BYKdb

Dataset for cluster orphancd of phylum acidobacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

242 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1F2U8T6      ------------------------------------------------------------
A0A2V8BV42      ------------------------------------------------------------
A0A2V8F916      ------------------------------------------------------------
A0A1Q7K833      ------------------------------------------------------------
A0A1Q8AMY4      ------------------------------------------------------------
A0A2V8BM40      ------------------------------------------------------------
A0A2V8CRT6      ------------------------------------------------------------
A0A1F2VH76      ------------------------------------------------------------
A0A1F2R0X5      ------------------------------------------------------------
A0A2V8B278      ------------------------------------------------------------
A0A2V8CEF9      ------------------------------------------------------------
A0A2V8KZG2      ------------------------------------------------------------
A0A1Q7LG57      ------------------------------------------------------------
A0A2V8YMQ4      ------------------------------------------------------------
A0A1Q7L5B1      ------------------------------------------------------------
A0A2V9DKV4      ------------------------------------------------------------
A0A2V8W380      ------------------------------------------------------------
A0A2V8ZIV5      ------------------------------------------------------------
A0A2V9EVA0      ------------------------------------------------------------
A0A1Q7RB73      ------------------------------------------------------------
A0A2V9K0H7      ------------------------------------------------------------
A0A3N5YN96      ------------------------------------------------------------
A0A1Q7Y646      ------------------------------------------------------------
A0A2V8QZU0      ------------------------------------------------------------
A0A2V8RSQ9      ------------------------------------------------------------
A0A2V9LS17      ------------------------------------------------------------
A0A2V9AGR3      ------------------------------------------------------------
A0A2V9G0N7      ------------------------------------------------------------
A0A2V9GQ44      ------------------------------------------------------------
A0A2V9HRN3      ------------------------------------------------------------
A0A2V8WG13      ------------------------------------------------------------
A0A2V8X987      ------------------------------------------------------------
A0A1Q7KX94      ------------------------------------------------------------
A0A2V8XHT0      ------------------------------------------------------------
A0A2V9L2P7      ------------------------------------------------------------
A0A2V7UMX0      ------------------------------------------------------------
A0A136K497      ------------------------------------------------------------
A0A399W9E4      ------------------------------------------------------------
A0A2V7X0V9      ------------------------------------------------------------
A0A2V9X518      ------------------------------------------------------------
A0A2V9VC62      ------------------------------------------------------------
A0A2V9S1P8      ------------------------------------------------------------
A0A2V9RTW2      ------------------------------------------------------------
A0A2V9TGF1      ------------------------------------------------------------
A0A2V9XEV6      ------------------------------------------------------------
A0A2V9Y3Q6      ------------------------------------------------------------
A0A2V9R269      ------------------------------------------------------------
A0A2V9PTS3      ------------------------------------------------------------
A0A2V9NPF4      ------------------------------------------------------------
A0A2V9PNZ0      ------------------------------------------------------------
A0A321LMC5      ------------------------------------------------------------
A0A2V8X713      ------------------------------------------------------------
A0A2V8ZLE9      ------------------------------------------------------------
A0A2V8Y4D3      ------------------------------------------------------------
A0A2V8Z2X8      ------------------------------------------------------------
A0A2V9C3F6      ------------------------------------------------------------
A0A2V9QMU9      ------------------------------------------------------------
A0A2V9QY75      ------------------------------------------------------------
A0A2V9SVU9      ------------------------------------------------------------
A0A2V8W5N5      ------------------------------------------------------------
A0A2V8XG53      ------------------------------------------------------------
A0A6A7LB89      ------------------------------------------------------------
A0A2V9XV04      ------------------------------------------------------------
A0A2V9CBY1      ------------------------------------------------------------
A0A2V9D656      ------------------------------------------------------------
A0A352EZH8      ------------------------------------------------------------
A0A0B6X033      ------------------------------------------------------------
A0A2V8R0I3      ------------------------------------------------------------
A0A2V8N1U8      ------------------------------------------------------------
A0A2V8QL35      ------------------------------------------------------------
A0A352FU10      ------------------------------------------------------------
A0A2V8LCU0      ------------------------------------------------------------
A0A1Q7NGT0      ------------------------------------------------------------
A0A2V8MLP9      ------------------------------------------------------------
A0A2V8PQZ0      ------------------------------------------------------------
A0A3B9MKY6      ------------------------------------------------------------
A0A3D5SKZ1      ------------------------------------------------------------
A0A2V8NRW2      ------------------------------------------------------------
A0A2V8TKR9      ------------------------------------------------------------
A0A2V8LBV1      ------------------------------------------------------------
A0A2V8GAF9      ------------------------------------------------------------
A0A2V8CN98      ------------------------------------------------------------
A0A1Q7LC46      ------------------------------------------------------------
A0A1Q8BDC5      ------------------------------------------------------------
A0A2V9Q1Y8      ------------------------------------------------------------
A0A2V8JXG1      ------------------------------------------------------------
A0A350D2W9      ------------------------------------------------------------
A0A2V9I4J1      ------------------------------------------------------------
A0A2V8PQZ9      ------------------------------------------------------------
A0A2V8D8B1      ------------------------------------------------------------
A0A3B9LSB4      ------------------------------------------------------------
A0A2V9H7U2      ------------------------------------------------------------
A0A2V8NJB5      ------------------------------------------------------------
A0A2V9JMZ4      ------------------------------------------------------------
A0A2V9MDJ6      ------------------------------------------------------------
A0A2V8QJT6      ------------------------------------------------------------
A0A2V8FSM8      -----MSQELQSLARHSYPTSTQPLSTIDLPPTAVSIEPPGPGLKRDYSGPVEYWQIVRR
A0A359M0J2      -----MHPEDPNSGTSHRPQALTPIVLPRNAQPALYTPFPSEPAPEAPATNWVQFHLAIL
A0A2V8JLJ1      ------------------------------------------------------------
A0A5M8SND8      MPHGTSGLRAAVVRRTIDAGAPLMPYTGTTGFDGDSLKIAADAERGGLFEAWRIVRAEYR
A0A2V9GAQ1      ----------------------------MTEENKLVPRENGSLGGSDLLPVPIRLPVWEL
A0A497EDQ8      ------------------------------------------------------------
G8NS05          -------------------MIPSRPENFSAEPDSRAASAGPAATDATLSEALMTIRKRKY
A0A2V8KZ20      ------------------------------------------MKNFENLTISDYIDIARR
A0A3D0NWU2      ------------------------------------------------------------
A0A2V8EPD9      ------------------------------------------------------------
A0A3N5NSX5      ------------------------------------------------------------
A0A2V8MUA1      ------------------------------------------------------------
A0A2V8MBH9      ------------------------------------------------------------
A0A3N5ZPQ7      ------------------------------------------------------------
A0A3N5P5F2      ------------------------------------------------------------
A0A2V9G1P7      ------------------------------------------PTIKELYELDAVSDAYLR
A0A2V9BCK9      ------------------------------------------------------MKATKM
A0A2V9TMX2      -------------------------------MYQATSKVAIFPEVPNVLGFKDAENIAPD
A0A2V8N2J7      ----------------------------------------MASTAGNSLSVFSILDALRR
A0A3N6BI26      ------------------------------------------------------------
A0A2V9JMM3      ---------------------------------------MQLTEVAKGASILAILDAARR
A0A2V9M815      ---------------------------------------MQLTEVAKGASILAILDAARR
A0A2V9A795      ------------------------------------------------------------
A0A355ESH9      ------------------------------------------------------------
A0A3D0NW85      ------------------------------------------------------------
A0A353CAT5      ------------------------------------------------------------
A0A2V9HB55      ------------------------------------------------------------
A0A2V8CU57      ------------------------------------------------------------
A0A2V8BDI4      ------------------------------------------------------------
A0A2V8F8T3      ------------------------------------------------------------
A0A2V9J901      ------------------------------------------------------------
A0A2V8MKQ7      ------------------------------------------------------------
A0A3M1SNQ5      ------------------------------------------------------------
A0A2V8QJ59      ------------------------------------------------------------
A0A1Q7HTA7      ------------------------------------------------------------
A0A2W0B5E2      ------------------------------------------------------------
A0A2V8NMG8      ------------------------------------------------------------
A0A2V8TBM7      ------------------------------------------------------------
A0A1Q7HEZ8      ------------------------------------------------------------
A0A1Q7JW36      ------------------------------------------------------------
A0A1Q7MUR4      ------------------------------------------------------------
A0A3N5PFU4      ------------------------------------------------------------
A0A4R1LDF1      ------------------------------------------------------------
A0A1F2T1R8      ------------------------------------------------------------
A0A2V9BW09      ------------------------------------------------------------
A0A3M1SSE1      ------------------------------------------------------------
A0A2V9GQV7      ------------------------------------------------------------
A0A2V7YV88      ------------------------------------------------------------
A0A2V8YCY6      ------------------------------------------------------------
A0A2V8EGM3      ------------------------------------------------------------
A0A2V8FGH1      ------------------------------------------------------------
A0A2V8D468      ------------------------------------------------------------
A0A1F2R977      ------------------------------------------------------------
A0A2U3LF12      ------------------------------------------------------------
A0A3N5G7M6      ------------------------------------------------------------
A0A1F2S3Q7      ------------------------------------------------------------
A0A2V8GVG4      ------------------------------------------------------------
A0A2V8PJQ0      ------------------------------------------------------------
A0A2V8H566      ------------------------------------------------------------
A0A2V8UVN4      ------------------------------------------------------------
A0A321LXF5      ------------------------------------------------------------
A0A5M8SBZ0      ------------------------------------------------------------
A0A1Q7JFB1      ------------------------------------------------------------
A0A2V8DMJ9      ------------------------------------------------------------
A0A2V8GGF6      ------------------------------------------------------------
A0A2V8HKU7      ------------------------------------------------------------
A0A1Q6Y875      ------------------------------------------------------------
A0A523DJA9      ------------------------------------------------------------
A0A2V8I604      ------------------------------------------------------------
A0A2V8J066      ------------------------------------------------------------
A0A1I6MMC5      ------------------------------------------------------------
A0A2V9D5W7      ------------------------------------------------------------
A0A2V9D4I4      ------------------------------------------------------------
A0A2V9D6L7      ------------------------------------------------------------
A0A2V8ZJV2      ------------------------------------------------------------
A0A2V9AWB5      ------------------------------------------------------------
A0A2V8Z1Y8      ------------------------------------------------------------
A0A1Q8AX10      ------------------------------------------------------------
A0A2V9A773      ------------------------------------------------------------
A0A2V9AND3      ------------------------------------------------------------
A0A2V9BTJ7      ------------------------------------------------------------
A0A2V8W2M7      ------------------------------------------------------------
A0A2V8XNW2      ------------------------------------------------------------
A0A1Q7CJC1      ------------------------------------------------------------
A0A2V9UEM7      ------------------------------------------------------------
A0A1Q7V300      ------------------------------------------------------------
A0A2V9ZCI3      ------------------------------------------------------------
A0A2V9WCB3      ------------------------------------------------------------
A0A2V9VQW5      ------------------------------------------------------------
A0A2V9WTP3      ------------------------------------------------------------
A0A2V9NLA9      ------------------------------------------------------------
A0A2V9RKJ9      ------------------------------------------------------------
A0A2V9RN95      ------------------------------------------------------------
A0A2V9N406      ------------------------------------------------------------
A0A2V9U6D9      ------------------------------------------------------------
A0A2V8DZN4      ------------------------------------------------------------
A0A3N5YKY1      ------------------------------------------------------------
A0A2G6HQA4      ------------------------------------------------------------
A0A2V7ZTY7      ------------------------------------------------------------
A0A2V7ZVL9      ------------------------------------------------------------
A0A1Q7QYI4      ------------------------------------------------------------
A0A2V8G9Y9      ------------------------------------------------------------
A0A143PNR5      ------------------------------------------------------------
A0A6A7L078      ------------------------------------------------------------
A0A143PXU3      ------------------------------------------------------------
A0A2V8D8G9      ------------------------------------------------------------
A0A2V8ESQ4      ------------------------------------------------------------
A0A1E3Y5Q0      ------------------------------------------------------------
A0A2W4TWK5      ------------------------------------------------------------
A0A3N5NYV3      ------------------------------------------------------------
A0A2V2RJF9      ------------------------------------------------------------
A0A2G6HNT3      ------------------------------------------------------------
A0A2V7YWD4      ------------------------------------------------------------
A0A2V2R8T6      ------------------------------------------------------------
A0A1Q7RGF1      ------------------------------------------------------------
A0A2V9BLX2      ------------------------------------------------------------
A0A2V9ZA03      ------------------------------------------------------------
A0A3N5ZNH4      ------------------------------------------------------------
A0A2V8GEZ2      ------------------------------------------------------------
A0A3N5ZFD3      ------------------------------------------------------------
G8NXD3          ------------------------------------------------------------
A0A2V9VR38      ------------------------------------------------------------
A0A2V9EY04      ------------------------------------------------------------
A0A2V9HAK9      ------------------------------------------------------------
A0A1Q7FS15      ------------------------------------------------------------
A0A1Q7K9P1      ------------------------------------------------------------
A0A1Q7N989      ------------------------------------------------------------
A0A2V9G7Y0      ------------------------------------------------------------
A0A2V8T7Z1      ------------------------------------------------------------
A0A2V7U8G5      ------------------------------------------------------------
A0A2V7UNP9      ------------------------------------------------------------
A0A2V7VLD7      ------------------------------------------------------------
A0A2V7XGA3      ------------------------------------------------------------
A0A2V7YAG6      ------------------------------------------------------------
A0A2V7VK33      ------------------------------------------------------------
A0A3M1VTE1      ------------------------------------------------------------
A0A2V7TTM7      ------------------------------------------------------------
A0A2V8VI82      ------------------------------------------------------------
A0A2V7U4P9      ------------------------------------------------------------
A0A2V7TQY5      ------------------------------------------------------------
A0A2V7TU87      ------------------------------------------------------------
A0A2V8SEH0      ------------------------------------------------------------
A0A2V8VU54      ------------------------------------------------------------
A0A1Q7RML7      ------------------------------------------------------------
A0A1Q7ZIQ5      ------------------------------------------------------------
A0A2V8TKD8      ------------------------------------------------------------
                                                                            

A0A1F2U8T6      ------------------------------------------------------------
A0A2V8BV42      ------------------------------------------------------------
A0A2V8F916      ------------------------------------------------------------
A0A1Q7K833      ------------------------------------------------------------
A0A1Q8AMY4      ------------------------------------------------------------
A0A2V8BM40      ------------------------------------------------------------
A0A2V8CRT6      ------------------------------------------------------------
A0A1F2VH76      ------------------------------------------------------------
A0A1F2R0X5      ------------------------------------------------------------
A0A2V8B278      ------------------------------------------------------------
A0A2V8CEF9      ------------------------------------------------------------
A0A2V8KZG2      ------------------------------------------------------------
A0A1Q7LG57      ------------------------------------------------------------
A0A2V8YMQ4      ------------------------------------------------------------
A0A1Q7L5B1      ------------------------------------------------------------
A0A2V9DKV4      ------------------------------------------------------------
A0A2V8W380      ------------------------------------------------------------
A0A2V8ZIV5      ------------------------------------------------------------
A0A2V9EVA0      ------------------------------------------------------------
A0A1Q7RB73      ------------------------------------------------------------
A0A2V9K0H7      ------------------------------------------------------------
A0A3N5YN96      ------------------------------------------------------------
A0A1Q7Y646      ------------------------------------------------------------
A0A2V8QZU0      ------------------------------------------------------------
A0A2V8RSQ9      ------------------------------------------------------------
A0A2V9LS17      ------------------------------------------------------------
A0A2V9AGR3      ------------------------------------------------------------
A0A2V9G0N7      ------------------------------------------------------------
A0A2V9GQ44      ------------------------------------------------------------
A0A2V9HRN3      ------------------------------------------------------------
A0A2V8WG13      ------------------------------------------------------------
A0A2V8X987      ------------------------------------------------------------
A0A1Q7KX94      ------------------------------------------------------------
A0A2V8XHT0      ------------------------------------------------------------
A0A2V9L2P7      ------------------------------------------------------------
A0A2V7UMX0      ------------------------------------------------------------
A0A136K497      ------------------------------------------------------------
A0A399W9E4      ------------------------------------------------------------
A0A2V7X0V9      ------------------------------------------------------------
A0A2V9X518      ------------------------------------------------------------
A0A2V9VC62      ------------------------------------------------------------
A0A2V9S1P8      ------------------------------------------------------------
A0A2V9RTW2      ------------------------------------------------------------
A0A2V9TGF1      ------------------------------------------------------------
A0A2V9XEV6      ------------------------------------------------------------
A0A2V9Y3Q6      ------------------------------------------------------------
A0A2V9R269      ------------------------------------------------------------
A0A2V9PTS3      ------------------------------------------------------------
A0A2V9NPF4      ------------------------------------------------------------
A0A2V9PNZ0      ------------------------------------------------------------
A0A321LMC5      ------------------------------------------------------------
A0A2V8X713      ------------------------------------------------------------
A0A2V8ZLE9      ------------------------------------------------------------
A0A2V8Y4D3      ------------------------------------------------------------
A0A2V8Z2X8      ------------------------------------------------------------
A0A2V9C3F6      ------------------------------------------------------------
A0A2V9QMU9      ------------------------------------------------------------
A0A2V9QY75      ------------------------------------------------------------
A0A2V9SVU9      ------------------------------------------------------------
A0A2V8W5N5      ------------------------------------------------------------
A0A2V8XG53      ------------------------------------------------------------
A0A6A7LB89      ------------------------------------------------------------
A0A2V9XV04      ------------------------------------------------------------
A0A2V9CBY1      ------------------------------------------------------------
A0A2V9D656      ------------------------------------------------------------
A0A352EZH8      ------------------------------------------------------------
A0A0B6X033      ------------------------------------------------------------
A0A2V8R0I3      ------------------------------------------------------------
A0A2V8N1U8      ------------------------------------------------------------
A0A2V8QL35      ------------------------------------------------------------
A0A352FU10      ------------------------------------------------------------
A0A2V8LCU0      ------------------------------------------------------------
A0A1Q7NGT0      ------------------------------------------------------------
A0A2V8MLP9      ------------------------------------------------------------
A0A2V8PQZ0      ------------------------------------------------------------
A0A3B9MKY6      ------------------------------------------------------------
A0A3D5SKZ1      ------------------------------------------------------------
A0A2V8NRW2      ------------------------------------------------------------
A0A2V8TKR9      ------------------------------------------------------------
A0A2V8LBV1      ------------------------------------------------------------
A0A2V8GAF9      ------------------------------------------------------------
A0A2V8CN98      ------------------------------------------------------------
A0A1Q7LC46      ------------------------------------------------------------
A0A1Q8BDC5      ------------------------------------------------------------
A0A2V9Q1Y8      ------------------------------------------------------------
A0A2V8JXG1      ------------------------------------------------------------
A0A350D2W9      ------------------------------------------------------------
A0A2V9I4J1      ------------------------------------------------------------
A0A2V8PQZ9      ------------------------------------------------------------
A0A2V8D8B1      ------------------------------------------------------------
A0A3B9LSB4      ------------------------------------------------------------
A0A2V9H7U2      ------------------------------------------------------------
A0A2V8NJB5      ------------------------------------------------------------
A0A2V9JMZ4      ------------------------------------------------------------
A0A2V9MDJ6      ------------------------------------------------------------
A0A2V8QJT6      ------------------------------------------------------------
A0A2V8FSM8      HKGAVLLATVAGALLGFAMTLSEPRIYQAKTTLEYQGINEEFLDMKKVNPVVDTSYLDSD
A0A359M0J2      KRRFWWVLALGFLGTGVGFLVFLPQDPQYMAATTIELQPINENFLGAFDPLSGSFSSQNL
A0A2V8JLJ1      ------------------------------------------------------------
A0A5M8SND8      TVLLAMGVGLVLALSVGLFKAPMFTSRCELVIESPNGDFLGTRSISPVADDPASEGGLTD
A0A2V9GAQ1      SPREPHLYDYLLILRKHQWLILSFLHRENANILPFQGTDSYDIMMDQDNYIETQSKILTS
A0A497EDQ8      ------------------------------------------------------------
G8NS05          VILAAALLGMIYGFYKGSTQPHLFESYGDIEIRSGSSDQYRIAGSTGAGGNRLPTEVAIL
A0A2V8KZ20      RIWYVVTTTTLVAAGTVLFALRLPAIYKSETTIAISSRFLPENYMPTIDRQTITDRMDFA
A0A3D0NWU2      ------------------------------------------------------------
A0A2V8EPD9      ------------------------------------------------------------
A0A3N5NSX5      ---------------------------------------ARRLTRAATPSGATAGQPSA-
A0A2V8MUA1      ------------------------------------------------------------
A0A2V8MBH9      ------------------------------------------------------------
A0A3N5ZPQ7      ------------------------------------------------------------
A0A3N5P5F2      ------------------------------------------------------------
A0A2V9G1P7      TQYSILASESLARRAIDQLHLETLREFNSRKWWQLWPETRKPSTTQTFAVGPVPQVRDRE
A0A2V9BCK9      YEKFFGLRESPFNVNPDPRYLFLTPSTQEALASLAYGIRGRKGIILLTGEVGTGKTTLL-
A0A2V9TMX2      YEYEATLETQVAILRSDALALKVIEGMRLYQDPRFTAVKQSSPESPMGEPSMQPDPVQA-
A0A2V8N2J7      RKFILMISKILLTAGFAIFAHLQPDRFRATALIAAA----QTTPPEYLR-HVAPPPLNI-
A0A3N6BI26      ------------------MTSQLSWLKRTVSNLRPG----RSDAPKTGADESGAGRDKN-
A0A2V9JMM3      RKFYVIVPALVLTVCVGAFASRLPNSYRAQALLAVE----RPPASDLLKMGGTPGPPGI-
A0A2V9M815      RKFYVIVPALVLTVCVGAFASRLPNSYRAQALLAVE----RPPASDLLRMGGTPGPPSI-
A0A2V9A795      ---------------------------------------------------------MY-
A0A355ESH9      -------------VRSLDLMADPSFNPGAAAAKE-----------RTGATTAEEDEATL-
A0A3D0NW85      -----------RGFLRAIGLASSPDAQSDASLSEFA----ASPNSGLMSADEIAEAIRL-
A0A353CAT5      ------------MLRAIGLASDTTKDTTSTADSVNS----LNS--GLVSADEIAEAIRL-
A0A2V9HB55      -----------KILTSETLALQTIRNNGLSARPEFS----SPS--GPSEAIAVGSLANQ-
A0A2V8CU57      ------------------------------------------------------------
A0A2V8BDI4      -----------MDLPRMSGRSDATSSWRSAATSIWG----RKP--RPRHRRCA---RRR-
A0A2V8F8T3      -----------MDLPRMSGRSDATSSWRSAATSIWG----RKP--RPRHRRCA---RRR-
A0A2V9J901      ------------------------------------------------------------
A0A2V8MKQ7      ------------------------------------------------------------
A0A3M1SNQ5      ------------------------------------------------------------
A0A2V8QJ59      ------------------------------------------------------------
A0A1Q7HTA7      ------------------------------------------------------------
A0A2W0B5E2      ------------------------------------------------------------
A0A2V8NMG8      ------------------------------------------------------------
A0A2V8TBM7      ------------------------------------------------------------
A0A1Q7HEZ8      ------------------------------------------------------------
A0A1Q7JW36      ------------------------------------------------------------
A0A1Q7MUR4      ------------------------------------------------------------
A0A3N5PFU4      ------------------------------------------------------------
A0A4R1LDF1      ------------------------------------------------------------
A0A1F2T1R8      ------------------------------------------------------------
A0A2V9BW09      ------------------------------------------------------------
A0A3M1SSE1      ------------------------------------------------------------
A0A2V9GQV7      ------------------------------------------------------------
A0A2V7YV88      ------------------------------------------------------------
A0A2V8YCY6      ------------------------------------------------------------
A0A2V8EGM3      ------------------------------------------------------------
A0A2V8FGH1      ------------------------------------------------------------
A0A2V8D468      ------------------------------------------------------------
A0A1F2R977      ------------------------------------------------------------
A0A2U3LF12      ------------------------------------------------------------
A0A3N5G7M6      ------------------------------------------------------------
A0A1F2S3Q7      ------------------------------------------------------------
A0A2V8GVG4      ------------------------------------------------------------
A0A2V8PJQ0      ------------------------------------------------------------
A0A2V8H566      ------------------------------------------------------------
A0A2V8UVN4      ------------------------------------------------------------
A0A321LXF5      ------------------------------------------------------------
A0A5M8SBZ0      ------------------------------------------------------------
A0A1Q7JFB1      ------------------------------------------------------------
A0A2V8DMJ9      ------------------------------------------------------------
A0A2V8GGF6      ------------------------------------------------------------
A0A2V8HKU7      ------------------------------------------------------------
A0A1Q6Y875      ------------------------------------------------------------
A0A523DJA9      ------------------------------------------------------------
A0A2V8I604      ------------------------------------------------------------
A0A2V8J066      ------------------------------------------------------------
A0A1I6MMC5      ------------------------------------------------------------
A0A2V9D5W7      ------------------------------------------------------------
A0A2V9D4I4      ------------------------------------------------------------
A0A2V9D6L7      ------------------------------------------------------------
A0A2V8ZJV2      ------------------------------------------------------------
A0A2V9AWB5      ------------------------------------------------------------
A0A2V8Z1Y8      ------------------------------------------------------------
A0A1Q8AX10      ------------------------------------------------------------
A0A2V9A773      ------------------------------------------------------------
A0A2V9AND3      ------------------------------------------------------------
A0A2V9BTJ7      ------------------------------------------------------------
A0A2V8W2M7      ------------------------------------------------------------
A0A2V8XNW2      ------------------------------------------------------------
A0A1Q7CJC1      ------------------------------------------------------------
A0A2V9UEM7      ------------------------------------------------------------
A0A1Q7V300      ------------------------------------------------------------
A0A2V9ZCI3      ------------------------------------------------------------
A0A2V9WCB3      ------------------------------------------------------------
A0A2V9VQW5      ------------------------------------------------------------
A0A2V9WTP3      ------------------------------------------------------------
A0A2V9NLA9      ------------------------------------------------------------
A0A2V9RKJ9      ------------------------------------------------------------
A0A2V9RN95      ------------------------------------------------------------
A0A2V9N406      ------------------------------------------------------------
A0A2V9U6D9      ------------------------------------------------------------
A0A2V8DZN4      ------------------------------------------------------------
A0A3N5YKY1      ------------------------------------------------------------
A0A2G6HQA4      ------------------------------------------------------------
A0A2V7ZTY7      ------------------------------------------------------------
A0A2V7ZVL9      ------------------------------------------------------------
A0A1Q7QYI4      ------------------------------------------------------------
A0A2V8G9Y9      ------------------------------------------------------------
A0A143PNR5      ------------------------------------------------------------
A0A6A7L078      ------------------------------------------------------------
A0A143PXU3      ------------------------------------------------------------
A0A2V8D8G9      ------------------------------------------------------------
A0A2V8ESQ4      ------------------------------------------------------------
A0A1E3Y5Q0      ------------------------------------------------------------
A0A2W4TWK5      ------------------------------------------------------------
A0A3N5NYV3      ------------------------------------------------------------
A0A2V2RJF9      ------------------------------------------------------------
A0A2G6HNT3      ------------------------------------------------------------
A0A2V7YWD4      ------------------------------------------------------------
A0A2V2R8T6      ------------------------------------------------------------
A0A1Q7RGF1      ------------------------------------------------------------
A0A2V9BLX2      ------------------------------------------------------------
A0A2V9ZA03      ------------------------------------------------------------
A0A3N5ZNH4      ------------------------------------------------------------
A0A2V8GEZ2      ------------------------------------------------------------
A0A3N5ZFD3      ------------------------------------------------------------
G8NXD3          ------------------------------------------------------------
A0A2V9VR38      ------------------------------------------------------------
A0A2V9EY04      ------------------------------------------------------------
A0A2V9HAK9      ------------------------------------------------------------
A0A1Q7FS15      ------------------------------------------------------------
A0A1Q7K9P1      ------------------------------------------------------------
A0A1Q7N989      ------------------------------------------------------------
A0A2V9G7Y0      ------------------------------------------------------------
A0A2V8T7Z1      ------------------------------------------------------------
A0A2V7U8G5      ------------------------------------------------------------
A0A2V7UNP9      ------------------------------------------------------------
A0A2V7VLD7      ------------------------------------------------------------
A0A2V7XGA3      ------------------------------------------------------------
A0A2V7YAG6      ------------------------------------------------------------
A0A2V7VK33      ------------------------------------------------------------
A0A3M1VTE1      ------------------------------------------------------------
A0A2V7TTM7      ------------------------------------------------------------
A0A2V8VI82      ------------------------------------------------------------
A0A2V7U4P9      ------------------------------------------------------------
A0A2V7TQY5      ------------------------------------------------------------
A0A2V7TU87      ------------------------------------------------------------
A0A2V8SEH0      ------------------------------------------------------------
A0A2V8VU54      ------------------------------------------------------------
A0A1Q7RML7      ------------------------------------------------------------
A0A1Q7ZIQ5      ------------------------------------------------------------
A0A2V8TKD8      ------------------------------------------------------------
                                                                            

