--T
A0A2V8DZN4      ALILVVRSGQTTRDAARWAQARF-AEDGTAVLGTILN----FW-----N--PKT-----P
A0A3N5YKY1      GVLLVVRAGQTPRPAIERALRQV-APA--RVLGLVLN----DV-----G--EI------S
A0A2G6HQA4      GVVMVVRQGIVGKAKIEETINAI-GPE--RILGIVFN----DH-----H--GAYF----S
A0A2V7ZTY7      AAILVIGAGKTPYKLITRAVDTL-GRA--KIIGVVLN----RV-----D--RRHV----A
A0A2V7ZVL9      AAILVIGAGKTPYKLITRAVDTL-GRG--KIIGVVLN----RV-----D--RRNV----A
A0A1Q7QYI4      AAILVIGAGKTPHKLIMRAIDAL-GRN--RILGVVLN----RV-----D--PS-CLA--G
A0A2V8G9Y9      VTLFVVRAGRSPFRLIQRALDAV-GRN--RIIGVVLN----AV-----K--ES-DDV--V
A0A143PNR5      GALLVIHANRTPYALVQKAVQAL-GKP--KIFGVVLN----RL-----E--DHITVH--S
A0A6A7L078      GALLVILAERTPYKVVSKAVEVV-GRD--RILGVVLN----GV-----K--AL-------
A0A143PXU3      GAILVVRAAATRFAELQAATDAL-GPG--RLLGVILN----AV-----D--PREI----H
A0A2V8D8G9      AVILVIGAGSTPAAAVERAVAELGGPD--SIIGTVLN----RV-----E--EGRI----P
A0A2V8ESQ4      AVILVIGAGSTPAAAVERAVAELGGPD--SIIGTVLN----RV-----E--EGRI----P
A0A1E3Y5Q0      GTVVVVRADATQYDFVQRSIAEL-GRE--RILGVVLN----LA-----T--PPTDVRYGA
A0A2W4TWK5      GMVLVVKAGTTPYDVVQKAVELL-GRD--RILGVVLN----QA-----E--PDS-----L
A0A3N5NYV3      VVLLVVQAGRTPARLVQRTADAL-GRE--RVMGVVLN----RA-----D--DLV-----V
A0A2V2RJF9      CVVMVVHGGVTPRDVVQMAKQKLV-KSDATMAGVVLN----YI-----D--LTDPYY--Y
A0A2G6HNT3      GVVMVVRQGVVGKAKVEETINAIG-P--ERILGIVFN----DHHGAYFS--KSSKYG--Y
A0A2V7YWD4      GYVIVVAADKTPRKLLEETFALLG-P--AKILGLVFN-----------R--ESYKGS-RY
A0A2V2R8T6      GALLVVSAGKTRYSVVDKLLDQLP-R--DRVLGVVLN----RT-----D--EALEPSTYY
A0A1Q7RGF1      GVVMVVRAQHAKREVLQKCAGQID-P--KKLLGVVYN----AV-----E--SGAHDHYSY
A0A2V9BLX2      GVVMVVRAQHAKREVLQKCAGQID-P--KKLLGVVYN----AV-----E--SGAHDHYSY
A0A2V9ZA03      GTLLVVEQGKTPKKLLRKSLESIE-N--LKLIGVVMN----GS-----Q--DADHQY--Y
A0A3N5ZNH4      GVVLVVRGGATPKDVVRKAGGHLV-GVHARILGAVIN----NV-----N--MDAPEYVHY
A0A2V8GEZ2      AVVMVVSAGAVPYRVVQRSADALG-R--DRIIGVVLN----RAAAAPFE--RAYG-YGGY
A0A3N5ZFD3      AAVLVVEAGKTDYASVQRAVAAIG-R--DKIIGIVLN----RA-----E--RPAGTYGNY
G8NXD3          LVLMVVRERVTRRAAVQRAAEMLG-E---HLSSLIFN----DV-----T--MSIAAG--Y
A0A2V9VR38      AVVLVIRSGQTTKQALRRSRDVLT-QVSANVVGVLLN----AV-----D--LSSPDY--Y
A0A2V9EY04      GVVMVVRARHGQRETLQKSASSVD-R--KKLLGLVFN----GT-----D--ANEKHY--Y
A0A2V9HAK9      GIVMVVRAHHGQRETLQKTASTLD-T--KKLLGVVFN----AT-----D--VSVKDY--D
A0A1Q7FS15      GVLMVVRAHHGQRETLQKTARALD-P--KKLLGLVFN----AT-----D--VSRKDY--Y
A0A1Q7K9P1      GVLMVVRAHHGQRETLQKTARALD-P--KKLLGLVFN----AT-----D--VSRKDY--Y
A0A1Q7N989      GVLMVVRAHHGQRETLQKTARALD-P--KKLLGLVFN----AT-----D--VSRKDY--Y
A0A2V9G7Y0      GIVMVVRAHHGQRETLRKTASTVD-K--KKLVGVVFN----AT-----D--VSVKDY--D
A0A2V8T7Z1      GILLVVAAHRTPRRLVEEALNVME-P--DRLVGLVFN----GD-----D--RPLSGY--Y
A0A2V7U8G5      GFLLVVAAHRTPRKLLGEALSALD-E--SKMLGIVFN----GD-----D--RPMGGY--Y
A0A2V7UNP9      GFLLVVAAHRTPRKLLGEALSAMD-E--AKVLGIVFN----GD-----D--RPLSGY--Y
A0A2V7VLD7      GFLLVVAAHRTPRKLLGEALSAMD-E--AKVLGIVFN----GD-----D--RPLSGY--Y
A0A2V7XGA3      GFIVVVAAHRTPRKLLVDGLGALE-E--GKVLGVVFN----AD-----D--RPLSGY--F
A0A2V7YAG6      GFLIVVAAHRTPRKLLAESLGAIH-Q--DKVLGIVFN----AD-----D--RPLSGY--F
A0A2V7VK33      GFLLVGA--------VAAALDALE-E--EKTIGIVFN----NE-----N--RPPSSY--Y
A0A7C5EWK9      GVILVLRPDHTNRTLGLKALASIP-A--GRLIGVVMN----CVPDWFLT--RPFGHN--Y
A0A3M1VTE1      GVLLVARAGRTPKALIEQVVEEAG-S--VKLLGVVLNDWTGSL-----A--DRRTGY--D
A0A2V7TTM7      AFVIVVAARRTPRKLLAETLGSVD-A--GKLAGIVFN----GD-----D--RPLGGY--Y
A0A2V8VI82      GFLLVVAAHRTPQRLVEEALHLLS-H--AKVAGIVFN----GD-----D--RPSSAY--Y
A0A2V7U4P9      GVMLVVAADKTAREMMDTALDLLD-K--PKTLGVIFN----GE-----T--PQADRS--S
A0A2V7TQY5      GFVIVVRAHRTPQRLLEDALNMVS-P--EKLIGLVFN----GD-----Q--RPTSRH--Y
A0A2V7TU87      SFLLVVRANTTPRSLLEESLNLME-P--QKVLGLVFN----ND-----E--RPRTTY--N
A0A2V8SEH0      GFMVVVAAHKTPRRLLQEALNVTE-P--GKLMGLVFN----RD-----E--RLLTRA--Y
A0A2V8VU54      GLLMVVAAHRTPRKLVEEGLNLME-P--SKVIGIVFN----GD-----A--RAFSGY--Y
A0A1Q7RML7      GLLMVVAAHRTPRKLVEEGLNLVD-P--AKAIGVVFN----GE-----R--RSRSGY--Y
A0A1Q7ZIQ5      GLLMVVAAHRTPRKLVEEGLNLVD-P--AKAIGVVFN----GE-----R--RSRSGY--Y
A0A2V8TKD8      GLLMVVAAHRTPRKLVEEGLNLVD-P--AKTIGVVFN----GE-----R--RSRSGY--Y
                                                                            

A0A1F2U8T6      RY----------YGRQYENHYAEAV-----------------------------------
A0A2V8BV42      RY----------YGHQYKNYYAEATG----------------------------------
A0A2V8F916      RY----------YGHQYKNYYAEATG----------------------------------
A0A1Q7K833      RY----------YGHQYKNYYAEATV----------------------------------
A0A1Q8AMY4      RY----------YGHQYKNYYAEATV----------------------------------
A0A2V8BM40      RY----------YGHQYKNYYAEAVS----------------------------------
A0A2V8CRT6      RY----------YGHQYKNYYAEATS----------------------------------
