BYKdb

Dataset for cluster orphancd of phylum acidobacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

240 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1F2U8T6      ------------------------------------------------------------
A0A2V8BV42      ------------------------------------------------------------
A0A2V8F916      ------------------------------------------------------------
A0A1Q7K833      ------------------------------------------------------------
A0A1Q8AMY4      ------------------------------------------------------------
A0A2V8BM40      ------------------------------------------------------------
A0A2V8CRT6      ------------------------------------------------------------
A0A1F2VH76      ------------------------------------------------------------
A0A1F2R0X5      ------------------------------------------------------------
A0A2V8B278      ------------------------------------------------------------
A0A2V8CEF9      ------------------------------------------------------------
A0A2V8KZG2      ------------------------------------------------------------
A0A1Q7LG57      ------------------------------------------------------------
A0A2V8YMQ4      ------------------------------------------------------------
A0A1Q7L5B1      ------------------------------------------------------------
A0A2V9DKV4      ------------------------------------------------------------
A0A2V8W380      ------------------------------------------------------------
A0A2V8ZIV5      ------------------------------------------------------------
A0A2V9EVA0      ------------------------------------------------------------
A0A1Q7RB73      ------------------------------------------------------------
A0A2V9K0H7      ------------------------------------------------------------
A0A3N5YN96      ------------------------------------------------------------
A0A1Q7Y646      ------------------------------------------------------------
A0A2V8QZU0      ------------------------------------------------------------
A0A2V8RSQ9      ------------------------------------------------------------
A0A2V9LS17      ------------------------------------------------------------
A0A2V9AGR3      ------------------------------------------------------------
A0A2V9G0N7      ------------------------------------------------------------
A0A2V9GQ44      ------------------------------------------------------------
A0A2V9HRN3      ------------------------------------------------------------
A0A2V8WG13      ------------------------------------------------------------
A0A2V8X987      ------------------------------------------------------------
A0A1Q7KX94      ------------------------------------------------------------
A0A2V8XHT0      ------------------------------------------------------------
A0A2V9L2P7      ------------------------------------------------------------
A0A2V7UMX0      ------------------------------------------------------------
A0A136K497      ------------------------------------------------------------
A0A399W9E4      ------------------------------------------------------------
A0A2V7X0V9      ------------------------------------------------------------
A0A2V9X518      ------------------------------------------------------------
A0A2V9VC62      ------------------------------------------------------------
A0A2V9S1P8      ------------------------------------------------------------
A0A2V9RTW2      ------------------------------------------------------------
A0A2V9TGF1      ------------------------------------------------------------
A0A2V9XEV6      ------------------------------------------------------------
A0A2V9Y3Q6      ------------------------------------------------------------
A0A2V9R269      ------------------------------------------------------------
A0A2V9PTS3      ------------------------------------------------------------
A0A2V9NPF4      ------------------------------------------------------------
A0A2V9PNZ0      ------------------------------------------------------------
A0A321LMC5      ------------------------------------------------------------
A0A2V8X713      ------------------------------------------------------------
A0A2V8ZLE9      ------------------------------------------------------------
A0A2V8Y4D3      ------------------------------------------------------------
A0A2V8Z2X8      ------------------------------------------------------------
A0A2V9C3F6      ------------------------------------------------------------
A0A2V9QMU9      ------------------------------------------------------------
A0A2V9QY75      ------------------------------------------------------------
A0A2V9SVU9      ------------------------------------------------------------
A0A2V8W5N5      ------------------------------------------------------------
A0A2V8XG53      ------------------------------------------------------------
A0A2V9XV04      ------------------------------------------------------------
A0A2V9CBY1      ------------------------------------------------------------
A0A2V9D656      ------------------------------------------------------------
A0A352EZH8      ------------------------------------------------------------
A0A0B6X033      ------------------------------------------------------------
A0A2V8R0I3      ------------------------------------------------------------
A0A2V8N1U8      ------------------------------------------------------------
A0A2V8QL35      ------------------------------------------------------------
A0A352FU10      ------------------------------------------------------------
A0A2V8LCU0      ------------------------------------------------------------
A0A1Q7NGT0      ------------------------------------------------------------
A0A2V8MLP9      ------------------------------------------------------------
A0A2V8PQZ0      ------------------------------------------------------------
A0A3B9MKY6      ------------------------------------------------------------
A0A3D5SKZ1      ------------------------------------------------------------
A0A2V8NRW2      ------------------------------------------------------------
A0A2V8TKR9      ------------------------------------------------------------
A0A2V8LBV1      ------------------------------------------------------------
A0A2V8GAF9      ------------------------------------------------------------
A0A2V8CN98      ------------------------------------------------------------
A0A1Q7LC46      ------------------------------------------------------------
A0A1Q8BDC5      ------------------------------------------------------------
A0A2V9Q1Y8      ------------------------------------------------------------
A0A2V8JXG1      ------------------------------------------------------------
A0A350D2W9      ------------------------------------------------------------
A0A2V9I4J1      ------------------------------------------------------------
A0A2V8PQZ9      ------------------------------------------------------------
A0A2V8D8B1      ------------------------------------------------------------
A0A3B9LSB4      ------------------------------------------------------------
A0A2V9H7U2      ------------------------------------------------------------
A0A2V8NJB5      ------------------------------------------------------------
A0A2V9JMZ4      ------------------------------------------------------------
A0A2V9MDJ6      ------------------------------------------------------------
A0A2V8QJT6      ------------------------------------------------------------
A0A2V8FSM8      -----MSQELQSLARHSYPTSTQPLSTIDLPPTAVSIEPPGPGLKRDYSGPVEYWQIVRR
A0A359M0J2      -----MHPEDPNSGTSHRPQALTPIVLPRNAQPALYTPFPSEPAPEAPATNWVQFHLAIL
A0A2V8JLJ1      ------------------------------------------------------------
A0A5M8SND8      MPHGTSGLRAAVVRRTIDAGAPLMPYTGTTGFDGDSLKIAADAERGGLFEAWRIVRAEYR
A0A2V9GAQ1      ----------------------------MTEENKLVPRENGSLGGSDLLPVPIRLPVWEL
A0A497EDQ8      ------------------------------------------------------------
G8NS05          -------------------MIPSRPENFSAEPDSRAASAGPAATDATLSEALMTIRKRKY
A0A2V8KZ20      ------------------------------------------MKNFENLTISDYIDIARR
A0A3D0NWU2      ------------------------------------------------------------
A0A2V8EPD9      ------------------------------------------------------------
A0A3N5NSX5      ------------------------------------------------------------
A0A2V8MUA1      ------------------------------------------------------------
A0A2V8MBH9      ------------------------------------------------------------
A0A3N5ZPQ7      ------------------------------------------------------------
A0A3N5P5F2      ------------------------------------------------------------
A0A2V9G1P7      ------------------------------------------PTIKELYELDAVSDAYLR
A0A2V9BCK9      ------------------------------------------------------MKATKM
A0A2V9TMX2      -------------------------------MYQATSKVAIFPEVPNVLGFKDAENIAPD
A0A2V8N2J7      ----------------------------------------MASTAGNSLSVFSILDALRR
A0A3N6BI26      ------------------------------------------------------------
A0A2V9JMM3      ---------------------------------------MQLTEVAKGASILAILDAARR
A0A2V9M815      ---------------------------------------MQLTEVAKGASILAILDAARR
A0A2V9A795      ------------------------------------------------------------
A0A355ESH9      ------------------------------------------------------------
A0A3D0NW85      ------------------------------------------------------------
A0A353CAT5      ------------------------------------------------------------
A0A2V9HB55      ------------------------------------------------------------
A0A2V8CU57      ------------------------------------------------------------
A0A2V8BDI4      ------------------------------------------------------------
A0A2V8F8T3      ------------------------------------------------------------
A0A2V9J901      ------------------------------------------------------------
A0A2V8MKQ7      ------------------------------------------------------------
A0A3M1SNQ5      ------------------------------------------------------------
A0A2V8QJ59      ------------------------------------------------------------
A0A1Q7HTA7      ------------------------------------------------------------
A0A2W0B5E2      ------------------------------------------------------------
A0A2V8NMG8      ------------------------------------------------------------
A0A2V8TBM7      ------------------------------------------------------------
A0A1Q7HEZ8      ------------------------------------------------------------
A0A1Q7JW36      ------------------------------------------------------------
A0A1Q7MUR4      ------------------------------------------------------------
A0A3N5PFU4      ------------------------------------------------------------
A0A4R1LDF1      ------------------------------------------------------------
A0A1F2T1R8      ------------------------------------------------------------
A0A2V9BW09      ------------------------------------------------------------
A0A3M1SSE1      ------------------------------------------------------------
A0A2V9GQV7      ------------------------------------------------------------
A0A2V7YV88      ------------------------------------------------------------
A0A2V8YCY6      ------------------------------------------------------------
A0A2V8EGM3      ------------------------------------------------------------
A0A2V8FGH1      ------------------------------------------------------------
A0A2V8D468      ------------------------------------------------------------
A0A1F2R977      ------------------------------------------------------------
A0A2U3LF12      ------------------------------------------------------------
A0A3N5G7M6      ------------------------------------------------------------
A0A1F2S3Q7      ------------------------------------------------------------
A0A2V8GVG4      ------------------------------------------------------------
A0A143PNR5      ------------------------------------------------------------
A0A2V8PJQ0      ------------------------------------------------------------
A0A2V8H566      ------------------------------------------------------------
A0A3N5YKY1      ------------------------------------------------------------
A0A2V8UVN4      ------------------------------------------------------------
A0A321LXF5      ------------------------------------------------------------
A0A5M8SBZ0      ------------------------------------------------------------
A0A1Q7JFB1      ------------------------------------------------------------
A0A2V8DMJ9      ------------------------------------------------------------
A0A2V8GGF6      ------------------------------------------------------------
A0A2V8HKU7      ------------------------------------------------------------
A0A1Q6Y875      ------------------------------------------------------------
A0A523DJA9      ------------------------------------------------------------
A0A2V8I604      ------------------------------------------------------------
A0A2V8J066      ------------------------------------------------------------
A0A1I6MMC5      ------------------------------------------------------------
A0A2V9D5W7      ------------------------------------------------------------
A0A2V9D4I4      ------------------------------------------------------------
A0A2V9D6L7      ------------------------------------------------------------
A0A2V8ZJV2      ------------------------------------------------------------
A0A2V9AWB5      ------------------------------------------------------------
A0A2V8Z1Y8      ------------------------------------------------------------
A0A1Q8AX10      ------------------------------------------------------------
A0A2V9A773      ------------------------------------------------------------
A0A2V9AND3      ------------------------------------------------------------
A0A2V9BTJ7      ------------------------------------------------------------
A0A2V8W2M7      ------------------------------------------------------------
A0A2V8XNW2      ------------------------------------------------------------
A0A1Q7CJC1      ------------------------------------------------------------
A0A2V9UEM7      ------------------------------------------------------------
A0A1Q7V300      ------------------------------------------------------------
A0A2V9ZCI3      ------------------------------------------------------------
A0A2V9WCB3      ------------------------------------------------------------
A0A2V9VQW5      ------------------------------------------------------------
A0A2V9WTP3      ------------------------------------------------------------
A0A2V9NLA9      ------------------------------------------------------------
A0A2V9RKJ9      ------------------------------------------------------------
A0A2V9RN95      ------------------------------------------------------------
A0A2V9N406      ------------------------------------------------------------
A0A2V9U6D9      ------------------------------------------------------------
A0A2V8DZN4      ------------------------------------------------------------
A0A2G6HQA4      ------------------------------------------------------------
A0A2V7ZTY7      ------------------------------------------------------------
A0A2V7ZVL9      ------------------------------------------------------------
A0A1Q7QYI4      ------------------------------------------------------------
A0A2V8G9Y9      ------------------------------------------------------------
A0A143PXU3      ------------------------------------------------------------
A0A2V8D8G9      ------------------------------------------------------------
A0A2V8ESQ4      ------------------------------------------------------------
A0A1E3Y5Q0      ------------------------------------------------------------
A0A2W4TWK5      ------------------------------------------------------------
A0A3N5NYV3      ------------------------------------------------------------
A0A2V2RJF9      ------------------------------------------------------------
A0A2G6HNT3      ------------------------------------------------------------
A0A2V7YWD4      ------------------------------------------------------------
A0A2V2R8T6      ------------------------------------------------------------
A0A1Q7RGF1      ------------------------------------------------------------
A0A2V9BLX2      ------------------------------------------------------------
A0A2V9ZA03      ------------------------------------------------------------
A0A3N5ZNH4      ------------------------------------------------------------
A0A2V8GEZ2      ------------------------------------------------------------
A0A3N5ZFD3      ------------------------------------------------------------
G8NXD3          ------------------------------------------------------------
A0A2V9VR38      ------------------------------------------------------------
A0A2V9EY04      ------------------------------------------------------------
A0A2V9HAK9      ------------------------------------------------------------
A0A1Q7FS15      ------------------------------------------------------------
A0A1Q7K9P1      ------------------------------------------------------------
A0A1Q7N989      ------------------------------------------------------------
A0A2V9G7Y0      ------------------------------------------------------------
A0A2V8T7Z1      ------------------------------------------------------------
A0A2V7U8G5      ------------------------------------------------------------
A0A2V7UNP9      ------------------------------------------------------------
A0A2V7VLD7      ------------------------------------------------------------
A0A2V7XGA3      ------------------------------------------------------------
A0A2V7YAG6      ------------------------------------------------------------
A0A2V7VK33      ------------------------------------------------------------
A0A3M1VTE1      ------------------------------------------------------------
A0A2V7TTM7      ------------------------------------------------------------
A0A2V8VI82      ------------------------------------------------------------
A0A2V7U4P9      ------------------------------------------------------------
A0A2V7TQY5      ------------------------------------------------------------
A0A2V7TU87      ------------------------------------------------------------
A0A2V8SEH0      ------------------------------------------------------------
A0A2V8VU54      ------------------------------------------------------------
A0A1Q7RML7      ------------------------------------------------------------
A0A1Q7ZIQ5      ------------------------------------------------------------
A0A2V8TKD8      ------------------------------------------------------------
                                                                            

A0A1F2U8T6      ------------------------------------------------------------
A0A2V8BV42      ------------------------------------------------------------
A0A2V8F916      ------------------------------------------------------------
A0A1Q7K833      ------------------------------------------------------------
A0A1Q8AMY4      ------------------------------------------------------------
A0A2V8BM40      ------------------------------------------------------------
A0A2V8CRT6      ------------------------------------------------------------
A0A1F2VH76      ------------------------------------------------------------
A0A1F2R0X5      ------------------------------------------------------------
A0A2V8B278      ------------------------------------------------------------
A0A2V8CEF9      ------------------------------------------------------------
A0A2V8KZG2      ------------------------------------------------------------
A0A1Q7LG57      ------------------------------------------------------------
A0A2V8YMQ4      ------------------------------------------------------------
A0A1Q7L5B1      ------------------------------------------------------------
A0A2V9DKV4      ------------------------------------------------------------
A0A2V8W380      ------------------------------------------------------------
A0A2V8ZIV5      ------------------------------------------------------------
A0A2V9EVA0      ------------------------------------------------------------
A0A1Q7RB73      ------------------------------------------------------------
A0A2V9K0H7      ------------------------------------------------------------
A0A3N5YN96      ------------------------------------------------------------
A0A1Q7Y646      ------------------------------------------------------------
A0A2V8QZU0      ------------------------------------------------------------
A0A2V8RSQ9      ------------------------------------------------------------
A0A2V9LS17      ------------------------------------------------------------
A0A2V9AGR3      ------------------------------------------------------------
A0A2V9G0N7      ------------------------------------------------------------
A0A2V9GQ44      ------------------------------------------------------------
A0A2V9HRN3      ------------------------------------------------------------
A0A2V8WG13      ------------------------------------------------------------
A0A2V8X987      ------------------------------------------------------------
A0A1Q7KX94      ------------------------------------------------------------
A0A2V8XHT0      ------------------------------------------------------------
A0A2V9L2P7      ------------------------------------------------------------
A0A2V7UMX0      ------------------------------------------------------------
A0A136K497      ------------------------------------------------------------
A0A399W9E4      ------------------------------------------------------------
A0A2V7X0V9      ------------------------------------------------------------
A0A2V9X518      ------------------------------------------------------------
A0A2V9VC62      ------------------------------------------------------------
A0A2V9S1P8      ------------------------------------------------------------
A0A2V9RTW2      ------------------------------------------------------------
A0A2V9TGF1      ------------------------------------------------------------
A0A2V9XEV6      ------------------------------------------------------------
A0A2V9Y3Q6      ------------------------------------------------------------
A0A2V9R269      ------------------------------------------------------------
A0A2V9PTS3      ------------------------------------------------------------
A0A2V9NPF4      ------------------------------------------------------------
A0A2V9PNZ0      ------------------------------------------------------------
A0A321LMC5      ------------------------------------------------------------
A0A2V8X713      ------------------------------------------------------------
A0A2V8ZLE9      ------------------------------------------------------------
A0A2V8Y4D3      ------------------------------------------------------------
A0A2V8Z2X8      ------------------------------------------------------------
A0A2V9C3F6      ------------------------------------------------------------
A0A2V9QMU9      ------------------------------------------------------------
A0A2V9QY75      ------------------------------------------------------------
A0A2V9SVU9      ------------------------------------------------------------
A0A2V8W5N5      ------------------------------------------------------------
A0A2V8XG53      ------------------------------------------------------------
A0A2V9XV04      ------------------------------------------------------------
A0A2V9CBY1      ------------------------------------------------------------
A0A2V9D656      ------------------------------------------------------------
A0A352EZH8      ------------------------------------------------------------
A0A0B6X033      ------------------------------------------------------------
A0A2V8R0I3      ------------------------------------------------------------
A0A2V8N1U8      ------------------------------------------------------------
A0A2V8QL35      ------------------------------------------------------------
A0A352FU10      ------------------------------------------------------------
A0A2V8LCU0      ------------------------------------------------------------
A0A1Q7NGT0      ------------------------------------------------------------
A0A2V8MLP9      ------------------------------------------------------------
A0A2V8PQZ0      ------------------------------------------------------------
A0A3B9MKY6      ------------------------------------------------------------
A0A3D5SKZ1      ------------------------------------------------------------
A0A2V8NRW2      ------------------------------------------------------------
A0A2V8TKR9      ------------------------------------------------------------
A0A2V8LBV1      ------------------------------------------------------------
A0A2V8GAF9      ------------------------------------------------------------
A0A2V8CN98      ------------------------------------------------------------
A0A1Q7LC46      ------------------------------------------------------------
A0A1Q8BDC5      ------------------------------------------------------------
A0A2V9Q1Y8      ------------------------------------------------------------
A0A2V8JXG1      ------------------------------------------------------------
A0A350D2W9      ------------------------------------------------------------
A0A2V9I4J1      ------------------------------------------------------------
A0A2V8PQZ9      ------------------------------------------------------------
A0A2V8D8B1      ------------------------------------------------------------
A0A3B9LSB4      ------------------------------------------------------------
A0A2V9H7U2      ------------------------------------------------------------
A0A2V8NJB5      ------------------------------------------------------------
A0A2V9JMZ4      ------------------------------------------------------------
A0A2V9MDJ6      ------------------------------------------------------------
A0A2V8QJT6      ------------------------------------------------------------
A0A2V8FSM8      HKGAVLLATVAGALLGFAMTLSEPRIYQAKTTLEYQGINEEFLDMKKVNPVVDTSYLDSD
A0A359M0J2      KRRFWWVLALGFLGTGVGFLVFLPQDPQYMAATTIELQPINENFLGAFDPLSGSFSSQNL
A0A2V8JLJ1      ------------------------------------------------------------
A0A5M8SND8      TVLLAMGVGLVLALSVGLFKAPMFTSRCELVIESPNGDFLGTRSISPVADDPASEGGLTD
A0A2V9GAQ1      SPREPHLYDYLLILRKHQWLILSFLHRENANILPFQGTDSYDIMMDQDNYIETQSKILTS
A0A497EDQ8      ------------------------------------------------------------
G8NS05          VILAAALLGMIYGFYKGSTQPHLFESYGDIEIRSGSSDQYRIAGSTGAGGNRLPTEVAIL
A0A2V8KZ20      RIWYVVTTTTLVAAGTVLFALRLPAIYKSETTIAISSRFLPENYMPTIDRQTITDRMDFA
A0A3D0NWU2      ------------------------------------------------------------
A0A2V8EPD9      ------------------------------------------------------------
A0A3N5NSX5      ------------------------------------------ARRLTRAATPSGATAGQP
A0A2V8MUA1      ------------------------------------------------------------
A0A2V8MBH9      ------------------------------------------------------------
A0A3N5ZPQ7      ------------------------------------------------------------
A0A3N5P5F2      ------------------------------------------------------------
A0A2V9G1P7      TQYSILASESLARRAIDQLHLETLREFNSRKWWQLWPETRKPSTTQTFAVGPVPQVRDRE
A0A2V9BCK9      YEKFFGLRESPFNVNPDPRYLFLTPSTQEALASLAYGIRGRKGIILLTGEVGTGKTTLLN
A0A2V9TMX2      YEYEATLETQVAILRSDALALKVIEGMRLYQDPRFTAVKQSSPESPMGEPSMQPDPVQAA
A0A2V8N2J7      RKFILMISKILLTAGFAIFAHLQPDRFRATALIAAA----QTTPPEYLR-HVAPPPLNIE
A0A3N6BI26      ------------------MTSQLSWLKRTVSNLRPG----RSDAPKTGADESGAGRDKNR
A0A2V9JMM3      RKFYVIVPALVLTVCVGAFASRLPNSYRAQALLAVE----RPPASDLLKMGGTPGPPGIQ
A0A2V9M815      RKFYVIVPALVLTVCVGAFASRLPNSYRAQALLAVE----RPPASDLLRMGGTPGPPSIQ
A0A2V9A795      ---------------------------------------------------------MYQ
A0A355ESH9      -------------VRSLDLMADPSFNPGAAAAKE-----------RTGATTAEEDEATLG
A0A3D0NW85      -----------RGFLRAIGLASSPDAQSDASLSEFA----ASPNSGLMSADEIAEAIRLA
A0A353CAT5      ------------MLRAIGLASDTTKDTTSTADSVNS----LNS--GLVSADEIAEAIRLA
A0A2V9HB55      -----------KILTSETLALQTIRNNGLSARPEFS----SPS--GPSEAIAVGSLANQK
A0A2V8CU57      ------------------------------------------------------------
A0A2V8BDI4      -----------MDLPRMSGRSDATSSWRSAATSIWG----RKP--RPRHRRCA---RRRP
A0A2V8F8T3      -----------MDLPRMSGRSDATSSWRSAATSIWG----RKP--RPRHRRCA---RRRP
A0A2V9J901      ------------------------------------------------------------
A0A2V8MKQ7      ------------------------------------------------------------
A0A3M1SNQ5      ------------------------------------------------------------
A0A2V8QJ59      ------------------------------------------------------------
A0A1Q7HTA7      ------------------------------------------------------------
A0A2W0B5E2      ------------------------------------------------------------
A0A2V8NMG8      ------------------------------------------------------------
A0A2V8TBM7      ------------------------------------------------------------
A0A1Q7HEZ8      ------------------------------------------------------------
A0A1Q7JW36      ------------------------------------------------------------
A0A1Q7MUR4      ------------------------------------------------------------
A0A3N5PFU4      ------------------------------------------------------------
A0A4R1LDF1      ------------------------------------------------------------
A0A1F2T1R8      ------------------------------------------------------------
A0A2V9BW09      ------------------------------------------------------------
A0A3M1SSE1      ------------------------------------------------------------
A0A2V9GQV7      ------------------------------------------------------------
A0A2V7YV88      ------------------------------------------------------------
A0A2V8YCY6      ------------------------------------------------------------
A0A2V8EGM3      ------------------------------------------------------------
A0A2V8FGH1      ------------------------------------------------------------
A0A2V8D468      ------------------------------------------------------------
A0A1F2R977      ------------------------------------------------------------
A0A2U3LF12      ------------------------------------------------------------
A0A3N5G7M6      ------------------------------------------------------------
A0A1F2S3Q7      ------------------------------------------------------------
A0A2V8GVG4      ------------------------------------------------------------
A0A143PNR5      ------------------------------------------------------------
A0A2V8PJQ0      ------------------------------------------------------------
A0A2V8H566      ------------------------------------------------------------
A0A3N5YKY1      ------------------------------------------------------------
A0A2V8UVN4      ------------------------------------------------------------
A0A321LXF5      ------------------------------------------------------------
A0A5M8SBZ0      ------------------------------------------------------------
A0A1Q7JFB1      ------------------------------------------------------------
A0A2V8DMJ9      ------------------------------------------------------------
A0A2V8GGF6      ------------------------------------------------------------
A0A2V8HKU7      ------------------------------------------------------------
A0A1Q6Y875      ------------------------------------------------------------
A0A523DJA9      ------------------------------------------------------------
A0A2V8I604      ------------------------------------------------------------
A0A2V8J066      ------------------------------------------------------------
A0A1I6MMC5      ------------------------------------------------------------
A0A2V9D5W7      ------------------------------------------------------------
A0A2V9D4I4      ------------------------------------------------------------
A0A2V9D6L7      ------------------------------------------------------------
A0A2V8ZJV2      ------------------------------------------------------------
A0A2V9AWB5      ------------------------------------------------------------
A0A2V8Z1Y8      ------------------------------------------------------------
A0A1Q8AX10      ------------------------------------------------------------
A0A2V9A773      ------------------------------------------------------------
A0A2V9AND3      ------------------------------------------------------------
A0A2V9BTJ7      ------------------------------------------------------------
A0A2V8W2M7      ------------------------------------------------------------
A0A2V8XNW2      ------------------------------------------------------------
A0A1Q7CJC1      ------------------------------------------------------------
A0A2V9UEM7      ------------------------------------------------------------
A0A1Q7V300      ------------------------------------------------------------
A0A2V9ZCI3      ------------------------------------------------------------
A0A2V9WCB3      ------------------------------------------------------------
A0A2V9VQW5      ------------------------------------------------------------
A0A2V9WTP3      ------------------------------------------------------------
A0A2V9NLA9      ------------------------------------------------------------
A0A2V9RKJ9      ------------------------------------------------------------
A0A2V9RN95      ------------------------------------------------------------
A0A2V9N406      ------------------------------------------------------------
A0A2V9U6D9      ------------------------------------------------------------
A0A2V8DZN4      ------------------------------------------------------------
A0A2G6HQA4      ------------------------------------------------------------
A0A2V7ZTY7      ------------------------------------------------------------
A0A2V7ZVL9      ------------------------------------------------------------
A0A1Q7QYI4      ------------------------------------------------------------
A0A2V8G9Y9      ------------------------------------------------------------
A0A143PXU3      ------------------------------------------------------------
A0A2V8D8G9      ------------------------------------------------------------
A0A2V8ESQ4      ------------------------------------------------------------
A0A1E3Y5Q0      ------------------------------------------------------------
A0A2W4TWK5      ------------------------------------------------------------
A0A3N5NYV3      ------------------------------------------------------------
A0A2V2RJF9      ------------------------------------------------------------
A0A2G6HNT3      ------------------------------------------------------------
A0A2V7YWD4      ------------------------------------------------------------
A0A2V2R8T6      ------------------------------------------------------------
A0A1Q7RGF1      ------------------------------------------------------------
A0A2V9BLX2      ------------------------------------------------------------
A0A2V9ZA03      ------------------------------------------------------------
A0A3N5ZNH4      ------------------------------------------------------------
A0A2V8GEZ2      ------------------------------------------------------------
A0A3N5ZFD3      ------------------------------------------------------------
G8NXD3          ------------------------------------------------------------
A0A2V9VR38      ------------------------------------------------------------
A0A2V9EY04      ------------------------------------------------------------
A0A2V9HAK9      ------------------------------------------------------------
A0A1Q7FS15      ------------------------------------------------------------
A0A1Q7K9P1      ------------------------------------------------------------
A0A1Q7N989      ------------------------------------------------------------
A0A2V9G7Y0      ------------------------------------------------------------
A0A2V8T7Z1      ------------------------------------------------------------
A0A2V7U8G5      ------------------------------------------------------------
A0A2V7UNP9      ------------------------------------------------------------
A0A2V7VLD7      ------------------------------------------------------------
A0A2V7XGA3      ------------------------------------------------------------
A0A2V7YAG6      ------------------------------------------------------------
A0A2V7VK33      ------------------------------------------------------------
A0A3M1VTE1      ------------------------------------------------------------
A0A2V7TTM7      ------------------------------------------------------------
A0A2V8VI82      ------------------------------------------------------------
A0A2V7U4P9      ------------------------------------------------------------
A0A2V7TQY5      ------------------------------------------------------------
A0A2V7TU87      ------------------------------------------------------------
A0A2V8SEH0      ------------------------------------------------------------
A0A2V8VU54      ------------------------------------------------------------
A0A1Q7RML7      ------------------------------------------------------------
A0A1Q7ZIQ5      ------------------------------------------------------------
A0A2V8TKD8      ------------------------------------------------------------
                                                                            

A0A1F2U8T6      ---------------------------------------------MGRAGQARGPLS---
A0A2V8BV42      ---------------------------------------MADLPPNARADSSPGVFAPPP
A0A2V8F916      ---------------------------------------MADLPPNARADSAPGVFAPPP
A0A1Q7K833      ------------------------------------------------------------
A0A1Q8AMY4      ------------------------------------------------------------
A0A2V8BM40      -----------------------------------------MPDHRQRTSSGTGSNPPAP
A0A2V8CRT6      ------------------------------------------------------------
A0A1F2VH76      -------------------------------MNGPNTPANLQAGTH---ALTPLSQE---
A0A1F2R0X5      -------------------------------MSESASGGAHRPSTTSASASHPTGTAGHS
A0A2V8B278      -------------------------------MAEPKAPHPLRPATT---ADHPAAAA---
A0A2V8CEF9      -------------------------------MAELKAPHSLRPATT---ADHPAAAA---
A0A2V8KZG2      ------------------------------------------------------------
A0A1Q7LG57      ------------------------------------------------------------
A0A2V8YMQ4      ------------------------------------------------------------
A0A1Q7L5B1      ------------------------------------------------------------
A0A2V9DKV4      ------------------------------------------------------------
A0A2V8W380      ------------------------------------------------------------
A0A2V8ZIV5      ------------------------------------------------------------
A0A2V9EVA0      ------------------------------------------------------------
A0A1Q7RB73      ------------------------------------------------------------
A0A2V9K0H7      ------------------------------------------------------------
A0A3N5YN96      ------------------------------------------------------------
A0A1Q7Y646      ------------------------------------------------------------
A0A2V8QZU0      ------------------------------------------------------------
A0A2V8RSQ9      ------------------------------------------------------------
A0A2V9LS17      ------------------------------------------------------------
A0A2V9AGR3      ------------------------------------------------------------
A0A2V9G0N7      ------------------------------------------------------------
A0A2V9GQ44      ------------------------------------------------------------
A0A2V9HRN3      ------------------------------------------------------------
A0A2V8WG13      ------------------------------------------------------------
A0A2V8X987      ------------------------------------------------------------
A0A1Q7KX94      ------------------------------------------------------------
A0A2V8XHT0      ------------------------------------------------------------
A0A2V9L2P7      ------------------------------------------------------------
A0A2V7UMX0      ------------------------------------------------------------
A0A136K497      ------------------------------------------------------------
A0A399W9E4      ------------------------------------------------------------
A0A2V7X0V9      ------------------------------------------------------------
A0A2V9X518      ------------------------------------------------------------
A0A2V9VC62      ------------------------------------------------------------
A0A2V9S1P8      ------------------------------------------------------------
A0A2V9RTW2      ------------------------------------------------------------
A0A2V9TGF1      ------------------------------------------------------------
A0A2V9XEV6      ------------------------------------------------------------
A0A2V9Y3Q6      ------------------------------------------------------------
A0A2V9R269      ------------------------------------------------------------
A0A2V9PTS3      ------------------------------------------------------------
A0A2V9NPF4      ------------------------------------------------------------
A0A2V9PNZ0      ------------------------------------------------------------
A0A321LMC5      ------------------------------------------------------------
A0A2V8X713      ------------------------------------------------------------
A0A2V8ZLE9      ------------------------------------------------------------
A0A2V8Y4D3      ------------------------------------------------------------
A0A2V8Z2X8      ------------------------------------------------------------
A0A2V9C3F6      ------------------------------------------------------------
A0A2V9QMU9      ------------------------------------------------------------
A0A2V9QY75      ------------------------------------------------------------
A0A2V9SVU9      ------------------------------------------------------------
A0A2V8W5N5      ------------------------------------------------------------
A0A2V8XG53      ------------------------------------------------------------
A0A2V9XV04      ------------------------------------------------------------
A0A2V9CBY1      ------------------------------------------------------------
A0A2V9D656      ------------------------------------------------------------
A0A352EZH8      ------------------------------------------------------------
A0A0B6X033      ------------------------------------------------------------
A0A2V8R0I3      ------------------------------------------------------------
A0A2V8N1U8      ------------------------------------------------------------
A0A2V8QL35      ------------------------------------------------------------
A0A352FU10      ------------------------------------------------------------
A0A2V8LCU0      ------------------------------------------------------------
A0A1Q7NGT0      ------------------------------------------------------------
A0A2V8MLP9      ------------------------------------------------------------
A0A2V8PQZ0      ------------------------------------------------------------
A0A3B9MKY6      ------------------------------------------------------------
A0A3D5SKZ1      ------------------------------------------------------------
A0A2V8NRW2      ------------------------------------------------------------
A0A2V8TKR9      ------------------------------------------------------------
A0A2V8LBV1      ------------------------------------------------------------
A0A2V8GAF9      ------------------------------------------------------------
A0A2V8CN98      ------------------------------------------------------------
A0A1Q7LC46      ------------------------------------------------------------
A0A1Q8BDC5      ------------------------------------------------------------
A0A2V9Q1Y8      ------------------------------------------------------------
A0A2V8JXG1      ------------------------------------------------------------
A0A350D2W9      ------------------------------------------------------------
A0A2V9I4J1      ------------------------------------------------------------
A0A2V8PQZ9      ------------------------------------------------------------
A0A2V8D8B1      ------------------------------------------------------------
A0A3B9LSB4      ------------------------------------------------------------
A0A2V9H7U2      ------------------------------------------------------------
A0A2V8NJB5      ------------------------------------------------------------
A0A2V9JMZ4      ------------------------------------------------------------
A0A2V9MDJ6      ------------------------------------------------------------
A0A2V8QJT6      ------------------------------------------------------------
A0A2V8FSM8      IS-TQVKILESRALISRVREKMATRPQPERLQPPDRLGMWRTALRLNAPTADGLWKQALG
A0A359M0J2      NAQTQISILRSYSLLSAALERMERESTLTAAAPAGRFAALRRRLGFVPLEPLEATREATF
A0A2V8JLJ1      ------------------------------------------------------------
A0A5M8SND8      VQTQLRVIQSDQLIDRVIAKLESQGKLGPLELEATHRSFASRLLMRPKLTANERAYRIHK
A0A2V9GAQ1      ETLALQTIRNNGLSARPEFSSPNGPSEAVALGSLANQKRPPELGQF--------------
A0A497EDQ8      ------------------------------------------------------------
G8NS05          KSDTLLLTVAEDLDLANNQDFLGMTQRPPHVNIEDPNVRQATIGRM--------------
A0A2V8KZ20      RQQLQSRTFLEGIVEEFH------------LAGPDGVEKAAEVIRN--------------
A0A3D0NWU2      ------------------------------------------------------------
A0A2V8EPD9      ------------------------------------------------------------
A0A3N5NSX5      SATDLANAFLGAVHVEQV------------------------------------------
A0A2V8MUA1      ------------------------------------------------------------
A0A2V8MBH9      ------------------------------------------------------------
A0A3N5ZPQ7      ------------------------------------------------------------
A0A3N5P5F2      ------------------------------------------------------------
A0A2V9G1P7      LSERVLERFLDRLTIDPV------------------------------------------
A0A2V9BCK9      ---RLLDWLRHEQAVTAF------------------------------------------
A0A2V9TMX2      ---GLLGAFRGGLSVQPV------------------------------------------
A0A2V8N2J7      ---DHLWTVREVLYSEPVLKAAARESKRYRSNKGDLSPQQLDEFKQ--------------
A0A3N6BI26      ---DVLDTFRDRLEVAQV------------------------------------------
A0A2V9JMM3      ---EQLRVIRETLFARPLLQEVLKEFTLYGPATD--PDWATEDMKK--------------
A0A2V9M815      ---EQLRVIRETLFARPLLQEVLKEFKLYGPATD--PDWATEDMKK--------------
A0A2V9A795      ---RVLERFQDRLTIEPV---------------------------S--------------
A0A355ESH9      ---KLAQQLKGGLTVDPV---------------------------R--------------
A0A3D0NW85      ---PFVDVIKRNLSIEPV---------------------------R--------------
A0A353CAT5      ---PYVEIIRNNLTVEPV---------------------------R--------------
A0A2V9HB55      ---RPPGLGEFLGSLSVK---------------------------R--------------
A0A2V8CU57      ------------------------------------------------------------
A0A2V8BDI4      ---RPSWRSPRERQWRST---------------------------R--------------
A0A2V8F8T3      ---RPSWRSPRERQWRST---------------------------R--------------
A0A2V9J901      ------------------------------------------------------------
A0A2V8MKQ7      ------------------------------------------------------------
A0A3M1SNQ5      ------------------------------------------------------------
A0A2V8QJ59      ------------------------------------------------------------
A0A1Q7HTA7      ------------------------------------------------------------
A0A2W0B5E2      ------------------------------------------------------------
A0A2V8NMG8      ------------------------------------------------------------
A0A2V8TBM7      ------------------------------------------------------------
A0A1Q7HEZ8      ------------------------------------------------------------
A0A1Q7JW36      ------------------------------------------------------------
A0A1Q7MUR4      ------------------------------------------------------------
A0A3N5PFU4      ------------------------------------------------------------
A0A4R1LDF1      ------------------------------------------------------------
A0A1F2T1R8      ------------------------------------------------------------
A0A2V9BW09      ------------------------------------------------------------
A0A3M1SSE1      ------------------------------------------------------------
A0A2V9GQV7      ------------------------------------------------------------
A0A2V7YV88      ------------------------------------------------------------
A0A2V8YCY6      ------------------------------------------------------------
A0A2V8EGM3      ------------------------------------------------------------
A0A2V8FGH1      ------------------------------------------------------------
A0A2V8D468      ------------------------------------------------------------
A0A1F2R977      ------------------------------------------------------------
A0A2U3LF12      ------------------------------------------------------------
A0A3N5G7M6      ------------------------------------------------------------
A0A1F2S3Q7      ------------------------------------------------------------
A0A2V8GVG4      ------------------------------------------------------------
A0A143PNR5      ------------------------------------------------------------
A0A2V8PJQ0      ------------------------------------------------------------
A0A2V8H566      ------------------------------------------------------------
A0A3N5YKY1      ------------------------------------------------------------
A0A2V8UVN4      ------------------------------------------------------------
A0A321LXF5      ------------------------------------------------------------
A0A5M8SBZ0      ------------------------------------------------------------
A0A1Q7JFB1      ------------------------------------------------------------
A0A2V8DMJ9      ------------------------------------------------------------
A0A2V8GGF6      ------------------------------------------------------------
A0A2V8HKU7      ------------------------------------------------------------
A0A1Q6Y875      ------------------------------------------------------------
A0A523DJA9      ------------------------------------------------------------
A0A2V8I604      ------------------------------------------------------------
A0A2V8J066      ------------------------------------------------------------
A0A1I6MMC5      ------------------------------------------------------------
A0A2V9D5W7      ------------------------------------------------------------
A0A2V9D4I4      ------------------------------------------------------------
A0A2V9D6L7      ------------------------------------------------------------
A0A2V8ZJV2      ------------------------------------------------------------
A0A2V9AWB5      ------------------------------------------------------------
A0A2V8Z1Y8      ------------------------------------------------------------
A0A1Q8AX10      ------------------------------------------------------------
A0A2V9A773      ------------------------------------------------------------
A0A2V9AND3      ------------------------------------------------------------
A0A2V9BTJ7      ------------------------------------------------------------
A0A2V8W2M7      ------------------------------------------------------------
A0A2V8XNW2      ------------------------------------------------------------
A0A1Q7CJC1      ------------------------------------------------------------
A0A2V9UEM7      ------------------------------------------------------------
A0A1Q7V300      ------------------------------------------------------------
A0A2V9ZCI3      ------------------------------------------------------------
A0A2V9WCB3      ------------------------------------------------------------
A0A2V9VQW5      ------------------------------------------------------------
A0A2V9WTP3      ------------------------------------------------------------
A0A2V9NLA9      ------------------------------------------------------------
A0A2V9RKJ9      ------------------------------------------------------------
A0A2V9RN95      ------------------------------------------------------------
A0A2V9N406      ------------------------------------------------------------
A0A2V9U6D9      ------------------------------------------------------------
A0A2V8DZN4      ------------------------------------------------------------
A0A2G6HQA4      ------------------------------------------------------------
A0A2V7ZTY7      ------------------------------------------------------------
A0A2V7ZVL9      ------------------------------------------------------------
A0A1Q7QYI4      ------------------------------------------------------------
A0A2V8G9Y9      ------------------------------------------------------------
A0A143PXU3      ------------------------------------------------------------
A0A2V8D8G9      ------------------------------------------------------------
A0A2V8ESQ4      ------------------------------------------------------------
A0A1E3Y5Q0      ------------------------------------------------------------
A0A2W4TWK5      ------------------------------------------------------------
A0A3N5NYV3      ------------------------------------------------------------
A0A2V2RJF9      ------------------------------------------------------------
A0A2G6HNT3      ------------------------------------------------------------
A0A2V7YWD4      ------------------------------------------------------------
A0A2V2R8T6      ------------------------------------------------------------
A0A1Q7RGF1      ------------------------------------------------------------
A0A2V9BLX2      ------------------------------------------------------------
A0A2V9ZA03      ------------------------------------------------------------
A0A3N5ZNH4      ------------------------------------------------------------
A0A2V8GEZ2      ------------------------------------------------------------
A0A3N5ZFD3      ------------------------------------------------------------
G8NXD3          ------------------------------------------------------------
A0A2V9VR38      ------------------------------------------------------------
A0A2V9EY04      ------------------------------------------------------------
A0A2V9HAK9      ------------------------------------------------------------
A0A1Q7FS15      ------------------------------------------------------------
A0A1Q7K9P1      ------------------------------------------------------------
A0A1Q7N989      ------------------------------------------------------------
A0A2V9G7Y0      ------------------------------------------------------------
A0A2V8T7Z1      ------------------------------------------------------------
A0A2V7U8G5      ------------------------------------------------------------
A0A2V7UNP9      ------------------------------------------------------------
A0A2V7VLD7      ------------------------------------------------------------
A0A2V7XGA3      ------------------------------------------------------------
A0A2V7YAG6      ------------------------------------------------------------
A0A2V7VK33      ------------------------------------------------------------
A0A3M1VTE1      ------------------------------------------------------------
A0A2V7TTM7      ------------------------------------------------------------
A0A2V8VI82      ------------------------------------------------------------
A0A2V7U4P9      ------------------------------------------------------------
A0A2V7TQY5      ------------------------------------------------------------
A0A2V7TU87      ------------------------------------------------------------
A0A2V8SEH0      ------------------------------------------------------------
A0A2V8VU54      ------------------------------------------------------------
A0A1Q7RML7      ------------------------------------------------------------
A0A1Q7ZIQ5      ------------------------------------------------------------
A0A2V8TKD8      ------------------------------------------------------------
                                                                            

A0A1F2U8T6      ---THAVHKDVHILDLLAVIYRYRRMAFSVFILTTIALMIQGYSGVRLYQAKAQLLIEDE
A0A2V8BV42      AGAPYAPDGDIHLLDRFAILYRYRRIAVSVFILTTAVLMIQGYTNVKVFQARAQLLIEDE
A0A2V8F916      AGAPYAPDGDIHLLDRFAILYRYRRIAVSVFILTTAVLMIQGYTNVKVFQARAQLLIEDE
A0A1Q7K833      ---MYSPDTDVHILDRLAVLYRYRRIAIAVFVLTTAAMMIQGYTTEKIFRAQARLLIEDE
A0A1Q8AMY4      ---MYSPDTDVHILDRLAVLYRYRRIAIAVFVLTTAAMMIQGYTTEKIFRAQARLLIEDE
A0A2V8BM40      APLAYAADNDVHILDRLAVIYRYRYIATAVFVLATSAIMIQSYTSLELFRAQARLLIEDE
A0A2V8CRT6      ---------------------------------------------LELFRAQARLLIEDE
A0A1F2VH76      ----------THLLDRLSVLFKYRRAAMAVFVLVVAWNMVDSYTTIPQYQAQSRVLIDED
A0A1F2R0X5      PASSYAPQSEVHLLDRLVVLYRYRWLCLTVFVLVSGAMIIQGYTTVRMYRAQARLQIDDE
A0A2V8B278      PTSTYTPDTDVHILDRLAVLYRYRRVAIAVFILTTVAMMIQGYSSTQMYRAQARLLIEDE
A0A2V8CEF9      PTSTYTPDTDVHILDRLAVLYRYRRVAIAVFILTTVAMMIQGYSSIQMYRAQARLLIEDE
A0A2V8KZG2      ------------------------------------------------------------
A0A1Q7LG57      ------------------------------------------------------------
A0A2V8YMQ4      ------------------------------------------------------------
A0A1Q7L5B1      ------------------------------------------------------------
A0A2V9DKV4      ------------------------------------------------------------
A0A2V8W380      ------------------------------------------------------------
A0A2V8ZIV5      ------------------------------------------------------------
A0A2V9EVA0      ------------------------------------------------------------
A0A1Q7RB73      ------------------------------------------------------------
A0A2V9K0H7      ------------------------------------------------------------
A0A3N5YN96      ------------------------------------------------------------
A0A1Q7Y646      ------------------------------------------------------------
A0A2V8QZU0      ------------------------------------------------------------
A0A2V8RSQ9      ------------------------------------------------------------
A0A2V9LS17      ------------------------------------------------------------
A0A2V9AGR3      ------------------------------------------------------------
A0A2V9G0N7      ------------------------------------------------------------
A0A2V9GQ44      ------------------------------------------------------------
A0A2V9HRN3      ------------------------------------------------------------
A0A2V8WG13      ------------------------------------------------------------
A0A2V8X987      ------------------------------------------------------------
A0A1Q7KX94      ------------------------------------------------------------
A0A2V8XHT0      ------------------------------------------------------------
A0A2V9L2P7      ------------------------------------------------------------
A0A2V7UMX0      ------------------------------------------------------------
A0A136K497      ------------------------------------------------------------
A0A399W9E4      ------------------------------------------------------------
A0A2V7X0V9      ------------------------------------------------------------
A0A2V9X518      ------------------------------------------------------------
A0A2V9VC62      ------------------------------------------------------------
A0A2V9S1P8      ------------------------------------------------------------
A0A2V9RTW2      ------------------------------------------------------------
A0A2V9TGF1      ------------------------------------------------------------
A0A2V9XEV6      ------------------------------------------------------------
A0A2V9Y3Q6      ------------------------------------------------------------
A0A2V9R269      ------------------------------------------------------------
A0A2V9PTS3      ------------------------------------------------------------
A0A2V9NPF4      ------------------------------------------------------------
A0A2V9PNZ0      ------------------------------------------------------------
A0A321LMC5      ------------------------------------------------------------
A0A2V8X713      ------------------------------------------------------------
A0A2V8ZLE9      ------------------------------------------------------------
A0A2V8Y4D3      ------------------------------------------------------------
A0A2V8Z2X8      ------------------------------------------------------------
A0A2V9C3F6      ------------------------------------------------------------
A0A2V9QMU9      ------------------------------------------------------------
A0A2V9QY75      ------------------------------------------------------------
A0A2V9SVU9      ------------------------------------------------------------
A0A2V8W5N5      ------------------------------------------------------------
A0A2V8XG53      ------------------------------------------------------------
A0A2V9XV04      ------------------------------------------------------------
A0A2V9CBY1      ------------------------------------------------------------
A0A2V9D656      ------------------------------------------------------------
A0A352EZH8      ------------------------------------------------------------
A0A0B6X033      ------------------------------------------------------------
A0A2V8R0I3      ------------------------------------------------------------
A0A2V8N1U8      ------------------------------------------------------------
A0A2V8QL35      ------------------------------------------------------------
A0A352FU10      ------------------------------------------------------------
A0A2V8LCU0      ------------------------------------------------------------
A0A1Q7NGT0      ------------------------------------------------------------
A0A2V8MLP9      ------------------------------------------------------------
A0A2V8PQZ0      ------------------------------------------------------------
A0A3B9MKY6      ------------------------------------------------------------
A0A3D5SKZ1      ------------------------------------------------------------
A0A2V8NRW2      ------------------------------------------------------------
A0A2V8TKR9      ------------------------------------------------------------
A0A2V8LBV1      ------------------------------------------------------------
A0A2V8GAF9      ------------------------------------------------------------
A0A2V8CN98      ------------------------------------------MSEFLTRRVQEDQLRRD-
A0A1Q7LC46      ------------------------------------------------------------
A0A1Q8BDC5      ------------------------------------------------------------
A0A2V9Q1Y8      ------------------------------------------------------------
A0A2V8JXG1      ------------------------------------------------------------
A0A350D2W9      ------------------------------------------------------------
A0A2V9I4J1      ------------------------------------------------------------
A0A2V8PQZ9      ------------------------------------------MKSEKDLRASSTLPAAP-
A0A2V8D8B1      ------------------------------------------MPCPLKSARTSSCRSWP-
A0A3B9LSB4      ------------------------------------------------------------
A0A2V9H7U2      ------------------------------------------------------------
A0A2V8NJB5      --------MNLVLDEIRQLGENRENGFLTLSRNGHRVVMF--YREGMIQAVSSNLTSHR-
A0A2V9JMZ4      ------MTVQLLLDHIRPILEGSKDGTLLLGNQSEIIKVF--CRQGLIEAVSSNLEQYH-
A0A2V9MDJ6      ------MTVQLLLDHIRPILEGSKDGTLLLGNQSEIIKVF--CRQGLIEAVSSNLEQYH-
A0A2V8QJT6      -----------------------------------------MLEAENDRKMAEAEYNAAK
A0A2V8FSM8      SAADGVRVRSSGTNRIIDMSCDSTNGQIAADFCNTLAQEY--IDQSLEARWKTTEYTGQ-
A0A359M0J2      IAARSVMPRIVPGTRIIQITASSTIPEVAANLVNAVAAEY--VYQNQQFRSNSVQRTTQ-
A0A2V8JLJ1      ---------------------------------------MEGLVRQFKAAAEAAKAAAA-
A0A5M8SND8      YVASHLGVRQVGPTRAVDISFSFPDPAFAALLCNTMASEY--IAYNTEARWAMSERTGE-
A0A2V9GAQ1      --LGSLTVKRVPNSHLMDVSFESTDPQLAARIVNAHISSY--IEQNFRSKYEATTRAST-
A0A497EDQ8      --------------------MIGRNPDRVAEWLNVYVEQY--IAANIEDGIDKTRKIYK-
G8NS05          --QAIVSVANIPKTDIIRISCSTFNAKLSADIINKLIDAY--IKRSFTSRVSSTQRASG-
A0A2V8KZ20      --KIEITVLT---ANTFKLGFPAADPFSAQAVTKRLTERI--IQLNDSFRKEKVQVADQ-
A0A3D0NWU2      ----------------------------------------------SASQRGEGMNIPD-
A0A2V8EPD9      ------------------------------------------------------------
A0A3N5NSX5      --------RG---SRLFNVSITSSDPQFAARAADALAAEY--VQFNLEYRTDATRKSLD-
A0A2V8MUA1      ------------------MQATNEVAQSDNKIREFYQKHFPGLPEDQAAILQTLNDLGRE
A0A2V8MBH9      ------------------------------------------------------------
A0A3N5ZPQ7      -----------------------MDPAQASRLCSYPCAAFPTPKATEVNRFESSMDNRK-
A0A3N5P5F2      ------------------------------------------IERNLQFKFDASKDAAD-
A0A2V9G1P7      --------NR---SRLVAVRFDSHDPELAARVVNTLAADY--VDQSLEARWQATQKAAE-
A0A2V9BCK9      -------IFN---TRLSVTEFFDCLTADFGISCQSPSKSH--VLLGLNRWLLDRYRAGET
A0A2V9TMX2      --------PS---TRLIQVSYTHSDPRFATEITNALVKTF--IEENFRTKYNSASQTSE-
A0A2V8N2J7      --AIGIKVDS---EHSFQLTYEAGDRYDAMNVTNKLAELF--VQNASAKREQKTSEAAN-
A0A3N6BI26      --------PN---SRLVEIRWVSPDPTLAAAVSDTLAEEF--IEQNLQTKFEANTRATE-
A0A2V9JMM3      --RIRIQVEG---TDAFYIGFEDGDRQAVAEVANRLAELF--VKSTSASQEQNVEEAAG-
A0A2V9M815      --RIRIQVEG---TDAFYIGFEDGDRQAVAEVANRLAELF--VKSTSASQEQNVEEAAG-
A0A2V9A795      ---------R---SRLVTVQFDSNNADLSARVVNTLAEDY--IDQSLEARWAATQKAAD-
A0A355ESH9      ---------N---TQLVRLSFRSSSREFSAKAANAFAESF--IDMGVEDRYASAGKAST-
A0A3D0NW85      --ESRVTVKD---TRLIEVAFRNTDPQLAAFVVNGIGETF--AASNQEQRSGTSRKTSD-
A0A353CAT5      --EPRATFKD---TRLIEISFRHTNPELAAFVVNGLGETF--ASTNQEQRSGTSRKTSD-
A0A2V9HB55      --VP-----N---SRLMDVSFESTDPQLAARVVNAHIASY--IEQNFSSKYEATTRASA-
A0A2V8CU57      -----------------------------------------------MSRLEDALRRAE-
A0A2V8BDI4      --RP-----D---RAIVARSRGRCSAASTAR----DGSCF--SEDTSMSRLEDALRRAE-
A0A2V8F8T3      --RP-----D---RAIVARSRGRCSAASTAR----DGSCF--SEDTSMSRLEDALRRAE-
A0A2V9J901      ------------------------------------------------------------
A0A2V8MKQ7      ------------------------------------------------------------
A0A3M1SNQ5      ------------------------------------------------------------
A0A2V8QJ59      ------------------------------------------------------------
A0A1Q7HTA7      ------------------------------------------------------------
A0A2W0B5E2      ------------------------------------------------------------
A0A2V8NMG8      ------------------------------------------------------------
A0A2V8TBM7      ------------------------------------------------------------
A0A1Q7HEZ8      ------------------------------------------------------------
A0A1Q7JW36      ------------------------------------------------------------
A0A1Q7MUR4      ------------------------------------------------------------
A0A3N5PFU4      ------------------------------------------------------------
A0A4R1LDF1      ------------------------------------------------------------
A0A1F2T1R8      ------------------------------------------------------------
A0A2V9BW09      ------------------------------------------------------------
A0A3M1SSE1      ------------------------------------------------------------
A0A2V9GQV7      ------------------------------------------------------------
A0A2V7YV88      ------------------------------------------------------------
A0A2V8YCY6      ------------------------------------------------------------
A0A2V8EGM3      ------------------------------------------------------------
A0A2V8FGH1      ------------------------------------------------------------
A0A2V8D468      ------------------------------------------------------------
A0A1F2R977      ------------------------------------------------------------
A0A2U3LF12      ------------------------------------------------------------
A0A3N5G7M6      ------------------------------------------------------------
A0A1F2S3Q7      ------------------------------------------------------------
A0A2V8GVG4      ------------------------------------------------------------
A0A143PNR5      ------------------------------------------------------------
A0A2V8PJQ0      ------------------------------------------------------------
A0A2V8H566      ------------------------------------------------------------
A0A3N5YKY1      ------------------------------------------------------------
A0A2V8UVN4      ------------------------------------------------------------
A0A321LXF5      ------------------------------------------------------------
A0A5M8SBZ0      ------------------------------------------------------------
A0A1Q7JFB1      ------------------------------------------------------------
A0A2V8DMJ9      ------------------------------------------------------------
A0A2V8GGF6      ------------------------------------------------------------
A0A2V8HKU7      ------------------------------------------------------------
A0A1Q6Y875      ------------------------------------------------------------
A0A523DJA9      ------------------------------------------------------------
A0A2V8I604      ------------------------------------------------------------
A0A2V8J066      ------------------------------------------------------------
A0A1I6MMC5      ------------------------------------------------------------
A0A2V9D5W7      ------------------------------------------------------------
A0A2V9D4I4      ------------------------------------------------------------
A0A2V9D6L7      ------------------------------------------------------------
A0A2V8ZJV2      ------------------------------------------------------------
A0A2V9AWB5      ------------------------------------------------------------
A0A2V8Z1Y8      ------------------------------------------------------------
A0A1Q8AX10      ------------------------------------------------------------
A0A2V9A773      ------------------------------------------------------------
A0A2V9AND3      ------------------------------------------------------------
A0A2V9BTJ7      ------------------------------------------------------------
A0A2V8W2M7      ------------------------------------------------------------
A0A2V8XNW2      ------------------------------------------------------------
A0A1Q7CJC1      ------------------------------------------------------------
A0A2V9UEM7      ------------------------------------------------------------
A0A1Q7V300      ------------------------------------------------------------
A0A2V9ZCI3      ------------------------------------------------------------
A0A2V9WCB3      ------------------------------------------------------------
A0A2V9VQW5      ------------------------------------------------------------
A0A2V9WTP3      ------------------------------------------------------------
A0A2V9NLA9      ------------------------------------------------------------
A0A2V9RKJ9      ------------------------------------------------------------
A0A2V9RN95      ------------------------------------------------------------
A0A2V9N406      ------------------------------------------------------------
A0A2V9U6D9      ------------------------------------------------------------
A0A2V8DZN4      ------------------------------------------------------------
A0A2G6HQA4      ------------------------------------------------------------
A0A2V7ZTY7      ------------------------------------------------------------
A0A2V7ZVL9      ------------------------------------------------------------
A0A1Q7QYI4      ------------------------------------------------------------
A0A2V8G9Y9      ------------------------------------------------------------
A0A143PXU3      ------------------------------------------------------------
A0A2V8D8G9      ------------------------------------------------------------
A0A2V8ESQ4      ------------------------------------------------------------
A0A1E3Y5Q0      ------------------------------------------------------------
A0A2W4TWK5      ------------------------------------------------------------
A0A3N5NYV3      ------------------------------------------------------------
A0A2V2RJF9      ------------------------------------------------------------
A0A2G6HNT3      ------------------------------------------------------------
A0A2V7YWD4      ------------------------------------------------------------
A0A2V2R8T6      ------------------------------------------------------------
A0A1Q7RGF1      ------------------------------------------------------------
A0A2V9BLX2      ------------------------------------------------------------
A0A2V9ZA03      ------------------------------------------------------------
A0A3N5ZNH4      ------------------------------------------------------------
A0A2V8GEZ2      ------------------------------------------------------------
A0A3N5ZFD3      ------------------------------------------------------------
G8NXD3          ------------------------------------------------------------
A0A2V9VR38      ------------------------------------------------------------
A0A2V9EY04      ------------------------------------------------------------
A0A2V9HAK9      ------------------------------------------------------------
A0A1Q7FS15      ------------------------------------------------------------
A0A1Q7K9P1      ------------------------------------------------------------
A0A1Q7N989      ------------------------------------------------------------
A0A2V9G7Y0      ------------------------------------------------------------
A0A2V8T7Z1      ------------------------------------------------------------
A0A2V7U8G5      ------------------------------------------------------------
A0A2V7UNP9      ------------------------------------------------------------
A0A2V7VLD7      ------------------------------------------------------------
A0A2V7XGA3      ------------------------------------------------------------
A0A2V7YAG6      ------------------------------------------------------------
A0A2V7VK33      ------------------------------------------------------------
A0A3M1VTE1      ------------------------------------------------------------
A0A2V7TTM7      ------------------------------------------------------------
A0A2V8VI82      ------------------------------------------------------------
A0A2V7U4P9      ------------------------------------------------------------
A0A2V7TQY5      ------------------------------------------------------------
A0A2V7TU87      ------------------------------------------------------------
A0A2V8SEH0      ------------------------------------------------------------
A0A2V8VU54      ------------------------------------------------------------
A0A1Q7RML7      ------------------------------------------------------------
A0A1Q7ZIQ5      ------------------------------------------------------------
A0A2V8TKD8      ------------------------------------------------------------
                                                                            