A0A1F2U8T6      ------------------------------------------------------------
A0A2V8BV42      ------------------------------------------------------------
A0A2V8F916      ------------------------------------------------------------
A0A1Q7K833      ------------------------------------------------------------
A0A1Q8AMY4      ------------------------------------------------------------
A0A2V8BM40      ------------------------------------------------------------
A0A2V8CRT6      ------------------------------------------------------------
A0A1F2VH76      ------------------------------------------------------------
A0A1F2R0X5      ------------------------------------------------------------
A0A2V8B278      ------------------------------------------------------------
A0A2V8CEF9      ------------------------------------------------------------
A0A2V8KZG2      ------------------------------------------------------------
A0A1Q7LG57      ------------------------------------------------------------
A0A2V8YMQ4      ------------------------------------------------------------
A0A1Q7L5B1      ------------------------------------------------------------
A0A2V9DKV4      ------------------------------------------------------------
A0A2V8W380      ------------------------------------------------------------
A0A2V8ZIV5      ------------------------------------------------------------
A0A2V9EVA0      ------------------------------------------------------------
A0A1Q7RB73      ------------------------------------------------------------
A0A2V9K0H7      ------------------------------------------------------------
A0A3N5YN96      ------------------------------------------------------------
A0A1Q7Y646      ------------------------------------------------------------
A0A2V8QZU0      ------------------------------------------------------------
A0A2V8RSQ9      ------------------------------------------------------------
A0A2V9LS17      ------------------------------------------------------------
A0A2V9AGR3      ------------------------------------------------------------
A0A2V9G0N7      ------------------------------------------------------------
A0A2V9GQ44      ------------------------------------------------------------
A0A2V9HRN3      ------------------------------------------------------------
A0A2V8WG13      ------------------------------------------------------------
A0A2V8X987      ------------------------------------------------------------
A0A1Q7KX94      ------------------------------------------------------------
A0A2V8XHT0      ------------------------------------------------------------
A0A2V9L2P7      ------------------------------------------------------------
A0A2V7UMX0      ------------------------------------------------------------
A0A136K497      ------------------------------------------------------------
A0A399W9E4      ------------------------------------------------------------
A0A2V7X0V9      ------------------------------------------------------------
A0A2V9X518      ------------------------------------------------------------
A0A2V9VC62      ------------------------------------------------------------
A0A2V9S1P8      ------------------------------------------------------------
A0A2V9RTW2      ------------------------------------------------------------
A0A2V9TGF1      ------------------------------------------------------------
A0A2V9XEV6      ------------------------------------------------------------
A0A2V9Y3Q6      ------------------------------------------------------------
A0A2V9R269      ------------------------------------------------------------
A0A2V9PTS3      ------------------------------------------------------------
A0A2V9NPF4      ------------------------------------------------------------
A0A2V9PNZ0      ------------------------------------------------------------
A0A321LMC5      ------------------------------------------------------------
A0A2V8X713      ------------------------------------------------------------
A0A2V8ZLE9      ------------------------------------------------------------
A0A2V8Y4D3      ------------------------------------------------------------
A0A2V8Z2X8      ------------------------------------------------------------
A0A2V9C3F6      ------------------------------------------------------------
A0A2V9QMU9      ------------------------------------------------------------
A0A2V9QY75      ------------------------------------------------------------
A0A2V9SVU9      ------------------------------------------------------------
A0A2V8W5N5      ------------------------------------------------------------
A0A2V8XG53      ------------------------------------------------------------
A0A6A7LB89      ------------------------------------------------------------
A0A2V9XV04      ------------------------------------------------------------
A0A2V9CBY1      ------------------------------------------------------------
A0A2V9D656      ------------------------------------------------------------
A0A352EZH8      ------------------------------------------------------------
A0A0B6X033      ------------------------------------------------------------
A0A2V8R0I3      ------------------------------------------------------------
A0A2V8N1U8      ------------------------------------------------------------
A0A2V8QL35      ------------------------------------------------------------
A0A352FU10      ------------------------------------------------------------
A0A2V8LCU0      ------------------------------------------------------------
A0A1Q7NGT0      ------------------------------------------------------------
A0A2V8MLP9      ------------------------------------------------------------
A0A2V8PQZ0      ------------------------------------------------------------
A0A3B9MKY6      ------------------------------------------------------------
A0A3D5SKZ1      ------------------------------------------------------------
A0A2V8NRW2      ------------------------------------------------------------
A0A2V8TKR9      ------------------------------------------------------------
A0A2V8LBV1      ------------------------------------------------------------
A0A2V8GAF9      ------------------------------------------------------------
A0A2V8CN98      ------------------------------------------------------------
A0A1Q7LC46      ------------------------------------------------------------
A0A1Q8BDC5      ------------------------------------------------------------
A0A2V9Q1Y8      ------------------------------------------------------------
A0A2V8JXG1      ------------------------------------------------------------
A0A350D2W9      ------------------------------------------------------------
A0A2V9I4J1      ------------------------------------------------------------
A0A2V8PQZ9      ------------------------------------------------------------
A0A2V8D8B1      ------------------------------------------------------------
A0A3B9LSB4      ------------------------------------------------------------
A0A2V9H7U2      ------------------------------------------------------------
A0A2V8NJB5      ------------------------------------------------------------
A0A2V9JMZ4      ------------------------------------------------------------
A0A2V9MDJ6      ------------------------------------------------------------
A0A2V8QJT6      ------------------------------------------------------------
A0A2V8FSM8      I-STQVKILESRALISRVREKMATRPQPERLQPPDRLGMWRTALRLNAPTADGLWKQALG
A0A359M0J2      NAQTQISILRSYSLLSAALERMERESTLTAAAPAGRFAALRRRLGFVPLEPLEATREATF
A0A2V8JLJ1      ------------------------------------------------------------
A0A5M8SND8      VQTQLRVIQSDQLIDRVIAKLESQGKLGPLELEATHRSFASRLLMRPKLTANERAYRIHK
A0A2V9GAQ1      ETLALQTIRNNGLSARPEFSSPNGPSEAVALGSLANQKRPPELGQF--------------
A0A497EDQ8      ------------------------------------------------------------
G8NS05          KSDTLLLTVAEDLDLANNQDFLGMTQRPPHVNIEDPNVRQATIGRM--------------
A0A2V8KZ20      RQQLQSRTFLEGIVEEFH------------LAGPDGVEKAAEVIRN--------------
A0A3D0NWU2      ------------------------------------------------------------
A0A2V8EPD9      ------------------------------------------------------------
A0A3N5NSX5      --TDLANAFLGAVHVEQV------------------------------------------
A0A2V8MUA1      ------------------------------------------------------------
A0A2V8MBH9      ------------------------------------------------------------
A0A3N5ZPQ7      ------------------------------------------------------------
A0A3N5P5F2      ------------------------------------------------------------
A0A2V9G1P7      LSERVLERFLDRLTIDPV------------------------------------------
A0A2V9BCK9      --NRLLDWLRHEQAVTAF------------------------------------------
A0A2V9TMX2      --AGLLGAFRGGLSVQPV------------------------------------------
A0A2V8N2J7      --EDHLWTVREVLYSEPVLKAAARESKRYRSNKGDLSPQQLDEFKQ--------------
A0A3N6BI26      --RDVLDTFRDRLEVAQV------------------------------------------
A0A2V9JMM3      --QEQLRVIRETLFARPLLQEVLKEFTLYGPATD--PDWATEDMKK--------------
A0A2V9M815      --QEQLRVIRETLFARPLLQEVLKEFKLYGPATD--PDWATEDMKK--------------
A0A2V9A795      --QRVLERFQDRLTIEPV---------------------------S--------------
A0A355ESH9      --GKLAQQLKGGLTVDPV---------------------------R--------------
A0A3D0NW85      --APFVDVIKRNLSIEPV---------------------------R--------------
A0A353CAT5      --APYVEIIRNNLTVEPV---------------------------R--------------
A0A2V9HB55      --KRPPGLGEFLGSLSVK---------------------------R--------------
A0A2V8CU57      ------------------------------------------------------------
A0A2V8BDI4      --PRPSWRSPRERQWRST---------------------------R--------------
A0A2V8F8T3      --PRPSWRSPRERQWRST---------------------------R--------------
A0A2V9J901      ------------------------------------------------------------
A0A2V8MKQ7      ------------------------------------------------------------
A0A3M1SNQ5      ------------------------------------------------------------
A0A2V8QJ59      ------------------------------------------------------------
A0A1Q7HTA7      ------------------------------------------------------------
A0A2W0B5E2      ------------------------------------------------------------
A0A2V8NMG8      ------------------------------------------------------------
A0A2V8TBM7      ------------------------------------------------------------
A0A1Q7HEZ8      ------------------------------------------------------------
A0A1Q7JW36      ------------------------------------------------------------
A0A1Q7MUR4      ------------------------------------------------------------
A0A3N5PFU4      ------------------------------------------------------------
A0A4R1LDF1      ------------------------------------------------------------
A0A1F2T1R8      ------------------------------------------------------------
A0A2V9BW09      ------------------------------------------------------------
A0A3M1SSE1      ------------------------------------------------------------
A0A2V9GQV7      ------------------------------------------------------------
A0A2V7YV88      ------------------------------------------------------------
A0A2V8YCY6      ------------------------------------------------------------
A0A2V8EGM3      ------------------------------------------------------------
A0A2V8FGH1      ------------------------------------------------------------
A0A2V8D468      ------------------------------------------------------------
A0A1F2R977      ------------------------------------------------------------
A0A2U3LF12      ------------------------------------------------------------
A0A3N5G7M6      ------------------------------------------------------------
A0A1F2S3Q7      ------------------------------------------------------------
A0A2V8GVG4      ------------------------------------------------------------
A0A2V8PJQ0      ------------------------------------------------------------
A0A2V8H566      ------------------------------------------------------------
A0A2V8UVN4      ------------------------------------------------------------
A0A321LXF5      ------------------------------------------------------------
A0A5M8SBZ0      ------------------------------------------------------------
A0A1Q7JFB1      ------------------------------------------------------------
A0A2V8DMJ9      ------------------------------------------------------------
A0A2V8GGF6      ------------------------------------------------------------
A0A2V8HKU7      ------------------------------------------------------------
A0A1Q6Y875      ------------------------------------------------------------
A0A523DJA9      ------------------------------------------------------------
A0A2V8I604      ------------------------------------------------------------
A0A2V8J066      ------------------------------------------------------------
A0A1I6MMC5      ------------------------------------------------------------
A0A2V9D5W7      ------------------------------------------------------------
A0A2V9D4I4      ------------------------------------------------------------
A0A2V9D6L7      ------------------------------------------------------------
A0A2V8ZJV2      ------------------------------------------------------------
A0A2V9AWB5      ------------------------------------------------------------
A0A2V8Z1Y8      ------------------------------------------------------------
A0A1Q8AX10      ------------------------------------------------------------
A0A2V9A773      ------------------------------------------------------------
A0A2V9AND3      ------------------------------------------------------------
A0A2V9BTJ7      ------------------------------------------------------------
A0A2V8W2M7      ------------------------------------------------------------
A0A2V8XNW2      ------------------------------------------------------------
A0A1Q7CJC1      ------------------------------------------------------------
A0A2V9UEM7      ------------------------------------------------------------
A0A1Q7V300      ------------------------------------------------------------
A0A2V9ZCI3      ------------------------------------------------------------
A0A2V9WCB3      ------------------------------------------------------------
A0A2V9VQW5      ------------------------------------------------------------
A0A2V9WTP3      ------------------------------------------------------------
A0A2V9NLA9      ------------------------------------------------------------
A0A2V9RKJ9      ------------------------------------------------------------
A0A2V9RN95      ------------------------------------------------------------
A0A2V9N406      ------------------------------------------------------------
A0A2V9U6D9      ------------------------------------------------------------
A0A2V8DZN4      ------------------------------------------------------------
A0A3N5YKY1      ------------------------------------------------------------
A0A2G6HQA4      ------------------------------------------------------------
A0A2V7ZTY7      ------------------------------------------------------------
A0A2V7ZVL9      ------------------------------------------------------------
A0A1Q7QYI4      ------------------------------------------------------------
A0A2V8G9Y9      ------------------------------------------------------------
A0A143PNR5      ------------------------------------------------------------
A0A6A7L078      ------------------------------------------------------------
A0A143PXU3      ------------------------------------------------------------
A0A2V8D8G9      ------------------------------------------------------------
A0A2V8ESQ4      ------------------------------------------------------------
A0A1E3Y5Q0      ------------------------------------------------------------
A0A2W4TWK5      ------------------------------------------------------------
A0A3N5NYV3      ------------------------------------------------------------
A0A2V2RJF9      ------------------------------------------------------------
A0A2G6HNT3      ------------------------------------------------------------
A0A2V7YWD4      ------------------------------------------------------------
A0A2V2R8T6      ------------------------------------------------------------
A0A1Q7RGF1      ------------------------------------------------------------
A0A2V9BLX2      ------------------------------------------------------------
A0A2V9ZA03      ------------------------------------------------------------
A0A3N5ZNH4      ------------------------------------------------------------
A0A2V8GEZ2      ------------------------------------------------------------
A0A3N5ZFD3      ------------------------------------------------------------
G8NXD3          ------------------------------------------------------------
A0A2V9VR38      ------------------------------------------------------------
A0A2V9EY04      ------------------------------------------------------------
A0A2V9HAK9      ------------------------------------------------------------
A0A1Q7FS15      ------------------------------------------------------------
A0A1Q7K9P1      ------------------------------------------------------------
A0A1Q7N989      ------------------------------------------------------------
A0A2V9G7Y0      ------------------------------------------------------------
A0A2V8T7Z1      ------------------------------------------------------------
A0A2V7U8G5      ------------------------------------------------------------
A0A2V7UNP9      ------------------------------------------------------------
A0A2V7VLD7      ------------------------------------------------------------
A0A2V7XGA3      ------------------------------------------------------------
A0A2V7YAG6      ------------------------------------------------------------
A0A2V7VK33      ------------------------------------------------------------
A0A3M1VTE1      ------------------------------------------------------------
A0A2V7TTM7      ------------------------------------------------------------
A0A2V8VI82      ------------------------------------------------------------
A0A2V7U4P9      ------------------------------------------------------------
A0A2V7TQY5      ------------------------------------------------------------
A0A2V7TU87      ------------------------------------------------------------
A0A2V8SEH0      ------------------------------------------------------------
A0A2V8VU54      ------------------------------------------------------------
A0A1Q7RML7      ------------------------------------------------------------
A0A1Q7ZIQ5      ------------------------------------------------------------
A0A2V8TKD8      ------------------------------------------------------------
                                                                            

A0A1F2U8T6      -----------------------------MGRAGQARGPLS------THAVHKDVHILDL
A0A2V8BV42      -----------------------MADLPPNARADSSPGVFAPPPAGAPYAPDGDIHLLDR
A0A2V8F916      -----------------------MADLPPNARADSAPGVFAPPPAGAPYAPDGDIHLLDR
A0A1Q7K833      -----------------------------------------------MYSPDTDVHILDR
A0A1Q8AMY4      -----------------------------------------------MYSPDTDVHILDR
A0A2V8BM40      -------------------------MPDHRQRTSSGTGSNPPAPAPLAYAADNDVHILDR
A0A2V8CRT6      ------------------------------------------------------------
A0A1F2VH76      ---------------MNGPNTPANLQAGTH---ALTPLSQE-------------THLLDR
A0A1F2R0X5      ---------------MSESASGGAHRPSTTSASASHPTGTAGHSPASSYAPQSEVHLLDR
A0A2V8B278      ---------------MAEPKAPHPLRPATT---ADHPAAAA---PTSTYTPDTDVHILDR
A0A2V8CEF9      ---------------MAELKAPHSLRPATT---ADHPAAAA---PTSTYTPDTDVHILDR
A0A2V8KZG2      ------------------------------------------------------------
A0A1Q7LG57      ------------------------------------------------------------
A0A2V8YMQ4      ------------------------------------------------------------
A0A1Q7L5B1      ------------------------------------------------------------
A0A2V9DKV4      ------------------------------------------------------------
A0A2V8W380      ------------------------------------------------------------
A0A2V8ZIV5      ------------------------------------------------------------
A0A2V9EVA0      ------------------------------------------------------------
A0A1Q7RB73      ------------------------------------------------------------
A0A2V9K0H7      ------------------------------------------------------------
A0A3N5YN96      ------------------------------------------------------------
A0A1Q7Y646      ------------------------------------------------------------
A0A2V8QZU0      ------------------------------------------------------------
A0A2V8RSQ9      ------------------------------------------------------------
A0A2V9LS17      ------------------------------------------------------------
A0A2V9AGR3      ------------------------------------------------------------
A0A2V9G0N7      ------------------------------------------------------------
A0A2V9GQ44      ------------------------------------------------------------
A0A2V9HRN3      ------------------------------------------------------------
A0A2V8WG13      ------------------------------------------------------------
A0A2V8X987      ------------------------------------------------------------
A0A1Q7KX94      ------------------------------------------------------------
A0A2V8XHT0      ------------------------------------------------------------
A0A2V9L2P7      ------------------------------------------------------------
A0A2V7UMX0      ------------------------------------------------------------
A0A136K497      ------------------------------------------------------------
A0A399W9E4      ------------------------------------------------------------
A0A2V7X0V9      ------------------------------------------------------------
A0A2V9X518      ------------------------------------------------------------
A0A2V9VC62      ------------------------------------------------------------
A0A2V9S1P8      ------------------------------------------------------------
A0A2V9RTW2      ------------------------------------------------------------
A0A2V9TGF1      ------------------------------------------------------------
A0A2V9XEV6      ------------------------------------------------------------
A0A2V9Y3Q6      ------------------------------------------------------------
A0A2V9R269      ------------------------------------------------------------
A0A2V9PTS3      ------------------------------------------------------------
A0A2V9NPF4      ------------------------------------------------------------
A0A2V9PNZ0      ------------------------------------------------------------
A0A321LMC5      ------------------------------------------------------------
A0A2V8X713      ------------------------------------------------------------
A0A2V8ZLE9      ------------------------------------------------------------
A0A2V8Y4D3      ------------------------------------------------------------
A0A2V8Z2X8      ------------------------------------------------------------
A0A2V9C3F6      ------------------------------------------------------------
A0A2V9QMU9      ------------------------------------------------------------
A0A2V9QY75      ------------------------------------------------------------
A0A2V9SVU9      ------------------------------------------------------------
A0A2V8W5N5      ------------------------------------------------------------
A0A2V8XG53      ------------------------------------------------------------
A0A6A7LB89      ------------------------------------------------------------
A0A2V9XV04      ------------------------------------------------------------
A0A2V9CBY1      ------------------------------------------------------------
A0A2V9D656      ------------------------------------------------------------
A0A352EZH8      ------------------------------------------------------------
A0A0B6X033      ------------------------------------------------------------
A0A2V8R0I3      ------------------------------------------------------------
A0A2V8N1U8      ------------------------------------------------------------
A0A2V8QL35      ------------------------------------------------------------
A0A352FU10      ------------------------------------------------------------
A0A2V8LCU0      ------------------------------------------------------------
A0A1Q7NGT0      ------------------------------------------------------------
A0A2V8MLP9      ------------------------------------------------------------
A0A2V8PQZ0      ------------------------------------------------------------
A0A3B9MKY6      ------------------------------------------------------------
A0A3D5SKZ1      ------------------------------------------------------------
A0A2V8NRW2      ------------------------------------------------------------
A0A2V8TKR9      ------------------------------------------------------------
A0A2V8LBV1      ------------------------------------------------------------
A0A2V8GAF9      ------------------------------------------------------------
A0A2V8CN98      ------------------------------------------MSEFLTRRVQEDQLRRD-
A0A1Q7LC46      ------------------------------------------------------------
A0A1Q8BDC5      ------------------------------------------------------------
A0A2V9Q1Y8      ------------------------------------------------------------
A0A2V8JXG1      ------------------------------------------------------------
A0A350D2W9      ------------------------------------------------------------
A0A2V9I4J1      ------------------------------------------------------------
A0A2V8PQZ9      ------------------------------------------MKSEKDLRASSTLPAAP-
A0A2V8D8B1      ------------------------------------------MPCPLKSARTSSCRSWP-
A0A3B9LSB4      ------------------------------------------------------------
A0A2V9H7U2      ------------------------------------------------------------
A0A2V8NJB5      --------MNLVLDEIRQLGENRENGFLTLSRNGHRVVMF--YREGMIQAVSSNLTSHR-
A0A2V9JMZ4      ------MTVQLLLDHIRPILEGSKDGTLLLGNQSEIIKVF--CRQGLIEAVSSNLEQYH-
A0A2V9MDJ6      ------MTVQLLLDHIRPILEGSKDGTLLLGNQSEIIKVF--CRQGLIEAVSSNLEQYH-
A0A2V8QJT6      -----------------------------------------MLEAENDRKMAEAEYNAAK
A0A2V8FSM8      SAADGVRVRSSGTNRIIDMSCDSTNGQIAADFCNTLAQEY--IDQSLEARWKTTEYTGQ-
A0A359M0J2      IAARSVMPRIVPGTRIIQITASSTIPEVAANLVNAVAAEY--VYQNQQFRSNSVQRTTQ-
A0A2V8JLJ1      ---------------------------------------MEGLVRQFKAAAEAAKAAAA-
A0A5M8SND8      YVASHLGVRQVGPTRAVDISFSFPDPAFAALLCNTMASEY--IAYNTEARWAMSERTGE-
A0A2V9GAQ1      --LGSLTVKRVPNSHLMDVSFESTDPQLAARIVNAHISSY--IEQNFRSKYEATTRAST-
A0A497EDQ8      --------------------MIGRNPDRVAEWLNVYVEQY--IAANIEDGIDKTRKIYK-
G8NS05          --QAIVSVANIPKTDIIRISCSTFNAKLSADIINKLIDAY--IKRSFTSRVSSTQRASG-
A0A2V8KZ20      --KIEITVLT---ANTFKLGFPAADPFSAQAVTKRLTERI--IQLNDSFRKEKVQVADQ-
A0A3D0NWU2      ----------------------------------------------SASQRGEGMNIPD-
A0A2V8EPD9      ------------------------------------------------------------
A0A3N5NSX5      --------RG---SRLFNVSITSSDPQFAARAADALAAEY--VQFNLEYRTDATRKSLD-
A0A2V8MUA1      ------------------MQATNEVAQSDNKIREFYQKHFPGLPEDQAAILQTLNDLGRE
A0A2V8MBH9      ------------------------------------------------------------
A0A3N5ZPQ7      -----------------------MDPAQASRLCSYPCAAFPTPKATEVNRFESSMDNRK-
A0A3N5P5F2      ------------------------------------------IERNLQFKFDASKDAAD-
A0A2V9G1P7      --------NR---SRLVAVRFDSHDPELAARVVNTLAADY--VDQSLEARWQATQKAAE-
A0A2V9BCK9      -------IFN---TRLSVTEFFDCLTADFGISCQSPSKSH--VLLGLNRWLLDRYRAGET
A0A2V9TMX2      --------PS---TRLIQVSYTHSDPRFATEITNALVKTF--IEENFRTKYNSASQTSE-
A0A2V8N2J7      --AIGIKVDS---EHSFQLTYEAGDRYDAMNVTNKLAELF--VQNASAKREQKTSEAAN-
A0A3N6BI26      --------PN---SRLVEIRWVSPDPTLAAAVSDTLAEEF--IEQNLQTKFEANTRATE-
A0A2V9JMM3      --RIRIQVEG---TDAFYIGFEDGDRQAVAEVANRLAELF--VKSTSASQEQNVEEAAG-
A0A2V9M815      --RIRIQVEG---TDAFYIGFEDGDRQAVAEVANRLAELF--VKSTSASQEQNVEEAAG-
A0A2V9A795      ---------R---SRLVTVQFDSNNADLSARVVNTLAEDY--IDQSLEARWAATQKAAD-
A0A355ESH9      ---------N---TQLVRLSFRSSSREFSAKAANAFAESF--IDMGVEDRYASAGKAST-
A0A3D0NW85      --ESRVTVKD---TRLIEVAFRNTDPQLAAFVVNGIGETF--AASNQEQRSGTSRKTSD-
A0A353CAT5      --EPRATFKD---TRLIEISFRHTNPELAAFVVNGLGETF--ASTNQEQRSGTSRKTSD-
A0A2V9HB55      --VP-----N---SRLMDVSFESTDPQLAARVVNAHIASY--IEQNFSSKYEATTRASA-
A0A2V8CU57      -----------------------------------------------MSRLEDALRRAE-
A0A2V8BDI4      --RP-----D---RAIVARSRGRCSAASTAR----DGSCF--SEDTSMSRLEDALRRAE-
A0A2V8F8T3      --RP-----D---RAIVARSRGRCSAASTAR----DGSCF--SEDTSMSRLEDALRRAE-
A0A2V9J901      ------------------------------------------------------------
A0A2V8MKQ7      ------------------------------------------------------------
A0A3M1SNQ5      ------------------------------------------------------------
A0A2V8QJ59      ------------------------------------------------------------
A0A1Q7HTA7      ------------------------------------------------------------
A0A2W0B5E2      ------------------------------------------------------------
A0A2V8NMG8      ------------------------------------------------------------
A0A2V8TBM7      ------------------------------------------------------------
A0A1Q7HEZ8      ------------------------------------------------------------
A0A1Q7JW36      ------------------------------------------------------------
A0A1Q7MUR4      ------------------------------------------------------------
A0A3N5PFU4      ------------------------------------------------------------
A0A4R1LDF1      ------------------------------------------------------------
A0A1F2T1R8      ------------------------------------------------------------
A0A2V9BW09      ------------------------------------------------------------
A0A3M1SSE1      ------------------------------------------------------------
A0A2V9GQV7      ------------------------------------------------------------
A0A2V7YV88      ------------------------------------------------------------
A0A2V8YCY6      ------------------------------------------------------------
A0A2V8EGM3      ------------------------------------------------------------
A0A2V8FGH1      ------------------------------------------------------------
A0A2V8D468      ------------------------------------------------------------
A0A1F2R977      ------------------------------------------------------------
A0A2U3LF12      ------------------------------------------------------------
A0A3N5G7M6      ------------------------------------------------------------
A0A1F2S3Q7      ------------------------------------------------------------
A0A2V8GVG4      ------------------------------------------------------------
A0A2V8PJQ0      ------------------------------------------------------------
A0A2V8H566      ------------------------------------------------------------
A0A2V8UVN4      ------------------------------------------------------------
A0A321LXF5      ------------------------------------------------------------
A0A5M8SBZ0      ------------------------------------------------------------
A0A1Q7JFB1      ------------------------------------------------------------
A0A2V8DMJ9      ------------------------------------------------------------
A0A2V8GGF6      ------------------------------------------------------------
A0A2V8HKU7      ------------------------------------------------------------
A0A1Q6Y875      ------------------------------------------------------------
A0A523DJA9      ------------------------------------------------------------
A0A2V8I604      ------------------------------------------------------------
A0A2V8J066      ------------------------------------------------------------
A0A1I6MMC5      ------------------------------------------------------------
A0A2V9D5W7      ------------------------------------------------------------
A0A2V9D4I4      ------------------------------------------------------------
A0A2V9D6L7      ------------------------------------------------------------
A0A2V8ZJV2      ------------------------------------------------------------
A0A2V9AWB5      ------------------------------------------------------------
A0A2V8Z1Y8      ------------------------------------------------------------
A0A1Q8AX10      ------------------------------------------------------------
A0A2V9A773      ------------------------------------------------------------
A0A2V9AND3      ------------------------------------------------------------
A0A2V9BTJ7      ------------------------------------------------------------
A0A2V8W2M7      ------------------------------------------------------------
A0A2V8XNW2      ------------------------------------------------------------
A0A1Q7CJC1      ------------------------------------------------------------
A0A2V9UEM7      ------------------------------------------------------------
A0A1Q7V300      ------------------------------------------------------------
A0A2V9ZCI3      ------------------------------------------------------------
A0A2V9WCB3      ------------------------------------------------------------
A0A2V9VQW5      ------------------------------------------------------------
A0A2V9WTP3      ------------------------------------------------------------
A0A2V9NLA9      ------------------------------------------------------------
A0A2V9RKJ9      ------------------------------------------------------------
A0A2V9RN95      ------------------------------------------------------------
A0A2V9N406      ------------------------------------------------------------
A0A2V9U6D9      ------------------------------------------------------------
A0A2V8DZN4      ------------------------------------------------------------
A0A3N5YKY1      ------------------------------------------------------------
A0A2G6HQA4      ------------------------------------------------------------
A0A2V7ZTY7      ------------------------------------------------------------
A0A2V7ZVL9      ------------------------------------------------------------
A0A1Q7QYI4      ------------------------------------------------------------
A0A2V8G9Y9      ------------------------------------------------------------
A0A143PNR5      ------------------------------------------------------------
A0A6A7L078      ------------------------------------------------------------
A0A143PXU3      ------------------------------------------------------------
A0A2V8D8G9      ------------------------------------------------------------
A0A2V8ESQ4      ------------------------------------------------------------
A0A1E3Y5Q0      ------------------------------------------------------------
A0A2W4TWK5      ------------------------------------------------------------
A0A3N5NYV3      ------------------------------------------------------------
A0A2V2RJF9      ------------------------------------------------------------
A0A2G6HNT3      ------------------------------------------------------------
A0A2V7YWD4      ------------------------------------------------------------
A0A2V2R8T6      ------------------------------------------------------------
A0A1Q7RGF1      ------------------------------------------------------------
A0A2V9BLX2      ------------------------------------------------------------
A0A2V9ZA03      ------------------------------------------------------------
A0A3N5ZNH4      ------------------------------------------------------------
A0A2V8GEZ2      ------------------------------------------------------------
A0A3N5ZFD3      ------------------------------------------------------------
G8NXD3          ------------------------------------------------------------
A0A2V9VR38      ------------------------------------------------------------
A0A2V9EY04      ------------------------------------------------------------
A0A2V9HAK9      ------------------------------------------------------------
A0A1Q7FS15      ------------------------------------------------------------
A0A1Q7K9P1      ------------------------------------------------------------
A0A1Q7N989      ------------------------------------------------------------
A0A2V9G7Y0      ------------------------------------------------------------
A0A2V8T7Z1      ------------------------------------------------------------
A0A2V7U8G5      ------------------------------------------------------------
A0A2V7UNP9      ------------------------------------------------------------
A0A2V7VLD7      ------------------------------------------------------------
A0A2V7XGA3      ------------------------------------------------------------
A0A2V7YAG6      ------------------------------------------------------------
A0A2V7VK33      ------------------------------------------------------------
A0A3M1VTE1      ------------------------------------------------------------
A0A2V7TTM7      ------------------------------------------------------------
A0A2V8VI82      ------------------------------------------------------------
A0A2V7U4P9      ------------------------------------------------------------
A0A2V7TQY5      ------------------------------------------------------------
A0A2V7TU87      ------------------------------------------------------------
A0A2V8SEH0      ------------------------------------------------------------
A0A2V8VU54      ------------------------------------------------------------
A0A1Q7RML7      ------------------------------------------------------------
A0A1Q7ZIQ5      ------------------------------------------------------------
A0A2V8TKD8      ------------------------------------------------------------
                                                                            

A0A1F2U8T6      LAVIYRYRRMAFSVFILTTIALMIQGYSGVRLYQAKAQLLIEDERSTAMPGI--ATGQYY
A0A2V8BV42      FAILYRYRRIAVSVFILTTAVLMIQGYTNVKVFQARAQLLIEDERSTAVPGLNSSENTYY
A0A2V8F916      FAILYRYRRIAVSVFILTTAVLMIQGYTNVKVFQARAQLLIEDERSTAVPGLNSSENTYY
A0A1Q7K833      LAVLYRYRRIAIAVFVLTTAAMMIQGYTTEKIFRAQARLLIEDERSTAVPGM-SPEN-FY
A0A1Q8AMY4      LAVLYRYRRIAIAVFVLTTAAMMIQGYTTEKIFRAQARLLIEDERSTAVPGM-SPEN-FY
A0A2V8BM40      LAVIYRYRYIATAVFVLATSAIMIQSYTSLELFRAQARLLIEDERSTAVPGV-SADNSYY
A0A2V8CRT6      -----------------------------LELFRAQARLLIEDERSTAVPGV-SADNSYY
A0A1F2VH76      LSVLFKYRRAAMAVFVLVVAWNMVDSYTTIPQYQAQSRVLIDEDTAGLGTPADISQNFTL
A0A1F2R0X5      LVVLYRYRWLCLTVFVLVSGAMIIQGYTTVRMYRAQARLQIDDERSTAIPGLQSDQNTFY
A0A2V8B278      LAVLYRYRRVAIAVFILTTVAMMIQGYSSTQMYRAQARLLIEDERATAVPGITTAENTYY
A0A2V8CEF9      LAVLYRYRRVAIAVFILTTVAMMIQGYSSIQMYRAQARLLIEDERATAVPGITTAENTYY
A0A2V8KZG2      ------------------------------------------------------------
A0A1Q7LG57      ------------------------------------------------------------
A0A2V8YMQ4      ------------------------------------------------------------
A0A1Q7L5B1      ------------------------------------------------------------
A0A2V9DKV4      ------------------------------------------------------------
A0A2V8W380      ------------------------------------------------------------
A0A2V8ZIV5      ------------------------------------------------------------
A0A2V9EVA0      ------------------------------------------------------------
A0A1Q7RB73      ------------------------------------------------------------
A0A2V9K0H7      ------------------------------------------------------------
A0A3N5YN96      ------------------------------------------------------------
A0A1Q7Y646      ------------------------------------------------------------
A0A2V8QZU0      ------------------------------------------------------------
A0A2V8RSQ9      ------------------------------------------------------------
A0A2V9LS17      ------------------------------------------------------------
A0A2V9AGR3      ------------------------------------------------------------
A0A2V9G0N7      ------------------------------------------------------------
A0A2V9GQ44      ------------------------------------------------------------
A0A2V9HRN3      ------------------------------------------------------------
A0A2V8WG13      ------------------------------------------------------------
A0A2V8X987      ------------------------------------------------------------
A0A1Q7KX94      ------------------------------------------------------------
A0A2V8XHT0      ------------------------------------------------------------
A0A2V9L2P7      ------------------------------------------------------------
A0A2V7UMX0      ------------------------------------------------------------
A0A136K497      ------------------------------------------------------------
A0A399W9E4      ------------------------------------------------------------
A0A2V7X0V9      ------------------------------------------------------------
A0A2V9X518      ------------------------------------------------------------
A0A2V9VC62      ------------------------------------------------------------
A0A2V9S1P8      ------------------------------------------------------------
A0A2V9RTW2      ------------------------------------------------------------
A0A2V9TGF1      ------------------------------------------------------------
A0A2V9XEV6      ------------------------------------------------------------
A0A2V9Y3Q6      ------------------------------------------------------------
A0A2V9R269      ------------------------------------------------------------
A0A2V9PTS3      ------------------------------------------------------------
A0A2V9NPF4      ------------------------------------------------------------
A0A2V9PNZ0      ------------------------------------------------------------
A0A321LMC5      ------------------------------------------------------------
A0A2V8X713      ------------------------------------------------------------
A0A2V8ZLE9      ------------------------------------------------------------
A0A2V8Y4D3      ------------------------------------------------------------
A0A2V8Z2X8      ------------------------------------------------------------
A0A2V9C3F6      ------------------------------------------------------------
A0A2V9QMU9      ------------------------------------------------------------
A0A2V9QY75      ------------------------------------------------------------
A0A2V9SVU9      ------------------------------------------------------------
A0A2V8W5N5      ------------------------------------------------------------
A0A2V8XG53      ------------------------------------------------------------
A0A6A7LB89      ------------------------------------------------------------
A0A2V9XV04      ------------------------------------------------------------
A0A2V9CBY1      ------------------------------------------------------------
A0A2V9D656      ------------------------------------------------------------
A0A352EZH8      ------------------------------------------------------------
A0A0B6X033      ------------------------------------------------------------
A0A2V8R0I3      ------------------------------------------------------------
A0A2V8N1U8      ------------------------------------------------------------
A0A2V8QL35      ------------------------------------------------------------
A0A352FU10      ------------------------------------------------------------
A0A2V8LCU0      ------------------------------------------------------------
A0A1Q7NGT0      ------------------------------------------------------------
A0A2V8MLP9      ------------------------------------------------------------
A0A2V8PQZ0      ------------------------------------------------------------
A0A3B9MKY6      ------------------------------------------------------------
A0A3D5SKZ1      ------------------------------------------------------------
A0A2V8NRW2      ------------------------------------------------------------
A0A2V8TKR9      ------------------------------------------------------------
A0A2V8LBV1      ------------------------------------------------------------
A0A2V8GAF9      ------------------------------------------------------------
A0A2V8CN98      --------QDALAQLLAQGPDSLGFSERLAAIGAVQGS----------------------
A0A1Q7LC46      ------------------------------------------------------------
A0A1Q8BDC5      --MLANPVLSEIRELHQKKQSGILVLTGGAGERVEVFFREGMIDAASSNMDARRLGDYLA
A0A2V9Q1Y8      ------------------------------------------------------------
A0A2V8JXG1      ------------------------------------------------------------
A0A350D2W9      ------------------------------------------------------------
A0A2V9I4J1      -------------MEASAVQPLLAESRRQ----------------GVPIGEAALRSKLLE
A0A2V8PQZ9      --NFGQRGTAIPATAMAA------------------------------------------
A0A2V8D8B1      --ISTGPGQSDRTALDTVPAILAN------------------------------------
A0A3B9LSB4      ------------------------------------------------------------
A0A2V9H7U2      ------------------------------------------------------------
A0A2V8NJB5      ---LGDYLVKAGYLTARDIQSVLKSAQRK----------------HALFGEAAVRERHLE
A0A2V9JMZ4      ---LGQHLVTEGFMEASAVQPLLAESRRQ----------------GVPIGEAALRSKLLE
A0A2V9MDJ6      ---LGQHLVTEGFMEASAVQPLLAESRRQ----------------GVPIGEAALRSKLLE
A0A2V8QJT6      APGAAGALAEAGA-----------------------------------------------
A0A2V8FSM8      --WLTKQLDDLKIKLEKQEEGLQAYANATGLIMTSEKN-------NVQEAQLGDLEKELS
A0A359M0J2      --WIAGQLEETKFKLEQAEQKLQDFVRKSGNVFVNSED-------TLANSKLRQLQAELT
A0A2V8JLJ1      ------------------------------------------------------------
A0A5M8SND8      --GLSRRLEEVRAHLKESQKNLQDYAQRS-GLLFGPPVPGTSEETDVSENRLTELQSELS
A0A2V9GAQ1      --WLTDQLTELKIRVQKAEDARIAYERRN-QIWTLDDK----Q--NITSQRLGDINRQLT
A0A497EDQ8      --VIQSRLDPLRLQVEAGQRKLMSFQEGHDSLGFADEQ----K--SVITEQVDLLTKEYA
G8NS05          --WLTSQLDELKHQVETSQNQVIDLQKRI-GVLSIDPT----H--NQISSSLEELTTAAG
A0A2V8KZ20      --FLEEQLEQAGNELSEAERKLLQLRNGAFPGVTTDVVTPDVV--RDLQAQLAKLDAQVE
A0A3D0NWU2      --LYENKIFQDTMRLNNERKAKLQ------------------------------------
A0A2V8EPD9      ---------------------------------------------------MTRLADALL
A0A3N5NSX5      --FLAGEIAKQQTKVEDSERAMAEYRESN-NALSLEDR----Q--NTVVSSLNQVNDEYT
A0A2V8MUA1      RVTVENSIESITTETKLLEQRRQEQQKFK-IAMSSRAPAGPSR--AEGQARQPSRAEQLI
A0A2V8MBH9      ------------------EEKLVSYAKNN-QILSLDAS----Q--NTVVERLAGLNKQLL
A0A3N5ZPQ7      --AILEYMKQIEVQEKTGSLYLVH------------------G--AADHTELTEMKEVIR
A0A3N5P5F2      --WLTNQLDAQRKNVEETELALQRYREQN-NATSTN------D--PEVIQRLSGLNAAVM
A0A2V9G1P7      --WLSQQLVGVKAKLEKSEDALQGYARHN-GLVFLETDKGASQ--NVANERLQQLQEQLT
A0A2V9BCK9      AVLIVDEAQNLSQQLLEEIRLLSNLETST-EKL---------L--QIVLSGQPELEEKLK
A0A2V9TMX2      --WLGKELADLQLKVQTSEEKLVRYQKDH-GILGVDEK----Q--NIVTEKLGELNKELT
A0A2V8N2J7      --VINEQVDDLKNRLQRQNDQIQNY-KTK-AVHALPDH----I--DNTIKAIDSLKEQIQ
A0A3N6BI26      --FLKKQLQDMKGKVEKSEQELVKYAREN-NIVNIGPDR---G--SMVLQTLEDLNRQMT
A0A2V9JMM3      --LLDQELARLRDKLADEDEEIKEYK----------------Q--KVGEELPEHLGTNLK
A0A2V9M815      --LLDQELARLRDKLADEDEEIKEYK----------------Q--KVGEELPEHLGTNLK
A0A2V9A795      --WLSQQLVGVKSKLEKSEEQLQDYARHN-GLVFLETDKGASQ--NVANERLQQLQEELT
A0A355ESH9      --FLGSQIETLKQEVAEKEAQLQAFSRSS-DIVTLDPQ----S--NVTLRRLETLNTALM
A0A3D0NW85      --FLQQRIADLQSDIRRDELKLVELERTE-GILKTPGD----Q--TIVLERLAGLNKDLL
A0A353CAT5      --FLQKRISDLQADIRNDEVRLVELERSE-GILKTPGD----Q--TIVLERLGGLNKDLL
A0A2V9HB55      --WLADQLTELKIKVQRAEDARIAYERQN-QIWTLDDK----Q--NITSQRLSDINKQLT
A0A2V8CU57      ---LANRQAKMKTEAEAA-------VKTP-AVAAWSEP----E--AVTAPFAAAGSEPES
A0A2V8BDI4      ---LANRQAKMKTEAEAA-------VKTP-AVAA--------------------------
A0A2V8F8T3      ---LANRQAKMKTEAEAA-------VKTP-AVAAWSEP----E--AVTAPFAAAWSEPES
A0A2V9J901      ------------------------------------------------------------
A0A2V8MKQ7      ------------------------------------------------------------
A0A3M1SNQ5      ------------------------------------------------------------
A0A2V8QJ59      ------------------------------------------------------------
A0A1Q7HTA7      ------------------------------------------------------------
A0A2W0B5E2      ------------------------------------------------------------
A0A2V8NMG8      ------------------------------------------------------------
A0A2V8TBM7      ------------------------------------------------------------
A0A1Q7HEZ8      ------------------------------------------------------------
A0A1Q7JW36      ------------------------------------------------------------
A0A1Q7MUR4      ------------------------------------------------------------
A0A3N5PFU4      ------------------------------------------------------------
A0A4R1LDF1      ------------------------------------------------------------
A0A1F2T1R8      ------------------------------------------------------------
A0A2V9BW09      ------------------------------------------------------------
A0A3M1SSE1      ------------------------------------------------------------
A0A2V9GQV7      ------------------------------------------------------------
A0A2V7YV88      ------------------------------------------------------------
A0A2V8YCY6      ------------------------------------------------------------
A0A2V8EGM3      ------------------------------------------------------------
A0A2V8FGH1      ------------------------------------------------------------
A0A2V8D468      ------------------------------------------------------------
A0A1F2R977      ------------------------------------------------------------
A0A2U3LF12      ------------------------------------------------------------
A0A3N5G7M6      ------------------------------------------------------------
A0A1F2S3Q7      ------------------------------------------------------------
A0A2V8GVG4      ------------------------------------------------------------
A0A2V8PJQ0      ------------------------------------------------------------
A0A2V8H566      ------------------------------------------------------------
A0A2V8UVN4      ------------------------------------------------------------
A0A321LXF5      ------------------------------------------------------------
A0A5M8SBZ0      ------------------------------------------------------------
A0A1Q7JFB1      ------------------------------------------------------------
A0A2V8DMJ9      ------------------------------------------------------------
A0A2V8GGF6      ------------------------------------------------------------
A0A2V8HKU7      ------------------------------------------------------------
A0A1Q6Y875      ------------------------------------------------------------
A0A523DJA9      ------------------------------------------------------------
A0A2V8I604      ------------------------------------------------------------
A0A2V8J066      ------------------------------------------------------------
A0A1I6MMC5      ------------------------------------------------------------
A0A2V9D5W7      ------------------------------------------------------------
A0A2V9D4I4      ------------------------------------------------------------
A0A2V9D6L7      ------------------------------------------------------------
A0A2V8ZJV2      ------------------------------------------------------------
A0A2V9AWB5      ------------------------------------------------------------
A0A2V8Z1Y8      ------------------------------------------------------------
A0A1Q8AX10      ------------------------------------------------------------
A0A2V9A773      ------------------------------------------------------------
A0A2V9AND3      ------------------------------------------------------------
A0A2V9BTJ7      ------------------------------------------------------------
A0A2V8W2M7      ------------------------------------------------------------
A0A2V8XNW2      ------------------------------------------------------------
A0A1Q7CJC1      ------------------------------------------------------------
A0A2V9UEM7      ------------------------------------------------------------
A0A1Q7V300      ------------------------------------------------------------
A0A2V9ZCI3      ------------------------------------------------------------
A0A2V9WCB3      ------------------------------------------------------------
A0A2V9VQW5      ------------------------------------------------------------
A0A2V9WTP3      ------------------------------------------------------------
A0A2V9NLA9      ------------------------------------------------------------
A0A2V9RKJ9      ------------------------------------------------------------
A0A2V9RN95      ------------------------------------------------------------
A0A2V9N406      ------------------------------------------------------------
A0A2V9U6D9      ------------------------------------------------------------
A0A2V8DZN4      ------------------------------------------------------------
A0A3N5YKY1      ------------------------------------------------------------
A0A2G6HQA4      ------------------------------------------------------------
A0A2V7ZTY7      ------------------------------------------------------------
A0A2V7ZVL9      ------------------------------------------------------------
A0A1Q7QYI4      ------------------------------------------------------------
A0A2V8G9Y9      ------------------------------------------------------------
A0A143PNR5      ------------------------------------------------------------
A0A6A7L078      ------------------------------------------------------------
A0A143PXU3      ------------------------------------------------------------
A0A2V8D8G9      ------------------------------------------------------------
A0A2V8ESQ4      ------------------------------------------------------------
A0A1E3Y5Q0      ------------------------------------------------------------
A0A2W4TWK5      ------------------------------------------------------------
A0A3N5NYV3      ------------------------------------------------------------
A0A2V2RJF9      ------------------------------------------------------------
A0A2G6HNT3      ------------------------------------------------------------
A0A2V7YWD4      ------------------------------------------------------------
A0A2V2R8T6      ------------------------------------------------------------
A0A1Q7RGF1      ------------------------------------------------------------
A0A2V9BLX2      ------------------------------------------------------------
A0A2V9ZA03      ------------------------------------------------------------
A0A3N5ZNH4      ------------------------------------------------------------
A0A2V8GEZ2      ------------------------------------------------------------
A0A3N5ZFD3      ------------------------------------------------------------
G8NXD3          ------------------------------------------------------------
A0A2V9VR38      ------------------------------------------------------------
A0A2V9EY04      ------------------------------------------------------------
A0A2V9HAK9      ------------------------------------------------------------
A0A1Q7FS15      ------------------------------------------------------------
A0A1Q7K9P1      ------------------------------------------------------------
A0A1Q7N989      ------------------------------------------------------------
A0A2V9G7Y0      ------------------------------------------------------------
A0A2V8T7Z1      ------------------------------------------------------------
A0A2V7U8G5      ------------------------------------------------------------
A0A2V7UNP9      ------------------------------------------------------------
A0A2V7VLD7      ------------------------------------------------------------
A0A2V7XGA3      ------------------------------------------------------------
A0A2V7YAG6      ------------------------------------------------------------
A0A2V7VK33      ------------------------------------------------------------
A0A3M1VTE1      ------------------------------------------------------------
A0A2V7TTM7      ------------------------------------------------------------
A0A2V8VI82      ------------------------------------------------------------
A0A2V7U4P9      ------------------------------------------------------------
A0A2V7TQY5      ------------------------------------------------------------
A0A2V7TU87      ------------------------------------------------------------
A0A2V8SEH0      ------------------------------------------------------------
A0A2V8VU54      ------------------------------------------------------------
A0A1Q7RML7      ------------------------------------------------------------
A0A1Q7ZIQ5      ------------------------------------------------------------
A0A2V8TKD8      ------------------------------------------------------------
                                                                            