A0A1F2VH76      RY----------YGHQYKSYYAEAPAA---------------------------------
A0A1F2R0X5      RY----------YGHQYKNYYAEKAS----------------------------------
A0A2V8B278      RY----------YGHQYKNYYAEAAI----------------------------------
A0A2V8CEF9      RY----------YGHQYKNYYAEAAV----------------------------------
A0A2V8KZG2      QY----------YYYGYSSKEEVSEN----------------------------------
A0A2V8TKR9      YY----------HYNRYYGGYPSDTNV---------------------------------
A0A1Q7LG57      RY----------GYGSYADYEEYVGQ----------------------------------
A0A2V8MKQ7      DY----------YYQ------GYYSGYYQAADYQEDTAPNPADSRAASS-----------
A0A1Q7L5B1      AY----------PYY------GGNGMDKK-------------------------------
A0A2V9DKV4      AY----------PYY------GGNGMDKK-------------------------------
A0A2V9EVA0      PY----------AYY------GRSEHVRS-------------------------------
A0A7C5ZU39      AY----------YY-------SNY------------------------------------
A0A3N5YN96      SG----------YAY------GRVDNQNAGRRVARSGA----------------------
A0A1Q7Y646      SA----------YYY------RRYYRRDDAVEDKTEKEVDEKA-----------------
A0A2V8QZU0      NY----------YYY------RRYGSRRDAGK-------EQEG-----------------
A0A2V8RSQ9      SY----------YYQ------RRYYRRDETQPGAPTKDVEEDV-----------------
A0A2V9L2P7      YG----------HYHYYGYYSKGYYDYAEGKGNGQG------------------------
A0A2V7UMX0      YR----------YY-------RGYGTAARQSSDLTPGEAADGASRAPDSPPSSHPSTIQE
A0A136K497      HY----------NYGY-----YNYRRMAEDAAS---------------------------
A0A399W9E4      HY----------NYGY-----YNYRRMAEDAAS---------------------------
A0A321LMC5      TY----------YYGAKNKRRGWFGKKH--------------------------------
A0A2V8X713      AY----------SY--------GYGVDTK-------------------------------
A0A2V8ZLE9      GY----------ACS------AGFGLAKR-------------------------------
A0A2V8Y4D3      GY----------SFR------AGFGTDKK-------------------------------
A0A2V8Z2X8      SY----------SYY------AGFELDRK-------------------------------
A0A2V9C3F6      GY----------SYY------AGFGMDKK-------------------------------
A0A2V9QMU9      -Y----------YYEYQGKHGQRYFGQDEPAIAEEAKATSSGA-----------------
A0A2V9QY75      SY----------YYEYQGKHGQRYYDESQTDENSIAAAS---GGA---------------
A0A2V9SVU9      YY----------YYEYQGKYGHRYYREEEMDNGGASLPSVRAGSA---------------
A0A2V8W5N5      SH----------YHA------YGYGEPMETPVSGLRRRVSPLHSWGPR------------
A0A2V8XG53      SH----------YHA------YGYGEPMETPVSGLRRRVSPLHSWGPR------------
A0A6A7LB89      SS----------Y-----------------------------------------------
A0A352EZH8      AY----------YYQ------QRHYRQPRVP-------AGEDRLRLVSELEEDEEVAIAS
A0A0B6X033      SY----------YYR------RYYRRA-----------------------EEAKKKAVAE
A0A2V8R0I3      AY----------YYQ------SRYQRQSPLVEAG----TEEV--ADDEATDQPEMIYIEE
A0A2V8N1U8      AY----------YYQ------PRHQRAATEF-------VEDTVAREHEDTDQLEMIYLEE
A0A2V8QL35      VY----------YYQ------PRYQRAASAAD------VGDA--G-DAFEDRPGMIYIEE
A0A352FU10      AY----------YYQ------PRHQRVASAAT------TDVA--DREAVEDEPEMIYIEE
A0A2V8LCU0      AY----------YYQ------PRHVRSVAVPDAPSKVKASEE--RYESTPGEPEMIYIEE
A0A1Q7NGT0      AY----------YYQ------PRHQRMMAAP-------VEGT--EYDQGGANPEMIYLEE
A0A2V8MLP9      AY----------YYQ------PRHQRVMAVP-------LEET--EDDHG-ANPEMIYLEE
A0A2V8PQZ0      AY----------YYQ------PRHQRVMAVP-------LEET--EDDHGAANPEMIYLEE
A0A3B9MKY6      AY----------YYQ------RHYYNR-DRG-------LTEAKTKQLPGERQEEVALVN-
A0A3D5SKZ1      AY----------YYQ------RHYYNR-DRG-------LTEAKMKQLPGERQEEVALVN-
A0A2V8NRW2      SY----------YYQ------RRYYRREDKG-------ITKSAT-QAEMKNAEEVIVAG-
A0A2V9XV04      AR----------YYY------ESYEKKPALPSVLPASRSCAAGGRGPDCLVVVCRGDHPS
A0A2V9CBY1      IY----------GAY------GYY------------------------------------
A0A2V9D656      IY----------GAY------GYY---------------YGGNGTGGE------------
A0A7C2L7W9      SY----------YYY------RYY---------------YAGDREVEEPTPAIAEDRPPS
A0A7C2XG00      SY----------YYY------RYY---------------YAGDREVEEPTPAIAEDRPPS
A0A2V9J901      GS-----------YGYSYTGYGAPGSEASSRHGNT-------------------------
A0A2V8QJ59      YY---------GYYKSNYYTAEEDPEADQGSTAST-------------------------
A0A1Q7HTA7      YY----------GYGRGRGGGAARGEHPAWRKAAAPWR----------------------
A0A2V8YMQ4      -G----------LGIYGSNGNSHSETISDPAEPWNRLSK---------------------
A0A2V8W380      -N----------YGSYGSNRGDPPQETFVPTNLHLPPQQKASD-----------------
A0A2V8ZIV5      -G----------LGMYGMNGNSHGKTSSDEADSWRTLSK---------------------
A0A7C2M3P5      -Y----------GRYYRSDYYGPGEHPPK-------------------------------
A0A2V8LBV1      -H----------YSHYYDGYYTYYAKK---------------------------------
A0A2V8GAF9      YY----------DTHARDRHAGWWRRVWNARHSQGPQHLR--------------------
A0A7C5I7P7      -Y----------GSKYYDGYSKYYGKKG--------------------------------
A0A2V8CN98      -M----------YGEYYGYMAGYGTTTEDGGTRIARRRLQGAL-----------------