A0A1F2U8T6      RSTAMPGI--ATGQYYEDPVPYYNTQHRILRSRELARRVVRRLQLGTHPEFNGTATPPVT
A0A2V8BV42      RSTAVPGLNSSENTYYEDPEPYYNTQFRILKGRDLVRRVVRRLKLGTIPEFNGTAVPPPT
A0A2V8F916      RSTAVPGLNSSENTYYEDPEPYYNTQFRILKGRDLVRRVVRRLKLGTIPEFNGTAVPPPT
A0A1Q7K833      RSTAVPGM-SPEN-FYQDPDLYYKTQYRILKGRDLTRRVVRRLNLGSVPEFNGTAEPPST
A0A1Q8AMY4      RSTAVPGM-SPEN-FYQDPDLYYKTQYRILKGRDLTRRVVRRLNLGSVPEFNGTAEPPST
A0A2V8BM40      RSTAVPGV-SADNSYYEDPDLYYKTQYRILKGRDLTRRVVRKLNMAAIPEFNGTAEPPVT
A0A2V8CRT6      RSTAVPGV-SADNSYYEDPDLYYKTQYRILKGRDLTRRVVRKLNVAAIPEFNGTAEPPVT
A0A1F2VH76      TAGLGTPADISQNFTLQDPEVYLQTQLRIIRGRELARRTAKKLELHTVPEFNGQGAKPTA
A0A1F2R0X5      RSTAIPGLQSDQNTFYEDPEPYYQTQYRILRGRDLTRRVVQRLRLDTVPEFNGTAERAPT
A0A2V8B278      RATAVPGITTAENTYYEDPDLYYKTQYRILKGRDLARRVVKRVNLGAVPEFNGTAEKPST
A0A2V8CEF9      RATAVPGITTAENTYYEDPDLYYKTQYRILKGRDLARRVVKRVNLGAVPEFNGTAQKPST
A0A2V8KZG2      ------------------------------------------------------------
A0A1Q7LG57      ------------------------------------------------------------
A0A2V8YMQ4      ------------------------------------------------------------
A0A1Q7L5B1      ------------------------------------------------------------
A0A2V9DKV4      ------------------------------------------------------------
A0A2V8W380      ------------------------------------------------------------
A0A2V8ZIV5      ------------------------------------------------------------
A0A2V9EVA0      ------------------------------------------------------------
A0A1Q7RB73      ------------------------------------------------------------
A0A2V9K0H7      ------------------------------------------------------------
A0A3N5YN96      ------------------------------------------------------------
A0A1Q7Y646      ------------------------------------------------------------
A0A2V8QZU0      ------------------------------------------------------------
A0A2V8RSQ9      ------------------------------------------------------------
A0A2V9LS17      ------------------------------------------------------------
A0A2V9AGR3      ------------------------------------------------------------
A0A2V9G0N7      ------------------------------------------------------------
A0A2V9GQ44      ------------------------------------------------------------
A0A2V9HRN3      ------------------------------------------------------------
A0A2V8WG13      ------------------------------------------------------------
A0A2V8X987      ------------------------------------------------------------
A0A1Q7KX94      ------------------------------------------------------------
A0A2V8XHT0      ------------------------------------------------------------
A0A2V9L2P7      ------------------------------------------------------------
A0A2V7UMX0      ------------------------------------------------------------
A0A136K497      ------------------------------------------------------------
A0A399W9E4      ------------------------------------------------------------
A0A2V7X0V9      ------------------------------------------------------------
A0A2V9X518      ------------------------------------------------------------
A0A2V9VC62      ------------------------------------------------------------
A0A2V9S1P8      ------------------------------------------------------------
A0A2V9RTW2      ------------------------------------------------------------
A0A2V9TGF1      ------------------------------------------------------------
A0A2V9XEV6      ------------------------------------------------------------
A0A2V9Y3Q6      ------------------------------------------------------------
A0A2V9R269      ------------------------------------------------------------
A0A2V9PTS3      ------------------------------------------------------------
A0A2V9NPF4      ------------------------------------------------------------
A0A2V9PNZ0      ------------------------------------------------------------
A0A321LMC5      ------------------------------------------------------------
A0A2V8X713      ------------------------------------------------------------
A0A2V8ZLE9      ------------------------------------------------------------
A0A2V8Y4D3      ------------------------------------------------------------
A0A2V8Z2X8      ------------------------------------------------------------
A0A2V9C3F6      ------------------------------------------------------------
A0A2V9QMU9      ------------------------------------------------------------
A0A2V9QY75      ------------------------------------------------------------
A0A2V9SVU9      ------------------------------------------------------------
A0A2V8W5N5      ------------------------------------------------------------
A0A2V8XG53      ------------------------------------------------------------
A0A2V9XV04      ------------------------------------------------------------
A0A2V9CBY1      ------------------------------------------------------------
A0A2V9D656      ------------------------------------------------------------
A0A352EZH8      ------------------------------------------------------------
A0A0B6X033      ------------------------------------------------------------
A0A2V8R0I3      ------------------------------------------------------------
A0A2V8N1U8      ------------------------------------------------------------
A0A2V8QL35      ------------------------------------------------------------
A0A352FU10      ------------------------------------------------------------
A0A2V8LCU0      ------------------------------------------------------------
A0A1Q7NGT0      ------------------------------------------------------------
A0A2V8MLP9      ------------------------------------------------------------
A0A2V8PQZ0      ------------------------------------------------------------
A0A3B9MKY6      ------------------------------------------------------------
A0A3D5SKZ1      ------------------------------------------------------------
A0A2V8NRW2      ------------------------------------------------------------
A0A2V8TKR9      ------------------------------------------------------------
A0A2V8LBV1      ------------------------------------------------------------
A0A2V8GAF9      ------------------------------------------------------------
A0A2V8CN98      --------QDALAQLLAQGPDSLGFSERLAAIGAVQGS----------------------
A0A1Q7LC46      ------------------------------------------------------------
A0A1Q8BDC5      --MLANPVLSEIRELHQKKQSGILVLTGGAGERVEVFFREGMIDAASSNMDARRLGDYLA
A0A2V9Q1Y8      ------------------------------------------------------------
A0A2V8JXG1      ------------------------------------------------------------
A0A350D2W9      ------------------------------------------------------------
A0A2V9I4J1      -------------MEASAVQPLLAESRRQ----------------GVPIGEAALRSKLLE
A0A2V8PQZ9      --NFGQRGTAIPATAMAA------------------------------------------
A0A2V8D8B1      --ISTGPGQSDRTALDTVPAILAN------------------------------------
A0A3B9LSB4      ------------------------------------------------------------
A0A2V9H7U2      ------------------------------------------------------------
A0A2V8NJB5      ---LGDYLVKAGYLTARDIQSVLKSAQRK----------------HALFGEAAVRERHLE
A0A2V9JMZ4      ---LGQHLVTEGFMEASAVQPLLAESRRQ----------------GVPIGEAALRSKLLE
A0A2V9MDJ6      ---LGQHLVTEGFMEASAVQPLLAESRRQ----------------GVPIGEAALRSKLLE
A0A2V8QJT6      APGAAGALAEAGA-----------------------------------------------
A0A2V8FSM8      --WLTKQLDDLKIKLEKQEEGLQAYANATGLIMTSEKN-------NVQEAQLGDLEKELS
A0A359M0J2      --WIAGQLEETKFKLEQAEQKLQDFVRKSGNVFVNSED-------TLANSKLRQLQAELT
A0A2V8JLJ1      ------------------------------------------------------------
A0A5M8SND8      --GLSRRLEEVRAHLKESQKNLQDYAQRS-GLLFGPPVPGTSEETDVSENRLTELQSELS
A0A2V9GAQ1      --WLTDQLTELKIRVQKAEDARIAYERRN-QIWTLDDK----Q--NITSQRLGDINRQLT
A0A497EDQ8      --VIQSRLDPLRLQVEAGQRKLMSFQEGHDSLGFADEQ----K--SVITEQVDLLTKEYA
G8NS05          --WLTSQLDELKHQVETSQNQVIDLQKRI-GVLSIDPT----H--NQISSSLEELTTAAG
A0A2V8KZ20      --FLEEQLEQAGNELSEAERKLLQLRNGAFPGVTTDVVTPDVV--RDLQAQLAKLDAQVE
A0A3D0NWU2      --LYENKIFQDTMRLNNERKAKLQ------------------------------------
A0A2V8EPD9      ---------------------------------------------------MTRLADALL
A0A3N5NSX5      --FLAGEIAKQQTKVEDSERAMAEYRESN-NALSLEDR----Q--NTVVSSLNQVNDEYT
A0A2V8MUA1      RVTVENSIESITTETKLLEQRRQEQQKFK-IAMSSRAPAGPSR--AEGQARQPSRAEQLI
A0A2V8MBH9      ------------------EEKLVSYAKNN-QILSLDAS----Q--NTVVERLAGLNKQLL
A0A3N5ZPQ7      --AILEYMKQIEVQEKTGSLYLVH------------------G--AADHTELTEMKEVIR
A0A3N5P5F2      --WLTNQLDAQRKNVEETELALQRYREQN-NATSTN------D--PEVIQRLSGLNAAVM
A0A2V9G1P7      --WLSQQLVGVKAKLEKSEDALQGYARHN-GLVFLETDKGASQ--NVANERLQQLQEQLT
A0A2V9BCK9      AVLIVDEAQNLSQQLLEEIRLLSNLETST-EKL---------L--QIVLSGQPELEEKLK
A0A2V9TMX2      --WLGKELADLQLKVQTSEEKLVRYQKDH-GILGVDEK----Q--NIVTEKLGELNKELT
A0A2V8N2J7      --VINEQVDDLKNRLQRQNDQIQNY-KTK-AVHALPDH----I--DNTIKAIDSLKEQIQ
A0A3N6BI26      --FLKKQLQDMKGKVEKSEQELVKYAREN-NIVNIGPDR---G--SMVLQTLEDLNRQMT
A0A2V9JMM3      --LLDQELARLRDKLADEDEEIKEYK----------------Q--KVGEELPEHLGTNLK
A0A2V9M815      --LLDQELARLRDKLADEDEEIKEYK----------------Q--KVGEELPEHLGTNLK
A0A2V9A795      --WLSQQLVGVKSKLEKSEEQLQDYARHN-GLVFLETDKGASQ--NVANERLQQLQEELT
A0A355ESH9      --FLGSQIETLKQEVAEKEAQLQAFSRSS-DIVTLDPQ----S--NVTLRRLETLNTALM
A0A3D0NW85      --FLQQRIADLQSDIRRDELKLVELERTE-GILKTPGD----Q--TIVLERLAGLNKDLL
A0A353CAT5      --FLQKRISDLQADIRNDEVRLVELERSE-GILKTPGD----Q--TIVLERLGGLNKDLL
A0A2V9HB55      --WLADQLTELKIKVQRAEDARIAYERQN-QIWTLDDK----Q--NITSQRLSDINKQLT
A0A2V8CU57      ---LANRQAKMKTEAEAA-------VKTP-AVAAWSEP----E--AVTAPFAAAGSEPES
A0A2V8BDI4      ---LANRQAKMKTEAEAA-------VKTP-AVAA--------------------------
A0A2V8F8T3      ---LANRQAKMKTEAEAA-------VKTP-AVAAWSEP----E--AVTAPFAAAWSEPES
A0A2V9J901      ------------------------------------------------------------
A0A2V8MKQ7      ------------------------------------------------------------
A0A3M1SNQ5      ------------------------------------------------------------
A0A2V8QJ59      ------------------------------------------------------------
A0A1Q7HTA7      ------------------------------------------------------------
A0A2W0B5E2      ------------------------------------------------------------
A0A2V8NMG8      ------------------------------------------------------------
A0A2V8TBM7      ------------------------------------------------------------
A0A1Q7HEZ8      ------------------------------------------------------------
A0A1Q7JW36      ------------------------------------------------------------
A0A1Q7MUR4      ------------------------------------------------------------
A0A3N5PFU4      ------------------------------------------------------------
A0A4R1LDF1      ------------------------------------------------------------
A0A1F2T1R8      ------------------------------------------------------------
A0A2V9BW09      ------------------------------------------------------------
A0A3M1SSE1      ------------------------------------------------------------
A0A2V9GQV7      ------------------------------------------------------------
A0A2V7YV88      ------------------------------------------------------------
A0A2V8YCY6      ------------------------------------------------------------
A0A2V8EGM3      ------------------------------------------------------------
A0A2V8FGH1      ------------------------------------------------------------
A0A2V8D468      ------------------------------------------------------------
A0A1F2R977      ------------------------------------------------------------
A0A2U3LF12      ------------------------------------------------------------
A0A3N5G7M6      ------------------------------------------------------------
A0A1F2S3Q7      ------------------------------------------------------------
A0A2V8GVG4      ------------------------------------------------------------
A0A143PNR5      ------------------------------------------------------------
A0A2V8PJQ0      ------------------------------------------------------------
A0A2V8H566      ------------------------------------------------------------
A0A3N5YKY1      ------------------------------------------------------------
A0A2V8UVN4      ------------------------------------------------------------
A0A321LXF5      ------------------------------------------------------------
A0A5M8SBZ0      ------------------------------------------------------------
A0A1Q7JFB1      ------------------------------------------------------------
A0A2V8DMJ9      ------------------------------------------------------------
A0A2V8GGF6      ------------------------------------------------------------
A0A2V8HKU7      ------------------------------------------------------------
A0A1Q6Y875      ------------------------------------------------------------
A0A523DJA9      ------------------------------------------------------------
A0A2V8I604      ------------------------------------------------------------
A0A2V8J066      ------------------------------------------------------------
A0A1I6MMC5      ------------------------------------------------------------
A0A2V9D5W7      ------------------------------------------------------------
A0A2V9D4I4      ------------------------------------------------------------
A0A2V9D6L7      ------------------------------------------------------------
A0A2V8ZJV2      ------------------------------------------------------------
A0A2V9AWB5      ------------------------------------------------------------
A0A2V8Z1Y8      ------------------------------------------------------------
A0A1Q8AX10      ------------------------------------------------------------
A0A2V9A773      ------------------------------------------------------------
A0A2V9AND3      ------------------------------------------------------------
A0A2V9BTJ7      ------------------------------------------------------------
A0A2V8W2M7      ------------------------------------------------------------
A0A2V8XNW2      ------------------------------------------------------------
A0A1Q7CJC1      ------------------------------------------------------------
A0A2V9UEM7      ------------------------------------------------------------
A0A1Q7V300      ------------------------------------------------------------
A0A2V9ZCI3      ------------------------------------------------------------
A0A2V9WCB3      ------------------------------------------------------------
A0A2V9VQW5      ------------------------------------------------------------
A0A2V9WTP3      ------------------------------------------------------------
A0A2V9NLA9      ------------------------------------------------------------
A0A2V9RKJ9      ------------------------------------------------------------
A0A2V9RN95      ------------------------------------------------------------
A0A2V9N406      ------------------------------------------------------------
A0A2V9U6D9      ------------------------------------------------------------
A0A2V8DZN4      ------------------------------------------------------------
A0A2G6HQA4      ------------------------------------------------------------
A0A2V7ZTY7      ------------------------------------------------------------
A0A2V7ZVL9      ------------------------------------------------------------
A0A1Q7QYI4      ------------------------------------------------------------
A0A2V8G9Y9      ------------------------------------------------------------
A0A143PXU3      ------------------------------------------------------------
A0A2V8D8G9      ------------------------------------------------------------
A0A2V8ESQ4      ------------------------------------------------------------
A0A1E3Y5Q0      ------------------------------------------------------------
A0A2W4TWK5      ------------------------------------------------------------
A0A3N5NYV3      ------------------------------------------------------------
A0A2V2RJF9      ------------------------------------------------------------
A0A2G6HNT3      ------------------------------------------------------------
A0A2V7YWD4      ------------------------------------------------------------
A0A2V2R8T6      ------------------------------------------------------------
A0A1Q7RGF1      ------------------------------------------------------------
A0A2V9BLX2      ------------------------------------------------------------
A0A2V9ZA03      ------------------------------------------------------------
A0A3N5ZNH4      ------------------------------------------------------------
A0A2V8GEZ2      ------------------------------------------------------------
A0A3N5ZFD3      ------------------------------------------------------------
G8NXD3          ------------------------------------------------------------
A0A2V9VR38      ------------------------------------------------------------
A0A2V9EY04      ------------------------------------------------------------
A0A2V9HAK9      ------------------------------------------------------------
A0A1Q7FS15      ------------------------------------------------------------
A0A1Q7K9P1      ------------------------------------------------------------
A0A1Q7N989      ------------------------------------------------------------
A0A2V9G7Y0      ------------------------------------------------------------
A0A2V8T7Z1      ------------------------------------------------------------
A0A2V7U8G5      ------------------------------------------------------------
A0A2V7UNP9      ------------------------------------------------------------
A0A2V7VLD7      ------------------------------------------------------------
A0A2V7XGA3      ------------------------------------------------------------
A0A2V7YAG6      ------------------------------------------------------------
A0A2V7VK33      ------------------------------------------------------------
A0A3M1VTE1      ------------------------------------------------------------
A0A2V7TTM7      ------------------------------------------------------------
A0A2V8VI82      ------------------------------------------------------------
A0A2V7U4P9      ------------------------------------------------------------
A0A2V7TQY5      ------------------------------------------------------------
A0A2V7TU87      ------------------------------------------------------------
A0A2V8SEH0      ------------------------------------------------------------
A0A2V8VU54      ------------------------------------------------------------
A0A1Q7RML7      ------------------------------------------------------------
A0A1Q7ZIQ5      ------------------------------------------------------------
A0A2V8TKD8      ------------------------------------------------------------
                                                                            

A0A1F2U8T6      LVTAVRAAAA------RALRGLTLLSAAVEEEAPTPDETPAEAALVGNFLSRVVVTPVPD
A0A2V8BV42      PVSMINDFQT------RLMGLLRKPAAPAPQEAPKVDETPDESALVSSFIGRVTVEPIRT
A0A2V8F916      PVSMINDFQT------RLMGLLRKPAAPAPQEAPKVDETPDESALVSSFIGRVTVEPIRT
A0A1Q7K833      PSTMLRDFQQ------RVVHLIKPSALAETQEVPKVDETPDESSMVNAFIGRVNVEPVTG
A0A1Q8AMY4      PSTMLRDFQQ------RVVHLIKPSALAETQEVPKVDETPDESSMVNAFIGRVNVEPVTG
A0A2V8BM40      PLTIAHDLEK------RIVAFVRPAA-SEATDTRKIDEAPSESGLVNAFIGQVTVEPVPG
A0A2V8CRT6      PLTIAHDLEK------RIVAFVRPAA-SEATDTRKIDEAPSESGLVDAFIGQVTVEPVPG
A0A1F2VH76      LAEAISTVKTYAYWPVRIVLGSTPAPSPVATA-----ESGDPEAYADALIGHLGVNQIRG
A0A1F2R0X5      PISMLRDFER------RLVSLVRRAPAQPQEEPPKLDETTDESALVGAFIGRVGVEPVRG
A0A2V8B278      PATLLHDLKQ------KIVGLVRPAPAPENTESPKVDETADESALVSAFLSRVDVAPVSG
A0A2V8CEF9      PATLLHDLKQ------KIVGLVRPAPAPENTESPKVDETADESALVSAFLSRVDVAPVSG
A0A2V8KZG2      ------------------------------------------------------------
A0A1Q7LG57      ------------------------------------------------------------
A0A2V8YMQ4      ------------------------------------------------------------
A0A1Q7L5B1      ------------------------------------------------------------
A0A2V9DKV4      ------------------------------------------------------------
A0A2V8W380      ------------------------------------------------------------
A0A2V8ZIV5      ------------------------------------------------------------
A0A2V9EVA0      ------------------------------------------------------------
A0A1Q7RB73      ------------------------------------------------------------
A0A2V9K0H7      ------------------------------------------------------------
A0A3N5YN96      ------------------------------------------------------------
A0A1Q7Y646      ------------------------------------------------------------
A0A2V8QZU0      ------------------------------------------------------------
A0A2V8RSQ9      ------------------------------------------------------------
A0A2V9LS17      ------------------------------------------------------------
A0A2V9AGR3      ------------------------------------------------------------
A0A2V9G0N7      ------------------------------------------------------------
A0A2V9GQ44      ------------------------------------------------------------
A0A2V9HRN3      ------------------------------------------------------------
A0A2V8WG13      ------------------------------------------------------------
A0A2V8X987      ------------------------------------------------------------
A0A1Q7KX94      ------------------------------------------------------------
A0A2V8XHT0      ------------------------------------------------------------
A0A2V9L2P7      ------------------------------------------------------------
A0A2V7UMX0      ------------------------------------------------------------
A0A136K497      ------------------------------------------------------------
A0A399W9E4      ------------------------------------------------------------
A0A2V7X0V9      ------------------------------------------------------------
A0A2V9X518      ------------------------------------------------------------
A0A2V9VC62      ------------------------------------------------------------
A0A2V9S1P8      ------------------------------------------------------------
A0A2V9RTW2      ------------------------------------------------------------
A0A2V9TGF1      ------------------------------------------------------------
A0A2V9XEV6      ------------------------------------------------------------
A0A2V9Y3Q6      ------------------------------------------------------------
A0A2V9R269      ------------------------------------------------------------
A0A2V9PTS3      ------------------------------------------------------------
A0A2V9NPF4      ------------------------------------------------------------
A0A2V9PNZ0      ------------------------------------------------------------
A0A321LMC5      ------------------------------------------------------------
A0A2V8X713      ------------------------------------------------------------
A0A2V8ZLE9      ------------------------------------------------------------
A0A2V8Y4D3      ------------------------------------------------------------
A0A2V8Z2X8      ------------------------------------------------------------
A0A2V9C3F6      ------------------------------------------------------------
A0A2V9QMU9      ------------------------------------------------------------
A0A2V9QY75      ------------------------------------------------------------
A0A2V9SVU9      ------------------------------------------MNSQMKEVDAQIQVEMKK
A0A2V8W5N5      ------------------------------------------------------------
A0A2V8XG53      ------------------------------------------------------------
A0A2V9XV04      ------------------------------------------------------------
A0A2V9CBY1      ------------------------------------------------------------
A0A2V9D656      ------------------------------------------------------------
A0A352EZH8      ------------------------------------------------------------
A0A0B6X033      ------------------------------------------------------------
A0A2V8R0I3      ------------------------------------------------------------
A0A2V8N1U8      ------------------------------------------------------------
A0A2V8QL35      ------------------------------------------------------------
A0A352FU10      ------------------------------------------------------------
A0A2V8LCU0      ------------------------------------------------------------
A0A1Q7NGT0      ------------------------------------------------------------
A0A2V8MLP9      ------------------------------------------------------------
A0A2V8PQZ0      ------------------------------------------------------------
A0A3B9MKY6      ------------------------------------------------------------
A0A3D5SKZ1      ------------------------------------------------------------
A0A2V8NRW2      ------------------------------------------------------------
A0A2V8TKR9      ------------------------------------------------------------
A0A2V8LBV1      ------------------------------------------------------------
A0A2V8GAF9      ------------------------------------------------------------
A0A2V8CN98      ------------------------------------------------------------
A0A1Q7LC46      -------------------------------------------------------MKKES
A0A1Q8BDC5      KQEYLHA-----------------------------------------------------
A0A2V9Q1Y8      ------------------------------------------------------------
A0A2V8JXG1      ------------------------------------------------------------
A0A350D2W9      ------------------------------------------------------------
A0A2V9I4J1      PAELADVIRR--------------------------------------------------
A0A2V8PQZ9      ------------------------------------------------------------
A0A2V8D8B1      ------------------------------------------------------------
A0A3B9LSB4      ------------------------------------------------------------
A0A2V9H7U2      ------------------------------------------------------------
A0A2V8NJB5      PVELAEV-----------------------------------------------------
A0A2V9JMZ4      PAELADVIRR--------------------------------------------------
A0A2V9MDJ6      PAELADVIRR--------------------------------------------------
A0A2V8QJT6      ------------------------------------------------------------
A0A2V8FSM8      VARADRI-------------------------------------------------AKQS
A0A359M0J2      AAQTDRI-------------------------------------------------NKEN
A0A2V8JLJ1      ------------------------------------------------------------
A0A5M8SND8      GAEAARM-------------------------------------------------AAES
A0A2V9GAQ1      DAQSERM-------------------------------------------------KKES
A0A497EDQ8      QAKAERI-------------------------------------------------DVET
G8NS05          TAQIARILAESRYRVLSG------------------------------------------
A0A2V8KZ20      SANDQRKVLQRRLEEHRQ--------------------------------------LKIA
A0A3D0NWU2      ------------------------------------------------------------
A0A2V8EPD9      RANRQNQ-----------------------------------------------------
A0A3N5NSX5      RIRTVRI-------------------------------------------------QKEA
A0A2V8MUA1      AAKRDQLAAERLKHTDDW------------------------------------------
A0A2V8MBH9      EAENDRKMAEAEYNAAKAPGAATALAEGA-------------------------------
A0A3N5ZPQ7      V-----------------------------------------------------------
A0A3N5P5F2      EARTARL-------------------------------------------------EKEA
A0A2V9G1P7      KAQSERY-------------------------------------------------EKEA
A0A2V9BCK9      HAQLRQF--------------------------------------------------RQR
A0A2V9TMX2      EAETDRI-------------------------------------------------QKEA
A0A2V8N2J7      DRETKIAEEQAKRASIER--------------------------------------ELQD
A0A3N6BI26      TVEGELI-------------------------------------------------GKTA
A0A2V9JMM3      LVEALEMRLQAKRDSIGENQARR-------------------------AQVLEEMKGLQK
A0A2V9M815      LVEALEMRLQAKRDSIGENQARR-------------------------AQVLEEMKGLQK
A0A2V9A795      KAEAERY-------------------------------------------------EKEA
A0A355ESH9      DAKKERI-------------------------------------------------EKEA
A0A3D0NW85      TAENERKTAEAQFLSVRNN-----------------------------PERVSALAEAES
A0A353CAT5      TAENDRKTAEAEYNSVKGS-----------------------------PERLKSLAEAES
A0A2V9HB55      DAQSERM-------------------------------------------------KKES
A0A2V8CU57      AAAPPVVAAWSEPETVTAPLAA--------------------------------------
A0A2V8BDI4      ------------------------------------------------------------
A0A2V8F8T3      AAPLPAVAAWSEPETVTAPLAAAAWSEPESAAVLPAVAAWSEPETVTAPLAAAAWSEPES
A0A2V9J901      ------------------------------------------------------------
A0A2V8MKQ7      ------------------------------------------------------------
A0A3M1SNQ5      ------------------------------------------------------------
A0A2V8QJ59      ------------------------------------------------------------
A0A1Q7HTA7      ------------------------------------------------------------
A0A2W0B5E2      ------------------------------------------------------------
A0A2V8NMG8      ------------------------------------------------------------
A0A2V8TBM7      ------------------------------------------------------------
A0A1Q7HEZ8      ------------------------------------------------------------
A0A1Q7JW36      ------------------------------------------------------------
A0A1Q7MUR4      ------------------------------------------------------------
A0A3N5PFU4      ------------------------------------------------------------
A0A4R1LDF1      ------------------------------------------------------------
A0A1F2T1R8      ------------------------------------------------------------
A0A2V9BW09      ------------------------------------------------------------
A0A3M1SSE1      ------------------------------------------------------------
A0A2V9GQV7      ------------------------------------------------------------
A0A2V7YV88      ------------------------------------------------------------
A0A2V8YCY6      ------------------------------------------------------------
A0A2V8EGM3      ------------------------------------------------------------
A0A2V8FGH1      ------------------------------------------------------------
A0A2V8D468      ------------------------------------------------------------
A0A1F2R977      ------------------------------------------------------------
A0A2U3LF12      ------------------------------------------------------------
A0A3N5G7M6      ------------------------------------------------------------
A0A1F2S3Q7      ------------------------------------------------------------
A0A2V8GVG4      ------------------------------------------------------------
A0A143PNR5      ------------------------------------------------------------
A0A2V8PJQ0      ------------------------------------------------------------
A0A2V8H566      ------------------------------------------------------------
A0A3N5YKY1      ------------------------------------------------------------
A0A2V8UVN4      ------------------------------------------------------------
A0A321LXF5      ------------------------------------------------------------
A0A5M8SBZ0      ------------------------------------------------------------
A0A1Q7JFB1      ------------------------------------------------------------
A0A2V8DMJ9      ------------------------------------------------------------
A0A2V8GGF6      ------------------------------------------------------------
A0A2V8HKU7      ------------------------------------------------------------
A0A1Q6Y875      ------------------------------------------------------------
A0A523DJA9      ------------------------------------------------------------
A0A2V8I604      ------------------------------------------------------------
A0A2V8J066      ------------------------------------------------------------
A0A1I6MMC5      ------------------------------------------------------------
A0A2V9D5W7      ------------------------------------------------------------
A0A2V9D4I4      ------------------------------------------------------------
A0A2V9D6L7      ------------------------------------------------------------
A0A2V8ZJV2      ------------------------------------------------------------
A0A2V9AWB5      ------------------------------------------------------------
A0A2V8Z1Y8      ------------------------------------------------------------
A0A1Q8AX10      ------------------------------------------------------------
A0A2V9A773      ------------------------------------------------------------
A0A2V9AND3      ------------------------------------------------------------
A0A2V9BTJ7      ------------------------------------------------------------
A0A2V8W2M7      ------------------------------------------------------------
A0A2V8XNW2      ------------------------------------------------------------
A0A1Q7CJC1      ------------------------------------------------------------
A0A2V9UEM7      ------------------------------------------------------------
A0A1Q7V300      ------------------------------------------------------------
A0A2V9ZCI3      ------------------------------------------------------------
A0A2V9WCB3      ------------------------------------------------------------
A0A2V9VQW5      ------------------------------------------------------------
A0A2V9WTP3      ------------------------------------------------------------
A0A2V9NLA9      ------------------------------------------------------------
A0A2V9RKJ9      ------------------------------------------------------------
A0A2V9RN95      ------------------------------------------------------------
A0A2V9N406      ------------------------------------------------------------
A0A2V9U6D9      ------------------------------------------------------------
A0A2V8DZN4      ------------------------------------------------------------
A0A2G6HQA4      ------------------------------------------------------------
A0A2V7ZTY7      ------------------------------------------------------------
A0A2V7ZVL9      ------------------------------------------------------------
A0A1Q7QYI4      ------------------------------------------------------------
A0A2V8G9Y9      ------------------------------------------------------------
A0A143PXU3      ------------------------------------------------------------
A0A2V8D8G9      ------------------------------------------------------------
A0A2V8ESQ4      ------------------------------------------------------------
A0A1E3Y5Q0      ------------------------------------------------------------
A0A2W4TWK5      ------------------------------------------------------------
A0A3N5NYV3      ------------------------------------------------------------
A0A2V2RJF9      ------------------------------------------------------------
A0A2G6HNT3      ------------------------------------------------------------
A0A2V7YWD4      ------------------------------------------------------------
A0A2V2R8T6      ------------------------------------------------------------
A0A1Q7RGF1      ------------------------------------------------------------
A0A2V9BLX2      ------------------------------------------------------------
A0A2V9ZA03      ------------------------------------------------------------
A0A3N5ZNH4      ------------------------------------------------------------
A0A2V8GEZ2      ------------------------------------------------------------
A0A3N5ZFD3      ------------------------------------------------------------
G8NXD3          ------------------------------------------------------------
A0A2V9VR38      ------------------------------------------------------------
A0A2V9EY04      ------------------------------------------------------------
A0A2V9HAK9      ------------------------------------------------------------
A0A1Q7FS15      ------------------------------------------------------------
A0A1Q7K9P1      ------------------------------------------------------------
A0A1Q7N989      ------------------------------------------------------------
A0A2V9G7Y0      ------------------------------------------------------------
A0A2V8T7Z1      ------------------------------------------------------------
A0A2V7U8G5      ------------------------------------------------------------
A0A2V7UNP9      ------------------------------------------------------------
A0A2V7VLD7      ------------------------------------------------------------
A0A2V7XGA3      ------------------------------------------------------------
A0A2V7YAG6      ------------------------------------------------------------
A0A2V7VK33      ------------------------------------------------------------
A0A3M1VTE1      ------------------------------------------------------------
A0A2V7TTM7      ------------------------------------------------------------
A0A2V8VI82      ------------------------------------------------------------
A0A2V7U4P9      ------------------------------------------------------------
A0A2V7TQY5      ------------------------------------------------------------
A0A2V7TU87      ------------------------------------------------------------
A0A2V8SEH0      ------------------------------------------------------------
A0A2V8VU54      ------------------------------------------------------------
A0A1Q7RML7      ------------------------------------------------------------
A0A1Q7ZIQ5      ------------------------------------------------------------
A0A2V8TKD8      ------------------------------------------------------------
                                                                            

A0A1F2U8T6      SKLVDVFFTAADPAVTALAATTLAEEYVAQNLELKQQSTQNMLEWLENEVAAQQTKVEQS
A0A2V8BV42      SRLVDVTFMSADPNFAALAVNTLVDEYTEQNLAIKLESSQNMLNWLAKELDKQQQKVRES
A0A2V8F916      SRLVDVTFMSADPNFAALAVNTLVDEYTEQNLAIKLESSQNMLNWLAKELDKQQQKVRES
A0A1Q7K833      SKLVDVTFDSMDPKFAQLAANTLVDEYVEQNLALKQQSTQNMIDWLDKELERQQQKTEES
A0A1Q8AMY4      SKLVDVTFDSMDPKFAQLAANTLVDEYVEQNLALKQQSTQNMIDWLDKELERQQQKTEES
A0A2V8BM40      SKLVDVLFDSRDPKFAQAAANALVDEYVEQNLQVKLQSTQNMIEWLDKELEKQQQKVGES
A0A2V8CRT6      SKLVDVLFDSRDPKFAQAAANALVDEYVEQNLQVKLQSTQNMIEWLDKELEKQQQKVGES
A0A1F2VH76      SRLVDLLFTAADPAFAAKAANAYAEEYVAQNLELKAANLDKSLEWLTGEVGRQEGLVKAS
A0A1F2R0X5      SRLVDVTFLSVEPKFAAEAANALAEEYVEQNLQVKLQTAQNMLDWLGKELATQQQKVEES
A0A2V8B278      SKLVDVTFDSMDRRFAATAANTLVDEFVDQNLQVKLQSTENMIDWLDKELDKQQQKVQDS
A0A2V8CEF9      SKLVDVTFDSMDPRFAATAANTLVDEFVEQNLQVKLQSTENMIDWLDKELDKQQHKVQDS
A0A2V8KZG2      ------------------------------------------------------------
A0A1Q7LG57      ------------------------------------------------------------
A0A2V8YMQ4      ------------------------------------------------------------
A0A1Q7L5B1      -----------------------------------------------------MSRIHEA
A0A2V9DKV4      ------------------------------------------------------------
A0A2V8W380      ------------------------------------------------------------
A0A2V8ZIV5      -----------------------------------------------------QYNILKR
A0A2V9EVA0      -----------------------------------------------------MSRIFEA
A0A1Q7RB73      ------------------------------------------------------------
A0A2V9K0H7      -----------------------------------------------------MSRLHEA
A0A3N5YN96      -----------------------------------------------------MSRIQRV
A0A1Q7Y646      -----------------------------------------------------MGRVYDA
A0A2V8QZU0      -----------------------------------------------------MGRVYEA
A0A2V8RSQ9      -----------------------------------------------------MGRVYEA
A0A2V9LS17      -----------------------------------------------------MSRIHEA
A0A2V9AGR3      -----------------------------------------------------MSRIHEA
A0A2V9G0N7      -----------------------------------------------------MSRIHDA
A0A2V9GQ44      -----------------------------------------------------MSRIHDA
A0A2V9HRN3      -----------------------------------------------------MSRIHDA
A0A2V8WG13      -----------------------------------------------------MSRIHEA
A0A2V8X987      -----------------------------------------------------MSRIHEA
A0A1Q7KX94      -----------------------------------------------------MSRIHEA
A0A2V8XHT0      -----------------------------------------------------MSRIHEA
A0A2V9L2P7      -------------------------------------------MNQLLIEHNLLKRDFDS
A0A2V7UMX0      -----------------------------------------------------MLRSTVG
A0A136K497      ------------------------------------------------------MSVLQA
A0A399W9E4      ------------------------------------------------------MSVLQA
A0A2V7X0V9      -----------------------------------------------------MSRIHEA
A0A2V9X518      ------------------------------------------------------------
A0A2V9VC62      -----------------------------------------------------MSRIHEA
A0A2V9S1P8      -----------------------------------------------------MSRIHEA
A0A2V9RTW2      -----------------------------------------------------MSRIHEA
A0A2V9TGF1      -----------------------------------------------------MSRIHEA
A0A2V9XEV6      -----------------------------------------------------MSRIHEA
A0A2V9Y3Q6      -----------------------------------------------------MSRIHEA
A0A2V9R269      -----------------------------------------------------MSRIHEA
A0A2V9PTS3      -----------------------------------------------------MSRIHEA
A0A2V9NPF4      -----------------------------------------------------MSRIHEA
A0A2V9PNZ0      -----------------------------------------------------MSRIHEA
A0A321LMC5      ---------------------------------------------------MPMGRVYKA
A0A2V8X713      -----------------------------------------------------MSRIHEA
A0A2V8ZLE9      -----------------------------------------------------MSRIHEA
A0A2V8Y4D3      -----------------------------------------------------MSRIHEA
A0A2V8Z2X8      -----------------------------------------------------MSRIHEA
A0A2V9C3F6      -----------------------------------------------------MSRIHEA
A0A2V9QMU9      -----------------------------------------------------MARVPIE
A0A2V9QY75      ----------------------------------------------------------QK
A0A2V9SVU9      IVSRVRSDYLAALQRETMLRAALDKQKQEANKLNESAIDYSLLKRDVETNRTLYEGLLEK
A0A2V8W5N5      -----------------------------------------------------MSRIHEA
A0A2V8XG53      -----------------------------------------------------MSRIHEA
A0A2V9XV04      -----------------------------------------------------MSRIHEA
A0A2V9CBY1      -----------------------------------------------------MSRVYEA
A0A2V9D656      -----------------------------------------------------MSRVYEA
A0A352EZH8      -----------------------------------------------------MGRVYDA
A0A0B6X033      -----------------------------------------------------MGRVFDA
A0A2V8R0I3      -----------------------MSSCASVATLQRRLKMSGQPSAVPVLGEEPMGRVYDA
A0A2V8N1U8      -----------------------------------------------------MGRVYDA
A0A2V8QL35      -----------------------------------------------------MGRVYDA
A0A352FU10      -----------------------------------------------------MGRVYDA
A0A2V8LCU0      -----------------------------------------------------MGRIYDA
A0A1Q7NGT0      -----------------------------------------------------MGRIYDA
A0A2V8MLP9      -----------------------------------------------------MGRIYDA
A0A2V8PQZ0      -----------------------------------------------------MGRIYDA
A0A3B9MKY6      -----------------------------------------------------MGRVFDA
A0A3D5SKZ1      -----------------------------------------------------MGRVFDA
A0A2V8NRW2      -----------------------------------------------------MGRVYDA
A0A2V8TKR9      ------------------------------------------------------------
A0A2V8LBV1      ------------------------------------------------------------
A0A2V8GAF9      ------------------------------------------------------------
A0A2V8CN98      ------------------------ADLTRALSELTTKRADRRA--LLYRYTDDHPAVRRV
A0A1Q7LC46      LYEFAKAGDLDAVPQVQSN-----AALTDLLKKQRDSSAEYTD--ALAQYGPNFPKVQRL
A0A1Q8BDC5      ------------------------RDLDAAHSEAQRHQILIGEAVVRKRLLGQAEVIVAV
A0A2V9Q1Y8      ------------------------------------------------------------
A0A2V8JXG1      --------------------------------------------------------MAAI
A0A350D2W9      --------------------------------------------------------MQRL
A0A2V9I4J1      ------------------------QAFQLLRHALEKQFSVQSF--QVSATGFSVPAQIHF
A0A2V8PQZ9      ------------------------TATFQPTRTLSARASLNLRSSSTSTRAHSLQPPLRN
A0A2V8D8B1      ------------------------QFVQQQKSELAELQRQQAQ--LSDKLGDKHPDMVKN
A0A3B9LSB4      ----------------------------------------------MVDATEEAPEVKEV
A0A2V9H7U2      ------------------------------------LKTQNVD--ALEQYGPKHPKVERL
A0A2V8NJB5      ---------------------------------------------VRRQSLELLQHVLTN
A0A2V9JMZ4      ------------------------QAFQLLRHALEKQFSVQSF--QVSATGFSVPAQIHF
A0A2V9MDJ6      ------------------------QAFQLLRHALEKQFSVQSF--QVSATGFSVPAQIHF
A0A2V8QJT6      ------------------------KEIEVTDSELAKLRQKRAQ--LLIEATEEAPEVKEI
A0A2V8FSM8      KYEMSSSSPPAALPEILDD-----PSQRTSQTTLYDLRAKLAL--LRVTYTTSYAEVRKV
A0A359M0J2      RLNVAKGKPVETLPGEIA------GGLSTQQGALDSLKRQRAD--LLTTLMPGHYKVQRI
A0A2V8JLJ1      ------------------------ATATAEAAKAASIQVQAAK--EPKPEEKPRPFLPEF
A0A5M8SND8      RLKTAESSGAESVAEVVND-----DSLRDLQAKITELQRQKAD--LLTIYTPEHEKVQRV
A0A2V9GAQ1      LYQFAKSGNLDAIPQVQSN-----LALTELLKKRGEVSSDYTD--ALNQYGPNFPKVQRL
A0A497EDQ8      KLNALNQLRARHVSEVAFPEVLEDATISNLMQRRGEVEVELLD--KLGTYKEGHPAIKEL
G8NS05          -----MDPNSLDQTVANTTNNVAATQLATLRSQRETDMANYAKLTAPGNLGPNHPQVKAA
A0A2V8KZ20      LNASSPPPPPAAHTESTTAAAIETPPPSPLETELANRQAQLAA--ASVRYTPRHPEVVRL
A0A3D0NWU2      ------------------------DDIRNIDKQIQQAETEKSE--LLVRYTPEYPEVKKM
A0A2V8EPD9      ------------------------LAASAAATALATPESEPAQDAAAPSVAPVGPVARAA
A0A3N5NSX5      LYNQIKSLPPSSVGDAPAVGAS--PAVQSLRTRLAELQRQKVQ--LNERYGPKNPQVIEN
A0A2V8MUA1      ------------------------PDIRALKRDIKQLEEQVATDRAAETSAEKNAEETTE
A0A2V8MBH9      ------------------------KDINESESKLADLKQKRAQ--LLVDATEEAPEVKEV
A0A3N5ZPQ7      ------------------------YFHGGLVSAMSSSLPEYRL--GQYCLKEGIIDPPDL
A0A3N5P5F2      ALTQLRAIQHDKAALASAPAVVANASVQRLNQELADLQRQDAQ--LSRQYGERHPEMIKV
A0A2V9G1P7      LYRLVQTGESGALPGVFEN-----KLIQDLSERLAELKREHAQ--LSTTFNPDYPRVKEI
A0A2V9BCK9      ITVRARTGPLSLQET---------HGYIAERLRIAGANGEPIF--APGAVESVYNYARGI
A0A2V9TMX2      DYKLAVNGDPEMFMKTSPDGRGGSGLLDKLREKEADLETQYAM--ATTQFGSGYPRVTEL
A0A2V8N2J7      LESKGVLEQPMVHEKTPDE-----AKLDELRIQLAELQTRYTA--QHPVVVAKKREISDL
A0A3N6BI26      DYQAVRDATPESFPQSLRT-----PSISLLEERLFGLQQNLAS--LSAQFGSEWPAVIQV
A0A2V9JMM3      EPAQEIQRELPVEEPTAEQ-----KALDEKRLKLKELEAKYTE--QYPEIPRLRKEIADL
A0A2V9M815      EPAQEIQRELPVEEPTAEQ-----KALDEKRLKLKELEAKYTE--QYPEIPRLRKEIADL
A0A2V9A795      LYRLVQSGDYGSLPGVVEN-----KLIQDLSERLAELKRELAQ--LSTKFNAGYPRVKEI
A0A355ESH9      HYHEVMTGPLDAVADSLAP-----GVISGLRTQQLQMEQDYET--KLKTFKPEWPEMVSL
A0A3D0NW85      ARYITERENFLLNYRNETQ-----KTIAGLTANRAKLLEEFLP--TAPEVKEIDSQIKSL
A0A353CAT5      ARYITERENFILNNRTETD-----KAIAGLAATRAKLLEEYKE--SAPEIKEIDSQIASL
A0A2V9HB55      LYQFAKSGNLDAVPQIQSN-----LALTELLKKRSEVSSDYTD--ALNQYGPNFPKVQRL
A0A2V8CU57      -------AAWSEPETVTAP-----FAVAGWSEPESAAAPPVVA--AWSE-----PETVTA
A0A2V8BDI4      -----------------------------WSEPESAAALPAVA--AWSE-----PETVTA
A0A2V8F8T3      TAVLPAVAAWSEPETVTAP-----FAVAGWSEPESAAAPPVVA--AWSE-----PETVTA
A0A2V9J901      ------------------------------------------------------------
A0A2V8MKQ7      ------------------------------------------------------------
A0A3M1SNQ5      ------------------------------------------------------MKILKA
A0A2V8QJ59      ------------------------------------------------------------
A0A1Q7HTA7      ------------------------------------------------------------
A0A2W0B5E2      ------------------------------------------------------------
A0A2V8NMG8      ------------------------------------------------------------
A0A2V8TBM7      ------------------------------------------------------------
A0A1Q7HEZ8      ------------------------------------------------------------
A0A1Q7JW36      ------------------------------------------------------------
A0A1Q7MUR4      ------------------------------------------------------------
A0A3N5PFU4      ------------------------------------------------------------
A0A4R1LDF1      ------------------------MTISLRKEQNIAAINLQSESFQLIDAPREATTLQGG
A0A1F2T1R8      -----------------------------------------------------MPTLDRH
A0A2V9BW09      ------------------------------------------------------------
A0A3M1SSE1      ------------------------DIPVSPRRLLTVMMALFLSACFGIGLAFFLEYLDDT
A0A2V9GQV7      ------------------------------------------------------------
A0A2V7YV88      ------------------------------------------------------DYLDQS
A0A2V8YCY6      ----------------------------------------------------------MC
A0A2V8EGM3      -----------------------------------------------------MARSMNH
A0A2V8FGH1      -----------------------------------------------------MGRIDEA
A0A2V8D468      ------------------------------------------------------------
A0A1F2R977      -------------------------------------------------MALVMSRIDEA
A0A2U3LF12      ------------------------------------------------------------
A0A3N5G7M6      ------------------------------------------------------------
A0A1F2S3Q7      ------------------------------------------------------------
A0A2V8GVG4      ------------------------------------------------------------
A0A143PNR5      -----------------------------------------------------MSRIDEA
A0A2V8PJQ0      -----------------------------------------------------LDDTVKS
A0A2V8H566      ------------------------------------------------------------
A0A3N5YKY1      ----------------------------------------------MQVFATPSAATHPN
A0A2V8UVN4      -----------------------------------------------------MSKIFEA
A0A321LXF5      -----------------------------------------------------MSRFFNE
A0A5M8SBZ0      ----------------------------------------------MPQMRNLMSRIHEA
A0A1Q7JFB1      ------------------------------------------------------------
A0A2V8DMJ9      -----------------------------------------------------MADGARR
A0A2V8GGF6      -----------------------------------------------------MGTVRAR
A0A2V8HKU7      -----------------------------------------------------MGTVRAR
A0A1Q6Y875      ------------------------------------------------------------
A0A523DJA9      -----------------------------------------------------MNSRANN
A0A2V8I604      -----------------------------------------------------MSRIQDI
A0A2V8J066      -----------------------------------------------------MSRIQDI
A0A1I6MMC5      -----------------------------------------------------MSKIYEA
A0A2V9D5W7      -----------------------------------------------------MTRIHEA
A0A2V9D4I4      -----------------------------------------------------MSRIHEA
A0A2V9D6L7      -----------------------------------------------------MSRIHEA
A0A2V8ZJV2      -----------------------------------------------------MSRIHEA
A0A2V9AWB5      -----------------------------------------------------MSRIHEA
A0A2V8Z1Y8      -----------------------------------------------------MSRIHEA
A0A1Q8AX10      -----------------------------------------------------MSRIHEA
A0A2V9A773      -----------------------------------------------------MSRIHEA
A0A2V9AND3      -----------------------------------------------------MSRIHEA
A0A2V9BTJ7      -----------------------------------------------------MSRIHEA
A0A2V8W2M7      -----------------------------------------------------MSRIHEA
A0A2V8XNW2      -----------------------------------------------------MSRIHEA
A0A1Q7CJC1      ------------------------------------------------------------
A0A2V9UEM7      -----------------------------------------------------MSRIHDA
A0A1Q7V300      -----------------------------------------------------MSRIHEA
A0A2V9ZCI3      -----------------------------------------------------MSRIHEA
A0A2V9WCB3      -----------------------------------------------------MSRIHEA
A0A2V9VQW5      -----------------------------------------------------MSRIHEA
A0A2V9WTP3      -----------------------------------------------------MSRIHEA
A0A2V9NLA9      -----------------------------------------------------MSRIHEA
A0A2V9RKJ9      -----------------------------------------------------MSRIHEA
A0A2V9RN95      ------------------------------------------------------------
A0A2V9N406      -----------------------------------------------------MSRIHEA
A0A2V9U6D9      -----------------------------------------------------MSRIHEA
A0A2V8DZN4      -----------------------------------------------------MRSPAAA
A0A2G6HQA4      -----------------------------------------------------MDKFSKI
A0A2V7ZTY7      -----------------------------------------------------MSRLEAA
A0A2V7ZVL9      -----------------------------------------------------MSRLEAA
A0A1Q7QYI4      -----------------------------------------------------MSRLEAA
A0A2V8G9Y9      -----------------------------------------------------MTRLAEA
A0A143PXU3      -----------------------------------------------------MSRIDDA
A0A2V8D8G9      -----------------------------------------------------MSRIDQA
A0A2V8ESQ4      -----------------------------------------------------MSRIDQA
A0A1E3Y5Q0      -----------------------------------------------------MRRAAEA
A0A2W4TWK5      -----------------------------------------------------MGRIDEA
A0A3N5NYV3      -----------------------------------------------------MSRLAEA
A0A2V2RJF9      ------------------------------------------------------------
A0A2G6HNT3      ------------------------------------------------------------
A0A2V7YWD4      ------------------------------------------------------------
A0A2V2R8T6      ------------------------------------------------------------
A0A1Q7RGF1      ------------------------------------------------------------
A0A2V9BLX2      ------------------------------------------------------------
A0A2V9ZA03      ------------------------------------------------------------
A0A3N5ZNH4      ------------------------------------------------------------
A0A2V8GEZ2      ------------------------------------------------------------
A0A3N5ZFD3      ------------------------------------------------------------
G8NXD3          ------------------------------------------------------------
A0A2V9VR38      ------------------------------------------------------------
A0A2V9EY04      ------------------------------------------------------------
A0A2V9HAK9      ------------------------------------------------------------
A0A1Q7FS15      ------------------------------------------------------------
A0A1Q7K9P1      ------------------------------------------------------------
A0A1Q7N989      ------------------------------------------------------------
A0A2V9G7Y0      ------------------------------------------------------------
A0A2V8T7Z1      ------------------------------------------------------------
A0A2V7U8G5      ------------------------------------------------------------
A0A2V7UNP9      ------------------------------------------------------------
A0A2V7VLD7      ------------------------------------------------------------
A0A2V7XGA3      ------------------------------------------------------------
A0A2V7YAG6      ------------------------------------------------------------
A0A2V7VK33      ------------------------------------------------------------
A0A3M1VTE1      ------------------------------------------------------------
A0A2V7TTM7      ------------------------------------------------------------
A0A2V8VI82      ------------------------------------------------------------
A0A2V7U4P9      ------------------------------------------------------------
A0A2V7TQY5      ------------------------------------------------------------
A0A2V7TU87      ------------------------------------------------------------
A0A2V8SEH0      ------------------------------------------------------------
A0A2V8VU54      ------------------------------------------------------------
A0A1Q7RML7      ------------------------------------------------------------
A0A1Q7ZIQ5      ------------------------------------------------------------
A0A2V8TKD8      ------------------------------------------------------------
                                                                            