A0A1F2U8T6      EDPVPYYNTQHRILRSRELARRVVRRLQLGTHPEFNGTATPPVTLVTAVRAAAA------
A0A2V8BV42      EDPEPYYNTQFRILKGRDLVRRVVRRLKLGTIPEFNGTAVPPPTPVSMINDFQT------
A0A2V8F916      EDPEPYYNTQFRILKGRDLVRRVVRRLKLGTIPEFNGTAVPPPTPVSMINDFQT------
A0A1Q7K833      QDPDLYYKTQYRILKGRDLTRRVVRRLNLGSVPEFNGTAEPPSTPSTMLRDFQQ------
A0A1Q8AMY4      QDPDLYYKTQYRILKGRDLTRRVVRRLNLGSVPEFNGTAEPPSTPSTMLRDFQQ------
A0A2V8BM40      EDPDLYYKTQYRILKGRDLTRRVVRKLNMAAIPEFNGTAEPPVTPLTIAHDLEK------
A0A2V8CRT6      EDPDLYYKTQYRILKGRDLTRRVVRKLNVAAIPEFNGTAEPPVTPLTIAHDLEK------
A0A1F2VH76      QDPEVYLQTQLRIIRGRELARRTAKKLELHTVPEFNGQGAKPTALAEAISTVKTYAYWPV
A0A1F2R0X5      EDPEPYYQTQYRILRGRDLTRRVVQRLRLDTVPEFNGTAERAPTPISMLRDFER------
A0A2V8B278      EDPDLYYKTQYRILKGRDLARRVVKRVNLGAVPEFNGTAEKPSTPATLLHDLKQ------
A0A2V8CEF9      EDPDLYYKTQYRILKGRDLARRVVKRVNLGAVPEFNGTAQKPSTPATLLHDLKQ------
A0A2V8KZG2      ------------------------------------------------------------
A0A1Q7LG57      ------------------------------------------------------------
A0A2V8YMQ4      ------------------------------------------------------------
A0A1Q7L5B1      ------------------------------------------------------------
A0A2V9DKV4      ------------------------------------------------------------
A0A2V8W380      ------------------------------------------------------------
A0A2V8ZIV5      ------------------------------------------------------------
A0A2V9EVA0      ------------------------------------------------------------
A0A1Q7RB73      ------------------------------------------------------------
A0A2V9K0H7      ------------------------------------------------------------
A0A3N5YN96      ------------------------------------------------------------
A0A1Q7Y646      ------------------------------------------------------------
A0A2V8QZU0      ------------------------------------------------------------
A0A2V8RSQ9      ------------------------------------------------------------
A0A2V9LS17      ------------------------------------------------------------
A0A2V9AGR3      ------------------------------------------------------------
A0A2V9G0N7      ------------------------------------------------------------
A0A2V9GQ44      ------------------------------------------------------------
A0A2V9HRN3      ------------------------------------------------------------
A0A2V8WG13      ------------------------------------------------------------
A0A2V8X987      ------------------------------------------------------------
A0A1Q7KX94      ------------------------------------------------------------
A0A2V8XHT0      ------------------------------------------------------------
A0A2V9L2P7      ------------------------------------------------------------
A0A2V7UMX0      ------------------------------------------------------------
A0A136K497      ------------------------------------------------------------
A0A399W9E4      ------------------------------------------------------------
A0A2V7X0V9      ------------------------------------------------------------
A0A2V9X518      ------------------------------------------------------------
A0A2V9VC62      ------------------------------------------------------------
A0A2V9S1P8      ------------------------------------------------------------
A0A2V9RTW2      ------------------------------------------------------------
A0A2V9TGF1      ------------------------------------------------------------
A0A2V9XEV6      ------------------------------------------------------------
A0A2V9Y3Q6      ------------------------------------------------------------
A0A2V9R269      ------------------------------------------------------------
A0A2V9PTS3      ------------------------------------------------------------
A0A2V9NPF4      ------------------------------------------------------------
A0A2V9PNZ0      ------------------------------------------------------------
A0A321LMC5      ------------------------------------------------------------
A0A2V8X713      ------------------------------------------------------------
A0A2V8ZLE9      ------------------------------------------------------------
A0A2V8Y4D3      ------------------------------------------------------------
A0A2V8Z2X8      ------------------------------------------------------------
A0A2V9C3F6      ------------------------------------------------------------
A0A2V9QMU9      ------------------------------------------------------------
A0A2V9QY75      ------------------------------------------------------------
A0A2V9SVU9      ------------------------------------------------------------
A0A2V8W5N5      ------------------------------------------------------------
A0A2V8XG53      ------------------------------------------------------------
A0A6A7LB89      ------------------------------------------------------------
A0A2V9XV04      ------------------------------------------------------------
A0A2V9CBY1      ------------------------------------------------------------
A0A2V9D656      ------------------------------------------------------------
A0A352EZH8      ------------------------------------------------------------
A0A0B6X033      ------------------------------------------------------------
A0A2V8R0I3      ------------------------------------------------------------
A0A2V8N1U8      ------------------------------------------------------------
A0A2V8QL35      ------------------------------------------------------------
A0A352FU10      ------------------------------------------------------------
A0A2V8LCU0      ------------------------------------------------------------
A0A1Q7NGT0      ------------------------------------------------------------
A0A2V8MLP9      ------------------------------------------------------------
A0A2V8PQZ0      ------------------------------------------------------------
A0A3B9MKY6      ------------------------------------------------------------
A0A3D5SKZ1      ------------------------------------------------------------
A0A2V8NRW2      ------------------------------------------------------------
A0A2V8TKR9      ------------------------------------------------------------
A0A2V8LBV1      ------------------------------------------------------------
A0A2V8GAF9      ------------------------------------------------------------
A0A2V8CN98      ------------------------------------------------------------
A0A1Q7LC46      -------------------------------------------------------MKKES
A0A1Q8BDC5      KQEYLHA-----------------------------------------------------
A0A2V9Q1Y8      ------------------------------------------------------------
A0A2V8JXG1      ------------------------------------------------------------
A0A350D2W9      ------------------------------------------------------------
A0A2V9I4J1      PAELADVIRR--------------------------------------------------
A0A2V8PQZ9      ------------------------------------------------------------
A0A2V8D8B1      ------------------------------------------------------------
A0A3B9LSB4      ------------------------------------------------------------
A0A2V9H7U2      ------------------------------------------------------------
A0A2V8NJB5      PVELAEV-----------------------------------------------------
A0A2V9JMZ4      PAELADVIRR--------------------------------------------------
A0A2V9MDJ6      PAELADVIRR--------------------------------------------------
A0A2V8QJT6      ------------------------------------------------------------
A0A2V8FSM8      VARADRI-------------------------------------------------AKQS
A0A359M0J2      AAQTDRI-------------------------------------------------NKEN
A0A2V8JLJ1      ------------------------------------------------------------
A0A5M8SND8      GAEAARM-------------------------------------------------AAES
A0A2V9GAQ1      DAQSERM-------------------------------------------------KKES
A0A497EDQ8      QAKAERI-------------------------------------------------DVET
G8NS05          TAQIARILAESRYRVLSG------------------------------------------
A0A2V8KZ20      SANDQRKVLQRRLEEHRQ--------------------------------------LKIA
A0A3D0NWU2      ------------------------------------------------------------
A0A2V8EPD9      RANRQNQ-----------------------------------------------------
A0A3N5NSX5      RIRTVRI-------------------------------------------------QKEA
A0A2V8MUA1      AAKRDQLAAERLKHTDDW------------------------------------------
A0A2V8MBH9      EAENDRKMAEAEYNAAKAPGAATALAEGA-------------------------------
A0A3N5ZPQ7      V-----------------------------------------------------------
A0A3N5P5F2      EARTARL-------------------------------------------------EKEA
A0A2V9G1P7      KAQSERY-------------------------------------------------EKEA
A0A2V9BCK9      HAQLRQF--------------------------------------------------RQR
A0A2V9TMX2      EAETDRI-------------------------------------------------QKEA
A0A2V8N2J7      DRETKIAEEQAKRASIER--------------------------------------ELQD
A0A3N6BI26      TVEGELI-------------------------------------------------GKTA
A0A2V9JMM3      LVEALEMRLQAKRDSIGENQARR-------------------------AQVLEEMKGLQK
A0A2V9M815      LVEALEMRLQAKRDSIGENQARR-------------------------AQVLEEMKGLQK
A0A2V9A795      KAEAERY-------------------------------------------------EKEA
A0A355ESH9      DAKKERI-------------------------------------------------EKEA
A0A3D0NW85      TAENERKTAEAQFLSVRNN-----------------------------PERVSALAEAES
A0A353CAT5      TAENDRKTAEAEYNSVKGS-----------------------------PERLKSLAEAES
A0A2V9HB55      DAQSERM-------------------------------------------------KKES
A0A2V8CU57      AAAPPVVAAWSEPETVTAPLAA--------------------------------------
A0A2V8BDI4      ------------------------------------------------------------
A0A2V8F8T3      AAPLPAVAAWSEPETVTAPLAAAAWSEPESAAVLPAVAAWSEPETVTAPLAAAAWSEPES
A0A2V9J901      ------------------------------------------------------------
A0A2V8MKQ7      ------------------------------------------------------------
A0A3M1SNQ5      ------------------------------------------------------------
A0A2V8QJ59      ------------------------------------------------------------
A0A1Q7HTA7      ------------------------------------------------------------
A0A2W0B5E2      ------------------------------------------------------------
A0A2V8NMG8      ------------------------------------------------------------
A0A2V8TBM7      ------------------------------------------------------------
A0A1Q7HEZ8      ------------------------------------------------------------
A0A1Q7JW36      ------------------------------------------------------------
A0A1Q7MUR4      ------------------------------------------------------------
A0A3N5PFU4      ------------------------------------------------------------
A0A4R1LDF1      ------------------------------------------------------------
A0A1F2T1R8      ------------------------------------------------------------
A0A2V9BW09      ------------------------------------------------------------
A0A3M1SSE1      ------------------------------------------------------------
A0A2V9GQV7      ------------------------------------------------------------
A0A2V7YV88      ------------------------------------------------------------
A0A2V8YCY6      ------------------------------------------------------------
A0A2V8EGM3      ------------------------------------------------------------
A0A2V8FGH1      ------------------------------------------------------------
A0A2V8D468      ------------------------------------------------------------
A0A1F2R977      ------------------------------------------------------------
A0A2U3LF12      ------------------------------------------------------------
A0A3N5G7M6      ------------------------------------------------------------
A0A1F2S3Q7      ------------------------------------------------------------
A0A2V8GVG4      ------------------------------------------------------------
A0A2V8PJQ0      ------------------------------------------------------------
A0A2V8H566      ------------------------------------------------------------
A0A2V8UVN4      ------------------------------------------------------------
A0A321LXF5      ------------------------------------------------------------
A0A5M8SBZ0      ------------------------------------------------------------
A0A1Q7JFB1      ------------------------------------------------------------
A0A2V8DMJ9      ------------------------------------------------------------
A0A2V8GGF6      ------------------------------------------------------------
A0A2V8HKU7      ------------------------------------------------------------
A0A1Q6Y875      ------------------------------------------------------------
A0A523DJA9      ------------------------------------------------------------
A0A2V8I604      ------------------------------------------------------------
A0A2V8J066      ------------------------------------------------------------
A0A1I6MMC5      ------------------------------------------------------------
A0A2V9D5W7      ------------------------------------------------------------
A0A2V9D4I4      ------------------------------------------------------------
A0A2V9D6L7      ------------------------------------------------------------
A0A2V8ZJV2      ------------------------------------------------------------
A0A2V9AWB5      ------------------------------------------------------------
A0A2V8Z1Y8      ------------------------------------------------------------
A0A1Q8AX10      ------------------------------------------------------------
A0A2V9A773      ------------------------------------------------------------
A0A2V9AND3      ------------------------------------------------------------
A0A2V9BTJ7      ------------------------------------------------------------
A0A2V8W2M7      ------------------------------------------------------------
A0A2V8XNW2      ------------------------------------------------------------
A0A1Q7CJC1      ------------------------------------------------------------
A0A2V9UEM7      ------------------------------------------------------------
A0A1Q7V300      ------------------------------------------------------------
A0A2V9ZCI3      ------------------------------------------------------------
A0A2V9WCB3      ------------------------------------------------------------
A0A2V9VQW5      ------------------------------------------------------------
A0A2V9WTP3      ------------------------------------------------------------
A0A2V9NLA9      ------------------------------------------------------------
A0A2V9RKJ9      ------------------------------------------------------------
A0A2V9RN95      ------------------------------------------------------------
A0A2V9N406      ------------------------------------------------------------
A0A2V9U6D9      ------------------------------------------------------------
A0A2V8DZN4      ------------------------------------------------------------
A0A3N5YKY1      ------------------------------------------------------------
A0A2G6HQA4      ------------------------------------------------------------
A0A2V7ZTY7      ------------------------------------------------------------
A0A2V7ZVL9      ------------------------------------------------------------
A0A1Q7QYI4      ------------------------------------------------------------
A0A2V8G9Y9      ------------------------------------------------------------
A0A143PNR5      ------------------------------------------------------------
A0A6A7L078      ------------------------------------------------------------
A0A143PXU3      ------------------------------------------------------------
A0A2V8D8G9      ------------------------------------------------------------
A0A2V8ESQ4      ------------------------------------------------------------
A0A1E3Y5Q0      ------------------------------------------------------------
A0A2W4TWK5      ------------------------------------------------------------
A0A3N5NYV3      ------------------------------------------------------------
A0A2V2RJF9      ------------------------------------------------------------
A0A2G6HNT3      ------------------------------------------------------------
A0A2V7YWD4      ------------------------------------------------------------
A0A2V2R8T6      ------------------------------------------------------------
A0A1Q7RGF1      ------------------------------------------------------------
A0A2V9BLX2      ------------------------------------------------------------
A0A2V9ZA03      ------------------------------------------------------------
A0A3N5ZNH4      ------------------------------------------------------------
A0A2V8GEZ2      ------------------------------------------------------------
A0A3N5ZFD3      ------------------------------------------------------------
G8NXD3          ------------------------------------------------------------
A0A2V9VR38      ------------------------------------------------------------
A0A2V9EY04      ------------------------------------------------------------
A0A2V9HAK9      ------------------------------------------------------------
A0A1Q7FS15      ------------------------------------------------------------
A0A1Q7K9P1      ------------------------------------------------------------
A0A1Q7N989      ------------------------------------------------------------
A0A2V9G7Y0      ------------------------------------------------------------
A0A2V8T7Z1      ------------------------------------------------------------
A0A2V7U8G5      ------------------------------------------------------------
A0A2V7UNP9      ------------------------------------------------------------
A0A2V7VLD7      ------------------------------------------------------------
A0A2V7XGA3      ------------------------------------------------------------
A0A2V7YAG6      ------------------------------------------------------------
A0A2V7VK33      ------------------------------------------------------------
A0A3M1VTE1      ------------------------------------------------------------
A0A2V7TTM7      ------------------------------------------------------------
A0A2V8VI82      ------------------------------------------------------------
A0A2V7U4P9      ------------------------------------------------------------
A0A2V7TQY5      ------------------------------------------------------------
A0A2V7TU87      ------------------------------------------------------------
A0A2V8SEH0      ------------------------------------------------------------
A0A2V8VU54      ------------------------------------------------------------
A0A1Q7RML7      ------------------------------------------------------------
A0A1Q7ZIQ5      ------------------------------------------------------------
A0A2V8TKD8      ------------------------------------------------------------
                                                                            

A0A1F2U8T6      RALRGLTLLSAAVEEEAPTPDETPAEAALVGNFLSRVVVTPVPDSKLVDVFFTAADPAVT
A0A2V8BV42      RLMGLLRKPAAPAPQEAPKVDETPDESALVSSFIGRVTVEPIRTSRLVDVTFMSADPNFA
A0A2V8F916      RLMGLLRKPAAPAPQEAPKVDETPDESALVSSFIGRVTVEPIRTSRLVDVTFMSADPNFA
A0A1Q7K833      RVVHLIKPSALAETQEVPKVDETPDESSMVNAFIGRVNVEPVTGSKLVDVTFDSMDPKFA
A0A1Q8AMY4      RVVHLIKPSALAETQEVPKVDETPDESSMVNAFIGRVNVEPVTGSKLVDVTFDSMDPKFA
A0A2V8BM40      RIVAFVRPAA-SEATDTRKIDEAPSESGLVNAFIGQVTVEPVPGSKLVDVLFDSRDPKFA
A0A2V8CRT6      RIVAFVRPAA-SEATDTRKIDEAPSESGLVDAFIGQVTVEPVPGSKLVDVLFDSRDPKFA
A0A1F2VH76      RIVLGSTPAPSPVATA-----ESGDPEAYADALIGHLGVNQIRGSRLVDLLFTAADPAFA
A0A1F2R0X5      RLVSLVRRAPAQPQEEPPKLDETTDESALVGAFIGRVGVEPVRGSRLVDVTFLSVEPKFA
A0A2V8B278      KIVGLVRPAPAPENTESPKVDETADESALVSAFLSRVDVAPVSGSKLVDVTFDSMDRRFA
A0A2V8CEF9      KIVGLVRPAPAPENTESPKVDETADESALVSAFLSRVDVAPVSGSKLVDVTFDSMDPRFA
A0A2V8KZG2      ------------------------------------------------------------
A0A1Q7LG57      ------------------------------------------------------------
A0A2V8YMQ4      ------------------------------------------------------------
A0A1Q7L5B1      ------------------------------------------------------------
A0A2V9DKV4      ------------------------------------------------------------
A0A2V8W380      ------------------------------------------------------------
A0A2V8ZIV5      ------------------------------------------------------------
A0A2V9EVA0      ------------------------------------------------------------
A0A1Q7RB73      ------------------------------------------------------------
A0A2V9K0H7      ------------------------------------------------------------
A0A3N5YN96      ------------------------------------------------------------
A0A1Q7Y646      ------------------------------------------------------------
A0A2V8QZU0      ------------------------------------------------------------
A0A2V8RSQ9      ------------------------------------------------------------
A0A2V9LS17      ------------------------------------------------------------
A0A2V9AGR3      ------------------------------------------------------------
A0A2V9G0N7      ------------------------------------------------------------
A0A2V9GQ44      ------------------------------------------------------------
A0A2V9HRN3      ------------------------------------------------------------
A0A2V8WG13      ------------------------------------------------------------
A0A2V8X987      ------------------------------------------------------------
A0A1Q7KX94      ------------------------------------------------------------
A0A2V8XHT0      ------------------------------------------------------------
A0A2V9L2P7      ------------------------------------------------------------
A0A2V7UMX0      ------------------------------------------------------------
A0A136K497      ------------------------------------------------------------
A0A399W9E4      ------------------------------------------------------------
A0A2V7X0V9      ------------------------------------------------------------
A0A2V9X518      ------------------------------------------------------------
A0A2V9VC62      ------------------------------------------------------------
A0A2V9S1P8      ------------------------------------------------------------
A0A2V9RTW2      ------------------------------------------------------------
A0A2V9TGF1      ------------------------------------------------------------
A0A2V9XEV6      ------------------------------------------------------------
A0A2V9Y3Q6      ------------------------------------------------------------
A0A2V9R269      ------------------------------------------------------------
A0A2V9PTS3      ------------------------------------------------------------
A0A2V9NPF4      ------------------------------------------------------------
A0A2V9PNZ0      ------------------------------------------------------------
A0A321LMC5      ------------------------------------------------------------
A0A2V8X713      ------------------------------------------------------------
A0A2V8ZLE9      ------------------------------------------------------------
A0A2V8Y4D3      ------------------------------------------------------------
A0A2V8Z2X8      ------------------------------------------------------------
A0A2V9C3F6      ------------------------------------------------------------
A0A2V9QMU9      ------------------------------------------------------------
A0A2V9QY75      ------------------------------------------------------------
A0A2V9SVU9      ------------------------------------------------------------
A0A2V8W5N5      ------------------------------------------------------------
A0A2V8XG53      ------------------------------------------------------------
A0A6A7LB89      ------------------------------------------------------------
A0A2V9XV04      ------------------------------------------------------------
A0A2V9CBY1      ------------------------------------------------------------
A0A2V9D656      ------------------------------------------------------------
A0A352EZH8      ------------------------------------------------------------
A0A0B6X033      ------------------------------------------------------------
A0A2V8R0I3      ------------------------------------------------------------
A0A2V8N1U8      ------------------------------------------------------------
A0A2V8QL35      ------------------------------------------------------------
A0A352FU10      ------------------------------------------------------------
A0A2V8LCU0      ------------------------------------------------------------
A0A1Q7NGT0      ------------------------------------------------------------
A0A2V8MLP9      ------------------------------------------------------------
A0A2V8PQZ0      ------------------------------------------------------------
A0A3B9MKY6      ------------------------------------------------------------
A0A3D5SKZ1      ------------------------------------------------------------
A0A2V8NRW2      ------------------------------------------------------------
A0A2V8TKR9      ------------------------------------------------------------
A0A2V8LBV1      ------------------------------------------------------------
A0A2V8GAF9      ------------------------------------------------------------
A0A2V8CN98      ------------------------ADLTRALSELTTKRADRRA--LLYRYTDDHPAVRRV
A0A1Q7LC46      LYEFAKAGDLDAVPQVQSN-----AALTDLLKKQRDSSAEYTD--ALAQYGPNFPKVQRL
A0A1Q8BDC5      ------------------------RDLDAAHSEAQRHQILIGEAVVRKRLLGQAEVIVAV
A0A2V9Q1Y8      ------------------------------------------------------------
A0A2V8JXG1      --------------------------------------------------------MAAI
A0A350D2W9      --------------------------------------------------------MQRL
A0A2V9I4J1      ------------------------QAFQLLRHALEKQFSVQSF--QVSATGFSVPAQIHF
A0A2V8PQZ9      ------------------------TATFQPTRTLSARASLNLRSSSTSTRAHSLQPPLRN
A0A2V8D8B1      ------------------------QFVQQQKSELAELQRQQAQ--LSDKLGDKHPDMVKN
A0A3B9LSB4      ----------------------------------------------MVDATEEAPEVKEV
A0A2V9H7U2      ------------------------------------LKTQNVD--ALEQYGPKHPKVERL
A0A2V8NJB5      ---------------------------------------------VRRQSLELLQHVLTN
A0A2V9JMZ4      ------------------------QAFQLLRHALEKQFSVQSF--QVSATGFSVPAQIHF
A0A2V9MDJ6      ------------------------QAFQLLRHALEKQFSVQSF--QVSATGFSVPAQIHF
A0A2V8QJT6      ------------------------KEIEVTDSELAKLRQKRAQ--LLIEATEEAPEVKEI
A0A2V8FSM8      KYEMSSSSPPAALPEILDD-----PSQRTSQTTLYDLRAKLAL--LRVTYTTSYAEVRKV
A0A359M0J2      RLNVAKGKPVETLPGEIA------GGLSTQQGALDSLKRQRAD--LLTTLMPGHYKVQRI
A0A2V8JLJ1      ------------------------ATATAEAAKAASIQVQAAK--EPKPEEKPRPFLPEF
A0A5M8SND8      RLKTAESSGAESVAEVVND-----DSLRDLQAKITELQRQKAD--LLTIYTPEHEKVQRV
A0A2V9GAQ1      LYQFAKSGNLDAIPQVQSN-----LALTELLKKRGEVSSDYTD--ALNQYGPNFPKVQRL
A0A497EDQ8      KLNALNQLRARHVSEVAFPEVLEDATISNLMQRRGEVEVELLD--KLGTYKEGHPAIKEL
G8NS05          -----MDPNSLDQTVANTTNNVAATQLATLRSQRETDMANYAKLTAPGNLGPNHPQVKAA
A0A2V8KZ20      LNASSPPPPPAAHTESTTAAAIETPPPSPLETELANRQAQLAA--ASVRYTPRHPEVVRL
A0A3D0NWU2      ------------------------DDIRNIDKQIQQAETEKSE--LLVRYTPEYPEVKKM
A0A2V8EPD9      ------------------------LAASAAATALATPESEPAQDAAAPSVAPVGPVARAA
A0A3N5NSX5      LYNQIKSLPPSSVGDAPAVGAS--PAVQSLRTRLAELQRQKVQ--LNERYGPKNPQVIEN
A0A2V8MUA1      ------------------------PDIRALKRDIKQLEEQVATDRAAETSAEKNAEETTE
A0A2V8MBH9      ------------------------KDINESESKLADLKQKRAQ--LLVDATEEAPEVKEV
A0A3N5ZPQ7      ------------------------YFHGGLVSAMSSSLPEYRL--GQYCLKEGIIDPPDL
A0A3N5P5F2      ALTQLRAIQHDKAALASAPAVVANASVQRLNQELADLQRQDAQ--LSRQYGERHPEMIKV
A0A2V9G1P7      LYRLVQTGESGALPGVFEN-----KLIQDLSERLAELKREHAQ--LSTTFNPDYPRVKEI
A0A2V9BCK9      ITVRARTGPLSLQET---------HGYIAERLRIAGANGEPIF--APGAVESVYNYARGI
A0A2V9TMX2      DYKLAVNGDPEMFMKTSPDGRGGSGLLDKLREKEADLETQYAM--ATTQFGSGYPRVTEL
A0A2V8N2J7      LESKGVLEQPMVHEKTPDE-----AKLDELRIQLAELQTRYTA--QHPVVVAKKREISDL
A0A3N6BI26      DYQAVRDATPESFPQSLRT-----PSISLLEERLFGLQQNLAS--LSAQFGSEWPAVIQV
A0A2V9JMM3      EPAQEIQRELPVEEPTAEQ-----KALDEKRLKLKELEAKYTE--QYPEIPRLRKEIADL
A0A2V9M815      EPAQEIQRELPVEEPTAEQ-----KALDEKRLKLKELEAKYTE--QYPEIPRLRKEIADL
A0A2V9A795      LYRLVQSGDYGSLPGVVEN-----KLIQDLSERLAELKRELAQ--LSTKFNAGYPRVKEI
A0A355ESH9      HYHEVMTGPLDAVADSLAP-----GVISGLRTQQLQMEQDYET--KLKTFKPEWPEMVSL
A0A3D0NW85      ARYITERENFLLNYRNETQ-----KTIAGLTANRAKLLEEFLP--TAPEVKEIDSQIKSL
A0A353CAT5      ARYITERENFILNNRTETD-----KAIAGLAATRAKLLEEYKE--SAPEIKEIDSQIASL
A0A2V9HB55      LYQFAKSGNLDAVPQIQSN-----LALTELLKKRSEVSSDYTD--ALNQYGPNFPKVQRL
A0A2V8CU57      -------AAWSEPETVTAP-----FAVAGWSEPESAAAPPVVA--AWSE-----PETVTA
A0A2V8BDI4      -----------------------------WSEPESAAALPAVA--AWSE-----PETVTA
A0A2V8F8T3      TAVLPAVAAWSEPETVTAP-----FAVAGWSEPESAAAPPVVA--AWSE-----PETVTA
A0A2V9J901      ------------------------------------------------------------
A0A2V8MKQ7      ------------------------------------------------------------
A0A3M1SNQ5      ------------------------------------------------------------
A0A2V8QJ59      ------------------------------------------------------------
A0A1Q7HTA7      ------------------------------------------------------------
A0A2W0B5E2      ------------------------------------------------------------
A0A2V8NMG8      ------------------------------------------------------------
A0A2V8TBM7      ------------------------------------------------------------
A0A1Q7HEZ8      ------------------------------------------------------------
A0A1Q7JW36      ------------------------------------------------------------
A0A1Q7MUR4      ------------------------------------------------------------
A0A3N5PFU4      ------------------------------------------------------------
A0A4R1LDF1      ------------------------------------------------------------
A0A1F2T1R8      ------------------------------------------------------------
A0A2V9BW09      ------------------------------------------------------------
A0A3M1SSE1      ------------------------------------------------------------
A0A2V9GQV7      ------------------------------------------------------------
A0A2V7YV88      ------------------------------------------------------------
A0A2V8YCY6      ------------------------------------------------------------
A0A2V8EGM3      ------------------------------------------------------------
A0A2V8FGH1      ------------------------------------------------------------
A0A2V8D468      ------------------------------------------------------------
A0A1F2R977      ------------------------------------------------------------
A0A2U3LF12      ------------------------------------------------------------
A0A3N5G7M6      ------------------------------------------------------------
A0A1F2S3Q7      ------------------------------------------------------------
A0A2V8GVG4      ------------------------------------------------------------
A0A2V8PJQ0      ------------------------------------------------------------
A0A2V8H566      ------------------------------------------------------------
A0A2V8UVN4      ------------------------------------------------------------
A0A321LXF5      ------------------------------------------------------------
A0A5M8SBZ0      ------------------------------------------------------------
A0A1Q7JFB1      ------------------------------------------------------------
A0A2V8DMJ9      ------------------------------------------------------------
A0A2V8GGF6      ------------------------------------------------------------
A0A2V8HKU7      ------------------------------------------------------------
A0A1Q6Y875      ------------------------------------------------------------
A0A523DJA9      ------------------------------------------------------------
A0A2V8I604      ------------------------------------------------------------
A0A2V8J066      ------------------------------------------------------------
A0A1I6MMC5      ------------------------------------------------------------
A0A2V9D5W7      ------------------------------------------------------------
A0A2V9D4I4      ------------------------------------------------------------
A0A2V9D6L7      ------------------------------------------------------------
A0A2V8ZJV2      ------------------------------------------------------------
A0A2V9AWB5      ------------------------------------------------------------
A0A2V8Z1Y8      ------------------------------------------------------------
A0A1Q8AX10      ------------------------------------------------------------
A0A2V9A773      ------------------------------------------------------------
A0A2V9AND3      ------------------------------------------------------------
A0A2V9BTJ7      ------------------------------------------------------------
A0A2V8W2M7      ------------------------------------------------------------
A0A2V8XNW2      ------------------------------------------------------------
A0A1Q7CJC1      ------------------------------------------------------------
A0A2V9UEM7      ------------------------------------------------------------
A0A1Q7V300      ------------------------------------------------------------
A0A2V9ZCI3      ------------------------------------------------------------
A0A2V9WCB3      ------------------------------------------------------------
A0A2V9VQW5      ------------------------------------------------------------
A0A2V9WTP3      ------------------------------------------------------------
A0A2V9NLA9      ------------------------------------------------------------
A0A2V9RKJ9      ------------------------------------------------------------
A0A2V9RN95      ------------------------------------------------------------
A0A2V9N406      ------------------------------------------------------------
A0A2V9U6D9      ------------------------------------------------------------
A0A2V8DZN4      ------------------------------------------------------------
A0A3N5YKY1      ------------------------------------------------------------
A0A2G6HQA4      ------------------------------------------------------------
A0A2V7ZTY7      ------------------------------------------------------------
A0A2V7ZVL9      ------------------------------------------------------------
A0A1Q7QYI4      ------------------------------------------------------------
A0A2V8G9Y9      ------------------------------------------------------------
A0A143PNR5      ------------------------------------------------------------
A0A6A7L078      ------------------------------------------------------------
A0A143PXU3      ------------------------------------------------------------
A0A2V8D8G9      ------------------------------------------------------------
A0A2V8ESQ4      ------------------------------------------------------------
A0A1E3Y5Q0      ------------------------------------------------------------
A0A2W4TWK5      ------------------------------------------------------------
A0A3N5NYV3      ------------------------------------------------------------
A0A2V2RJF9      ------------------------------------------------------------
A0A2G6HNT3      ------------------------------------------------------------
A0A2V7YWD4      ------------------------------------------------------------
A0A2V2R8T6      ------------------------------------------------------------
A0A1Q7RGF1      ------------------------------------------------------------
A0A2V9BLX2      ------------------------------------------------------------
A0A2V9ZA03      ------------------------------------------------------------
A0A3N5ZNH4      ------------------------------------------------------------
A0A2V8GEZ2      ------------------------------------------------------------
A0A3N5ZFD3      ------------------------------------------------------------
G8NXD3          ------------------------------------------------------------
A0A2V9VR38      ------------------------------------------------------------
A0A2V9EY04      ------------------------------------------------------------
A0A2V9HAK9      ------------------------------------------------------------
A0A1Q7FS15      ------------------------------------------------------------
A0A1Q7K9P1      ------------------------------------------------------------
A0A1Q7N989      ------------------------------------------------------------
A0A2V9G7Y0      ------------------------------------------------------------
A0A2V8T7Z1      ------------------------------------------------------------
A0A2V7U8G5      ------------------------------------------------------------
A0A2V7UNP9      ------------------------------------------------------------
A0A2V7VLD7      ------------------------------------------------------------
A0A2V7XGA3      ------------------------------------------------------------
A0A2V7YAG6      ------------------------------------------------------------
A0A2V7VK33      ------------------------------------------------------------
A0A3M1VTE1      ------------------------------------------------------------
A0A2V7TTM7      ------------------------------------------------------------
A0A2V8VI82      ------------------------------------------------------------
A0A2V7U4P9      ------------------------------------------------------------
A0A2V7TQY5      ------------------------------------------------------------
A0A2V7TU87      ------------------------------------------------------------
A0A2V8SEH0      ------------------------------------------------------------
A0A2V8VU54      ------------------------------------------------------------
A0A1Q7RML7      ------------------------------------------------------------
A0A1Q7ZIQ5      ------------------------------------------------------------
A0A2V8TKD8      ------------------------------------------------------------
                                                                            