A0A1Q7LC46      -Y----------SYRYYPYSYGYGPQEAGEPAQGDDASESVTEALSRHHDDDSQAL----
A0A1Q8BDC5      -H----------YGQYYYGPPADAKKVKGPKSKNYLQS----------------------
A0A2V9Q1Y8      -Y----------YYEYQGKYGQRYYDEDMTGGDSVRAASGSA------------------
A0A2V8JXG1      ------------DYYYYSYQYSYSADGKRTKT----------------------------
A0A350D2W9      HY----------YRHYYKESRG--------------------------------------
A0A2V9I4J1      -Y----------DHGYYRYGKQGAYPYYGTRKPRSRSKTYLEN-----------------
A0A2V8PQZ9      -Y----------YYQPRHQRMMAAPVEGTEYDQGAANPEMIYLEEDMVS-----------
A0A2V8D8B1      -Y----------SQYYRRQYGEYYTSTSASA-----------------------------
A0A3B9LSB4      -Y----------YQRYYGARNYKSDGDDDIEPTSHARRNGSHNTLDLN------------
A0A2V9H7U2      -G----------YYGHYYYSSGSGKTKRTPASESVSSHLQG-------------------
A0A2V8NJB5      -Y----------KRGYYDYGRDSQYMYSRGRKRLEKPKNYLES-----------------
A0A2V9JMZ4      -Y----------DHGYYRYGKQGAYPYYGTRKPRSRSKNYLES-----------------
A0A2V9MDJ6      -Y----------DHGYYRYGKQGAYPYYGTRKPRSRSKNYLES-----------------
A0A2V8QJT6      -Y----------YYQRYYHQSYYTQDPSEEVVATRS------------------------
A0A2V8FSM8      -Y----------YKHYYAGYYHYYGDGSGKGGGNSVGPQDGEEPVAAERAAGASRWVADV
A0A359M0J2      GY----------GADYYSKYYEYQTMAESGKSGTS-------------------------
A0A2V8JLJ1      -Y----------DAYYRQPLNESSQRNSNLQLREGI------------------------
A0A5M8SND8      -Y----------VTEA--------------------------------------------
A0A2V9GAQ1      -Y----------SYRYYPYSYGYGPQEAAEAPHEEDSEAIAHRVSRDRDDDSQAL-----
A0A497EDQ8      -S----------TYYYSYYHYGYDEDGKRDKG----------------------------
G8NS05          -Y----------GYYGYSGYSGYGSAGMDAAGWESQSGKSTGKGQK--------------
A0A2V8KZ20      -Y----------DAYYRQPLNESSQRNSNLQLREGI------------------------
A0A3D0NWU2      -Y----------YGSGYYDYYKSADADTTTPRMDSDANGNGSNGRA--------------
A0A2V8EPD9      -G----------GYYEYYGAGYYGAPSTK-------------------------------
A0A3N5NSX5      -Y----------SRYYGYKYKNYYVKSNAA------------------------------
A0A2V8MUA1      -Y----------SRYYRQVSLSSK------------------------------------
A0A2V8MBH9      -Y----------YYQRYYHQSYYSHDVESDGADERASA----------------------
A0A3N5ZPQ7      -Y----------YQHSYYH----------------PGKDRQSSRTRRRKRNAP-------
A0A3N5P5F2      -Y----------APYYRREYTDYYSRALRS------------------------------
A0A7C2EFE5      -Y----------YYSYRRYGKYYHSPKAA-------------------------------
A0A2V9G1P7      -Y----------NYGPYGLNPDCPSHETVVTANFQMPPQQKASD----------------
A0A2V9BCK9      -------------YGAYSYYAGYGMDRK--------------------------------
A0A2V9TMX2      -Y----------YYGTQYSNNYYSEES--------------PNNKPKAASKIS-------
A0A7C4DQP8      -Y----------AYSYYHYYERREVET-----------------TESAASPDR-------
A0A2V8N2J7      -Y----------AYEYYKKLA---------------------------------------
A0A3N6BI26      -Y----------YYRHYFD----------------------ERYNTDLSSAAG-------
A0A2V9JMM3      -R----------AYEYYRRTY-----------------------YKQNIRTGT-------
A0A2V9M815      -R----------AYEYYRRTY-----------------------YKQNIRTGT-------
A0A2V9A795      -Y----------GLGIYGS-NGNSHSEIISDTADSWGTLSK-------------------
A0A355ESH9      -A----------GYRYAEA-YGYGAEE-----------------TGSKAGSAA-------
A0A3D0NW85      -Y----------YYQSYYSQSQYRRDEE--------------------------------
A0A353CAT5      -Y----------YYQSYYHRDNYRSGD-----------------------DPK-------
A0A2V9HB55      -Y----------SYRYYPYSYGYGPQEVVEAPHEEDSEAVTERVSRDDDSEAL-------
A0A2V8CU57      -G----------GYGFYDY-YGYGTRD------DGARKAGKADAAREAAMDAA-------
A0A2V8BDI4      -G----------GYGFYDY-YGYGTRD------DGARKAGKADAAREAAMDAA-------
A0A2V8F8T3      -G----------GYGFYDY-YGYGTRD------DGARKAGKADAAREAAMDAA-------
A0A2W0B5E2      YY--------SGYH------------------------A---------------------
A0A2V8NMG8      YY--------HRYYSSSYYKAEADDTEQVASSAH----G---------------------
A0A2V8TBM7      YY--------SGYY-SGYYSDDDTAPEGAATAGERPGAG---------------------
A0A1Q7HEZ8      SY--------RGYFGEARTA----------------------------------------
A0A1Q7JW36      SY--------RGYFGEARTA----------------------------------------
A0A1Q7MUR4      SY--------RGYFGEARTA----------------------------------------
A0A3N5PFU4      NY--------RRYFSRAH------------------------------------------
A0A3M1SNQ5      ES----------YYRSYQKYAEVVDS----------------------------------
A0A7C2C0C1      ES----------YYRSYPKYAEVADS----------------------------------
A0A4R1LDF1      ------------YYRAYYK-----------------------------------------
A0A1F2T1R8      YS---------RYYREYFTDPTQIASGA--------------------------------
A0A2V9BW09      RY----------YYSYYPRHKNA-------------------------------------
A0A3M1SSE1      SY----------YYNSYYKKEEEEE-----------------------------------
A0A2V9GQV7      EY----------GYGYGKD-----------------------------------------