A0A1F2U8T6      ERDLAEYREMENAMSL-DDKNNIVVSRLNALNEASIRARTVRIEKESVNNQLKAIRDTRS
A0A2V8BV42      EQALAEYRDKQNAMSL-DDKQNIVTTRLTALNDALIHARTAKVQKEALYNQVKSMSGTTA
A0A2V8F916      EQALAEYRDKQNAMSL-DDKQNIVTTRLTALNDALIHARTAKVQKEALYNQVKSMSGTTA
A0A1Q7K833      ERALADYRERQNALSL-DERQNIVLVRLNKLNDDVMLARSRKAQKQAVYDQLRSLTASQH
A0A1Q8AMY4      ERALADYRERQNALSL-DERQNIVLVRLNKLNDDVMLARSRKAQKQAVYDQLRSLTASQH
A0A2V8BM40      ERGLADYRERQNAMSL-DEKQNLVVVRLNKLNDDLMLARSRRAQKQAVYDQLRSIGAGEP
A0A2V8CRT6      ERGLADYRERQNAMSL-DEKQNLVVVRLNKLNDDLMLARSRRAQKQAVYDQLRSIGAGEP
A0A1F2VH76      ERALADYRERQDAGGLAEGSGNIVVARLTQLNDEVTRARTNRLTKENVWNQVRSA--GQD
A0A1F2R0X5      ERSLAEYREKENALSL-DDKQNIVLARLNQLNDLVTKAKTQRIQREALYNQVKSIAGGAA
A0A2V8B278      ERGLAEYRERQNALSL-DDKQNIVLARLNKLNDDVMMARSRRIQKETLFNQIKSVS-TQA
A0A2V8CEF9      ERALAEYRERQNALSL-DDKQNLVLARLNKLNDDVMMARSRRIQKETLFNQIKSAS-TQA
A0A2V8KZG2      ------------------------------------------------------------
A0A1Q7LG57      ------------------------------------MRDSNVLVVDRAKPPLLPYRPSFP
A0A2V8YMQ4      ------------------------------------------------------------
A0A1Q7L5B1      LKQAAHGR----------------------------------------------------
A0A2V9DKV4      ------------------------------------------------------------
A0A2V8W380      --------------------------------------------MDSAEPPAKPVKPRTL
A0A2V8ZIV5      EVDTNKQLYEGLLQTL------------KQTGVSASLKATNIRIVDSAVPPVKPATPKIP
A0A2V9EVA0      LQKIQSQQTPVVPGAE------------T-------------------------------
A0A1Q7RB73      ------------------------------------------------------------
A0A2V9K0H7      LKKAEQQKTENGSPLD------------LERPTVIPGDGKGVAVLPPAELPSGAAELRVL
A0A3N5YN96      LDKAEREGQVRRTTSE------------V-----------PPAADTAAAGRVSSPVSPQP
A0A1Q7Y646      LKRASATQGGVTKRSN------------E----QKRRNGNSNAARQNGNGN---------
A0A2V8QZU0      LKRAAEQNGSKAKKEE------------KLAHDSRDERPPAPAAETNGHGRPHAAPGASA
A0A2V8RSQ9      LKRAAAHGDAKSKRPD------------D-AGPSRVDNTNGNAQHANGNGAAHTRAPVAD
A0A2V9LS17      LKRAEQEMEGRS------------------------------------------------
A0A2V9AGR3      LRKAEQERASSA------------------------------------------------
A0A2V9G0N7      LKKATEEKASQS------------------------------------------------
A0A2V9GQ44      LKKAAEEKASQS------------------------------------------------
A0A2V9HRN3      LKKAAEERASKS------------------------------------------------
A0A2V8WG13      LKKAAQERSSQV------------------------------------------------
A0A2V8X987      LKKAAQERSTQI------------------------------------------------
A0A1Q7KX94      LKKAAEERSAQL------------------------------------------------
A0A2V8XHT0      LKKAAEERSAQL------------------------------------------------
A0A2V9L2P7      NQALYESLLQHLKDAN------------V----------SAGLRATNIHFIDSAAVPTVP
A0A2V7UMX0      EWRCGLLSQVK-------------------------------------------------
A0A136K497      LQRKNIENPTTSKPRV------------V----------AFDANGKRNAPPDILGTELTI
A0A399W9E4      LQRKNSENPTSTKPKV------------V----------AFDAPGRRNLPPDLLGTGLAI
A0A2V7X0V9      LKKAEEERAASQGGAQ------------L----------EPTP-----------------
A0A2V9X518      --------------------------------------------MDVP------------
A0A2V9VC62      LKRAEQERAASQGGR-------------V----------DSAPVMDLPASPEPLP-----
A0A2V9S1P8      LKKAEEQRVASQGGRP------------V----------EPVQPADAA------------
A0A2V9RTW2      LKRAEEQRAASQGGQ-------------V----------PSSQTPEAV------------
A0A2V9TGF1      LKRAEEQRAASQGGQ-------------V----------PSSQTPEAV------------
A0A2V9XEV6      LKRAEQERAASQGGH-------------V----------ESLHPMDVP------------
A0A2V9Y3Q6      LKRAEQERATSQGGH-------------L----------EPLHTTEGP------------
A0A2V9R269      LKKAEQERAMLHPSQR------------V----------EM-PAV---------------
A0A2V9PTS3      LKKAEQERAMSQSPGA------------I----------ETSPAV---------------
A0A2V9NPF4      LKKAEQERAMSQSPGA------------I----------ETAPAV---------------
A0A2V9PNZ0      LKKAEQERAMSQSPGA------------I----------ETAPAV---------------
A0A321LMC5      LVKAGRITE---------------------------------------------------
A0A2V8X713      LKKAEEEK----------------------------------------------------
A0A2V8ZLE9      LKRAEEQK----------------------------------------------------
A0A2V8Y4D3      LKRAEEQR----------------------------------------------------
A0A2V8Z2X8      LKRAEEAG----------------------------------------------------
A0A2V9C3F6      LKKAEEQK----------------------------------------------------
A0A2V9QMU9      PAEPDVPRN---------------------------------------------------
A0A2V9QY75      LKEAGVTAGLRSNNIR------------E----------VDIARTPGAPAEPNI---ARN
A0A2V9SVU9      LKEAGVTAGLRSNNIR------------P----------VDEARVPMYPAEPNV---PRN
A0A2V8W5N5      LKKAHEERHSSQAADT------------V----------T--------------------
A0A2V8XG53      LKKAHEERHSSQAADT------------V----------T--------------------
A0A2V9XV04      LKKAEQERASTQGERV------------P----------SSYATTPVADVPGY-------
A0A2V9CBY1      LKNAQEQRTIRGPLEA------------E----------VTAQESSVGGPVHNGKTASRI
A0A2V9D656      LKNAQDQQTIRGP-----------------------------------------------
A0A352EZH8      LRRSGTDGSAIVFEPQ------------P----------SSSDYRGEIRTHRLVPSAQQI
A0A0B6X033      LRRAAELDSRKREHRA------------R----------PSDAQARAEEIESLLQRSEIF
A0A2V8R0I3      LKRAESAQR-HNHKPS------------D----------FSGRHNGDADNVSLF-TPKNE
A0A2V8N1U8      LKRADAQRQ-FK--PS------------T----------PSVRRHGNSDNVAYF-VPKNG
A0A2V8QL35      LKRAESPER-RIT-AS------------K----------SAIRQNGNSGNVLYPGWPGNG
A0A352FU10      LKRAESAER-QVT-SS------------K----------SSVRQNGNSGNVLYPGWPGNG
A0A2V8LCU0      LKRAESNQR-DFTSTN------------K----------SSVSRNGNPDNVSYF-VQKNG
A0A1Q7NGT0      LKRAESAPR-----TP------------K----------PSVNRPGNPDNIAYF-VPK--
A0A2V8MLP9      LKRAESAQR-----TP------------K----------PSVNRNGNPDNVAYF-VPK--
A0A2V8PQZ0      LKRAESAQR-----TP------------K----------PSVNRNGNPDNVAYF-VPK--
A0A3B9MKY6      IKRASAADQGGEQKRH------------Q----------PDLERHGESPSVPGLPSARQI
A0A3D5SKZ1      IKRASAADQGGEQKRH------------Q----------PDLERHGESPSVPGLPSARQI
A0A2V8NRW2      LKRASTAKDENGAGRK------------K----------EDQKRRNGTAAGRKLSAVLPV
A0A2V8TKR9      ------------------------------------------------------------
A0A2V8LBV1      ------------------------------------------------------------
A0A2V8GAF9      ------------------------------------------------------------
A0A2V8CN98      TTDIDELEHQTIPG----------------------------------------------
A0A1Q7LC46      KTELKDIEDSIEKE---------------------------------KRKV---------
A0A1Q8BDC5      RQQATEVLEHVFKN------------------------------NFAVDSF---------
A0A2V9Q1Y8      --MIRKSRARPRKS----------------------------------------------
A0A2V8JXG1      RDQIAASRGLLEDK----------------------------------------------
A0A350D2W9      KAELDTARDLLKNE---------------------------------TGGL---------
A0A2V9I4J1      ENLLLEVARGDSKP----------------------------------------------
A0A2V8PQZ9      SDRLSTLRAWGEET----------------------------------------------
A0A2V8D8B1      RHAIQTAEAKIQGE---------------------------------IAKV---------
A0A3B9LSB4      DQQIAELERQVKDV-----------------------------RSRKSVTL---------
A0A2V9H7U2      RSQVNEIQSLIDTE---------------------------------RKRM---------
A0A2V8NJB5      DFSIDDFTNSVRSF----------------------------------------------
A0A2V9JMZ4      ENLLLEVARGDSKP----------------------------------------------
A0A2V9MDJ6      ENLLLEVARGDSKP----------------------------------------------
A0A2V8QJT6      DQQIDVLQKHLADT-----------------------------RARGAATL---------
A0A2V8FSM8      MAQIAAIESSLEGT---------------------------------RENV---------
A0A359M0J2      QAQIDELEQSLERE---------------------------------RVNI---------
A0A2V8JLJ1      NLSLDTVPAEVQLQ----------------------------------------------
A0A5M8SND8      QAQLTPLQNALEQH---------------------------------RSRI---------
A0A2V9GAQ1      QAQLKDYDLSIEKE---------------------------------KKYI---------
A0A497EDQ8      RVRLEGIDQAIERQ---------------------------------IQTL---------
G8NS05          HAQIEELDKAIKQE---------------------------------QDRV---------
A0A2V8KZ20      TQEVRELEGLVRQFKA------------AAEAAKAAAAATATAEAAKAASIQVQAAKEPK
A0A3D0NWU2      EERIASLKESRTRT--------------EQEVSSIIDRDQKRIEREAVGGA---------
A0A2V8EPD9      SPAPVVVAPAAPVV---------------------------------LAPV---------
A0A3N5NSX5      DNAIADTTQQLQTA---------------------------------LTAA---------
A0A2V8MUA1      KRELGETPGPAPADEV------------AASTLLPQLDFSIDFSDFEIQLR---------
A0A2V8MBH9      DQQIAELQKHLHES-----------------------------RARNTNTL---------
A0A3N5ZPQ7      HKQIKGRDHRPLGEAI------------VAAGLAEPVEIQQLLQKQAIDVF---------
A0A3N5P5F2      RTAIQQIRQKLDAE---------------------------------LHNA---------
A0A2V9G1P7      QSQIDEIAASLREE---------------------------------RQRA---------
A0A2V9BCK9      PRVINVLCEHALIN--------------------------------SFADQ---------
A0A2V9TMX2      NNQLKQVRAAIEAE---------------------------------KTKL---------
A0A2V8N2J7      ERTIASQPKKGRSE-----------------------PSPTYLRYSQLKSE---------
A0A3N6BI26      RQQIQEVEKQLLRE---------------------------------KKET---------
A0A2V9JMM3      EQAVAAGPRRKSRSDA------------TAATSRRYPGPDASMRYLALKGE---------
A0A2V9M815      EQAVAAGPRRKSRSDA------------TAATSRRYPGPDASMRYLALKGE---------
A0A2V9A795      QSQIDETEAALKEE---------------------------------RQRA---------
A0A355ESH9      KSQIETGKQHIDSVIR------------E-------------M----VQKA---------
A0A3D0NW85      EDSLANATEKAQAEIQ------------A-------------YRGRTADNL---------
A0A353CAT5      ERSLKTATDRANAEIA------------T-------------FRERTAKTL---------
A0A2V9HB55      QAQLKDYDQSIEKE---------------------------------KKNI---------
A0A2V8CU57      PFAVAGWSEPESAA---------------------------------APPV---------
A0A2V8BDI4      PFAVAGWSEPESAA---------------------------------APPV---------
A0A2V8F8T3      PFAVAGWSEPESAA---------------------------------APPV---------
A0A2V9J901      ------------------------------------------------------------
A0A2V8MKQ7      ------------------------------------------------------------
A0A3M1SNQ5      LQRRKQENERIVPF----------------------------------------------
A0A2V8QJ59      ------------------------------------------------------------
A0A1Q7HTA7      ------------------------------------------------------------
A0A2W0B5E2      ------------------------------------------------------------
A0A2V8NMG8      ------------------------------------------------------------
A0A2V8TBM7      ------------------------------------------------------------
A0A1Q7HEZ8      ------------------------------------------------------------
A0A1Q7JW36      ------------------------------------------------------------
A0A1Q7MUR4      ------------------------------------------------------------
A0A3N5PFU4      ------------------------------------------------------------
A0A4R1LDF1      VNGRTKLASSYLPT----------------------------------------------
A0A1F2T1R8      LVSLTE------------------------------------------------------
A0A2V9BW09      ------------------------------------------------------------
A0A3M1SSE1      IKTAEDVENYLGLP----------------------------------------------
A0A2V9GQV7      ------------------------------------------------------------
A0A2V7YV88      IKSDEELTE---------------------------------------------------
A0A2V8YCY6      PSHRCRKPSGPCAP----------------------------------------------
A0A2V8EGM3      PRPDSTSSGRRCSP----------------------------------------------
A0A2V8FGH1      LRRSTAKKDTQVKA----------------------------------------------
A0A2V8D468      ------------------------------------------------------------
A0A1F2R977      LKRVTRAPSPSPRR----------------------------------------------
A0A2U3LF12      ------------------------------------------------------------
A0A3N5G7M6      ------------------------------------------------------------
A0A1F2S3Q7      ------------------------------------------------------------
A0A2V8GVG4      ------------------------------------------------------------
A0A143PNR5      LRRARGEQPEHRAT----------------------------------------------
A0A2V8PJQ0      LDDVDRYIHLPTLA----------------------------------------------
A0A2V8H566      ------------------------------------------------------------
A0A3N5YKY1      VPPTVGVGGASAVP----------------------------------------------
A0A2V8UVN4      LQKSEGEVAQEALP----------------------------------------------
A0A321LXF5      SRKASRHVTVGPRN----------------------------------------------
A0A5M8SBZ0      LIRAEQEHNGRPGA----------------------------------------------
A0A1Q7JFB1      ------------------------------------------------------------
A0A2V8DMJ9      GNRCRR-CRVDRRG----------------------------------------------
A0A2V8GGF6      GHHDRHWSDVHRRR----------------------------------------------
A0A2V8HKU7      GRHDRHWSDVHRRR----------------------------------------------
A0A1Q6Y875      ------------------------------------------------------------
A0A523DJA9      VRVIDRAPVPSTPF----------------------------------------------
A0A2V8I604      LNKAERDGAVRRTR----------------------------------------------
A0A2V8J066      LNKAEREGSARRTR----------------------------------------------
A0A1I6MMC5      LLRAEIERLTTKD-----------------------------------------------
A0A2V9D5W7      LTKAGQEYPAAQAI----------------------------------------------
A0A2V9D4I4      MQKAAQERAAAPAT----------------------------------------------
A0A2V9D6L7      IQKAAQERSAAPAT----------------------------------------------
A0A2V8ZJV2      LKRAAEERAAQLAA----------------------------------------------
A0A2V9AWB5      LKKAAEERAARLTF----------------------------------------------
A0A2V8Z1Y8      LKKAALERSAQL-V----------------------------------------------
A0A1Q8AX10      LKRAEQERAPIQSA----------------------------------------------
A0A2V9A773      LKKAEEQRPPAWKP----------------------------------------------
A0A2V9AND3      LKRAEEQRPPSWKP----------------------------------------------
A0A2V9BTJ7      LKKAAQERSAQLAA----------------------------------------------
A0A2V8W2M7      LKKAVEERVSHLSV----------------------------------------------
A0A2V8XNW2      LKKAVEERVSHLSV----------------------------------------------
A0A1Q7CJC1      ------------------------------------------------------------
A0A2V9UEM7      LKRAEQERATSMGG----------------------------------------------
A0A1Q7V300      LKKAEQERATS-------------------------------------------------
A0A2V9ZCI3      LKKAEQERAASQGS----------------------------------------------
A0A2V9WCB3      LKKAEQERAATQAM----------------------------------------------
A0A2V9VQW5      LKRAEQERAASQGT----------------------------------------------
A0A2V9WTP3      LKKAEQERAASQGG----------------------------------------------
A0A2V9NLA9      LKKAEEQRSAEHEM----------------------------------------------
A0A2V9RKJ9      LKKAEEQRSAEHEM----------------------------------------------
A0A2V9RN95      ------------------------------------------------------------
A0A2V9N406      LKKAEEQRAASQGG----------------------------------------------
A0A2V9U6D9      LKKAEEQRAASQGG----------------------------------------------
A0A2V8DZN4      LTGASAP-----------------------------------------------------
A0A2G6HQA4      MEKAGVDTSYNLHS----------------------------------------------
A0A2V7ZTY7      LWRAETLNDEPAAP----------------------------------------------
A0A2V7ZVL9      LWRAETLNDEPAAP----------------------------------------------
A0A1Q7QYI4      LRRAQALNDQSDAP----------------------------------------------
A0A2V8G9Y9      LRRAED-HSGAEAP----------------------------------------------
A0A143PXU3      LRRARGEQPEQAAT----------------------------------------------
A0A2V8D8G9      LRIREVASGAAAPE----------------------------------------------
A0A2V8ESQ4      LRMREVASGAAAPE----------------------------------------------
A0A1E3Y5Q0      RQPISPDAGDAAGG----------------------------------------------
A0A2W4TWK5      MRRAGGASATVEEA----------------------------------------------
A0A3N5NYV3      LKRASAEQESDGAE----------------------------------------------
A0A2V2RJF9      ------------------------------------------------------------
A0A2G6HNT3      ------------------------------------------------------------
A0A2V7YWD4      ------------------------------------------------------------
A0A2V2R8T6      ------------------------------------------------------------
A0A1Q7RGF1      ------------------------------------------------------------
A0A2V9BLX2      ------------------------------------------------------------
A0A2V9ZA03      ------------------------------------------------------------
A0A3N5ZNH4      ------------------------------------------------------------
A0A2V8GEZ2      ------------------------------------------------------------
A0A3N5ZFD3      ------------------------------------------------------------
G8NXD3          ------------------------------------------------------------
A0A2V9VR38      ------------------------------------------------------------
A0A2V9EY04      ------------------------------------------------------------
A0A2V9HAK9      ------------------------------------------------------------
A0A1Q7FS15      ------------------------------------------------------------
A0A1Q7K9P1      ------------------------------------------------------------
A0A1Q7N989      ------------------------------------------------------------
A0A2V9G7Y0      ------------------------------------------------------------
A0A2V8T7Z1      ------------------------------------------------------------
A0A2V7U8G5      ------------------------------------------------------------
A0A2V7UNP9      ------------------------------------------------------------
A0A2V7VLD7      ------------------------------------------------------------
A0A2V7XGA3      ------------------------------------------------------------
A0A2V7YAG6      ------------------------------------------------------------
A0A2V7VK33      ------------------------------------------------------------
A0A3M1VTE1      ------------------------------------------------------------
A0A2V7TTM7      ------------------------------------------------------------
A0A2V8VI82      ------------------------------------------------------------
A0A2V7U4P9      ------------------------------------------------------------
A0A2V7TQY5      ------------------------------------------------------------
A0A2V7TU87      ------------------------------------------------------------
A0A2V8SEH0      ------------------------------------------------------------
A0A2V8VU54      ------------------------------------------------------------
A0A1Q7RML7      ------------------------------------------------------------
A0A1Q7ZIQ5      ------------------------------------------------------------
A0A2V8TKD8      ------------------------------------------------------------
                                                                            

A0A1F2U8T6      VDAIPVITQNLQIQALRNQLGDLQRQKANLTERYGDKHPEMVKVNAQLADGQRQLDVGTA
A0A2V8BV42      PDAIPVIAQNTQVQALKTKLNELQRDKSRLEERYGPKHLAVQANATAILDTQRQVDVETS
A0A2V8F916      PDAIPVIAQNTQVQALKTKLNELQRDKSRLEERYGPKHLAVQANATAILDTQRQVDVETS
A0A1Q7K833      LDTIPVIAQNPDVGAAKAKVTAAQTDRARTAERYGEKHPNMQKVNADVAEAQRQYDLAVN
A0A1Q8AMY4      LDTIPVIAQNPDVGAAKAKVTAAQTDRARTAERYGEKHPNMQKVNADVAEAQRQYDLAVN
A0A2V8BM40      VDTIQVIATSPEVSAAKGKVFAIQSEKARIAERYGDKHPTMQKAMADLTEAQRQYDTAVT
A0A2V8CRT6      VDTIQVIATSPEVAAAKGKVFAIQSEKARIAERYGDKHPTMQKAIADLTEAQRQYDTAVT
A0A1F2VH76      TETITTILQNPMVLSLRNRVSEVERDRGRISERYGPRHPEYEKVTTQLADVKLQLEAEIK
A0A1F2R0X5      PDSIPIIAQNPNVQALKNKLSSLQQDKVRLLERYGDKHPQVIAVNASLQDTQRQLDQETA
A0A2V8B278      PDTIPAIAQNASVAAAKSRVVEMQRARAQVADRYGERHPNMQKANADLSEAQRQYDFEVA
A0A2V8CEF9      PDTIPAIAQNASVAAAKSRVVEMQRARAQVADRYGERHPNMQKANADLSEAQRQYDFEVA
A0A2V8KZG2      ------------------------------------------------------------
A0A1Q7LG57      MNSAIGLFSGLFLGFGF---------VILRDRLDRRITAPGDAQAYLDLPELGVIPFDQG
A0A2V8YMQ4      ------------------------------------------------------------
A0A1Q7L5B1      --------------------------------EPALFPGEAKPNHSVVAEAGHGNRHEWL
A0A2V9DKV4      -------------------------------------------------MRTVGSRPYFQ
A0A2V8W380      LNLSVALFLGLALGICA---------ALFQERMDDTLKGDDDVERLLGLPSLALIPVVAP
A0A2V8ZIV5      LNLTVASLLGLGLGISA---------AFLQERLDDTLKGADDVERLFGLPALALIPSVHH
A0A2V9EVA0      --------------------------------IPPEPVAFWTEQREEELRPTSSFAPSEP
A0A1Q7RB73      ------------------------------------------------------------
A0A2V9K0H7      ------------------------------------------------------------
A0A3N5YN96      PVASRRAVPPE---------------PPMQVFATPSAATHPNVPPTVGVGGASAVPPAAA
A0A1Q7Y646      --------------HAF---------EDSPLFAPLGAAHNSASTAHT-EEGVGSALSDVI
A0A2V8QZU0      PVVGVNRDADDAAEFLF---------RRSKHFQSPESATVSASNEHTVTPG-GSALPAA-
A0A2V8RSQ9      PLFD----------------------RPSAFFHAPDAAHSSASTEHTAQAGVGSALPGGV
A0A2V9LS17      --------------------------------IPSVGTQIAELAEAGTAVPEKLPQSATG
A0A2V9AGR3      --------------------------------AVGRKDELPAINTDALSSSPVAPRNGKL
A0A2V9G0N7      --------------------------------PASPAQTFVDVREGISRFAQARNEVGT-
A0A2V9GQ44      --------------------------------PASPAQTFVDVREGISRFAQARNEVGT-
A0A2V9HRN3      --------------------------------PASAAQTFVDVTEGISRFAQARNEVGT-
A0A2V8WG13      --------------------------------ATGTVPDLADVATGLESPFGNKMQAGEP
A0A2V8X987      --------------------------------GAGLDRDVADVAAEIHRPVTVEPVVAVL
A0A1Q7KX94      --------------------------------AAGLETGVVEVTGELRRPITQGPGIAQP
A0A2V8XHT0      --------------------------------AAGLETGVVEVTGELRRPITQGPGIAQP
A0A2V9L2P7      VRPQKGRNIAFAMAVGL---------ALGMGLAFVREALANSIKGAQEVENLIAAPALA-
A0A2V7UMX0      --------------------------------GFRLPEAKPGAQPGKSARTKAGLPDQEV
A0A136K497      --------------------------------GSPRSAFDGQPNSSLGTALPDVETGLTA
A0A399W9E4      --------------------------------GSPRSAFDGQPNSSLGTALPDVETGLTA
A0A2V7X0V9      ---------------------------------VGAESPVMPDMASHRVPDPVAVAA---
A0A2V9X518      ---------------------------------AVEAAGMPPVIERAPLSTAASAAA---
A0A2V9VC62      --------------------------------GMAEAADATRTAPTAPIPGAPGNGQ---
A0A2V9S1P8      ---------------------------------VAEPLAATP---PAPQGTTASVGA---
A0A2V9RTW2      ---------------------------------LSDTPTEAQVVASPSTGVAP-------
A0A2V9TGF1      ---------------------------------LSDTPTEAQVVASPSTGVAP-------
A0A2V9XEV6      ---------------------------------AVEAAGMPPVIERAPLSTAASAAA---
A0A2V9Y3Q6      ---------------------------------VMDPIQASTVVEHPPVAPSTGI-----
A0A2V9R269      ---------------------------------LETPEMPAGAVAGAVGR----------
A0A2V9PTS3      ---------------------------------LEAPPETTPFLRSEPTE----------
A0A2V9NPF4      ---------------------------------LEAPLETTPFLRSEPTE----------
A0A2V9PNZ0      ---------------------------------LEAPLETTPFLRSEPTE----------
A0A321LMC5      -QFQQPEGAVFGDAIGP---------DFFDERDDSFIKESGSTRNSQPASSRREARASAA
A0A2V8X713      --------------------------------SPTRSAPGAGPLDFAG--DVAEPSPLGT
A0A2V8ZLE9      --------------------------------PPAWKPSEPTPLGFGGNVNTAVAREALH
A0A2V8Y4D3      --------------------------------PSAWKPAEPTPFGVAGGEGGSASAVSRA
A0A2V8Z2X8      --------------------------------PSAWRPSEPTPLGIVG--AGGVAGAHRI
A0A2V9C3F6      --------------------------------PPAWRPTDPTPLNYVG--ESEVAAASGV
A0A2V9QMU9      LSFALVLGLTTGVSLAF---------LLEGIDNTVRTPEQAQAISGLPSLGIIP------
A0A2V9QY75      LVFAFALGLSSGIGLAF---------LLEGLDNTVRTPEQAQAISGLPSLGMIP------
A0A2V9SVU9      LSFALALGLTTGVGLAF---------LLEGIDNTVRTPEQAQALSALPSLGLIP------
A0A2V8W5N5      --------------------------------LSVETPRTQVIAGIGLRAPAAETRA---
A0A2V8XG53      --------------------------------LSVETPRTQVIAGIGLRAPAAETRA---
A0A2V9XV04      --------------------------------DDIEVNRVPPSLGMPELGG---------
A0A2V9CBY1      REILSALTAEGAPPQEQ---------RTIRGPLEAEATPQESSVGGPVHNGKTASRIPEI
A0A2V9D656      --------------------------------LEAEATPQESGVGEPVHNGKAASRIPEI
A0A352EZH8      EEELFSASSILNRTEDT---------VT----SSAFTAHTAYATGGTALPAGQSSGA---
A0A0B6X033      SSQAREPQLFSAS---------------------AEHADVATAIGSALPENGWASRV---
A0A2V8R0I3      QEHPWSASPFTAM--PA---------AI----DSAPTAHTAEETGGPALPGGPASRD---
A0A2V8N1U8      HEHPWETAPTIGA--PA---------AI----DSASTAHTAEATGGPALPGGPASRD---
A0A2V8QL35      HDHPWERNAFTGM--PS---------AY----DSASTAHTAEAASGPALPAGTASRD---
A0A352FU10      HDHPWERNAFTGM--AS---------AY----DSASTAHTSEAASGPALPAGTASRD---
A0A2V8LCU0      HEHPWEKAPFTGM--PS---------AF----SSASTAHTAEATGGPALPGGPAFRD---
A0A1Q7NGT0      HVHPWERQSFTGM--PQ---------GY----DSASTAHTEEATGGPALPGGPASRD---
A0A2V8MLP9      HVHPWERRPFTGM--PA---------GI----DSASTAHTEEATGGPALPGGPASRD---
A0A2V8PQZ0      HVHPWERRPFTGM--PA---------GI----DSASTAHTEEATGGPALPGGPASRD---
A0A3B9MKY6      EEQLPSRSSFLSVSHET---------AQ----NSASSAHTADIPGGLALPGGKASRD---
A0A3D5SKZ1      EEQLPSRSSFLSVSHET---------AQ----NSASSAHTADIPGGLALPGGKASRD---
A0A2V8NRW2      VNGDEHPWDSSPLFSRA---------AH----ESASTAHTEERAGS-ALSGVTASRA---
A0A2V8TKR9      ------------------------------------------------------------
A0A2V8LBV1      ------------------------------------------------------------
A0A2V8GAF9      --------------------------MFALDCAGCRGGAGDGSARYVIPRHRGPAGLPPR
A0A2V8CN98      ----------------------------LIRGLLAELGTQRRGLASQLETGGRELQGIPQ
A0A1Q7LC46      --------------------------LEVLESDYREARQRETLLSEALDQAKVEANQMSE
A0A1Q8BDC5      --------------------------RNSLKSYYAPARIAYPQVLLEVCRSKNEPFECKE
A0A2V9Q1Y8      -----------------------------------AAVCVVIIWQPXXXEQKQQENKLNE
A0A2V8JXG1      -----------------------------LKADYERVVRDENALKAALAEAKAGAAQENQ
A0A350D2W9      --------------------------VKAAYSEYQAALKKENSLKDLFERQKDEAFRLNS
A0A2V9I4J1      --------------------------FQVYPWQLVVMNNGKDLTHLPWYPQELSVLSELR
A0A2V8PQZ9      --------------------------MGRIYDALKRAESAPRTPKPSVNRNGNPDN----
A0A2V8D8B1      --------------------------VESMKHDYQTALTQEQSLMHALDQQKADALALNR
A0A3B9LSB4      --------------------------LTNLETDYRQTLAREQALRKAFEQQRGETLSQNE
A0A2V9H7U2      --------------------------VERLRNDYVAARGREKLLAAAVAKEKVGVGALSQ
A0A2V8NJB5      ------------------------------------YTPANITFAGLFLELCRNNAKSFE
A0A2V9JMZ4      --------------------------FQVYPWQLVVMNNGKDLTHLPWYPQELSVLSELR
A0A2V9MDJ6      --------------------------FQVYPWQLVVMKNGKDLTHLPWYPQELSVLSELR
A0A2V8QJT6      --------------------------LKNLETKYRQAADREEALRKSFNQQKGETVTQNE
A0A2V8FSM8      --------------------------ATRIRKEYEGALRREKLLETAYAEKVHQLASKAE
A0A359M0J2      --------------------------VERLKNDYEAALKREQMLTSAYSRQASAVTGQAN
A0A2V8JLJ1      --------------------------IDQLDRDVSKLKQGREPLQARIAAYQNRLNPPAP
A0A5M8SND8      --------------------------MARIKSDYSSAVKHEELLQSAYRQQVSVVTDKHN
A0A2V9GAQ1      --------------------------LDVLESDYREAQQRESLLMQALDQQKTETNQMAE
A0A497EDQ8      --------------------------RLGMETRFDMVKRREQSLFENIQGLRNQTIELSK
G8NS05          --------------------------IAQAKQTFIAAQANEQQTRAALEDQKSEAYKLRD
A0A2V8KZ20      PEEKPRPFLSEFNLSLDTVPAEVQLQIDQLDRDVSKLKQGREPLQARIAAYQNRLNPPAP
A0A3D0NWU2      --------------------------LTALRAQLDAKRKEEAQAQAAYDREAALANIQGQ
A0A2V8EPD9      --------------------------VVPIAPVAPVAAAPAPAAPVALAAAAPVPAAAAA
A0A3N5NSX5      --------------------------VAAIRSEYQTARATELRLADALKQSQGAAMELNR
A0A2V8MUA1      --------------------------LEKLARDLKQRQEAEEEIVRKINQYRSRVNAPPE
A0A2V8MBH9      --------------------------LTNLETKYRQSLAREESLRKSFNQQKGETVTQNE
A0A3N5ZPQ7      --------------------------RRALENGFRIESFEPMSVHLGIPLKAR-------
A0A3N5P5F2      --------------------------VQAVEGEYVGAQAREESLTRELEAQKADVLAINR
A0A2V9G1P7      --------------------------ADRMVNDYSAAVRRENLVQQALDDQQKQVNLIAE
A0A2V9BCK9      --------------------------QRPVPTHLVDEVAREFELGSLEPTTQPTSTACPE
A0A2V9TMX2      --------------------------QQKMRDDYLAALQRENLLDSAFNKQKQEANKLNE
A0A2V8N2J7      --------------------------LEGIQQRIAAYQRDQENLSAQMDTYSRRLESTPQ
A0A3N6BI26      --------------------------INRVQSEYRVAVNRRQMLLGALNRQKAEANQLNQ
A0A2V9JMM3      --------------------------LEGIDQRLRSYAPEEKALQAEIASLRQRVASAPK
A0A2V9M815      --------------------------LEGIDQRLRSYAPEEKALQAEIASLRQRVASAPK
A0A2V9A795      --------------------------ADKITNEYFAALRREGLVKEALEGQQKQVNVIAE
A0A355ESH9      --------------------------RSNASSNYQAVLRQEQSLAAELETIKRQAIDQNS
A0A3D0NW85      --------------------------LKVLETQYRRAQEKENKIRSAFNVQFQEAQGQNA
A0A353CAT5      --------------------------IDVLETKYRRAKEKEDKIRAAFDVQVNEAQGQNA
A0A2V9HB55      --------------------------LAVLESDYREAQQRESLLTQALDEQKAETNHMAE
A0A2V8CU57      --------------------------VAAW----------------------SEPETVTA
A0A2V8BDI4      --------------------------VAAW----------------------SEPETVTA
A0A2V8F8T3      --------------------------VAAW----------------------SEPETVTA
A0A2V9J901      ------------------------------------------------------------
A0A2V8MKQ7      ------------------------------------------------------------
A0A3M1SNQ5      --------------------------ERKYQPESYAPTTFPLGDIKIGAPTSSEPEIASN
A0A2V8QJ59      ------------------------------------------------------------
A0A1Q7HTA7      ------------------------------------------------------------
A0A2W0B5E2      ------------------------------------------------------------
A0A2V8NMG8      ------------------------------------------------------------
A0A2V8TBM7      ------------------------------------------------------------
A0A1Q7HEZ8      ------------------------------------------------------------
A0A1Q7JW36      ------------------------------------------------------------
A0A1Q7MUR4      ------------------------------------------------------------
A0A3N5PFU4      ------------------------------------------------------------
A0A4R1LDF1      --------------------------GGASDLL---------------------------
A0A1F2T1R8      ------------------------------------------------------------
A0A2V9BW09      ------------------------------------------------------------
A0A3M1SSE1      --------------------------VLVVIPSMNAAQK---------------------
A0A2V9GQV7      ------------------------------------------------------------
A0A2V7YV88      ------------------------------------------------------------
A0A2V8YCY6      --------------------------L---------------------------------
A0A2V8EGM3      --------------------------A---------------------------------
A0A2V8FGH1      --------------------------VEVPPDDMFVSPWNFAGPPEPVAQGPVRDGALDE
A0A2V8D468      -----------------------------------------IPFSPNKTLTLELTFVVGL
A0A1F2R977      --------------------------AESAESRATSFGDSSLDHYPAEHHSVPWTGEGRE
A0A2U3LF12      ------------------------------------------------------------
A0A3N5G7M6      ------------------------------------------------------------
A0A1F2S3Q7      ------------------------------------------------------------
A0A2V8GVG4      ------------------------------------------------------------
A0A143PNR5      --------------------------DFEADAPWEFAEGTSARARSGRPDARPETPNALI
A0A2V8PJQ0      --------------------------LIP-------------------------------
A0A2V8H566      -----------------------------------------MSPEDRSTALEAVVRDGRI
A0A3N5YKY1      --------------------------PAAAFPGAAGPTAAPASPAAAPASFPGNGGHQPL
A0A2V8UVN4      --------------------------VLTDGGSQLGGVKVVDKILRETTGERRPADASDG
A0A321LXF5      --------------------------VDLQEHISRLREGLETHSRPSSSQVRQVLAPLED
A0A5M8SBZ0      --------------------------PANVTLPPFNTSALLQPQALGMPSMVESEKTH--
A0A1Q7JFB1      ------------------------------------------------------------
A0A2V8DMJ9      --------------------------QSSPGAWKRTDRSADGARTSMMRAQGRMLTDVES
A0A2V8GGF6      --------------------------VALHRERQRAHRPADGAWTGVMASEGRALTDPGE
A0A2V8HKU7      --------------------------VALHRERQRAHRPADGAWTGVMTSEGRALTDPGE
A0A1Q6Y875      ------------------------------------------------------------
A0A523DJA9      --------------------------TPNARRDWRT-----AVAIGLLFAVGLLFVVEYL
A0A2V8I604      --------------------------PLGSETSAAA-----ALAAPAPMARPIVEPPAPP
A0A2V8J066      --------------------------SIGTDAPVGTPPSPVAAPPPTPVHRPIVE---PT
A0A1I6MMC5      -----------------------------------------EVSQATTVPLPVRERDYAE
A0A2V9D5W7      --------------------------D-SLFQL--------DSTRPIESESKDAPPS---
A0A2V9D4I4      --------------------------EIAPFPF--------DAEPAPERELKTVASASAN
A0A2V9D6L7      --------------------------DFAPLPF--------DVELAPER--KSVAPASVI
A0A2V8ZJV2      --------------------------GSEASSA--------D--VRSELEL-LRRGPECT
A0A2V9AWB5      --------------------------DVDPREG--------DGEVRSEPESPLTQGIDLL
A0A2V8Z1Y8      --------------------------TELESAE--------V--LGEIRRS-VPGPLETE
A0A1Q8AX10      --------------------------NEAKPSD--------S--LLAEGAH-RDGGEWSA
A0A2V9A773      --------------------------ADPTPL-----------------GF-GDDGIAVA
A0A2V9AND3      --------------------------AEPTPL-----------------RF-G--GERLA
A0A2V9BTJ7      --------------------------GTAPSFL--------E--VA-DVPR-TAVPLREL
A0A2V8W2M7      --------------------------GESLNLA--------A--IAGSMQA-PAVPARQV
A0A2V8XNW2      --------------------------GESLNLA--------A--IAGSMQA-PAVPARQV
A0A1Q7CJC1      ------------------------------------------------------------
A0A2V9UEM7      --------------------------QLEPALEQPELQ---PVGMPEHAHMQTAVMP---
A0A1Q7V300      --------------------------------E-SIPQ---MVADQVVLEAIASSEN---
A0A2V9ZCI3      --------------------------QIDSSHV-GEM----PVMDPASVATGVAAAP---
A0A2V9WCB3      --------------------------AVPPPMA-AMP----MSEQPVFADTPPVPAMP--
A0A2V9VQW5      --------------------------RTDG--T-PVMD---LPATESVPAMPETAQASKA
A0A2V9WTP3      --------------------------PVPSNFS-GAES---PVTEPRVIDADTAARVAAV
A0A2V9NLA9      --------------------------HIEPPLA-SAPE---VVPDP--ISMPVAAVPPLA
A0A2V9RKJ9      --------------------------HIEPPLA-SAPE---VVPDP--VSMPVAAVPPLA
A0A2V9RN95      ------------------------------------------------------------
A0A2V9N406      --------------------------NIEP--A-SISE---MVNES--AATAVAPAV---
A0A2V9U6D9      --------------------------SIEP--A-PIAE---MVNDP--AATAVAPAV---
A0A2V8DZN4      ------------------------------------------------------------
A0A2G6HQA4      --------------------------KKRKNSLPGKKRRSVTSFNPPPVHDREPEKREDS
A0A2V7ZTY7      --------------------------PTVSGGQGSRDCA---TGGQRPPDRTSAGQRPPD
A0A2V7ZVL9      --------------------------PTVSGGQGSRDCA---TGGKRPPDRTSAGQRPPD
A0A1Q7QYI4      --------------------------EADPKAERMSRAL------------AALADTPPP
A0A2V8G9Y9      --------------------------TSDSRVLSQPAG-------------EPLTRVPDT
A0A143PXU3      --------------------------D--------ADIDMPWQFADSPAAPPRASHPPEQ
A0A2V8D8G9      --------------------------TGTNQSRGSSSLN------------QYPNEEPDR
A0A2V8ESQ4      --------------------------TGTNQSRGSSSLN------------QYPNEEPDR
A0A1E3Y5Q0      -----------------------------------PTVGWPAAPAPVEAFSSEGAERPRP
A0A2W4TWK5      --------------------------AQPAVPVELPTEAFPAEPGQR----PEPSERPVR
A0A3N5NYV3      --------------------------QQEPIKREKPPTSHPKLA--V----AEATAKLES
A0A2V2RJF9      ---------------------------------------------------------DSD
A0A2G6HNT3      -----------------------MEKFSKIMEKAGVETSYKLHNKEKESFRPKKRVQPKP
A0A2V7YWD4      ---------------------------------------------------------MDV
A0A2V2R8T6      ------------------------------------------------------------
A0A1Q7RGF1      --------------MSKYFDQTFKTRDAGTDPEKLQITGIDKFLETGSSFKNSAPGMGAS
A0A2V9BLX2      --------------MSKYFDQTFKTRDAGTDPEKLQITGIDKFLETGSSFKNSAPGMGAS
A0A2V9ZA03      -------------------------------------------MMKDLGLTRNAAASPRM
A0A3N5ZNH4      --------------------------------------------------------MPSL
A0A2V8GEZ2      -------------------------------------------------MHDFASSVEQP
A0A3N5ZFD3      ------------------------------------------------MAEALSASPAEP
G8NXD3          --------------------------MITLNLREYQTIEPHLMIASASNGDAGSPHKHQN
A0A2V9VR38      ----------------------------------------------------MFGHDPAR
A0A2V9EY04      --------------MSKFFNETQKANQWAQSKLPEPDRDVREMLESIKQGSILETATANA
A0A2V9HAK9      --------------------------------------------ESLKQGPPINAPPAEA
A0A1Q7FS15      --------------MSKFFNETQKANQWTQQKLANQDMDVKEMLESLKQGPASGTQLADA
A0A1Q7K9P1      --------------MSKFFNETQKANQWTQQKLANQDMDVKEMLESLKQGPASGTQLADA
A0A1Q7N989      --------------MSKFFNETQKANQWTQQKLANQDMDVKEMLESLKQGPASGTQLADA
A0A2V9G7Y0      --------------MSKFFNETQKAHQWAQQKLVNQDLDVRQILASLKQGPANDAPPAGA
A0A2V8T7Z1      -----------------------------------------------------MMSRPSI
A0A2V7U8G5      ---------------------------MPMARSR-GPRPVSLD--FELHRLSTPPTSG--
A0A2V7UNP9      -------------------------------MRT-NSRPVSMSQYLELERRSPGDARGEP
A0A2V7VLD7      -------------------------------MRT-NSRPVSMSQYLELERRSPGDARGEP
A0A2V7XGA3      ---------------------------MTTPTTLGDPASLSAVRTSEPSPRAQAETAR--
A0A2V7YAG6      --------------MAWLPPWRQAGPDMSMPTTL-DPAPMGAARAPEDSRRSNGGTGT--
A0A2V7VK33      -----------------------------MLSISPTRDPEAPPSAPTRGRGSNEPPRTAP
A0A3M1VTE1      ------------------------------------MTAGGSGRGADRGSPTRYAIGAGV
A0A2V7TTM7      -----------------------------MYRVGNPLLKSRSLVPASEDDDVTREAPAGR
A0A2V8VI82      -----------------------------MREAETGSGAGTQPDAGQPTRTVRSAPSHGP
A0A2V7U4P9      -----------------------------MSIKPPEEMLSSAVPAGEKGGPVSETPRRGP
A0A2V7TQY5      ---------------------------------------MRARRGRGPPGARRRHRRIEA
A0A2V7TU87      ------------------------------------------------------------
A0A2V8SEH0      --------------------------------------MNATLTPRQPEGSAHAARRAGP
A0A2V8VU54      ---------------------------------------MSGYIDAKPDGSVDLMGRSRT
A0A1Q7RML7      ---------------------------------------MSAFSGGDRDHTSDRSERACP
A0A1Q7ZIQ5      ---------------------------------------MSAFSGGDRDHTSDRSERACP
A0A2V8TKD8      ---------------------------------------MSAFSGGDRDHTSDRSERACP
                                                                            