A0A1F2U8T6      ALAATTLAEEYVAQNLELKQQSTQNMLEWLENEVAAQQTKVEQSERDLAEYREMENAMSL
A0A2V8BV42      ALAVNTLVDEYTEQNLAIKLESSQNMLNWLAKELDKQQQKVRESEQALAEYRDKQNAMSL
A0A2V8F916      ALAVNTLVDEYTEQNLAIKLESSQNMLNWLAKELDKQQQKVRESEQALAEYRDKQNAMSL
A0A1Q7K833      QLAANTLVDEYVEQNLALKQQSTQNMIDWLDKELERQQQKTEESERALADYRERQNALSL
A0A1Q8AMY4      QLAANTLVDEYVEQNLALKQQSTQNMIDWLDKELERQQQKTEESERALADYRERQNALSL
A0A2V8BM40      QAAANALVDEYVEQNLQVKLQSTQNMIEWLDKELEKQQQKVGESERGLADYRERQNAMSL
A0A2V8CRT6      QAAANALVDEYVEQNLQVKLQSTQNMIEWLDKELEKQQQKVGESERGLADYRERQNAMSL
A0A1F2VH76      AKAANAYAEEYVAQNLELKAANLDKSLEWLTGEVGRQEGLVKASERALADYRERQDAGGL
A0A1F2R0X5      AEAANALAEEYVEQNLQVKLQTAQNMLDWLGKELATQQQKVEESERSLAEYREKENALSL
A0A2V8B278      ATAANTLVDEFVDQNLQVKLQSTENMIDWLDKELDKQQQKVQDSERGLAEYRERQNALSL
A0A2V8CEF9      ATAANTLVDEFVEQNLQVKLQSTENMIDWLDKELDKQQHKVQDSERALAEYRERQNALSL
A0A2V8KZG2      ------------------------------------------------------------
A0A1Q7LG57      ------------------------------------------------------------
A0A2V8YMQ4      ------------------------------------------------------------
A0A1Q7L5B1      ------------------------------------------------------------
A0A2V9DKV4      ------------------------------------------------------------
A0A2V8W380      ------------------------------------------------------------
A0A2V8ZIV5      ------------------------------------------------------------
A0A2V9EVA0      ------------------------------------------------------------
A0A1Q7RB73      ------------------------------------------------------------
A0A2V9K0H7      ------------------------------------------------------------
A0A3N5YN96      ------------------------------------------------------------
A0A1Q7Y646      ------------------------------------------------------------
A0A2V8QZU0      ------------------------------------------------------------
A0A2V8RSQ9      ------------------------------------------------------------
A0A2V9LS17      ------------------------------------------------------------
A0A2V9AGR3      ------------------------------------------------------------
A0A2V9G0N7      ------------------------------------------------------------
A0A2V9GQ44      ------------------------------------------------------------
A0A2V9HRN3      ------------------------------------------------------------
A0A2V8WG13      ------------------------------------------------------------
A0A2V8X987      ------------------------------------------------------------
A0A1Q7KX94      ------------------------------------------------------------
A0A2V8XHT0      ------------------------------------------------------------
A0A2V9L2P7      ------------------------------------------------------MNQLLI
A0A2V7UMX0      ------------------------------------------------------------
A0A136K497      ------------------------------------------------------------
A0A399W9E4      ------------------------------------------------------------
A0A2V7X0V9      ------------------------------------------------------------
A0A2V9X518      ------------------------------------------------------------
A0A2V9VC62      ------------------------------------------------------------
A0A2V9S1P8      ------------------------------------------------------------
A0A2V9RTW2      ------------------------------------------------------------
A0A2V9TGF1      ------------------------------------------------------------
A0A2V9XEV6      ------------------------------------------------------------
A0A2V9Y3Q6      ------------------------------------------------------------
A0A2V9R269      ------------------------------------------------------------
A0A2V9PTS3      ------------------------------------------------------------
A0A2V9NPF4      ------------------------------------------------------------
A0A2V9PNZ0      ------------------------------------------------------------
A0A321LMC5      ------------------------------------------------------------
A0A2V8X713      ------------------------------------------------------------
A0A2V8ZLE9      ------------------------------------------------------------
A0A2V8Y4D3      ------------------------------------------------------------
A0A2V8Z2X8      ------------------------------------------------------------
A0A2V9C3F6      ------------------------------------------------------------
A0A2V9QMU9      ------------------------------------------------------------
A0A2V9QY75      ------------------------------------------------------------
A0A2V9SVU9      ------------------------------------------------------------
A0A2V8W5N5      ------------------------------------------------------------
A0A2V8XG53      ------------------------------------------------------------
A0A6A7LB89      ------------------------------------------------------MALLVA
A0A2V9XV04      ------------------------------------------------------------
A0A2V9CBY1      ------------------------------------------------------------
A0A2V9D656      ------------------------------------------------------------
A0A352EZH8      ------------------------------------------------------------
A0A0B6X033      ------------------------------------------------------------
A0A2V8R0I3      ------------------------------------------------------MSSCAS
A0A2V8N1U8      ------------------------------------------------------------
A0A2V8QL35      ------------------------------------------------------------
A0A352FU10      ------------------------------------------------------------
A0A2V8LCU0      ------------------------------------------------------------
A0A1Q7NGT0      ------------------------------------------------------------
A0A2V8MLP9      ------------------------------------------------------------
A0A2V8PQZ0      ------------------------------------------------------------
A0A3B9MKY6      ------------------------------------------------------------
A0A3D5SKZ1      ------------------------------------------------------------
A0A2V8NRW2      ------------------------------------------------------------
A0A2V8TKR9      ------------------------------------------------------------
A0A2V8LBV1      ------------------------------------------------------------
A0A2V8GAF9      ------------------------------------------------------------
A0A2V8CN98      TTDIDELEHQTIPG----------------------------------------------
A0A1Q7LC46      KTELKDIEDSIEKE---------------------KRKV---------------------
A0A1Q8BDC5      RQQATEVLEHVFKN------------------NFAVDSF---------------------
A0A2V9Q1Y8      --MIRKSRARPRKS----------------------------------------------
A0A2V8JXG1      RDQIAASRGLLEDK----------------------------------------------
A0A350D2W9      KAELDTARDLLKNE---------------------TGGL---------------------
A0A2V9I4J1      ENLLLEVARGDSKP----------------------------------------------
A0A2V8PQZ9      SDRLSTLRAWGEET----------------------------------------------
A0A2V8D8B1      RHAIQTAEAKIQGE---------------------IAKV---------------------
A0A3B9LSB4      DQQIAELERQVKDV-----------------RSRKSVTL---------------------
A0A2V9H7U2      RSQVNEIQSLIDTE---------------------RKRM---------------------
A0A2V8NJB5      DFSIDDFTNSVRSF----------------------------------------------
A0A2V9JMZ4      ENLLLEVARGDSKP----------------------------------------------
A0A2V9MDJ6      ENLLLEVARGDSKP----------------------------------------------
A0A2V8QJT6      DQQIDVLQKHLADT-----------------RARGAATL---------------------
A0A2V8FSM8      MAQIAAIESSLEGT---------------------RENV---------------------
A0A359M0J2      QAQIDELEQSLERE---------------------RVNI---------------------
A0A2V8JLJ1      NLSLDTVPAEVQLQ----------------------------------------------
A0A5M8SND8      QAQLTPLQNALEQH---------------------RSRI---------------------
A0A2V9GAQ1      QAQLKDYDLSIEKE---------------------KKYI---------------------
A0A497EDQ8      RVRLEGIDQAIERQ---------------------IQTL---------------------
G8NS05          HAQIEELDKAIKQE---------------------QDRV---------------------
A0A2V8KZ20      TQEVRELEGLVRQFKAAAEAAKAAAAATATAEAAKAASIQVQAAKEPKPEEKPRPFLSEF
A0A3D0NWU2      EERIASLKESRTRT--EQEVSSIIDRDQKRIEREAVGGA---------------------
A0A2V8EPD9      SPAPVVVAPAAPVV---------------------LAPV---------------------
A0A3N5NSX5      DNAIADTTQQLQTA---------------------LTAA---------------------
A0A2V8MUA1      KRELGETPGPAPADEVAASTLLPQLDFSIDFSDFEIQLR---------------------
A0A2V8MBH9      DQQIAELQKHLHES-----------------RARNTNTL---------------------
A0A3N5ZPQ7      HKQIKGRDHRPLGEAIVAAGLAEPVEIQQLLQKQAIDVF---------------------
A0A3N5P5F2      RTAIQQIRQKLDAE---------------------LHNA---------------------
A0A2V9G1P7      QSQIDEIAASLREE---------------------RQRA---------------------
A0A2V9BCK9      PRVINVLCEHALIN--------------------SFADQ---------------------
A0A2V9TMX2      NNQLKQVRAAIEAE---------------------KTKL---------------------
A0A2V8N2J7      ERTIASQPKKGRSE-----------PSPTYLRYSQLKSE---------------------
A0A3N6BI26      RQQIQEVEKQLLRE---------------------KKET---------------------
A0A2V9JMM3      EQAVAAGPRRKSRSDATAATSRRYPGPDASMRYLALKGE---------------------
A0A2V9M815      EQAVAAGPRRKSRSDATAATSRRYPGPDASMRYLALKGE---------------------
A0A2V9A795      QSQIDETEAALKEE---------------------RQRA---------------------
A0A355ESH9      KSQIETGKQHIDSVIRE-------------M----VQKA---------------------
A0A3D0NW85      EDSLANATEKAQAEIQA-------------YRGRTADNL---------------------
A0A353CAT5      ERSLKTATDRANAEIAT-------------FRERTAKTL---------------------
A0A2V9HB55      QAQLKDYDQSIEKE---------------------KKNI---------------------
A0A2V8CU57      PFAVAGWSEPESAA---------------------APPV---------------------
A0A2V8BDI4      PFAVAGWSEPESAA---------------------APPV---------------------
A0A2V8F8T3      PFAVAGWSEPESAA---------------------APPV---------------------
A0A2V9J901      ------------------------------------------------------------
A0A2V8MKQ7      ------------------------------------------------------------
A0A3M1SNQ5      ------------------------------------------------------------
A0A2V8QJ59      ------------------------------------------------------------
A0A1Q7HTA7      ------------------------------------------------------------
A0A2W0B5E2      ------------------------------------------------------------
A0A2V8NMG8      ------------------------------------------------------------
A0A2V8TBM7      ------------------------------------------------------------
A0A1Q7HEZ8      ------------------------------------------------------------
A0A1Q7JW36      ------------------------------------------------------------
A0A1Q7MUR4      ------------------------------------------------------------
A0A3N5PFU4      ------------------------------------------------------------
A0A4R1LDF1      ------------------------------------------------------------
A0A1F2T1R8      ------------------------------------------------------------
A0A2V9BW09      ------------------------------------------------------------
A0A3M1SSE1      ------------------------------------------------------------
A0A2V9GQV7      ------------------------------------------------------------
A0A2V7YV88      ------------------------------------------------------------
A0A2V8YCY6      ------------------------------------------------------------
A0A2V8EGM3      ------------------------------------------------------------
A0A2V8FGH1      ------------------------------------------------------------
A0A2V8D468      ------------------------------------------------------------
A0A1F2R977      ------------------------------------------------------------
A0A2U3LF12      ------------------------------------------------------------
A0A3N5G7M6      ------------------------------------------------------------
A0A1F2S3Q7      ------------------------------------------------------------
A0A2V8GVG4      ------------------------------------------------------------
A0A2V8PJQ0      ------------------------------------------------------------
A0A2V8H566      ------------------------------------------------------------
A0A2V8UVN4      ------------------------------------------------------------
A0A321LXF5      ------------------------------------------------------------
A0A5M8SBZ0      ------------------------------------------------------------
A0A1Q7JFB1      ------------------------------------------------------------
A0A2V8DMJ9      ------------------------------------------------------------
A0A2V8GGF6      ------------------------------------------------------------
A0A2V8HKU7      ------------------------------------------------------------
A0A1Q6Y875      ------------------------------------------------------------
A0A523DJA9      ------------------------------------------------------------
A0A2V8I604      ------------------------------------------------------------
A0A2V8J066      ------------------------------------------------------------
A0A1I6MMC5      ------------------------------------------------------------
A0A2V9D5W7      ------------------------------------------------------------
A0A2V9D4I4      ------------------------------------------------------------
A0A2V9D6L7      ------------------------------------------------------------
A0A2V8ZJV2      ------------------------------------------------------------
A0A2V9AWB5      ------------------------------------------------------------
A0A2V8Z1Y8      ------------------------------------------------------------
A0A1Q8AX10      ------------------------------------------------------------
A0A2V9A773      ------------------------------------------------------------
A0A2V9AND3      ------------------------------------------------------------
A0A2V9BTJ7      ------------------------------------------------------------
A0A2V8W2M7      ------------------------------------------------------------
A0A2V8XNW2      ------------------------------------------------------------
A0A1Q7CJC1      ------------------------------------------------------------
A0A2V9UEM7      ------------------------------------------------------------
A0A1Q7V300      ------------------------------------------------------------
A0A2V9ZCI3      ------------------------------------------------------------
A0A2V9WCB3      ------------------------------------------------------------
A0A2V9VQW5      ------------------------------------------------------------
A0A2V9WTP3      ------------------------------------------------------------
A0A2V9NLA9      ------------------------------------------------------------
A0A2V9RKJ9      ------------------------------------------------------------
A0A2V9RN95      ------------------------------------------------------------
A0A2V9N406      ------------------------------------------------------------
A0A2V9U6D9      ------------------------------------------------------------
A0A2V8DZN4      ------------------------------------------------------------
A0A3N5YKY1      ------------------------------------------------------------
A0A2G6HQA4      ------------------------------------------------------------
A0A2V7ZTY7      ------------------------------------------------------------
A0A2V7ZVL9      ------------------------------------------------------------
A0A1Q7QYI4      ------------------------------------------------------------
A0A2V8G9Y9      ------------------------------------------------------------
A0A143PNR5      ------------------------------------------------------------
A0A6A7L078      ------------------------------------------------------------
A0A143PXU3      ------------------------------------------------------------
A0A2V8D8G9      ------------------------------------------------------------
A0A2V8ESQ4      ------------------------------------------------------------
A0A1E3Y5Q0      ------------------------------------------------------------
A0A2W4TWK5      ------------------------------------------------------------
A0A3N5NYV3      ------------------------------------------------------------
A0A2V2RJF9      ------------------------------------------------------------
A0A2G6HNT3      ------------------------------------------------------------
A0A2V7YWD4      ------------------------------------------------------------
A0A2V2R8T6      ------------------------------------------------------------
A0A1Q7RGF1      ------------------------------------------------------------
A0A2V9BLX2      ------------------------------------------------------------
A0A2V9ZA03      ------------------------------------------------------------
A0A3N5ZNH4      ------------------------------------------------------------
A0A2V8GEZ2      ------------------------------------------------------------
A0A3N5ZFD3      ------------------------------------------------------------
G8NXD3          ------------------------------------------------------------
A0A2V9VR38      ------------------------------------------------------------
A0A2V9EY04      ------------------------------------------------------------
A0A2V9HAK9      ------------------------------------------------------------
A0A1Q7FS15      ------------------------------------------------------------
A0A1Q7K9P1      ------------------------------------------------------------
A0A1Q7N989      ------------------------------------------------------------
A0A2V9G7Y0      ------------------------------------------------------------
A0A2V8T7Z1      ------------------------------------------------------------
A0A2V7U8G5      ------------------------------------------------------------
A0A2V7UNP9      ------------------------------------------------------------
A0A2V7VLD7      ------------------------------------------------------------
A0A2V7XGA3      ------------------------------------------------------------
A0A2V7YAG6      ------------------------------------------------------------
A0A2V7VK33      ------------------------------------------------------------
A0A3M1VTE1      ------------------------------------------------------------
A0A2V7TTM7      ------------------------------------------------------------
A0A2V8VI82      ------------------------------------------------------------
A0A2V7U4P9      ------------------------------------------------------------
A0A2V7TQY5      ------------------------------------------------------------
A0A2V7TU87      ------------------------------------------------------------
A0A2V8SEH0      ------------------------------------------------------------
A0A2V8VU54      ------------------------------------------------------------
A0A1Q7RML7      ------------------------------------------------------------
A0A1Q7ZIQ5      ------------------------------------------------------------
A0A2V8TKD8      ------------------------------------------------------------
                                                                            

A0A1F2U8T6      -DDKNNIVVSRLNALNEASIRARTVRIEKESVNNQLKAIRDTRSVDAIPVITQNLQIQAL
A0A2V8BV42      -DDKQNIVTTRLTALNDALIHARTAKVQKEALYNQVKSMSGTTAPDAIPVIAQNTQVQAL
A0A2V8F916      -DDKQNIVTTRLTALNDALIHARTAKVQKEALYNQVKSMSGTTAPDAIPVIAQNTQVQAL
A0A1Q7K833      -DERQNIVLVRLNKLNDDVMLARSRKAQKQAVYDQLRSLTASQHLDTIPVIAQNPDVGAA
A0A1Q8AMY4      -DERQNIVLVRLNKLNDDVMLARSRKAQKQAVYDQLRSLTASQHLDTIPVIAQNPDVGAA
A0A2V8BM40      -DEKQNLVVVRLNKLNDDLMLARSRRAQKQAVYDQLRSIGAGEPVDTIQVIATSPEVSAA
A0A2V8CRT6      -DEKQNLVVVRLNKLNDDLMLARSRRAQKQAVYDQLRSIGAGEPVDTIQVIATSPEVAAA
A0A1F2VH76      AEGSGNIVVARLTQLNDEVTRARTNRLTKENVWNQVRSA--GQDTETITTILQNPMVLSL
A0A1F2R0X5      -DDKQNIVLARLNQLNDLVTKAKTQRIQREALYNQVKSIAGGAAPDSIPIIAQNPNVQAL
A0A2V8B278      -DDKQNIVLARLNKLNDDVMMARSRRIQKETLFNQIKSVS-TQAPDTIPAIAQNASVAAA
A0A2V8CEF9      -DDKQNLVLARLNKLNDDVMMARSRRIQKETLFNQIKSAS-TQAPDTIPAIAQNASVAAA
A0A2V8KZG2      ------------------------------------------------------------
A0A1Q7LG57      ------------------------------------------------------------
A0A2V8YMQ4      ------------------------------------------------------------
A0A1Q7L5B1      ------------------------MSRIHEALKQA-------------------------
A0A2V9DKV4      ------------------------------------------------------------
A0A2V8W380      ------------------------------------------------------------
A0A2V8ZIV5      -------------QYNILKREVDTNKQLYEGLLQT-------------------------
A0A2V9EVA0      ------------------------MSRIFEALQKI-------------------------
A0A1Q7RB73      ------------------------------------------------------------
A0A2V9K0H7      ------------------------MSRLHEALKKA-------------------------
A0A3N5YN96      ------------------------MSRIQRVLDKA-----EREGQVRRTTSEV-------
A0A1Q7Y646      ------------------------MGRVYDALKRA-----SATQGGVTKRSNE----QKR
A0A2V8QZU0      ------------------------MGRVYEALKRA-----AEQNGSKAKKEEKLAHDSRD
A0A2V8RSQ9      ------------------------MGRVYEALKRA-----AAHGDAKSKRPDD-AGPSRV
A0A2V9LS17      ------------------------MSRIHEALKRA-------------------------
A0A2V9AGR3      ------------------------MSRIHEALRKA-------------------------
A0A2V9G0N7      ------------------------MSRIHDALKKA-------------------------
A0A2V9GQ44      ------------------------MSRIHDALKKA-------------------------
A0A2V9HRN3      ------------------------MSRIHDALKKA-------------------------
A0A2V8WG13      ------------------------MSRIHEALKKA-------------------------
A0A2V8X987      ------------------------MSRIHEALKKA-------------------------
A0A1Q7KX94      ------------------------MSRIHEALKKA-------------------------
A0A2V8XHT0      ------------------------MSRIHEALKKA-------------------------
A0A2V9L2P7      EHNLLKRDFDSNQALYESLLQHLKDANVSAGLRAT-------------------------
A0A2V7UMX0      ------------------------MLRSTVGEWRC-------------------------
A0A136K497      -------------------------MSVLQALQRK-------------------------
A0A399W9E4      -------------------------MSVLQALQRK-------------------------
A0A2V7X0V9      ------------------------MSRIHEALKKA-------------------------
A0A2V9X518      ------------------------------------------------------------
A0A2V9VC62      ------------------------MSRIHEALKRA-------------------------
A0A2V9S1P8      ------------------------MSRIHEALKKA-------------------------
A0A2V9RTW2      ------------------------MSRIHEALKRA-------------------------
A0A2V9TGF1      ------------------------MSRIHEALKRA-------------------------
A0A2V9XEV6      ------------------------MSRIHEALKRA-------------------------
A0A2V9Y3Q6      ------------------------MSRIHEALKRA-------------------------
A0A2V9R269      ------------------------MSRIHEALKKA-------------------------
A0A2V9PTS3      ------------------------MSRIHEALKKA-------------------------
A0A2V9NPF4      ------------------------MSRIHEALKKA-------------------------
A0A2V9PNZ0      ------------------------MSRIHEALKKA-------------------------
A0A321LMC5      ----------------------MPMGRVYKALVKA-------------------------
A0A2V8X713      ------------------------MSRIHEALKKA----------EEEKSPTRSAPGAGP
A0A2V8ZLE9      ------------------------MSRIHEALKRA----------EEQKPPAWKPSEPTP
A0A2V8Y4D3      ------------------------MSRIHEALKRA----------EEQRPSAWKPAEPTP
A0A2V8Z2X8      ------------------------MSRIHEALKRA----------EEAGPSAWRPSEPTP
A0A2V9C3F6      ------------------------MSRIHEALKKA----------EEQKPPAWRPTDPTP
A0A2V9QMU9      ------------------------------------------------------------
A0A2V9QY75      ------------------------------------------------------------
A0A2V9SVU9      -----MNSQMKEVDAQIQVEMKKIVSRVRSDYLAALQRETMLRAALDKQKQEANKLNESA
A0A2V8W5N5      ------------------------MSRIHEALKKA-------------------------
A0A2V8XG53      ------------------------MSRIHEALKKA-------------------------
A0A6A7LB89      KIRQHRASAWLGGWRRSFATARVKMSRIGDALLRA-----SEAAQERGEPVHRDVAGAAA
A0A2V9XV04      ------------------------MSRIHEALKKA----------EQERA----------
A0A2V9CBY1      ------------------------MSRVYEALKNAQEQRTIRGPLEAEVTAQESSVGGPV
A0A2V9D656      ------------------------MSRVYEALKNA-------------------------
A0A352EZH8      ------------------------MGRVYDALRRS----------GTDGSAIVFEPQPSS
A0A0B6X033      ------------------------MGRVFDALRRA----------AELDSRKREHRARPS
A0A2V8R0I3      VATLQRRLKMSGQPSAVPVLGEEPMGRVYDALKRA----------ESAQR-HNHKPSDFS
A0A2V8N1U8      ------------------------MGRVYDALKRA----------DAQRQ-FK--PSTPS
A0A2V8QL35      ------------------------MGRVYDALKRA----------ESPER-RIT-ASKSA
A0A352FU10      ------------------------MGRVYDALKRA----------ESAER-QVT-SSKSS
A0A2V8LCU0      ------------------------MGRIYDALKRA----------ESNQR-DFTSTNKSS
A0A1Q7NGT0      ------------------------MGRIYDALKRA----------ESAPR-----TPKPS
A0A2V8MLP9      ------------------------MGRIYDALKRA----------ESAQR-----TPKPS
A0A2V8PQZ0      ------------------------MGRIYDALKRA----------ESAQR-----TPKPS
A0A3B9MKY6      ------------------------MGRVFDAIKRA----------SAADQGGEQKRHQPD
A0A3D5SKZ1      ------------------------MGRVFDAIKRA----------SAADQGGEQKRHQPD
A0A2V8NRW2      ------------------------MGRVYDALKRA----------STAKDENGAGRKKED
A0A2V8TKR9      ------------------------------------------------------------
A0A2V8LBV1      --------------------------------------------------------MKRE
A0A2V8GAF9      --------------MFALDCAGCRGGAGDGSARYVIPRHRGPAGLPPRPD----DAVQHS
A0A2V8CN98      ----------------LIRGLLAELGTQRRGLASQLETGGRELQGIPQRA-IEDARLRRD
A0A1Q7LC46      --------------LEVLESDYREARQRETLLSEALDQAKVEANQMSEKL-VEYNILKRE
A0A1Q8BDC5      --------------RNSLKSYYAPARIAYPQVLLEVCRSKNEPFECKEGT---RIVLSNG
A0A2V9Q1Y8      -----------------------AAVCVVIIWQPXXXEQKQQENKLNESA-IEFSLLKRD
A0A2V8JXG1      -----------------LKADYERVVRDENALKAALAEAKAGAAQENQRA-IQYSLLKQD
A0A350D2W9      --------------VKAAYSEYQAALKKENSLKDLFERQKDEAFRLNSNA-ILYNGLKIE
A0A2V9I4J1      --------------FQVYPWQLVVMNNGKDLTHLPWYPQELSVLSELRRS-RTLQDLATA
A0A2V8PQZ9      --------------MGRIYDALKRAESAPRTPKPSVNRNGNPDN-------IAYFVPKHV
A0A2V8D8B1      --------------VESMKHDYQTALTQEQSLMHALDQQKADALALNRKG-IGYGALQRD
A0A3B9LSB4      --------------LTNLETDYRQTLAREQALRKAFEQQRGETLSQNEAA-INYRIIQQE
A0A2V9H7U2      --------------VERLRNDYVAARGREKLLAAAVAKEKVGVGALSQLL-IQHNLLKRE
A0A2V8NJB5      ------------------------YTPANITFAGLFLELCRNNAKSFEASGTRTVVLRSG
A0A2V9JMZ4      --------------FQVYPWQLVVMNNGKDLTHLPWYPQELSVLSELRRS-RTLQDLATA
A0A2V9MDJ6      --------------FQVYPWQLVVMKNGKDLTHLPWYPQELSVLSELRRS-RTLQDLATA
A0A2V8QJT6      --------------LKNLETKYRQAADREEALRKSFNQQKGETVTQNEAA-INYRILQQE
A0A2V8FSM8      --------------ATRIRKEYEGALRREKLLETAYAEKVHQLASKAEET-AHYNLLKRD
A0A359M0J2      --------------VERLKNDYEAALKREQMLTSAYSRQASAVTGQANVA-AEYGTLKRE
A0A2V8JLJ1      --------------IDQLDRDVSKLKQGREPLQARIAAYQNRLNPPAPVA-EELARLTRN
A0A5M8SND8      --------------MARIKSDYSSAVKHEELLQSAYRQQVSVVTDKHNKA-IQYGIFKHQ
A0A2V9GAQ1      --------------LDVLESDYREAQQRESLLMQALDQQKTETNQMAEKL-VEYNILKRE
A0A497EDQ8      --------------RLGMETRFDMVKRREQSLFENIQGLRNQTIELSKTS-LEYDRLEET
G8NS05          --------------IAQAKQTFIAAQANEQQTRAALEDQKSEAYKLRDDL-VQYTLLQRD
A0A2V8KZ20      NLSLDTVPAEVQLQIDQLDRDVSKLKQGREPLQARIAAYQNRLNPPAPVA-EELARLTRN
A0A3D0NWU2      --------------LTALRAQLDAKRKEEAQAQAAYDREAALANIQGQAQ-TRLTTLKRD
A0A2V8EPD9      --------------VVPIAPVAPVAAAPAPAAPVALAAAAPVPAAAAAPV----------
A0A3N5NSX5      --------------VAAIRSEYQTARATELRLADALKQSQGAAMELNRKN-VGYTVLERE
A0A2V8MUA1      --------------LEKLARDLKQRQEAEEEIVRKINQYRSRVNAPPEVL-DELAGLQRQ
A0A2V8MBH9      --------------LTNLETKYRQSLAREESLRKSFNQQKGETVTQNEAA-INYRILQQE
A0A3N5ZPQ7      --------------RRALENGFRIESFEPMSVHLGIPLKAR----------LDVLLLDLA
A0A3N5P5F2      --------------VQAVEGEYVGAQAREESLTRELEAQKADVLAINRKS-IGYAALERD
A0A2V9G1P7      --------------ADRMVNDYSAAVRRENLVQQALDDQQKQVNLIAEKS-VQYNILKRE
A0A2V9BCK9      --------------QRPVPTHLVDEVAREFELGSLEPTTQPTSTACPENTLAAESPLEDF
A0A2V9TMX2      --------------QQKMRDDYLAALQRENLLDSAFNKQKQEANKLNESATIEYTVLKRD
A0A2V8N2J7      --------------LEGIQQRIAAYQRDQENLSAQMDTYSRRLESTPQHE-KVIDDMERE
A0A3N6BI26      --------------INRVQSEYRVAVNRRQMLLGALNRQKAEANQLNQDS-IQYNILQRE
A0A2V9JMM3      --------------LEGIDQRLRSYAPEEKALQAEIASLRQRVASAPKHE-RALAEMTRE
A0A2V9M815      --------------LEGIDQRLRSYAPEEKALQAEIASLRQRVASAPKHE-RALAEMTRE
A0A2V9A795      --------------ADKITNEYFAALRREGLVKEALEGQQKQVNVIAEKA-VQYNILKRE
A0A355ESH9      --------------RSNASSNYQAVLRQEQSLAAELETIKRQAIDQNSSA-VQFTNLKVE
A0A3D0NW85      --------------LKVLETQYRRAQEKENKIRSAFNVQFQEAQGQNAGA-VMIKLLQQN
A0A353CAT5      --------------IDVLETKYRRAKEKEDKIRAAFDVQVNEAQGQNAGA-VMLKLLQQS
A0A2V9HB55      --------------LAVLESDYREAQQRESLLTQALDEQKAETNHMAEKL-VEYNILKRE
A0A2V8CU57      --------------VAAW----------------------SEPETVTAPL-AVAAWSEPE
A0A2V8BDI4      --------------VAAW----------------------SEPETVTAPL-AVAAWSEPE
A0A2V8F8T3      --------------VAAW----------------------SEPETVTAPL-AVAAWSEPE
A0A2V9J901      ------------------------------------------------------------
A0A2V8MKQ7      ------------------------------------------------------------
A0A3M1SNQ5      -------------------------MKILKALQRRKQENERIVPFERKYQ----------
A0A2V8QJ59      ------------------------------------------------------------
A0A1Q7HTA7      ------------------------------------------------------------
A0A2W0B5E2      ------------------------------------------------------------
A0A2V8NMG8      ------------------------------------------------------------
A0A2V8TBM7      ------------------------------------------------------------
A0A1Q7HEZ8      ------------------------------------------------------------
A0A1Q7JW36      ------------------------------------------------------------
A0A1Q7MUR4      ------------------------------------------------------------
A0A3N5PFU4      ------------------------------------------------------------
A0A4R1LDF1      -----------------------------MTISLRKEQNIAAINLQSESF----------
A0A1F2T1R8      ------------------------------------------------------------
A0A2V9BW09      ------------------------------------------------------------
A0A3M1SSE1      ------------------------------------DIPVSPRRLLTVMM----------
A0A2V9GQV7      ------------------------------------------------------------
A0A2V7YV88      -------------------------DYLDQSIKSDEELTERLGLMTLAHI----------
A0A2V8YCY6      -----------------------------MCPSHRCRKPSGPCAPL--------------
A0A2V8EGM3      ------------------------MARSMNHPRPDSTSSGRRCSPA--------------
A0A2V8FGH1      ------------------------MGRIDEALRRSTAKKDTQVKAVEVPP----------
A0A2V8D468      ------------------------------------------------------------
A0A1F2R977      --------------------MALVMSRIDEALKRVTRAPSPSPRRAESAE----------
A0A2U3LF12      ------------------------------------------------------------
A0A3N5G7M6      ------------------------------------------------------------
A0A1F2S3Q7      ------------------------------------------------------------
A0A2V8GVG4      ------------------------------------------------------------
A0A2V8PJQ0      ---------------------------LDDTVKSLD------------------------
A0A2V8H566      ------------------------------------------------------------
A0A2V8UVN4      ------------------------MSKIFEALQKSEGEVAQEALPVLTDG----------
A0A321LXF5      ------------------------MSRFFNESRKASRHVTVGPRNVDLQE----------
A0A5M8SBZ0      -----------------MPQMRNLMSRIHEALIRAEQEHNGRPGAPANVT----------
A0A1Q7JFB1      ------------------------------------------------------------
A0A2V8DMJ9      --------------MADGARRGNRCRR-CRVDRRGQSSPGAWKRTDRSAD----------
A0A2V8GGF6      --------------MGTVRARGHHDRHWSDVHRRRVALHRERQRAHRPAD----------
A0A2V8HKU7      --------------MGTVRARGRHDRHWSDVHRRRVALHRERQRAHRPAD----------
A0A1Q6Y875      ------------------------------------------------------------
A0A523DJA9      ------------------------MNSRANNVRVIDRAPVPSTPFTPNAR----------
A0A2V8I604      ------------------------MSRIQDILNKAERDGAVRRTRPLGSE----------
A0A2V8J066      ------------------------MSRIQDILNKAEREGSARRTRSIGTD----------
A0A1I6MMC5      ------------------------MSKIYEALLRAEIERLTTKD----------------
A0A2V9D5W7      ------------------------MTRIHEALTKAGQEYPAAQAID-SLF----------
A0A2V9D4I4      ------------------------MSRIHEAMQKAAQERAAAPATEIAPF----------
A0A2V9D6L7      ------------------------MSRIHEAIQKAAQERSAAPATDFAPL----------
A0A2V8ZJV2      ------------------------MSRIHEALKRAAEERAAQLAAGSEAS----------
A0A2V9AWB5      ------------------------MSRIHEALKKAAEERAARLTFDVDPR----------
A0A2V8Z1Y8      ------------------------MSRIHEALKKAALERSAQL-VTELES----------
A0A1Q8AX10      ------------------------MSRIHEALKRAEQERAPIQSANEAKP----------
A0A2V9A773      ------------------------MSRIHEALKKAEEQRPPAWKPADPTP----------
A0A2V9AND3      ------------------------MSRIHEALKRAEEQRPPSWKPAEPTP----------
A0A2V9BTJ7      ------------------------MSRIHEALKKAAQERSAQLAAGTAPS----------
A0A2V8W2M7      ------------------------MSRIHEALKKAVEERVSHLSVGESLN----------
A0A2V8XNW2      ------------------------MSRIHEALKKAVEERVSHLSVGESLN----------
A0A1Q7CJC1      ------------------------------------------------------------
A0A2V9UEM7      ------------------------MSRIHDALKRAEQERATSMGGQLEPA----------
A0A1Q7V300      ------------------------MSRIHEALKKAEQERATS------------------
A0A2V9ZCI3      ------------------------MSRIHEALKKAEQERAASQGSQIDSS----------
A0A2V9WCB3      ------------------------MSRIHEALKKAEQERAATQAMAVPPP----------
A0A2V9VQW5      ------------------------MSRIHEALKRAEQERAASQGTRTDG-----------
A0A2V9WTP3      ------------------------MSRIHEALKKAEQERAASQGGPVPSN----------
A0A2V9NLA9      ------------------------MSRIHEALKKAEEQRSAEHEMHIEPP----------
A0A2V9RKJ9      ------------------------MSRIHEALKKAEEQRSAEHEMHIEPP----------
A0A2V9RN95      ------------------------------------------------------------
A0A2V9N406      ------------------------MSRIHEALKKAEEQRAASQGGNIEP-----------
A0A2V9U6D9      ------------------------MSRIHEALKKAEEQRAASQGGSIEP-----------
A0A2V8DZN4      ------------------------------------------------------------
A0A3N5YKY1      --------------------------------------MQVFATPSAATH----------
A0A2G6HQA4      ------------------------MDKFSKIMEKAGVDTSYNLHSKKRKN----------
A0A2V7ZTY7      ------------------------MSRLEAALWRAETLNDEPAAPPTVSG----------
A0A2V7ZVL9      ------------------------MSRLEAALWRAETLNDEPAAPPTVSG----------
A0A1Q7QYI4      ------------------------MSRLEAALRRAQALNDQSDA----------------
A0A2V8G9Y9      ------------------------MTRLAEALRRAED-HSGAEA----------------
A0A143PNR5      ------------------------MSRIDEALRRARGEQPEHRATDFEAD----------
A0A6A7L078      ------------------------MGRIDEALRRAGGGASTLEREDGGSD----------
A0A143PXU3      ------------------------MSRIDDALRRARGEQPEQAATD--------------
A0A2V8D8G9      ------------------------MSRIDQALRIREVASGAAAPETGTNQ----------
A0A2V8ESQ4      ------------------------MSRIDQALRMREVASGAAAPETGTNQ----------
A0A1E3Y5Q0      ------------------------MRRAAEARQPISPDAGDAAGG---------------
A0A2W4TWK5      ------------------------MGRIDEAMRRAGGASATVEEAAQPAV----------
A0A3N5NYV3      ------------------------MSRLAEALKRASAEQESDGAEQQEPI----------
A0A2V2RJF9      ------------------------------------------------------------
A0A2G6HNT3      ------------------------------------------------------------
A0A2V7YWD4      ------------------------------------------------------------
A0A2V2R8T6      ------------------------------------------------------------
A0A1Q7RGF1      ------------------------------------------------------------
A0A2V9BLX2      ------------------------------------------------------------
A0A2V9ZA03      ------------------------------------------------------------
A0A3N5ZNH4      ------------------------------------------------------------
A0A2V8GEZ2      ------------------------------------------------------------
A0A3N5ZFD3      ------------------------------------------------------------
G8NXD3          ------------------------------------------------------------
A0A2V9VR38      ------------------------------------------------------------
A0A2V9EY04      ------------------------------------------------------------
A0A2V9HAK9      ------------------------------------------------------------
A0A1Q7FS15      ------------------------------------------------------------
A0A1Q7K9P1      ------------------------------------------------------------
A0A1Q7N989      ------------------------------------------------------------
A0A2V9G7Y0      ------------------------------------------------------------
A0A2V8T7Z1      ------------------------------------------------------------
A0A2V7U8G5      ------------------------------------------------------------
A0A2V7UNP9      ------------------------------------------------------------
A0A2V7VLD7      ------------------------------------------------------------
A0A2V7XGA3      ------------------------------------------------------------
A0A2V7YAG6      ------------------------------------------------------------
A0A2V7VK33      ------------------------------------------------------------
A0A3M1VTE1      ------------------------------------------------------------
A0A2V7TTM7      ------------------------------------------------------------
A0A2V8VI82      ------------------------------------------------------------
A0A2V7U4P9      ------------------------------------------------------------
A0A2V7TQY5      ------------------------------------------------------------
A0A2V7TU87      ------------------------------------------------------------
A0A2V8SEH0      ------------------------------------------------------------
A0A2V8VU54      ------------------------------------------------------------
A0A1Q7RML7      ------------------------------------------------------------
A0A1Q7ZIQ5      ------------------------------------------------------------
A0A2V8TKD8      ------------------------------------------------------------
                                                                            