A0A7C5AUB2      YY----------YSSYYYKDRNDKHEEPE-------------------------------
A0A2V8YCY6      YR----------YYPYSYGYGPQEAGEAAQGEASESVGGAISRHHDDDSQAL--------
A0A2V8EGM3      SG----------YY-----YSSQASDNVTS------------------------------
A0A2V8FGH1      SG----------YY-----YSSQASDNVTS------------------------------
A0A2V7YV88      AY----------GYGNYGSKSNQGTTTVRSADPSAFQPRITHRERLARIALRLFWRLRSD
A0A2V8D468      GY----------YRKEYTNQYTRTL-----------------------------------
A0A1F2R977      AY-------YRHYYPSSGAKDG--------------------------------------
A0A2U3LF12      YR----------YYQRHYVGRR--------------------------------------
A0A7C5MF19      HR-----------YDYYYEESQG-------------------------------------
A0A3N5G7M6      YY-------RRAYQAYYGHPTPA-------------------------------------
A0A1F2S3Q7      YC--------RQYFPGVSRIAGQA------------------------------------
A0A2V8GVG4      YY--------KDYFP--EQAVTRA------------------------------------
A0A2V8PJQ0      GYYGRYYYKYGYYYSDYSDDDGKKAQTASG------------------------------
A0A2V8H566      SY----------SYSYYGYGSPRTKD----------------------------------
A0A2V8UVN4      TQ---------DYYSYTEN-----------------------------------------
A0A1Q7RB73      GS---------QYYATTPETKK--------------------------------------
A0A2V9K0H7      GS---------QYYATTPETKK--------------------------------------
A0A321LXF5      DY---------KYYRYAVGGPSSS------------------------------------
A0A5M8SBZ0      AY---------HYYGHDAASPDGMDKENQD------------------------------
A0A1Q7JFB1      GY----------GYGYYSYGERG-------------------------------------
A0A2V9LS17      KY----------YDYYRGAAENANGKGRRAKT----------------------------
A0A7C2YLF6      SY----------YYQYYRGRSGVNGKGKE-------------------------------
A0A2V7X0V9      RY----------YYEAYEKRQPTTV-----------------------------------
A0A2V9X518      RY----------YYGVNGNNKEMQETVQG-------------------------------
A0A2V9VC62      RY----------YYEAYEKTAKPKA-----------------------------------
A0A2V9S1P8      QY----------YYATYG-RTNGRHESQG-------------------------------
A0A2V9RTW2      QY----------YYGAYG-RPDAKGATQR-------------------------------
A0A2V9TGF1      QY----------YYGAYG-RPDAKGATQR-------------------------------
A0A2V9XEV6      RY----------YYGVNGNNKEMQETVQG-------------------------------
A0A2V9Y3Q6      RY----------YYGSYG-NKETQETIQG-------------------------------
A0A2V9R269      QY----------YYSAYSPNVRTEDKN---------------------------------
A0A2V9PTS3      QY----------YYSVYSEDGKAKG-----------------------------------
A0A2V9NPF4      QY----------YYSVYSEDGKAKG-----------------------------------
A0A2V9PNZ0      QY----------YYSVYSEDGKAKG-----------------------------------
A0A2V9AGR3      DY----------YYGKTYGRTRK-------------------------------------
A0A2V9G0N7      EY----------YNHYTGR-----------------------------------------
A0A2V9GQ44      EY----------YNHYTGR-----------------------------------------
A0A2V9HRN3      EY----------YNHYT-------------------------------------------
A0A2V8WG13      DY----------YSGYATDDQKDSY-----------------------------------
A0A2V8X987      AY----------YHGHLSENAEKAT-----------------------------------
A0A1Q7KX94      DE----------YQNYYAERD---------------------------------------
A0A2V8XHT0      DE----------YQNYYAERD---------------------------------------
A0A2V8DMJ9      SE---------YGYGYYGYP-----ERVTWWQRLFGTVRSARVR----------------
A0A2V8GGF6      HQ---------NSYYAYYTPQGRDRQRRRWWRRG--------------------------
A0A2V8HKU7      HQ---------NSYYAYYTPQGRDRQRRRWWRRG--------------------------
A0A1Q6Y875      PY---------AYYGRSEHVRG--------------------------------------
A0A523DJA9      YS---------RYYGYTYKNYYGNTSTAA-------------------------------
A0A2V8I604      AY---------DGYGYIGG-----------------------------------------
A0A2V8J066      DY---------AGYKYVAG-----------------------------------------
A0A1I6MMC5      GY---------YGYDAPGKQTT--------------------------------------
A0A2V9D5W7      SY---------YNYPQNGHDEVKKTQAHRNKFRQ--------------------------
A0A2V9D4I4      SY---------YNHGYGNGRVKEPMKEKSD------------------------------
A0A2V9D6L7      SY---------YNY---RDHAHDPLKESTNRILD--------------------------
A0A2V8ZJV2      D-----------YYGGRIVQLETTDRALPAGERLS-------------------------
A0A2V9AWB5      A-----------EY-----QNYHSDRD---------------------------------
A0A2V8Z1Y8      AP---------DYH----------------------------------------------
A0A1Q8AX10      AY---------SYYAGYGMDRK--------------------------------------
A0A2V9A773      GH---------SYYAGFGMDTE--------------------------------------
A0A2V9AND3      SY---------SGYAGVGMDKK--------------------------------------
A0A2V9BTJ7      GY----------YYSYPSGEE--VKKSS--------------------------------