A0A1F2U8T6      KALESVRNEYERALIEERTLAAHLEEAKRDAQDLSRKSVGYNVLEREAKSHRTVYESLLQ
A0A2V8BV42      RALQSVKNDFETAVLEERVLAQNLDAAKGDAQDLSRKSVGYNVMERESKSNRLVYESLLQ
A0A2V8F916      RALQSVKNDFETAVLEERVLAQNLDAAKGDAQDLSRKSVGYNVMERESKSNRLVYESLLQ
A0A1Q7K833      RAASAIKNEYETAQLEEQAYSRGLDSAKADAQDLSKKSVDYNVMEREAKTNRDIFQALMT
A0A1Q8AMY4      RAASAIKNEYETAQLEEQAYSRGLDSAKADAQDLSKKSVDYNVMEREAKTNRDIFQALMT
A0A2V8BM40      RAAQAIKNDYETAVLEEQTFSRGLDSAKSAAQDLSRKSVDYNVMERDAKTNREIYSTLLT
A0A2V8CRT6      RAAQAIKNDYETAVLEEQTFSRGLDSAKSAAQDLSRKSVDYNVMERDAKTNREIYSTLLT
A0A1F2VH76      KAIQTAKSEYEAAVVQERTLTQALNEQKAAATDLSRKGVDYTLILREAESNREIYNSLLT
A0A1F2R0X5      RAVQSVRNEFETSVLEERTLSQNLEAAKVEASDLNRKGIGYGVMEREAQSNRQVYEALLQ
A0A2V8B278      RARASIKNDYESALIEEQTMARGLENAKADMQDLSKKSVDYNVMQRDSQTNRQIYDALLT
A0A2V8CEF9      RARASIKNDYESALIEEQTMARGLENAKADMQDLSKKSVDYNVMQRDSQTNRQIYDALLT
A0A2V8KZG2      ------------------------------------------------------------
A0A1Q7LG57      GLAGQIAG-RLHSHRPTRTLTS--------------------DTAPDSSANW--------
A0A2V8YMQ4      -----------------------------------------MAMGQAFAGCWIIQ-----
A0A1Q7L5B1      NRRVPTSEERAAAVSDFLGLND--------------------LWQRCRKPGWTLD-----
A0A2V9DKV4      GRRNQT----------ILGLND--------------------LWQRCRKPGWTLD-----
A0A2V8W380      ANGNHLGIHRFLPRDKSLVLAGN-------------------GSGKNSRS-WH-------
A0A2V8ZIV5      LNGDRSSVRKLLDSASTLRSSQN-------------------GTASTPGAYWH-------
A0A2V9EVA0      SPRPSLTSFAPGLNA---------------------------LRQRCAKPAWKLH-----
A0A1Q7RB73      -------------------------------------------MERCSQSLWNPA-----
A0A2V9K0H7      ------------------------------------------LMERCSQSLWNPD-----
A0A3N5YN96      FPGAAGPTAAPASPATAPASFPGNGGHQPLPIVVPNPVLAGGRRARSVT-----------
A0A1Q7Y646      ASRAAGATLDAAGSARAIEFVS--------------------RQISTAR-----------
A0A2V8QZU0      ASRAAGATLGADGSARTPEFVT--------------------LDISAAR-----------
A0A2V8RSQ9      AARVAGATVDAVGSTRDATYTS--------------------IEVVTSR-----------
A0A2V9LS17      IEPAALS--ELEEPGSDLTLEV--------------------LESQVRRFKWNPN-----
A0A2V9AGR3      F--APTTGIRDVMAPP--SFEV--------------------LASRCVHLNWRLD-----
A0A2V9G0N7      ---APKNGSGNAVKQPCVRFEQ--------------------LLKRCAHPKWTLD-----
A0A2V9GQ44      ---APKNGSGNAVKQPCVRFEQ--------------------LLKRCAHPKWTLD-----
A0A2V9HRN3      ---APKNGTSTAVKQPCVRFEQ--------------------LLKRCAHPKWTLD-----
A0A2V8WG13      AVRSARVSEGSSF----LDFDD--------------------LLRRCAHPNWHLD-----
A0A2V8X987      AE-QPRATIGGGHTGS-MRYEE--------------------IVRRCSRPDWRLD-----
A0A1Q7KX94      TA-APRVPTGDNQDVP-FHYEE--------------------LIKRCAQVEWRLD-----
A0A2V8XHT0      TA-APRVPTGDNQDVP-FHYEE--------------------LIKRCAQVEWRLD-----
A0A2V9L2P7      ---------IVPDVSSSVTRSG--------------------LFAKRSEVKAKKA-----
A0A2V7UMX0      HGPQALGSREPAGRERSTDPAV--------------------PQARVAEIPWKK------
A0A136K497      GAKPNADTLTRSARRPLPDCVS--------------------WTVDAER-----------
A0A399W9E4      GAKPNADTLTRSHRRPLPDCVS--------------------WTVDAER-----------
A0A2V7X0V9      ---------MMPAFGSPFSVDT--------------------MLARCPQMEWKPD-----
A0A2V9X518      ---------AGPAFSNAFTFDT--------------------LLARCAQSEWNPD-----
A0A2V9VC62      ---------KVPSFATSFTFDT--------------------LLARSAQADWKPD-----
A0A2V9S1P8      ---------SIPSFGSPYTLDT--------------------LLARCPQGRWSPD-----
A0A2V9RTW2      -----------PSFAAPFTFDT--------------------LLARASQHDWTPD-----
A0A2V9TGF1      -----------PSFAAPFTLDT--------------------LLARASQHDWTPD-----
A0A2V9XEV6      ---------AGPAFSNAFTFDT--------------------LLARCAQSEWNPD-----
A0A2V9Y3Q6      -----------PPFSNPFTFDT--------------------LLARCAQTNWSPD-----
A0A2V9R269      -----------GIPGMATGMEA--------------------LMTRSRETRWSPD-----
A0A2V9PTS3      -----------ARFASGGIAES--------------------LLARSRQTAWNPD-----
A0A2V9NPF4      -----------ARFASGGIAES--------------------LLARSRQTAWNPD-----
A0A2V9PNZ0      -----------ARFASGGIAES--------------------LAARSRQTAWNPD-----
A0A321LMC5      ASNLRVGEFARNNQGFVEPRQS--------------------FSIHDLR-----------
A0A2V8X713      LYPQMPG--GAPTPEFCLGLEE--------------------LRGRCAKPGWKMN-----
A0A2V8ZLE9      SPTPTPK--GIPTVGRGLRLEE--------------------LRQRCIKPGWELN-----
A0A2V8Y4D3      LYSPKWG--EIPAPGRRLRLEE--------------------LRQRSSKPGWKLN-----
A0A2V8Z2X8      LSSPIRA--EMPMAGRCLGLEE--------------------LRHRCIKPGWKLN-----
A0A2V9C3F6      LHSPRRG--EMPATGRCLRLEE--------------------LRQRCIKPGWRLN-----
A0A2V9QMU9      -DGSKLS--IESSAR-----RR--------------------LSLTSSR-----------
A0A2V9QY75      -LGSKIG--AEAGAK-----QG--------------------LVVASSK-----------
A0A2V9SVU9      -LGLKAG--VEMSMK-----QR--------------------LSVASSK-----------
A0A2V8W5N5      -RTETIP--APSRSAPELRFDS--------------------LVAHCTRREWQPE-----
A0A2V8XG53      -RTETIP--APPRSAPELRFDS--------------------LVAHCTRREWQPE-----
A0A2V9XV04      ----------------PSSLEM--------------------LLGRCPQPGWNPD-----
A0A2V9CBY1      LSAVTAE--VAPPAR-SLQLEE--------------------LQQRCAKPGWKPQ-----
A0A2V9D656      LSAVRPE--GAPPAR-LLQLEE--------------------LQQRCAKPVWKPQ-----
A0A352EZH8      -VGATLD--AARPAR-VSGLVS--------------------YDVDATR-----------
A0A0B6X033      -AGATVD--AERSAR-VASFPA--------------------LDVSAAR-----------
A0A2V8R0I3      -AGATLG--AVGSAR-AARFRS--------------------RDILAAR-----------
A0A2V8N1U8      -AGATLG--AVSSTR-AAEFQS--------------------QDISAAR-----------
A0A2V8QL35      -AGATLG--AVGSAR-AIEFSS--------------------REVSAAR-----------
A0A352FU10      -AGATLG--AVGSAR-AVEFSS--------------------REISTAR-----------
A0A2V8LCU0      -AGATLG--AVGSAR-AAEFSS--------------------REISAAR-----------
A0A1Q7NGT0      -AGATLG--AVGSAR-AAEFSS--------------------REVLAAR-----------
A0A2V8MLP9      -AGATLG--AVGSAR-AAEFSS--------------------REVLVAR-----------
A0A2V8PQZ0      -AGATLG--AVGSAR-AAEFSS--------------------REVLVAR-----------
A0A3B9MKY6      -AGATLG--AAGAAR-VDGFAT--------------------YDISPAR-----------
A0A3D5SKZ1      -AGATLG--AAGAAR-VDGFAT--------------------YDISPAR-----------
A0A2V8NRW2      -AGATLD--AAGTARALPEFMS--------------------LDISAAR-----------
A0A2V8TKR9      ------------------------------------------------------------
A0A2V8LBV1      --------MKREVETSRQLYEAMMQKV-------------KEYSIA---SAITANNV-RV
A0A2V8GAF9      PD----DAVQHSAAYDRGAHATSVASN-------------RVDGGVGHDRLGLDCRWRSP
A0A2V8CN98      RA-IEDARLRRDVSIAENLFTSVQQRY-------------SEARLA---EASSIADV-RV
A0A1Q7LC46      KL-VEYNILKREAEANKALYEGLMTKM-------------KETAIS---AGLRSSNI-RI
A0A1Q8BDC5      GT---RIVLSNGTDLSVFPW--------------------YPEELSLLSEIKVPSTVQEL
A0A2V9Q1Y8      SA-IEFSLLKRDFETNRTLYEGLLQKL-------------KEAGVT---AGLRSNNI-RQ
A0A2V8JXG1      RA-IQYSLLKQDVDTAKSLYTEFLQKT-------------NQAYLE---VAQQQSNI-RV
A0A350D2W9      NA-ILYNGLKIEIENKKSLLESLLKRQ-------------SETGVSARLRGLRTSNI-RV
A0A2V9I4J1      RS-RTLQDLATATGLEYVRLTKILDVF-------------RKLQVV------------DI
A0A2V8PQZ9      ---IAYFVPKHVHPWERQSFTGMPQGY-------------DSASTA------------HT
A0A2V8D8B1      KG-IGYGALQRDAASNRQIFEALMQRT-------------KETGIS---GALKTSNI-RV
A0A3B9LSB4      AA-INYRIIQQEIDTNKTLLDSLLQRS-------------KENDVI---MASKPNNI-SI
A0A2V9H7U2      LL-IQHNLLKREFDTNQQLYDSLLQRL-------------KDATVS---AGLRATNI-HL
A0A2V8NJB5      ASGTRTVVLRSGQDLSELPW--------------------YPEELGVLRELTHPTTVAGL
A0A2V9JMZ4      RS-RTLQDLATATGLEYVRLTKILDVF-------------RKLQVV------------DI
A0A2V9MDJ6      RS-RTLQDLATATGLEYVRLTKILDVF-------------RKLQVV------------DI
A0A2V8QJT6      AA-INYRILQQEIETNKGLLDNLLQRS-------------KENDVV---LAGRPNNI-SV
A0A2V8FSM8      ET-AHYNLLKRDVDGTRKMYESLTQRL-------------KEASMA---SALRANNV-RV
A0A359M0J2      VA-AEYGTLKREVDILRQSFNALLQQS-------------NQVSIG---SAIPVSSV-RV
A0A2V8JLJ1      VA-EELARLTRNYDEARQHYNVLAEKR-------------SNSKMAATADSSDNNEMFKV
A0A5M8SND8      KA-IQYGIFKHQVDSDEKLYESMLEQV-------------NRASVA---SAAGSSNI-QI
A0A2V9GAQ1      KL-VEYNILKREAEANKTLYDGLMTKL-------------KETAIS---QGLRSSNI-RV
A0A497EDQ8      TS-LEYDRLEETYLQNRRFLDDMLARS-------------NEADLS---ATAWMNNI-RV
G8NS05          DL-VQYTLLQRDFESNRTLYEGLLEKL-------------QTARVQ---AGLDSTEI-DI
A0A2V8KZ20      VA-EELARLTRNYDEARQHYNVLAEKR-------------SNSKMAATADSSDNNEMFKV
A0A3D0NWU2      AQ-TRLTTLKRDIETKRNLLDTYTQRL-------------KEQELAIANSTPDNIKM---
A0A2V8EPD9      PV--------------------------------------ARVAPAVHVAVPPAAKPTAP
A0A3N5NSX5      KN-VGYTVLEREAQSNRGIYEALLQRQ-------------NELQIV---SNSGGNNV-RL
A0A2V8MUA1      VL-DELAGLQRQRQVANQRYELLSGKK-------------FSSDLAGRVDTDINNQTFKV
A0A2V8MBH9      AA-INYRILQQEIETNKGLLDNLLQRS-------------KENDVV---LAGRPNNI-SI
A0A3N5ZPQ7      ---LDVLLLDLARTAANTFEPGLYEKIGLIAEHTFATLPWQPAELAVLDCLLQPKNLEEL
A0A3N5P5F2      KS-IGYAALERDAASNRQIFEALLQRA-------------KETGIS---SELKTNNI-RI
A0A2V9G1P7      KS-VQYNILKREVDTNKQLYEGLLLQL-------------KEAGVS---ASLKASNI-RL
A0A2V9BCK9      NTLAAESPLEDFIGSIGAVPSARLDHC-------------GTQGRE------RMSRIHEA
A0A2V9TMX2      SATIEYTVLKRDAETNRQLYQDLLQRL-------------KEAGVS---AGLRSSNI-RI
A0A2V8N2J7      HE-KVIDDMERELKVGEMQFHALLDKQ-------------LDTKLAKGFEQSEGGIAFAV
A0A3N6BI26      DS-IQYNILQREVDTNRQLYEGLLQRL-------------KETGIS---AGMRASNI-HV
A0A2V9JMM3      HE-RALAEMTREQALTRSQYQGLLEKQ-------------NEMKMAERLRQKGQSLVFKV
A0A2V9M815      HE-RALAEMTREQALTRSQYQGLLEKQ-------------NEMKMAERLRQKGQSLVFKV
A0A2V9A795      KA-VQYNILKREVETNKQLYEGLLQRL-------------KEAGVS---ASLKASNI-RI
A0A355ESH9      SA-VQFTNLKVEIQTRRELLDELLRRQ-------------SETEVAVRLQDTRESNV-RI
A0A3D0NW85      GA-VMIKLLQQNIETNKGFLDNLRKQQ-------------SSNDIA---SQGSDNNI-RV
A0A353CAT5      GA-VMLKLLQQSIETNKGFLDNLRKQQ-------------SSNDIA---TQGTDNNI-RV
A0A2V9HB55      KL-VEYNILKREAEANKTLYEGLMTKL-------------KETAIS---QGLRSSNI-RV
A0A2V8CU57      PL-AVAAWSEPESAAAPPVVAGWSEPE-------------TVTA--------PFAVA-GW
A0A2V8BDI4      PL-AVAAWSEPESAAAPPVVAGWSEPE-------------TVTA--------PFAVA-GW
A0A2V8F8T3      PL-AVAAWSEPESAAAPPVVAGWSEPE-------------TVTA--------PFAVA-GW
A0A2V9J901      ------------------------------------------------------------
A0A2V8MKQ7      ------------------------------------------------------------
A0A3M1SNQ5      DS-PITF-------------------T-------------QAETLVFPRVEIDPEIV---
A0A2V8QJ59      ------------------------------------------------------------
A0A1Q7HTA7      ------------------------------------------------------------
A0A2W0B5E2      ------------------------------------------------------------
A0A2V8NMG8      ------------------------------------------------------------
A0A2V8TBM7      ------------------------------------------------------------
A0A1Q7HEZ8      ------------------------------------------------------------
A0A1Q7JW36      ------------------------------------------------------------
A0A1Q7MUR4      ------------------------------------------------------------
A0A3N5PFU4      ------------------------------------------------------MNT---
A0A4R1LDF1      --------------------------Y-------------QPRHNHNLADVQSDIIL---
A0A1F2T1R8      ------------------------------------------------------------
A0A2V9BW09      ------SLALRGNEQLGPQLPASPGKH-------------PVGFEDVKRVRWPMDSE---
A0A3M1SSE1      --------------------------R-------------RLLLVESSDNEPASKNR---
A0A2V9GQV7      ------------------------------------------------------NGN---
A0A2V7YV88      --------------------------R-------------LGLMTLAHIGFAPAGKG---
A0A2V8YCY6      ------------------------------------------------------------
A0A2V8EGM3      ------------------------------------------------------------
A0A2V8FGH1      PS-STGLHVIWPSLLARFKNEWRDRLA-------------IGID----------------
A0A2V8D468      MF-AVGLALFVEYLDDRIKTPDEIWMH-------------LGLKTLGLVPRVTPELV---
A0A1F2R977      GN-VEPPAPVR---------------P-------------EPAGRRVQLGPFDPSIA---
A0A2U3LF12      ----------------------MRPET-------------PKLKDDGITPEERRHFQ---
A0A3N5G7M6      --------------------------------------------------------S---
A0A1F2S3Q7      --------------------------------------------------MHSMATR---
A0A2V8GVG4      --------------------------------------------------MAKKAQL---
A0A143PNR5      PE-ESGVPDEVTLPP-----------A-------------SSATGAIPEGGLFVSLD---
A0A2V8PJQ0      --------------------------A-------------ARSEKRLREGEAPTAGA---
A0A2V8H566      AA-VTSPFVRVEPPPGSARFRHAGAGA-------------AGRLREKLVVARN-------
A0A3N5YKY1      PI-VVPNPVLAGGRRARSVT------L-------------HPLLAAALE-----------
A0A2V8UVN4      AA-EDLPAAATAIDVAGLESARRAA-A-------------ETVEAVPGIRTVALHLS---
A0A321LXF5      AN-NIASQV-----------------V-------------AARLENCRSIRLPRDNE---
A0A5M8SBZ0      --------------------------S-------------DNAFSRVSRPDWQAANG---
A0A1Q7JFB1      ------------------------------------------------------------
A0A2V8DMJ9      LI-EAP--------------HGLGLSQ-------------RPALCDVTADRARISEK---
A0A2V8GGF6      IP-AAPPMERDAVLFSRAFRHGSG--------------------------REAIDEE---
A0A2V8HKU7      IP-AAPPMERDAVLFSRAFRHGSG--------------------------REAIDEE---
A0A1Q6Y875      ------------------------------------------MRQRCAKPAWKLHKD---
A0A523DJA9      DD-TIKTPDDVGRRLHLPMLG-----L-------------VPVGPGAHPPVLPAEVS---
A0A2V8I604      PP-IEPPAAPGWSAAAAVAPP-----V-------------VQIDRRLAAAL---------
A0A2V8J066      PI-AERREARARLAEQASPHR-----E-------------VNLDRHLVAAL---------
A0A1I6MMC5      LS-AGPGWPDVDVVASSVLNG-----L-------------PSDPAKIAVKRWKPLLH---
A0A2V9D5W7      GI-GSPRRVNILAPAATDPLE-----L-------------DDLRKRCSYPEWSFDPA---
A0A2V9D4I4      GA-VTETQISTSAAPSPEPLR-----F-------------EDLQRQCTRSEWRPDPR---
A0A2V9D6L7      GC-V--TPVSTSASTSAEPLE-----F-------------DDLQRRCTRPRWRPEPN---
A0A2V8ZJV2      GP-AVSARGTTSGNEN-TLLC-----F-------------EELGKRCVKLEWQIDPH---
A0A2V9AWB5      PP-VPSTRTEAVDSSTIASFS-----F-------------EELNKRCARKEWRLDPL---
A0A2V8Z1Y8      VP-RPQAPPRIAGSREPAPSC-----F-------------GELVKRCAHPEWWPYRG---
A0A1Q8AX10      LG-MVSPVGPGIESPNSHHLR-----L-------------DELRRRCATPGWKLNPD---
A0A2V9A773      AG-AMQSPRREEMPTAGRCLR-----L-------------EELRQRCIKPGWKLSPD---
A0A2V9AND3      PG-VLQPSLQQEMPTARRCLG-----L-------------EELRRRCLKPGWKLNAD---
A0A2V9BTJ7      DE-PTS--PERSPAKGGSFLR-----Y-------------EDLIKGCARPIWKTDAR---
A0A2V8W2M7      AE-QPARVTPPPPSEAGAFLR-----F-------------DDLVKRCAHPTWKPDMR---
A0A2V8XNW2      AE-QPARVTPPPPSEAGAFLR-----F-------------DDLVKRCAHPTWKPDMR---
A0A1Q7CJC1      -------------------------------------------------------MR---
A0A2V9UEM7      -------------PIQGSSFS-----Y-------------ESLLARCPVSNWNPDTR---
A0A1Q7V300      ---VVPARSAISASAAVAATT-----S-------------DILVARSRRTEWRPNPK---
A0A2V9ZCI3      ---------GPATPAFSSQFT-----F-------------DTLLARCVSVNWHPDEK---
A0A2V9WCB3      ------ASMGLGMPTFGGGLN-----M-------------DTLLARCPRTEWTPDPG---
A0A2V9VQW5      AA-PGTPGNGQGTPSFTTSFT-----F-------------DTLLARCAQGEWKPDEK---
A0A2V9WTP3      AP-AVSAHASPGLPPFGSPFS-----L-------------ETMLARCAAVQWSPDPK---
A0A2V9NLA9      DE-RDRRTVSAAMPSFGTGLS-----V-------------ESLLSRCVAGHWTPDRK---
A0A2V9RKJ9      DE-RDRRTVSAAMPSFGTGLS-----V-------------ESLLSRCVAGHWTPDRK---
A0A2V9RN95      ------------MPSFASPFT-----F-------------DALLARSAQARWSPDSK---
A0A2V9N406      ---EHTPSAVSAVPSFSSPFT-----F-------------DTLLASCAQARWSPDSK---
A0A2V9U6D9      ---EHTPSAVSAMPSFSSPFT-----F-------------DTLLARCAQARWSPDSK---
A0A2V8DZN4      --------------------------A-------------APGLSVAHRVEL--------
A0A2G6HQA4      LP-GKKRRPEPSFSTRRNSSPVHQRKP-------------EKTIEEDWEERF--------
A0A2V7ZTY7      SA-KAKRVEQALAAITAPAPDAAP--A-------------RVTPDGVVAERL--------
A0A2V7ZVL9      SA-KAKRVEQALAAIMAPAPDAAP--A-------------RVTPDGVVAERL--------
A0A1Q7QYI4      VS-TASSPTN---------VRTAG--F-------------Y-------AEKL--------
A0A2V8G9Y9      LS-VQRADQDWVAELEIQKHRTLG--V-------------FHGFGANAVDKL--------
A0A143PXU3      RP-TSAPARVPEVARVDVKPLPEQ--V-------------QRSVDDVPTARL--------
A0A2V8D8G9      HP-LEEPASPDSFESAQPFRP--A--S-------------TSRRTATRRAKLPNSAD---
A0A2V8ESQ4      HP-LEEPASPDSFESAQPFRP--A--S-------------TSRRTATRRAKLPNSAD---
A0A1E3Y5Q0      RP-VTTVPEILPSRPPASGAPSSP--V-------------GERIAADLANKI--------
A0A2W4TWK5      HA-RPAMDAPVVDDEPEPALP--P--L-------------EGRIAPALERKV--------
A0A3N5NYV3      AV-QAEAASVATEAESEATAP--R--V-------------TSSVTSLIAEKL--------
A0A2V2RJF9      SDNGSSRQKHLAKQENPPASPT--------------------------------------
A0A2G6HNT3      VASVAREKKRPRPVHHPELKES--------------------------------------
A0A2V7YWD4      VRTKSMTATLVTDSEAATDRED--------------------------------------
A0A2V2R8T6      ----AGAARAGGFVSFEISPAR--------------------------------------
A0A1Q7RGF1      ----GDLGESRLGQCRKMKIPA--------------------------------------
A0A2V9BLX2      ----GDLGESRLGQCRKMKIPA--------------------------------------
A0A2V9ZA03      LHDLDSDLAVSNEPPGIEVEVP--------------------------------------
A0A3N5ZNH4      GVIPTIAKPGRTQKFLAAKNSE--------------------------------------
A0A2V8GEZ2      FRIAPVDRGNG-------------------------------------------------
A0A3N5ZFD3      RSAAAQPRATGPMAVFHGFDPS--------------------------------------
G8NXD3          AVVDRPASDQSDAINWLNMVPK--------------------------------------
A0A2V9VR38      FQVSPRGAQSQTVGDRYLQGSR--------------------------------------
A0A2V9EY04      QLPQCQQVQVGNGNATHLVLRQ--------------------------------------
A0A2V9HAK9      RLARSRQVTLGNGNATRLVLRQ--------------------------------------
A0A1Q7FS15      RLNECRQVHVGNGNGARLVLHQ--------------------------------------
A0A1Q7K9P1      RLNECRQVHVGNGNGARLVLHQ--------------------------------------
A0A1Q7N989      RLNECRQVHVGNGNGARLVLHQ--------------------------------------
A0A2V9G7Y0      RLAHCRHVALGNGNAARLLLRQ--------------------------------------
A0A2V8T7Z1      EAERSVVSHPAARATAPAPPQK--------------------------------------
A0A2V7U8G5      ---------------EVVPALE--------------------------------------
A0A2V7UNP9      LIADSAESRPGRDSREAAPVPE--------------------------------------
A0A2V7VLD7      LIADSAESRPGRDSREAAPVPE--------------------------------------
A0A2V7XGA3      -------------TARAAILTE--------------------------------------
A0A2V7YAG6      -------------TVGGAVSRD--------------------------------------
A0A2V7VK33      ---------------------L--------------------------------------
A0A3M1VTE1      --------GARPRRPRPRITLA--------------------------------------
A0A2V7TTM7      --PRPSVGPSPENSKIAAAALR--------------------------------------
A0A2V8VI82      -------------------AGP--------------------------------------
A0A2V7U4P9      -------------GGGSAVRST--------------------------------------
A0A2V7TQY5      PGRRQLPAGRRAGGRWVVTAPR--------------------------------------
A0A2V7TU87      ----------MSRHR----MAT--------------------------------------
A0A2V8SEH0      RRPEAAAPAARPIGS----SGA--------------------------------------
A0A2V8VU54      ---------ATETQG----VRG--------------------------------------
A0A1Q7RML7      ---------APSAGG----LRG--------------------------------------
A0A1Q7ZIQ5      ---------APSAGG----LRG--------------------------------------
A0A2V8TKD8      ---------AQSAGG----LRG--------------------------------------
                                                                            

A0A1F2U8T6      RTNELRVSSNSRANNVRLVERGEVPGSPVTPSGRRTWGLSVVVGLFAAIAVAYGLDYMND
A0A2V8BV42      REKELRVSSNSRQNNVRIVDKAEVPQSPMTAGGRRTWMMSSLVGLVLAIGVAFGLDYMND
A0A2V8F916      REKELRVSSNSRQNNVRIVDKAEVPQSPMTAGGRRTWMMSSLVGLVLAIGVAFGLDYMND
A0A1Q7K833      REKELRVSSNSRQNNVRVVDHAEVPRGPLAPTGRRTWLLSLAVGLVLAVGVAYGLDYMND
A0A1Q8AMY4      REKELRVSSNSRQNNVRVVDHAEVPRGPLAPTGRRTWLLSLAVGLVLAVGVAYGLDYMND
A0A2V8BM40      RERELRVSSNSRQNNVRVIDHAEAPGGAMSPSGRRTWLLALGIGLALGIGLAYGLDYMND
A0A2V8CRT6      RERELRVSSNSRQNNVRVIDHAEAPGGAMSPSGRRTWLLALGIGLALGIGLAYGLDYMND
A0A1F2VH76      REKELRVVANSRTNNIRLVDRAQVPGSPSSPNHRQDWIYALAFGLVFALGAAFGIDYLDD
A0A1F2R0X5      REKELRVASNSRANNVRLVDRAEVPGSPVTPGGRRTWLLSIVVGLVLAVGVAMGLDYMND
A0A2V8B278      RERELRVASNSRANNVRVVDRAEVPKAPLAPTGRRTWLLSLAVGLTLAIAVAYGLDYMND
A0A2V8CEF9      RERELRVASNSRANNVRVVDRAEVPKAPLAPTGRRTWLLSLAVGLTLAIAVAYGLDYMND
A0A2V8KZG2      ------------------------------------------------------------
A0A1Q7LG57      ------------------------------------------------------------
A0A2V8YMQ4      ------------------------------------------------------------
A0A1Q7L5B1      ------------------------------------------------------------
A0A2V9DKV4      ------------------------------------------------------------
A0A2V8W380      ------------------------------------------------------------
A0A2V8ZIV5      ------------------------------------------------------------
A0A2V9EVA0      ------------------------------------------------------------
A0A1Q7RB73      ------------------------------------------------------------
A0A2V9K0H7      ------------------------------------------------------------
A0A3N5YN96      ------------------------------------------------------------
A0A1Q7Y646      ------------------------------------------------------------
A0A2V8QZU0      ------------------------------------------------------------
A0A2V8RSQ9      ------------------------------------------------------------
A0A2V9LS17      ------------------------------------------------------------
A0A2V9AGR3      ------------------------------------------------------------
A0A2V9G0N7      ------------------------------------------------------------
A0A2V9GQ44      ------------------------------------------------------------
A0A2V9HRN3      ------------------------------------------------------------
A0A2V8WG13      ------------------------------------------------------------
A0A2V8X987      ------------------------------------------------------------
A0A1Q7KX94      ------------------------------------------------------------
A0A2V8XHT0      ------------------------------------------------------------
A0A2V9L2P7      ------------------------------------------------------------
A0A2V7UMX0      ------------------------------------------------------------
A0A136K497      ------------------------------------------------------------
A0A399W9E4      ------------------------------------------------------------
A0A2V7X0V9      ------------------------------------------------------------
A0A2V9X518      ------------------------------------------------------------
A0A2V9VC62      ------------------------------------------------------------
A0A2V9S1P8      ------------------------------------------------------------
A0A2V9RTW2      ------------------------------------------------------------
A0A2V9TGF1      ------------------------------------------------------------
A0A2V9XEV6      ------------------------------------------------------------
A0A2V9Y3Q6      ------------------------------------------------------------
A0A2V9R269      ------------------------------------------------------------
A0A2V9PTS3      ------------------------------------------------------------
A0A2V9NPF4      ------------------------------------------------------------
A0A2V9PNZ0      ------------------------------------------------------------
A0A321LMC5      ------------------------------------------------------------
A0A2V8X713      ------------------------------------------------------------
A0A2V8ZLE9      ------------------------------------------------------------
A0A2V8Y4D3      ------------------------------------------------------------
A0A2V8Z2X8      ------------------------------------------------------------
A0A2V9C3F6      ------------------------------------------------------------
A0A2V9QMU9      ------------------------------------------------------------
A0A2V9QY75      ------------------------------------------------------------
A0A2V9SVU9      ------------------------------------------------------------
A0A2V8W5N5      ------------------------------------------------------------
A0A2V8XG53      ------------------------------------------------------------
A0A2V9XV04      ------------------------------------------------------------
A0A2V9CBY1      ------------------------------------------------------------
A0A2V9D656      ------------------------------------------------------------
A0A352EZH8      ------------------------------------------------------------
A0A0B6X033      ------------------------------------------------------------
A0A2V8R0I3      ------------------------------------------------------------
A0A2V8N1U8      ------------------------------------------------------------
A0A2V8QL35      ------------------------------------------------------------
A0A352FU10      ------------------------------------------------------------
A0A2V8LCU0      ------------------------------------------------------------
A0A1Q7NGT0      ------------------------------------------------------------
A0A2V8MLP9      ------------------------------------------------------------
A0A2V8PQZ0      ------------------------------------------------------------
A0A3B9MKY6      ------------------------------------------------------------
A0A3D5SKZ1      ------------------------------------------------------------
A0A2V8NRW2      ------------------------------------------------------------
A0A2V8TKR9      ------------------------------------------------------------
A0A2V8LBV1      VDPATPPGAPYK--PDIYMYTMLGLAT-----------GVFLSILLIVRQARV-----DR
A0A2V8GAF9      CRHRKRANRPVGGWPARVTREDVSTQL-------------------------------DQ
A0A2V8CN98      LDAAVAPETPVK--NTAVRLLIMGLFA-----------GLGFGVVGAVVIDRF-----DP
A0A1Q7LC46      VDPAMVPTSPAR--PAKARNIMLAFLV-----------GLIGGIGLALMREYL-----DN
A0A1Q8BDC5      AKTTGMKETNIR--KVLGVFQTLGIIE-----------------TFADAEAPI-----PG
A0A2V9Q1Y8      VDIARTPAGPAE--PNIPRNLGFALAL-----------GLTSGIGLAFLLEGI-----DN
A0A2V8JXG1      ISPARMPKGPVS--PNRQRTILIGLLL-----------SLSGGIGLAWLLERF-----DD
A0A350D2W9      IDRADLPINPSS--PKKLRNLLLALFL-----------GLFGGAGLAFVMEYL-----DN
A0A2V9I4J1      VDEETG----------------------------------------------------QD
A0A2V8PQZ9      EEATGGPALPDG--PA----------------------SRDAGATLGAVGSAR-----AA
A0A2V8D8B1      VDNAETPRVPAS--PNKLANMMLAFIG-----------GSVLAVALVFFFEYA-----DN
A0A3B9LSB4      VDYAVTPDGPIG--PNRSSTVSMALFL-----------SLGLGVGLALLLEYF-----DD
A0A2V9H7U2      VDPARPPKVPVR--PQKLYNIAVSIAV-----------GLILGVMLAFVKEAL-----DS
A0A2V8NJB5      VASTGMKETPLR--RILGVFDQLGIIE----------------------LKSE-----NE
A0A2V9JMZ4      VDEETG----------------------------------------------------QD
A0A2V9MDJ6      VDEETG----------------------------------------------------QD
A0A2V8QJT6      VDYAIVPDLPVG--PARLRTVMFAFLL-----------ALAFGAALALFLEYL-----DD
A0A2V8FSM8      VDPAEEPEAPYK--PDVVRRITFGLIF-----------GAMFGVAFSVLRERA-----DR
A0A359M0J2      IDTAKPNNTQMS--PSLFRELARGLGL-----------GLLLGYGCAFLHERVYRKRQER
A0A2V8JLJ1      IDAAFLPRQAIG--PNRRLIAALGGAA-----------GLVLGLAIAFLREFT-----DS
A0A5M8SND8      FSGAQPPLRPDS--SGLITYSFGGLFF-----------GFLAGSAWVFTRSAA-----NR
A0A2V9GAQ1      VDPEMIPSTPAR--PAKARNMVLAFLV-----------GLVGGIGLALMREYL-----DN
A0A497EDQ8      IEKATPPSGPFS--PNLRRAVALGGVL-----------GLFLGIGLVLGLDFL-----DH
G8NS05          IDQAVPPAQPSL--KSKSSIMMLNTII-----------GIVLGAILGFILESL-----DT
A0A2V8KZ20      IDAAFLPRQAIG--PNRRLIAALGGAA-----------GLVLGFGIAFLREFT-----DS
A0A3D0NWU2      -AAAAETAPRVG--PNRTRNIIVALLL-----------SLAAGIGLAFLLDYL-----DD
A0A2V8EPD9      AAPAAVPKPPIA--PARPVAASASNAP-----------------AASAAPRPA-----GA
A0A3N5NSX5      MDRAVVPGSPFT--PDVRRNYMLGALT-----------GLLLSLGLVLAIDYL-----DD
A0A2V8MUA1      IDPANLPIRPFG--PNRERMIMIGCLA-----------SFALGLALVFARELL-----DS
A0A2V8MBH9      VDYAITPDFPVG--PARMRSVMLAFVL-----------ALALGVGLALFLEYL-----DD
A0A3N5ZPQ7      MGETGLPESQLV--ACLQTLRALGMIE----------------------IREE-----ET
A0A3N5P5F2      ADPADVPRVPIS--PNKQRDLLFGVMV-----------GLVAAIGMAFLFEYL-----DN
A0A2V9G1P7      VDSAQPPAKPVK--PKILLNLAVAMFL-----------GLGLGIGTALFQERM-----DN
A0A2V9BCK9      LKRAEQERAPIQ--SANEAKPSDSLLAEGAHRDGGEWSALGMVSPVGPGIESP-----NS
A0A2V9TMX2      VDIARVPTQPIS--PNVHRSLVLGFLL-----------ALGLGVGLALVRETF-----DS
A0A2V8N2J7      VEPAGLPRAPFS--PQRVRLVALGVVA-----------GLGLGLALIFVLEQN-----DT
A0A3N6BI26      VDHAEVPEAPYS--PQRAADLALGLGV-----------GLFLAIGLAFLMEYL-----DN
A0A2V9JMM3      VEPASVPSAPSS--PKRERILLLGFVG-----------SLGLGVVLAFLVEQL-----DT
A0A2V9M815      VEPASVPSAPSS--PKRERILLLGFVG-----------SLGLGVVLAFLVEQL-----DT
A0A2V9A795      VDSAEPPAKPAK--PRIPLNLAVAALL-----------GLGLGISTAFLQERL-----DD
A0A355ESH9      IDHALVPDGPFR--PSLRKDLTYGLLI-----------GLLFGIGVALFLEFL-----DR
A0A3D0NW85      AQYAIPPKNPVS--PSRTTTVLAALLL-----------STLFGMGLALFLEYL-----DD
A0A353CAT5      AAFAIPPDTPVA--PRRLTTVLAALFL-----------STLFGMGLALFLEYL-----DD
A0A2V9HB55      VDPAMIPSTPAR--PAKTRNLALAFLV-----------GLVGGIGLALLREYL-----DN
A0A2V8CU57      SEPESATAPPAV--AAWSEAVTAPFAV------------VASSEPETVTAPFV-----VV
A0A2V8BDI4      SEPESATAPPAV--AAWSEAVTAPFAV------------VASSEKETVTAPFV-----VA
A0A2V8F8T3      SEPESATAPPAV--AAWSEAVTAPFAV------------VASSEPETVTAPFV-----VA
A0A2V9J901      ------------------------------------------------------------
A0A2V8MKQ7      ------------------------------------------------------------
A0A3M1SNQ5      ------------------------------------------------------------
A0A2V8QJ59      ------------------------------------------------------------
A0A1Q7HTA7      ------------------------------------------------------------
A0A2W0B5E2      ------------------------------------------------------------
A0A2V8NMG8      ------------------------------------------------------------
A0A2V8TBM7      ------------------------------------------------------------
A0A1Q7HEZ8      ------------------------------------------------------------
A0A1Q7JW36      ------------------------------------------------------------
A0A1Q7MUR4      ------------------------------------------------------------
A0A3N5PFU4      ------------------------------------------------------------
A0A4R1LDF1      ------------------------------------------------------------
A0A1F2T1R8      ------------------------------------------------------------
A0A2V9BW09      ------------------------------------------------------------
A0A3M1SSE1      ------------------------------------------------------------
A0A2V9GQV7      ------------------------------------------------------------
A0A2V7YV88      ------------------------------------------------------------
A0A2V8YCY6      ------------------------------------------------------------
A0A2V8EGM3      ------------------------------------------------------------
A0A2V8FGH1      ------------------------------------------------------------
A0A2V8D468      ------------------------------------------------------------
A0A1F2R977      ------------------------------------------------------------
A0A2U3LF12      ------------------------------------------------------------
A0A3N5G7M6      ------------------------------------------------------------
A0A1F2S3Q7      ------------------------------------------------------------
A0A2V8GVG4      ------------------------------------------------------------
A0A143PNR5      ------------------------------------------------------------
A0A2V8PJQ0      ------------------------------------------------------------
A0A2V8H566      ------------------------------------------------------------
A0A3N5YKY1      ------------------------------------------------------------
A0A2V8UVN4      ------------------------------------------------------------
A0A321LXF5      ------------------------------------------------------------
A0A5M8SBZ0      ------------------------------------------------------------
A0A1Q7JFB1      ------------------------------------------------------------
A0A2V8DMJ9      ------------------------------------------------------------
A0A2V8GGF6      ------------------------------------------------------------
A0A2V8HKU7      ------------------------------------------------------------
A0A1Q6Y875      ------------------------------------------------------------
A0A523DJA9      ------------------------------------------------------------
A0A2V8I604      ------------------------------------------------------------
A0A2V8J066      ------------------------------------------------------------
A0A1I6MMC5      ------------------------------------------------------------
A0A2V9D5W7      ------------------------------------------------------------
A0A2V9D4I4      ------------------------------------------------------------
A0A2V9D6L7      ------------------------------------------------------------
A0A2V8ZJV2      ------------------------------------------------------------
A0A2V9AWB5      ------------------------------------------------------------
A0A2V8Z1Y8      ------------------------------------------------------------
A0A1Q8AX10      ------------------------------------------------------------
A0A2V9A773      ------------------------------------------------------------
A0A2V9AND3      ------------------------------------------------------------
A0A2V9BTJ7      ------------------------------------------------------------
A0A2V8W2M7      ------------------------------------------------------------
A0A2V8XNW2      ------------------------------------------------------------
A0A1Q7CJC1      ------------------------------------------------------------
A0A2V9UEM7      ------------------------------------------------------------
A0A1Q7V300      ------------------------------------------------------------
A0A2V9ZCI3      ------------------------------------------------------------
A0A2V9WCB3      ------------------------------------------------------------
A0A2V9VQW5      ------------------------------------------------------------
A0A2V9WTP3      ------------------------------------------------------------
A0A2V9NLA9      ------------------------------------------------------------
A0A2V9RKJ9      ------------------------------------------------------------
A0A2V9RN95      ------------------------------------------------------------
A0A2V9N406      ------------------------------------------------------------
A0A2V9U6D9      ------------------------------------------------------------
A0A2V8DZN4      ------------------------------------------------------------
A0A2G6HQA4      ------------------------------------------------------------
A0A2V7ZTY7      ------------------------------------------------------------
A0A2V7ZVL9      ------------------------------------------------------------
A0A1Q7QYI4      ------------------------------------------------------------
A0A2V8G9Y9      ------------------------------------------------------------
A0A143PXU3      ------------------------------------------------------------
A0A2V8D8G9      ------------------------------------------------------------
A0A2V8ESQ4      ------------------------------------------------------------
A0A1E3Y5Q0      ------------------------------------------------------------
A0A2W4TWK5      ------------------------------------------------------------
A0A3N5NYV3      ------------------------------------------------------------
A0A2V2RJF9      ------------------------------------------------------------
A0A2G6HNT3      ------------------------------------------------------------
A0A2V7YWD4      ------------------------------------------------------------
A0A2V2R8T6      ------------------------------------------------------------
A0A1Q7RGF1      ------------------------------------------------------------
A0A2V9BLX2      ------------------------------------------------------------
A0A2V9ZA03      ------------------------------------------------------------
A0A3N5ZNH4      ------------------------------------------------------------
A0A2V8GEZ2      ------------------------------------------------------------
A0A3N5ZFD3      ------------------------------------------------------------
G8NXD3          ------------------------------------------------------------
A0A2V9VR38      ------------------------------------------------------------
A0A2V9EY04      ------------------------------------------------------------
A0A2V9HAK9      ------------------------------------------------------------
A0A1Q7FS15      ------------------------------------------------------------
A0A1Q7K9P1      ------------------------------------------------------------
A0A1Q7N989      ------------------------------------------------------------
A0A2V9G7Y0      ------------------------------------------------------------
A0A2V8T7Z1      ------------------------------------------------------------
A0A2V7U8G5      ------------------------------------------------------------
A0A2V7UNP9      ------------------------------------------------------------
A0A2V7VLD7      ------------------------------------------------------------
A0A2V7XGA3      ------------------------------------------------------------
A0A2V7YAG6      ------------------------------------------------------------
A0A2V7VK33      ------------------------------------------------------------
A0A3M1VTE1      ------------------------------------------------------------
A0A2V7TTM7      ------------------------------------------------------------
A0A2V8VI82      ------------------------------------------------------------
A0A2V7U4P9      ------------------------------------------------------------
A0A2V7TQY5      ------------------------------------------------------------
A0A2V7TU87      ------------------------------------------------------------
A0A2V8SEH0      ------------------------------------------------------------
A0A2V8VU54      ------------------------------------------------------------
A0A1Q7RML7      ------------------------------------------------------------
A0A1Q7ZIQ5      ------------------------------------------------------------
A0A2V8TKD8      ------------------------------------------------------------
                                                                            

A0A1F2U8T6      TVKTPEDVTRFLKMTFLGLVPSVRGDK---------------------------------
A0A2V8BV42      TIKTPEDVTRRLKLPFLGLVPSVRGDK---------------------------------
A0A2V8F916      TIKTPEDVTRRLKLPFLGLVPSVRGDK---------------------------------
A0A1Q7K833      TIKTPEDVARRLKLPFLGLVPSVRGDK---------------------------------
A0A1Q8AMY4      TIKTPEDVARRLKLPFLGLVPSVRGDK---------------------------------
A0A2V8BM40      TIKTPEDIARRLRLPFLGLVPSVRGDA---------------------------------
A0A2V8CRT6      TIKTPEDIARRLRLPFLGLVPSVRGDA---------------------------------
A0A1F2VH76      TVKTPEDITRRLKLRFLGLVPAVRGDR---------------------------------
A0A1F2R0X5      TIKTPEDVTKRLRLPFLGLVPSVRGAK---------------------------------
A0A2V8B278      TIKTPEEVTRRLRLPFLGLVPSVRGDK---------------------------------
A0A2V8CEF9      TIKTPEEVTRRLRLPFLGLVPSVRGDK---------------------------------
A0A2V8KZG2      ------------------------------------------------------------
A0A1Q7LG57      ------------------------------------------------------------
A0A2V8YMQ4      ------------------------------------------------------------
A0A1Q7L5B1      ------------------------------------------------------------
A0A2V9DKV4      ------------------------------------------------------------
A0A2V8W380      ------------------------------------------------------------
A0A2V8ZIV5      ------------------------------------------------------------
A0A2V9EVA0      ------------------------------------------------------------
A0A1Q7RB73      ------------------------------------------------------------
A0A2V9K0H7      ------------------------------------------------------------
A0A3N5YN96      ------------------------------------------------------------
A0A1Q7Y646      ------------------------------------------------------------
A0A2V8QZU0      ------------------------------------------------------------
A0A2V8RSQ9      ------------------------------------------------------------
A0A2V9LS17      ------------------------------------------------------------
A0A2V9AGR3      ------------------------------------------------------------
A0A2V9G0N7      ------------------------------------------------------------
A0A2V9GQ44      ------------------------------------------------------------
A0A2V9HRN3      ------------------------------------------------------------
A0A2V8WG13      ------------------------------------------------------------
A0A2V8X987      ------------------------------------------------------------
A0A1Q7KX94      ------------------------------------------------------------
A0A2V8XHT0      ------------------------------------------------------------
A0A2V9L2P7      ------------------------------------------------------------
A0A2V7UMX0      ------------------------------------------------------------
A0A136K497      ------------------------------------------------------------
A0A399W9E4      ------------------------------------------------------------
A0A2V7X0V9      ------------------------------------------------------------
A0A2V9X518      ------------------------------------------------------------
A0A2V9VC62      ------------------------------------------------------------
A0A2V9S1P8      ------------------------------------------------------------
A0A2V9RTW2      ------------------------------------------------------------
A0A2V9TGF1      ------------------------------------------------------------
A0A2V9XEV6      ------------------------------------------------------------
A0A2V9Y3Q6      ------------------------------------------------------------
A0A2V9R269      ------------------------------------------------------------
A0A2V9PTS3      ------------------------------------------------------------
A0A2V9NPF4      ------------------------------------------------------------
A0A2V9PNZ0      ------------------------------------------------------------
A0A321LMC5      ------------------------------------------------------------
A0A2V8X713      ------------------------------------------------------------
A0A2V8ZLE9      ------------------------------------------------------------
A0A2V8Y4D3      ------------------------------------------------------------
A0A2V8Z2X8      ------------------------------------------------------------
A0A2V9C3F6      ------------------------------------------------------------
A0A2V9QMU9      ------------------------------------------------------------
A0A2V9QY75      ------------------------------------------------------------
A0A2V9SVU9      ------------------------------------------------------------
A0A2V8W5N5      ------------------------------------------------------------
A0A2V8XG53      ------------------------------------------------------------
A0A2V9XV04      ------------------------------------------------------------
A0A2V9CBY1      ------------------------------------------------------------
A0A2V9D656      ------------------------------------------------------------
A0A352EZH8      ------------------------------------------------------------
A0A0B6X033      ------------------------------------------------------------
A0A2V8R0I3      ------------------------------------------------------------
A0A2V8N1U8      ------------------------------------------------------------
A0A2V8QL35      ------------------------------------------------------------
A0A352FU10      ------------------------------------------------------------
A0A2V8LCU0      ------------------------------------------------------------
A0A1Q7NGT0      ------------------------------------------------------------
A0A2V8MLP9      ------------------------------------------------------------
A0A2V8PQZ0      ------------------------------------------------------------
A0A3B9MKY6      ------------------------------------------------------------
A0A3D5SKZ1      ------------------------------------------------------------
A0A2V8NRW2      ------------------------------------------------------------
A0A2V8TKR9      ------------------------------------------------------------
A0A2V8LBV1      TIQSPGEAPTYLKVRELGVILSAEADSTLGRPGRS-----------KHIPSLQSLIQLGK
A0A2V8GAF9      TATSSESARRADAAARLREFVRANGERFQ-------------------------------
A0A2V8CN98      RVRYPAQVTTDMGLRILGALPHV-------------------------------------
A0A1Q7LC46      TVKTPDDIESLARLPSLAVVPQFTGLNGSKGRGVLPGLSSNGHE----------------
A0A1Q8BDC5      ALTRRDALVRTSEFPLEELVPVVSNAT---------------------------------
A0A2V9Q1Y8      TVRTPEQAQLISGLPSLGMIPLGSRTAAEANPTGLSVAASK-------------------
A0A2V8JXG1      SIRSVDDVNRYTQLPALAVIPAIGANNSLLNGRRRKDNAGELLALDSGDKPTAK------
A0A350D2W9      TVKSAEEVGRYTGLPTLGVVPVFGDDSNRAYGYYYSYGQKKGEEKGKGGKEDSGKP----
A0A2V9I4J1      DTKGSAAVGGQSRFPFEHLIPEISNAV---------------------------------
A0A2V8PQZ9      EFSSREVLAAR-------------------------------------------------
A0A2V8D8B1      RIKSPNEIKAHLGLPFLGMIPSLTDQ----------------------------------
A0A3B9LSB4      TLRSSEEVERLLQLPALGVIPS------------------------ANASARRRLMGASG
A0A2V9H7U2      SIKSIEEAERVVNAPALAVVPLER----------------------EIPHRAARSLTRNN
A0A2V8NJB5      FLSEHVAIVKRSGFPFDGLIPVISNAV---------------------------------
A0A2V9JMZ4      DTKGSAAVGGQSRFPFEHLIPEISNAV---------------------------------
A0A2V9MDJ6      DTKGSAAVGGQSRFPFEHLIPEISNAV---------------------------------
A0A2V8QJT6      TVHSTDDVERFLRLPALAVIPAMS----------------------SASAPRRLLSSATS
A0A2V8FSM8      TLQDPGDVSYYLGVPELGVVPVGE---------------------------PIDLPRSGV
A0A359M0J2      RFAAPGNSGRLLNVPELGVIPSNAAPERFG----------------KQFFRIRVRRRKSK
A0A2V8JLJ1      SLHTEDELAAAIKLPILASIPTVD----------------------EKRTRKRKSASVLR
A0A5M8SND8      TFHSPGQSAVQVQLRELGVIPRHSL---------------------SSNKAFARLLRSTD
A0A2V9GAQ1      TVKTPDDVETHSRLPSLAVVPQFT------------------------------------
A0A497EDQ8      TLRTPDQVERYLGLEVLAALPKLT------------------------------------
G8NS05          NLHSVAEIEAVSGLHSLALIPRARRTGIDTSNLSV-------------------------
A0A2V8KZ20      SLHTEDELAAAIKLPILASIPTVD----------------------EKRTRKRKSASVLR
A0A3D0NWU2      SVKNSEEIGRQLGLPTLALIPHYF----------------------GSEKKRLRLAAENG
A0A2V8EPD9      KRAPAWSREASIEKPIVHAAPT-------------------------------------G
A0A3N5NSX5      TVKTPEDITRRLKLPFLGLVPAVK------------------------------------
A0A2V8MUA1      TLSDEDTAASELKLPVLACVPNI-----------------------PAGRKKRRERTNSK
A0A2V8MBH9      SIHSTDDVEKFLRLPALAVIPSMS----------------------GGVARRRRLLSSAT
A0A3N5ZPQ7      EEERSVALTVRERLPLEQLVPEAADAL---------------------------------
A0A3N5P5F2      KIKSPPEIRTYLNLPCLGLVPRIAGKH---------------------------------
A0A2V9G1P7      TLKGDDDVERLFGLPSLALIPVVPPSDSDQHGIHRFLPRDKAFEFKGNGAGKNSHS----
A0A2V9BCK9      HHLRLDELRRRCATPGWKLNPDY-------------------------------------
A0A2V9TMX2      TVRSMEEVRAVSTLPALGTIPLQLVT--------------------DERFRKRRLTISPD
A0A2V8N2J7      TFGNVDDFESFSTLPVAGIVPNIQNRNKKR------------------------------
A0A3N6BI26      TLKTPEDMEQSLGLPSLGVIPAMA----------------------DLPAGSSRLLASRN
A0A2V9JMM3      SFDSADDFKTFTNLPLLAVIPSVR----------------------SKSRSGRKLPEGGK
A0A2V9M815      SFDSADDFKTFTNLPLLAVIPSVR----------------------SKSRSGRKLPEGGK
A0A2V9A795      TLKGADDVERVFGLSALALIPSVHHLNGDRPSV-------------SSLLGRTNLLRSGQ
A0A355ESH9      TVKSPEEVERRFSIATLAVIQDIAETGKAYGSPAYGYGYGYGYGYGDPPTGEPSRVRPTK
A0A3D0NW85      TIGTTEEIESYLQLPALAAIPSI------------------------DSMPKRKLLLVGG
A0A353CAT5      TIRTTEEIENYLQLPALAAIPTI------------------------DSMPKRRLLLVGN
A0A2V9HB55      TVKTPDDIETLARLPSLAVVPQFTGS--------------------NGHAKKRGLLQGPA
A0A2V8CU57      APSGPENVQ-----PPLPPLPTW-DF--------------------DGSVAAAELVEAPD
A0A2V8BDI4      APSGPENVQ-----PPLPPLPTW-DF--------------------DGSVAAAELVEAPD
A0A2V8F8T3      APSGPENVQ-----PPLPPLPTW-DF--------------------DGSVAAAELVEAPD
A0A2V9J901      ------------------------------------------------------------
A0A2V8MKQ7      ------------------------------------------------------------
A0A3M1SNQ5      ------------------------------------------------------------
A0A2V8QJ59      ------------------------------------------------------------
A0A1Q7HTA7      ------------------------------------------------------------
A0A2W0B5E2      ------------------------------------------------------------
A0A2V8NMG8      ------------------------------------------------------------
A0A2V8TBM7      ------------------------------------------------------------
A0A1Q7HEZ8      ------------------------------------------------------------
A0A1Q7JW36      ------------------------------------------------------------
A0A1Q7MUR4      ------------------------------------------------------------
A0A3N5PFU4      ------------------------------------------------------------
A0A4R1LDF1      ------------------------------------------------------------
A0A1F2T1R8      ------------------------------------------------------------
A0A2V9BW09      ------------------------------------------------------------
A0A3M1SSE1      ------------------------------------------------------------
A0A2V9GQV7      ------------------------------------------------------------
A0A2V7YV88      ------------------------------------------------------------
A0A2V8YCY6      ------------------------------------------------------------
A0A2V8EGM3      ------------------------------------------------------------
A0A2V8FGH1      ------------------------------------------------------------
A0A2V8D468      ------------------------------------------------------------
A0A1F2R977      ------------------------------------------------------------
A0A2U3LF12      ------------------------------------------------------------
A0A3N5G7M6      ------------------------------------------------------------
A0A1F2S3Q7      ------------------------------------------------------------
A0A2V8GVG4      ------------------------------------------------------------
A0A143PNR5      ------------------------------------------------------------
A0A2V8PJQ0      ------------------------------------------------------------
A0A2V8H566      ------------------------------------------------------------
A0A3N5YKY1      ------------------------------------------------------------
A0A2V8UVN4      ------------------------------------------------------------
A0A321LXF5      ------------------------------------------------------------
A0A5M8SBZ0      ------------------------------------------------------------
A0A1Q7JFB1      ------------------------------------------------------------
A0A2V8DMJ9      ------------------------------------------------------------
A0A2V8GGF6      ------------------------------------------------------------
A0A2V8HKU7      ------------------------------------------------------------
A0A1Q6Y875      ------------------------------------------------------------
A0A523DJA9      ------------------------------------------------------------
A0A2V8I604      ------------------------------------------------------------
A0A2V8J066      ------------------------------------------------------------
A0A1I6MMC5      ------------------------------------------------------------
A0A2V9D5W7      ------------------------------------------------------------
A0A2V9D4I4      ------------------------------------------------------------
A0A2V9D6L7      ------------------------------------------------------------
A0A2V8ZJV2      ------------------------------------------------------------
A0A2V9AWB5      ------------------------------------------------------------
A0A2V8Z1Y8      ------------------------------------------------------------
A0A1Q8AX10      ------------------------------------------------------------
A0A2V9A773      ------------------------------------------------------------
A0A2V9AND3      ------------------------------------------------------------
A0A2V9BTJ7      ------------------------------------------------------------
A0A2V8W2M7      ------------------------------------------------------------
A0A2V8XNW2      ------------------------------------------------------------
A0A1Q7CJC1      ------------------------------------------------------------
A0A2V9UEM7      ------------------------------------------------------------
A0A1Q7V300      ------------------------------------------------------------
A0A2V9ZCI3      ------------------------------------------------------------
A0A2V9WCB3      ------------------------------------------------------------
A0A2V9VQW5      ------------------------------------------------------------
A0A2V9WTP3      ------------------------------------------------------------
A0A2V9NLA9      ------------------------------------------------------------
A0A2V9RKJ9      ------------------------------------------------------------
A0A2V9RN95      ------------------------------------------------------------
A0A2V9N406      ------------------------------------------------------------
A0A2V9U6D9      ------------------------------------------------------------
A0A2V8DZN4      ------------------------------------------------------------
A0A2G6HQA4      ------------------------------------------------------------
A0A2V7ZTY7      ------------------------------------------------------------
A0A2V7ZVL9      ------------------------------------------------------------
A0A1Q7QYI4      ------------------------------------------------------------
A0A2V8G9Y9      ------------------------------------------------------------
A0A143PXU3      ------------------------------------------------------------
A0A2V8D8G9      ------------------------------------------------------------
A0A2V8ESQ4      ------------------------------------------------------------
A0A1E3Y5Q0      ------------------------------------------------------------
A0A2W4TWK5      ------------------------------------------------------------
A0A3N5NYV3      ------------------------------------------------------------
A0A2V2RJF9      ------------------------------------------------------------
A0A2G6HNT3      ------------------------------------------------------------
A0A2V7YWD4      ------------------------------------------------------------
A0A2V2R8T6      ------------------------------------------------------------
A0A1Q7RGF1      ------------------------------------------------------------
A0A2V9BLX2      ------------------------------------------------------------
A0A2V9ZA03      ------------------------------------------------------------
A0A3N5ZNH4      ------------------------------------------------------------
A0A2V8GEZ2      ------------------------------------------------------------
A0A3N5ZFD3      ------------------------------------------------------------
G8NXD3          ------------------------------------------------------------
A0A2V9VR38      ------------------------------------------------------------
A0A2V9EY04      ------------------------------------------------------------
A0A2V9HAK9      ------------------------------------------------------------
A0A1Q7FS15      ------------------------------------------------------------
A0A1Q7K9P1      ------------------------------------------------------------
A0A1Q7N989      ------------------------------------------------------------
A0A2V9G7Y0      ------------------------------------------------------------
A0A2V8T7Z1      ------------------------------------------------------------
A0A2V7U8G5      ------------------------------------------------------------
A0A2V7UNP9      ------------------------------------------------------------
A0A2V7VLD7      ------------------------------------------------------------
A0A2V7XGA3      ------------------------------------------------------------
A0A2V7YAG6      ------------------------------------------------------------
A0A2V7VK33      ------------------------------------------------------------
A0A3M1VTE1      ------------------------------------------------------------
A0A2V7TTM7      ------------------------------------------------------------
A0A2V8VI82      ------------------------------------------------------------
A0A2V7U4P9      ------------------------------------------------------------
A0A2V7TQY5      ------------------------------------------------------------
A0A2V7TU87      ------------------------------------------------------------
A0A2V8SEH0      ------------------------------------------------------------
A0A2V8VU54      ------------------------------------------------------------
A0A1Q7RML7      ------------------------------------------------------------
A0A1Q7ZIQ5      ------------------------------------------------------------
A0A2V8TKD8      ------------------------------------------------------------
                                                                            