A0A1F2U8T6      RNQLGDLQRQKANLTERYGDKHPEMVKVNAQLADGQRQLDVGTAKALESVRNEYERALIE
A0A2V8BV42      KTKLNELQRDKSRLEERYGPKHLAVQANATAILDTQRQVDVETSRALQSVKNDFETAVLE
A0A2V8F916      KTKLNELQRDKSRLEERYGPKHLAVQANATAILDTQRQVDVETSRALQSVKNDFETAVLE
A0A1Q7K833      KAKVTAAQTDRARTAERYGEKHPNMQKVNADVAEAQRQYDLAVNRAASAIKNEYETAQLE
A0A1Q8AMY4      KAKVTAAQTDRARTAERYGEKHPNMQKVNADVAEAQRQYDLAVNRAASAIKNEYETAQLE
A0A2V8BM40      KGKVFAIQSEKARIAERYGDKHPTMQKAMADLTEAQRQYDTAVTRAAQAIKNDYETAVLE
A0A2V8CRT6      KGKVFAIQSEKARIAERYGDKHPTMQKAIADLTEAQRQYDTAVTRAAQAIKNDYETAVLE
A0A1F2VH76      RNRVSEVERDRGRISERYGPRHPEYEKVTTQLADVKLQLEAEIKKAIQTAKSEYEAAVVQ
A0A1F2R0X5      KNKLSSLQQDKVRLLERYGDKHPQVIAVNASLQDTQRQLDQETARAVQSVRNEFETSVLE
A0A2V8B278      KSRVVEMQRARAQVADRYGERHPNMQKANADLSEAQRQYDFEVARARASIKNDYESALIE
A0A2V8CEF9      KSRVVEMQRARAQVADRYGERHPNMQKANADLSEAQRQYDFEVARARASIKNDYESALIE
A0A2V8KZG2      ------------------------------------------------------------
A0A1Q7LG57      --------------------------------MRDSNVLVVDRAKPPLLPYRPSFPMNSA
A0A2V8YMQ4      ------------------------------------------------------------
A0A1Q7L5B1      --------------------------------------------AHGREPALFPGEAKPN
A0A2V9DKV4      ------------------------------------------------------------
A0A2V8W380      ----------------------------------------MDSAEPPAKPVKPRTLLNLS
A0A2V8ZIV5      -----------------------LKQTGVSASLKATNIRIVDSAVPPVKPATPKIPLNLT
A0A2V9EVA0      ------------------------------------------QSQQTPVVPGAETIPPEP
A0A1Q7RB73      ------------------------------------------------------------
A0A2V9K0H7      ------------------------------------------------------EQQKTE
A0A3N5YN96      ----PPAADTAAAGRVSSPVSPQPPVASRRAVPPE------PPMQVFATPSAATHPNVPP
A0A1Q7Y646      RNGNSNAARQNGNGN-----------------------HAFEDSPLFAPLGAAHNSASTA
A0A2V8QZU0      ERPPAPAAETNGHGRPHAAPGASAPVVGVNRDADDAAEFLFRRSKHFQSPESATVSASNE
A0A2V8RSQ9      DNTNGNAQHANGNGAAHTRAPVADPLFD-------------RPSAFFHAPDAAHSSASTE
A0A2V9LS17      --------------------------------------EQEMEGRSIPSVGTQIAELAEA
A0A2V9AGR3      ----------------------------------------EQERASSAAVGRKDELPAIN
A0A2V9G0N7      ----------------------------------------TEEKASQSPASPAQTFVDVR
A0A2V9GQ44      ----------------------------------------AEEKASQSPASPAQTFVDVR
A0A2V9HRN3      ----------------------------------------AEERASKSPASAAQTFVDVT
A0A2V8WG13      ----------------------------------------AQERSSQVATGTVPDLADVA
A0A2V8X987      ----------------------------------------AQERSTQIGAGLDRDVADVA
A0A1Q7KX94      ----------------------------------------AEERSAQLAAGLETGVVEVT
A0A2V8XHT0      ----------------------------------------AEERSAQLAAGLETGVVEVT
A0A2V9L2P7      ---------------------NIHFIDSAAVPTVPVRPQKGRNIAFAMAVGLALGMGLAF
A0A2V7UMX0      --------------------GLLSQVKGFRLPEAKPGAQPGKSARTK-------------
A0A136K497      -----------------------NIENPTTSKPRVVAFDANGKRNAPPDILGTELTIGSP
A0A399W9E4      -----------------------NSENPTSTKPKVVAFDAPGRRNLPPDLLGTGLAIGSP
A0A2V7X0V9      -------------------------------EEERAASQGGAQLEPTP------------
A0A2V9X518      -------------------------------------------------MDVP-------
A0A2V9VC62      -------------------------------EQERAASQGGR-VDSAPVMDLPASPEPLP
A0A2V9S1P8      -------------------------------EEQRVASQGGRPVEPVQPADAA-------
A0A2V9RTW2      -------------------------------EEQRAASQGGQ-VPSSQTPEAV-------
A0A2V9TGF1      -------------------------------EEQRAASQGGQ-VPSSQTPEAV-------
A0A2V9XEV6      -------------------------------EQERAASQGGH-VESLHPMDVP-------
A0A2V9Y3Q6      -------------------------------EQERATSQGGH-LEPLHTTEGP-------
A0A2V9R269      -------------------------------EQERAMLHPSQRVEM-PAV----------
A0A2V9PTS3      -------------------------------EQERAMSQSPGAIETSPAV----------
A0A2V9NPF4      -------------------------------EQERAMSQSPGAIETAPAV----------
A0A2V9PNZ0      -------------------------------EQERAMSQSPGAIETAPAV----------
A0A321LMC5      --------------GRITEQFQQPEGAVFGDAIGPDFFDERDDSFIKESGSTR-------
A0A2V8X713      LDFAG-------------------------------------------------------
A0A2V8ZLE9      LGFGGNV-----------------------------------------------------
A0A2V8Y4D3      FGVAGGE-----------------------------------------------------
A0A2V8Z2X8      LGIVG-------------------------------------------------------
A0A2V9C3F6      LNYVG-------------------------------------------------------
A0A2V9QMU9      ------------------------------------------MARVPIEPAEPDVPRNLS
A0A2V9QY75      ---------------------QKLKEAGVTAGLRSNNIREVDIARTPGAPAEPNIARNLV
A0A2V9SVU9      IDYSLLKRDVETNRTLYEGLLEKLKEAGVTAGLRSNNIRPVDEARVPMYPAEPNVPRNLS
A0A2V8W5N5      ------------------------HEERHSSQAADTVTLSVETPRTQVIAGIGLRA----
A0A2V8XG53      ------------------------HEERHSSQAADTVTLSVETPRTQVIAGIGLRA----
A0A6A7LB89      LRPSGEDPSHVAPWTFDESQPSRPHRSSLADV----------------------------
A0A2V9XV04      ----------------STQGERVPSSYATTPVADVPGYDDIEVNRVPPSLGMPELG----
A0A2V9CBY1      HNGKTASRIREILSALTAEGAPPQEQRTIRGP------LEAEATPQESSVGGPVHN----
A0A2V9D656      -----------------------QDQQTIRGP------LEAEATPQESGVGEPVHN----
A0A352EZH8      SDYRGEIRTHRLVPSAQQIEEELFSASSILNRTEDTVTSSAFTAHTAYATGGTALP----
A0A0B6X033      DAQARAEEIESLLQRSEIFSSQAREPQLFSAS--------AEHADVATAIGSALPE----
A0A2V8R0I3      GRHNGDADNVSLF-TPKNEQEHPWSASPFTAM--PAAIDSAPTAHTAEETGGPALP----
A0A2V8N1U8      VRRHGNSDNVAYF-VPKNGHEHPWETAPTIGA--PAAIDSASTAHTAEATGGPALP----
A0A2V8QL35      IRQNGNSGNVLYPGWPGNGHDHPWERNAFTGM--PSAYDSASTAHTAEAASGPALP----
A0A352FU10      VRQNGNSGNVLYPGWPGNGHDHPWERNAFTGM--ASAYDSASTAHTSEAASGPALP----
A0A2V8LCU0      VSRNGNPDNVSYF-VQKNGHEHPWEKAPFTGM--PSAFSSASTAHTAEATGGPALP----
A0A1Q7NGT0      VNRPGNPDNIAYF-VPK--HVHPWERQSFTGM--PQGYDSASTAHTEEATGGPALP----
A0A2V8MLP9      VNRNGNPDNVAYF-VPK--HVHPWERRPFTGM--PAGIDSASTAHTEEATGGPALP----
A0A2V8PQZ0      VNRNGNPDNVAYF-VPK--HVHPWERRPFTGM--PAGIDSASTAHTEEATGGPALP----
A0A3B9MKY6      LERHGESPSVPGLPSARQIEEQLPSRSSFLSVSHETAQNSASSAHTADIPGGLALP----
A0A3D5SKZ1      LERHGESPSVPGLPSARQIEEQLPSRSSFLSVSHETAQNSASSAHTADIPGGLALP----
A0A2V8NRW2      QKRRNGTAAGRKLSAVLPVVNGDEHPWDSSPLFSRAAHESASTAHTEERAGS-ALS----
A0A2V8TKR9      ------------------------------------------------------------
A0A2V8LBV1      VETSRQLYEAMMQKV-------------KEYSIA---SAITANNV-RVVDPATPPGAPYK
A0A2V8GAF9      AAYDRGAHATSVASN-------------RVDGGVGHDRLGLDCRWRSPCRHRKRANRPVG
A0A2V8CN98      VSIAENLFTSVQQRY-------------SEARLA---EASSIADV-RVLDAAVAPETPVK
A0A1Q7LC46      AEANKALYEGLMTKM-------------KETAIS---AGLRSSNI-RIVDPAMVPTSPAR
A0A1Q8BDC5      TDLSVFPW--------------------YPEELSLLSEIKVPSTVQELAKTTGMKETNIR
A0A2V9Q1Y8      FETNRTLYEGLLQKL-------------KEAGVT---AGLRSNNI-RQVDIARTPAGPAE
A0A2V8JXG1      VDTAKSLYTEFLQKT-------------NQAYLE---VAQQQSNI-RVISPARMPKGPVS
A0A350D2W9      IENKKSLLESLLKRQ-------------SETGVSARLRGLRTSNI-RVIDRADLPINPSS
A0A2V9I4J1      TGLEYVRLTKILDVF-------------RKLQVV------------DIVDEETG------
A0A2V8PQZ9      HPWERQSFTGMPQGY-------------DSASTA------------HTEEATGGPALPDG
A0A2V8D8B1      AASNRQIFEALMQRT-------------KETGIS---GALKTSNI-RVVDNAETPRVPAS
A0A3B9LSB4      IDTNKTLLDSLLQRS-------------KENDVI---MASKPNNI-SIVDYAVTPDGPIG
A0A2V9H7U2      FDTNQQLYDSLLQRL-------------KDATVS---AGLRATNI-HLVDPARPPKVPVR
A0A2V8NJB5      QDLSELPW--------------------YPEELGVLRELTHPTTVAGLVASTGMKETPLR
A0A2V9JMZ4      TGLEYVRLTKILDVF-------------RKLQVV------------DIVDEETG------
A0A2V9MDJ6      TGLEYVRLTKILDVF-------------RKLQVV------------DIVDEETG------
A0A2V8QJT6      IETNKGLLDNLLQRS-------------KENDVV---LAGRPNNI-SVVDYAIVPDLPVG
A0A2V8FSM8      VDGTRKMYESLTQRL-------------KEASMA---SALRANNV-RVVDPAEEPEAPYK
A0A359M0J2      VDILRQSFNALLQQS-------------NQVSIG---SAIPVSSV-RVIDTAKPNNTQMS
A0A2V8JLJ1      YDEARQHYNVLAEKR-------------SNSKMAATADSSDNNEMFKVIDAAFLPRQAIG
A0A5M8SND8      VDSDEKLYESMLEQV-------------NRASVA---SAAGSSNI-QIFSGAQPPLRPDS
A0A2V9GAQ1      AEANKTLYDGLMTKL-------------KETAIS---QGLRSSNI-RVVDPEMIPSTPAR
A0A497EDQ8      YLQNRRFLDDMLARS-------------NEADLS---ATAWMNNI-RVIEKATPPSGPFS
G8NS05          FESNRTLYEGLLEKL-------------QTARVQ---AGLDSTEI-DIIDQAVPPAQPSL
A0A2V8KZ20      YDEARQHYNVLAEKR-------------SNSKMAATADSSDNNEMFKVIDAAFLPRQAIG
A0A3D0NWU2      IETKRNLLDTYTQRL-------------KEQELAIANSTPDNIKM----AAAAETAPRVG
A0A2V8EPD9      ----------------------------ARVAPAVHVAVPPAAKPTAPAAPAAVPKPPIA
A0A3N5NSX5      AQSNRGIYEALLQRQ-------------NELQIV---SNSGGNNV-RLMDRAVVPGSPFT
A0A2V8MUA1      RQVANQRYELLSGKK-------------FSSDLAGRVDTDINNQTFKVIDPANLPIRPFG
A0A2V8MBH9      IETNKGLLDNLLQRS-------------KENDVV---LAGRPNNI-SIVDYAITPDFPVG
A0A3N5ZPQ7      RTAANTFEPGLYEKIGLIAEHTFATLPWQPAELAVLDCLLQPKNLEELMGETGLPESQLV
A0A3N5P5F2      AASNRQIFEALLQRA-------------KETGIS---SELKTNNI-RIADPADVPRVPIS
A0A2V9G1P7      VDTNKQLYEGLLLQL-------------KEAGVS---ASLKASNI-RLVDSAQPPAKPVK
A0A2V9BCK9      IGSIGAVPSARLDHC-------------GTQGRE------RMSRIHEALKRAEQERAPIQ
A0A2V9TMX2      AETNRQLYQDLLQRL-------------KEAGVS---AGLRSSNI-RIVDIARVPTQPIS
A0A2V8N2J7      LKVGEMQFHALLDKQ-------------LDTKLAKGFEQSEGGIAFAVVEPAGLPRAPFS
A0A3N6BI26      VDTNRQLYEGLLQRL-------------KETGIS---AGMRASNI-HVVDHAEVPEAPYS
A0A2V9JMM3      QALTRSQYQGLLEKQ-------------NEMKMAERLRQKGQSLVFKVVEPASVPSAPSS
A0A2V9M815      QALTRSQYQGLLEKQ-------------NEMKMAERLRQKGQSLVFKVVEPASVPSAPSS
A0A2V9A795      VETNKQLYEGLLQRL-------------KEAGVS---ASLKASNI-RIVDSAEPPAKPAK
A0A355ESH9      IQTRRELLDELLRRQ-------------SETEVAVRLQDTRESNV-RIIDHALVPDGPFR
A0A3D0NW85      IETNKGFLDNLRKQQ-------------SSNDIA---SQGSDNNI-RVAQYAIPPKNPVS
A0A353CAT5      IETNKGFLDNLRKQQ-------------SSNDIA---TQGTDNNI-RVAAFAIPPDTPVA
A0A2V9HB55      AEANKTLYEGLMTKL-------------KETAIS---QGLRSSNI-RVVDPAMIPSTPAR
A0A2V8CU57      SAAAPPVVAGWSEPE-------------TVTA--------PFAVA-GWSEPESATAPPAV
A0A2V8BDI4      SAAAPPVVAGWSEPE-------------TVTA--------PFAVA-GWSEPESATAPPAV
A0A2V8F8T3      SAAAPPVVAGWSEPE-------------TVTA--------PFAVA-GWSEPESATAPPAV
A0A2V9J901      ------------------------------------------------------------
A0A2V8MKQ7      ------------------------------------------------------------
A0A3M1SNQ5      ----------------------------PESYAPTTFPLGDIKIGAPTSSEPEIASNDSP
A0A2V8QJ59      ------------------------------------------------------------
A0A1Q7HTA7      ------------------------------------------------------------
A0A2W0B5E2      ------------------------------------------------------------
A0A2V8NMG8      ------------------------------------------------------------
A0A2V8TBM7      ------------------------------------------------------------
A0A1Q7HEZ8      ------------------------------------------------------------
A0A1Q7JW36      ------------------------------------------------------------
A0A1Q7MUR4      ------------------------------------------------------------
A0A3N5PFU4      ------------------------------------------------------------
A0A4R1LDF1      ----------------------------QLIDAPREATTLQGGVNGRTKLASSYLPTGGA
A0A1F2T1R8      ------------------------------------------------------------
A0A2V9BW09      -----------------------------------------------------SLALRGN
A0A3M1SSE1      ----------------------------ALFLSACFGIGLAFFLEYLDDTIKTAEDVENY
A0A2V9GQV7      ------------------------------------------------------------
A0A2V7YV88      ----------------------------GFAPAGKGKRAE--------------------
A0A2V8YCY6      ------------------------------------------------------------
A0A2V8EGM3      ------------------------------------------------------------
A0A2V8FGH1      ----------------------------DDMFVSPWNFAGPPEPVAQGPVRDGALDEPSS
A0A2V8D468      -------------------------------------------------IPFSPNKTLTL
A0A1F2R977      ----------------------------SRATSFGDSSLDHYPAEHHSVPWTGEGREGNV
A0A2U3LF12      ------------------------------------------------------------
A0A3N5G7M6      ------------------------------------------------------------
A0A1F2S3Q7      ------------------------------------------------------------
A0A2V8GVG4      ------------------------------------------------------------
A0A2V8PJQ0      --------------------------------------DVDRYIHLPTLALIPAARSEKR
A0A2V8H566      --------------------------------------MSPEDRSTALEAVVRDGRIAAV
A0A2V8UVN4      ----------------------------GSQLGGVKVVDKILRETTGERRPADASDGAAE
A0A321LXF5      ----------------------------HISRLREGLETHSRPSSSQVRQVLAPLEDANN
A0A5M8SBZ0      ----------------------------LP----------------------PFNTSALL
A0A1Q7JFB1      ------------------------------------------------------------
A0A2V8DMJ9      ----------------------------GARTSMMRAQGRMLTDVESLIEAP--------
A0A2V8GGF6      ----------------------------GAWTGVMASEGRALTDPGEIPAAPPMERDAVL
A0A2V8HKU7      ----------------------------GAWTGVMTSEGRALTDPGEIPAAPPMERDAVL
A0A1Q6Y875      ------------------------------------------------------------
A0A523DJA9      ----------------------------RDWRT-----AVAIGLLFAVGLLFVVEYLDDT
A0A2V8I604      ----------------------------TSAAA-----ALAAPAPMARPIVEPPAPPPPI
A0A2V8J066      ----------------------------APVGTPPSPVAAPPPTPVHRPIVE---PTPIA
A0A1I6MMC5      --------------------------------------EVSQATTVPLPVRERDYAELSA
A0A2V9D5W7      ----------------------------QL--------DSTRPIESESKDAPPS---GIG
A0A2V9D4I4      ----------------------------PF--------DAEPAPERELKTVASASANGAV
A0A2V9D6L7      ----------------------------PF--------DVELAPER--KSVAPASVIGCV
A0A2V8ZJV2      ----------------------------SA--------D--VRSELEL-LRRGPECTGPA
A0A2V9AWB5      ----------------------------EG--------DGEVRSEPESPLTQGIDLLPPV
A0A2V8Z1Y8      ----------------------------AE--------V--LGEIRRS-VPGPLETEVPR
A0A1Q8AX10      ----------------------------SD--------S--LLAEGAH-RDGGEWSALGM
A0A2V9A773      ----------------------------L-----------------GF-GDDGIAVAAGA
A0A2V9AND3      ----------------------------L-----------------RF-G--GERLAPGV
A0A2V9BTJ7      ----------------------------FL--------E--VA-DVPR-TAVPLRELDEP
A0A2V8W2M7      ----------------------------LA--------A--IAGSMQA-PAVPARQVAEQ
A0A2V8XNW2      ----------------------------LA--------A--IAGSMQA-PAVPARQVAEQ
A0A1Q7CJC1      ------------------------------------------------------------
A0A2V9UEM7      ----------------------------LEQPELQ---PVGMPEHAHMQTAVMP------
A0A1Q7V300      -----------------------------E-SIPQ---MVADQVVLEAIASSEN-----V
A0A2V9ZCI3      ----------------------------HV-GEM----PVMDPASVATGVAAAP------
A0A2V9WCB3      ----------------------------MA-AMP----MSEQPVFADTPPVPAMP-----
A0A2V9VQW5      -----------------------------T-PVMD---LPATESVPAMPETAQASKAAAP
A0A2V9WTP3      ----------------------------FS-GAES---PVTEPRVIDADTAARVAAVAPA
A0A2V9NLA9      ----------------------------LA-SAPE---VVPDP--ISMPVAAVPPLADER
A0A2V9RKJ9      ----------------------------LA-SAPE---VVPDP--VSMPVAAVPPLADER
A0A2V9RN95      ------------------------------------------------------------
A0A2V9N406      -----------------------------A-SISE---MVNES--AATAVAPAV-----E
A0A2V9U6D9      -----------------------------A-PIAE---MVNDP--AATAVAPAV-----E
A0A2V8DZN4      ------------------------------------------------------------
A0A3N5YKY1      ----------------------------PNVPPTVGVGGASAVPPAAAFPGAAGPTAAPA
A0A2G6HQA4      ----------------------------SLPGKKRRSVTSFNPPPVHDREPEKREDSLPG
A0A2V7ZTY7      ----------------------------GQGSRDCATGGQRPPDRTSAGQRPPDSAKAKR
A0A2V7ZVL9      ----------------------------GQGSRDCATGGKRPPDRTSAGQRPPDSAKAKR
A0A1Q7QYI4      ----------------------------------------------------PEADPKAE
A0A2V8G9Y9      ----------------------------------------------------PTSDSRVL
A0A143PNR5      -----------------------------------APWEFAEGTSARARS--GRPDARPE
A0A6A7L078      ----------------------------QPSPPPASPWVFPSDELGRAAPFEGSTPSSVE
A0A143PXU3      --------------------------------ADIDMPWQFADSPAAPPRASHPPEQRPT
A0A2V8D8G9      ----------------------------SRGSSSLN------------QYPNEEPDRHPL
A0A2V8ESQ4      ----------------------------SRGSSSLN------------QYPNEEPDRHPL
A0A1E3Y5Q0      --------------------------------PTVGWPAAPAPVEAFSSEGAERPRPRPV
A0A2W4TWK5      ----------------------------PVELPTEAFPAEPGQR----PEPSERPVRHAR
A0A3N5NYV3      ----------------------------KREKPPTSHPKLA--V----AEATAKLESAVQ
A0A2V2RJF9      ------------------------------------------------------------
A0A2G6HNT3      ------------------------------------------------------------
A0A2V7YWD4      ------------------------------------------------------------
A0A2V2R8T6      ------------------------------------------------------------
A0A1Q7RGF1      ------------------------------------------------------------
A0A2V9BLX2      ------------------------------------------------------------
A0A2V9ZA03      ------------------------------------------------------------
A0A3N5ZNH4      ------------------------------------------------------------
A0A2V8GEZ2      ------------------------------------------------------------
A0A3N5ZFD3      ------------------------------------------------------------
G8NXD3          ------------------------------------------------------------
A0A2V9VR38      ------------------------------------------------------------
A0A2V9EY04      ------------------------------------------------------------
A0A2V9HAK9      ------------------------------------------------------------
A0A1Q7FS15      ------------------------------------------------------------
A0A1Q7K9P1      ------------------------------------------------------------
A0A1Q7N989      ------------------------------------------------------------
A0A2V9G7Y0      ------------------------------------------------------------
A0A2V8T7Z1      ------------------------------------------------------------
A0A2V7U8G5      ------------------------------------------------------------
A0A2V7UNP9      ------------------------------------------------------------
A0A2V7VLD7      ------------------------------------------------------------
A0A2V7XGA3      ------------------------------------------------------------
A0A2V7YAG6      ------------------------------------------------------------
A0A2V7VK33      ------------------------------------------------------------
A0A3M1VTE1      ------------------------------------------------------------
A0A2V7TTM7      ------------------------------------------------------------
A0A2V8VI82      ------------------------------------------------------------
A0A2V7U4P9      ------------------------------------------------------------
A0A2V7TQY5      ------------------------------------------------------------
A0A2V7TU87      ------------------------------------------------------------
A0A2V8SEH0      ------------------------------------------------------------
A0A2V8VU54      ------------------------------------------------------------
A0A1Q7RML7      ------------------------------------------------------------
A0A1Q7ZIQ5      ------------------------------------------------------------
A0A2V8TKD8      ------------------------------------------------------------
                                                                            