A0A2V8W2M7      DY----------YYGSLGEEEQPVLRAS--------------------------------
A0A2V8XNW2      DY----------YYGSLGEEEQPVLHAS--------------------------------
A0A1Q7CJC1      DY----------YYGSLGEEEQPVLHAS--------------------------------
A0A2V9UEM7      RY----------YYGEAVSSPA--------------------------------------
A0A7C4DTF2      SY----------YQYRYPQNGKRKD-----------------------------------
A0A1Q7V300      QY----------YYTAYGNPNGKDPA----------------------------------
A0A2V9ZCI3      RY----------YYG-YGDQ----------------------------------------
A0A2V9WCB3      RY----------YYEAYENKGTATKA----------------------------------
A0A2V9VQW5      RY----------YYESYEKTARQKA-----------------------------------
A0A2V9WTP3      RY----------YYGAYEKRGTEAKA----------------------------------
A0A2V9NLA9      QY----------YYDAYGKPNGKNEQR---------------------------------
A0A2V9RKJ9      QY----------YYDAYGKPNGKNEQR---------------------------------
A0A2V9RN95      QY----------YYSSYGHPNSKGDGRR--------------------------------
A0A2V9N406      QY----------YYSSYGHPNSQGDGRR--------------------------------
A0A2V9U6D9      QY----------YYSSYGHPNSQGDGRR--------------------------------
A0A2V8DZN4      GY---------AYYKHYYAGYYHYYGDGSGKGGGNSVGPQDGEEPVAVERAAGASRWVAD
A0A3N5YKY1      SG---------YAYGRVDNQNAGRRVARSGA-----------------------------
A0A2G6HQA4      KS---------SKYG-YGYGYNYRYE----------------------------------
A0A2V7ZTY7      GG---------YTYGYYGER----------------------------------------
A0A2V7ZVL9      GG---------YTYGYYGER----------------------------------------
A0A1Q7QYI4      GY---------G-YG-YYSY--------GERG----------------------------
A0A2V8G9Y9      GF---------GYYG-YYGHYGPQRKRGARRA----------------------------
A0A143PNR5      GY---------GKYGGYYNDYGRGGQ----------------------------------
A0A6A7L078      ------------EENEYYDRHYRQ------------------------------------
A0A143PXU3      RE---------DYYGNY-YGYGSK------------------------------------
A0A2V8D8G9      DA---------DYYGQYGSSRDGR------------------------------------
A0A2V8ESQ4      DA---------DYYGQYGSSRDGR------------------------------------
A0A1E3Y5Q0      NY---------GRYAERTSPPGRR------------------------------------
A0A2W4TWK5      -A---------DRYQSYYYSPARS------------------------------------
A0A3N5NYV3      SS---------DSSSSYAYGPNNN------------------------------------
A0A2V2RJF9      YS----------YYSRYYAYRYGEQPKALPPKFIQ-------------------------
A0A2G6HNT3      GY----------GYGSKYE-----------------------------------------
A0A2V7YWD4      GR----------YYYAYSSRS---------------------------------------
A0A2V2R8T6      QY----------RYYNQRSLPPGDPNELVNQQQEVVTVN---------------------
A0A1Q7RGF1      GG----------YTAARKEST---------------------------------------
A0A2V9BLX2      GG----------YTAARKEST---------------------------------------
A0A2V9ZA03      RQ----------YYKSPANSRASAGHERRLS-----------------------------
A0A3N5ZNH4      YR----------HYYDETYSNDFSAA----------------------------------
A0A2V8GEZ2      GG----------YYGAHSHEDQEQA-----------------------------------
A0A3N5ZFD3      ER----------YYAGYAKRTEG-------------------------------------
G8NXD3          GA----------NYDRGYR-----------------------------------------
A0A2V9VR38      ------------YYYEYQGKYARYYREDDSSEHDHDEEHAVEESSPSSSSA---------
A0A2V9EY04      GY----------KYAEAKA-----------------------------------------
A0A2V9HAK9      VH----------EYGY--------------------------------------------
A0A1Q7FS15      GY----------GYGSSKS-----------------------------------------
A0A1Q7K9P1      GY----------GYGSSKS-----------------------------------------
A0A1Q7N989      GY----------GYGSSKS-----------------------------------------
A0A2V9G7Y0      GY----------E-----------------------------------------------
A0A2V8T7Z1      -R----------SYRAYG-----------YPPRLARAAARRPRLR---------------
A0A2V7U8G5      GK----------YYGGYYHDRSRRETGG------GRSSRQRDQKPRRSSWR---------
A0A2V7UNP9      GG----------DYRSYYHHPSAPRRGGWWRSWRGQAKTKRGQKARPQPWR---------
A0A2V7VLD7      GG----------DYRSYYH---------WWRSWRGQAKTKRGQKARPQPWR---------
A0A2V7XGA3      GR-----------YEGYYGYHQPH------------------------------------
A0A2V7YAG6      TR-----------YQGYYGYGQPANGGRSW----WRFPWRRAAQGRFRPWR---------
A0A2V7VK33      KR----------YY---------------GAPPGPRATRNRVTAGRGWRFWR--------
A0A7C5EWK9      HK----------YYYE--------------------------------------------
A0A3M1VTE1      SR----------YYSRYY-----------GKGGR--------------------------
A0A2V7TTM7      KG----------YYMGYDGDRA-------GAGSKGRWSSWWRRRRSGRKPWR--------
A0A2V8VI82      -G----------YYYGYG-----------RPRGDGRYDRGERPGSRKVAALWR-------
A0A2V7U4P9      -Y----------YYSAAR-----------PEPSRWSWFKRK-------------------