A0A1F2U8T6      ----------------------HPLMASWDTPKHFG--------EAFRNL-RTAIIALY-
A0A2V8BV42      ----------------------HPLLTSAHVPHDFG--------EAFRAL-RTSLISKY-
A0A2V8F916      ----------------------HPLLTSAHVPHDFG--------EAFRAL-RTSLISKY-
A0A1Q7K833      ----------------------HPVLASSHVPHDFG--------ESFRAL-RTSLMSKY-
A0A1Q8AMY4      ----------------------HPVLASSHVPHDFG--------ESFRAL-RTSLMSKY-
A0A2V8BM40      ----------------------HPVLASSNVPHNFG--------ESFRAL-RTSLTSKY-
A0A2V8CRT6      ----------------------HPVLASSNVPHNFG--------ESFRAL-RTSLTSKY-
A0A1F2VH76      ----------------------HPLLSGP-VPHDFG--------EAFRTL-RTALVSQL-
A0A1F2R0X5      ---------------------QQPLLTSSHAPVDFS--------ESFRSL-RTTLLTRY-
A0A2V8B278      ----------------------HPLLASSHVPHDFG--------ESFRAL-RTALVSKY-
A0A2V8CEF9      ----------------------HPLLASSHVPHDFG--------ESFRAL-RTALISKY-
A0A2V8KZG2      ------------------------------------------------------------
A0A1Q7LG57      -----------------------PELATWKRKPSFLA-------ECARTT-LTSILLPS-
A0A2V8YMQ4      ---------------------SFLGPGRMERRVTLAR-------AGTALI-KEDSVLLST
A0A1Q7L5B1      ---------------------PTYSAFSNSKSFTSCA-------EQFSKL-RTRLYEFR-
A0A2V9DKV4      ---------------------PTYSAFSNSKSFTSCA-------EQFSKL-RTRLYEFR-
A0A2V8W380      ------------------------LIDRDGAQHAALG-------EAFRSL-RTSVLLST-
A0A2V8ZIV5      ------------------------RIDQRGKPQAALV-------EAFRSL-RASVLLST-
A0A2V9EVA0      ---------------------KDSLVLFNEQSFDRCA-------EQFRIL-RARLYRLR-
A0A1Q7RB73      ---------------------RNMMLFFDRRNPVVGV-------EEFRTL-RSHLTLIR-
A0A2V9K0H7      ---------------------RKMMLFFDRRNPVVGV-------EEFRTL-RSHLSLIR-
A0A3N5YN96      ---------------------LHPLLAAALEFGSPAA-------EQFRAL-RTRIGQVEF
A0A1Q7Y646      ---------------------VEPHLVAITQPRSPYC-------EQFRSL-RTRLLQAS-
A0A2V8QZU0      ---------------------VEPHLIAITQPRSAHA-------ERFRSL-RTRVLHAG-
A0A2V8RSQ9      ---------------------VEPHLVAITDPRSPHA-------EQYRSL-RTRVLHAG-
A0A2V9LS17      ---------------------VKTMLFFGEENYALGT-------EEFRTL-RSHLFGLN-
A0A2V9AGR3      ---------------------PQVSLVDGGESETGGA-------ERFRTL-RSRLFQIA-
A0A2V9G0N7      ---------------------PARSVFGGPDSKKLGA-------EPFRTL-RSRLSQIA-
A0A2V9GQ44      ---------------------PARSVFGGPDSKKFGA-------EPFRTL-RSRLSQIA-
A0A2V9HRN3      ---------------------PARSVFGGTDSKKFGA-------EPFRTL-RSRLSQIA-
A0A2V8WG13      ---------------------PRLNIFLKTDEGRIGR-------ERFRTL-RSRLYQIA-
A0A2V8X987      ---------------------PRASAFQDSNSGHSGA-------ERFRTL-RSRLSQIA-
A0A1Q7KX94      ---------------------PVSSVFLNSKPGEGGP-------ERFRTL-RSRLYKIA-
A0A2V8XHT0      ---------------------PVSSVFLNSKPGEGGP-------ERFRTL-RSRLYKIA-
A0A2V9L2P7      ---------------------EMVELSVLKNPGASIS-------EAFRTL-RTSILLST-
A0A2V7UMX0      ---------------------IDGRLVSLTAPTSPEA-------HQYRVL-GHQLERLR-
A0A136K497      ---------------------VEPRLVAITSPNSSYC-------EEYRSL-RTHVLHKS-
A0A399W9E4      ---------------------VEPRLVAITSPNSSYC-------EEYRSL-RTNVLHKS-
A0A2V7X0V9      ---------------------LGTMLFMNGDDSKRGT-------EEFRTL-RSRLYHMR-
A0A2V9X518      ---------------------PKSMLFFNDDERKYGA-------EEFRTL-RSRLYQMR-
A0A2V9VC62      ---------------------PTTMLFFSQEDNALGT-------EQFRTL-RSRLYQLR-
A0A2V9S1P8      ---------------------RKTMLFFNPEEQEYGN-------EEFRTL-RSRLYQIR-
A0A2V9RTW2      ---------------------TNTMLFFKAEEQGFGT-------EEFRTL-RSRLYQMR-
A0A2V9TGF1      ---------------------TNTMLFFKAEEQGFGT-------EEFRTL-RSRLYQMR-
A0A2V9XEV6      ---------------------PKSMLFFNDDERKYGA-------EEFRTL-RSRLYQMR-
A0A2V9Y3Q6      ---------------------AKSMLFFNSDERKYGV-------EEFRTL-RSRLYQLR-
A0A2V9R269      ---------------------PKKMLFFGTEEHASGM-------EEFRTL-RSRLYQAR-
A0A2V9PTS3      ---------------------LKCMLFFSGEEHGSGM-------EEFRTL-RTRLYQIR-
A0A2V9NPF4      ---------------------LKSMLFFSGEEHGSGM-------EEFRTL-RTRLYQIR-
A0A2V9PNZ0      ---------------------LKCMLFFSGEEHGSGM-------EEFRTL-RTRLYQIR-
A0A321LMC5      ---------------------VDQHLAGLIERDDLAR-------ERYNTL-AVRLINLA-
A0A2V8X713      ---------------------PDYDVFSAKQTSFPCA-------EQFRTL-RARLYRLR-
A0A2V8ZLE9      ---------------------PDCDVFSTKQSSSLCA-------EQFRTL-RSHLYRLR-
A0A2V8Y4D3      ---------------------PDYDAFSPQHSSALCA-------EQFRTL-RSRLYRLK-
A0A2V8Z2X8      ---------------------PDYDVFSTKQSSALCA-------EQFRTL-RSRLDRLR-
A0A2V9C3F6      ---------------------PDYDVFSTQQSSALCA-------EQFRTL-RSRLYRLR-
A0A2V9QMU9      ---------------------EAIELVTQSRPQSQMA-------EAYRAL-RTALLLSS-
A0A2V9QY75      ---------------------EPVELITQARPQSQMA-------ESYRAL-RTSLLLTS-
A0A2V9SVU9      ---------------------EVVELITQSRPQSQMA-------ESYRAL-RTSLLLTS-
A0A2V8W5N5      ---------------------PGKNVFSNAAATACGA-------EQFRTL-RSRLYQIR-
A0A2V8XG53      ---------------------PGKNVFSNAAATACGA-------EQFRTL-RSRLYQIR-
A0A2V9XV04      ---------------------LQTMLFMNGNDSAKGT-------EEYRTL-RSRLYHIR-
A0A2V9CBY1      ---------------------LRWNVFSNERSCKRQA-------EQFHTL-RARLYSLR-
A0A2V9D656      ---------------------LRWNVFPKERPCGRQA-------EQFHSL-RARLYSLR-
A0A352EZH8      ---------------------VEPHLVAITQPRSAYC-------EQFRSL-RTRVLQAG-
A0A0B6X033      ---------------------ADQHLIAITQPQSPEC-------EQFRSL-RTHVLHAG-
A0A2V8R0I3      ---------------------VEPHLVAITQPRSPEC-------EQFRAL-RTRLLEAG-
A0A2V8N1U8      ---------------------VEPHLVAITSPRSPEC-------EQFRSL-RTRLLQAS-
A0A2V8QL35      ---------------------VEPHLVALTDPRSVAC-------EQFRAL-RTQLLQAG-
A0A352FU10      ---------------------VEPHLVAITDPRSPEC-------EQFRAL-RTRLLQAG-
A0A2V8LCU0      ---------------------VEPHLVAVTSPHSPEC-------EQFRAL-RTRLLQAG-
A0A1Q7NGT0      ---------------------VEPHLLAITEPRSAEC-------EQYRSL-RTRLLQAG-
A0A2V8MLP9      ---------------------VEPHLLAITEPRSPEC-------EQYRSL-RTRLLQAG-
A0A2V8PQZ0      ---------------------VEPHLLAITEPRSPEC-------EQYRSL-RTRLLQAG-
A0A3B9MKY6      ---------------------VEPHLVAVSQPRSPYC-------EQFRSL-RTKLLQAG-
A0A3D5SKZ1      ---------------------VEPHLVAVSQPRSPYC-------EQFRSL-RTKLLQAG-
A0A2V8NRW2      ---------------------VEPHLIAVTQPRSAYC-------EQFRSL-RTRVLQAS-
A0A2V8TKR9      -------------------------------------------------------MLLSA
A0A2V8LBV1      PAGNGSFSKAVRKYAGENRAPKRVELMTWEKRSSLFA-------ECFRTT-AASLLFSEP
A0A2V8GAF9      ---------------------IAEQLVSLIAPGSFAA-------DQYRAL-RHNLER-LR
A0A2V8CN98      ---------------------KKRAGASDDESGALVI-------ETMRGV-RLSLIH-AY
A0A1Q7LC46      ---------------------RRIELVAQHLPKSQMS-------EAFRAL-RTSILL-SQ
A0A1Q8BDC5      ---------------------LAEKLQIARSEMSFTS-------EQFKNL-KVQLRD-AA
A0A2V9Q1Y8      ---------------------EAVELITISRPQSQMS-------ESYRAL-RTSLLL-TS
A0A2V8JXG1      ---------------------MQRARLMEFDGRSPAS-------EAYRAL-RTALLL-SA
A0A350D2W9      ---------------------KNIELIVHFAPESAFA-------ENYRSL-RTALLL-SS
A0A2V9I4J1      ---------------------LSEKLEVLKNEFSFVS-------EQFKAL-KVRINE-TQ
A0A2V8PQZ9      ---------------------VEPHLLAITEPRSAEC-------EQYRSL-RTCLLQ-AG
A0A2V8D8B1      ---------------------VEGTPLLDNGVNAGFA-------EAFRMV-RTNLVF-ST
A0A3B9LSB4      ALQKRNGHS------------DSPELLMNVDGHSPLA-------EAYRHL-RTSVLL-ST
A0A2V9H7U2      GTSKP----------------GDAELALLKQPSSALA-------ESFRTL-LTSVVL-ST
A0A2V8NJB5      ---------------------VSDKLEVLKNSSSFIS-------EQFRNL-KVRI---NE
A0A2V9JMZ4      ---------------------LSEKLEVLKNEFSFVS-------EQFKAL-KVRINE-TQ
A0A2V9MDJ6      ---------------------LSEKLEVLKNEFSFVS-------EQFKAL-KVRINE-TQ
A0A2V8QJT6      LQKRNSSNG------------ANPELLLNINGRSALA-------EAYRQL-RTSVLL-ST
A0A2V8FSM8      RSPAAALTGASAPAAPGLSVAHRVELISFRQKTSLLA-------ESFRTT-LTSILFSQR
A0A359M0J2      PLSLTGTGTAAPAAETPPSNPRLEFLEIWKGKPSIVA-------ESFRLT-LTSLTRSGP
A0A2V8JLJ1      LQEHKGGSGPSPLRHV-----DNKITDAILNPSCSAR-------EHYRFL-HSQLLA-MQ
A0A5M8SND8      SGGEPALMAYRA---------NQAELAGFAERSGMVA-------ESFRML-LASIMFGEE
A0A2V9GAQ1      GSNGSGKHHGPLLGFSSNGHEKRMELVAHHLPKSQMS-------EAFRAL-RTSILL-SQ
A0A497EDQ8      -----------------------------DDNSRALR-------EAFQTL-RTALML-AA
G8NS05          ---------------------IQRNLATLSSPKSQFT-------EAFRGL-RTSLLL-ST
A0A2V8KZ20      LQEHKGGSGHSPLRHV-----DNKITDAILNPSCSAR-------EHYRFL-HSQLLA-MQ
A0A3D0NWU2      GS-------------------PGTSLVALEERHSPMA-------EAYRHL-RTSLLF-SS
A0A2V8EPD9      SSLIAVPASADQLTLWRSDPETAGKLVGTDGFLPSAM-------EQYRKL-AAILHH-AQ
A0A3N5NSX5      ---------------------GNNHPLLSQEVPHEFG-------EAFRAL-RTSLVF-SS
A0A2V8MUA1      AGMVAVSVGHDSINKFSLDYADIRIKKVVLDPLTVSG-------EQFRVV-RAQLSA-LQ
A0A2V8MBH9      ALQKRNGNTS-----------GTPELLLNVNGRSALA-------ESYRQL-RTSVLL-ST
A0A3N5ZPQ7      ---------------------LSQQLETVTNEHSFAS-------EQFASL-KVRIKE-SR
A0A3N5P5F2      ---------------------GSSPLLLNNGAPDSFA-------EAFRAV-RSNVLF-SV
A0A2V9G1P7      ---------------------YWHRIDRDETQHASLV-------EAFRNL-RTSVLL-ST
A0A2V9BCK9      -------------------------AVFCKQSLAVCA-------EQFRTL-RSRLYR-LR
A0A2V9TMX2      GERS-----------------GMLALVTYERPKSEAA-------EAYRAL-RTSILL-SS
A0A2V8N2J7      ---------------------TQPSVVTVEEPDSIAA-------EQYRIL-AMRVQQ-QC
A0A3N6BI26      ESGDS----------------KTDLPAAISPARFRVW-------EAYRSL-RTSILL-SH
A0A2V9JMM3      GDPHLPQPNLRHL--------QKNRVVTVTDPGAIAS-------EQYSIL-AMKLRW-HL
A0A2V9M815      GDPHLPQPNLRHL--------QKNRVVTVTDPGAIAS-------EQYSIL-AMKLRW-HL
A0A2V9A795      NGTASNPAA------------RWHRIDQGQRPQPALI-------EAFRSL-RASVLL-ST
A0A355ESH9      GKAKVAGGGWLEKKKGTPGPQAQIELVPHERPRTLIS-------ESYRSL-RTALLL-SS
A0A3D0NW85      SDRPDEE--------TEP---LNSELLINADPRSSLA-------EAYRQL-RTSILL-ST
A0A353CAT5      AERPAE---------DDP---ANSELLIYADSRSSLA-------EAYRQL-RTSILL-ST
A0A2V9HB55      AN-------------GHE---MRIELAAQHLPKSQMS-------EAFRAL-RTSILL-SR
A0A2V8CU57      EPKVVTPSDWKTYRFGAV---ASRKTIVDPDVESSLV-------EQYRRL-AASLHH-AQ
A0A2V8BDI4      EPKVVTPSDWKTYRFGAV---ASRKTIVDPDVESSLV-------EQYRRL-AASLHH-AQ
A0A2V8F8T3      EPKVVTPSDWKTYRFGAV---ASRKTIVDPDVESSLV-------EQYRRL-AASLHH-AQ
A0A2V9J901      -------------------------MAPAIQTHAEVL-------EAFRSL-RTSILLS--
A0A2V8MKQ7      ---------------------------MVGDARSPVA-------ESYRHL-RTSLLLSS-
A0A3M1SNQ5      ---------------------HQRLISIKA-PNSGYC-------EEYRNL-RTHILHES-
A0A2V8QJ59      ------------------------------------------------------------
A0A1Q7HTA7      ------------------------------------------------------------
A0A2W0B5E2      ---------------------------MAAQATSEQS-------EAYRAL-RTSVLLSV-
A0A2V8NMG8      -------------------------------------------------------MLST-
A0A2V8TBM7      ---------------------------------------------------RTSLLLSS-
A0A1Q7HEZ8      --------------------------MSLKAPASFAA-------EQYQGL-RITIEQLK-
A0A1Q7JW36      --------------------------MSLKAPASFAA-------EQYQGL-RITIEQLK-
A0A1Q7MUR4      --------------------------MSLKAPASFAA-------EQYQGL-RITIEQLK-
A0A3N5PFU4      ---------------------FATQLVSLTNPASFAA-------EQYQNL-RLKIERLR-
A0A4R1LDF1      ---------------------AHALTQEQEKCVYFPL-------ERYRLL-STRVLQVA-
A0A1F2T1R8      -------------------------------PASFAA-------EQYQGL-RLTIERVA-
A0A2V9BW09      ---------------------KRIVAWAD--PHAIGA-------EKFRVL-RYRLQHLR-
A0A3M1SSE1      ---------------------SELLIYDNS-RSSSLS-------EAYRQL-RTSILLSV-
A0A2V9GQV7      ---------------------AARLVLREDGSLNAAL-------EAYRGL-RTRLMRAQ-
A0A2V7YV88      ---------------------KRAELVALD-GQSPAS-------EAYKAL-RTNLLFST-
A0A2V8YCY6      ------------------------------------------------------------
A0A2V8EGM3      ------------------------------------S-------EQFRRL-AATLLQNQ-
A0A2V8FGH1      -------------------------------VEPGLA-------EQFRRL-AATLLQNQ-
A0A2V8D468      ---------------------GTHSLINNG-APPNLA-------EAFRAL-RTSVMFSS-
A0A1F2R977      ---------------------GKLVTGS---MRPVSQ-------EEYRRL-AAVLHQMQ-
A0A2U3LF12      ---------------------EHRLTVLSD-PQSIAS-------QQYGIL-TLKIQRWR-
A0A3N5G7M6      ---------------------ARPLLVDRE-ISTGFG-------EAFRAF-RTNVRLSM-
A0A1F2S3Q7      ---------------------DTLLVSLTA-PASFAA-------EQYQGL-RLAVERLA-
A0A2V8GVG4      ---------------------DQHLVTLTS-PGSFAA-------EQYQGL-RLTIERLR-
A0A143PNR5      ---------------------GDERMVGAG-LRQAVV-------EEYRKL-ASSLHQAQ-
A0A2V8PJQ0      ---------------------STALAMVED-VRSHVA-------ESYRHL-RTSLLLSS-
A0A2V8H566      -------------------------------INQGVL-------EQYRKL-AASLHYAQ-
A0A3N5YKY1      -------------------------------FGSPAA-------EQFRAL-RTRIGQVEF
A0A2V8UVN4      ---------------------VETPVLPFDVRDGRAG-------EQYRTA-RTKL--LH-
A0A321LXF5      ---------------------QLLLVPQYNLPMQQAM-------EAYQTL-RTRLVKHE-
A0A5M8SBZ0      ---------------------NMLFLQEES-QVTPWA-------EQFRAI-RSRLYRIR-
A0A1Q7JFB1      -------------------------MVTER-PEQSTI-------EQYRKL-AATLHHAQ-
A0A2V8DMJ9      ---------------------LVSLV---A-RDSCAA-------DQYRAL-RQTVERLR-
A0A2V8GGF6      ---------------------IVSLV---D-PASFAA-------DQYRSL-RHSIERLR-
A0A2V8HKU7      ---------------------IVSLV---D-PASFAA-------DQYRSL-RHSIERLR-
A0A1Q6Y875      ---------------------SLVLF-NEQ-SFDQCA-------EQFRIL-RARLYRLR-
A0A523DJA9      ---------------------DEF------------G-------EAFRSL-RTSLVFTA-
A0A2V8I604      -----------------------------A-PQSLAA-------EQYRSV-RTRIRQAE-
A0A2V8J066      -----------------------------A-PQSLAA-------EQYRSL-RTRISRME-
A0A1I6MMC5      ---------------------QLPAL---G-ERGASV-------EQFRTL-RSRVQEFR-
A0A2V9D5W7      ---------------------VDVFS-DQG-RSALGA-------EQFRTL-RSRLCQLR-
A0A2V9D4I4      ---------------------CTVFS-NPA-LSTLCA-------EQFRTL-RSRLYQLR-
A0A2V9D6L7      ---------------------STIFS-NPA-LSTIGA-------EQFRTL-RSRLYQLR-
A0A2V8ZJV2      ---------------------NSVFV-NAR-PGQEGS-------ERFRTL-RSRLDKIA-
A0A2V9AWB5      ---------------------NSVFL-NSK-PGEEGP-------ERFRTL-RLRLYKIA-
A0A2V8Z1Y8      ---------------------SSVFG-DPA-AGHAGA-------EKFSTL-RSRLYQIA-
A0A1Q8AX10      ---------------------YAVFC--KQ-SLAVCA-------EQFRTL-RSRLYRLR-
A0A2V9A773      ---------------------YDVFS-TKQ-SSALCA-------EQFRTL-RSRLYRLR-
A0A2V9AND3      ---------------------YDVFS-TKQ-SSALCA-------EEFRTL-RSRLYRLR-
A0A2V9BTJ7      ---------------------MSVFE-GGD-DGHVGA-------ERFRTL-RSRLYQIG-
A0A2V8W2M7      ---------------------FSLFHRTDD-DAKIGT-------ERFRTL-RSRLYQIA-
A0A2V8XNW2      ---------------------FSLFHRTDD-DAKIGT-------ERFRTL-RSRLYQIA-
A0A1Q7CJC1      ---------------------FSLFHRTDD-DAKIGT-------ERFRTL-RSRLYQIA-
A0A2V9UEM7      ---------------------TMLFFQE-D-ENRKGA-------EEFRTL-RSRLYQIR-
A0A1Q7V300      ---------------------TMLFFSG-E-EHLYGM-------EEFRTL-RSRLYQAR-
A0A2V9ZCI3      ---------------------TMLFFTK-E-DHAPGM-------EEFRTL-RSRLYQLR-
A0A2V9WCB3      ---------------------SMLFMNG-D-DHARGT-------EEFRTL-RSRLYHLR-
A0A2V9VQW5      ---------------------TMLFFNP-E-ENALGT-------EQFRTL-RSRLYQMR-
A0A2V9WTP3      ---------------------TMLFLNG-D-DNARGS-------EEFRTL-RSRLYQIR-
A0A2V9NLA9      ---------------------TMLFFNG-D-EQGYGT-------EEFRTL-RSRLYQLR-
A0A2V9RKJ9      ---------------------TMLFFNG-D-EQGYGT-------EEFRTL-RSRLYQLR-
A0A2V9RN95      ---------------------TMLFFNS-D-EQGYGM-------EEFRTL-RSRLYQMR-
A0A2V9N406      ---------------------TMLFFNSDD-EQGYGM-------EEFRTL-RSRLYQMR-
A0A2V9U6D9      ---------------------TMLFFNSED-EQGYGM-------EEFRTL-RSRLYQMR-
A0A2V8DZN4      -------------------------ISFRQ-KTSLLA-------ESFRTTLTSILFSQR-
A0A2G6HQA4      -------------------------YSANH-SVDSLT-------EIFKTLRARILLTKK-
A0A2V7ZTY7      -------------------------VTTDG-LDFSTV-------EQYRKL-AATLHHAQ-
A0A2V7ZVL9      -------------------------VTTDR-LDFSTV-------EQYRKL-AATLHHAQ-
A0A1Q7QYI4      -------------------------VVTER-PEQSTI-------EQYRKL-AATLHHAQ-
A0A2V8G9Y9      -------------------------IVTPT-VPHAAV-------EQYRKL-AASLHHAQ-
A0A143PXU3      -------------------------VSAAD-ANPVLI-------EQFRNL-AAALNRLQ-
A0A2V8D8G9      ---------------------IQARLVTGA-LSTVSL-------EQYRRL-AAVLHEDQ-
A0A2V8ESQ4      ---------------------IQARLVTGA-LSTVSL-------EQYRRL-AAVLHEDQ-
A0A1E3Y5Q0      -------------------------VVDSG-MDAGSR-------EQYRRM-AATLHALQ-
A0A2W4TWK5      -------------------------VIDRE-LDPVSR-------EQYRRL-AMALHAAQ-
A0A3N5NYV3      -------------------------VVTPS-ISPVSL-------EQYRRL-AATLHRRQ-
A0A2V2RJF9      ---------------------EAIDLLTHYNPTSVAS-------EAFKTV-RTS-LLLSF
A0A2G6HNT3      ---------------------IEEDWEKRLYNANYSVDSLT---EIFKTL-RARILLSKE
A0A2V7YWD4      ---------------------LDPRLVSFLKPESFEA-------DQYRML-RYA-MERAC
A0A2V2R8T6      ---------------------VEPHLVAIRQPQSAYA-------EQFRSL-RTR-ILQAG
A0A1Q7RGF1      ---------------------VGKLLGQFGSGPALEAAE-----ESYRAL-RTR-LLRAR
A0A2V9BLX2      ---------------------VGKLLGQFGSGPALEAAE-----ESYRAL-RTR-LLRAR
A0A2V9ZA03      ---------------------PNPRLVAMMEREGVGA-------EKFRVL-AAR-LQYFR
A0A3N5ZNH4      ---------------------EDENSTALLNANELRFRVW----ESYRSL-RTS-ILLSN
A0A2V8GEZ2      ---------------------VRATIDRLPGKVVLSPDTPSAVVEQYRRL-AAT-LHHAQ
A0A3N5ZFD3      ---------------------VRERIVTGHAETNGNLAVMTVATEQYRRL-AAT-LHHAQ
G8NXD3          ---------------------LERLPQKHRTTIAFESGADSRACEQFRLM-QHR-LVTAR
A0A2V9VR38      ---------------------RTRHPSQAAVPNGGVL-------PRSAYF-PAA-VEFRR
A0A2V9EY04      ---------------------DQSSKVAL---------------EAYRAL-RTR-LMRAQ
A0A2V9HAK9      ---------------------DDSLDAAL---------------EAYRGL-RAK-LMRAQ
A0A1Q7FS15      ---------------------GEASRAAL---------------EAYRGL-RTR-LMRAQ
A0A1Q7K9P1      ---------------------GEASRAAL---------------EAYRGL-RTR-LMRAQ
A0A1Q7N989      ---------------------GEASRAAL---------------EAYRGL-RTR-LMRAQ
A0A2V9G7Y0      ---------------------DDFLIAAL---------------EAYRGL-RTR-LMHAQ
A0A2V8T7Z1      ---------------------VEGHVVALTAPGSFEA-------EQYRTL-NLV-LERMQ
A0A2V7U8G5      ---------------------VEDHLACLLSPQSFEA-------DQYRVL-RQF-LTEAR
A0A2V7UNP9      ---------------------VEEHLASLLSPYSFEA-------DQYRLL-RQS-V-EQL
A0A2V7VLD7      ---------------------VEEHLASLLSPYSFEA-------DQYRLL-RQS-V-EQL
A0A2V7XGA3      ---------------------VDDHLVAVHSPQSFEA-------DQYRIL-RHF-LDQDS
A0A2V7YAG6      ---------------------LDEHLVSLLNPQSFEA-------DQYRIL-RHF-VDQAK
A0A2V7VK33      ---------------------LEERLVSLGQPWSLEA-------DQYRML-RCE-IEYLR
A0A3M1VTE1      ---------------------PTEELVVAREPNCPAA-------EAYLRL-RSA-LLHES
A0A2V7TTM7      ---------------------VDERLVSLRSPNSFEA-------DQYRVL-RHF-LEAAG
A0A2V8VI82      ---------------------IDQRLVSLLAPDSFEA-------EQYRTL-RHV-VEERR
A0A2V7U4P9      ---------------------PADHLVSLVAPTSFEA-------EQYRIL-RHA-IERRH
A0A2V7TQY5      ---------------------IDQHLISLLQPRSFEA-------EQYRVL-RHV-IEEGK
A0A2V7TU87      ---------------------LDERLVSLVAPHSYEA-------EQYRGL-RHL-VEQAH
A0A2V8SEH0      ---------------------ADEHLVSLLVPNSIEG-------EQYRAL-RHQ-IEQRH
A0A2V8VU54      ---------------------LDPHLVSLVAPASFEA-------EQYRAL-RSR-LESRP
A0A1Q7RML7      ---------------------LDRHLVSLVAPASFEA-------EHYRML-RAR-LESRQ
A0A1Q7ZIQ5      ---------------------LDRHLVSLVAPASFEA-------EHYRML-RAR-LESRQ
A0A2V8TKD8      ---------------------LDRHLVSLVAPASFEA-------EHYRML-RAR-IEARQ
                                                                            