A0A1F2U8T6      ERTLAAHLEEAKRDAQDLSRKSVGYNVLEREAKSHRTVYESLLQRTNELRVSSNSRANNV
A0A2V8BV42      ERVLAQNLDAAKGDAQDLSRKSVGYNVMERESKSNRLVYESLLQREKELRVSSNSRQNNV
A0A2V8F916      ERVLAQNLDAAKGDAQDLSRKSVGYNVMERESKSNRLVYESLLQREKELRVSSNSRQNNV
A0A1Q7K833      EQAYSRGLDSAKADAQDLSKKSVDYNVMEREAKTNRDIFQALMTREKELRVSSNSRQNNV
A0A1Q8AMY4      EQAYSRGLDSAKADAQDLSKKSVDYNVMEREAKTNRDIFQALMTREKELRVSSNSRQNNV
A0A2V8BM40      EQTFSRGLDSAKSAAQDLSRKSVDYNVMERDAKTNREIYSTLLTRERELRVSSNSRQNNV
A0A2V8CRT6      EQTFSRGLDSAKSAAQDLSRKSVDYNVMERDAKTNREIYSTLLTRERELRVSSNSRQNNV
A0A1F2VH76      ERTLTQALNEQKAAATDLSRKGVDYTLILREAESNREIYNSLLTREKELRVVANSRTNNI
A0A1F2R0X5      ERTLSQNLEAAKVEASDLNRKGIGYGVMEREAQSNRQVYEALLQREKELRVASNSRANNV
A0A2V8B278      EQTMARGLENAKADMQDLSKKSVDYNVMQRDSQTNRQIYDALLTRERELRVASNSRANNV
A0A2V8CEF9      EQTMARGLENAKADMQDLSKKSVDYNVMQRDSQTNRQIYDALLTRERELRVASNSRANNV
A0A2V8KZG2      ------------------------------------------------------------
A0A1Q7LG57      -----------------------------IGLFSGLFLGFGFVILRDRLDRRITAPGDAQ
A0A2V8YMQ4      ----------------------------------------------MAMGQAFAGCWIIQ
A0A1Q7L5B1      -----------------------------HSVVAEAGHGNRHEWLNRRVPTSEERAAAVS
A0A2V9DKV4      ----------------------------------MRTVGSRPYFQGRRNQT---------
A0A2V8W380      -----------------------------VALFLGLALGICAALFQERMDDTLKGDDDVE
A0A2V8ZIV5      -----------------------------VASLLGLGLGISAAFLQERLDDTLKGADDVE
A0A2V9EVA0      -----------------------------VAFWTEQREEELRPTSSFAPSEPSPRPSLTS
A0A1Q7RB73      ------------------------------------------------------------
A0A2V9K0H7      -----------------------------NGSPLDLERPTVIPGDGKGVAVLPPAELPSG
A0A3N5YN96      -----------------------------TVGVGGASAVPPAAAFPGAAGPTAAPASPAT
A0A1Q7Y646      -----------------------------HT-EEGVGSALSDVIASRAAGATLDAAGSAR
A0A2V8QZU0      -----------------------------HTVTPG-GSALPAA-ASRAAGATLGADGSAR
A0A2V8RSQ9      -----------------------------HTAQAGVGSALPGGVAARVAGATVDAVGSTR
A0A2V9LS17      -----------------------------GTAVPEKLPQSATGI----EPAALSELEEPG
A0A2V9AGR3      -----------------------------TDALSSSPVAPRNGKLF--APTTGIRDVMAP
A0A2V9G0N7      -----------------------------EGISRFAQARNEVGT----APKNGSGNAVKQ
A0A2V9GQ44      -----------------------------EGISRFAQARNEVGT----APKNGSGNAVKQ
A0A2V9HRN3      -----------------------------EGISRFAQARNEVGT----APKNGTSTAVKQ
A0A2V8WG13      -----------------------------TGLESPFGNKMQAGEPAVRSARVSEGSSF--
A0A2V8X987      -----------------------------AEIHRPVTVEPVVAVLAE-QPRATIGGGHTG
A0A1Q7KX94      -----------------------------GELRRPITQGPGIAQPTA-APRVPTGDNQDV
A0A2V8XHT0      -----------------------------GELRRPITQGPGIAQPTA-APRVPTGDNQDV
A0A2V9L2P7      -----------------------------VREALANSIKGAQEVENLIAAPALAIVPDVS
A0A2V7UMX0      -------------------------------------AGLPDQEVHGPQALGSREPAGRE
A0A136K497      -----------------------------RSAFDGQPNSSLGTALPDVETGLTAGAKPNA
A0A399W9E4      -----------------------------RSAFDGQPNSSLGTALPDVETGLTAGAKPNA
A0A2V7X0V9      ------------------------------VGAESPVMPDMASHRVPDPVAVAAMMPAFG
A0A2V9X518      ------------------------------AVEAAGMPPVIERAPLSTAASAAAAGPAFS
A0A2V9VC62      -----------------------------GMAEAADATRTAPTAPIPGAPGNGQKVPSFA
A0A2V9S1P8      ------------------------------VAEPLAATP---PAPQGTTASVGASIPSFG
A0A2V9RTW2      ------------------------------LSDTPTEAQVVASPSTGVAP------PSFA
A0A2V9TGF1      ------------------------------LSDTPTEAQVVASPSTGVAP------PSFA
A0A2V9XEV6      ------------------------------AVEAAGMPPVIERAPLSTAASAAAAGPAFS
A0A2V9Y3Q6      ------------------------------VMDPIQASTVVEHPPVAPSTGI----PPFS
A0A2V9R269      ------------------------------LETPEMPAGAVAGAVGR---------GIPG
A0A2V9PTS3      ------------------------------LEAPPETTPFLRSEPTE---------ARFA
A0A2V9NPF4      ------------------------------LEAPLETTPFLRSEPTE---------ARFA
A0A2V9PNZ0      ------------------------------LEAPLETTPFLRSEPTE---------ARFA
A0A321LMC5      ------------------------------------------------NSQPASSRREAR
A0A2V8X713      -------------------------------------DVAEPSPLGTLYPQMPGGAPTPE
A0A2V8ZLE9      -------------------------------------NTAVAREALHSPTPTPKGIPTVG
A0A2V8Y4D3      -------------------------------------GGSASAVSRALYSPKWGEIPAPG
A0A2V8Z2X8      -------------------------------------AGGVAGAHRILSSPIRAEMPMAG
A0A2V9C3F6      -------------------------------------ESEVAAASGVLHSPRRGEMPATG
A0A2V9QMU9      -----------------------------FALVLGLTTGVSLAFLLEGIDNTVRTPEQAQ
A0A2V9QY75      -----------------------------FAFALGLSSGIGLAFLLEGLDNTVRTPEQAQ
A0A2V9SVU9      -----------------------------FALALGLTTGVGLAFLLEGIDNTVRTPEQAQ
A0A2V8W5N5      -------------------------------------PAAETRA----RTETIPAPSRSA
A0A2V8XG53      -------------------------------------PAAETRA----RTETIPAPPRSA
A0A6A7LB89      ------------------------------------------------SRMNRSATTIRP
A0A2V9XV04      -------------------------------------G----------------------
A0A2V9CBY1      -------------------------------------GKTASRIPEILSAVTAEVAPPAR
A0A2V9D656      -------------------------------------GKAASRIPEILSAVRPEGAPPAR
A0A352EZH8      -------------------------------------AGQSSGA----VGATLDAARPAR
A0A0B6X033      -------------------------------------NGWASRV----AGATVDAERSAR
A0A2V8R0I3      -------------------------------------GGPASRD----AGATLGAVGSAR
A0A2V8N1U8      -------------------------------------GGPASRD----AGATLGAVSSTR
A0A2V8QL35      -------------------------------------AGTASRD----AGATLGAVGSAR
A0A352FU10      -------------------------------------AGTASRD----AGATLGAVGSAR
A0A2V8LCU0      -------------------------------------GGPAFRD----AGATLGAVGSAR
A0A1Q7NGT0      -------------------------------------GGPASRD----AGATLGAVGSAR
A0A2V8MLP9      -------------------------------------GGPASRD----AGATLGAVGSAR
A0A2V8PQZ0      -------------------------------------GGPASRD----AGATLGAVGSAR
A0A3B9MKY6      -------------------------------------GGKASRD----AGATLGAAGAAR
A0A3D5SKZ1      -------------------------------------GGKASRD----AGATLGAAGAAR
A0A2V8NRW2      -------------------------------------GVTASRA----AGATLDAAGTAR
A0A2V8TKR9      ------------------------------------------------------------
A0A2V8LBV1      --PDIYMYTMLGLAT-----------GVFLSILLIVRQARV-----DRTIQSPGEAPTYL
A0A2V8GAF9      GWPARVTREDVSTQL-------------------------------DQTATSSESARRAD
A0A2V8CN98      --NTAVRLLIMGLFA-----------GLGFGVVGAVVIDRF-----DPRVRYPAQVTTDM
A0A1Q7LC46      --PAKARNIMLAFLV-----------GLIGGIGLALMREYL-----DNTVKTPDDIESLA
A0A1Q8BDC5      --KVLGVFQTLGIIE-----------------TFADAEAPI-----PGALTRRDALVRTS
A0A2V9Q1Y8      --PNIPRNLGFALAL-----------GLTSGIGLAFLLEGI-----DNTVRTPEQAQLIS
A0A2V8JXG1      --PNRQRTILIGLLL-----------SLSGGIGLAWLLERF-----DDSIRSVDDVNRYT
A0A350D2W9      --PKKLRNLLLALFL-----------GLFGGAGLAFVMEYL-----DNTVKSAEEVGRYT
A0A2V9I4J1      ----------------------------------------------QDDTKGSAAVGGQS
A0A2V8PQZ9      --PA----------------------SRDAGATLGAVGSAR-----AAEFSSREVLAAR-
A0A2V8D8B1      --PNKLANMMLAFIG-----------GSVLAVALVFFFEYA-----DNRIKSPNEIKAHL
A0A3B9LSB4      --PNRSSTVSMALFL-----------SLGLGVGLALLLEYF-----DDTLRSSEEVERLL
A0A2V9H7U2      --PQKLYNIAVSIAV-----------GLILGVMLAFVKEAL-----DSSIKSIEEAERVV
A0A2V8NJB5      --RILGVFDQLGIIE----------------------LKSE-----NEFLSEHVAIVKRS
A0A2V9JMZ4      ----------------------------------------------QDDTKGSAAVGGQS
A0A2V9MDJ6      ----------------------------------------------QDDTKGSAAVGGQS
A0A2V8QJT6      --PARLRTVMFAFLL-----------ALAFGAALALFLEYL-----DDTVHSTDDVERFL
A0A2V8FSM8      --PDVVRRITFGLIF-----------GAMFGVAFSVLRERA-----DRTLQDPGDVSYYL
A0A359M0J2      --PSLFRELARGLGL-----------GLLLGYGCAFLHERVYRKRQERRFAAPGNSGRLL
A0A2V8JLJ1      --PNRRLIAALGGAA-----------GLVLGLAIAFLREFT-----DSSLHTEDELAAAI
A0A5M8SND8      --SGLITYSFGGLFF-----------GFLAGSAWVFTRSAA-----NRTFHSPGQSAVQV
A0A2V9GAQ1      --PAKARNMVLAFLV-----------GLVGGIGLALMREYL-----DNTVKTPDDVETHS
A0A497EDQ8      --PNLRRAVALGGVL-----------GLFLGIGLVLGLDFL-----DHTLRTPDQVERYL
G8NS05          --KSKSSIMMLNTII-----------GIVLGAILGFILESL-----DTNLHSVAEIEAVS
A0A2V8KZ20      --PNRRLIAALGGAA-----------GLVLGFGIAFLREFT-----DSSLHTEDELAAAI
A0A3D0NWU2      --PNRTRNIIVALLL-----------SLAAGIGLAFLLDYL-----DDSVKNSEEIGRQL
A0A2V8EPD9      --PARPVAASASNAP-----------------AASAAPRPA-----GAKRAPAWSREASI
A0A3N5NSX5      --PDVRRNYMLGALT-----------GLLLSLGLVLAIDYL-----DDTVKTPEDITRRL
A0A2V8MUA1      --PNRERMIMIGCLA-----------SFALGLALVFARELL-----DSTLSDEDTAASEL
A0A2V8MBH9      --PARMRSVMLAFVL-----------ALALGVGLALFLEYL-----DDSIHSTDDVEKFL
A0A3N5ZPQ7      --ACLQTLRALGMIE----------------------IREE-----ETEEERSVALTVRE
A0A3N5P5F2      --PNKQRDLLFGVMV-----------GLVAAIGMAFLFEYL-----DNKIKSPPEIRTYL
A0A2V9G1P7      --PKILLNLAVAMFL-----------GLGLGIGTALFQERM-----DNTLKGDDDVERLF
A0A2V9BCK9      --SANEAKPSDSLLAEGAHRDGGEWSALGMVSPVGPGIESP-----NSHHLRLDELRRRC
A0A2V9TMX2      --PNVHRSLVLGFLL-----------ALGLGVGLALVRETF-----DSTVRSMEEVRAVS
A0A2V8N2J7      --PQRVRLVALGVVA-----------GLGLGLALIFVLEQN-----DTTFGNVDDFESFS
A0A3N6BI26      --PQRAADLALGLGV-----------GLFLAIGLAFLMEYL-----DNTLKTPEDMEQSL
A0A2V9JMM3      --PKRERILLLGFVG-----------SLGLGVVLAFLVEQL-----DTSFDSADDFKTFT
A0A2V9M815      --PKRERILLLGFVG-----------SLGLGVVLAFLVEQL-----DTSFDSADDFKTFT
A0A2V9A795      --PRIPLNLAVAALL-----------GLGLGISTAFLQERL-----DDTLKGADDVERVF
A0A355ESH9      --PSLRKDLTYGLLI-----------GLLFGIGVALFLEFL-----DRTVKSPEEVERRF
A0A3D0NW85      --PSRTTTVLAALLL-----------STLFGMGLALFLEYL-----DDTIGTTEEIESYL
A0A353CAT5      --PRRLTTVLAALFL-----------STLFGMGLALFLEYL-----DDTIRTTEEIENYL
A0A2V9HB55      --PAKTRNLALAFLV-----------GLVGGIGLALLREYL-----DNTVKTPDDIETLA
A0A2V8CU57      --AAWSEAVTAPFAV------------VASSEPETVTAPFV-----VVAPSGPENVQ---
A0A2V8BDI4      --AAWSEAVTAPFAV------------VASSEKETVTAPFV-----VAAPSGPENVQ---
A0A2V8F8T3      --AAWSEAVTAPFAV------------VASSEPETVTAPFV-----VAAPSGPENVQ---
A0A2V9J901      ------------------------------------------------------------
A0A2V8MKQ7      ------------------------------------------------------------
A0A3M1SNQ5      ----------------------------------------------ITFTQAETLVFPRV
A0A2V8QJ59      ------------------------------------------------------------
A0A1Q7HTA7      ------------------------------------------------------------
A0A2W0B5E2      ------------------------------------------------------------
A0A2V8NMG8      ------------------------------------------------------------
A0A2V8TBM7      ------------------------------------------------------------
A0A1Q7HEZ8      ------------------------------------------------------------
A0A1Q7JW36      ------------------------------------------------------------
A0A1Q7MUR4      ------------------------------------------------------------
A0A3N5PFU4      ------------------------------------------------------------
A0A4R1LDF1      ----------------------------------------------SDLLYQPRHNHNLA
A0A1F2T1R8      ------------------------------------------------------------
A0A2V9BW09      ----------------------------------------------EQLGPQLPASPGKH
A0A3M1SSE1      ----------------------------------------------LGLPVLVVIPSMNA
A0A2V9GQV7      ------------------------------------------------------------
A0A2V7YV88      ------------------------------------------------------------
A0A2V8YCY6      ------------------------------------------------------------
A0A2V8EGM3      ------------------------------------------------------------
A0A2V8FGH1      ----------------------------------------------TGLHVIWPSLLARF
A0A2V8D468      ----------------------------------------------ELTFVVGLMFAVGL
A0A1F2R977      ----------------------------------------------EPPAPVRPEPAG--
A0A2U3LF12      -----------------------------------------------------------M
A0A3N5G7M6      ------------------------------------------------------------
A0A1F2S3Q7      ------------------------------------------------------------
A0A2V8GVG4      ------------------------------------------------------------
A0A2V8PJQ0      ----------------------------------------------LREGEAPTAGASTA
A0A2V8H566      ----------------------------------------------TSPFVRVEPPPGSA
A0A2V8UVN4      ----------------------------------------------DLPAAATAIDVAGL
A0A321LXF5      ----------------------------------------------IASQVVAARLENCR
A0A5M8SBZ0      ----------------------------------------------QPQALGMPSMVESE
A0A1Q7JFB1      ------------------------------------------------------------
A0A2V8DMJ9      ----------------------------------------------------HGLGLSQR
A0A2V8GGF6      ----------------------------------------------FSRAFRHGSG----
A0A2V8HKU7      ----------------------------------------------FSRAFRHGSG----
A0A1Q6Y875      ------------------------------------------------------------
A0A523DJA9      ----------------------------------------------IKTPDDVGRRLHLP
A0A2V8I604      ----------------------------------------------EPPAAPGWSAAAAV
A0A2V8J066      ----------------------------------------------ERREARARLAEQAS
A0A1I6MMC5      ----------------------------------------------GPGWPDVDVVASSV
A0A2V9D5W7      ----------------------------------------------SPRRVNILAPAATD
A0A2V9D4I4      ----------------------------------------------TETQISTSAAPSPE
A0A2V9D6L7      ------------------------------------------------TPVSTSASTSAE
A0A2V8ZJV2      ----------------------------------------------VSARGTTSGNEN-T
A0A2V9AWB5      ----------------------------------------------PSTRTEAVDSSTIA
A0A2V8Z1Y8      ----------------------------------------------PQAPPRIAGSREPA
A0A1Q8AX10      ----------------------------------------------VSPVGPGIESPNSH
A0A2V9A773      ----------------------------------------------MQSPRREEMPTAGR
A0A2V9AND3      ----------------------------------------------LQPSLQQEMPTARR
A0A2V9BTJ7      ----------------------------------------------TS--PERSPAKGGS
A0A2V8W2M7      ----------------------------------------------PARVTPPPPSEAGA
A0A2V8XNW2      ----------------------------------------------PARVTPPPPSEAGA
A0A1Q7CJC1      ------------------------------------------------------------
A0A2V9UEM7      -------------------------------------------------------PIQGS
A0A1Q7V300      ----------------------------------------------VPARSAISASAAVA
A0A2V9ZCI3      ---------------------------------------------------GPATPAFSS
A0A2V9WCB3      ------------------------------------------------ASMGLGMPTFGG
A0A2V9VQW5      ----------------------------------------------GTPGNGQGTPSFTT
A0A2V9WTP3      ----------------------------------------------VSAHASPGLPPFGS
A0A2V9NLA9      ----------------------------------------------DRRTVSAAMPSFGT
A0A2V9RKJ9      ----------------------------------------------DRRTVSAAMPSFGT
A0A2V9RN95      ------------------------------------------------------MPSFAS
A0A2V9N406      ----------------------------------------------HTPSAVSAVPSFSS
A0A2V9U6D9      ----------------------------------------------HTPSAVSAMPSFSS
A0A2V8DZN4      ----------------------------------------------MRSPAAALTGASAP
A0A3N5YKY1      ----------------------------------------------SPAAAPASFPGNGG
A0A2G6HQA4      ----------------------------------------------KKRRPEPSFSTRRN
A0A2V7ZTY7      ----------------------------------------------VEQALAAITAPAPD
A0A2V7ZVL9      ----------------------------------------------VEQALAAIMAPAPD
A0A1Q7QYI4      ----------------------------------------------RMSRALAALADTPP
A0A2V8G9Y9      ----------------------------------------------SQPAG-EPLTRVPD
A0A143PNR5      ----------------------------------------------TPNALIPEESGVPD
A0A6A7L078      ----------------------------------------------ARSETATNPSSVAH
A0A143PXU3      ----------------------------------------------SAPARVPEVARVDV
A0A2V8D8G9      ----------------------------------------------EEPASPDSFESAQP
A0A2V8ESQ4      ----------------------------------------------EEPASPDSFESAQP
A0A1E3Y5Q0      ----------------------------------------------TTVPEILPSRPPAS
A0A2W4TWK5      ----------------------------------------------PAMDAPVVDDEPEP
A0A3N5NYV3      ----------------------------------------------AEAASVATEAESEA
A0A2V2RJF9      ------------------------------------------------------------
A0A2G6HNT3      ------------------------------------------------------------
A0A2V7YWD4      ------------------------------------------------------------
A0A2V2R8T6      ------------------------------------------------------------
A0A1Q7RGF1      ------------------------------------------------------------
A0A2V9BLX2      ------------------------------------------------------------
A0A2V9ZA03      ------------------------------------------------------------
A0A3N5ZNH4      ------------------------------------------------------------
A0A2V8GEZ2      ------------------------------------------------------------
A0A3N5ZFD3      ------------------------------------------------------------
G8NXD3          ------------------------------------------------------------
A0A2V9VR38      ------------------------------------------------------------
A0A2V9EY04      ------------------------------------------------------------
A0A2V9HAK9      ------------------------------------------------------------
A0A1Q7FS15      ------------------------------------------------------------
A0A1Q7K9P1      ------------------------------------------------------------
A0A1Q7N989      ------------------------------------------------------------
A0A2V9G7Y0      ------------------------------------------------------------
A0A2V8T7Z1      ------------------------------------------------------------
A0A2V7U8G5      ------------------------------------------------------------
A0A2V7UNP9      ------------------------------------------------------------
A0A2V7VLD7      ------------------------------------------------------------
A0A2V7XGA3      ------------------------------------------------------------
A0A2V7YAG6      ------------------------------------------------------------
A0A2V7VK33      ------------------------------------------------------------
A0A3M1VTE1      ------------------------------------------------------------
A0A2V7TTM7      ------------------------------------------------------------
A0A2V8VI82      ------------------------------------------------------------
A0A2V7U4P9      ------------------------------------------------------------
A0A2V7TQY5      ------------------------------------------------------------
A0A2V7TU87      ------------------------------------------------------------
A0A2V8SEH0      ------------------------------------------------------------
A0A2V8VU54      ------------------------------------------------------------
A0A1Q7RML7      ------------------------------------------------------------
A0A1Q7ZIQ5      ------------------------------------------------------------
A0A2V8TKD8      ------------------------------------------------------------
                                                                            

A0A1F2U8T6      RLVERGEVPGSPVTPSGRRTWGLSVVVGLFAAIAVAYGLDYMNDTVKTPEDVTRFLKMTF
A0A2V8BV42      RIVDKAEVPQSPMTAGGRRTWMMSSLVGLVLAIGVAFGLDYMNDTIKTPEDVTRRLKLPF
A0A2V8F916      RIVDKAEVPQSPMTAGGRRTWMMSSLVGLVLAIGVAFGLDYMNDTIKTPEDVTRRLKLPF
A0A1Q7K833      RVVDHAEVPRGPLAPTGRRTWLLSLAVGLVLAVGVAYGLDYMNDTIKTPEDVARRLKLPF
A0A1Q8AMY4      RVVDHAEVPRGPLAPTGRRTWLLSLAVGLVLAVGVAYGLDYMNDTIKTPEDVARRLKLPF
A0A2V8BM40      RVIDHAEAPGGAMSPSGRRTWLLALGIGLALGIGLAYGLDYMNDTIKTPEDIARRLRLPF
A0A2V8CRT6      RVIDHAEAPGGAMSPSGRRTWLLALGIGLALGIGLAYGLDYMNDTIKTPEDIARRLRLPF
A0A1F2VH76      RLVDRAQVPGSPSSPNHRQDWIYALAFGLVFALGAAFGIDYLDDTVKTPEDITRRLKLRF
A0A1F2R0X5      RLVDRAEVPGSPVTPGGRRTWLLSIVVGLVLAVGVAMGLDYMNDTIKTPEDVTKRLRLPF
A0A2V8B278      RVVDRAEVPKAPLAPTGRRTWLLSLAVGLTLAIAVAYGLDYMNDTIKTPEEVTRRLRLPF
A0A2V8CEF9      RVVDRAEVPKAPLAPTGRRTWLLSLAVGLTLAIAVAYGLDYMNDTIKTPEEVTRRLRLPF
A0A2V8KZG2      ------------------------------------------------------------
A0A1Q7LG57      AYLDLPELGVIPFDQGGLAGQIAGRLHSHRPTRTLTSDTAPDSSAN--------------
A0A2V8YMQ4      SFLGPGRM----------------------ERR---------------------------
A0A1Q7L5B1      DFLGLNDL----------------------WQRCRKPGWTLDPTYS--------------
A0A2V9DKV4      -ILGLNDL----------------------WQRCRKPGWTLDPTYS--------------
A0A2V8W380      RLLGLPSL----------------------ALIPVVAPANGNHLGIHRFLPRDKSLVLAG
A0A2V8ZIV5      RLFGLPAL----------------------ALIPSVHHLNGDRSSVRKLLDSASTLRSSQ
A0A2V9EVA0      FAPGLNAL----------------------RQRCAKPAWKLHKDSL--------------
A0A1Q7RB73      ------------------------------MERCSQSLWNPARNMM--------------
A0A2V9K0H7      AAELRVLL----------------------MERCSQSLWNPDRKMM--------------
A0A3N5YN96      APASFPGN----------------------GGHQPLPIVVPNPVLAGGRRARSVTL----
A0A1Q7Y646      AIEFVS------------------------------------------RQISTARV----
A0A2V8QZU0      TPEFVT------------------------------------------LDISAARV----
A0A2V8RSQ9      DATYTS------------------------------------------IEVVTSRV----
A0A2V9LS17      SDLTLEVL----------------------ESQVRRFKWNPNVKTM--------------
A0A2V9AGR3      P--SFEVL----------------------ASRCVHLNWRLDPQVS--------------
A0A2V9G0N7      PCVRFEQL----------------------LKRCAHPKWTLDPARS--------------
A0A2V9GQ44      PCVRFEQL----------------------LKRCAHPKWTLDPARS--------------
A0A2V9HRN3      PCVRFEQL----------------------LKRCAHPKWTLDPARS--------------
A0A2V8WG13      --LDFDDL----------------------LRRCAHPNWHLDPRLN--------------
A0A2V8X987      S-MRYEEI----------------------VRRCSRPDWRLDPRAS--------------
A0A1Q7KX94      P-FHYEEL----------------------IKRCAQVEWRLDPVSS--------------
A0A2V8XHT0      P-FHYEEL----------------------IKRCAQVEWRLDPVSS--------------
A0A2V9L2P7      SSVTRSGL----------------------FAKRSEVKAKKAEMVE--------------
A0A2V7UMX0      RSTDPAVP----------------------QARVAEIPWKK-IDGR--------------
A0A136K497      DTLTRSAR----------------------RPLPDCVSWTVDAERV--------------
A0A399W9E4      DTLTRSHR----------------------RPLPDCVSWTVDAERV--------------
A0A2V7X0V9      SPFSVDTM----------------------LARCPQMEWKPDLGTM--------------
A0A2V9X518      NAFTFDTL----------------------LARCAQSEWNPDPKSM--------------
A0A2V9VC62      TSFTFDTL----------------------LARSAQADWKPDPTTM--------------
A0A2V9S1P8      SPYTLDTL----------------------LARCPQGRWSPDRKTM--------------
A0A2V9RTW2      APFTFDTL----------------------LARASQHDWTPDTNTM--------------
A0A2V9TGF1      APFTLDTL----------------------LARASQHDWTPDTNTM--------------
A0A2V9XEV6      NAFTFDTL----------------------LARCAQSEWNPDPKSM--------------
A0A2V9Y3Q6      NPFTFDTL----------------------LARCAQTNWSPDAKSM--------------
A0A2V9R269      MATGMEAL----------------------MTRSRETRWSPDPKKM--------------
A0A2V9PTS3      SGGIAESL----------------------LARSRQTAWNPDLKCM--------------
A0A2V9NPF4      SGGIAESL----------------------LARSRQTAWNPDLKSM--------------
A0A2V9PNZ0      SGGIAESL----------------------AARSRQTAWNPDLKCM--------------
A0A321LMC5      ASAAASNL----------------------RVGEFARNNQGFVEPRQSFSIHDLRV----
A0A2V8X713      FCLGLEEL----------------------RGRCAKPGWKMNPDYD--------------
A0A2V8ZLE9      RGLRLEEL----------------------RQRCIKPGWELNPDCD--------------
A0A2V8Y4D3      RRLRLEEL----------------------RQRSSKPGWKLNPDYD--------------
A0A2V8Z2X8      RCLGLEEL----------------------RHRCIKPGWKLNPDYD--------------
A0A2V9C3F6      RCLRLEEL----------------------RQRCIKPGWRLNPDYD--------------
A0A2V9QMU9      AISGLPSL----------------------GIIPDGSKLSIESSARRRLSLTSSRE----
A0A2V9QY75      AISGLPSL----------------------GMIPLGSKIGAEAGAKQGLVVASSKE----
A0A2V9SVU9      ALSALPSL----------------------GLIPLGLKAGVEMSMKQRLSVASSKE----
A0A2V8W5N5      PELRFDSL----------------------VAHCTRREWQPEPGKN--------------
A0A2V8XG53      PELRFDSL----------------------VAHCTRREWQPEPGKN--------------
A0A6A7LB89      SVTPRRRH----------------------ELLATFRGVNPEIEER--------------
A0A2V9XV04      -PSSLEML----------------------LGRCPQPGWNPDLQTM--------------
A0A2V9CBY1      -SLQLEEL----------------------QQRCAKPGWKPQLRWN--------------
A0A2V9D656      -LLQLEEL----------------------QQRCAKPVWKPQLRWN--------------
A0A352EZH8      -VSGLVSY----------------------DVDATR------VEPH--------------
A0A0B6X033      -VASFPAL----------------------DVSAAR------ADQH--------------
A0A2V8R0I3      -AARFRSR----------------------DILAAR------VEPH--------------
A0A2V8N1U8      -AAEFQSQ----------------------DISAAR------VEPH--------------
A0A2V8QL35      -AIEFSSR----------------------EVSAAR------VEPH--------------
A0A352FU10      -AVEFSSR----------------------EISTAR------VEPH--------------
A0A2V8LCU0      -AAEFSSR----------------------EISAAR------VEPH--------------
A0A1Q7NGT0      -AAEFSSR----------------------EVLAAR------VEPH--------------
A0A2V8MLP9      -AAEFSSR----------------------EVLVAR------VEPH--------------
A0A2V8PQZ0      -AAEFSSR----------------------EVLVAR------VEPH--------------
A0A3B9MKY6      -VDGFATY----------------------DISPAR------VEPH--------------
A0A3D5SKZ1      -VDGFATY----------------------DISPAR------VEPH--------------
A0A2V8NRW2      ALPEFMSL----------------------DISAAR------VEPH--------------
A0A2V8TKR9      ------------------------------------------------------------
A0A2V8LBV1      KVRELGVILSAEADSTLGRPGRS-----------KHIPSLQSLIQLGKPAGNGSFSKAVR
A0A2V8GAF9      AAARLREFVRANGERFQ-------------------------------------------
A0A2V8CN98      GLRILGALPHV-------------------------------------------------
A0A1Q7LC46      RLPSLAVVPQFTGLNGSKGRGVLPGLSSNGHE----------------------------
A0A1Q8BDC5      EFPLEELVPVVSNAT---------------------------------------------
A0A2V9Q1Y8      GLPSLGMIPLGSRTAAEANPTGLSVAASK-------------------------------
A0A2V8JXG1      QLPALAVIPAIGANNSLLNGRRRKDNAGELLALDSGDKPTAK------------------
A0A350D2W9      GLPTLGVVPVFGDDSNRAYGYYYSYGQKKGEEKGKGGKEDSGKP----------------
A0A2V9I4J1      RFPFEHLIPEISNAV---------------------------------------------
A0A2V8PQZ9      ------------------------------------------------------------
A0A2V8D8B1      GLPFLGMIPSLTDQ----------------------------------------------
A0A3B9LSB4      QLPALGVIPS------------------------ANASARRRLMGASGALQKRNGHS---
A0A2V9H7U2      NAPALAVVPLER----------------------EIPHRAARSLTRNNGTSKP-------
A0A2V8NJB5      GFPFDGLIPVISNAV---------------------------------------------
A0A2V9JMZ4      RFPFEHLIPEISNAV---------------------------------------------
A0A2V9MDJ6      RFPFEHLIPEISNAV---------------------------------------------
A0A2V8QJT6      RLPALAVIPAMS----------------------SASAPRRLLSSATSLQKRNSSNG---
A0A2V8FSM8      GVPELGVVPVGE---------------------------PIDLPRSGVRSPAAALTGASA
A0A359M0J2      NVPELGVIPSNAAPERFG----------------KQFFRIRVRRRKSKPLSLTGTGTAAP
A0A2V8JLJ1      KLPILASIPTVD----------------------EKRTRKRKSASVLRLQEHKGGSGPSP
A0A5M8SND8      QLRELGVIPRHSL---------------------SSNKAFARLLRSTDSGGEPALMAYRA
A0A2V9GAQ1      RLPSLAVVPQFT------------------------------------GSNGSGKHHGPL
A0A497EDQ8      GLEVLAALPKLT------------------------------------------------
G8NS05          GLHSLALIPRARRTGIDTSNLSV-------------------------------------
A0A2V8KZ20      KLPILASIPTVD----------------------EKRTRKRKSASVLRLQEHKGGSGHSP
A0A3D0NWU2      GLPTLALIPHYF----------------------GSEKKRLRLAAENGGS----------
A0A2V8EPD9      EKPIVHAAPT-------------------------------------GSSLIAVPASADQ
A0A3N5NSX5      KLPFLGLVPAVK------------------------------------------------
A0A2V8MUA1      KLPVLACVPNI-----------------------PAGRKKRRERTNSKAGMVAVSVGHDS
A0A2V8MBH9      RLPALAVIPSMS----------------------GGVARRRRLLSSATALQKRNGNTS--
A0A3N5ZPQ7      RLPLEQLVPEAADAL---------------------------------------------
A0A3N5P5F2      NLPCLGLVPRIAGKH---------------------------------------------
A0A2V9G1P7      GLPSLALIPVVPPSDSDQHGIHRFLPRDKAFEFKGNGAGKNSHS----------------
A0A2V9BCK9      ATPGWKLNPDY-------------------------------------------------
A0A2V9TMX2      TLPALGTIPLQLVT--------------------DERFRKRRLTISPDGERS--------
A0A2V8N2J7      TLPVAGIVPNIQNRNKKR------------------------------------------
A0A3N6BI26      GLPSLGVIPAMA----------------------DLPAGSSRLLASRNESGDS-------
A0A2V9JMM3      NLPLLAVIPSVR----------------------SKSRSGRKLPEGGKGDPHLPQPNLRH
A0A2V9M815      NLPLLAVIPSVR----------------------SKSRSGRKLPEGGKGDPHLPQPNLRH
A0A2V9A795      GLSALALIPSVHHLNGDRPSV-------------SSLLGRTNLLRSGQNGTASNPAA---
A0A355ESH9      SIATLAVIQDIAETGKAYGSPAYGYGYGYGYGYGDPPTGEPSRVRPTKGKAKVAGGGWLE
A0A3D0NW85      QLPALAAIPSI------------------------DSMPKRKLLLVGGSDRPDEE-----
A0A353CAT5      QLPALAAIPTI------------------------DSMPKRRLLLVGNAERPAE------
A0A2V9HB55      RLPSLAVVPQFTGS--------------------NGHAKKRGLLQGPAAN----------
A0A2V8CU57      --PPLPPLPTW-DF--------------------DGSVAAAELVEAPDEPKVVTPSDWKT
A0A2V8BDI4      --PPLPPLPTW-DF--------------------DGSVAAAELVEAPDEPKVVTPSDWKT
A0A2V8F8T3      --PPLPPLPTW-DF--------------------DGSVAAAELVEAPDEPKVVTPSDWKT
A0A2V9J901      ------------------------------------------------------------
A0A2V8MKQ7      ------------------------------------------------------------
A0A3M1SNQ5      EIDPEIVHQR--------------------------------------------------
A0A2V8QJ59      ------------------------------------------------------------
A0A1Q7HTA7      ------------------------------------------------------------
A0A2W0B5E2      ------------------------------------------------------------
A0A2V8NMG8      ------------------------------------------------------------
A0A2V8TBM7      ------------------------------------------------------------
A0A1Q7HEZ8      ------------------------------------------------------------
A0A1Q7JW36      ------------------------------------------------------------
A0A1Q7MUR4      ------------------------------------------------------------
A0A3N5PFU4      --------------------------------------MNT-------------------
A0A4R1LDF1      DVQSDIILAH--------------------------------------------------
A0A1F2T1R8      --------------------------------------MPT-------------------
A0A2V9BW09      PVGFEDVKRV--------------------------RWPMD-------------------
A0A3M1SSE1      AQKRRLLLVE---------------------SSDNEPASKN-------------------
A0A2V9GQV7      --------------------------------------NGN-------------------
A0A2V7YV88      ------------------------------------------------------------
A0A2V8YCY6      ------------------------------------------------------------
A0A2V8EGM3      ------------------------------------------------------------
A0A2V8FGH1      KNEWRDRLAI--------------------------------------------------
A0A2V8D468      ALFVEYLDDR-----IKTPDEIWMHLGLKTLGLVPRVTPEL-------------------
A0A1F2R977      -------------------------------RRVQLGPFDP-------------------
A0A2U3LF12      RPETPKLKDD---------------------GITPEERRHF-------------------
A0A3N5G7M6      ------------------------------------------------------------
A0A1F2S3Q7      -----------------------------------MHSMAT-------------------
A0A2V8GVG4      -----------------------------------MAKKAQ-------------------
A0A2V8PJQ0      LAMVEDVRSH--------------------------------------------------
A0A2V8H566      RFRHAGAGAA-----------------------------GR-------------------
A0A2V8UVN4      ESARRAAAET----------------VEAVPGIRTVALHLS-------------------
A0A321LXF5      SIRLPRDNEQ--------------------------------------------------
A0A5M8SBZ0      KTHSDNAFSR---------------------VSRPDWQAAN-------------------
A0A1Q7JFB1      ------------------------------------------------------------
A0A2V8DMJ9      PALCDVTADR-----------------------------AR-------------------
A0A2V8GGF6      ---------R-----------------------------EA-------------------
A0A2V8HKU7      ---------R-----------------------------EA-------------------
A0A1Q6Y875      ------MRQR---------------------CAKPAWKLHK-------------------
A0A523DJA9      MLGLVPVGPG---------------------AHPPVLPAEV-------------------
A0A2V8I604      APPVVQIDRR---------------------LAAAL------------------------
A0A2V8J066      PHREVNLDRH---------------------LVAAL------------------------
A0A1I6MMC5      LNGLPSDPAK---------------------IAVKRWKPLL-------------------
A0A2V9D5W7      PLELDDLRKR---------------------CSYPEWSFDP-------------------
A0A2V9D4I4      PLRFEDLQRQ---------------------CTRSEWRPDP-------------------
A0A2V9D6L7      PLEFDDLQRR---------------------CTRPRWRPEP-------------------
A0A2V8ZJV2      LLCFEELGKR---------------------CVKLEWQIDP-------------------
A0A2V9AWB5      SFSFEELNKR---------------------CARKEWRLDP-------------------
A0A2V8Z1Y8      PSCFGELVKR---------------------CAHPEWWPYR-------------------
A0A1Q8AX10      HLRLDELRRR---------------------CATPGWKLNP-------------------
A0A2V9A773      CLRLEELRQR---------------------CIKPGWKLSP-------------------
A0A2V9AND3      CLGLEELRRR---------------------CLKPGWKLNA-------------------
A0A2V9BTJ7      FLRYEDLIKG---------------------CARPIWKTDA-------------------
A0A2V8W2M7      FLRFDDLVKR---------------------CAHPTWKPDM-------------------
A0A2V8XNW2      FLRFDDLVKR---------------------CAHPTWKPDM-------------------
A0A1Q7CJC1      ----------------------------------------M-------------------
A0A2V9UEM7      SFSYESLLAR---------------------CPVSNWNPDT-------------------
A0A1Q7V300      ATTSDILVAR---------------------SRRTEWRPNP-------------------
A0A2V9ZCI3      QFTFDTLLAR---------------------CVSVNWHPDE-------------------
A0A2V9WCB3      GLNMDTLLAR---------------------CPRTEWTPDP-------------------
A0A2V9VQW5      SFTFDTLLAR---------------------CAQGEWKPDE-------------------
A0A2V9WTP3      PFSLETMLAR---------------------CAAVQWSPDP-------------------
A0A2V9NLA9      GLSVESLLSR---------------------CVAGHWTPDR-------------------
A0A2V9RKJ9      GLSVESLLSR---------------------CVAGHWTPDR-------------------
A0A2V9RN95      PFTFDALLAR---------------------SAQARWSPDS-------------------
A0A2V9N406      PFTFDTLLAS---------------------CAQARWSPDS-------------------
A0A2V9U6D9      PFTFDTLLAR---------------------CAQARWSPDS-------------------
A0A2V8DZN4      AAPGLSVAHR------------------------VEL-----------------------
A0A3N5YKY1      HQPLPIVVPN---------PVLAGGRRARSVTLHPLL-----------------------
A0A2G6HQA4      SSPVHQRKPE----------------KTIEEDWEERF-----------------------
A0A2V7ZTY7      AAPARVTPDG---------------------VVAERL-----------------------
A0A2V7ZVL9      AAPARVTPDG---------------------VVAERL-----------------------
A0A1Q7QYI4      PVSTASSPTN---------VRTAGFY-------AEKL-----------------------
A0A2V8G9Y9      TLSVQRADQDWVAELEIQKHRTLGVFHGFGANAVDKL-----------------------
A0A143PNR5      EVTLPPASSA---TGAIPEGGLFVSLDG------DER-----------------------
A0A6A7L078      -VPRRPSTDP---GGLRRADGELAVFRGFSPAVLDRL-----------------------
A0A143PXU3      KPLPEQVQRS------------------VDDVPTARL-----------------------
A0A2V8D8G9      FRP--ASTSR------------------RTATRRAKLPNSA-------------------
A0A2V8ESQ4      FRP--ASTSR------------------RTATRRAKLPNSA-------------------
A0A1E3Y5Q0      GAPSSPVGER------------------IAADLANKI-----------------------
A0A2W4TWK5      ALP--PLEGR------------------IAPALERKV-----------------------
A0A3N5NYV3      TAP--RVTSS------------------VTSLIAEKL-----------------------
A0A2V2RJF9      --------------------------------------------DSDSDNGSSRQKHLAK
A0A2G6HNT3      ----------MEKFSKIMEKAGVETSYKLHNKEKESFRPKKRVQPKPVASVAREKKRPRP
A0A2V7YWD4      --------------------------------------------MDVVRTKSMTATLVTD
A0A2V2R8T6      ---------------------------------------------------AGAARAGGF
A0A1Q7RGF1      -MSKYFDQTFKTRDAGTDPEKLQITGIDKFLETGSSFKNSAPGMGAS----GDLGESRLG
A0A2V9BLX2      -MSKYFDQTFKTRDAGTDPEKLQITGIDKFLETGSSFKNSAPGMGAS----GDLGESRLG
A0A2V9ZA03      ------------------------------MMKDLGLTRNAAASPRMLHDLDSDLAVSNE
A0A3N5ZNH4      -------------------------------------------MPSLGVIPTIAKPGRTQ
A0A2V8GEZ2      ------------------------------------MHDFASSVEQPFRIAPVDRGNG--
A0A3N5ZFD3      -----------------------------------MAEALSASPAEPRSAAAQPRATGPM
G8NXD3          -------------MITLNLREYQTIEPHLMIASASNGDAGSPHKHQNAVVDRPASDQSDA
A0A2V9VR38      ---------------------------------------MFGHDPARFQVSPRGAQSQTV
A0A2V9EY04      -MSKFFNETQKANQWAQSKLPEPDRDVREMLESIKQGSILETATANAQLPQCQQVQVGNG
A0A2V9HAK9      -------------------------------ESLKQGPPINAPPAEARLARSRQVTLGNG
A0A1Q7FS15      -MSKFFNETQKANQWTQQKLANQDMDVKEMLESLKQGPASGTQLADARLNECRQVHVGNG
A0A1Q7K9P1      -MSKFFNETQKANQWTQQKLANQDMDVKEMLESLKQGPASGTQLADARLNECRQVHVGNG
A0A1Q7N989      -MSKFFNETQKANQWTQQKLANQDMDVKEMLESLKQGPASGTQLADARLNECRQVHVGNG
A0A2V9G7Y0      -MSKFFNETQKAHQWAQQKLVNQDLDVRQILASLKQGPANDAPPAGARLAHCRHVALGNG
A0A2V8T7Z1      ----------------------------------------MMSRPSIEAERSVVSHPAAR
A0A2V7U8G5      --------------MPMARSR-GPRPVSLD--FELHRLSTPPTSG---------------
A0A2V7UNP9      ------------------MRT-NSRPVSMSQYLELERRSPGDARGEPLIADSAESRPGRD
A0A2V7VLD7      ------------------MRT-NSRPVSMSQYLELERRSPGDARGEPLIADSAESRPGRD
A0A2V7XGA3      --------------MTTPTTLGDPASLSAVRTSEPSPRAQAETAR---------------
A0A2V7YAG6      -MAWLPPWRQAGPDMSMPTTL-DPAPMGAARAPEDSRRSNGGTGT---------------
A0A2V7VK33      ----------------MLSISPTRDPEAPPSAPTRGRGSNEPPRTAP-------------
A0A3M1VTE1      -----------------------MTAGGSGRGADRGSPTRYAIGAGV--------GARPR
A0A2V7TTM7      ----------------MYRVGNPLLKSRSLVPASEDDDVTREAPAGR--PRPSVGPSPEN
A0A2V8VI82      ----------------MREAETGSGAGTQPDAGQPTRTVRSAPSHGP-------------
A0A2V7U4P9      ----------------MSIKPPEEMLSSAVPAGEKGGPVSETPRRGP-------------
A0A2V7TQY5      --------------------------MRARRGRGPPGARRRHRRIEAPGRRQLPAGRRAG
A0A2V7TU87      ---------------------------------------------------------MSR
A0A2V8SEH0      -------------------------MNATLTPRQPEGSAHAARRAGPRRPEAAAPAARPI
A0A2V8VU54      --------------------------MSGYIDAKPDGSVDLMGRSRT---------ATET
A0A1Q7RML7      --------------------------MSAFSGGDRDHTSDRSERACP---------APSA
A0A1Q7ZIQ5      --------------------------MSAFSGGDRDHTSDRSERACP---------APSA
A0A2V8TKD8      --------------------------MSAFSGGDRDHTSDRSERACP---------AQSA
                                                                            