A0A2V7TQY5      -G----------YYSSYY-----------HEPTNGQGTLWTRIADTAKRPFRSRVSGTAV
A0A2V7TU87      -D----------YYAGSGRHDKGGAPTWWRPFAKIRSVFDPDAAGRRRPERRREIR----
A0A2V8SEH0      -G----------YY-GYG-----------QQHGRARAAERGRGGAPRSQPCP--------
A0A2V8VU54      -G----------YYHAYG-----------RPPGRGR---RPPQPATRETAPREAAPEPPL
A0A1Q7RML7      -G----------YYHAYG-----------RPPGRAR---RSGARSPAHDTLR--------
A0A1Q7ZIQ5      -G----------YYHAYG-----------RPPGRAR---RSGARSPAHDTLR--------
A0A2V8TKD8      -G----------YYHAYG-----------RPPGRAR---RPGARSPAHDTLR--------
                                                                            

A0A1F2U8T6      -----------------------------------
A0A2V8BV42      -----------------------------------
A0A2V8F916      -----------------------------------
A0A1Q7K833      -----------------------------------
A0A1Q8AMY4      -----------------------------------
A0A2V8BM40      -----------------------------------
A0A2V8CRT6      -----------------------------------
A0A1F2VH76      -----------------------------------
A0A1F2R0X5      -----------------------------------
A0A2V8B278      -----------------------------------
A0A2V8CEF9      -----------------------------------
A0A2V8KZG2      -----------------------------------
A0A2V8TKR9      -----------------------------------
A0A1Q7LG57      -----------------------------------
A0A2V8MKQ7      -----------------------------------
A0A1Q7L5B1      -----------------------------------
A0A2V9DKV4      -----------------------------------
A0A2V9EVA0      -----------------------------------
A0A7C5ZU39      -----------------------------------
A0A3N5YN96      -----------------------------------
A0A1Q7Y646      -----------------------------------
A0A2V8QZU0      -----------------------------------
A0A2V8RSQ9      -----------------------------------
A0A2V9L2P7      -----------------------------------
A0A2V7UMX0      -----------------------------------
A0A136K497      -----------------------------------
A0A399W9E4      -----------------------------------
A0A321LMC5      -----------------------------------
A0A2V8X713      -----------------------------------
A0A2V8ZLE9      -----------------------------------
A0A2V8Y4D3      -----------------------------------
A0A2V8Z2X8      -----------------------------------
A0A2V9C3F6      -----------------------------------
A0A2V9QMU9      -----------------------------------
A0A2V9QY75      -----------------------------------
A0A2V9SVU9      -----------------------------------
A0A2V8W5N5      -----------------------------------
A0A2V8XG53      -----------------------------------
A0A6A7LB89      -----------------------------------
A0A352EZH8      -----------------------------------
A0A0B6X033      GVAV-------------------------------
A0A2V8R0I3      GFVS-------------------------------
A0A2V8N1U8      DMVS-------------------------------
A0A2V8QL35      EGVS-------------------------------
A0A352FU10      EGVS-------------------------------
A0A2V8LCU0      EGVS-------------------------------
A0A1Q7NGT0      EMVS-------------------------------
A0A2V8MLP9      DMVS-------------------------------
A0A2V8PQZ0      DMVS-------------------------------
A0A3B9MKY6      -----------------------------------
A0A3D5SKZ1      -----------------------------------
A0A2V8NRW2      -----------------------------------
A0A2V9XV04      EPGELVASAERGGWVRQDSGRDSNRALDFALARPV
A0A2V9CBY1      -----------------------------------
A0A2V9D656      -----------------------------------
A0A7C2L7W9      EEAS-------------------------------
A0A7C2XG00      EEAS-------------------------------
A0A2V9J901      -----------------------------------
A0A2V8QJ59      -----------------------------------
A0A1Q7HTA7      -----------------------------------
A0A2V8YMQ4      -----------------------------------
A0A2V8W380      -----------------------------------
A0A2V8ZIV5      -----------------------------------
A0A7C2M3P5      -----------------------------------
A0A2V8LBV1      -----------------------------------
A0A2V8GAF9      -----------------------------------
A0A7C5I7P7      -----------------------------------
A0A2V8CN98      -----------------------------------
A0A1Q7LC46      -----------------------------------
A0A1Q8BDC5      -----------------------------------
A0A2V9Q1Y8      -----------------------------------
A0A2V8JXG1      -----------------------------------
A0A350D2W9      -----------------------------------
A0A2V9I4J1      -----------------------------------
A0A2V8PQZ9      -----------------------------------
A0A2V8D8B1      -----------------------------------
A0A3B9LSB4      -----------------------------------
A0A2V9H7U2      -----------------------------------