A0A1F2U8T6      PGDG-PKTMAVTSAQPLEGKTTTACNIALALAYGGM--RVLLIDADLRRPGLHLSLR-LT
A0A2V8BV42      PATG-TKTLLVTSAQPLEGKTTTAANIAMALAYGGS--RVLLIDGDMRRPGLHRPLR-LT
A0A2V8F916      PATG-TKTLLVTSAQPLEGKTTTAANIAMALAYGGS--RVLLIDGDMRRPGLHRPLR-LT
A0A1Q7K833      PGEG-TKILVVTSAQPLEGKTTTAANIAMALAYGGS--RVLLVDADMRRPGLHRPLR-LT
A0A1Q8AMY4      PGEG-TKILVVTSAQPLEGKTTTAANIAMALAYGGS--RVLLVDADMRRPGLHRPLR-LT
A0A2V8BM40      PTDG-TKIIAVTSAQPLEGKTTTAANMALALAYGGS--RVLLIDADMRRPGLHRPLR-LT
A0A2V8CRT6      PTDG-TKIIAVTSAQPLEGKTTTAANMALALAYGGS--RVLLIDADMRRPGLHRPLR-LT
A0A1F2VH76      PGDG-PKVMAVTSAQPLEGKTTTAVNIAMALAVGGS--RVLLIDADMRRPSVHKALR-MT
A0A1F2R0X5      SGEG-TKLMAVTSAQPLEGKTTAACNIAMALAYGGA--RVLLIDADMRRPGLHRTLR-LA
A0A2V8B278      PSAG-TKIVVVTSAQPLEGKTTTAANIAMALAYGGS--RVLLVDADMRRPGLHRPLR-LT
A0A2V8CEF9      PSAG-TKIVVVTSAQPLEGKTTTAANIAMALAYGGS--RVLLVDADMRRPGLHRPLR-LT
A0A2V8KZG2      ------------------GKTTTASNIAISLAQLGG--SVLLIDCDLRKPSIHTAFG-IS
A0A1Q7LG57      QNGDCPGVVVLTSPSSGDGKTTVACNLAIAMAEI-GR-KVLLIDGDLRRPRLHKVFG-AP
A0A2V8YMQ4      ADHP-PGSLLITSTQPGEGKTTVATNLAISLAQL-GQ-RVLLVDADLRFPSLQRLFC-IR
A0A1Q7L5B1      DNEP-LHTLLVTSSLPAEGKSFVSLNLALAMMRQHNR-YVLLVDGDLRAPKLATCLG-VP
A0A2V9DKV4      DNEP-LHTLLVTSSLPAEGKSFVSLNLALAMMRQHNR-YVLLVDGDLRAPKLATCLG-VP
A0A2V8W380      PDRP-PSSLLVTSTQPADGKTTVACNLAISLAQL-GH-RVLLVDADLRSPSLHKLFG-ID
A0A2V8ZIV5      ADHP-PGSLLVTSTQPGEGKTTVATNLALSLAQL-GQ-RVLLVDADLRFPSLQSLFG-MR
A0A2V9EVA0      EKKP-FRTLLVTSAQAGEGKSFVSLNLARAIVHQHER-HALLIDADLRAPKLHVSLG-TP
A0A1Q7RB73      ERQP-LQSLLVTSPLPSEGKTVVAANLAQVLVQQREQ-RVLLVDSDLRYSRMHLSLG-AS
A0A2V9K0H7      EQLP-LQSLLVTSPLPSEGKTVVAANLAQVLVQQREQ-RVLLVDSDLRYSRMHLSLG-AS
A0A3N5YN96      GGRD-CRSLVVTSPMPGDGKTVTSANLALSMAQEFHR-KVLIIDADLRKGALHRMFG-VD
A0A1Q7Y646      ERRK-MQAFVVTSAGVGEGKTLTALNLAWLLAQTDGV-RALLIDSDLRQPCATEYLG-ID
A0A2V8QZU0      ERKK-MQAFVVTSAGVMEGKTLTAINLSWLLAQTDGV-RALLIDGDLRNPCAGDYLG-LD
A0A2V8RSQ9      ERRK-VQAIVVTSAGIAEGKTITALNLAWLLAQTDGV-RALLVDGDLRQPCAAAYLA-FD
A0A2V9LS17      ETSA-TRSLLVTSASPREGKSFISSNTAQILARQPDK-RVLLIDADLRWSRLHLFLG-TP
A0A2V9AGR3      ATRP-LRRVLITSSLPAEGKSFIAANLAQSLACRQDS-RVLLIDGDLRAPRLHLALC-AP
A0A2V9G0N7      GTHV-LKRIVITSSVPAEGKTFVAANLAQSIIRQPDR-RVLLIDADLRASRLHVALG-AP
A0A2V9GQ44      GTHV-LKRIVITSSVPAEGKTFVAANLAQSIIRQPDR-RVLLIDADLRASRLHVALG-AP
A0A2V9HRN3      GTRV-LKRIVITSSVPAEGKTFVAANLAQSIIRQPDR-RVLLIDADLRASRLHVALG-AP
A0A2V8WG13      ATRP-LKRVLVTSSVPSEGKTTVAANLAHSIMCQPDR-RVLLIDADLRCSGMHELLG-AP
A0A2V8X987      GTRT-LRRLLITSSVAGEGKTFVASNLGQSIVRQPGR-RVLLLDADIRMSRLHVGLG-AP
A0A1Q7KX94      STRK-LQKVLITSGVAAEGKTFVASNLAQSIVQQPEL-RVLLIDADLRSSRLHVLFG-AP
A0A2V8XHT0      STRK-LQKVLITSGVAAEGKTFVASNLAQSIVQQPEL-RVLLIDADLRSSRLHVLFG-AP
A0A2V9L2P7      AERP-PQLLLVTSAQPHEGKTATSLNLAFTLAQM-GS-RALVVDADLRKRRIARALQ-MS
A0A2V7UMX0      REGG-LRLVAVTSPFAGDGKTTTSINVAATLAQAPGS-RTLLVDCDLRLPAVAKYLR-VE
A0A136K497      QRQH-LKSIVVASVNPSEGKSVTAVNLAWMLAQTDGV-CALIIDSDLRMPSLADYLG-IE
A0A399W9E4      QRQN-LQAIVVASANPSEGKSVTAVNLAWMLAQTDGV-RALIIDSDLRMPSLADYLG-IE
A0A2V7X0V9      EKMT-LKKLLVTSALPKEGKSFTSSNLAQVLVRQHGR-RVLLIDADLRGPRLHLMLG-TT
A0A2V9X518      EKMP-LKKVLITSALPKEGKTFVAANLAQVMVRQHGR-RALLIDADLRGARLHQALG-TS
A0A2V9VC62      EKIS-LKKILITSALPQEGKSFVAANLAQVLVRQHGR-RVLLIDGDLRVARLHTALG-TT
A0A2V9S1P8      EKQS-LKKVLVTSALPKEGKSFVAANLAQVMVRQEGR-RALLIDSDLRGSRLHEALG-TS
A0A2V9RTW2      EKQA-LKKVLVTSALPKEGKSFVAANLAQVMVRQHGR-QALLIDADLRGARLHHLLG-TS
A0A2V9TGF1      EKQA-LKKVLVTSALPKEGKSFVAANLAQVMVRQHGR-QALLIDADLRGARLHHLLG-TS
A0A2V9XEV6      EKMP-LKKVLITSALPKEGKTFVAANLAQVMVRQHGR-RALLIDADLRGARLHQALG-TS
A0A2V9Y3Q6      EKMS-LKKLLITSALPKEGKTFVAANLAQVLVRQHGR-RALLIDADLRGARLHQALG-TN
A0A2V9R269      EKQP-LSKLLITSALPKEGKSFTTANLGQVMVRQHGR-RVLLIDADLRNPQLHNQFG-AE
A0A2V9PTS3      EKQPLLSKLLVTSPLPKEGKSFTAANLAQVIVRQHGK-RALLIDADLRCPQLHVLVG-AE
A0A2V9NPF4      EKQPLLSKLLVTSPLPKEGKSFTAANLAQVIVRQHGK-RALLIDADLRCPQLHVLVG-AE
A0A2V9PNZ0      EKQPLLSKLLVTSPLPKEGKSFTAANLAQVIVRQHGK-RALLIDADLRCPQLHVLVG-AE
A0A321LMC5      AKHN-RRSLLVTSALEGEGKTTIATNLAWVMARQSGK-KVLLLDADLRRPSICKMLG-LK
A0A2V8X713      EKNP-IRILLVTSTLPGEGKTFVALNLALAITRQHER-GALLIDADLRASRLHVRMG-AP
A0A2V8ZLE9      EKNP-IRTLLVTSALPGEGKTFVALNLALAIARQHER-KALLIDADLRASSLHARLG-AP
A0A2V8Y4D3      EKSP-LRTLVVTSTLPGEGKTFVALNLALAIARQHER-RALLIDADLRASRIHVGLG-AP
A0A2V8Z2X8      KKSA-IRTLLVTSTLPGEGKTFVALNLALAIARQHEK-RALLIDADLRASRLHVRLG-AP
A0A2V9C3F6      EKSP-IRTLLVTSTLPGEGKTFVALNLALAIARQHER-RALLIDADLRASRLHVRLG-AP
A0A2V9QMU9      VGAA-PKVVVVTSALPSEGKTTTSINTAIVLAQK-GN-RVLLVDADLRRPSIHKTLG-MG
A0A2V9QY75      LGAP-PKIILITSALPREGKTTTSVNTAIVLAQK-GT-RVLLIDADLRRPSIHKALG-MG
A0A2V9SVU9      LGAP-PKVILITSALPQEGKTTTSINTAIVLAQK-GV-RVLLIDADLRRPSIHKTLG-MG
A0A2V8W5N5      GNQP-SYTLLVTSSLPDEGKTFVAQNLSQAIVQKPRQ-RVLMIDADLRYPQLHLALG-AP
A0A2V8XG53      GNQP-SYTLLVTSSLPDEGKTFVAQNLSQAIVQKPRQ-RVLMIDADLRYPQLHLALG-AP
A0A2V9XV04      EKMP-LKKLLVTSALPKEGKSFTSANLAQVMVRQHGR-RALLIDADLRGPRLHQMLG-AP
A0A2V9CBY1      DTRP-IQTLLITSTIAAEGKTFVAMNLAQSIARQRGR-RALLVDADLRASRLHIALG-AP
A0A2V9D656      DTRP-IQTLLITSTTAAEGKTFVAMNLAQSIARQPGR-RALLVDADLRASRLHIALG-AP
A0A352EZH8      EREQ-MRTFVVTSAGMGEGKTLTALNLAWLLAQSEGV-KALVIDSDLRQPCATNYLA-ID
A0A0B6X033      EKRQ-VQAVVITSAGVLEGKTVTAINLAWLLAQTDGV-RALLIDGDLRRPCALSYLG-LD
A0A2V8R0I3      ERKR-MRAFVITSPGVGEGKTLTALNLAWLLAQTDGV-KALLIDADLRQPCAAAYLG-IE
A0A2V8N1U8      ERER-KRAFVVTSAGIGEGKTLTTLNLAWLLAQTDGV-TALVIDADLRQPCAADYLG-IE
A0A2V8QL35      EREH-KRAFVITSAGQGEGKTLTALNLGWLLAQTDGA-TALLIDADLRQPCAAEYLG-IQ
A0A352FU10      EREH-KHAFVVTSAGMGEGKTLTALNLAWLLAQTDGA-TALLIDADLRQPCAAEYLG-IQ
A0A2V8LCU0      ERQG-KRAFVITSAGMGEGKTLTALNLAWLLAQTDGV-SALVIDADLRQPCAAEYLG-IE
A0A1Q7NGT0      ERQR-MRAFVITSAGVGEGKTLTALNLAWLLAQTDGV-RALVIDADLRQPCAADYLG-IE
A0A2V8MLP9      ERQR-MRAFVITSAGIGEGKTLTALNLAWLLAQTDGV-KALVIDADLRQPCAADYLG-IE
A0A2V8PQZ0      ERQR-MRAFVITSAGIGEGKTLTALNLAWLLAQTDGV-KALVIDADLRQPCAADYLG-IQ
A0A3B9MKY6      ERKQ-MRAFVITSAGVGEGKTLTALNLAWLLAQTDGV-RALVIDSDLRQPCATEYLG-ID
A0A3D5SKZ1      ERKQ-MRAFVITSAGVGEGKTLTALNLAWLLAQTDGV-RALVIDSDLRQPCATEYLG-ID
A0A2V8NRW2      ERKK-MQAFVVTSAGVAEGKTLTALNLAWLLAQTDGV-RALIIDSDLRNPCAADYLG-IE
A0A2V8TKR9      AGSP-PKIVLVTSAQPGEGKSTTVVNTAISLAQLGS--SVLIIDCDLRRPSTHKILG-IN
A0A2V8LBV1      NGAP-PHVLVITSTSPRDGKSTIASNLAVALAE-TKR-RILLIDADLRRPHLHTVFE-MD
A0A2V8GAF9      RESG-LQVLAVTSPGPGDGKSVTALNVAGALAQSPHA-QILIVDADLRRPTVAEYLG-LG
A0A2V8CN98      GTAG-PLVVTITSPGPGDGKSFVSANLALACAQ-AGQ-RTLLIDGDTRRGALHRVLG-AV
A0A1Q7LC46      ADHP-PQVILVTSALPREGKTTAAANLAVTLAQ-LGD-STVLVDADLRKPGIGRLLN-LG
A0A1Q8BDC5      SKAS-LKVLTVSSPDPRDGKSLISSALAFSFSMDPGR-RVIIVDCDLRNPSLDGYLG-VT
A0A2V9Q1Y8      LGAP-PKTILITSALPQEGKTTTSINTATVLAQ-KGT-RVLLIDADLRRPSIHKTLG-MG
A0A2V8JXG1      AGNP-PKTILVTSVRMEEGKTTTATNTAIALAQ-LGA-SVLLIDCDMRKPSVHDVFG-TS
A0A350D2W9      PQGS-LKTIMVTSPLPEEGKSATISNLAVSLAQ-TGK-KILLIDADLRRPKQHQIFK-MK
A0A2V9I4J1      ADHA-VQTIAISSPRPQDGKSLIAVNLAFCLAQDLDR-RVILVDGDLRNPTVNRYLG-VS
A0A2V8PQZ9      ERQR-MRAFVITSAGVGEGKTLTALNLAWLLAQTDGV-RALVIDADLRQPCAADYLG-IE
A0A2V8D8B1      VDNG-TQSICITSSGPGEGKTLVGSNLAVALGQ-TGQ-RVLLIDADMRRPRVHEVFE-MA
A0A3B9LSB4      AGRA-PRSLLVTSSLPGEGKTTTAVNTAVSLAQ-TGA-SVVIIDADMRRPRLRSIFG-LS
A0A2V9H7U2      APRP-PQVLLITSATAREGKSTTALNLAIALAQ-RGD-STLIIDADLRRPGIAESLD-ID
A0A2V8NJB5      SDNP-AQVMIVSSPENGDGKSLVSANLALSYSLEVAR-RVIIVDCDLRNPSLHRYLG-VT
A0A2V9JMZ4      ADHA-VQTIAISSPRPQDGKSLIAVNLAFCLAQDLDR-RVILVDGDLRNPTVNRYLG-VS
A0A2V9MDJ6      ADHA-VQTIAISSPRPQDGKSLIAVNLAFCLAQDLDR-RVILVDGDLRNPTVNRYLG-VS
A0A2V8QJT6      AGRA-PKTLLVTSSLPGEGKTTTAVNTAISLAQ-TGA-SVVIIDGDMRRPRLRSIFD-LP
A0A2V8FSM8      NGAY-PRVLVLTSASPKEGKTTVVSNLAITVAE-IRR-RVLVIDADMRRPRLHKVFS-VD
A0A359M0J2      GSLA-PGLVLVTSPSPGEGKTTIAANLGVAMAE-VNR-RTVVIDMDLRRPSLHNTFGSIP
A0A2V8JLJ1      RKKH-LKTILISSSGAGEGKTFSACCIAGMLAQEPGK-QVLLIDADLRRSTATTVLG-TP
A0A5M8SND8      GGKT-PQVLAVTSANPREGKTTVLCNLAVAMAE-IRK-RVLVIDADLRRPRLHDVFD-LP
A0A2V9GAQ1      ADHP-PQVILVTSALPREGKTTAAANLAVTLAQ-LGD-STVIVDADLRKSGIGRLLN-LA
A0A497EDQ8      RDEG-CQILLVTSSVPSEGKTTASFNLAKVLAA-GGA-RVLLIDGDLRKPRLHHMMK-VK
G8NS05          AGKL-PKVILLTSATPSEGKTTVSTNLACVFAQ-RDV-RVLLIDADLRRPTVHHRLG-LN
A0A2V8KZ20      RKKH-LKTILISSSGAGEGKTFSACCIAGMLAQEPGK-QVLLIDADLRRSTATTVLG-TP
A0A3D0NWU2      AGKP-PQSILVTSSQPSEGKTTTAINTAITLAQ-ADV-DVVIVDCDLRRPRIHNYFD-LE
A0A2V8EPD9      MERG-LKVIMTSSAMPGEGKSLTSVNLALTLSDSYRK-RVLLIDVDLRRPTVQRIFG-LP
A0A3N5NSX5      GTEG-TRVIALTSAQPLEGKTTTACNMAIALAY-GGS-RVLLIDADMRRPSVSRTLG-IE
A0A2V8MUA1      KKRN-LSRILIASAIPNEGKTFSACCLAGILAQEPRK-RVLLIDADVRTGSISHTLGIID
A0A2V8MBH9      AGRA-PKTLLITSSLPGEGKTTTAVNTAITLAQ-TGA-SVVIIDADMRRPRLRSIFD-LP
A0A3N5ZPQ7      AGSP-HKVITVTSPHIQDGKSLVSANLAFSFARDSGT-RTILVDCDLRRPSLHRYLG-IP
A0A3N5P5F2      S-PE-CRRLVVTSTAPREGKSVVASNLAAGLAM-AGH-RVVLIDADMRRPRVHAIFD-VE
A0A2V9G1P7      PDRP-PSSLLVTSTQPAEGKTTVACNLAISLAQ-LGH-RVLLLDADLRYPSLHKLFG-TS
A0A2V9BCK9      DKQP-VRTLLVTSAVPGEGKTFVSLNLALAIARQHER-RALLIDGDLRASRLHVRMG-AP
A0A2V9TMX2      FGAP-PKVILVTSAMPREGKTTISANSALVLAQ-RGS-RVLLVDADLRRPGVEKLFG-IR
A0A2V8N2J7      DAAQ-AKTVIVTSAAGGEGKSLTAINVAMALAAATDG-RVLLMDADMRKPRIGEYLK-LS
A0A3N6BI26      SGKP-PKVIMVTSSVPGEGKTTTVANTGIVLAQ-TGA-RTLLIDLDMRKPALASTFG-YN
A0A2V9JMM3      GEAP-SRVLTVTSASGGEGKTLTAVNLSFALAESGLG-KVLLLDADLRKPRTHEYLG-IE
A0A2V9M815      GEAP-SRVLTVTSASGGEGKTLTAVNLSFALAESGLG-KVLLLDADLRKPRTHEYLG-IE
A0A2V9A795      ADHP-PGSLLITSTQPGEGKTTIATNLAISLAQ-LGQ-RVLLVDADLRFPSLQRLFC-IR
A0A355ESH9      A-RE-LKVVAVTSAMAGEGKTATASNLAVVLAQ-LGR-PVVIIDCDLRKPRIHQVFK-LS
A0A3D0NW85      AGHA-PKSLLVTSSLPSEGKTTTATNTAISLAQ-TGA-KVLIIDADMRRPRLHSVFG-VS
A0A353CAT5      AGHP-PKSLLITSSLPSEGKTTTATNTAISLAQ-TGA-RVLIIDADMRRPRLHSVFN-IT
A0A2V9HB55      ADHP-PQVILVTSALPREGKTTAAANLAVTLAQ-LGD-STVIVDADLRKPGIGRLLN-LG
A0A2V8CU57      LQRN-VRTVMITSAVAAEGKTLTATNLALTLSHSYKR-RVLLIDADLRRPTVHEAFR-IA
A0A2V8BDI4      LQRN-VRTVMITSAVAAEGKTLTATNLALTLSHSYKR-RVLLIDADLRRPTVHEAFR-IA
A0A2V8F8T3      LQRN-VRTVMITSAVAAEGKTLTATNLALTLSHSYKR-RVLLIDADLRRPTVHEAFR-IA
A0A2V9J901      ASPV-PRVILITSALPGEGKTTTAVNLGAALASFGS--KVVVIDCDMRRPSCHRSVG-VK
A0A2V8MKQ7      AGTP-PRTILVTSSQPSEGKTTTAINTAFMLAQTGA--EVLIIDGDLRRPRLHAHFN-IP
A0A3M1SNQ5      QKRH-LKVITITSINPNEGKSITALNLAWLLAQTDGI-STLLIDADLRNPSLASYLG-IE
A0A2V8QJ59      ---------LVTSSQPSEGKTTTAINTAFILAQTGA--EILLIDCDLRRPRLHVHFN-IS
A0A1Q7HTA7      ----------MTSATSGEGKTTTAINLAAAMAQDAEA-RVLLVDADLRAPSVAPLLG-LG
A0A2W0B5E2      ASRA-PQTVLITSAKIGEGKSSTALNLAMALAQCGS--SVVLLDCDLRKPVLARLLG-IQ
A0A2V8NMG8      AGRP-PQTLLITSSVPSEGKTTTSINTAISLAQTGA--NVLIIDADMRRPRLHSIFD-VE
A0A2V8TBM7      AGQP-PKTVLVTSSQPSEGKTTTVVNIATMLAQTGA--DVLVLDCDLRRPRVHAHFG-LP
A0A1Q7HEZ8      RLRD-VRLIAVTSPSAGDGKTVTALNLAGVLACGSDA-RVLLIDADLRRPTVAARLG-IG
A0A1Q7JW36      RLRD-VRLIAVTSPSAGDGKTVTALNLAGVLACGSDA-RVLLIDADLRRPTVAARLG-IG
A0A1Q7MUR4      RLRD-VRLIAVTSPSAGDGKTVTALNLAGVLACGSDA-RVLLIDADLRRPTVAARLG-IG
A0A3N5PFU4      QTRD-LRVIAVTSPGAADGKTVTSINLAGALARGAAA-RVLLVDADLRRPQVADHLH-I-
A0A4R1LDF1      RNLK-SKVFLITSAIAEEGKTITAANLAFALSGASSI-RTLIIDLDLRRPSLATRLG-IK
A0A1F2T1R8      RARD-VKIIAITSPAAGDGKTVTAVNLAGALARGSDG-RVLLIDADLRRPSVATLLG-IE
A0A2V9BW09      MARA-LSKVLVTSAIPREGKTVVATNLAFTLARSSS--HVLLVDADLRLSAVHQMLG-IP
A0A3M1SSE1      AGHA-PKSLLVTSSLPAEGKTTTAVNTAITLAQTGA--KVLVIDADMRRPRIHSIFN-IS
A0A2V9GQV7      SKSG-LHSIVITSSLPGEGKTLTTMNLGLCYAQLPQQ-RVLVIDGDMRAHGLTSMLD-HP
A0A2V7YV88      IDHE-LKTIVLTSAAPGEGKSRTASNLAIALAHAGQ--RTLLIDADFRRPSLHRIFG-RI
A0A2V8YCY6      ------QVILVTSALPREGKTTAAANLAVTLAQ-LGD-STVLVDADLRKPGIGRLLN-LG
A0A2V8EGM3      RGEN-IRSVMITSAVPADGKTLTALNLSLILSESYKR-RVLLIDGDLRRPTISAATN-LA
A0A2V8FGH1      RGEN-IRSVMITSAVPADGKTLTALNLSLILSESYKR-RVLLIDGDLRRPTISAATN-LA
A0A2V8D468      AGGR-APTILVTSTGPGEGKTMTSCNLAVSIAQTRQ--RVLLIDADMRRPRVHEVFD-VE
A0A1F2R977      AEHK-VKTLMVTSALPREGKTLTVTNLALTLSEYFGR-RVLLIDGDLRHPSIHEILG-LP
A0A2U3LF12      EQTG-GRVLVVTSAAGGEGKSLTALNLSMALASSVEG-RVLLVDCDLRRPQVHERLG-LK
A0A3N5G7M6      LPGG-MRSVVVTSACAGDGKTLVASNLAVALALAEH--RVLLIDADLRRPTLHTAFN-VK
A0A1F2S3Q7      RARD-VRTIAVSSPAAGDGKTVTAINLAGTLARGSDD-RVLLVDADLRRPSVASLLA-IP
A0A2V8GVG4      RGRT-LQVIAVTSPAAGEGKTLTAINLAGALARGADDARVLLIDADLRRPAVAKQLA-ID
A0A143PNR5      INHR-LQVVLVASAVPGEGKSLTAANVALTLTTSYSR-KVLLIDADLRRPSLHGLFR-AP
A0A2V8PJQ0      AGQA-PKTILVTSSQPSEGKTTTAINTAFMLAQT-GA-EVLIIDCDLRRPRLHSNFN-IS
A0A2V8H566      SQHG-TRVLMMTSTLASEGKTLTATNLALTLSESYRR-RVLLIDADLRRPTIHDMFD-LP
A0A3N5YKY1      GGRD-CRSLVVTSPMPGDGKTVTSANLALSMAQEFHR-KVLIIDADLRKGALHRMFG-VD
A0A2V8UVN4      HPRQ-PRLVVISSAGSGDGKTVTSINLAGAMSLKTEA-EILLIDADLRKAQIAPLLG-IS
A0A321LXF5      GRHG-MRSLVISSAAPGDGKTLTAFNMALCFARIQNW-PVLLVDADLRTQGMSSLLG-RA
A0A5M8SBZ0      QKQT-LKIILVTSSLPREGKSFLSANLSQIFARQRGC-RTLLVDADLRWPRLHEYLG-AP
A0A1Q7JFB1      TERQ-LKVVMVSSAVSGDGKTLTSTNLALTLSESYRR-RVLLIDADLRRPSVHEVFQ-VK
A0A2V8DMJ9      RERG-FQVIGVTSPCPGDGKTVTTLNLAGALAQSPDS-RVLVVDADLRRPSVAEYLA-LP
A0A2V8GGF6      TDAS-SRVLAITSPGPGDGKTLTTLNLAGALAQCRDL-RVLVIDADLRRPAVSEYLG-LE
A0A2V8HKU7      TDAS-SRVLAITSPGPGDGKTLTTLNLAGALAQCRDL-RVLVIDADLRRPAVSEYLG-LE
A0A1Q6Y875      EKKP-FRTLLVTSAQAGEGKSFVSLNLARAIVHQHER-HALLIDADLRAPKLHVSLG-AP
A0A523DJA9      GGSS-SRIIGVTSTQPREGKTICVANLGLVLALG-GA-RVLLIDADTRLPALHKSLG-LA
A0A2V8I604      NGRP-LRAILVTSPGKGDGKSLTAANLALTMAQEFQQ-RVLLVDSDLRRPTVHRLFG-LQ
A0A2V8J066      NGRA-VRVLIVTSPAKGDGKSLTAANLALAMAEEFSQ-RVLLIDADLRRPSVHHLFD-LP
A0A1I6MMC5      DLGV-LKTVLVSSGLPGEGKSFVSANLAISLARRKQN-RVLLIDGDMRRSSLHKLLG-AP
A0A2V9D5W7      GNRP-VRTILITSAVAGEGKTFVAFNLAQAIVRQPDQ-RVLIIDADLRCSRLHGIFG-AP
A0A2V9D4I4      ASQR-LGTILITSAVPGEGKTFVAANLAQAIVRQAER-RVLIIDADLRSSHLHRMLG-AP
A0A2V9D6L7      SSQP-LRTILVTSAVAGEGKTFVVANLAEAIGRQRDR-RVLIIDADLRASRLHLMVG-AS
A0A2V8ZJV2      STRK-LKRVLLTSAVAGEGKTFVAFNLAQSIAQQPDL-RVLLVDADLRSPRLHHLFG-AP
A0A2V9AWB5      TTRK-LKRVLITSGVASEGKTFVASNLAQSIAQQPEL-RVLLIDADLRSSQLHVVFG-TQ
A0A2V8Z1Y8      EART-LRRLLLTSTVAGEGKTFVAANLAQAIIREPER-RVLLLDADLRVPQLHAVLG-AP
A0A1Q8AX10      DKQP-VRTLLVTSAVPGEGKTFVSLNLALAIARQHER-RALLIDGDLRASRLHVRMG-AP
A0A2V9A773      EKSP-IRTLLVTSTLPGEGKTFVALNLALAIARQHER-RALLIDADLRASRLHVRLG-AP
A0A2V9AND3      EKSP-IRTLLVTSTLPGEGKTFVALNLALAIARQPER-RALVIDADLRASRLHVRLG-AP
A0A2V9BTJ7      GTRQ-LRRVVVTSSLPAEGKTFVAANLAQSIVRQPDR-KVLLIDADLRASRLHQLLG-AP
A0A2V8W2M7      AAKQ-LRKVLVTSSVPNEGKTFVAANLAQSIVHQPDR-RVLLIDADLRAPLLHVTLG-AP
A0A2V8XNW2      AAKQ-LRKVLVTSSVPNEGKTFVAANLAQSIVHQPDR-RVLLIDADLRAPLLHVTLG-AP
A0A1Q7CJC1      AAKQ-LRKVLVTSSVPNEGKTFVAANLAQSIVHQPDR-RVLLIDADLRAPLLHVTLG-AP
A0A2V9UEM7      EKLP-LKRLMVTSALPKEGKSFVAANLAQVMVRQHGR-RVLVIDADLRSPGMHRHLG-AS
A0A1Q7V300      EKHP-LSKVLVTSPLPKEGKSFVTANLGQVLVRQQGK-RVLLIDADLRNPHLHSTLG-AE
A0A2V9ZCI3      EKMP-LKKILISSSLPKEGKSFVAANLAQVMVKQHGR-RVLLIDGDLRGSRLHQTLG-CP
A0A2V9WCB3      EKMT-LRTVLVTSALPKEGKSFTSANLAQVLVRQHGR-RVLLIDADLRGPRLHLMLG-TP
A0A2V9VQW5      EKAS-VKKILVTSALPQEGKSFVAANLAQVLVRQHGR-RVLLIDGDLRVARLHSALG-TT
A0A2V9WTP3      EKMT-LKKILVTSALPKEGKSFTAANLAQVMVRQHGR-RVLLIDADLRGPRLHLMLG-TS
A0A2V9NLA9      DRLP-LKKVLVTSALPKEGKSFVAANLAQVLVQQQGR-RTLLIDGDLRGARLHNALG-TE
A0A2V9RKJ9      DRLP-LKKVLVTSALPKEGKSFVAANLAQVLVQQQGR-RTLLIDGDLRGARLHNALG-TE
A0A2V9RN95      EKQS-LKKILVTSSLPKEGKSFVAANLAQVMVRQQGR-RALLIDGDLRGPRLHQVLG-TA
A0A2V9N406      EKQS-LKKVLVTSSLPKEGKSFVAANLAQVMVRQQGR-RALLIDGDLRGPRLHQVLG-TA
A0A2V9U6D9      EKQS-LKKILVTSSLPKEGKSFVAANLAQVMVRQQGR-RALLIDGDLRGPRLHQVLG-TA
A0A2V8DZN4      NGAY-PRVLVLTSASPKEGKTTVVSNLAITVAE-IRR-RVLVIDADMRRPRLHKVFS-VD
A0A2G6HQA4      RNTS-AGTIMVTSAMPGEGKSFVAANLSLAFASGLDQ-YVLLVDGDLRRPSIKKLFG-RD
A0A2V7ZTY7      VERD-LKVVMVSSAVSGDGKTLTSTNLALTLSESYHR-RVLLIDADLRRPSVHRVFQ-LK
A0A2V7ZVL9      VERD-LKVVMVSSAVSGDGKTLTSTNLALTLSESYHR-RVLLIDADLRRPSVHRVFQ-LK
A0A1Q7QYI4      TERQ-LKVVMVSSAVSGDGKTLTSTNLALTLSESYRR-RVLLIDADLRRPSVHEVFQ-VK
A0A2V8G9Y9      LERQ-IKVVMITSAAPGEGKTLTSTNLALTLSQSYRR-NVLLIDGDLRRPSVHSVFD-VP
A0A143PXU3      TERT-LKSLLVTSPAPGDGKSHVAVNLALTLSESYRR-KVLLVDADMRRPTLHHLFH-VS
A0A2V8D8G9      VQRQ-LKTVMITSALPQEGKTLTLVNLALTLSESYAR-RVLVIDADLRWPGLHTVLD-IP
A0A2V8ESQ4      VQRQ-LKTVMITSALPQEGKTLTLVNLALTLSESYAR-RVLVIDADLRWPGLHTVLD-IP
A0A1E3Y5Q0      AESG-LRVITVASAMPGEGKTLTAANLALTLSESYQR-KVLLIDGDLRKPSQHAVFG-LP
A0A2W4TWK5      GTGG-VKVIAVSSALANEGKSLTASNLAMTLSESYQK-RVLLIDGDLRRPSLQQIFG-LP
A0A3N5NYV3      TESR-IKTVLVASTMAGEGKTLTAVNLALTFSESYGR-NVLLIDGDLRRPTTHAVLE-VP
A0A2V2RJF9      PETP-PHTILITSSRPGEGKTFVACNLAISLAQ-LDK-RVVLIDGDMRNPRVHRVWGI--
A0A2G6HNT3      KNTS-AGTIMVTSAMPGEGKSFVAANLSLAFASGLDQ-YVLLVDGDLRRPSIQTLFGR--
A0A2V7YWD4      PSDG-SRVIAITSPISGDGKTLTAVNLAGTIARGGQS-RVLMVDADLRRPSLAKVLGHSN
A0A2V2R8T6      ERLQ-MRAFVITSAGIGEGKTLTALNLAWLLAQAEGV-RALIIDSDLRHPCAADYLGI--
A0A1Q7RGF1      SAQG-LRSVVVTSATPGEGKTLTSLNLSLCCAQLHDL-RVLLIDADIRTSGLSRTLGF--
A0A2V9BLX2      SAQG-LRSVVVTSATPGEGKTLTSLNLSLCCAQLHDL-RVLLIDADIRTSGLSRTLGF--
A0A2V9ZA03      KQRQ-LKKVVITSTIKGEGKSVVSANLAVTLAR--RQ-RTLLIDGDLRQSGLRELLTT--
A0A3N5ZNH4      SGKP-PRTILVTSSIPGEGKTTTVANIGIVLAQ-TGA-RTLLVDLDMRKPALDDKFNC--
A0A2V8GEZ2      RDRQ-AKVLMISSAMPGEGKTLTATNLALTLTESFRR-RVLVIDADLRRPSMHHTFGL--
A0A3N5ZFD3      MEKG-LKIVMVVSSMAGEGKTLTATNLALTLSESYQR-QVLLVDADLRRPSLHRVFGL--
G8NXD3          PAGG---VVLITSPSAEDGKSLNCQNLAWALAE-AGH-KTLLLDLDLRRPSLLAALG---
A0A2V9VR38      SAQG-Y---------PQEGKTTTSINCAVVLAQ-KGV-RVLLIDADLRRPSIHKTLGM--
A0A2V9EY04      SRAG-VKTIAITSSLPGEGKTLTTMNLGLCYAQLPQQ-RVLVIDADLRTCGLTALLDH--
A0A2V9HAK9      SKSG-LRSIVITSSLPGEGKTLTTMNLGLCYAQLPQQ-RVLVIDGDMRTRGLTSMIDH--
A0A1Q7FS15      AKTG-LKSIVVTSSLPGEGKTLTTMNLGLCYAQLPQQ-RVLVIDADLRTCGLTSMLDH--
A0A1Q7K9P1      AKTG-LKSIVVTSSLPGEGKTLTTMNLGLCYAQLPQQ-RVLVIDADLRTCGLTSMLDH--
A0A1Q7N989      AKTG-LKSIVVTSSLPGEGKTLTTMNLGLCYAQLPQQ-RVLVIDADLRTCGLTSMLDH--
A0A2V9G7Y0      AKSG-LRSIVITSSLPGEGKTLTTMNLGLCYAQLPQQ-RVLVIDGDMRTRGLTAMLDH--
A0A2V8T7Z1      PGRP-LRVIAVSSPAVGDGKTTTTVNLAVTMAQNPAA-RVLLVDADVRRPAVGRKLGLGK
A0A2V7U8G5      GARP-LRILAVTSPAAGDGKTTTSINLAATLAQTPGS-RVLLVDTDLRRPFVATNLGL-S
A0A2V7UNP9      AAKE-RKVIAITSPAAGDGKTTTAINLAATLAQSSRS-RVLLVDTDLRRPFVAANLGL-D
A0A2V7VLD7      AAKE-RKVIAITSPAAGDGKTTTAINLAATLAQSSRS-RVLLVDTDLRRPFVAANLGL-D
A0A2V7XGA3      GGAK-RQVLAVTSPTAGDGKTTTAVNLAVTLAQSPGA-RVVLIDADLRRPFVATSLGLDD
A0A2V7YAG6      GAVP-RQVLAVTSPTAGDGKTTTAVNLAATLSQLPGA-RVLLMDTDLRRPFVAAGLGLED
A0A2V7VK33      RSRS-LSIIAVTSPDVGDGKTTTSVNLAGTLSQDPGT-RVLLVDADLRRPSAAPLLGFGD
A0A3M1VTE1      DGTP-PRVIVVTSGMPQEGKSLTAVNLALAFAACGDE-RVLLVDGDLRRGGLARFL--EP
A0A2V7TTM7      AGNS-AQVLAVSSAAAGEGKTTTAINLAATLAQSPDM-RVLLMDTDLRRPSVASNLALGS
A0A2V8VI82      GE---MSVIAVTSAAAGEGKTTTAINLAAALAQDAES-RILLVDADLRVPSAGRLLGLGD
A0A2V7U4P9      TDGV-ATTTAVTSPSGGEGKTTTAINLAGALAQAADQ-RVLLVDADLRRPGVAAQLRIAS
A0A2V7TQY5      DG-G-LNVIAVSSATVGDGKTTTSINLAGTLAQNTTA-RVLLIDVDLRRGSVAAGLRLRA
A0A2V7TU87      RTSA-LSVLAVSSATVGDGKTTTAINLAGALAQAADA-RVLLMDVDLRRPAIAERLGLEE
A0A2V8SEH0      KDDG-LTVVAISSPTPADGKTTTAINLAGALAQDPQA-RVLLVDGDLRVPSVSEQLGLGE
A0A2V8VU54      EGRA-LQVLAVTSAVVGDGKTTTAINLAGSLAQARDA-RVLLVDADLRRASAGLQLGLED
A0A1Q7RML7      EGKA-LQVIAVTSATIGDGKTTTAINLAGALAQAREA-RVLLVDADLRRPSVALQLGLDD
A0A1Q7ZIQ5      EGKA-LQVIAVTSATIGDGKTTTAINLAGALAQAREA-RVLLVDADLRRPSVALQLGLDD
A0A2V8TKD8      EGKA-LQVIAVTSATIGDGKTTTAINLAGALAQAREA-RVLLVDADLRRPSVALQLGLDD
                                  **:      .            :::* * *            

A0A1F2U8T6      --NERGLSHVL-----GG---RARLRDV----IQR--------TV-DLNLFAIT----AG
A0A2V8BV42      --NDRGLSQVL-----IG---QARVRDV----IQR--------TV-DPNLLAIT----AG
A0A2V8F916      --NDRGLSQVL-----IG---QARVRDV----IQR--------TV-DPNLLAIT----AG
A0A1Q7K833      --NERGLSQVL-----IG---QARVRDV----IQR--------TV-DPNLLAIT----AG
A0A1Q8AMY4      --NERGLSQVL-----IG---QARVRDV----IQR--------TV-DPNLLAIT----AG
A0A2V8BM40      --NERGLCQVL-----MG---QARVRDV----IQR--------TV-DPNLLAIT----AG
A0A2V8CRT6      --NERGLCQVL-----MG---QARVRDV----IQR--------TV-DPNLLAIT----AG
A0A1F2VH76      --NDRGLSQLL-----AG---QARMREV----VQR--------TH-DPNLLVIT----AG
A0A1F2R0X5      --NERGLSQVL-----VG---QARVRDV----IQR--------TV-DPNLLAIT----AG
A0A2V8B278      --NERGLSQVL-----IG---QARVRDV----IQR--------TV-DPNLLAIT----AG
A0A2V8CEF9      --NERGLSQVL-----IG---QARVRDV----IQR--------TV-DPNLLAIT----AG
A0A2V8KZG2      --PMPGLSTYL-----AQ---NGKIDDL----IHH----------ASENLYLMP----AG
A0A1Q7LG57      --NNWGLSDVL-----WG---DTPLETLPISHLVR--------ETEVAGLSLLP----GG
A0A2V8YMQ4      --ENLGLVSYL-----TG---QEDWRTA----VCP--------SG-SPGLDLLP----CG
A0A1Q7L5B1      --GAPGLTEFL-----QG---AADASSI----IQT--------DT-EGKLFFIS----AG
A0A2V9DKV4      --GAPGLTEFL-----QG---AADASSI----IQT--------DT-EGKLFFIS----AG
A0A2V8W380      --RSLGLVSYL-----TG---QQDWRAV----VHP--------SG-SRGLDLLL----CG
A0A2V8ZIV5      --EKLGLVSYL-----TG---QQDWREA----VRP--------SG-SPGLDLLL----CG
A0A2V9EVA0      --SSPGLSDYL-----RG---DADEFSI----IQS--------GT-GENLFFIP----AG
A0A1Q7RB73      --RSPGLSDYL-----SG---AKDELAI----LQR--------GP-LENLFFIA----GG
A0A2V9K0H7      --RSPGLSDYL-----SG---AKDELAI----LQR--------GP-LENLFFIA----GG
A0A3N5YN96      --NEPGLTDVL-----AG---DVPLEEA----LIW--------IP-EYRLTLLP----AG
A0A1Q7Y646      --EPTGLSEVL-----AG---TATLEES----IIR--------LE-PAGLYLLP----GG
A0A2V8QZU0      --APTGLSEVL-----AG---EATLAES----IVR--------LE-PAGLHLLP----GG
A0A2V8RSQ9      --APVGLSEVL-----AG---QASLNDT----IVR--------LD-PSGLFLLP----GG
A0A2V9LS17      --AVPGLAEYL-----SG---EANELSV----IQR--------GP-LENLYFIP----GG
A0A2V9AGR3      --KSPGLTNCV-----RG---ETDEFSV----IQI--------GA-QSNLAFLP----SG
A0A2V9G0N7      --STPGLTDYL-----RG---EVDEYAI----IQS--------GP-DENLCFIP----GG
A0A2V9GQ44      --STPGLTDYL-----RG---EVDEYAI----IQS--------GP-DENLCFIP----GG
A0A2V9HRN3      --STPGLTDYL-----RG---EVDEYAI----IQS--------GP-DENLCFIP----GG
A0A2V8WG13      --GGPGLTDYL-----RG---EAEKEAV----IQN--------GL-EGNLCFIP----GG
A0A2V8X987      --SRPGLTEYL-----RG---EADEYSI----IQK--------GM-EGNLFLIP----GG
A0A1Q7KX94      --SCPGLSDYL-----RG---DADEYAV----IQK--------GT-KENLFLIP----GG
A0A2V8XHT0      --SCPGLSDYL-----RG---DADEYAV----IQK--------GT-KENLFLIP----GG
A0A2V9L2P7      --NEKGLSGIL-----TG---GYGLQEA----LLR--------VEDIEGLWVLS----SG
A0A2V7UMX0      GVDAPGLSEAV-----QA---RLGLDAV----MQR--------CPPRVDLWLLT----AG
A0A136K497      --TEKGLSDIL-----TG---DANFKDT----IVK--------LE-PSGLYLLA----GG
A0A399W9E4      --TEKGLSDIL-----TS---DARLQDT----IVK--------LE-PSGLYLLA----GG
A0A2V7X0V9      --AGPGLSEYL-----QG---KNDEFSI----MQR--------GP-LENLFFIP----SG
A0A2V9X518      --STPGLSEYL-----LG---ES---------VQR--------GP-MENLFFIP----SG
A0A2V9VC62      --SSPGLADYL-----LG---ESDEFSI----MQR--------GP-MENLFFLP----CG
A0A2V9S1P8      --SSPGLSDYL-----LG---EKDEFAV----MQR--------GS-MENLFFIP----SG
A0A2V9RTW2      --ATPGLAEYL-----LG---ENDEFGI----MQR--------GA-MENLFFIP----SG
A0A2V9TGF1      --ATPGLAEYL-----LG---ENDEFGI----MQR--------GA-MENLFFIP----SG
A0A2V9XEV6      --STPGLSEYL-----LG---ESDEFSV----MQR--------GP-MENLFFIP----SG
A0A2V9Y3Q6      --FTPGLSEYL-----LG---ESDEFSI----MQR--------GP-MENLFFVP----SG
A0A2V9R269      --IGPGLGDYL-----RD---EADEYSI----IQR--------GS-MENLFLIP----AG
A0A2V9PTS3      --PGPGLSEYL-----AS---ESDEFSI----LQR--------GP-MENLFLIA----AG
A0A2V9NPF4      --PGPGLSEYL-----AS---ESDEFSI----LQR--------GP-MENLFLIA----AG
A0A2V9PNZ0      --PGPGLSEYL-----AS---ESDEFSI----LQR--------GP-MENLFLIA----AG
A0A321LMC5      --SPHGLVDVI-----ER---RAAVSDS----IVA--------IK-PHGMYVLADRSNGD
A0A2V8X713      --SAPGLSDYL-----NG---RADEFSV----LQA--------DA-KADLFLIP----AG
A0A2V8ZLE9      --AAPGLSDFL-----GA---KVDEFSI----LQA--------DP-KFELFFVP----AG
A0A2V8Y4D3      --SAPGLSDYL-----SG---KADEFSI----LQA--------DP-KVELFLVP----AG
A0A2V8Z2X8      --SAPGLSDYL-----SG---HADEFSI----LQA--------DP-KVELFLVP----AG
A0A2V9C3F6      --SAPGLSDYL-----SG---RADEFSI----LQA--------DP-KVELFLVP----AG
A0A2V9QMU9      --PRTGLSSVL-----TG---SANVQQT----IVR--------SALLPSLFILP----AG
A0A2V9QY75      --PRVGLSNVL-----TG---GATSQQA----TVR--------SPILPNLFILP----AG
A0A2V9SVU9      --PKTGLSNVL-----TG---NATLQQA----TVR--------SSILPGLFILP----AG
A0A2V8W5N5      --MAPGLTDYL-----RG---EADEMAA----IQY--------SD-NENLCFMP----GG
A0A2V8XG53      --MAPGLTDYL-----RG---EADEMAA----IQY--------SD-NENLCFMP----GG
A0A2V9XV04      --KGPGLAEYL-----LG---KADEASV----IQR--------GP-MEGLFFMA----SG
A0A2V9CBY1      --SAPGLSDYL-----AG---ESDESAV----IQA--------GA-QEGLFFIP----GG
A0A2V9D656      --CAPGLSDYL-----AG---ESDECSI----IQA--------DS-QEGLFFIP----GG
A0A352EZH8      --APRGLSEIL-----GG---ELSLRDA----IVR--------LD-PAGLYLLP----GG
A0A0B6X033      --RRPGLSEVL-----AG---EAELDAT----IVR--------LE-PAGLYLLP----GG
A0A2V8R0I3      --TDCGLSEVL-----TG---VTRLTEA----ILK--------LN-PAGLHVLP----GG
A0A2V8N1U8      --TERGLSEVL-----TG---ETRLAEA----IVR--------LN-PAGLHVLP----GG
A0A2V8QL35      --TEVGLSEVL-----TG---ETKLTQA----ILK--------LE-PSGLHLLP----GG
A0A352FU10      --TECGLSEVL-----TG---ETKLTQA----ILK--------LE-PSGLHLLP----GG
A0A2V8LCU0      --TEVGLSEVL-----TG---ETKLTEA----IVK--------LK-PSGLHLLP----GG
A0A1Q7NGT0      --TDCGLSEVL-----TG---ETKLLEA----IVK--------LQ-PSGLHLLP----GG
A0A2V8MLP9      --TDCGLSEVL-----TG---ETKLLEA----IVR--------LR-PSGLHLLP----GG
A0A2V8PQZ0      --TDCGLSEVL-----TG---ETKLLEA----IVR--------LR-PSGLHLLP----GG
A0A3B9MKY6      --APIGLSEVL-----GG---AVRPEEA----IVR--------LD-PAGLYLLP----GG
A0A3D5SKZ1      --APIGLSEVL-----GG---AVRPEEA----IVR--------LD-PAGLYLLP----GG
A0A2V8NRW2      --DAIGLSDVL-----SG---EATLEEA----ILH--------LN-PSGLYMMP----GG
A0A2V8TKR9      --PAEGLSSYL-----TR---NIGIDRL----IHK--------LQ-IPNLSLLP----CG
A0A2V8LBV1      NR--WGLTDILQADIEIQ---EYPLEML----VQQ--------TV-VPNVYITG----SG
A0A2V8GAF9      SQRSPGLVEAI-----LD---PQYTLQR----VVR-------RLE-GFNLSVLP----AG
A0A2V8CN98      RR--PGLTDFL-----AG---HVSFEGL----IQT--------LK-FGSLQFIG----GG
A0A1Q7LC46      TGKYAGLSSYL-----AG---VSSLDLV----SVP-------HPA-IPNLVAIP----TG
A0A1Q8BDC5      PE--PGLLQYL------A---STNMSPY----CYV--------RR-IESLYFLT----VG
A0A2V9Q1Y8      PR--AGLSNVL-----TG---GTTLQQA----TVR-------STL-LPNLFILP----AG
A0A2V8JXG1      RT--LGLSTYL-----AR---NVEIDEL----IQD--------LP-GENLRMIS----SG
A0A350D2W9      NH--EGLTSYL-----AL---DLPVQKL----IKP--------TM-VPSLYLIN----SG
A0A2V9I4J1      VE--PGLSGYL------E---NGHLQPY----CYM--------RR-FKNLYIMT----AG
A0A2V8PQZ9      TD--CGLSEVL-----TG---ETKLLEA----IVK--------LQ-PSGLHLLP----GG
A0A2V8D8B1      QE--PGLSNLL-----VG---DTKTAEA----VKQ--------TR-SKGLWVLP----AG
A0A3B9LSB4      DR--AGLSSIL--SSDVS---EADMLEM----VST--------DE-ATGLRVLT----SG
A0A2V9H7U2      DG--EGLASFL-----TG---AHSIEAA----LRQ-------FSP-VPTLWVLP----AG
A0A2V8NJB5      EG--PGLLQYL------S---NGRLAPH----CYV--------RR-LENLFFLT----SG
A0A2V9JMZ4      VE--PGLSGYL------E---NGHLQPY----CYM--------RR-FKNLYIMT----AG
A0A2V9MDJ6      VE--PGLSGYL------E---NGHLQPY----CYM--------RR-FKNLYIMT----AG
A0A2V8QJT6      ER--EGLSSIL--ASDTT---ADDMLRS----VVR--------DV-SSGLFIMP----SG
A0A2V8FSM8      ND--HGLSNLLMEPEPLD---AAALEGG----CVP--------TQ-VPNLFLLP----SG
A0A359M0J2      EV--DWTSLVM--DDAPI---TAERIEP----LLQ-------ATD-FEGLSLLA----AK
A0A2V8JLJ1      SREGKNLGAIL-----RG---RSKVEES----LER--------CE-DLNLYFLS----SG
A0A5M8SND8      NE--RGLANML--ESPSD---EVALQAM----TKR--------TF-VGGVDVLP----SG
A0A2V9GAQ1      SGNYAGLSSYL-----AG---VSSLDLV----SVP-------HPA-IPNLVAIP----TG
A0A497EDQ8      NM--RGLTSLV-----LG---ESQLKDV----IHG-------LAD-VPNLDMVT----SG
G8NS05          GK--VGLTSVL-----TG---SHTLEQA----IQN-------VPE-MPSLDILV----SG
A0A2V8KZ20      SREGKNLGAIL-----RG---RSKVEES----LER--------CE-DLNLYFLS----SG
A0A3D0NWU2      NS--EGLTNYL--SGDRN---TKNLIKA----CR----------D-LPRLKVIT----SG
A0A2V8EPD9      PV--GGLTEAL------T---ADEDRQI----VLT--------RV-SDSLFVLP----AG
A0A3N5NSX5      NN--VGLSHLL-----TG---QATARQA----IHR--------TN-VQNLWVMT----AG
A0A2V8MUA1      AGRGKGLADVL-----RG---SATLEES----LVE--------CS-DLNFSLLP----SG
A0A2V8MBH9      ER--EGLSSIL--SSEIK---PEDMLHA----IHR--------DE-ATGLNVLA----SG
A0A3N5ZPQ7      PE--PGLIGYL------S---TNLLRPY----CFM--------RQ-VQGLFVLA----AG
A0A3N5P5F2      LS--PGLSQLI------V---GSAKAEV----IRR--------SR-IPNLWIVP----AG
A0A2V9G1P7      GS--LGLVSYL-----TG---QQDWRAV----VRP--------SG-SRGLDLLV----CG
A0A2V9BCK9      SA--PGLTEYL-----RG---EADEFSI----IQA--------DS-KDDLFFIP----AG
A0A2V9TMX2      AH--GGLSTLI--SGSSN---AEE--VI----LPS--------SE-VPNLWILP----AG
A0A2V8N2J7      VPTDKGFHNLL--VHSDG---NPDRYVM----------------Q-FKQLYVIP----GG
A0A3N6BI26      GN--QGISAYL-----SG---NGDLSSQ----IRQ--------TS-YPNLFLLP----AG
A0A2V9JMM3      PR--PALSNLL------Q---DPERDIY----REA--------VR-LKDLFVIP----GG
A0A2V9M815      PR--PALSNLL------Q---DPERDIY----REA--------AR-LKDLFVIP----GG
A0A2V9A795      EG--LGIVSYL-----TG---QQDWRAA----VRP--------SG-SPGLDLLP----CG
A0A355ESH9      NR--SGLVNQL-----TG---TAELDAV----IFP--------TE-VPNLWVIP----SG
A0A3D0NW85      NG--EGLSTIL--SSEMS---ENEILGV----IQQ--------EP-STKLNLLT----SG
A0A353CAT5      NG--IGLSTLL--SSELS---EAEILKA----IRT--------DD-GTKLNLLT----SG
A0A2V9HB55      GGKYAGLSSYL---AGVS---SLDL-VC----VPH--------PT-IANLVAIP----TG
A0A2V8CU57      ND--TGLVDVL---RKTE---TRRLPLC----RAS--------ET----LWILT----AG
A0A2V8BDI4      ND--TGLVDVL---RKTE---TRRLPLC----RAS--------ET----LWILT----AG
A0A2V8F8T3      ND--TGLVDVL---RKTE---TRRLPLC----RAS--------ET----LWILT----AG
A0A2V9J901      --NSPGFVQCL-----TG---HVELAEA----VLP-------APG-VPNLSVIP----CG
A0A2V8MKQ7      --NVRGLTNCL-----SG---ESRDLDA----LIQ------TSEK-QPNLKLLP----LG
A0A3M1SNQ5      --PDKGLAHVL-----SG---EIKLRES----ICR--------LE-PSSLHLIA----GG
A0A2V8QJ59      --NARGLTNCL-----SG---EASEIDS----VIQ------SYAQ-LPNLKVLP----SG
A0A1Q7HTA7      D-SLPGLAELA-----LG---SRAGLDD----TVR-------WCP-PSRLCVLP----AG
A0A2W0B5E2      --NERGMSTHL-----TG---HDSINDV----IQQ-------YKE-QPNLWLIP----SG
A0A2V8NMG8      --NRNGLSTIL-----SSEMKEAEVLAL----IQQ-------HEE--SGLHLMT----SG
A0A2V8TBM7      --NSRGVTNYL-----SG---DSQVADL----VQT-------YER-MPNLKVIT----SG
A0A1Q7HEZ8      AADPRGLVDAI-----AD---TNVWLDQ----VTR-------QVD-GFNLSVIP----AG
A0A1Q7JW36      AADPRGLVDAI-----AD---TNVWLDQ----VTR-------QVD-GFNLSVIP----AG
A0A1Q7MUR4      AADPRGLVDAI-----AD---TNVWLDQ----VTR-------QVD-GFNLSVIP----AG
A0A3N5PFU4      PQGAAGFADLV-----VS---ARASLGE----AVR-------PLD-GFNVDVLP----AG
A0A4R1LDF1      --ESSKASSYI-----TA---PDWHECI----W----------GL-KPNLHALV----LS
A0A1F2T1R8      T-TGPGLADVL-----SG---NRDAAEV----FRR--------IE-PFNLSVLP----AG
A0A2V9BW09      --PMAGLGEVL-----QG---RLDVRAA----IRR--------LD-PSGLYYLP----AG
A0A3M1SSE1      --NREGLSNLL-----SS---EIKRDKV----LDS-----IYFDM-SSRLYLLP----SG
A0A2V9GQV7      --NSPGLAEIL-----SG---DVAPDEA----IVA--------TN-QKNLFILP----AG
A0A2V7YV88      --RNVGLSNLT-----VQ---DADEREA----ITA-------VEE-VPNLWLMT----SG
A0A2V8YCY6      TGKYAGLSSYL-----AG---VSSLDLV----SVP-------HPA-IPNLVAIP----TG
A0A2V8EGM3      KAE--GLSEII-----AA---ADERRVP----LV---------QL-TETLTLLP----GG
A0A2V8FGH1      KAE--GLSEII-----AA---ADERRVP----LV---------QL-TETLTLLP----GG
A0A2V8D468      --QEPGLSNLM-----VG---TAQSREA----MHP--------SG-VKDLWILP----AG
A0A1F2R977      --NTTGLGDGL-----RS---ERVQIPF----YEL-----------SPTLTVLP----AG
A0A2U3LF12      --DPSGFSDLL-----AL---TDREVSP----FVS---------K-AGNLHVMP----GG
A0A3N5G7M6      --SEPGLTDFL-----IG---EGRIANL----IRR--------TR-IPRLHLLT----AG
A0A1F2S3Q7      G-GGLGLADAL-----GS---GRGA-AD----VVR-------TVD-GCLLDVIP----AG
A0A2V8GVG4      E-LSQGLTEVV-----EN---AQTSLGA----VTQ-------KLK-PFNLSIVT----AG
A0A143PNR5      --ETSGLSEGL-----DA---ATASRVS----AIQ---------L-SPLLALLP----AG
A0A2V8PJQ0      --NVRGLTNFL-----SG---ELPLDEV----IQP-------FEK-LPNLKLLP----SG
A0A2V8H566      --NVSGLNDVL-----YA---RDAALRC----ELF--------TM-TAQLCVLT----AG
A0A3N5YKY1      --NEPGLTDVL-----AG---DVPLEEA----LIW--------IP-EYRLTLLP----AG
A0A2V8UVN4      --GEPGLADVL-----MG---TCRLEDA----IVR-------LEQ-FPNLCVLP----SG
A0A321LXF5      --GAAGLADIL-----ES---DCAYDQA----VLQ--------TD-VPDLYVLP----AG
A0A5M8SBZ0      --CNPGLPDYL-----AG---TASAFSI----VQQ--------SP-VPDLFFIP----GG
A0A1Q7JFB1      --NVTGLTDSL-----KA---ENDRRLP----LIQ---------A-SAYLSLLL----AG
A0A2V8DMJ9      RTSFPGLAEAI-----LD---PAYDLAA----VVR-------CLD-TFNLSVLP----AG
A0A2V8GGF6      ARRSPGLADLL-----RD---PDYEIDQ----VTH-------RLE-RFNLSVVP----AG
A0A2V8HKU7      ARRSPGLADLL-----RD---PDYEIDQ----VTH-------RLE-RFNLSVVP----AG
A0A1Q6Y875      --SSPGLSDYL-----RG---DADEFSI----IQS--------GT-GENLFFIP----AG
A0A523DJA9      --NSIGLSHVL-----VG---QARIREA----IQR--------TH-DPNLFVVT----AG
A0A2V8I604      --QSPGLVDIL-----MG---GSTLEES----LVS--------IA-EHHLTILP----SG
A0A2V8J066      --EAPGLTDVL-----MG---GATLDDA----LVT--------LA-DHHLTVLP----SG
A0A1I6MMC5      --CEPGLTDYL-----SG---NASMFDV----MQRAHASDGMPSA-LSSLTFIA----GG
A0A2V9D5W7      --NALGLSDYL-----GG---RADELAI----IQS--------GH-EGNLYLIP----GG
A0A2V9D4I4      --AAPGLSDYL-----RG---DANELAV----TQS--------GQ-EGNLWFIP----GG
A0A2V9D6L7      --AAPGLSDYL-----RG---DIDEVAA----IQS--------GQ-DSSLYLIP----GG
A0A2V8ZJV2      --ICPGLSDYL-----RG---DVDEYAI----VQK--------GM-NESLFLIP----GG
A0A2V9AWB5      --GRPGLSDYL-----RG---DADEYAV----IQK--------GM-SKNLFLIP----GG
A0A2V8Z1Y8      --SSPGLTDYL-----LG---DADECAI----IQQ--------GL-QPNLFLIA----AG
A0A1Q8AX10      --SAPGLTEYL-----RG---EADEFSI----IQA--------DS-KDDLFFIP----AG
A0A2V9A773      --SAPGLSDYL-----GG---RADEFSI----LQA--------DP-KVELFLVP----AG
A0A2V9AND3      --SAPGLSDYL-----NG---RADEYSI----IQA--------DP-KVELFLVP----AG
A0A2V9BTJ7      --RSPGLSDYL-----LG---MADEFRV----VQK--------GS-ESNLCFIP----AG
A0A2V8W2M7      --TSPGLTDYL-----RG---EANEYDV----IQH--------SS-EVNLCFIP----CG
A0A2V8XNW2      --TSPGLTDYL-----RG---EANEYDV----IQH--------SS-EVNLCFIP----CG
A0A1Q7CJC1      --TSPGLTDYL-----RG---EANEYDV----IQH--------SS-EVNLCFIP----CG
A0A2V9UEM7      --QTPGLSEYL-----MG---ECDEFAI----MQR--------GP-MDNLFFVP----AG
A0A1Q7V300      --SGPGLSEFL-----KG---EMDEFTI----IQS--------GP-MENLFLIP----AG
A0A2V9ZCI3      --NTPGLSNYL-----MG---ENDEFAV----VQR--------GP-LENLFFVP----AG
A0A2V9WCB3      --MGPGLSDYL-----QS---KNDEFSI----IQQ--------GP-MENLFFMP----SG
A0A2V9VQW5      --SSPGLADYL-----MG---ESDEFSI----MQR--------GP-MENLFFVP----CG
A0A2V9WTP3      --SAPGLSDYL-----QG---ANDEFSI----MQR--------GA-LENLLLIP----SG
A0A2V9NLA9      --SSPGLTEYL-----LG---EADEFAI----LQR--------GP-MDNLFFIP----CG
A0A2V9RKJ9      --SSPGLTEYL-----LG---EADEFAI----LQR--------GP-MDNLFFIP----CG
A0A2V9RN95      --SSPGLSEYL-----LG---EADEFGA----IQR--------GP-MDNLFFIP----SG
A0A2V9N406      --SSPGLSEYL-----LG---EVDEFGA----IQR--------GP-MDNLFFIP----SG
A0A2V9U6D9      --SSPGLSEYL-----LG---EVDEFGA----IQR--------GP-MDNLFFIP----SG
A0A2V8DZN4      --NDHGLSNLL-----ME---PEPLDAA----ALE---GGCVPTQ-VPNLFLLP----SG
A0A2G6HQA4      --EDFGLVNYL-----EH---QTALPKL----IVR--------SR-KPKLSLLL----AG
A0A2V7ZTY7      --NAGGLSECL-----TA---EIE-RRL----PLV--------QA-TPYLSLML----AG
A0A2V7ZVL9      --NAGGLSECL-----TA---ETE-RRL----PLV--------QA-TPYLSLML----AG
A0A1Q7QYI4      --NVTGLTDSL-----KA---END-RRL----PLI--------QA-SAYLSLLL----AG
A0A2V8G9Y9      --NVLGLSDGL-----KS---EVE-HKL----SLI--------QI-SEHLTVLP----AG
A0A143PXU3      --GAHGLLDAL-----RA---EAE-DVP----AVV--------PV-TGTLSLLP----AG
A0A2V8D8G9      --NDRGLSEAL-----R----DGR-HEL----PFV--------EV-SSRLSVLT----AG
A0A2V8ESQ4      --NDRGLSEAL-----R----DGR-HEL----PFV--------EV-SSRLSVLT----AG
A0A1E3Y5Q0      --VSPGLTEGV-----V----GTD-AAL----SLH--------RV-SPTLTVIT----AG
A0A2W4TWK5      --GEGGLTAAF-----AP---RSD-HRI----RLH--------RI-TPHLTVLT----AG
A0A3N5NYV3      --NILGSGIGS-----KQ---ETD-QKL----SLI--------QV-SPRLSVLT----AG
A0A2V2RJF9      -RNDTGLSRFL-----TS---DVKAGEVIR--PSK-----------VKGLSLIT----SG
A0A2G6HNT3      -KENFGLVDYL-----QQ---QGSLPELIV--RSR-----------KPKLSLLL----AG
A0A2V7YWD4      VHRGWGLVDAI-----LD---RRLSLEQIA-WPLQ-----------PFNLSVVT----SR
A0A2V2R8T6      -DAPVGLAEVL-----GG---QARFEDAIV--RLD-----------PAGLYLLP----GG
A0A1Q7RGF1      -PPGPGLVDVL-----SG---KCEPRNAIL--ATD-----------IPNLYTLG----SG
A0A2V9BLX2      -PPGPGLVDVL-----SG---KCEPRNAIL--ATD-----------IPNLYALG----SG
A0A2V9ZA03      -HGLPGITD-W-----WQ---ETADVSEFL-RRVN-----------GFPLWYLP----AG
A0A3N5ZNH4      -RGEKGMSSYL-----SG---N-SDLSSLI-RPTA-----------YPNLFILP----AG
A0A2V8GEZ2      -PNNTGLNDAL-----LG---R-DNMPTAF---EM-----------SSRLTVLP----AG
A0A3N5ZFD3      -PNATGLNEAL-----TE---EAGNPPALF---SI-----------SPQLTLLA----GG
G8NXD3          -GVCPQSIEQV-----LK---GEVTPEAAI-RSVG-----------DLPLYIIG----LD
A0A2V9VR38      -GPHSGLSNVL-----TG---STTTEQAIT-RTTI-----------LPNLFVLA----AG
A0A2V9EY04      -PCTLGLAEVL-----AG---KATLEEAMV--ATN-----------QKNFFVLP----AG
A0A2V9HAK9      -PSSPGLAEIL-----SG---DVAPDEAIV--ATN-----------QKNLFILP----AG
A0A1Q7FS15      -PSTPGLAEVL-----AG---EVTPDEAIV--ATN-----------QKNLFVLP----AG
A0A1Q7K9P1      -PSTPGLAEVL-----AG---EVTPDEAIV--ATN-----------QKNLFVLP----AG
A0A1Q7N989      -PSTPGLAEVL-----AG---EVTPDEAIV--ATN-----------QKNLFVLP----AG
A0A2V9G7Y0      -PNSPGLAEIL-----SG---DVGPDEAIV--ATN-----------QKNLFILP----AG
A0A2V8T7Z1      -VRLPGLVELI-----AD---PSLGIGGLARRVGP-----------A-NLSVLL----AG
A0A2V7U8G5      -PDRPGLAEAA-----ID---EGLQLSDVV-QSTP-----------Y-NLAVLP----AG
A0A2V7UNP9      -MDAPGLADAV-----RD---EQIDLAAVV-QATP-----------Y-TLAVVP----AG
A0A2V7VLD7      -MDAPGLADAV-----RD---EQIDLAAVV-QATP-----------Y-NLAVVP----AG
A0A2V7XGA3      -RRGPGLAATA-----LD---PKLELEQLV-RPTP-----------F-NVDVVP----AG
A0A2V7YAG6      -GSAPGLATMA-----LD---PDLELDQMV-RRTP-----------Y-NFDIVP----AG
A0A2V7VK33      RGDGPGLAGAI-----LD---SHRSLASVV-RARP-----------PFNLSVLP----AG
A0A3M1VTE1      -APRAGLRELL-----EG---KVPEEEALL--EVS-----------GTRLAVVP----AG
A0A2V7TTM7      -SAGTGLAGAV-----LD---PRVELATVV-RPTP-----------F-GFSILP----AG
A0A2V8VI82      -DL-PGIADAV-----RE---PGALLEDFVRRRPP-----------S-RLSILP----AG
A0A2V7U4P9      -TA-PGLAEAV-----AD---GARPLDELC-QQVA-----------GFNLWVLP----AG
A0A2V7TQY5      -PEANGLVDAI-----LT---PGLDLSAVV-RELP-----------EFRLSVVP----SG
A0A2V7TU87      -GR-HGLVDAI-----LS---HDLKLADVARPCGP-----------L-NLAVVT----AG
A0A2V8SEH0      -VAGPGLVEAI-----LD---PGRSLDDVV-RDLP-----------LFNLSVLP----AG
A0A2V8VU54      -PRGAGLADAI-----LD---PDRSLPGLV-QSLP-----------A-NLGILP----AG
A0A1Q7RML7      -PRGAGLADAI-----LD---PERSLESVILRRLP-----------L-NLGVLT----AG
A0A1Q7ZIQ5      -PRGAGLADAI-----LD---PERSLESVILRRLP-----------L-NLGVLT----AG
A0A2V8TKD8      -PRGSGLADAI-----LD---PERSIESVILRRLP-----------L-NLGLLT----AG
                                                                 .          