A0A1F2U8T6      LGLVPSVRGDK-HPLMASWDTPKHFG-------EAFRNL-RTA-IIA-LY-PGDG-PKTM
A0A2V8BV42      LGLVPSVRGDK-HPLLTSAHVPHDFG-------EAFRAL-RTS-LIS-KY-PATG-TKTL
A0A2V8F916      LGLVPSVRGDK-HPLLTSAHVPHDFG-------EAFRAL-RTS-LIS-KY-PATG-TKTL
A0A1Q7K833      LGLVPSVRGDK-HPVLASSHVPHDFG-------ESFRAL-RTS-LMS-KY-PGEG-TKIL
A0A1Q8AMY4      LGLVPSVRGDK-HPVLASSHVPHDFG-------ESFRAL-RTS-LMS-KY-PGEG-TKIL
A0A2V8BM40      LGLVPSVRGDA-HPVLASSNVPHNFG-------ESFRAL-RTS-LTS-KY-PTDG-TKII
A0A2V8CRT6      LGLVPSVRGDA-HPVLASSNVPHNFG-------ESFRAL-RTS-LTS-KY-PTDG-TKII
A0A1F2VH76      LGLVPAVRGDR-HPLLSGP-VPHDFG-------EAFRTL-RTA-LVS-QL-PGDG-PKVM
A0A1F2R0X5      LGLVPSVRGAKQQPLLTSSHAPVDFS-------ESFRSL-RTT-LLT-RY-SGEG-TKLM
A0A2V8B278      LGLVPSVRGDK-HPLLASSHVPHDFG-------ESFRAL-RTA-LVS-KY-PSAG-TKIV
A0A2V8CEF9      LGLVPSVRGDK-HPLLASSHVPHDFG-------ESFRAL-RTA-LIS-KY-PSAG-TKIV
A0A2V8KZG2      ------------------------------------------------------------
A0A1Q7LG57      ----------W-PELATWKRKPSFLA-------ECARTT-LTS-ILL-PS-QNGDCPGVV
A0A2V8YMQ4      --------------VTLARAGTALIK-------EDSVLL-ST---------ADHP-PGSL
A0A1Q7L5B1      --------------AFSNSKSFTSCA-------EQFSKL-RTR-LYE-FR-DNEP-LHTL
A0A2V9DKV4      --------------AFSNSKSFTSCA-------EQFSKL-RTR-LYE-FR-DNEP-LHTL
A0A2V8W380      NGSGKNSRS-W-HLIDRDGAQHAALG-------EAFRSL-RTS-VLL-ST-PDRP-PSSL
A0A2V8ZIV5      NGTASTPGAYW-HRIDQRGKPQAALV-------EAFRSL-RAS-VLL-ST-ADHP-PGSL
A0A2V9EVA0      --------------VLFNEQSFDRCA-------EQFRIL-RAR-LYR-LR-EKKP-FRTL
A0A1Q7RB73      --------------LFFDRRNPVVGV-------EEFRTL-RSH-LTL-IR-ERQP-LQSL
A0A2V9K0H7      --------------LFFDRRNPVVGV-------EEFRTL-RSH-LSL-IR-EQLP-LQSL
A0A3N5YN96      ----------H-PLLAAALEFGSPAA-------EQFRAL-RTR-IGQ-VEFGGRD-CRSL
A0A1Q7Y646      ----------E-PHLVAITQPRSPYC-------EQFRSL-RTR-LLQ-AS-ERRK-MQAF
A0A2V8QZU0      ----------E-PHLIAITQPRSAHA-------ERFRSL-RTR-VLH-AG-ERKK-MQAF
A0A2V8RSQ9      ----------E-PHLVAITDPRSPHA-------EQYRSL-RTR-VLH-AG-ERRK-VQAI
A0A2V9LS17      --------------LFFGEENYALGT-------EEFRTL-RSH-LFG-LN-ETSA-TRSL
A0A2V9AGR3      --------------LVDGGESETGGA-------ERFRTL-RSR-LFQ-IA-ATRP-LRRV
A0A2V9G0N7      --------------VFGGPDSKKLGA-------EPFRTL-RSR-LSQ-IA-GTHV-LKRI
A0A2V9GQ44      --------------VFGGPDSKKFGA-------EPFRTL-RSR-LSQ-IA-GTHV-LKRI
A0A2V9HRN3      --------------VFGGTDSKKFGA-------EPFRTL-RSR-LSQ-IA-GTRV-LKRI
A0A2V8WG13      --------------IFLKTDEGRIGR-------ERFRTL-RSR-LYQ-IA-ATRP-LKRV
A0A2V8X987      --------------AFQDSNSGHSGA-------ERFRTL-RSR-LSQ-IA-GTRT-LRRL
A0A1Q7KX94      --------------VFLNSKPGEGGP-------ERFRTL-RSR-LYK-IA-STRK-LQKV
A0A2V8XHT0      --------------VFLNSKPGEGGP-------ERFRTL-RSR-LYK-IA-STRK-LQKV
A0A2V9L2P7      --------------LSVLKNPGASIS-------EAFRTL-RTS-ILL-ST-AERP-PQLL
A0A2V7UMX0      --------------LVSLTAPTSPEA-------HQYRVL-GHQ-LER-LR-REGG-LRLV
A0A136K497      ----------E-PRLVAITSPNSSYC-------EEYRSL-RTH-VLH-KS-QRQH-LKSI
A0A399W9E4      ----------E-PRLVAITSPNSSYC-------EEYRSL-RTN-VLH-KS-QRQN-LQAI
A0A2V7X0V9      --------------LFMNGDDSKRGT-------EEFRTL-RSR-LYH-MR-EKMT-LKKL
A0A2V9X518      --------------LFFNDDERKYGA-------EEFRTL-RSR-LYQ-MR-EKMP-LKKV
A0A2V9VC62      --------------LFFSQEDNALGT-------EQFRTL-RSR-LYQ-LR-EKIS-LKKI
A0A2V9S1P8      --------------LFFNPEEQEYGN-------EEFRTL-RSR-LYQ-IR-EKQS-LKKV
A0A2V9RTW2      --------------LFFKAEEQGFGT-------EEFRTL-RSR-LYQ-MR-EKQA-LKKV
A0A2V9TGF1      --------------LFFKAEEQGFGT-------EEFRTL-RSR-LYQ-MR-EKQA-LKKV
A0A2V9XEV6      --------------LFFNDDERKYGA-------EEFRTL-RSR-LYQ-MR-EKMP-LKKV
A0A2V9Y3Q6      --------------LFFNSDERKYGV-------EEFRTL-RSR-LYQ-LR-EKMS-LKKL
A0A2V9R269      --------------LFFGTEEHASGM-------EEFRTL-RSR-LYQ-AR-EKQP-LSKL
A0A2V9PTS3      --------------LFFSGEEHGSGM-------EEFRTL-RTR-LYQ-IR-EKQPLLSKL
A0A2V9NPF4      --------------LFFSGEEHGSGM-------EEFRTL-RTR-LYQ-IR-EKQPLLSKL
A0A2V9PNZ0      --------------LFFSGEEHGSGM-------EEFRTL-RTR-LYQ-IR-EKQPLLSKL
A0A321LMC5      ----------D-QHLAGLIERDDLAR-------ERYNTL-AVR-LIN-LA-AKHN-RRSL
A0A2V8X713      --------------VFSAKQTSFPCA-------EQFRTL-RAR-LYR-LR-EKNP-IRIL
A0A2V8ZLE9      --------------VFSTKQSSSLCA-------EQFRTL-RSH-LYR-LR-EKNP-IRTL
A0A2V8Y4D3      --------------AFSPQHSSALCA-------EQFRTL-RSR-LYR-LK-EKSP-LRTL
A0A2V8Z2X8      --------------VFSTKQSSALCA-------EQFRTL-RSR-LDR-LR-KKSA-IRTL
A0A2V9C3F6      --------------VFSTQQSSALCA-------EQFRTL-RSR-LYR-LR-EKSP-IRTL
A0A2V9QMU9      ----------A-IELVTQSRPQSQMA-------EAYRAL-RTA-LLL-SS-VGAA-PKVV
A0A2V9QY75      ----------P-VELITQARPQSQMA-------ESYRAL-RTS-LLL-TS-LGAP-PKII
A0A2V9SVU9      ----------V-VELITQSRPQSQMA-------ESYRAL-RTS-LLL-TS-LGAP-PKVI
A0A2V8W5N5      --------------VFSNAAATACGA-------EQFRTL-RSR-LYQ-IR-GNQP-SYTL
A0A2V8XG53      --------------VFSNAAATACGA-------EQFRTL-RSR-LYQ-IR-GNQP-SYTL
A0A6A7LB89      --------------IVASGSVSAEGV-------EQYRQL-AAT-THQ-AQ-LTHG-VRVV
A0A2V9XV04      --------------LFMNGNDSAKGT-------EEYRTL-RSR-LYH-IR-EKMP-LKKL
A0A2V9CBY1      --------------VFSNERSCKRQA-------EQFHTL-RAR-LYS-LR-DTRP-IQTL
A0A2V9D656      --------------VFPKERPCGRQA-------EQFHSL-RAR-LYS-LR-DTRP-IQTL
A0A352EZH8      --------------LVAITQPRSAYC-------EQFRSL-RTR-VLQ-AG-EREQ-MRTF
A0A0B6X033      --------------LIAITQPQSPEC-------EQFRSL-RTH-VLH-AG-EKRQ-VQAV
A0A2V8R0I3      --------------LVAITQPRSPEC-------EQFRAL-RTR-LLE-AG-ERKR-MRAF
A0A2V8N1U8      --------------LVAITSPRSPEC-------EQFRSL-RTR-LLQ-AS-ERER-KRAF
A0A2V8QL35      --------------LVALTDPRSVAC-------EQFRAL-RTQ-LLQ-AG-EREH-KRAF
A0A352FU10      --------------LVAITDPRSPEC-------EQFRAL-RTR-LLQ-AG-EREH-KHAF
A0A2V8LCU0      --------------LVAVTSPHSPEC-------EQFRAL-RTR-LLQ-AG-ERQG-KRAF
A0A1Q7NGT0      --------------LLAITEPRSAEC-------EQYRSL-RTR-LLQ-AG-ERQR-MRAF
A0A2V8MLP9      --------------LLAITEPRSPEC-------EQYRSL-RTR-LLQ-AG-ERQR-MRAF
A0A2V8PQZ0      --------------LLAITEPRSPEC-------EQYRSL-RTR-LLQ-AG-ERQR-MRAF
A0A3B9MKY6      --------------LVAVSQPRSPYC-------EQFRSL-RTK-LLQ-AG-ERKQ-MRAF
A0A3D5SKZ1      --------------LVAVSQPRSPYC-------EQFRSL-RTK-LLQ-AG-ERKQ-MRAF
A0A2V8NRW2      --------------LIAVTQPRSAYC-------EQFRSL-RTR-VLQ-AS-ERKK-MQAF
A0A2V8TKR9      ------------------------------------MLL---------SA-AGSP-PKIV
A0A2V8LBV1      KYAGENRAPKR-VELMTWEKRSSLFA-------ECFRTT-AAS-LLFSEP-NGAP-PHVL
A0A2V8GAF9      ---------IA-EQLVSLIAPGSFAA-------DQYRAL-RHN-LER-LR-RESG-LQVL
A0A2V8CN98      ---------KK-RAGASDDESGALVI-------ETMRGV-RLS-LIH-AY-GTAG-PLVV
A0A1Q7LC46      ---------RR-IELVAQHLPKSQMS-------EAFRAL-RTS-ILL-SQ-ADHP-PQVI
A0A1Q8BDC5      ---------LA-EKLQIARSEMSFTS-------EQFKNL-KVQ-LRD-AA-SKAS-LKVL
A0A2V9Q1Y8      ---------EA-VELITISRPQSQMS-------ESYRAL-RTS-LLL-TS-LGAP-PKTI
A0A2V8JXG1      ---------MQ-RARLMEFDGRSPAS-------EAYRAL-RTA-LLL-SA-AGNP-PKTI
A0A350D2W9      ---------KN-IELIVHFAPESAFA-------ENYRSL-RTA-LLL-SS-PQGS-LKTI
A0A2V9I4J1      ---------LS-EKLEVLKNEFSFVS-------EQFKAL-KVR-INE-TQ-ADHA-VQTI
A0A2V8PQZ9      ---------VE-PHLLAITEPRSAEC-------EQYRSL-RTC-LLQ-AG-ERQR-MRAF
A0A2V8D8B1      ---------VE-GTPLLDNGVNAGFA-------EAFRMV-RTN-LVF-ST-VDNG-TQSI
A0A3B9LSB4      ---------DS-PELLMNVDGHSPLA-------EAYRHL-RTS-VLL-ST-AGRA-PRSL
A0A2V9H7U2      ---------GD-AELALLKQPSSALA-------ESFRTL-LTS-VVL-ST-APRP-PQVL
A0A2V8NJB5      ---------VS-DKLEVLKNSSSFIS-------EQFRNL-KVR-I---NE-SDNP-AQVM
A0A2V9JMZ4      ---------LS-EKLEVLKNEFSFVS-------EQFKAL-KVR-INE-TQ-ADHA-VQTI
A0A2V9MDJ6      ---------LS-EKLEVLKNEFSFVS-------EQFKAL-KVR-INE-TQ-ADHA-VQTI
A0A2V8QJT6      ---------AN-PELLLNINGRSALA-------EAYRQL-RTS-VLL-ST-AGRA-PKTL
A0A2V8FSM8      PAAPGLSVAHR-VELISFRQKTSLLA-------ESFRTT-LTS-ILFSQR-NGAY-PRVL
A0A359M0J2      AAETPPSNPRL-EFLEIWKGKPSIVA-------ESFRLT-LTS-LTRSGP-GSLA-PGLV
A0A2V8JLJ1      LRHV-----DN-KITDAILNPSCSAR-------EHYRFL-HSQ-LLA-MQ-RKKH-LKTI
A0A5M8SND8      ---------NQ-AELAGFAERSGMVA-------ESFRML-LAS-IMFGEE-GGKT-PQVL
A0A2V9GAQ1      LGFSSNGHEKR-MELVAHHLPKSQMS-------EAFRAL-RTS-ILL-SQ-ADHP-PQVI
A0A497EDQ8      ------------------DDNSRALR-------EAFQTL-RTA-LML-AA-RDEG-CQIL
G8NS05          ---------IQ-RNLATLSSPKSQFT-------EAFRGL-RTS-LLL-ST-AGKL-PKVI
A0A2V8KZ20      LRHV-----DN-KITDAILNPSCSAR-------EHYRFL-HSQ-LLA-MQ-RKKH-LKTI
A0A3D0NWU2      ---------PG-TSLVALEERHSPMA-------EAYRHL-RTS-LLF-SS-AGKP-PQSI
A0A2V8EPD9      LTLWRSDPETA-GKLVGTDGFLPSAM-------EQYRKL-AAI-LHH-AQ-MERG-LKVI
A0A3N5NSX5      ---------GN-NHPLLSQEVPHEFG-------EAFRAL-RTS-LVF-SS-GTEG-TRVI
A0A2V8MUA1      INKFSLDYADI-RIKKVVLDPLTVSG-------EQFRVV-RAQ-LSA-LQ-KKRN-LSRI
A0A2V8MBH9      ---------GT-PELLLNVNGRSALA-------ESYRQL-RTS-VLL-ST-AGRA-PKTL
A0A3N5ZPQ7      ---------LS-QQLETVTNEHSFAS-------EQFASL-KVR-IKE-SR-AGSP-HKVI
A0A3N5P5F2      ---------GS-SPLLLNNGAPDSFA-------EAFRAV-RSN-VLF-SV-S-PE-CRRL
A0A2V9G1P7      ---------YW-HRIDRDETQHASLV-------EAFRNL-RTS-VLL-ST-PDRP-PSSL
A0A2V9BCK9      --------------AVFCKQSLAVCA-------EQFRTL-RSR-LYR-LR-DKQP-VRTL
A0A2V9TMX2      ---------GM-LALVTYERPKSEAA-------EAYRAL-RTS-ILL-SS-FGAP-PKVI
A0A2V8N2J7      ---------TQ-PSVVTVEEPDSIAA-------EQYRIL-AMR-VQQ-QC-DAAQ-AKTV
A0A3N6BI26      ---------KT-DLPAAISPARFRVW-------EAYRSL-RTS-ILL-SH-SGKP-PKVI
A0A2V9JMM3      L--------QK-NRVVTVTDPGAIAS-------EQYSIL-AMK-LRW-HL-GEAP-SRVL
A0A2V9M815      L--------QK-NRVVTVTDPGAIAS-------EQYSIL-AMK-LRW-HL-GEAP-SRVL
A0A2V9A795      ---------RW-HRIDQGQRPQPALI-------EAFRSL-RAS-VLL-ST-ADHP-PGSL
A0A355ESH9      KKKGTPGPQAQ-IELVPHERPRTLIS-------ESYRSL-RTA-LLL-SS-A-RE-LKVV
A0A3D0NW85      ---TEP---LN-SELLINADPRSSLA-------EAYRQL-RTS-ILL-ST-AGHA-PKSL
A0A353CAT5      ---DDP---AN-SELLIYADSRSSLA-------EAYRQL-RTS-ILL-ST-AGHP-PKSL
A0A2V9HB55      ---GHE---MR-IELAAQHLPKSQMS-------EAFRAL-RTS-ILL-SR-ADHP-PQVI
A0A2V8CU57      YRFGAV---AS-RKTIVDPDVESSLV-------EQYRRL-AAS-LHH-AQ-LQRN-VRTV
A0A2V8BDI4      YRFGAV---AS-RKTIVDPDVESSLV-------EQYRRL-AAS-LHH-AQ-LQRN-VRTV
A0A2V8F8T3      YRFGAV---AS-RKTIVDPDVESSLV-------EQYRRL-AAS-LHH-AQ-LQRN-VRTV
A0A2V9J901      --------------MAPAIQTHAEVL-------EAFRSL-RTS-IL--LS-ASPV-PRVI
A0A2V8MKQ7      ----------------MVGDARSPVA-------ESYRHL-RTS-LLL-SS-AGTP-PRTI
A0A3M1SNQ5      --------------LISIKAPNSGYC-------EEYRNL-RTH-ILH-ES-QKRH-LKVI
A0A2V8QJ59      ------------------------------------------------------------
A0A1Q7HTA7      ------------------------------------------------------------
A0A2W0B5E2      ----------------MAAQATSEQS-------EAYRAL-RTS-VLL-SV-ASRA-PQTV
A0A2V8NMG8      ---------------------------------------------ML-ST-AGRP-PQTL
A0A2V8TBM7      ----------------------------------------RTS-LLL-SS-AGQP-PKTV
A0A1Q7HEZ8      ---------------MSLKAPASFAA-------EQYQGL-RIT-IEQ-LK-RLRD-VRLI
A0A1Q7JW36      ---------------MSLKAPASFAA-------EQYQGL-RIT-IEQ-LK-RLRD-VRLI
A0A1Q7MUR4      ---------------MSLKAPASFAA-------EQYQGL-RIT-IEQ-LK-RLRD-VRLI
A0A3N5PFU4      ---------FA-TQLVSLTNPASFAA-------EQYQNL-RLK-IER-LR-QTRD-LRVI
A0A4R1LDF1      ------------ALTQEQEKCVYFPL-------ERYRLL-STR-VLQ-VA-RNLK-SKVF
A0A1F2T1R8      ---------LD-RHLVSLTEPASFAA-------EQYQGL-RLT-IER-VA-RARD-VKII
A0A2V9BW09      ---------SE-KRIVAWADPHAIGA-------EKFRVL-RYR-LQH-LR-MARA-LSKV
A0A3M1SSE1      ---------RS-ELLIYDNSRSSSLS-------EAYRQL-RTS-ILL-SV-AGHA-PKSL
A0A2V9GQV7      ---------AA-RLVLREDGSLNAAL-------EAYRGL-RTR-LMR-AQ-SKSG-LHSI
A0A2V7YV88      ---------------LVALDGQSPAS-------EAYKAL-RTN-LLF-ST-IDHE-LKTI
A0A2V8YCY6      ---------------------------------------------------------QVI
A0A2V8EGM3      -------------------------S-------EQFRRL-AAT-LLQ-NQ-RGEN-IRSV
A0A2V8FGH1      -----------------GIDVEPGLA-------EQFRRL-AAT-LLQ-NQ-RGEN-IRSV
A0A2V8D468      ---------VG-THSLINNGAPPNLA-------EAFRAL-RTS-VMF-SS-AGGR-APTI
A0A1F2R977      ---------SI-AGKLVTGSMRPVSQ-------EEYRRL-AAV-LHQ-MQ-AEHK-VKTL
A0A2U3LF12      ---------QE-HRLTVLSDPQSIAS-------QQYGIL-TLK-IQR-WR-EQTG-GRVL
A0A3N5G7M6      ---------SA-RPLLVDREISTGFG-------EAFRAF-RTN-VRL-SM-LPGG-MRSV
A0A1F2S3Q7      ---------RD-TLLVSLTAPASFAA-------EQYQGL-RLA-VER-LA-RARD-VRTI
A0A2V8GVG4      ---------LD-QHLVTLTSPGSFAA-------EQYQGL-RLT-IER-LR-RGRT-LQVI
A0A2V8PJQ0      ------------------------VA-------ESYRHL-RTS-LLL-SS-AGQA-PKTI
A0A2V8H566      ---------LR-EKLVVARNINQGVL-------EQYRKL-AAS-LHY-AQ-SQHG-TRVL
A0A2V8UVN4      ---------VE-TPVLPFDVRDGRAG-------EQYRTA-RTK-L---LH-HPRQ-PRLV
A0A321LXF5      ----------L-LLVPQYNLPMQQAM-------EAYQTL-RTR-LVK-HE-GRHG-MRSL
A0A5M8SBZ0      ---------GN-MLFLQEESQVTPWA-------EQFRAI-RSR-LYR-IR-QKQT-LKII
A0A1Q7JFB1      ---------------MVTERPEQSTI-------EQYRKL-AAT-LHH-AQ-TERQ-LKVV
A0A2V8DMJ9      ---------IS-EKLVSLVARDSCAA-------DQYRAL-RQT-VER-LR-RERG-FQVI
A0A2V8GGF6      ---------ID-EEIVSLVDPASFAA-------DQYRSL-RHS-IER-LR-TDAS-SRVL
A0A2V8HKU7      ---------ID-EEIVSLVDPASFAA-------DQYRSL-RHS-IER-LR-TDAS-SRVL
A0A1Q6Y875      ---------DS-LVLF-NEQSFDQCA-------EQFRIL-RAR-LYR-LR-EKKP-FRTL
A0A523DJA9      ---------SD-EF-----------G-------EAFRSL-RTS-LVF-TA-GGSS-SRII
A0A2V8I604      -------------------APQSLAA-------EQYRSV-RTR-IRQ-AE-NGRP-LRAI
A0A2V8J066      -------------------APQSLAA-------EQYRSL-RTR-ISR-ME-NGRA-VRVL
A0A1I6MMC5      ---------HQ-LPAL---GERGASV-------EQFRTL-RSR-VQE-FR-DLGV-LKTV
A0A2V9D5W7      ---------AV-DVFS-DQGRSALGA-------EQFRTL-RSR-LCQ-LR-GNRP-VRTI
A0A2V9D4I4      ---------RC-TVFS-NPALSTLCA-------EQFRTL-RSR-LYQ-LR-ASQR-LGTI
A0A2V9D6L7      ---------NS-TIFS-NPALSTIGA-------EQFRTL-RSR-LYQ-LR-SSQP-LRTI
A0A2V8ZJV2      ---------HN-SVFV-NARPGQEGS-------ERFRTL-RSR-LDK-IA-STRK-LKRV
A0A2V9AWB5      ---------LN-SVFL-NSKPGEEGP-------ERFRTL-RLR-LYK-IA-TTRK-LKRV
A0A2V8Z1Y8      ---------GS-SVFG-DPAAGHAGA-------EKFSTL-RSR-LYQ-IA-EART-LRRL
A0A1Q8AX10      ---------DY-AVFC--KQSLAVCA-------EQFRTL-RSR-LYR-LR-DKQP-VRTL
A0A2V9A773      ---------DY-DVFS-TKQSSALCA-------EQFRTL-RSR-LYR-LR-EKSP-IRTL
A0A2V9AND3      ---------DY-DVFS-TKQSSALCA-------EEFRTL-RSR-LYR-LR-EKSP-IRTL
A0A2V9BTJ7      ---------RM-SVFE-GGDDGHVGA-------ERFRTL-RSR-LYQ-IG-GTRQ-LRRV
A0A2V8W2M7      ---------RF-SLFHRTDDDAKIGT-------ERFRTL-RSR-LYQ-IA-AAKQ-LRKV
A0A2V8XNW2      ---------RF-SLFHRTDDDAKIGT-------ERFRTL-RSR-LYQ-IA-AAKQ-LRKV
A0A1Q7CJC1      ---------RF-SLFHRTDDDAKIGT-------ERFRTL-RSR-LYQ-IA-AAKQ-LRKV
A0A2V9UEM7      ---------RT-MLFFQE-DENRKGA-------EEFRTL-RSR-LYQ-IR-EKLP-LKRL
A0A1Q7V300      ---------KT-MLFFSG-EEHLYGM-------EEFRTL-RSR-LYQ-AR-EKHP-LSKV
A0A2V9ZCI3      ---------KT-MLFFTK-EDHAPGM-------EEFRTL-RSR-LYQ-LR-EKMP-LKKI
A0A2V9WCB3      ---------GS-MLFMNG-DDHARGT-------EEFRTL-RSR-LYH-LR-EKMT-LRTV
A0A2V9VQW5      ---------KT-MLFFNP-EENALGT-------EQFRTL-RSR-LYQ-MR-EKAS-VKKI
A0A2V9WTP3      ---------KT-MLFLNG-DDNARGS-------EEFRTL-RSR-LYQ-IR-EKMT-LKKI
A0A2V9NLA9      ---------KT-MLFFNG-DEQGYGT-------EEFRTL-RSR-LYQ-LR-DRLP-LKKV
A0A2V9RKJ9      ---------KT-MLFFNG-DEQGYGT-------EEFRTL-RSR-LYQ-LR-DRLP-LKKV
A0A2V9RN95      ---------KT-MLFFNS-DEQGYGM-------EEFRTL-RSR-LYQ-MR-EKQS-LKKI
A0A2V9N406      ---------KT-MLFFNSDDEQGYGM-------EEFRTL-RSR-LYQ-MR-EKQS-LKKV
A0A2V9U6D9      ---------KT-MLFFNSEDEQGYGM-------EEFRTL-RSR-LYQ-MR-EKQS-LKKI
A0A2V8DZN4      ---------------ISFRQKTSLLA-------ESFRTTLTSI-LFS-QR-NGAY-PRVL
A0A3N5YKY1      ---------------AAALEFGSPAA-------EQFRALRTRI-GQV-EF-GGRD-CRSL
A0A2G6HQA4      ---------------YSANHSVDSLT-------EIFKTLRARI-LLT-KK-RNTS-AGTI
A0A2V7ZTY7      ---------------VTTDGLDFSTV-------EQYRKL-AAT-LHH-AQ-VERD-LKVV
A0A2V7ZVL9      ---------------VTTDRLDFSTV-------EQYRKL-AAT-LHH-AQ-VERD-LKVV
A0A1Q7QYI4      ---------------VVTERPEQSTI-------EQYRKL-AAT-LHH-AQ-TERQ-LKVV
A0A2V8G9Y9      ---------------IVTPTVPHAAV-------EQYRKL-AAS-LHH-AQ-LERQ-IKVV
A0A143PNR5      ---------------MVGAGLRQAVV-------EEYRKL-ASS-LHQ-AQ-INHR-LQVV
A0A6A7L078      ---------------VVNDSTSPALS-------EEFRKL-AAT-LHH-AQ-LSEK-TKVI
A0A143PXU3      ---------------VSAADANPVLI-------EQFRNL-AAA-LNR-LQ-TERT-LKSL
A0A2V8D8G9      ---------DI-QARLVTGALSTVSL-------EQYRRL-AAV-LHE-DQ-VQRQ-LKTV
A0A2V8ESQ4      ---------DI-QARLVTGALSTVSL-------EQYRRL-AAV-LHE-DQ-VQRQ-LKTV
A0A1E3Y5Q0      ---------------VVDSGMDAGSR-------EQYRRM-AAT-LHA-LQ-AESG-LRVI
A0A2W4TWK5      ---------------VIDRELDPVSR-------EQYRRL-AMA-LHA-AQ-GTGG-VKVI
A0A3N5NYV3      ---------------VVTPSISPVSL-------EQYRRL-AAT-LHR-RQ-TESR-IKTV
A0A2V2RJF9      QENPPASPTEA-IDLLTHYNPTSVAS-------EAFKTV-RTS-LLL-SF-PETP-PHTI
A0A2G6HNT3      VHHPELKESIE-EDWEKRLYNANYSVDSLT---EIFKTL-RARILLS-KE-KNTS-AGTI
A0A2V7YWD4      SEAATDREDLD-PRLVSFLKPESFEA-------DQYRML-RYA-MER-AC-PSDG-SRVI
A0A2V2R8T6      VSFEISPARVE-PHLVAIRQPQSAYA-------EQFRSL-RTR-ILQ-AG-ERLQ-MRAF
A0A1Q7RGF1      QCRKMKIPAVG-KLLGQFGSGPALEAAE-----ESYRAL-RTR-LLR-AR-SAQG-LRSV
A0A2V9BLX2      QCRKMKIPAVG-KLLGQFGSGPALEAAE-----ESYRAL-RTR-LLR-AR-SAQG-LRSV
A0A2V9ZA03      PPGIEVEVPPN-PRLVAMMEREGVGA-------EKFRVL-AAR-LQY-FR-KQRQ-LKKV
A0A3N5ZNH4      KFLAAKNSEED-ENSTALLNANELRFRVW----ESYRSL-RTS-ILL-SN-SGKP-PRTI
A0A2V8GEZ2      ---------VR-ATIDRLPGKVVLSPDTPSAVVEQYRRL-AAT-LHH-AQ-RDRQ-AKVL
A0A3N5ZFD3      AVFHGFDPSVR-ERIVTGHAETNGNLAVMTVATEQYRRL-AAT-LHH-AQ-MEKG-LKIV
G8NXD3          INWLNMVPKLE-RLPQKHRTTIAFESGADSRACEQFRLM-QHR-LVT-AR-PAGG---VV
A0A2V9VR38      GDRYLQGSRRT-RHPSQAAVPNGGVL-------PRSAYF-PAA-VEF-RR-SAQG-Y---
A0A2V9EY04      NATHLVLRQDQ-SSKVAL---------------EAYRAL-RTR-LMR-AQ-SRAG-VKTI
A0A2V9HAK9      NATRLVLRQDD-SLDAAL---------------EAYRGL-RAK-LMR-AQ-SKSG-LRSI
A0A1Q7FS15      NGARLVLHQGE-ASRAAL---------------EAYRGL-RTR-LMR-AQ-AKTG-LKSI
A0A1Q7K9P1      NGARLVLHQGE-ASRAAL---------------EAYRGL-RTR-LMR-AQ-AKTG-LKSI
A0A1Q7N989      NGARLVLHQGE-ASRAAL---------------EAYRGL-RTR-LMR-AQ-AKTG-LKSI
A0A2V9G7Y0      NAARLLLRQDD-FLIAAL---------------EAYRGL-RTR-LMH-AQ-AKSG-LRSI
A0A2V8T7Z1      ATAPAPPQKVE-GHVVALTAPGSFEA-------EQYRTL-NLV-LER-MQ-PGRP-LRVI
A0A2V7U8G5      --EVVPALEVE-DHLACLLSPQSFEA-------DQYRVL-RQF-LTE-AR-GARP-LRIL
A0A2V7UNP9      SREAAPVPEVE-EHLASLLSPYSFEA-------DQYRLL-RQS-V-E-QL-AAKE-RKVI
A0A2V7VLD7      SREAAPVPEVE-EHLASLLSPYSFEA-------DQYRLL-RQS-V-E-QL-AAKE-RKVI
A0A2V7XGA3      TARAAILTEVD-DHLVAVHSPQSFEA-------DQYRIL-RHF-LDQ-DS-GGAK-RQVL
A0A2V7YAG6      TVGGAVSRDLD-EHLVSLLNPQSFEA-------DQYRIL-RHF-VDQ-AK-GAVP-RQVL
A0A2V7VK33      --------LLE-ERLVSLGQPWSLEA-------DQYRML-RCE-IEY-LR-RSRS-LSII
A0A3M1VTE1      RPRPRITLAPT-EELVVAREPNCPAA-------EAYLRL-RSA-LLH-ES-DGTP-PRVI
A0A2V7TTM7      SKIAAAALRVD-ERLVSLRSPNSFEA-------DQYRVL-RHF-LEA-AG-AGNS-AQVL
A0A2V8VI82      ------AGPID-QRLVSLLAPDSFEA-------EQYRTL-RHV-VEE-RR-GE---MSVI
A0A2V7U4P9      GGGSAVRSTPA-DHLVSLVAPTSFEA-------EQYRIL-RHA-IER-RH-TDGV-ATTT
A0A2V7TQY5      GRWVVTAPRID-QHLISLLQPRSFEA-------EQYRVL-RHV-IEE-GK-DG-G-LNVI
A0A2V7TU87      HR----MATLD-ERLVSLVAPHSYEA-------EQYRGL-RHL-VEQ-AH-RTSA-LSVL
A0A2V8SEH0      GS----SGAAD-EHLVSLLVPNSIEG-------EQYRAL-RHQ-IEQ-RH-KDDG-LTVV
A0A2V8VU54      QG----VRGLD-PHLVSLVAPASFEA-------EQYRAL-RSR-LES-RP-EGRA-LQVL
A0A1Q7RML7      GG----LRGLD-RHLVSLVAPASFEA-------EHYRML-RAR-LES-RQ-EGKA-LQVI
A0A1Q7ZIQ5      GG----LRGLD-RHLVSLVAPASFEA-------EHYRML-RAR-LES-RQ-EGKA-LQVI
A0A2V8TKD8      GG----LRGLD-RHLVSLVAPASFEA-------EHYRML-RAR-IEA-RQ-EGKA-LQVI
                                                                            