A0A2V8NJB5      -----------------------------------
A0A2V9JMZ4      -----------------------------------
A0A2V9MDJ6      -----------------------------------
A0A2V8QJT6      -----------------------------------
A0A2V8FSM8      DVHPDEGSRRRPRYARSEA----------------
A0A359M0J2      -----------------------------------
A0A2V8JLJ1      -----------------------------------
A0A5M8SND8      -----------------------------------
A0A2V9GAQ1      -----------------------------------
A0A497EDQ8      -----------------------------------
G8NS05          -----------------------------------
A0A2V8KZ20      -----------------------------------
A0A3D0NWU2      -----------------------------------
A0A2V8EPD9      -----------------------------------
A0A3N5NSX5      -----------------------------------
A0A2V8MUA1      -----------------------------------
A0A2V8MBH9      -----------------------------------
A0A3N5ZPQ7      -----------------------------------
A0A3N5P5F2      -----------------------------------
A0A7C2EFE5      -----------------------------------
A0A2V9G1P7      -----------------------------------
A0A2V9BCK9      -----------------------------------
A0A2V9TMX2      -----------------------------------
A0A7C4DQP8      -----------------------------------
A0A2V8N2J7      -----------------------------------
A0A3N6BI26      -----------------------------------
A0A2V9JMM3      -----------------------------------
A0A2V9M815      -----------------------------------
A0A2V9A795      -----------------------------------
A0A355ESH9      -----------------------------------
A0A3D0NW85      -----------------------------------
A0A353CAT5      -----------------------------------
A0A2V9HB55      -----------------------------------
A0A2V8CU57      -----------------------------------
A0A2V8BDI4      -----------------------------------
A0A2V8F8T3      -----------------------------------
A0A2W0B5E2      -----------------------------------
A0A2V8NMG8      -----------------------------------
A0A2V8TBM7      -----------------------------------
A0A1Q7HEZ8      -----------------------------------
A0A1Q7JW36      -----------------------------------
A0A1Q7MUR4      -----------------------------------
A0A3N5PFU4      -----------------------------------
A0A3M1SNQ5      -----------------------------------
A0A7C2C0C1      -----------------------------------
A0A4R1LDF1      -----------------------------------
A0A1F2T1R8      -----------------------------------
A0A2V9BW09      -----------------------------------
A0A3M1SSE1      -----------------------------------
A0A2V9GQV7      -----------------------------------
A0A7C5AUB2      -----------------------------------
A0A2V8YCY6      -----------------------------------
A0A2V8EGM3      -----------------------------------
A0A2V8FGH1      -----------------------------------
A0A2V7YV88      LDRS-------------------------------
A0A2V8D468      -----------------------------------
A0A1F2R977      -----------------------------------
A0A2U3LF12      -----------------------------------
A0A7C5MF19      -----------------------------------
A0A3N5G7M6      -----------------------------------
A0A1F2S3Q7      -----------------------------------
A0A2V8GVG4      -----------------------------------
A0A2V8PJQ0      -----------------------------------
A0A2V8H566      -----------------------------------
A0A2V8UVN4      -----------------------------------
A0A1Q7RB73      -----------------------------------
A0A2V9K0H7      -----------------------------------
A0A321LXF5      -----------------------------------
A0A5M8SBZ0      -----------------------------------
A0A1Q7JFB1      -----------------------------------
A0A2V9LS17      -----------------------------------
A0A7C2YLF6      -----------------------------------
A0A2V7X0V9      -----------------------------------
A0A2V9X518      -----------------------------------
A0A2V9VC62      -----------------------------------
A0A2V9S1P8      -----------------------------------
A0A2V9RTW2      -----------------------------------
A0A2V9TGF1      -----------------------------------
A0A2V9XEV6      -----------------------------------
A0A2V9Y3Q6      -----------------------------------
A0A2V9R269      -----------------------------------
A0A2V9PTS3      -----------------------------------
A0A2V9NPF4      -----------------------------------
A0A2V9PNZ0      -----------------------------------
A0A2V9AGR3      -----------------------------------
A0A2V9G0N7      -----------------------------------
A0A2V9GQ44      -----------------------------------
A0A2V9HRN3      -----------------------------------
A0A2V8WG13      -----------------------------------