A0A1F2U8T6      PTP-SEPSELLASERMKMLLSSLAQGPF--D--WIIIDTPPVLGVSDAVVLTPLVTGVTF
A0A2V8BV42      KMP-PNPSELLASERMRTLLTNLAHGPF--D--WIIIDTPPVLAVTDAVILAPMVSGVTF
A0A2V8F916      KMP-PNPSELLASERMRTLLTNLAHGPF--D--WIIIDTPPVLAVTDAVILAPMVSGVTF
A0A1Q7K833      RTP-PNPSELLASERMKTLLTNLSHGPF--D--WIIIDTPPVLAVTDAVILAPAVSGVTF
A0A1Q8AMY4      RTP-PNPSELLASERMKTLLTNLSHGPF--D--WIIIDTPPVLAVTDAVILAPAVSGVTF
A0A2V8BM40      STP-PNPSELLASERMKTLLTNLSHGPF--D--WILIDTPPVLAVTDAVVLAPMMSGVTF
A0A2V8CRT6      STP-PNPSELLASERMKTLLTNLSHGPF--D--WILIDTPPVLAVTDAVVLAPMMSGVTF
A0A1F2VH76      RTP-ANPSELLAADRMRALISGLENGPF--D--WVIIDTPPVLAVTDAVIIAPLVAGVTF
A0A1F2R0X5      RPP-SNPSELLSSERMKTLITNLRSGPF--D--WIVIDTPPVLAVTDAVILAPLVNGVTF
A0A2V8B278      RTP-PNPSELLSSERMKTLLTNLAHGPF--D--WIIVDTPPVLAVTDAVILAPLVSGVTF
A0A2V8CEF9      RTP-PNPSELLSSERMKTLLTNLAHGPF--D--WIIVDTPPVLAVTDAVILAPLVSGVTF
A0A2V8KZG2      PTP-PNPAELLSSGKMKRLIEIMAE-RY--D--HVVIDTPPLGSVTDPVILSTMVDGVVL
A0A1Q7LG57      SCG-ITPTNLFYSPRMARFLKRMRK-EF--E--MVMIDAPPMIHLADARVLGRHADGVIL
A0A2V8YMQ4      PVP-PNPAELLSSKSMGAFLGSAKS-EY--A--FVILDSSPLLTLADSRILASLVDGVLL
A0A1Q7L5B1      SAV-SNPTELLSTERLECFLRQMAA-LF--D--WVIIDAPPVLPVSDAIVLAGRCDGVIV
A0A2V9DKV4      SAV-SNPTELLSTERLECFLRQMAA-LF--D--WVIIDAPPVLPVSDAIVLAGRCDGVIV
A0A2V8W380      PVP-PNPSELLSSQSMGALIRSASA-EY--G--FVILDSSPMLALADSRILAPLVNGVLL
A0A2V8ZIV5      PVP-PNPAELLSSKSMGAFLVSAKS-EY--A--FVILDSPPLLTLADSRILASLVDGVLL
A0A2V9EVA0      RPV-SNPTELLGSTRAKSLFERLNT-LF--D--WVIVDTSPVLPVSDATVLAPMCDGVIL
A0A1Q7RB73      KAA-SNPTELIGNGRLRLLLRRLCP-AF--D--WIIMDSPPVIPVSDAKLLAEYLDGVLI
A0A2V9K0H7      KAA-SNPTELIGNGRLRLLLRRLCP-AF--D--WIIMDSPPVIPVSDAKLLAEYLDGVLI
A0A3N5YN96      RPT-NQPTELLGSFEMRRAVDTLRT-HF--D--RIVIDTPPALALADVGVVGPLSDGVLL
A0A1Q7Y646      EPR-DDVAELLSGPKFDKVLAEARR-MF--D--YIIIDAPPMGIFTDANLLINSADGAML
A0A2V8QZU0      AAR-DDVAEMLSGPKFSAVLKEARR-MF--D--YVIIDAPPLGIFTDASVLINRADAALI
A0A2V8RSQ9      TPR-DNVAELLSGPKFSAVLAELRR-SF--N--YIIIDAPPLGIFTDATVLINRADGALV
A0A2V9LS17      KHP-ANPAELVSNGRFKNLLRRLSP-VF--D--WIVVDTPPAIAVSDAQVLAAACDGVLL
A0A2V9AGR3      DAV-ADPAELILGGRVKKLLDFVTP-AF--D--WVILDSPPALAVHDPSLFADLCDGVLF
A0A2V9G0N7      NDV-SNPSELLPSDRMRHLLDVVTP-MF--D--FVILDSPPATPVHDPIVLADLCDGVLF
A0A2V9GQ44      NDV-SNPSELLPSDRMRHLLDVVTP-MF--D--FVILDSPPATPVHDPIVLADLCDGVLF
A0A2V9HRN3      KDV-SNPSELLPSDRMRHLLDVVTP-MF--D--FVILDSPPASPVHDPIVLADLCDGVLF
A0A2V8WG13      SEV-SNPSELLLGDRMKKLLDLVTP-IF--D--WIILDSPPALAVHDASSLADLCDGVLF
A0A2V8X987      SPV-FNPSELLLHERMKRLLDLLTS-AF--D--WIIIDSPPALLVHDASILADLADGVLF
A0A1Q7KX94      SLV-SNPSELLLNERMKHLLNLVAP-SF--D--WIIIDSPPTLPVHDASILADLVDGVLF
A0A2V8XHT0      SLV-SNPSELLLNERMKHLLNLVAP-SF--D--WIIIDSPPTLPVHDASILADLVDGVLF
A0A2V9L2P7      PNP-PNPAELLCSTKMQELLKQMRE-RF--D--HVIVDSPPVLPITDATILSSRVDGVIM
A0A2V7UMX0      RPP-EDPYDVIRSPHFADLLEEARR-RF--D--FVVIDTPPILPVPDGREIARWVDGFLV
A0A136K497      AAR-PDVAELISGPKFAEILAEARE-MF--D--YVIIDAPPLAIFTDATVLINKADGALL
A0A399W9E4      TAR-PDVAELISGPKYAELLAEARE-MF--D--YIIIDAPPLAIFTDATVLINKADGALL
A0A2V7X0V9      TGI-EDPAELVGNGKLKTFLQRVEP-LF--D--WIIVDSPPAIPVSDASVLAKACDGVLM
A0A2V9X518      RTV-SNPAELVANGRLKFLLTRVEP-LF--D--WIIIDSPPTVPVSDSSLLDNFCDGVLI
A0A2V9VC62      RTV-AHPAELIANGRLKMLLQRVEP-LF--D--WIILDSPPAVPVSDASQLANFCDGVLM
A0A2V9S1P8      RSI-GNPAELVANGRTRFLLNRVEP-LF--D--WIIIDSPPAVPVSDAGLLANYCDGVLM
A0A2V9RTW2      RSV-SNPAELVANGRLKILLNRVEA-LF--D--WIIIDSPPAVPVSDASLLANYCDGVVM
A0A2V9TGF1      RSV-SNPAELVANGRLKILLNRVEA-LF--D--WIIIDSPPAVPVSDASLLANYCDGVVM
A0A2V9XEV6      RTV-SNPAELVANGRLKFLLTRVEP-LF--D--WIIIDSPPTVPVSDSSLLANFCDGVLI
A0A2V9Y3Q6      RTV-SSPAELVANGRLKFLLNRVEP-LF--D--WIIIDSPPAVPVSDASLLANFCDGVLI
A0A2V9R269      RIS-PNPAEMLSNGRIKTLLHRLEP-LF--D--WIIIDSPPAVPVADAAMLANHCDGVLL
A0A2V9PTS3      HRS-QNPAELLANGRMKFLLERLQP-IF--D--WIIIDSPPAALVSDAGLLAKYADGVLL
A0A2V9NPF4      HRS-QNPAELLANGRMKFLLERLQP-IF--D--WIIIDSPPAALVSDAGLLARYADGVLL
A0A2V9PNZ0      HRS-QNPAELLANGRMKFLLERLQP-IF--D--WIIIDSPPAALVSDAGLLAKYADGVLL
A0A321LMC5      IPN-LSAGDILTTSRVEGVLDELES-AF--D--FVVIDAPPITDFADAQRLAALADGTVL
A0A2V8X713      RFV-PNPAELLANGLLKGLLDRVSP-LF--D--WVILDAPPVLAVSDAGVLAGLCDGVIV
A0A2V8ZLE9      RPV-PNPSELLANGMLKAFIHGISP-VF--D--WVIVDAPPVLAVADAGIIADFCDGVIV
A0A2V8Y4D3      KPV-PNPSELLANGMLKSFIDGVSP-VF--E--WVIVDTPPVLAVADAGIIAEFCDGVMV
A0A2V8Z2X8      RPA-PNPSELLANGMLKGFIDKIGP-IF--D--WVIVDAPPVLAVADARIIAEFCDGIMV
A0A2V9C3F6      RSA-PNPSELLANGTLKRFLDGMSP-IF--D--WVIIDAPPVLAVADPSIIAEFCDGVLV
A0A2V9QMU9      PPP-PNPAELLSSGNMKKVLDELRE-QY--D--HIVVDTPPTLSVTDPVILSTRADAVVL
A0A2V9QY75      TPP-PNPAELMASQQMFDLLAELRE-QY--D--HIVIDTPPTLSVTDAVVLSTRSDAVVL
A0A2V9SVU9      TPP-PNPAELLASSNMKDVLAELRE-QY--D--HIVVDTPPTLSVTDAVVMSTRADAVVL
A0A2V8W5N5      KQV-TNPSELLSNGRLKILLDRLTP-IF--D--WIIVDSSPCLLVADASMVAGVSNGVLL
A0A2V8XG53      KQV-TNPSELLSNGRLKILLDRLTP-IF--D--WIIVDSSPCLLVADASMVAGVSNGVLL
A0A2V9XV04      ESI-EDPAEMVASSRLKVLLQRIEP-VF--D--WIIIDSPPAIPVSDASVLAKACDGVLM
A0A2V9CBY1      KPR-SNPAELLANNKLRALFSRVLA-LF--D--WIIVDAPPALPVSDASVLSGMCDGVIF
A0A2V9D656      KPR-SNPAELLANNLLRALFSRVLP-LF--D--WIIVDAPPALPVADASVLAGMCDGVIF
A0A352EZH8      QAR-EDVAELLSGPTFAGVIAEARR-LF--D--FIIIDAPPLGIFTDANVLISRADGALL
A0A0B6X033      SER-NDVAEMLSGPRFSSVLAEVRR-MF--D--YIVIDAPPLGIFTDATVLINRADAALI
A0A2V8R0I3      ASR-EDVAELLSGPRFARLLDEARK-LF--D--YIIIDAPPLGIFTDANLLINRADAAML
A0A2V8N1U8      AAR-EDVAELLSGPRFGRLLDEARK-MF--D--FVIIDAPPLGVFTDANLLINRADAAIL
A0A2V8QL35      AAR-EDVAELLSGPRFGRLLEEARK-LF--D--YIIIDAPPLGVFTDANLLINRADAALL
A0A352FU10      AAR-EDVAELLSGPRFGRLLEEARK-LF--D--YIIIDAPPLGVFTDANLLINRADAAML
A0A2V8LCU0      AAR-EDVAELLSGPRFGRLLEEARR-LF--D--YIIIDAPPLGVFTDANLLMNRADAALL
A0A1Q7NGT0      AAR-EDVAELLSGPRFGHLLDDARK-MF--D--YIIIDAPPLGVFTDANLLINRADAALL
A0A2V8MLP9      AAR-EDVAELLSGPRFGHLLDDARK-MF--D--YIIIDAPPLGVFTDANLLINRADAALL
A0A2V8PQZ0      AAR-EDVAELLSGPRFGHLLDDARK-MF--D--YIIIDAPPLGVFTDANLLINRADAALL
A0A3B9MKY6      KAR-DDVAELLSGPSYARILTDVRR-MF--D--YIIIDAPPLGIFTDANVLMNRADGALL
A0A3D5SKZ1      KAR-DDVAELLSGPSYARILTDVRR-MF--D--YIIIDAPPLGIFTDANVLMNRADGALL
A0A2V8NRW2      EAR-DDVAEILSGPKFGQLLAELRR-MF--D--YIIIDAPPLGIFTDATVLINRADAALL
A0A2V8TKR9      PIP-PNPAELISSARMRDLLKEMAA-RY--D--HILIDSPPMMNVTDPVILSRMVDGVIL
A0A2V8LBV1      SGR-ESSVHLLHSKRLPDLLRRVRK-EF--D--VVLIDAPPVSQIADARVLARLSDGVIF
A0A2V8GAF9      TPQ-STPYELLNSRRLEGLLSEARR-LY--D--FVLIDTPPLVPFPDCRLLGRWADGFVL
A0A2V8CN98      SRI-RESPELLGSPRMVELLVRLRA-MY--P--VIIVDSPPLGAGVDPYTLGTMTGAMML
A0A1Q7LC46      PLP-PNPADLLSSHRLADAIAELRT-KF--K--FIVIDSPPIMAATDAVILSVLADGVLL
A0A1Q8BDC5      GVA-TNSIEILSLRKMKELIESLRK-DF--D--TIILDAPPFAPIADARIVTGLSDGLIM
A0A2V9Q1Y8      TPP-PNPAELLASSQMLDLLAELRE-QY--D--HIIVDTPPTLSVTDAVVLSTRSDAVVL
A0A2V8JXG1      PIP-PNPAELLSSDRMKRLLAQLSE-RY--D--HIVLDSPPLGSVTDAVILSTMVNGVIL
A0A350D2W9      PIP-PNPAELLGSDRMSKLLALLKD-QF--D--FVLIDTPPILTVTDAQILGKLVDGLVL
A0A2V9I4J1      GVC-TNPVELLSQDKMRELIQYLKT-EF--D--TIIFDAPPFAPIPDARIIMGLSDGLVL
A0A2V8PQZ9      AAR-EDVAELLSGPRFGHLLDDARK-MF--D--YIIIDAPPLGVFTDANLLINRADAALL
A0A2V8D8B1      RIP-PNPAELLGSTRFKDFVTTVGQ-HF--D--WVVIDSPPVMAVADAAVIANIASGVVF
A0A3B9LSB4      PIP-PNPAELLGSDQMRRLMATLQS-QF--S--HVVVDSPPVNSFTDGVLLSSMVDGVLL
A0A2V9H7U2      PKP-PNPAQLLSSSAMESLLKELRQ-RF--K--FIVIDSPPVLPVTDAMILSTFVDGVAF
A0A2V8NJB5      GIA-ENPIELLSLRRMKDLIEYLKN-DF--D--TIILDAPPLSPIADARIVTALSDGCIM
A0A2V9JMZ4      GVC-TNPVELLSQDKMRELIQYLKT-EF--D--TIIFDAPPFAPIPDARIIMGLSDGLVL
A0A2V9MDJ6      GVC-TNPVELLSQDKMRDLIQYLKT-EF--D--TIIFDAPPFAPIPDARIIMGLSDGLVL
A0A2V8QJT6      PVP-PNPAELLGSDQMRKLLATLSE-KF--T--HIVIDSPPVNSFTDGVLIGSMVDGVLL
A0A2V8FSM8      TSR-THASSLVHTERLAEIVVLARE-HF--D--MVIIDTPPMVNIADARVLARHSDALIL
A0A359M0J2      AASASTIHSIFNSPRLGELLAVLRQ-RF--A--MVLLDSPPVLQFPEARLAGRFADGAVV
A0A2V8JLJ1      PMS-SNPGELLSSAHIELVLRECAE-SF--D--WVIVDTPPILGAADVNLMAPFCDAILL
A0A5M8SND8      TSSGSSEASLFYSPSLAKIVQTARK-QY--D--VVLIDTPPCLHLADARVIGKVSDAVIL
A0A2V9GAQ1      PLP-PNPADLLSSHRLVEAVAELRT-KY--K--FIIIDSPPIMAATDAVILSVQTDGVLL
A0A497EDQ8      PLP-SNPPELFGKKSFKDLLATARE-NY--D--WVILDSPPTASVTDPVVAAQLVDMVLA
G8NS05          PVP-PFPTEMLSSETMAELLEKCRG-IY--T--HILIDSPPLLSVTDGIILGRDADAVVL
A0A2V8KZ20      PMS-SNPGELLSSAHIELVLRECAE-SF--D--WVIVDTPPILGAADVNLMAPFCDAILL
A0A3D0NWU2      PIP-PNPAELLSSNEMRNLLQFLRS-KY--K--HVIIDSPPAISFTDAAILSTQVDGVIL
A0A2V8EPD9      RPE-SDPMSGLTSDRMKRVLAQAAS-HF--D--WVLVDSPPVGLLPDASLLATLVDGVLL
A0A3N5NSX5      MTP-PNPSELLASDRMKTLIANVQTGPF--D--WVLIDTPPVLAVTDAVIIAPWVSGVVF
A0A2V8MUA1      TIV-QNPTEVLSSPEFERVMKDLAQ-FF--D--WIVVDSPPSLAMADADLLLRQCDAALL
A0A2V8MBH9      PIP-PNPAELLGSEQMRKLIAVLSG-AF--T--HIVIDSPPVSSFTDGVLIASMVDGVLL
A0A3N5ZPQ7      GIS-DSPIELLSLRKMRELFDYLRI-EF--D--VVIIDSPPLNPISDTRLISGFSDDVIL
A0A3N5P5F2      EVP-PNPAELLSAQQFEHFLNSLSA-RF--D--WVILDAPPVLAVTDASIVAHSASGVVF
A0A2V9G1P7      PVP-PNPSEMLSSQSMSALIRSASA-EY--G--FIILDSSPMLALADSRILAPLVNGVLL
A0A2V9BCK9      RSV-LNPAELLADNRMKVLIDRMAP-VF--D--WVIVDAPPVHPVGDAGVLAGLCDGVIV
A0A2V9TMX2      PIP-PQPTELLGSTVMKDYISRWRN-EF--D--HIIIDTPPCLSVTDAVLLSPEADRVIL
A0A2V8N2J7      VSQ-ANPVAALSSAKARAVFEQLKQ-KF--A--YIIVDAPPVLPIADSQILAGIVDKVLF
A0A3N6BI26      FRP-PNPAELIGSERMESALRLLGD-YF--K--YILIDTPPILSVTDGLLLCPHVDGVVM
A0A2V9JMM3      SDF-ENPVGVLGSERMRRLVERLRL-EF--R--FIVLDAPPILPIADPQVLAGYADGVLL
A0A2V9M815      SDF-ENPVGVLGSERMRRLVERLRL-EF--R--FIVLDAPPILPIADPQVLAGYADGVLL
A0A2V9A795      PVP-PNPAELLSSKSMGAFITSAKS-EY--G--FVILDSSPLLTLADSRIVASLVDGVLM
A0A355ESH9      PMP-PNPSELLASERLRDLLRTLRS-RF--D--YVIVDTPPALAVTDATLVGIQTDGVVL
A0A3D0NW85      PIP-PNPAELIGSQPMAELLVTLQK-NF--T--HVVIDSPPITSFTDGVLIASMVDGVIL
A0A353CAT5      PIP-PNPAELIGSEQMASLLKVLQK-HF--T--HVVIDSPPITSFTDGVLIASMVDGVIL
A0A2V9HB55      PLP-PNPADLLSSHKLADGITELRT-KF--K--FIVIDSPPIMAATDAVILSVQADGVLL
A0A2V8CU57      MPT-SDPMSALASEEMKLLLGEAIE-HF--D--WVIVDSPPVALLSDANLVAAMVDATIL
A0A2V8BDI4      MPT-SDPMSALASEEMKLLLGEAIE-HF--D--WVIVDSPPVALLSDANLVAAMVDATIL
A0A2V8F8T3      MPT-SDPMSALASEEMKLLLGEAIE-HF--D--WVIVDSPPVALLSDANLVAAMVDTTIL
A0A2V9J901      PIP-PNPAEVLSSSLAAESLRKLRA-DF--D--YVLVDSPPLLSVADGRILATMVDGAVL
A0A2V8MKQ7      PIP-PNPAELLGSDEMRRLLASLSE-KF--T--HIVVDSPPAISFTDASILSTVVDGVIL
A0A3M1SNQ5      AIK-SDSSELLSGPKFRDLLQHLKK-MF--D--YILIDAPPLAIFSDAKVSINQSDAAIL
A0A2V8QJ59      PMP-PNPAELLGSEEMRKLLIALSK-KF--T--HVIVDSPPAISFTDASILSTFVDGVIL
A0A1Q7HTA7      RTP-ANPYEVLKSAGIGEVIQAARR-RY--D--AVVVDTPPLLPVPDNRALAKWVDGFLL
A0A2W0B5E2      PIP-PNPAELLCSEAMESLFGELRR-RF--K--HIIIDSPPLLAVTDATVLASAVDGVIL
A0A2V8NMG8      PIP-PNPAELIGSEQMRRLITTLQS-TF--T--HIIIDSPPIASFTDGVLIASMVDGVVL
A0A2V8TBM7      PVP-PNAAELLGSEEMRKLLYLLTE-NF--T--HIIIDSPPAISFTDASILSTMVDGVML
A0A1Q7HEZ8      VTR-VPIHEILRSPRLERLLQEARQ-RY--D--FIVLDTPPLLPVFDAATISKLVDGLIV
A0A1Q7JW36      VTR-VPIHEILRSPRLERLLQEARQ-RY--D--FIVLDTPPLLPVFDAATISKLVDGLIV
A0A1Q7MUR4      VTR-VPIHEILRSPRLERLLQEARQ-RY--D--FIVLDTPPLLPVFDAATISKLVDGLIV
A0A3N5PFU4      VVA-GPIHDVFRSARLPQLLSEARA-RY--D--YVVLDTPPLVPVVDSVLLSRVVDGVLV
A0A4R1LDF1      SPA-DRPEEAVHSEGVKKVLEAARQ-EY--D--MVIIDSAPLLLAVDTHVLLPMVDHALL
A0A1F2T1R8      ATR-AGVTEMLRSPRLEQLLQEARR-EY--A--YVVIDTPPLLPIFDASVLAKLADGVLM
A0A2V9BW09      HPP-PNPAELLQSPRIQELLTQISS-AF--D--WIVLDAPPVNLFADARHLANLADAVVL
A0A3M1SSE1      PVP-PNPAELIGSAQMSTLMEIFQK-EF--T--HVIIDSPPIASFTDGVLIAAMVDGVIM
A0A2V9GQV7      MVS-SPPPELFAGTRWQEFLGHCGE-MF--K--VILIDAPPILPRVDFELISAACDGIVM
A0A2V7YV88      PIP-PNPSELLGSGRMKELIAQMLS-HF--T--HVIFDTPPINAVTDAVILAASADGTIV
A0A2V8YCY6      PLP-PNPADLLSSHKLADAIVELRA-KF--K--FIVVDSPPIMAATDAVILSVHADGVLL
A0A2V8EGM3      RPN-PDPLSGISSLRMQQLLREAVE-RF--D--WVILDTPPVGVAADAGLLCPMVDGTLL
A0A2V8FGH1      RPN-PDPLSGISSLRMQQLLREAVE-RF--D--WVILDTPPVGVAADAGLLCPMVDGTLL
A0A2V8D468      HIP-PNSAELLTSQQFKDLLSALGG-HF--D--WIVLDSPPVSAVTDAVQLSHDVSGVLF
A0A1F2R977      PLH-ASSVGGLASNRMKAVIDGAAP-RF--D--WVLVDTPPIGLLSDAQFLAGLVDGVLL
A0A2U3LF12      TQL-SDPVELLSSRRTREILARLRQ-EY--Q--LIVLDSPPIVPIADSHFLAGLADGVIL
A0A3N5G7M6      TLP-PNPSELLDSQRFRKFLARLGN-HY--D--WVILDSPPVMPVTDAIVLAEAATGVIF
A0A1F2S3Q7      SPR-AGISEILRSPRLDAFLQELRQ-RY--A--YIVLDTPPLLPVFDAALIAKSVDGVLM
A0A2V8GVG4      TRK-GAVHQVLRSPRLDAVLAEARG-RY--D--FVVLDTPPLLPVFDSALLANAVDGVLM
A0A143PNR5      RPV-ENPVPLLTSERMGELVRDARQ-HF--D--WIVIDTPPVALLTDANLLTKECDGALL
A0A2V8PJQ0      PIP-PNPAELLGSEQMRRLLTLLGE-KF--A--HIIVDSPPAVSFTDASILSTFVDGVIL
A0A2V8H566      RPN-PDPIGGLTSERMRQLVAAGTA-EF--D--WVVIDTPPVGLLTDARLMSSMVDAVIF
A0A3N5YKY1      RPT-NQPTELLGSFEMRRAVDTLRT-HF--D--RIVIDTPPALALADVGVVGPLSDGVLL
A0A2V8UVN4      KPT-AHPTELLDSNRWTALCASVRQ-QF--K--FVILDTPPIAAVADYDLIDAQCDGVVL
A0A321LXF5      KSS-TPAPELFSRAAWKEFIGWSSE-SF--K--LVLIDSPPMLDLADFELIASPCEAVML
A0A5M8SBZ0      -PA-RSPAELMSNGKMKGLLDELEP-HF--E--WIVIDSPPVSVVSDVASLAAVSHGIVL
A0A1Q7JFB1      RPD-SDPMSGLTSGRMRRLIGEAAA-TF--D--WVIIDTPPVVLLPDANLLAAMVDAAIL
A0A2V8DMJ9      TPQ-VTPYELLNSPRLEGLLRDARR-TY--D--CVLIDTPPAVALPDCRLIERFVDAFLV
A0A2V8GGF6      SPQ-PAAYELLNSTRLESSIETARR-RY--D--YVLIDTPPLVPLPDCRLLAKCVDGFLL
A0A2V8HKU7      SPQ-PAAYELLNSARLESSIEEARR-RY--D--YVLIDTPPLVPLPDCRLLAKCVDGFLL
A0A1Q6Y875      RPV-SNPTELLGSTRTKSLFERLNT-LF--D--WVIVDTSPVLPVSDAAVLAPTCDGVIL
A0A523DJA9      QPP-PNPSELLASDRMRNLLASLATGPF--D--WIILDTPPVLAVTDSVILAPLLSGMVF
A0A2V8I604      PVP-TRPAELLGSSAMRRLLDTVRT-QF--D--RVLLDMPPVAPLADVSIVASMIDGVLM
A0A2V8J066      VPP-SHPAELLGSAAMRRTIDTLRT-RF--D--RLILDMPPVAPLADVNIAAAVADGILL
A0A1I6MMC5      GDA-DNAADLSSNNRFKELIVKASA-FF--D--WIIVDSSPVNVIADGVNLAHACDGVLL
A0A2V9D5W7      TRI-ANPSELLANGRFKRLIERVAP-LF--D--WIIVDSTPCLPVTDANIAANSCDGLLL
A0A2V9D4I4      TNI-ANPSELLSNGRLKSLLDHMAP-FF--D--WIILDSPPCLPVMDANVVADLCDGLLF
A0A2V9D6L7      TKI-ANPSELLSNGRLKKLLDRVAP-LF--D--WIIIDSPPCLPVADANVVSNFCDALLF
A0A2V8ZJV2      SLV-SSPSEVLRTERMKQLLNRVTP-LF--D--WIILDSPPSLRADDAGILADLADGVLL
A0A2V9AWB5      NLV-SNPSELLLSERMKHLLNVVSP-AF--D--WIILDAPPTLPVHDASILADLVDGVLF
A0A2V8Z1Y8      RAV-SNHSDLLLSKKMKHLLNYLTP-IF--D--WVIMDSPPTLPVHDASVLADLADGVLL
A0A1Q8AX10      RSV-LNPAELLADNRMKVLIDRMAP-VF--D--WVIVDAPPVHPVGDAGVLAGLCDGVIV
A0A2V9A773      RPV-GNPSELLANGKLKGFLNGINS-VF--D--WVIVDAPPVLAVADAGIIAQFCDGVIV
A0A2V9AND3      RPV-HNPSELLGNGLLRDFLHGMSP-IF--D--WVIVDAPPVLALADAGIVAEFCDGVIV
A0A2V9BTJ7      SEA-PNPSELLLNDRMKRLLDLMTP-IF--D--WIIIDTPPALPVHDASMMADLCDGVLF
A0A2V8W2M7      HPV-SNPSELLSGDRMKKLLDLVTP-VF--D--WVILDSPPSLAIHDASILADLCDGVLF
A0A2V8XNW2      HPV-SNPSELLSGDRMKKLLDLVTP-VF--D--WVILDSPPSLAIHDASILADLCDGVLF
A0A1Q7CJC1      HPV-SNPSELLSGDRMKKLLDLVTP-VF--D--WVILDSPPSLAIHDASILADLCDGVLF
A0A2V9UEM7      RQA-TGAPELLANGRLKLFLQRVEP-LF--D--WIILDTPPVIPVADSTLLANFCEGVLM
A0A1Q7V300      TRN-ENPAELVASGRMSTLLHRLEP-LF--D--WIIVDSPPAVAVSDAALLAKYCDGVIM
A0A2V9ZCI3      KQV-SSPAELVANGRLKFLLNRVES-LF--D--WIIVDSPPAVPVSDASLLANFCDGVLI
A0A2V9WCB3      SGI-EDPSELIANGRLKMLLQRLEP-LF--D--WIIVDSPPAIPVSDASVLAKACDGVLM
A0A2V9VQW5      RTV-THPAELIANGRLKMLLQRVEQ-LF--D--WIIVDSPPAVPVSDASQLANFCDGVLM
A0A2V9WTP3      CEV-SNPAELVANGRLKFLLQRVEP-LF--D--WIIIDSPPAVPVSDASLLANSCDGVLM
A0A2V9NLA9      RKV-TSPAELVANGRLKTLLNRLEP-LF--D--WMVLDSPPAVPVSDAGLLANYCDGVLM
A0A2V9RKJ9      RKV-TSPAELVANGRLKTLLNRLEP-LF--D--WMVLDSPPAVPVSDAGLLANYCDGVLM
A0A2V9RN95      RTV-SSPAELVANGRLKFLLNRLEP-LF--D--WIIIDSPPAVPVSDAGLLANYCDGVLI
A0A2V9N406      RTV-SSPAELVANGRLKFLLNRIEP-LF--D--WIIIDSPPAVPVSDAGLLANYCDGVLI
A0A2V9U6D9      RTV-SSPAELVANGRLKFLLTRVEP-LF--D--WIIIDSPPAVPVSDAGLLANYCDGVLI
A0A2V8DZN4      TSR-THASSLVHTERLAEIVVLARE-HF--D--MVIIDTPPMVNIADARVLARHSDALIL
A0A2G6HQA4      KPP-SNPSELLGSILMKDLIAELSS-RY--TDRTIIFDAPPVLLTAEARTLAHHVDGVVM
A0A2V7ZTY7      RPD-SDPMSGLTSNRMRRLVGEAAA-TF--D--WVIIDTPPIVLMPDANLLAAMADAAIL
A0A2V7ZVL9      RPD-SDPMSGLTSNRMRRLVGEAAA-TF--D--WVIIDTPPVVLMPDANLLAAMADAAIL
A0A1Q7QYI4      RPD-SDPMSGLTSGRMRRLIGEAAA-TF--D--WVIIDTPPVVLLPDANLLAAMVDAAIL
A0A2V8G9Y9      RPD-SDPMSGLTSDRMRRLVAEAAA-RF--D--WVLIDTPPVGFLSDANLLAAMADVTLF
A0A143PXU3      RPQ-ANPVGDLSSGRMSRLIANAGS-TY--D--WVIVDSPPAAGLADARIILETVDGAIL
A0A2V8D8G9      KPG-PTPLAGLTSSRMGEVIEECAA-RF--D--WVLIDTSPVGVLPDAQVLARLVGAVIL
A0A2V8ESQ4      KPG-PTPLAGLTSSRMGEVIEECAA-RF--D--WVLIDTSPVGVLPDAQVLARLVGAVIL
A0A1E3Y5Q0      EPT-DDPMVTLAAERMQALITEARE-QF--D--WIVIDTPPVGLLPDAGLISGLADGTVV
A0A2W4TWK5      RPT-TDPMAVLASERMRDLLADVRE-DY--D--WVVIDTPPIGLLADANLLADVSDGMVL
A0A3N5NYV3      QPD-PDPMSRLASDRMRRVLMEAAT-QF--D--WVIIDTPPVGTVPDANLLATMADVVLL
A0A2V2RJF9      SKT-PRPAELLSSHRLTQLLEQLKA-EF--D--HVIVDSPPLMPVTDAVILAAKSNCVVM
A0A2G6HNT3      DTP-PNPSELLSSVLMKDLIKELSS-RYTDR--TIIFDAPPVLLTAEARILAHHVDGVVM
A0A2V7YWD4      RPQ-ADTYELLASGRFGELLRDARQ-RY--D--CVVVDTPPVLPAPDSRLLAEWIDGYVI
A0A2V2R8T6      GVR-NDVAELLGGPTYARLLTDARR-MF--D--YVIIDAPPLGVFTDASVLISRADGALL
A0A1Q7RGF1      SHT-TQPAELFASSHWQEFISWCSE-SF--K--LVLIDSPPVLNLTDVDLIAAACDGVVM
A0A2V9BLX2      SHT-TQPAELFASSHWQEFISWCSE-SF--K--LVLIDSPPVLNLTDVDLIAAACDGVVM
A0A2V9ZA03      EAM-GQPLEILQSQRMSEMLTQVAE-WF--E--WVIIDSPPLAPVADPNLWAMQADGTLL
A0A3N5ZNH4      FRP-PNPAELIGSDKMETGLKLLGE-YF--K--YVVVDSPPVLAVTDALVISPLVDGVVL
A0A2V8GEZ2      CPN-PDPIGVLTSPAMRQLVKFARD-GY--D--WVLIDTPPVGLLTDAHLVAQMVDAVVM
A0A3N5ZFD3      RPH-PDPMAVLTSDRMRRLMEEAAA-GF--D--WVVVDTPPVGLLPDANLLAAMVHAAVL
G8NXD3          KAV-SKPVPLLRAPELSNLLKWAQK-NF--Q--WVLLDAPPVLPVADVEQLLPSADLVLM
A0A2V9VR38      TPP-PNPAELLASTNMRDLLAQLRE-QY--D--HIVIDTPPSLSVTDAVVLSPRADAVVL
A0A2V9EY04      TIS-SPPPELFTGSHWQELLGRCSE-LF--E--VVLVDTPPIIPLADFELISVACQGVVM
A0A2V9HAK9      TVS-SPSPELFIGTRWQEFLGHCGE-MF--K--VILIDAPPILHLADFELISAACDGIVM
A0A1Q7FS15      TVL-SSPPELFTGTHWQEFIARCSE-LF--K--VILIDTPPILPLADFELISAACDGVLM
A0A1Q7K9P1      TVL-SSPPELFTGTHWQEFIARCSE-LF--K--VILIDTPPILPLADFELISAACDGVLM
A0A1Q7N989      TVL-SSPPELFTGTHWQEFIARCSE-LF--K--VILIDTPPILPLADFELISAACDGVLM
A0A2V9G7Y0      TIS-SPSPELFTGTRWQEFLGQCGE-MF--K--VILIDAPPIRPLADFELISAACDGIVM
A0A2V8T7Z1      RSH-ADPFDVLRSPRFEEFLRQARE-SY--D--SVVLDTPPLLMVPDCRQLSAWVDGILL
A0A2V7U8G5      APP-ANPYQALESPRIGQLLEQARD-AY--E--YVVLDTPPVLLVPDCKLMSQWIDGFLL
A0A2V7UNP9      AAP-ADAYRVLESARVGQLLDTARG-SY--D--CVILDMPPVLLVPDCRLMSQWIDGFLL
A0A2V7VLD7      AAP-ADAYRVLESARVGQLLDTARG-SY--D--CVILDMPPVLLVPDCRLMSQWIDGFLL
A0A2V7XGA3      PST-PSAYRLFDSARVGQLLDQARR-RY--D--HVLVDTPPVLLVPDCRLMSQWVDGFIV
A0A2V7YAG6      PAA-PNAYRVFDSPRVGELLEQARR-TY--D--YVVLDTPPVLLVPDCRLMSQWVDGFLI
A0A2V7VK33      RFH-DLPFELLRSPRLADLLAEARQ-QY--D--YVVVDTPPLLLLPDCRAVAQQVDGFLL
A0A3M1VTE1      RPV-ANPVGLLSSGRMAGLLAEWRS-RF--Q--RVVVDTPPIVPFADAGILGELSDGVLL
A0A2V7TTM7      TSP-SNAYQILESPRIGQLLQEARR-SY--D--RVVLDTPPLLLVPDCRLLSQWVDAFVI
A0A2V8VI82      RTS-DNPYDVLKSPRMGEIVQAARR-RY--D--TIVIDTPPIVPVPDSRVLAKWVDGFLL
A0A2V7U4P9      HAV-MAPYEILRSPRVAELLAEAHS-LY--D--YVIIDTPPVIPCPDYRLLEPFIDGVML
A0A2V7TQY5      RCP-AAPYEMLKSPRLGQLIGQARD-RY--E--YVVIDTPPLVPVPDARVVEKWVDGFVI
A0A2V7TU87      VFS-DIPYELLRSSRLGDLLDQARR-DY--D--YVVLDTPPLVPIPDARVISKWVDSFLL
A0A2V8SEH0      RSP-SAPYEVLKSPRLGDLFQEARR-RF--D--YILVDTPPIVPVPDCRVISKWVDGFMV
A0A2V8VU54      RLA-PQPYEVLKSPRFGAVLEEARR-MF--D--YVVVDTPPLIPVPDCRLIARWVDGLLM
A0A1Q7RML7      RLP-PAPYEALKSPRLGALFEQARR-LF--D--YIVVDTPPLVPVPDCRLLARWVDGLLM
A0A1Q7ZIQ5      RLP-PAPYEALKSPRLGALFEQARR-LF--D--YIVVDTPPLVPVPDCRLLARWVDGLLM
A0A2V8TKD8      RLP-PAPYEALKSPRLGALFEQARR-LF--D--YIVVDTPPLVPVPDCRLLARWVDGLLM
                                           :      ::.* .*     :             