A0A2V8X987      -----------------------------------
A0A1Q7KX94      -----------------------------------
A0A2V8XHT0      -----------------------------------
A0A2V8DMJ9      -----------------------------------
A0A2V8GGF6      -----------------------------------
A0A2V8HKU7      -----------------------------------
A0A1Q6Y875      -----------------------------------
A0A523DJA9      -----------------------------------
A0A2V8I604      -----------------------------------
A0A2V8J066      -----------------------------------
A0A1I6MMC5      -----------------------------------
A0A2V9D5W7      -----------------------------------
A0A2V9D4I4      -----------------------------------
A0A2V9D6L7      -----------------------------------
A0A2V8ZJV2      -----------------------------------
A0A2V9AWB5      -----------------------------------
A0A2V8Z1Y8      -----------------------------------
A0A1Q8AX10      -----------------------------------
A0A2V9A773      -----------------------------------
A0A2V9AND3      -----------------------------------
A0A2V9BTJ7      -----------------------------------
A0A2V8W2M7      -----------------------------------
A0A2V8XNW2      -----------------------------------
A0A1Q7CJC1      -----------------------------------
A0A2V9UEM7      -----------------------------------
A0A7C4DTF2      -----------------------------------
A0A1Q7V300      -----------------------------------
A0A2V9ZCI3      -----------------------------------
A0A2V9WCB3      -----------------------------------
A0A2V9VQW5      -----------------------------------
A0A2V9WTP3      -----------------------------------
A0A2V9NLA9      -----------------------------------
A0A2V9RKJ9      -----------------------------------
A0A2V9RN95      -----------------------------------
A0A2V9N406      -----------------------------------
A0A2V9U6D9      -----------------------------------
A0A2V8DZN4      VDVHPDEGSRRRPRYARSEA---------------
A0A3N5YKY1      -----------------------------------
A0A2G6HQA4      -----------------------------------
A0A2V7ZTY7      -----------------------------------
A0A2V7ZVL9      -----------------------------------
A0A1Q7QYI4      -----------------------------------
A0A2V8G9Y9      -----------------------------------
A0A143PNR5      -----------------------------------
A0A6A7L078      -----------------------------------
A0A143PXU3      -----------------------------------
A0A2V8D8G9      -----------------------------------
A0A2V8ESQ4      -----------------------------------
A0A1E3Y5Q0      -----------------------------------
A0A2W4TWK5      -----------------------------------
A0A3N5NYV3      -----------------------------------
A0A2V2RJF9      -----------------------------------
A0A2G6HNT3      -----------------------------------
A0A2V7YWD4      -----------------------------------
A0A2V2R8T6      -----------------------------------
A0A1Q7RGF1      -----------------------------------
A0A2V9BLX2      -----------------------------------
A0A2V9ZA03      -----------------------------------
A0A3N5ZNH4      -----------------------------------
A0A2V8GEZ2      -----------------------------------
A0A3N5ZFD3      -----------------------------------
G8NXD3          -----------------------------------
A0A2V9VR38      -----------------------------------
A0A2V9EY04      -----------------------------------
A0A2V9HAK9      -----------------------------------
A0A1Q7FS15      -----------------------------------
A0A1Q7K9P1      -----------------------------------
A0A1Q7N989      -----------------------------------
A0A2V9G7Y0      -----------------------------------
A0A2V8T7Z1      -----------------------------------
A0A2V7U8G5      -----------------------------------
A0A2V7UNP9      -----------------------------------
A0A2V7VLD7      -----------------------------------
A0A2V7XGA3      -----------------------------------
A0A2V7YAG6      -----------------------------------
A0A2V7VK33      -----------------------------------
A0A7C5EWK9      -----------------------------------
A0A3M1VTE1      -----------------------------------
A0A2V7TTM7      -----------------------------------
A0A2V8VI82      -----------------------------------
A0A2V7U4P9      -----------------------------------
A0A2V7TQY5      -----------------------------------
A0A2V7TU87      -----------------------------------
A0A2V8SEH0      -----------------------------------
A0A2V8VU54      K----------------------------------
A0A1Q7RML7      -----------------------------------
A0A1Q7ZIQ5      -----------------------------------
A0A2V8TKD8      -----------------------------------
                                                   

© 1998-2021Legal notice