A0A1F2U8T6      VVGAEMTRRQVAEHAIETIL-SSRPKLLGVVLN----KV-----DFARNKY-----YYSR
A0A2V8BV42      VVGAEMTRRRLAERALETIM-SSRPRYAAIILN----RV-----DFARNKY-----YYSR
A0A2V8F916      VVGAEMTRRRLAERALETIM-SSRPRYAAIILN----RV-----DFARNKY-----YYSR
A0A1Q7K833      VIGAEMTRRRLAERAIETIL-QTRPKYTAVVLN----KV-----DFARNKY-----YYSR
A0A1Q8AMY4      VIGAEMTRRRLAERAIETIL-QTRPKYTAVVLN----KV-----DFARNKY-----YYSR
A0A2V8BM40      VIGAEMTRRRLAERAVETVM-QARPKYAAVVLN----KV-----DFARNKY-----YYSR
A0A2V8CRT6      VIGAEMTRRRLAERAVETVM-QARPKYAAVVLN----KV-----DFARNKY-----YYSR
A0A1F2VH76      VVGSEMTRWRLAERAVETLL-SGNPRHLCAVLN----KV-----DFARNKY-----YYSR
A0A1F2R0X5      VIGAEMTRRRLAERAIETIM-EARPRQVGVVLN----KV-----DFARNKY-----YYTR
A0A2V8B278      VVGAEMTRRRLAERAIETVM-QTHPKYAAVVLN----KV-----DFARNKY-----YYHR
A0A2V8CEF9      VVGAEMTRRRLAERAIETVM-QTHPKYAAVVLN----KV-----DFARNKY-----YYHR
A0A2V8KZG2      VVHAGRNKRNAVQRACRELS-AVGARIFGVVLN----NV-----NMKREGYADYQYYYYG
A0A1Q7LG57      VMRAGQTTTESALYASQRFA-EDGTRVLGTVLN----SW-----DPKNSHR--YGYGSYA
A0A2V8YMQ4      VAKSGATPREQIRQSQSGIR-SAGANLIGVVLN----NV-----TLHTNGY--YGLGIYG
A0A1Q7L5B1      VVRAGSTGYDVVSTALQELR-G--KKILGVVLN----RA-----EEKEATY--GAYPYYG
A0A2V9DKV4      VVRAGSTGYDVVSTALQELR-G--KKILGVVLN----RA-----EEKEATY--GAYPYYG
A0A2V8W380      VVRSGTTPREQLLHAQSGIR-SVGGNLIGVVLN----SV-----DIRTN----GYY-NYG
A0A2V8ZIV5      VVKSGATPREQVMQSQSSIR-TAGANLIGVVLN----IV-----RLHTN----GYY-GLG
A0A2V9EVA0      VVGAGRTSSDLARTACQELR-E--SRLLGVVLN----GV-----EDDAVGS--PYA-YYG
A0A1Q7RB73      VVQSDATPHDLARKACQEFA-S--KKIVGVVLN----RV-----KPEYSYG--SQY-YAT
A0A2V9K0H7      VVQSDATPHDLARKACQEFA-S--KKIVGVVLN----RV-----KPEYSYG--SQY-YAT
A0A3N5YN96      VVRAGQTPRPAIERALRQVA-P--ARVLGLVLN----DV-----GEI---S--SGY-AYG
A0A1Q7Y646      VVRAGKTRYATVERLLEQLP-R--ERMLGVVLN----RS-----EETMEDS--SAY-YYR
A0A2V8QZU0      VARAGRTRYAALERLLEPLP-R--ERLLGVVLN----GS-----DEQLSEQ--NYY-YYR
A0A2V8RSQ9      VVRAGRTRYGTLDRVLEPLP-R--ERLLGVVLN----GA-----DSAPDAQ--SYY-YQR
A0A2V9LS17      VVAAGSTSCEASQKTRDQFK-G--RRVLGVVLN----RV-----DPRGSSS--YKY-YDY
A0A2V9AGR3      VVKAGETSYENAVKGSSEFR-E--KNLLGVVLN----QI-----QEADMYA--GDY-YYG
A0A2V9G0N7      VVRAGVTDFEVAERAVAEFR-E--KNLLGVVLN----GA-----EQGAAY---GEY-YNH
A0A2V9GQ44      VVRAGVTDFEVAERAVAEFR-E--KNLLGVVLN----GA-----EQGAAY---GEY-YNH
A0A2V9HRN3      VVRAGVTDFEVAERAVAEFR-E--KNLLGVVLN----GA-----EQGAAY---GEY-YNH
A0A2V8WG13      VVKAGETNHQLAEKASAEFL-K--KNLLGVVLN----SA-----EIDASY---GDY-YSG
A0A2V8X987      VVQAGMTHVGEAEKAAEEFQ-N--KNLLGVVLN----KV-----EKRDSY---GAY-YHG
A0A1Q7KX94      VIRAGSTDAAIAERTAAEFQ-G--KNLLGVVLN----QV-----ERSDSY---GDE-YQN
A0A2V8XHT0      VIRAGSTDAAIAERTAAEFQ-G--KNLLGVVLN----QV-----ERSDSY---GDE-YQN
A0A2V9L2P7      VVENEVTTRATLSRACSVIR-HSGGKILGAVVN----KV-----DARRDGY--YGH-YHY
A0A2V7UMX0      VVAAHRTPRPLLAEALGVLE-P--DKVVGLVLN----GD-----DSFSSEY--YRY-YRG
A0A136K497      VVRANRTKYGALDRILEPLP-K--DRMLGVILN----QS-----EEVLDES--HYN-YGY
A0A399W9E4      VVRANRTKYSALDRILEPLP-K--DRMLGVILN----QS-----EEVLDES--HYN-YGY
A0A2V7X0V9      VVRSNATPCDVARKAREEFP-D--QSLIGVVLN----GT-----SDDAASY--ARY-YYE
A0A2V9X518      VVRSNTTPFDMARKARLEFQ-D--KHLIGVVLN----GI-----EADSSPY--SRY-YYG
A0A2V9VC62      VVRSNATPYDTAQKARQEFQ-G--KTLVGVVLN----GI-----TRGDS-Y--SRY-YYE
A0A2V9S1P8      VVRSNATPFDVARKARQEFR-D--KHLVGVVLN----GV-----STESS-Y--TQY-YYA
A0A2V9RTW2      VVRSNATPVDMARKARQEFR-D--KHLVGVVLN----GI-----EADSSPY--NQY-YYG
A0A2V9TGF1      VVRSNATPVDMARKARQEFR-D--KHLVGVVLN----GI-----EADSSPY--NQY-YYG
A0A2V9XEV6      VVRSNTTPFGMARKARLEFQ-D--KHLIGVVLN----GI-----EADSSPY--SRY-YYG
A0A2V9Y3Q6      VVRSNTTPFDIARKARQEFE-D--KHLVGVVLN----GI-----EPDSSPY--SRY-YYG
A0A2V9R269      VVRSNSTPIDAARRARAEFT-G--RNVVGVVLN----GI-----TAEMSPY--MQY-YYS
A0A2V9PTS3      VVRSNTTPADAARKARQEFA-D--HNIVGVVLN----GI-----TPELSPY--SQY-YYS
A0A2V9NPF4      VVRSNTTPADAARKARQEFA-D--HNLVGVVLN----GI-----TPELSPY--SQY-YYS
A0A2V9PNZ0      VVRSNTTPADAARKARQEFA-D--HNIVGVVLN----GI-----TPELSPY--SQY-YYS
A0A321LMC5      VVKAGRTHHSAVANALKLIP-K--ERRVGVVLN----VA-----EVFNEEV--TYY-YGA
A0A2V8X713      VVRAGATAHDLVQTTLQEFR-G--KNLLGVVLN----RA-----EREANYG--AYS-Y--
A0A2V8ZLE9      VVRAGETAHNLVKTTLQEFR-G--SNLLGVVLN----GG-----SEAANYG--GYA-CSA
A0A2V8Y4D3      VVRANKTPHDLVKTTLQEFR-G--NNLLGVVLN----DA-----SEGANYG--GYS-FRA
A0A2V8Z2X8      VVRAGQAGRDLVKTTLQEFR-G--NNLLGVVLN----GS-----DQDASCA--SYS-YYA
A0A2V9C3F6      VVQAGETAHDLVKTTLQEFR-G--NNLLGVVLN----GA-----NEGTNYG--GYS-YYA
A0A2V9QMU9      VIRSGQTTRQALRRARDILL-QVNAHATGVLLN----AV-----DLNSGDY---YY-YEY
A0A2V9QY75      VIRSSQTTKPALRRTRDILT-QVNARVAGVLLN----AV-----NLNSPDY--SYY-YEY
A0A2V9SVU9      VIRSGQTTKQALRRSRDLLM-QVNARIAGVLLN----AV-----DLNSPDY--YYY-YEY
A0A2V8W5N5      VVRAGSTSVDVAEKVCQQLK-G--KNIVGVVLN----GA-----EKSDLVD--SHY-HAY
A0A2V8XG53      VVRAGSTSVDVAEKVCQQLK-G--KNIVGVVLN----GA-----EKSDLVD--SHY-HAY
A0A2V9XV04      VVRSNSTPSDVARKARMEFP-D--QMLVGVVLN----GT-----DRDEAEY--ARY-YYE
A0A2V9CBY1      VVRAGMTAFDMAQAACGELR-N--KNLLGVVLN----GV-----EEEAIYG--AYG-YY-
A0A2V9D656      VVRAGVAAFDMAQAACGELK-H--KNLLGVVLN----GV-----EEEAIYG--AYG-YYY
A0A352EZH8      VVRAGKTRYAQVNELLEQLP-R--ERMLGVVLN----RA-----DEELESG--AYY-YQQ
A0A0B6X033      VVRAGYTRYSLLDRLLEPLP-R--ERLLGIVLN----GV-----DETLDEH--SYY-YRR
A0A2V8R0I3      VVRASKTRYAVVDRLLEQLP-R--ERVLGVVLN----RA-----ETRLDDA--AYY-YQS
A0A2V8N1U8      VVRASKTRYSIVDGLLEQIP-R--ERLLGVVLN----RA-----QAATDET--AYY-YQP
A0A2V8QL35      VVRAGVTRYAVVDRLLEQLP-R--ERMLGVVLN----RA-----QGKPDDA--VYY-YQP
A0A352FU10      VVRAGVTRYAVVDRLLEQLP-R--ERMLGVVLN----RA-----AGKTDDA--AYY-YQP
A0A2V8LCU0      VVRASATRYSVVDRLLEQLP-R--ERILGVVLN----RA-----EAKPEDT--AYY-YQP
A0A1Q7NGT0      VLRAAKTRYSVVDRLLEQLP-R--ERMLGVVLN----RA-----EIEPDET--AYY-YQP
A0A2V8MLP9      VLRAAKTRYSVVDRLLEQLP-R--ERMLGVVLN----RA-----EIGPDET--AYY-YQP
A0A2V8PQZ0      VLRAAKTRYSVVDRLLEQLP-R--ERMLGVVLN----RA-----EIGPDET--AYY-YQP
A0A3B9MKY6      VVRSGKTRYALIDRLLEQIP-R--EKLLGVVLN----RV-----DEQFDET--AYY-YQR
A0A3D5SKZ1      VVRSGKTRYALIDRLLEQIP-R--EKLLGVVLN----RV-----DEQFDET--AYY-YQR
A0A2V8NRW2      VVRSGKTRYAALDRIIEQLP-R--ERLLGVILN----RS-----DEQLDET--SYY-YQR
A0A2V8TKR9      VVHGGKSPRTTVQRARQELQ-GVGAKIYGVVLN----NI-----DLRRE-------GYDS
A0A2V8LBV1      VVRSAETTRDMAMAACRQFS-EDRSRVLGTILN----MW-----DPREHNQ--G---HYS
A0A2V8GAF9      IVGANKTPRKLLAQALNLLD-P--AKLIGVVLN----GE-----DRPLSSH--YGYYYDT
A0A2V8CN98      VLRTGATNLDLARTKVAMLE-NLPIRVVGAVLN----DV-----RLGQ---------MYG
A0A1Q7LC46      IVRSGETPKAAFTRTRDLLN-SVKSRILGVVLN----AV-----DSSAPDY--Y---YSY
A0A1Q8BDC5      VLRRGKTSYADTDRAFQAID-R--NKLLGVVFN----DV-----QRLFKTY--S---HYG
A0A2V9Q1Y8      VIRSGQTTKPALRRSRDILA-QVNARVAGVLLN----AV-----DLDSPDY--Y---YYY
A0A2V8JXG1      VVHGGRNSRQAVQRACHELS-AVGARVFGIVLN----NV-----DLRREGH--D----DY
A0A350D2W9      VVQAGTTPREALVQTRELID-LLKLRTLGVVVN----SL-----NLENHGY--YGRHYYR
A0A2V9I4J1      VVRRGKTPFSAIEKAFKVLD-R--KKLLGIVFN----DV-----KPMLLHT--H---YDH
A0A2V8PQZ9      VLRAAKTRYSVVDRLLEQLP-R--ERMLGVVLN----RA-----EIEPDET--A---YYY
A0A2V8D8B1      VVGAEMTSRTVARTAVEQLA-NARGRVIGAVLN----RV-----DLDNNAY--Y---YSQ
A0A3B9LSB4      VVHGGKSSRHVVRRSRQLLH-DVGAKIFGVVLN----NV-----ALQSHDY--Y---YYQ
A0A2V9H7U2      VVESGVTARGAVVRARRVLE-NAGARILGLVLN----KV-----DVRHNGY--Y---GYY
A0A2V8NJB5      VIRRGKTSYRSIEGAFRVID-Q--AKLLGIVFN----DV-----KPMLFHT--Y---YKR
A0A2V9JMZ4      VVRRGKTPFSAIEKAFKVLD-R--KKLLGIVFN----DV-----KPMLLHT--H---YDH
A0A2V9MDJ6      VVRRGKTPFSAIEKAFKVLD-R--KKLLGIVFN----DV-----KPMLLHT--H---YDH
A0A2V8QJT6      VVHGGKSSRDVVRRSRQLLL-DVGAKIVGVVLN----NV-----SVRSHEY--Y---YYY
A0A2V8FSM8      VVRSGQTTRDAARWAQARFA-EDGTAVLGTILN----FW-----NPKTPGY--A---YYK
A0A359M0J2      VLRSRHTERDAAMIALRRMA-EDGIPLLGTILN----DW-----DPKSGAH--HSHGYGA
A0A2V8JLJ1      VVQSGKTPLKVIKDSIKRVG-R--EQICGVILN----RV-----KVARYGS--Y---YDA
A0A5M8SND8      VTRAGHTTWTEGRAVAQNFT-EDGTRILGTVLN----DL-----KQSVGAY--S---YVT
A0A2V9GAQ1      VVRSGETPKKAFTRTRDLLS-SVKCRILGVVLN----AV-----DSSAPDY--Y---YSY
A0A497EDQ8      VVKYGGPRRQVVADAMRTLK-RSGVRVAGVLLN----NV-----DIERDHY--Y---STY
G8NS05          IVRHGKSNKHTIRRARDLLL-RAGVHITGIALN----AI-----DLNSPE---Y---YGY
A0A2V8KZ20      VVQSGKTPLKVIKDSIKRVG-R--EQICGVILN----RV-----KVARYGS--Y---YDA
A0A3D0NWU2      VAMAGKSSMHLMRRFKQRLG-NIGARIYGVVLN----GI-----KQGSVEY--G---YYG
A0A2V8EPD9      VIRSGKAPFPLVKRAVEIIT-H--QRILGVVMN----AI-----DFKHDRN--A---GGY
A0A3N5NSX5      VIGSEMTQRRLAERAVETLL-TSRPHVLGAVLN----RV-----DIIRNKY--Y---YSR
A0A2V8MUA1      VVNADKTPLKLIRDAVERMG-R--DRICGVLMN----RV-----RNLSSSH--Y---YSR
A0A2V8MBH9      VVHGGKSSRGVVRRSRQLLT-DVGAKIFGVVLN----NV-----SARSHDY--Y---YYY
A0A3N5ZPQ7      VIRRGRTPFATIEQGLKVVD-R--KKILGVVFN----DL-----DEKESQF--S---YYQ
A0A3N5P5F2      VTSADLTDRNAAVQAVSQLR-SAKANFLGVVLN----RV-----NLSRNAF--F---YAP
A0A2V9G1P7      VVKSGTTPREQFMHAQSGIR-GVGGNLIGVVLN----NV-----DICT-NG--Y---YNY
A0A2V9BCK9      VVRAKLTAYDLVQTTLQEFR-G--KNLLGVVLN----GA-----DEEAT----------Y
A0A2V9TMX2      VARSGQTTRPALRRACDLLL-QVNARVMGIVLN----AL-----NLHSVEG--Y---YYY
A0A2V8N2J7      VIRARQTPRELFQHAIEGFE-A--ANLLGAVLN----DV-----DYQRSRY--A---YAY
A0A3N6BI26      VIKGGSTPKEAARKAGNHLT-SVGARILGALIN----NV-----DMNAPEY--S---YYY
A0A2V9JMM3      VVRARRTRRELFKHAIESFR-A--TNVLGVVLN----GA-----DYAGSRY--A---RAY
A0A2V9M815      VVRARRTRRELFKHAIESFR-A--TNVLGVVLN----GA-----DYAGSRY--A---RAY
A0A2V9A795      VVKSGATPRDQVMQSQAGIR-SAGANLIGVVLN----SV-----TLHT-KG--Y---YGL
A0A355ESH9      TLRSHKVTREEVRLVRDRLR-QADVKILGAVLN----RY-----RALQAGA--A---AGY
A0A3D0NW85      VVHSGKSSRQIVRRAKQLLN-DVGARIFGVVLN----NV-----DLRSQEN--Y---YYY
A0A353CAT5      VVHSGKSSRQVVRRTKQSLI-DVGAKIVGVVLN----NV-----NLRSQDN--Y---YYY
A0A2V9HB55      VVRSGETPKAAFTRTRDLLN-SVKCRILGVVLN----AV-----DSSAPDY--Y---YSY
A0A2V8CU57      VIGAATTPYPLVRRAVESVG-A--SRIIGTVLN----RI-----ERG--QM--V---GGY
A0A2V8BDI4      VIGAATTPYPLVRRAVESVG-A--SRIIGTVLN----RI-----ERG--QM--V---GGY
A0A2V8F8T3      VIGAATTPYPLVRRAVESVG-A--SRIIGTVLN----RI-----ERG--QM--V---GGY
A0A2V9J901      VARAFETPYDLVCRARSLLY-GAGARILGVALN----DV-----DLRREGY--GHNGSYG
A0A2V8MKQ7      VVHGGRSSRAVVRRTKQQLM-DVGANIFGVVLN----NV-----KVE-SHD--Y--YYQG
A0A3M1SNQ5      VVRSGHTKYSTMTRILEGLP---REKMLGVVLN----DS-----EDLLQNE--S--YYRS
A0A2V8QJ59      VVHGGRSSRAVVRRAKQQLL-DIGAHIFGVVLN----NV-----KIEKTHD--Y--YYGG
A0A1Q7HTA7      VVAAHRTPRHLLEEGLRVLE---HARVAGIVFN----GD-----DRPSSA------CYGY
A0A2W0B5E2      VVESGVTPKKFVSRARNILD-GANARLLGVALN----KV-----HMRHDGY--YGSYYSG
A0A2V8NMG8      VIHGGETSRSLVRRSKQQLQ-DIGAKIFGVVLN----NV-----DLHRHDY--Y--YYHR
A0A2V8TBM7      VVHGGRSSRAVVRRAKQQLQ-DVGAHIFGIVLN----NV-----KLEGTDY--Y--YYSG
A0A1Q7HEZ8      VVAANQTPRKLLAEALTLLD---PATVLGLVFN----RD-----VQP---------LFGY
A0A1Q7JW36      VVAANQTPRKLLAEALTLLD---PATVLGLVFN----RD-----VQP---------LFGY
A0A1Q7MUR4      VVAANQTPRKLLAEALTLLD---PATVLGLVFN----RD-----VQP---------LFGY
A0A3N5PFU4      VVAANKTPRRLLEEGLNALD---SAKVLGLVFN----SD-----VRP---------LYG-
A0A4R1LDF1      VVRADHSPIACAQDAVKML----GDKALGCVLN----DV-----KKM---------KYEE
A0A1F2T1R8      IVAANQTPRKLLAEALNLLD---PAKVLGIVFN----QD-----DRP---------LFGY
A0A2V9BW09      VLRVGVTPRESTQQVSAALD---GAFIAGVVVN----GD-----VNP-LQD--R--YYYS
A0A3M1SSE1      VVHSAKTSRQIVRRSCQLIQ-DVGAKIFGVLLN----NV-----NISSQDN--Y--YYYQ
A0A2V9GQV7      VVRAHHGQRERLQNTASTLD---RKKLLGVVFN----AT-----DVSAKDY--H--GYEY
A0A2V7YV88      VVEQGRTTFPTLRHAKQMLD-RVGGHTLGVVMN----KV-----RASGGSS--Y--SYAY
A0A2V8YCY6      VVRSGETPKVAFMRTRDLLA-SVKSRVLGVVLN----AV-----DSS-APD--Y--YYSY
A0A2V8EGM3      VVRAGKTPYKAIEHALEAIG---RDRLLGVVLN----GV-----QEH-DRA--E--AYES
A0A2V8FGH1      VVRAGKTPYKAIEHALEAIG---RDRLLGVVLN----GV-----QEH-DRA--E--AYES
A0A2V8D468      VVGAGKTGRRIAQWALDQLG-LAQATMFGAILN----GI-----NVD-RHP--Y--YYSG
A0A1F2R977      VIGAAKTPYPLVQRAVAALG---PDRLIGIVLN----RV-----EEQTITA--D--AYYR
A0A2U3LF12      VIRARQTRRELLQRAVESLG---ATNIVGVVLN----DV-----EYG-DTR--Y--AYAY
A0A3N5G7M6      VTAAETTPIPASRSAVDQLR-RAPAPLLGVVLN----RA-----DLK---------RRGY
A0A1F2S3Q7      VVSANRTPRKLLGEALNLLD---ASKVLGIVFN----RD-----AHP---------LFGY
A0A2V8GVG4      VVAANQTPRKLLGEALNMLD---PGKVLGIVFN----RD-----AKP---------MFGY
A0A143PNR5      VIHANRTPYALVQKAVQALG---KPKIFGVVLN----RL-----EDHITVH--S--GYGK
A0A2V8PJQ0      VIHSGRSSRAVVRRAKQQLLDV-GAHIFGIVLN----NV-----KLD-THG--Y--YYGG
A0A2V8H566      VISAGRTPYRLVHRAVEAVG---RDRIFGVVLN----KV-----AVQ-DLW--R--DYGS
A0A3N5YKY1      VVRAGQTPRPAIERALRQVA---PARVLGLVLN----DV-----GEI-SSG--Y--AYGR
A0A2V8UVN4      VVRPDHTDRKLCMQAIDIVP---KDRLLGVVLN----CV-----RDW-F-------LWKT
A0A321LXF5      VARSGKTSLETFTKTCARVD---PKKLAGVVLN----AC-----EEV---------GDKD
A0A5M8SBZ0      VVRSGFTRFGVVQHAREELK---DRPLVGVVLN----AA-----SKN-E-------STAA
A0A1Q7JFB1      VIGAGKTPHKLIMRAIDALG---RNRILGVVLN----RV-----DPS-CLA--G--GYG-
A0A2V8DMJ9      VVAAHKTPRTLVAEALNVLD---PAKIAGVVFN----AD-----DRS-RP------SEYG
A0A2V8GGF6      IVAAHRTPRKSLARALDMLD---PSKLIGIVFN----GD-----DAS-GS------HQNS
A0A2V8HKU7      IVAAHRTPRKSLARALDMLD---PSKLIGIVFN----GD-----DAS-GS------HQNS
A0A1Q6Y875      VVGAGRTSSDLARTACQELR---ESRLLGVVLN----GV-----EDD-A-------LGSP
A0A523DJA9      VVGAEMTRSAHALRAVEMLKAGGNGNVIGVVLN----RV-----DFA-RN------RYYY
A0A2V8I604      IVRAGATTKPAIERALSGLD---ASKVLGIVLN----EA-----GSD-G-------AGYA
A0A2V8J066      IVRAGMTQKPAIERALGGLD---TTKVLGLVLN----EV-----GAE-A-------TYQD
A0A1I6MMC5      VARGGVTKFETAQRALSQLK---ASNVLGIVLN----AV-----SDP-P-------VSGG
A0A2V9D5W7      VVKAYSTPAEIAQRARQELQ---DRNVLGVVFN----SV-----QES-IV------SYGS
A0A2V9D4I4      VVKAGSTPAEIAQRARQELG---GRNLLGVVLN----AV-----SEK-AL------AYGS
A0A2V9D6L7      VVKAGSTPAEIAQRARHELE---GRNVLGVVLN----SV-----SEK-GL------AYGS
A0A2V8ZJV2      VIQAGSTAAQIAERTAAEFQ---GKNLLGVVLN----QV-----EKR-D-------CWND
A0A2V9AWB5      VIRAGSTHAEIVERTASEFQ---DKNLLGAVLN----QV-----EKS-D-------SYGA
A0A2V8Z1Y8      VVQAGSTAVDDARKAAEEFR---NKNLLGVVLN----QV-----EKS-D-------AYIA
A0A1Q8AX10      VVRAKLTAYDLVQTTLQEFR---GKNLLGVVLN----GA-----DEE-A-------TYGA
A0A2V9A773      VVRAGETAHDLVKTTLQEFR---GNNLLGVVLN----GA-----NEG-A-------DYGG
A0A2V9AND3      VVRAGQTSHDLVKTTLQEFR---GINLLGVVLN----GA-----NLE-A-------NYSS
A0A2V9BTJ7      VVRAGATDHEMATKAAAGFQ---DKNLLGVVLN----RV-----DGD-A-------GYGG
A0A2V8W2M7      VVRAGETNHETAERAASEFR---NKNLLGVVLN----RV-----EQA-A-------GYGD
A0A2V8XNW2      VVRAGETNHETAERAASEFR---NKNLLGVVLN----RV-----EQA-A-------GYGD
A0A1Q7CJC1      VVRAGETNHETAERAASEFR---NKNLLGVVLN----RV-----EQA-A-------GYGD
A0A2V9UEM7      VVRSNSTPSDLARRAREEFQ---DKLLLGVVLN----GI-----PAD-QL------PKSR
A0A1Q7V300      VVRSNATPFDIAQRARQEFG---DN-LVGVVLN----GI-----DTL-P-------EYSQ
A0A2V9ZCI3      VVRSEVTPFDMARKARMEFR---DKQLLGVVLN----GI-----DSS-SS------AYSR
A0A2V9WCB3      VVRSNATPSDAARRARQEFP---ENALVGFVLN----GT-----SEE-NA------PYAR
A0A2V9VQW5      VVRSNATPYDTAQKARQEFQ---GKLLVGVVLN----GI-----MRS-DS------YYSR
A0A2V9WTP3      VVRSNATPVDMARKARQEFP---DKVLVGVVLN----GT-----SAD-TE------AYSR
A0A2V9NLA9      VVRSNSTPFDMARKARQEFS---GKQLVGVVLN----GI-----DQG-N-------SYSQ
A0A2V9RKJ9      VVRSNSTPFDMARKARQEFS---GKQLVGVVLN----GI-----DQG-N-------SYSQ
A0A2V9RN95      VVRSNATPFDIARKARQEFR---DTSLVGVVLN----GI-----DVG-S-------SYTQ
A0A2V9N406      VVRSNATPFDIARKARQEFR---DTSLVGVVLN----GI-----DVG-S-------SYTQ
A0A2V9U6D9      VVRSNATPFDIARKARQEFR---DTSLVGVVLN----GI-----DVG-S-------SYTQ
A0A2V8DZN4      VVRSGQTTRDAARWAQARF-AEDGTAVLGTILN----FW-----NPK-TPG--Y--AYYK
A0A2G6HQA4      VVRQGIVGKAKIEETINAI-GPE--RILGIVFN----DH-----HG------------AY
A0A2V7ZTY7      VIGAGKTPYKLITRAVDTL-GRA--KIIGVVLN----RV-----DRR-HVA--G--GYT-
A0A2V7ZVL9      VIGAGKTPYKLITRAVDTL-GRG--KIIGVVLN----RV-----DRR-NVA--G--GYT-
A0A1Q7QYI4      VIGAGKTPHKLIMRAIDAL-GRN--RILGVVLN----RV-----DPS-CLA--G--GYG-
A0A2V8G9Y9      VVRAGRSPFRLIQRALDAV-GRN--RIIGVVLN----AV-----KES-DDV--V--GFGY
A0A143PXU3      VVRAAATRFAELQAATDAL-GPG--RLLGVILN----AV-----DPR-EI--------HR
A0A2V8D8G9      VIGAGSTPAAAVERAVAELGGPD--SIIGTVLN----RV-----EEG-RI--------PD
A0A2V8ESQ4      VIGAGSTPAAAVERAVAELGGPD--SIIGTVLN----RV-----EEG-RI--------PD
A0A1E3Y5Q0      VVRADATQYDFVQRSIAEL-GRE--RILGVVLN----LA-----TPP-TDV--R--YGAN
A0A2W4TWK5      VVKAGTTPYDVVQKAVELL-GRD--RILGVVLN----QA-----EPD-S---------L-
A0A3N5NYV3      VVQAGRTPARLVQRTADAL-GRE--RVMGVVLN----RA-----DDL-V---------VS
A0A2V2RJF9      VVHGGVTPRDVVQMAKQKLV-KSDATMAGVVLN----YI-----DLTDPYY--YYSYYSR
A0A2G6HNT3      VVRQGVVGKAKVEETINAIG-P--ERILGIVFN----DHHGAYFSKSSKYG--YGYGYGS
A0A2V7YWD4      VVAADKTPRKLLEETFALLG-P--AKILGLVFN-----------RESYKGS-RYGRYYYA
A0A2V2R8T6      VVSAGKTRYSVVDKLLDQLP-R--DRVLGVVLN----RT-----DEALEPSTYYQYRYYN
A0A1Q7RGF1      VVRAQHAKREVLQKCAGQID-P--KKLLGVVYN----AV-----ESGAHDHYSYGGYTAA
A0A2V9BLX2      VVRAQHAKREVLQKCAGQID-P--KKLLGVVYN----AV-----ESGAHDHYSYGGYTAA
A0A2V9ZA03      VVEQGKTPKKLLRKSLESIE-N--LKLIGVVMN----GS-----QDADHQY--YRQYYKS
A0A3N5ZNH4      VVRGGATPKDVVRKAGGHLV-GVHARILGAVIN----NV-----NMDAPEYVHYYRHYYD
A0A2V8GEZ2      VVSAGAVPYRVVQRSADALG-R--DRIIGVVLN----RAAAAPFERAYG-YGGYGGYYGA
A0A3N5ZFD3      VVEAGKTDYASVQRAVAAIG-R--DKIIGIVLN----RA-----ERPAGTYGNYERYYAG
G8NXD3          VVRERVTRRAAVQRAAEMLG-E---HLSSLIFN----DV-----TMSIAAG--YGANYDR
A0A2V9VR38      VIRSGQTTKQALRRSRDVLT-QVSANVVGVLLN----AV-----DLSSPDY--Y--YYYE
A0A2V9EY04      VVRARHGQRETLQKSASSVD-R--KKLLGLVFN----GT-----DANEKHY--YGYKYAE
A0A2V9HAK9      VVRAHHGQRETLQKTASTLD-T--KKLLGVVFN----AT-----DVSVKDY--DVHEYGY
A0A1Q7FS15      VVRAHHGQRETLQKTARALD-P--KKLLGLVFN----AT-----DVSRKDY--YGYGYGS
A0A1Q7K9P1      VVRAHHGQRETLQKTARALD-P--KKLLGLVFN----AT-----DVSRKDY--YGYGYGS
A0A1Q7N989      VVRAHHGQRETLQKTARALD-P--KKLLGLVFN----AT-----DVSRKDY--YGYGYGS
A0A2V9G7Y0      VVRAHHGQRETLRKTASTVD-K--KKLVGVVFN----AT-----DVSVKDY--DGYE---
A0A2V8T7Z1      VVAAHRTPRRLVEEALNVME-P--DRLVGLVFN----GD-----DRPLSGY--Y-RSYRA
A0A2V7U8G5      VVAAHRTPRKLLGEALSALD-E--SKMLGIVFN----GD-----DRPMGGY--YGKYYGG
A0A2V7UNP9      VVAAHRTPRKLLGEALSAMD-E--AKVLGIVFN----GD-----DRPLSGY--YGGDYRS
A0A2V7VLD7      VVAAHRTPRKLLGEALSAMD-E--AKVLGIVFN----GD-----DRPLSGY--YGGDYRS
A0A2V7XGA3      VVAAHRTPRKLLVDGLGALE-E--GKVLGVVFN----AD-----DRPLSGY--FGR-YEG
A0A2V7YAG6      VVAAHRTPRKLLAESLGAIH-Q--DKVLGIVFN----AD-----DRPLSGY--FTR-YQG
A0A2V7VK33      VGA--------VAAALDALE-E--EKTIGIVFN----NE-----NRPPSSY--YKRYY--
A0A3M1VTE1      VARAGRTPKALIEQVVEEAG-S--VKLLGVVLNDWTGSL-----ADRRTGY--DSRYYSR
A0A2V7TTM7      VVAARRTPRKLLAETLGSVD-A--GKLAGIVFN----GD-----DRPLGGY--YKGYYMG
A0A2V8VI82      VVAAHRTPQRLVEEALHLLS-H--AKVAGIVFN----GD-----DRPSSAY--Y-GYYYG
A0A2V7U4P9      VVAADKTAREMMDTALDLLD-K--PKTLGVIFN----GE-----TPQADRS--S-YYYSA
A0A2V7TQY5      VVRAHRTPQRLLEDALNMVS-P--EKLIGLVFN----GD-----QRPTSRH--Y-GYYSS
A0A2V7TU87      VVRANTTPRSLLEESLNLME-P--QKVLGLVFN----ND-----ERPRTTY--N-DYYAG
A0A2V8SEH0      VVAAHKTPRRLLQEALNVTE-P--GKLMGLVFN----RD-----ERLLTRA--Y-GYY-G
A0A2V8VU54      VVAAHRTPRKLVEEGLNLME-P--SKVIGIVFN----GD-----ARAFSGY--Y-GYYHA
A0A1Q7RML7      VVAAHRTPRKLVEEGLNLVD-P--AKAIGVVFN----GE-----RRSRSGY--Y-GYYHA
A0A1Q7ZIQ5      VVAAHRTPRKLVEEGLNLVD-P--AKAIGVVFN----GE-----RRSRSGY--Y-GYYHA
A0A2V8TKD8      VVAAHRTPRKLVEEGLNLVD-P--AKTIGVVFN----GE-----RRSRSGY--Y-GYYHA
                                                *                           

A0A1F2U8T6      Y----------------YGRQYENHYAEAV------------------------------
A0A2V8BV42      Y----------------YGHQYKNYYAEATG-----------------------------
A0A2V8F916      Y----------------YGHQYKNYYAEATG-----------------------------
A0A1Q7K833      Y----------------YGHQYKNYYAEATV-----------------------------
A0A1Q8AMY4      Y----------------YGHQYKNYYAEATV-----------------------------
A0A2V8BM40      Y----------------YGHQYKNYYAEAVS-----------------------------
A0A2V8CRT6      Y----------------YGHQYKNYYAEATS-----------------------------
A0A1F2VH76      Y----------------YGHQYKSYYAEAPAA----------------------------
A0A1F2R0X5      Y----------------YGHQYKNYYAEKAS-----------------------------
A0A2V8B278      Y----------------YGHQYKNYYAEAAI-----------------------------
A0A2V8CEF9      Y----------------YGHQYKNYYAEAAV-----------------------------
A0A2V8KZG2      Y----------------SSKEEVSEN----------------------------------
A0A1Q7LG57      D----------------YEEYVGQ------------------------------------
A0A2V8YMQ4      S----------------NGNSHSETISDPAEPWNRLSK----------------------
A0A1Q7L5B1      G----------------NGMDKK-------------------------------------
A0A2V9DKV4      G----------------NGMDKK-------------------------------------
A0A2V8W380      S----------------YGSNRGDPPQETFVPTNLHLPPQQKASD---------------
A0A2V8ZIV5      M----------------YGMNGNSHGKTSSDEADSWRTLSK-------------------
A0A2V9EVA0      R----------------SEHVRS-------------------------------------
A0A1Q7RB73      T----------------PETKK--------------------------------------
A0A2V9K0H7      T----------------PETKK--------------------------------------
A0A3N5YN96      R----------------VDNQNAGRRVARSGA----------------------------
A0A1Q7Y646      R----------------YYRRDDAVEDKTEKEVDEKA-----------------------
A0A2V8QZU0      R----------------YGSRRDAGK-------EQEG-----------------------
A0A2V8RSQ9      R----------------YYRRDETQPGAPTKDVEEDV-----------------------
A0A2V9LS17      Y----------------RGAAENANGKGRRAKT---------------------------
A0A2V9AGR3      K----------------TYGRTRK------------------------------------
A0A2V9G0N7      Y----------------TGR----------------------------------------
A0A2V9GQ44      Y----------------TGR----------------------------------------
A0A2V9HRN3      Y----------------T------------------------------------------
A0A2V8WG13      Y----------------ATDDQKDSY----------------------------------
A0A2V8X987      H----------------LSENAEKAT----------------------------------
A0A1Q7KX94      Y----------------YAERD--------------------------------------
A0A2V8XHT0      Y----------------YAERD--------------------------------------
A0A2V9L2P7      Y----------------GYYSKGYYDYAEGKGNGQG------------------------
A0A2V7UMX0      Y----------------GTAARQSSDLTPGEAADGASRAPDSPPSSHPSTIQE-------
A0A136K497      Y----------------NYRRMAEDAAS--------------------------------
A0A399W9E4      Y----------------NYRRMAEDAAS--------------------------------
A0A2V7X0V9      A----------------YEKRQPTTV----------------------------------
A0A2V9X518      V----------------NGNNKEMQETVQG------------------------------
A0A2V9VC62      A----------------YEKTAKPKA----------------------------------
A0A2V9S1P8      T----------------YG-RTNGRHESQG------------------------------
A0A2V9RTW2      A----------------YG-RPDAKGATQR------------------------------
A0A2V9TGF1      A----------------YG-RPDAKGATQR------------------------------
A0A2V9XEV6      V----------------NGNNKEMQETVQG------------------------------
A0A2V9Y3Q6      S----------------YG-NKETQETIQG------------------------------
A0A2V9R269      A----------------YSPNVRTEDKN--------------------------------
A0A2V9PTS3      V----------------YSEDGKAKG----------------------------------
A0A2V9NPF4      V----------------YSEDGKAKG----------------------------------
A0A2V9PNZ0      V----------------YSEDGKAKG----------------------------------
A0A321LMC5      K----------------NKRRGWFGKKH--------------------------------
A0A2V8X713      G----------------YGVDTK-------------------------------------
A0A2V8ZLE9      G----------------FGLAKR-------------------------------------
A0A2V8Y4D3      G----------------FGTDKK-------------------------------------
A0A2V8Z2X8      G----------------FELDRK-------------------------------------
A0A2V9C3F6      G----------------FGMDKK-------------------------------------
A0A2V9QMU9      Q----------------GKHGQRYFGQDEPAIAEEAKATSSGA-----------------
A0A2V9QY75      Q----------------GKHGQRYY-----------------------------------
A0A2V9SVU9      Q----------------GKYGHRYY-----------------------------------
A0A2V8W5N5      G----------------YGEPMETPVSGLRRRVSPLHSWGPR------------------
A0A2V8XG53      G----------------YGEPMETPVSGLRRRVSPLHSWGPR------------------
A0A2V9XV04      S----------------YEKKPALPSVLPASRSCAAGGRGPDCLVVVCRGDHPSEPGELV
A0A2V9CBY1      ------------------------------------------------------------
A0A2V9D656      G----------------GNGTGGE------------------------------------
A0A352EZH8      R----------------HYRQPRVP-------AGEDR-----------------------
A0A0B6X033      Y----------------YRRA---------------------------------------
A0A2V8R0I3      R----------------YQRQSPLVEAG----TEEV------------------------
A0A2V8N1U8      R----------------HQRAATEF-------VEDTV-----------------------
A0A2V8QL35      R----------------YQRAASAAD------VGDA------------------------
A0A352FU10      R----------------HQRVASAAT------TDVA------------------------
A0A2V8LCU0      R----------------HVRSVAVPDAPSKVKASEE------------------------
A0A1Q7NGT0      R----------------HQRMMAAP-------VEGT------------------------
A0A2V8MLP9      R----------------HQRVMAVP-------LEET------------------------
A0A2V8PQZ0      R----------------HQRVMAVP-------LEET------------------------
A0A3B9MKY6      H----------------YYNR-DRG-------LTEAK-----------------------
A0A3D5SKZ1      H----------------YYNR-DRG-------LTEAK-----------------------
A0A2V8NRW2      R----------------YYRREDKG-------ITKSA-----------------------
A0A2V8TKR9      Y---------YYHYNRYYGGYPSDTNV---------------------------------
A0A2V8LBV1      H---------YYDG-----YYTYYAKK---------------------------------
A0A2V8GAF9      H---------ARDRHAGWWRRVWNARHSQGPQHLR-------------------------
A0A2V8CN98      E---------YYGY-----MAGYGTTTEDGGTRIARRRLQGAL-----------------
A0A1Q7LC46      R---------YYPY-----SYGYGPQEAGEPAQGDDASESVTEALSRHHDDDSQAL----
A0A1Q8BDC5      Q---------YYYG-----PPADAKKVKGPKSKNYLQS----------------------
A0A2V9Q1Y8      E---------YQGKYGQRYYDEDMTGGDSVRAASGSA-----------------------
A0A2V8JXG1      Y---------YYSY-----QYSYSADGKRTKT----------------------------
A0A350D2W9      H---------YYKESRG-------------------------------------------
A0A2V9I4J1      G---------YYRYGKQGAYPYYGTRKPRSRSKTYLEN----------------------
A0A2V8PQZ9      Q---------PRHQRMMAAPVEGTEYDQGAANPEMIYLEEDMVS----------------
A0A2V8D8B1      Y---------YRRQ-----YGEYYTSTSASA-----------------------------
A0A3B9LSB4      R---------YYGA------RNYKSDGDDDIEPTSHARRNGSHNTLDLN-----------
A0A2V9H7U2      G---------HYYY-----SSGSGKTKRTPASESVSSHLQG-------------------
A0A2V8NJB5      G---------YYDYGRDSQYMYSRGRKRLEKPKNYLES----------------------
A0A2V9JMZ4      G---------YYRYGKQGAYPYYGTRKPRSRSKNYLES----------------------
A0A2V9MDJ6      G---------YYRYGKQGAYPYYGTRKPRSRSKNYLES----------------------
A0A2V8QJT6      Q---------RYYH-----QSYYTQDPSEEVVATRS------------------------
A0A2V8FSM8      H---------YYAG-----YYHYYGDGSGKGGGNSVGPQDGEEPVAAERAAGASRWVADV
A0A359M0J2      D---------YYSK-----YYEYQTMAESGKSGTS-------------------------
A0A2V8JLJ1      Y---------YRQP-----LNESSQRNSNLQLREGI------------------------
A0A5M8SND8      E---------A-------------------------------------------------
A0A2V9GAQ1      R---------YYPY-----SYGYGPQEAAEAPHEEDSEAIAHRVSRDRDDDSQAL-----
A0A497EDQ8      Y---------YSYY-----HYGYDEDGKRDKG----------------------------
G8NS05          Y---------GYSG-----YSGYGSAGMDAAGWESQSGKSTGKGQK--------------
A0A2V8KZ20      Y---------YRQP-----LNESSQRNSNLQLREGI------------------------
A0A3D0NWU2      S---------GYYD-----YYKSADADTTTPRMDSDANGNGSNGRA--------------
A0A2V8EPD9      Y---------EYYG-----AGYYGAPSTK-------------------------------
A0A3N5NSX5      Y---------YGYK-----YKNYYVKSNAA------------------------------
A0A2V8MUA1      Y---------YRQV-----SLSSK------------------------------------
A0A2V8MBH9      Q---------RYYH-----QSYYSHDVESDGADERASA----------------------
A0A3N5ZPQ7      H---------SYYH---------------------PGKDRQSSRTRRRKRNAP-------
A0A3N5P5F2      Y---------YRRE-----YTDYYSRALRS------------------------------
A0A2V9G1P7      G---------PYGL-----NPDCPSHETVVTANFQMPPQQKASD----------------
A0A2V9BCK9      G---------AYSY-----YAGYGMDRK--------------------------------
A0A2V9TMX2      G---------TQYS-----NNYYSEES--------------PNNKPKAASKIS-------
A0A2V8N2J7      E---------YYKK-----LA---------------------------------------
A0A3N6BI26      R---------HYFD---------------------------ERYNTDLSSAAG-------
A0A2V9JMM3      E---------YYRR-----TY-----------------------YKQNIRTGT-------
A0A2V9M815      E---------YYRR-----TY-----------------------YKQNIRTGT-------
A0A2V9A795      G---------IYGS------NGNSHSEIISDTADSWGTLSK-------------------
A0A355ESH9      R---------YAEA------YGYGAEE-----------------TGSKAGSAA-------
A0A3D0NW85      Q---------SYYS-----QSQYRRDEE--------------------------------
A0A353CAT5      Q---------SYYH-----RDNYRSGD-----------------------DPK-------
A0A2V9HB55      R---------YYPY-----SYGYGPQEVVEAPHEEDSEAVTERVSRDDDSEAL-------
A0A2V8CU57      G---------FYDY------YGYGTRD------DGARKAGKADAAREAAMDAA-------
A0A2V8BDI4      G---------FYDY------YGYGTRD------DGARKAGKADAAREAAMDAA-------
A0A2V8F8T3      G---------FYDY------YGYGTRD------DGARKAGKADAAREAAMDAA-------
A0A2V9J901      Y----------S-----YTGYGAPGSEASSRHGNT-------------------------
A0A2V8MKQ7      Y----------------YSGYYQAADYQEDTAPNPADSRAASS-----------------
A0A3M1SNQ5      Y---------QK-----YAEVVDS------------------------------------
A0A2V8QJ59      Y----------------YGYYKSNYYTAEEDPEADQGSTAST------------------
A0A1Q7HTA7      Y----------------YGYGRGRGGGAARGEHPAWRKAAAPWR----------------
A0A2W0B5E2      Y----------------H------------------------A-----------------
A0A2V8NMG8      Y----------------YSSSYYKAEADDTEQVASSAH----G-----------------
A0A2V8TBM7      Y----------------Y-SGYYSDDDTAPEGAATAGERPGAG-----------------
A0A1Q7HEZ8      Y--------NSS-----YRGYFGEARTA--------------------------------
A0A1Q7JW36      Y--------NSS-----YRGYFGEARTA--------------------------------
A0A1Q7MUR4      Y--------NSS-----YRGYFGEARTA--------------------------------
A0A3N5PFU4      Y--------DNN-----YRRYFSRAH----------------------------------
A0A4R1LDF1      Y----------------YRAYYK-------------------------------------
A0A1F2T1R8      Y-----NSYSRY-----YREYFTDPTQIASGA----------------------------
A0A2V9BW09      Y----------------YPRHKNA------------------------------------
A0A3M1SSE1      S---------YY-----YNSYYKKEEEEE-------------------------------
A0A2V9GQV7      G----------------YGYGKD-------------------------------------
A0A2V7YV88      G----------------YGNYGSKSNQGTTTVRSADPSAFQPRITHRERLARIALRLFWR
A0A2V8YCY6      R---------YYPYSYGYGPQEAGEAAQGEASESVGGAISRHHDDDSQAL----------
A0A2V8EGM3      G---------YY-----YSSQASDNVTS--------------------------------
A0A2V8FGH1      G---------YY-----YSSQASDNVTS--------------------------------
A0A2V8D468      Y----------Y-----RKEYTNQYTRTL-------------------------------
A0A1F2R977      H----------Y-----YPSSGAKDG----------------------------------
A0A2U3LF12      R----------Y-----YQRHYVGRR----------------------------------
A0A3N5G7M6      YTRYYRRAYQAY-----YGHPTPA------------------------------------
A0A1F2S3Q7      Y--------DAY-----CRQYFPGVSRIAGQA----------------------------
A0A2V8GVG4      Y--------DAY-----YKDYFP--EQAVTRA----------------------------
A0A143PNR5      Y--------GGY-----YNDYGRGGQ----------------------------------
A0A2V8PJQ0      YYGRYYYKYGYY-----YSDYSDDDGKKAQTASG--------------------------
A0A2V8H566      Y----------S-----YSYYGYGSPRTKD------------------------------
A0A3N5YKY1      V---------DN-----QNAGRRVARSGA-------------------------------
A0A2V8UVN4      Q---------DY-----YSYTEN-------------------------------------
A0A321LXF5      Y---------KY-----YRYAVGGPSSS--------------------------------
A0A5M8SBZ0      Y---------HY-----YGHDAASPDGMDKENQD--------------------------
A0A1Q7JFB1      Y---------GY-----YSYGERG------------------------------------
A0A2V8DMJ9      Y---------GY-----YGYP-----ERVTWWQRLFGTVRSARVR---------------
A0A2V8GGF6      Y---------YA-----YYTPQGRDRQRRRWWRRG-------------------------
A0A2V8HKU7      Y---------YA-----YYTPQGRDRQRRRWWRRG-------------------------
A0A1Q6Y875      Y---------AY-----YGRSEHVRG----------------------------------
A0A523DJA9      S---------RY-----YGYTYKNYYGNTSTAA---------------------------
A0A2V8I604      Y---------DG-----YGYIGG-------------------------------------
A0A2V8J066      Y---------AG-----YKYVAG-------------------------------------
A0A1I6MMC5      Y---------YG-----YDAPGKQTT----------------------------------
A0A2V9D5W7      Y---------YN-----YPQNGHDEVKKTQAHRNKFRQ----------------------
A0A2V9D4I4      Y---------YN-----HGYGNGRVKEPMKEKSD--------------------------
A0A2V9D6L7      Y---------YN-----Y---RDHAHDPLKESTNRILD----------------------
A0A2V8ZJV2      -----------Y-----YGGRIVQLETTDRALPAGERLS---------------------
A0A2V9AWB5      -----------E-----Y-----QNYHSDRD-----------------------------
A0A2V8Z1Y8      P---------DY-----H------------------------------------------
A0A1Q8AX10      Y---------SY-----YAGYGMDRK----------------------------------
A0A2V9A773      H---------SY-----YAGFGMDTE----------------------------------
A0A2V9AND3      Y---------SG-----YAGVGMDKK----------------------------------
A0A2V9BTJ7      Y----------Y-----YSYPSGEE--VKKSS----------------------------
A0A2V8W2M7      Y----------Y-----YGSLGEEEQPVLRAS----------------------------
A0A2V8XNW2      Y----------Y-----YGSLGEEEQPVLHAS----------------------------
A0A1Q7CJC1      Y----------Y-----YGSLGEEEQPVLHAS----------------------------
A0A2V9UEM7      Y----------Y-----YGEAVSSPA----------------------------------
A0A1Q7V300      Y----------Y-----YTAYGNPNGKDPA------------------------------
A0A2V9ZCI3      Y----------Y-----YG-YGDQ------------------------------------
A0A2V9WCB3      Y----------Y-----YEAYENKGTATKA------------------------------
A0A2V9VQW5      Y----------Y-----YESYEKTARQKA-------------------------------
A0A2V9WTP3      Y----------Y-----YGAYEKRGTEAKA------------------------------
A0A2V9NLA9      Y----------Y-----YDAYGKPNGKNEQR-----------------------------
A0A2V9RKJ9      Y----------Y-----YDAYGKPNGKNEQR-----------------------------
A0A2V9RN95      Y----------Y-----YSSYGHPNSKGDGRR----------------------------
A0A2V9N406      Y----------Y-----YSSYGHPNSQGDGRR----------------------------
A0A2V9U6D9      Y----------Y-----YSSYGHPNSQGDGRR----------------------------
A0A2V8DZN4      H---------YY-----AGYYHYYGDGSGKGGGNSVGPQDGEEPVAVERAAGASRWVADV
A0A2G6HQA4      F---------SK-----SSKYGYGYGYNYRYE----------------------------
A0A2V7ZTY7      Y---------GY-----YGER---------------------------------------
A0A2V7ZVL9      Y---------GY-----YGER---------------------------------------
A0A1Q7QYI4      Y---------GY-----YSY--------GERG----------------------------
A0A2V8G9Y9      Y---------GY-----YGHYGPQRKRGARRA----------------------------
A0A143PXU3      E---------DY-----YGNY-YGYGSK--------------------------------
A0A2V8D8G9      A---------DY-----YGQYGSSRDGR--------------------------------
A0A2V8ESQ4      A---------DY-----YGQYGSSRDGR--------------------------------
A0A1E3Y5Q0      Y---------GR-----YAERTSPPGRR--------------------------------
A0A2W4TWK5      A---------DR-----YQSYYYSPARS--------------------------------
A0A3N5NYV3      S---------DS-----SSSYAYGPNNN--------------------------------
A0A2V2RJF9      YYAYRYGEQPKALPPKFIQ-----------------------------------------
A0A2G6HNT3      KYE---------------------------------------------------------
A0A2V7YWD4      YSSRS-------------------------------------------------------
A0A2V2R8T6      QRSLPPGDPNELVNQQQEVVTVN-------------------------------------
A0A1Q7RGF1      RKEST-------------------------------------------------------
A0A2V9BLX2      RKEST-------------------------------------------------------
A0A2V9ZA03      PANSRASAGHERRLS---------------------------------------------
A0A3N5ZNH4      ETYSNDFSAA--------------------------------------------------
A0A2V8GEZ2      HSHEDQEQA---------------------------------------------------
A0A3N5ZFD3      YAKRTEG-----------------------------------------------------
G8NXD3          GYR---------------------------------------------------------
A0A2V9VR38      YQGKYARYYREDDSSEHDHDEEHAVEESSPSSSSA-------------------------
A0A2V9EY04      AKA---------------------------------------------------------
A0A2V9HAK9      ------------------------------------------------------------
A0A1Q7FS15      SKS---------------------------------------------------------
A0A1Q7K9P1      SKS---------------------------------------------------------
A0A1Q7N989      SKS---------------------------------------------------------
A0A2V9G7Y0      ------------------------------------------------------------
A0A2V8T7Z1      YG-----------YPPRLARAAARRPRLR-------------------------------
A0A2V7U8G5      YYHDRSRRETGG------GRSSRQRDQKPRRSSWR-------------------------
A0A2V7UNP9      YYHHPSAPRRGGWWRSWRGQAKTKRGQKARPQPWR-------------------------
A0A2V7VLD7      YYH---------WWRSWRGQAKTKRGQKARPQPWR-------------------------
A0A2V7XGA3      YYGYHQPH----------------------------------------------------
A0A2V7YAG6      YYGYGQPANGGRSW----WRFPWRRAAQGRFRPWR-------------------------
A0A2V7VK33      -------------GAPPGPRATRNRVTAGRGWRFWR------------------------
A0A3M1VTE1      YY-----------GKGGR------------------------------------------
A0A2V7TTM7      YDGDRA-------GAGSKGRWSSWWRRRRSGRKPWR------------------------
A0A2V8VI82      YG-----------RPRGDGRYDRGERPGSRKVAALWR-----------------------
A0A2V7U4P9      AR-----------PEPSRWSWFKRK-----------------------------------
A0A2V7TQY5      YY-----------HEPTNGQGTLWTRIADTAKRPFRSRVSGTAV----------------
A0A2V7TU87      SGRHDKGGAPTWWRPFAKIRSVFDPDAAGRRRPERRREIR--------------------
A0A2V8SEH0      YG-----------QQHGRARAAERGRGGAPRSQPCP------------------------
A0A2V8VU54      YG-----------RPPGRGR---RPPQPATRETAPREAAPEPPLK---------------
A0A1Q7RML7      YG-----------RPPGRAR---RSGARSPAHDTLR------------------------
A0A1Q7ZIQ5      YG-----------RPPGRAR---RSGARSPAHDTLR------------------------
A0A2V8TKD8      YG-----------RPPGRAR---RPGARSPAHDTLR------------------------
                                                                            

A0A1F2U8T6      -----------------------------
A0A2V8BV42      -----------------------------
A0A2V8F916      -----------------------------
A0A1Q7K833      -----------------------------
A0A1Q8AMY4      -----------------------------
A0A2V8BM40      -----------------------------
A0A2V8CRT6      -----------------------------
A0A1F2VH76      -----------------------------
A0A1F2R0X5      -----------------------------
A0A2V8B278      -----------------------------
A0A2V8CEF9      -----------------------------
A0A2V8KZG2      -----------------------------
A0A1Q7LG57      -----------------------------
A0A2V8YMQ4      -----------------------------
A0A1Q7L5B1      -----------------------------
A0A2V9DKV4      -----------------------------
A0A2V8W380      -----------------------------
A0A2V8ZIV5      -----------------------------
A0A2V9EVA0      -----------------------------
A0A1Q7RB73      -----------------------------
A0A2V9K0H7      -----------------------------
A0A3N5YN96      -----------------------------
A0A1Q7Y646      -----------------------------
A0A2V8QZU0      -----------------------------
A0A2V8RSQ9      -----------------------------
A0A2V9LS17      -----------------------------
A0A2V9AGR3      -----------------------------
A0A2V9G0N7      -----------------------------
A0A2V9GQ44      -----------------------------
A0A2V9HRN3      -----------------------------
A0A2V8WG13      -----------------------------
A0A2V8X987      -----------------------------
A0A1Q7KX94      -----------------------------
A0A2V8XHT0      -----------------------------
A0A2V9L2P7      -----------------------------
A0A2V7UMX0      -----------------------------
A0A136K497      -----------------------------
A0A399W9E4      -----------------------------
A0A2V7X0V9      -----------------------------
A0A2V9X518      -----------------------------
A0A2V9VC62      -----------------------------
A0A2V9S1P8      -----------------------------
A0A2V9RTW2      -----------------------------
A0A2V9TGF1      -----------------------------
A0A2V9XEV6      -----------------------------
A0A2V9Y3Q6      -----------------------------
A0A2V9R269      -----------------------------
A0A2V9PTS3      -----------------------------
A0A2V9NPF4      -----------------------------
A0A2V9PNZ0      -----------------------------
A0A321LMC5      -----------------------------
A0A2V8X713      -----------------------------
A0A2V8ZLE9      -----------------------------
A0A2V8Y4D3      -----------------------------
A0A2V8Z2X8      -----------------------------
A0A2V9C3F6      -----------------------------
A0A2V9QMU9      -----------------------------
A0A2V9QY75      ---------DESQTDENSIAAAS---GGA
A0A2V9SVU9      ---------REEEMDNGGASLPSVRAGSA
A0A2V8W5N5      -----------------------------
A0A2V8XG53      -----------------------------
A0A2V9XV04      ASAERGGWVRQDSGRDSNRALDFALARPV
A0A2V9CBY1      -----------------------------
A0A2V9D656      -----------------------------
A0A352EZH8      --------LRLVSELEEDEEVAIAS----
A0A0B6X033      ---------------EEAKKKAVAEGVAV
A0A2V8R0I3      ---------ADDEATDQPEMIYIEEGFVS
A0A2V8N1U8      --------AREHEDTDQLEMIYLEEDMVS
A0A2V8QL35      ---------G-DAFEDRPGMIYIEEEGVS
A0A352FU10      ---------DREAVEDEPEMIYIEEEGVS
A0A2V8LCU0      ---------RYESTPGEPEMIYIEEEGVS
A0A1Q7NGT0      ---------EYDQGGANPEMIYLEEEMVS
A0A2V8MLP9      ---------EDDHG-ANPEMIYLEEDMVS
A0A2V8PQZ0      ---------EDDHGAANPEMIYLEEDMVS
A0A3B9MKY6      --------TKQLPGERQEEVALVN-----
A0A3D5SKZ1      --------MKQLPGERQEEVALVN-----
A0A2V8NRW2      --------T-QAEMKNAEEVIVAG-----
A0A2V8TKR9      -----------------------------
A0A2V8LBV1      -----------------------------
A0A2V8GAF9      -----------------------------
A0A2V8CN98      -----------------------------
A0A1Q7LC46      -----------------------------
A0A1Q8BDC5      -----------------------------
A0A2V9Q1Y8      -----------------------------
A0A2V8JXG1      -----------------------------
A0A350D2W9      -----------------------------
A0A2V9I4J1      -----------------------------
A0A2V8PQZ9      -----------------------------
A0A2V8D8B1      -----------------------------
A0A3B9LSB4      -----------------------------
A0A2V9H7U2      -----------------------------
A0A2V8NJB5      -----------------------------
A0A2V9JMZ4      -----------------------------
A0A2V9MDJ6      -----------------------------
A0A2V8QJT6      -----------------------------
A0A2V8FSM8      DVHPDEGSRRRPRYARSEA----------
A0A359M0J2      -----------------------------
A0A2V8JLJ1      -----------------------------
A0A5M8SND8      -----------------------------
A0A2V9GAQ1      -----------------------------
A0A497EDQ8      -----------------------------
G8NS05          -----------------------------
A0A2V8KZ20      -----------------------------
A0A3D0NWU2      -----------------------------
A0A2V8EPD9      -----------------------------
A0A3N5NSX5      -----------------------------
A0A2V8MUA1      -----------------------------
A0A2V8MBH9      -----------------------------
A0A3N5ZPQ7      -----------------------------
A0A3N5P5F2      -----------------------------
A0A2V9G1P7      -----------------------------
A0A2V9BCK9      -----------------------------
A0A2V9TMX2      -----------------------------
A0A2V8N2J7      -----------------------------
A0A3N6BI26      -----------------------------
A0A2V9JMM3      -----------------------------
A0A2V9M815      -----------------------------
A0A2V9A795      -----------------------------
A0A355ESH9      -----------------------------
A0A3D0NW85      -----------------------------
A0A353CAT5      -----------------------------
A0A2V9HB55      -----------------------------
A0A2V8CU57      -----------------------------
A0A2V8BDI4      -----------------------------
A0A2V8F8T3      -----------------------------
A0A2V9J901      -----------------------------
A0A2V8MKQ7      -----------------------------
A0A3M1SNQ5      -----------------------------
A0A2V8QJ59      -----------------------------
A0A1Q7HTA7      -----------------------------
A0A2W0B5E2      -----------------------------
A0A2V8NMG8      -----------------------------
A0A2V8TBM7      -----------------------------
A0A1Q7HEZ8      -----------------------------
A0A1Q7JW36      -----------------------------
A0A1Q7MUR4      -----------------------------
A0A3N5PFU4      -----------------------------
A0A4R1LDF1      -----------------------------
A0A1F2T1R8      -----------------------------
A0A2V9BW09      -----------------------------
A0A3M1SSE1      -----------------------------
A0A2V9GQV7      -----------------------------
A0A2V7YV88      LRSDLDRS---------------------
A0A2V8YCY6      -----------------------------
A0A2V8EGM3      -----------------------------
A0A2V8FGH1      -----------------------------
A0A2V8D468      -----------------------------
A0A1F2R977      -----------------------------
A0A2U3LF12      -----------------------------
A0A3N5G7M6      -----------------------------
A0A1F2S3Q7      -----------------------------
A0A2V8GVG4      -----------------------------
A0A143PNR5      -----------------------------
A0A2V8PJQ0      -----------------------------
A0A2V8H566      -----------------------------
A0A3N5YKY1      -----------------------------
A0A2V8UVN4      -----------------------------
A0A321LXF5      -----------------------------
A0A5M8SBZ0      -----------------------------
A0A1Q7JFB1      -----------------------------
A0A2V8DMJ9      -----------------------------
A0A2V8GGF6      -----------------------------
A0A2V8HKU7      -----------------------------
A0A1Q6Y875      -----------------------------
A0A523DJA9      -----------------------------
A0A2V8I604      -----------------------------
A0A2V8J066      -----------------------------
A0A1I6MMC5      -----------------------------
A0A2V9D5W7      -----------------------------
A0A2V9D4I4      -----------------------------
A0A2V9D6L7      -----------------------------
A0A2V8ZJV2      -----------------------------
A0A2V9AWB5      -----------------------------
A0A2V8Z1Y8      -----------------------------
A0A1Q8AX10      -----------------------------
A0A2V9A773      -----------------------------
A0A2V9AND3      -----------------------------
A0A2V9BTJ7      -----------------------------
A0A2V8W2M7      -----------------------------
A0A2V8XNW2      -----------------------------
A0A1Q7CJC1      -----------------------------
A0A2V9UEM7      -----------------------------
A0A1Q7V300      -----------------------------
A0A2V9ZCI3      -----------------------------
A0A2V9WCB3      -----------------------------
A0A2V9VQW5      -----------------------------
A0A2V9WTP3      -----------------------------
A0A2V9NLA9      -----------------------------
A0A2V9RKJ9      -----------------------------
A0A2V9RN95      -----------------------------
A0A2V9N406      -----------------------------
A0A2V9U6D9      -----------------------------
A0A2V8DZN4      DVHPDEGSRRRPRYARSEA----------
A0A2G6HQA4      -----------------------------
A0A2V7ZTY7      -----------------------------
A0A2V7ZVL9      -----------------------------
A0A1Q7QYI4      -----------------------------
A0A2V8G9Y9      -----------------------------
A0A143PXU3      -----------------------------
A0A2V8D8G9      -----------------------------
A0A2V8ESQ4      -----------------------------
A0A1E3Y5Q0      -----------------------------
A0A2W4TWK5      -----------------------------
A0A3N5NYV3      -----------------------------
A0A2V2RJF9      -----------------------------
A0A2G6HNT3      -----------------------------
A0A2V7YWD4      -----------------------------
A0A2V2R8T6      -----------------------------
A0A1Q7RGF1      -----------------------------
A0A2V9BLX2      -----------------------------
A0A2V9ZA03      -----------------------------
A0A3N5ZNH4      -----------------------------
A0A2V8GEZ2      -----------------------------
A0A3N5ZFD3      -----------------------------
G8NXD3          -----------------------------
A0A2V9VR38      -----------------------------
A0A2V9EY04      -----------------------------
A0A2V9HAK9      -----------------------------
A0A1Q7FS15      -----------------------------
A0A1Q7K9P1      -----------------------------
A0A1Q7N989      -----------------------------
A0A2V9G7Y0      -----------------------------
A0A2V8T7Z1      -----------------------------
A0A2V7U8G5      -----------------------------
A0A2V7UNP9      -----------------------------
A0A2V7VLD7      -----------------------------
A0A2V7XGA3      -----------------------------
A0A2V7YAG6      -----------------------------
A0A2V7VK33      -----------------------------
A0A3M1VTE1      -----------------------------
A0A2V7TTM7      -----------------------------
A0A2V8VI82      -----------------------------
A0A2V7U4P9      -----------------------------
A0A2V7TQY5      -----------------------------
A0A2V7TU87      -----------------------------
A0A2V8SEH0      -----------------------------
A0A2V8VU54      -----------------------------
A0A1Q7RML7      -----------------------------
A0A1Q7ZIQ5      -----------------------------
A0A2V8TKD8      -----------------------------
                                             

© 1998-2020Legal notice