A0A1F2U8T6      AVTSAQPLEGKTTTACNIALALAYGGM--RVLLIDADLRRPGLHLSLR-LT--NERGLSH
A0A2V8BV42      LVTSAQPLEGKTTTAANIAMALAYGGS--RVLLIDGDMRRPGLHRPLR-LT--NDRGLSQ
A0A2V8F916      LVTSAQPLEGKTTTAANIAMALAYGGS--RVLLIDGDMRRPGLHRPLR-LT--NDRGLSQ
A0A1Q7K833      VVTSAQPLEGKTTTAANIAMALAYGGS--RVLLVDADMRRPGLHRPLR-LT--NERGLSQ
A0A1Q8AMY4      VVTSAQPLEGKTTTAANIAMALAYGGS--RVLLVDADMRRPGLHRPLR-LT--NERGLSQ
A0A2V8BM40      AVTSAQPLEGKTTTAANMALALAYGGS--RVLLIDADMRRPGLHRPLR-LT--NERGLCQ
A0A2V8CRT6      AVTSAQPLEGKTTTAANMALALAYGGS--RVLLIDADMRRPGLHRPLR-LT--NERGLCQ
A0A1F2VH76      AVTSAQPLEGKTTTAVNIAMALAVGGS--RVLLIDADMRRPSVHKALR-MT--NDRGLSQ
A0A1F2R0X5      AVTSAQPLEGKTTAACNIAMALAYGGA--RVLLIDADMRRPGLHRTLR-LA--NERGLSQ
A0A2V8B278      VVTSAQPLEGKTTTAANIAMALAYGGS--RVLLVDADMRRPGLHRPLR-LT--NERGLSQ
A0A2V8CEF9      VVTSAQPLEGKTTTAANIAMALAYGGS--RVLLVDADMRRPGLHRPLR-LT--NERGLSQ
A0A2V8KZG2      ---------GKTTTASNIAISLAQLGG--SVLLIDCDLRKPSIHTAFG-IS--PMPGLST
A0A1Q7LG57      VLTSPSSGDGKTTVACNLAIAMAEI-GR-KVLLIDGDLRRPRLHKVFG-AP--NNWGLSD
A0A2V8YMQ4      LITSTQPGEGKTTVATNLAISLAQL-GQ-RVLLVDADLRFPSLQRLFC-IR--ENLGLVS
A0A1Q7L5B1      LVTSSLPAEGKSFVSLNLALAMMRQHNR-YVLLVDGDLRAPKLATCLG-VP--GAPGLTE
A0A2V9DKV4      LVTSSLPAEGKSFVSLNLALAMMRQHNR-YVLLVDGDLRAPKLATCLG-VP--GAPGLTE
A0A2V8W380      LVTSTQPADGKTTVACNLAISLAQL-GH-RVLLVDADLRSPSLHKLFG-ID--RSLGLVS
A0A2V8ZIV5      LVTSTQPGEGKTTVATNLALSLAQL-GQ-RVLLVDADLRFPSLQSLFG-MR--EKLGLVS
A0A2V9EVA0      LVTSAQAGEGKSFVSLNLARAIVHQHER-HALLIDADLRAPKLHVSLG-TP--SSPGLSD
A0A1Q7RB73      LVTSPLPSEGKTVVAANLAQVLVQQREQ-RVLLVDSDLRYSRMHLSLG-AS--RSPGLSD
A0A2V9K0H7      LVTSPLPSEGKTVVAANLAQVLVQQREQ-RVLLVDSDLRYSRMHLSLG-AS--RSPGLSD
A0A3N5YN96      VVTSPMPGDGKTVTSANLALSMAQEFHR-KVLIIDADLRKGALHRMFG-VD--NEPGLTD
A0A1Q7Y646      VVTSAGVGEGKTLTALNLAWLLAQTDGV-RALLIDSDLRQPCATEYLG-ID--EPTGLSE
A0A2V8QZU0      VVTSAGVMEGKTLTAINLSWLLAQTDGV-RALLIDGDLRNPCAGDYLG-LD--APTGLSE
A0A2V8RSQ9      VVTSAGIAEGKTITALNLAWLLAQTDGV-RALLVDGDLRQPCAAAYLA-FD--APVGLSE
A0A2V9LS17      LVTSASPREGKSFISSNTAQILARQPDK-RVLLIDADLRWSRLHLFLG-TP--AVPGLAE
A0A2V9AGR3      LITSSLPAEGKSFIAANLAQSLACRQDS-RVLLIDGDLRAPRLHLALC-AP--KSPGLTN
A0A2V9G0N7      VITSSVPAEGKTFVAANLAQSIIRQPDR-RVLLIDADLRASRLHVALG-AP--STPGLTD
A0A2V9GQ44      VITSSVPAEGKTFVAANLAQSIIRQPDR-RVLLIDADLRASRLHVALG-AP--STPGLTD
A0A2V9HRN3      VITSSVPAEGKTFVAANLAQSIIRQPDR-RVLLIDADLRASRLHVALG-AP--STPGLTD
A0A2V8WG13      LVTSSVPSEGKTTVAANLAHSIMCQPDR-RVLLIDADLRCSGMHELLG-AP--GGPGLTD
A0A2V8X987      LITSSVAGEGKTFVASNLGQSIVRQPGR-RVLLLDADIRMSRLHVGLG-AP--SRPGLTE
A0A1Q7KX94      LITSGVAAEGKTFVASNLAQSIVQQPEL-RVLLIDADLRSSRLHVLFG-AP--SCPGLSD
A0A2V8XHT0      LITSGVAAEGKTFVASNLAQSIVQQPEL-RVLLIDADLRSSRLHVLFG-AP--SCPGLSD
A0A2V9L2P7      LVTSAQPHEGKTATSLNLAFTLAQM-GS-RALVVDADLRKRRIARALQ-MS--NEKGLSG
A0A2V7UMX0      AVTSPFAGDGKTTTSINVAATLAQAPGS-RTLLVDCDLRLPAVAKYLR-VEGVDAPGLSE
A0A136K497      VVASVNPSEGKSVTAVNLAWMLAQTDGV-CALIIDSDLRMPSLADYLG-IE--TEKGLSD
A0A399W9E4      VVASANPSEGKSVTAVNLAWMLAQTDGV-RALIIDSDLRMPSLADYLG-IE--TEKGLSD
A0A2V7X0V9      LVTSALPKEGKSFTSSNLAQVLVRQHGR-RVLLIDADLRGPRLHLMLG-TT--AGPGLSE
A0A2V9X518      LITSALPKEGKTFVAANLAQVMVRQHGR-RALLIDADLRGARLHQALG-TS--STPGLSE
A0A2V9VC62      LITSALPQEGKSFVAANLAQVLVRQHGR-RVLLIDGDLRVARLHTALG-TT--SSPGLAD
A0A2V9S1P8      LVTSALPKEGKSFVAANLAQVMVRQEGR-RALLIDSDLRGSRLHEALG-TS--SSPGLSD
A0A2V9RTW2      LVTSALPKEGKSFVAANLAQVMVRQHGR-QALLIDADLRGARLHHLLG-TS--ATPGLAE
A0A2V9TGF1      LVTSALPKEGKSFVAANLAQVMVRQHGR-QALLIDADLRGARLHHLLG-TS--ATPGLAE
A0A2V9XEV6      LITSALPKEGKTFVAANLAQVMVRQHGR-RALLIDADLRGARLHQALG-TS--STPGLSE
A0A2V9Y3Q6      LITSALPKEGKTFVAANLAQVLVRQHGR-RALLIDADLRGARLHQALG-TN--FTPGLSE
A0A2V9R269      LITSALPKEGKSFTTANLGQVMVRQHGR-RVLLIDADLRNPQLHNQFG-AE--IGPGLGD
A0A2V9PTS3      LVTSPLPKEGKSFTAANLAQVIVRQHGK-RALLIDADLRCPQLHVLVG-AE--PGPGLSE
A0A2V9NPF4      LVTSPLPKEGKSFTAANLAQVIVRQHGK-RALLIDADLRCPQLHVLVG-AE--PGPGLSE
A0A2V9PNZ0      LVTSPLPKEGKSFTAANLAQVIVRQHGK-RALLIDADLRCPQLHVLVG-AE--PGPGLSE
A0A321LMC5      LVTSALEGEGKTTIATNLAWVMARQSGK-KVLLLDADLRRPSICKMLG-LK--SPHGLVD
A0A2V8X713      LVTSTLPGEGKTFVALNLALAITRQHER-GALLIDADLRASRLHVRMG-AP--SAPGLSD
A0A2V8ZLE9      LVTSALPGEGKTFVALNLALAIARQHER-KALLIDADLRASSLHARLG-AP--AAPGLSD
A0A2V8Y4D3      VVTSTLPGEGKTFVALNLALAIARQHER-RALLIDADLRASRIHVGLG-AP--SAPGLSD
A0A2V8Z2X8      LVTSTLPGEGKTFVALNLALAIARQHEK-RALLIDADLRASRLHVRLG-AP--SAPGLSD
A0A2V9C3F6      LVTSTLPGEGKTFVALNLALAIARQHER-RALLIDADLRASRLHVRLG-AP--SAPGLSD
A0A2V9QMU9      VVTSALPSEGKTTTSINTAIVLAQK-GN-RVLLVDADLRRPSIHKTLG-MG--PRTGLSS
A0A2V9QY75      LITSALPREGKTTTSVNTAIVLAQK-GT-RVLLIDADLRRPSIHKALG-MG--PRVGLSN
A0A2V9SVU9      LITSALPQEGKTTTSINTAIVLAQK-GV-RVLLIDADLRRPSIHKTLG-MG--PKTGLSN
A0A2V8W5N5      LVTSSLPDEGKTFVAQNLSQAIVQKPRQ-RVLMIDADLRYPQLHLALG-AP--MAPGLTD
A0A2V8XG53      LVTSSLPDEGKTFVAQNLSQAIVQKPRQ-RVLMIDADLRYPQLHLALG-AP--MAPGLTD
A0A6A7LB89      MITSAVLAEGKSLTATNLALTLSESYRR-RVLLVDADLRRPTLHDIFQ-VG--NASGLSD
A0A2V9XV04      LVTSALPKEGKSFTSANLAQVMVRQHGR-RALLIDADLRGPRLHQMLG-AP--KGPGLAE
A0A2V9CBY1      LITSTIAAEGKTFVAMNLAQSIARQRGR-RALLVDADLRASRLHIALG-AP--SAPGLSD
A0A2V9D656      LITSTTAAEGKTFVAMNLAQSIARQPGR-RALLVDADLRASRLHIALG-AP--CAPGLSD
A0A352EZH8      VVTSAGMGEGKTLTALNLAWLLAQSEGV-KALVIDSDLRQPCATNYLA-ID--APRGLSE
A0A0B6X033      VITSAGVLEGKTVTAINLAWLLAQTDGV-RALLIDGDLRRPCALSYLG-LD--RRPGLSE
A0A2V8R0I3      VITSPGVGEGKTLTALNLAWLLAQTDGV-KALLIDADLRQPCAAAYLG-IE--TDCGLSE
A0A2V8N1U8      VVTSAGIGEGKTLTTLNLAWLLAQTDGV-TALVIDADLRQPCAADYLG-IE--TERGLSE
A0A2V8QL35      VITSAGQGEGKTLTALNLGWLLAQTDGA-TALLIDADLRQPCAAEYLG-IQ--TEVGLSE
A0A352FU10      VVTSAGMGEGKTLTALNLAWLLAQTDGA-TALLIDADLRQPCAAEYLG-IQ--TECGLSE
A0A2V8LCU0      VITSAGMGEGKTLTALNLAWLLAQTDGV-SALVIDADLRQPCAAEYLG-IE--TEVGLSE
A0A1Q7NGT0      VITSAGVGEGKTLTALNLAWLLAQTDGV-RALVIDADLRQPCAADYLG-IE--TDCGLSE
A0A2V8MLP9      VITSAGIGEGKTLTALNLAWLLAQTDGV-KALVIDADLRQPCAADYLG-IE--TDCGLSE
A0A2V8PQZ0      VITSAGIGEGKTLTALNLAWLLAQTDGV-KALVIDADLRQPCAADYLG-IQ--TDCGLSE
A0A3B9MKY6      VITSAGVGEGKTLTALNLAWLLAQTDGV-RALVIDSDLRQPCATEYLG-ID--APIGLSE
A0A3D5SKZ1      VITSAGVGEGKTLTALNLAWLLAQTDGV-RALVIDSDLRQPCATEYLG-ID--APIGLSE
A0A2V8NRW2      VVTSAGVAEGKTLTALNLAWLLAQTDGV-RALIIDSDLRNPCAADYLG-IE--DAIGLSD
A0A2V8TKR9      LVTSAQPGEGKSTTVVNTAISLAQLGS--SVLIIDCDLRRPSTHKILG-IN--PAEGLSS
A0A2V8LBV1      VITSTSPRDGKSTIASNLAVALAE-TKR-RILLIDADLRRPHLHTVFE-MDNR--WGLTD
A0A2V8GAF9      AVTSPGPGDGKSVTALNVAGALAQSPHA-QILIVDADLRRPTVAEYLG-LGSQRSPGLVE
A0A2V8CN98      TITSPGPGDGKSFVSANLALACAQ-AGQ-RTLLIDGDTRRGALHRVLG-AVRR--PGLTD
A0A1Q7LC46      LVTSALPREGKTTAAANLAVTLAQ-LGD-STVLVDADLRKPGIGRLLN-LGTGKYAGLSS
A0A1Q8BDC5      TVSSPDPRDGKSLISSALAFSFSMDPGR-RVIIVDCDLRNPSLDGYLG-VTPE--PGLLQ
A0A2V9Q1Y8      LITSALPQEGKTTTSINTATVLAQ-KGT-RVLLIDADLRRPSIHKTLG-MGPR--AGLSN
A0A2V8JXG1      LVTSVRMEEGKTTTATNTAIALAQ-LGA-SVLLIDCDMRKPSVHDVFG-TSRT--LGLST
A0A350D2W9      MVTSPLPEEGKSATISNLAVSLAQ-TGK-KILLIDADLRRPKQHQIFK-MKNH--EGLTS
A0A2V9I4J1      AISSPRPQDGKSLIAVNLAFCLAQDLDR-RVILVDGDLRNPTVNRYLG-VSVE--PGLSG
A0A2V8PQZ9      VITSAGVGEGKTLTALNLAWLLAQTDGV-RALVIDADLRQPCAADYLG-IETD--CGLSE
A0A2V8D8B1      CITSSGPGEGKTLVGSNLAVALGQ-TGQ-RVLLIDADMRRPRVHEVFE-MAQE--PGLSN
A0A3B9LSB4      LVTSSLPGEGKTTTAVNTAVSLAQ-TGA-SVVIIDADMRRPRLRSIFG-LSDR--AGLSS
A0A2V9H7U2      LITSATAREGKSTTALNLAIALAQ-RGD-STLIIDADLRRPGIAESLD-IDDG--EGLAS
A0A2V8NJB5      IVSSPENGDGKSLVSANLALSYSLEVAR-RVIIVDCDLRNPSLHRYLG-VTEG--PGLLQ
A0A2V9JMZ4      AISSPRPQDGKSLIAVNLAFCLAQDLDR-RVILVDGDLRNPTVNRYLG-VSVE--PGLSG
A0A2V9MDJ6      AISSPRPQDGKSLIAVNLAFCLAQDLDR-RVILVDGDLRNPTVNRYLG-VSVE--PGLSG
A0A2V8QJT6      LVTSSLPGEGKTTTAVNTAISLAQ-TGA-SVVIIDGDMRRPRLRSIFD-LPER--EGLSS
A0A2V8FSM8      VLTSASPKEGKTTVVSNLAITVAE-IRR-RVLVIDADMRRPRLHKVFS-VDND--HGLSN
A0A359M0J2      LVTSPSPGEGKTTIAANLGVAMAE-VNR-RTVVIDMDLRRPSLHNTFGSIPEV--DWTSL
A0A2V8JLJ1      LISSSGAGEGKTFSACCIAGMLAQEPGK-QVLLIDADLRRSTATTVLG-TPSREGKNLGA
A0A5M8SND8      AVTSANPREGKTTVLCNLAVAMAE-IRK-RVLVIDADLRRPRLHDVFD-LPNE--RGLAN
A0A2V9GAQ1      LVTSALPREGKTTAAANLAVTLAQ-LGD-STVIVDADLRKSGIGRLLN-LASGNYAGLSS
A0A497EDQ8      LVTSSVPSEGKTTASFNLAKVLAA-GGA-RVLLIDGDLRKPRLHHMMK-VKNM--RGLTS
G8NS05          LLTSATPSEGKTTVSTNLACVFAQ-RDV-RVLLIDADLRRPTVHHRLG-LNGK--VGLTS
A0A2V8KZ20      LISSSGAGEGKTFSACCIAGMLAQEPGK-QVLLIDADLRRSTATTVLG-TPSREGKNLGA
A0A3D0NWU2      LVTSSQPSEGKTTTAINTAITLAQ-ADV-DVVIVDCDLRRPRIHNYFD-LENS--EGLTN
A0A2V8EPD9      MTSSAMPGEGKSLTSVNLALTLSDSYRK-RVLLIDVDLRRPTVQRIFG-LPPV--GGLTE
A0A3N5NSX5      ALTSAQPLEGKTTTACNMAIALAY-GGS-RVLLIDADMRRPSVSRTLG-IENN--VGLSH
A0A2V8MUA1      LIASAIPNEGKTFSACCLAGILAQEPRK-RVLLIDADVRTGSISHTLGIIDAGRGKGLAD
A0A2V8MBH9      LITSSLPGEGKTTTAVNTAITLAQ-TGA-SVVIIDADMRRPRLRSIFD-LPER--EGLSS
A0A3N5ZPQ7      TVTSPHIQDGKSLVSANLAFSFARDSGT-RTILVDCDLRRPSLHRYLG-IPPE--PGLIG
A0A3N5P5F2      VVTSTAPREGKSVVASNLAAGLAM-AGH-RVVLIDADMRRPRVHAIFD-VELS--PGLSQ
A0A2V9G1P7      LVTSTQPAEGKTTVACNLAISLAQ-LGH-RVLLLDADLRYPSLHKLFG-TSGS--LGLVS
A0A2V9BCK9      LVTSAVPGEGKTFVSLNLALAIARQHER-RALLIDGDLRASRLHVRMG-APSA--PGLTE
A0A2V9TMX2      LVTSAMPREGKTTISANSALVLAQ-RGS-RVLLVDADLRRPGVEKLFG-IRAH--GGLST
A0A2V8N2J7      IVTSAAGGEGKSLTAINVAMALAAATDG-RVLLMDADMRKPRIGEYLK-LSVPTDKGFHN
A0A3N6BI26      MVTSSVPGEGKTTTVANTGIVLAQ-TGA-RTLLIDLDMRKPALASTFG-YNGN--QGISA
A0A2V9JMM3      TVTSASGGEGKTLTAVNLSFALAESGLG-KVLLLDADLRKPRTHEYLG-IEPR--PALSN
A0A2V9M815      TVTSASGGEGKTLTAVNLSFALAESGLG-KVLLLDADLRKPRTHEYLG-IEPR--PALSN
A0A2V9A795      LITSTQPGEGKTTIATNLAISLAQ-LGQ-RVLLVDADLRFPSLQRLFC-IREG--LGIVS
A0A355ESH9      AVTSAMAGEGKTATASNLAVVLAQ-LGR-PVVIIDCDLRKPRIHQVFK-LSNR--SGLVN
A0A3D0NW85      LVTSSLPSEGKTTTATNTAISLAQ-TGA-KVLIIDADMRRPRLHSVFG-VSNG--EGLST
A0A353CAT5      LITSSLPSEGKTTTATNTAISLAQ-TGA-RVLIIDADMRRPRLHSVFN-ITNG--IGLST
A0A2V9HB55      LVTSALPREGKTTAAANLAVTLAQ-LGD-STVIVDADLRKPGIGRLLN-LGGGKYAGLSS
A0A2V8CU57      MITSAVAAEGKTLTATNLALTLSHSYKR-RVLLIDADLRRPTVHEAFR-IAND--TGLVD
A0A2V8BDI4      MITSAVAAEGKTLTATNLALTLSHSYKR-RVLLIDADLRRPTVHEAFR-IAND--TGLVD
A0A2V8F8T3      MITSAVAAEGKTLTATNLALTLSHSYKR-RVLLIDADLRRPTVHEAFR-IAND--TGLVD
A0A2V9J901      LITSALPGEGKTTTAVNLGAALASFGS--KVVVIDCDMRRPSCHRSVG-VK--NSPGFVQ
A0A2V8MKQ7      LVTSSQPSEGKTTTAINTAFMLAQTGA--EVLIIDGDLRRPRLHAHFN-IP--NVRGLTN
A0A3M1SNQ5      TITSINPNEGKSITALNLAWLLAQTDGI-STLLIDADLRNPSLASYLG-IE--PDKGLAH
A0A2V8QJ59      LVTSSQPSEGKTTTAINTAFILAQTGA--EILLIDCDLRRPRLHVHFN-IS--NARGLTN
A0A1Q7HTA7      -MTSATSGEGKTTTAINLAAAMAQDAEA-RVLLVDADLRAPSVAPLLG-LGD-SLPGLAE
A0A2W0B5E2      LITSAKIGEGKSSTALNLAMALAQCGS--SVVLLDCDLRKPVLARLLG-IQ--NERGMST
A0A2V8NMG8      LITSSVPSEGKTTTSINTAISLAQTGA--NVLIIDADMRRPRLHSIFD-VE--NRNGLST
A0A2V8TBM7      LVTSSQPSEGKTTTVVNIATMLAQTGA--DVLVLDCDLRRPRVHAHFG-LP--NSRGVTN
A0A1Q7HEZ8      AVTSPSAGDGKTVTALNLAGVLACGSDA-RVLLIDADLRRPTVAARLG-IGAADPRGLVD
A0A1Q7JW36      AVTSPSAGDGKTVTALNLAGVLACGSDA-RVLLIDADLRRPTVAARLG-IGAADPRGLVD
A0A1Q7MUR4      AVTSPSAGDGKTVTALNLAGVLACGSDA-RVLLIDADLRRPTVAARLG-IGAADPRGLVD
A0A3N5PFU4      AVTSPGAADGKTVTSINLAGALARGAAA-RVLLVDADLRRPQVADHLH-I-PQGAAGFAD
A0A4R1LDF1      LITSAIAEEGKTITAANLAFALSGASSI-RTLIIDLDLRRPSLATRLG-IK--ESSKASS
A0A1F2T1R8      AITSPAAGDGKTVTAVNLAGALARGSDG-RVLLIDADLRRPSVATLLG-IET-TGPGLAD
A0A2V9BW09      LVTSAIPREGKTVVATNLAFTLARSSS--HVLLVDADLRLSAVHQMLG-IP--PMAGLGE
A0A3M1SSE1      LVTSSLPAEGKTTTAVNTAITLAQTGA--KVLVIDADMRRPRIHSIFN-IS--NREGLSN
A0A2V9GQV7      VITSSLPGEGKTLTTMNLGLCYAQLPQQ-RVLVIDGDMRAHGLTSMLD-HP--NSPGLAE
A0A2V7YV88      VLTSAAPGEGKSRTASNLAIALAHAGQ--RTLLIDADFRRPSLHRIFG-RI--RNVGLSN
A0A2V8YCY6      LVTSALPREGKTTAAANLAVTLAQ-LGD-STVLVDADLRKPGIGRLLN-LGTGKYAGLSS
A0A2V8EGM3      MITSAVPADGKTLTALNLSLILSESYKR-RVLLIDGDLRRPTISAATN-LAKAE--GLSE
A0A2V8FGH1      MITSAVPADGKTLTALNLSLILSESYKR-RVLLIDGDLRRPTISAATN-LAKAE--GLSE
A0A2V8D468      LVTSTGPGEGKTMTSCNLAVSIAQTRQ--RVLLIDADMRRPRVHEVFD-VE--QEPGLSN
A0A1F2R977      MVTSALPREGKTLTVTNLALTLSEYFGR-RVLLIDGDLRHPSIHEILG-LP--NTTGLGD
A0A2U3LF12      VVTSAAGGEGKSLTALNLSMALASSVEG-RVLLVDCDLRRPQVHERLG-LK--DPSGFSD
A0A3N5G7M6      VVTSACAGDGKTLVASNLAVALALAEH--RVLLIDADLRRPTLHTAFN-VK--SEPGLTD
A0A1F2S3Q7      AVSSPAAGDGKTVTAINLAGTLARGSDD-RVLLVDADLRRPSVASLLA-IPG-GGLGLAD
A0A2V8GVG4      AVTSPAAGEGKTLTAINLAGALARGADDARVLLIDADLRRPAVAKQLA-IDE-LSQGLTE
A0A2V8PJQ0      LVTSSQPSEGKTTTAINTAFMLAQT-GA-EVLIIDCDLRRPRLHSNFN-IS--NVRGLTN
A0A2V8H566      MMTSTLASEGKTLTATNLALTLSESYRR-RVLLIDADLRRPTIHDMFD-LP--NVSGLND
A0A2V8UVN4      VISSAGSGDGKTVTSINLAGAMSLKTEA-EILLIDADLRKAQIAPLLG-IS--GEPGLAD
A0A321LXF5      VISSAAPGDGKTLTAFNMALCFARIQNW-PVLLVDADLRTQGMSSLLG-RA--GAAGLAD
A0A5M8SBZ0      LVTSSLPREGKSFLSANLSQIFARQRGC-RTLLVDADLRWPRLHEYLG-AP--CNPGLPD
A0A1Q7JFB1      MVSSAVSGDGKTLTSTNLALTLSESYRR-RVLLIDADLRRPSVHEVFQ-VK--NVTGLTD
A0A2V8DMJ9      GVTSPCPGDGKTVTTLNLAGALAQSPDS-RVLVVDADLRRPSVAEYLA-LPRTSFPGLAE
A0A2V8GGF6      AITSPGPGDGKTLTTLNLAGALAQCRDL-RVLVIDADLRRPAVSEYLG-LEARRSPGLAD
A0A2V8HKU7      AITSPGPGDGKTLTTLNLAGALAQCRDL-RVLVIDADLRRPAVSEYLG-LEARRSPGLAD
A0A1Q6Y875      LVTSAQAGEGKSFVSLNLARAIVHQHER-HALLIDADLRAPKLHVSLG-AP--SSPGLSD
A0A523DJA9      GVTSTQPREGKTICVANLGLVLALG-GA-RVLLIDADTRLPALHKSLG-LA--NSIGLSH
A0A2V8I604      LVTSPGKGDGKSLTAANLALTMAQEFQQ-RVLLVDSDLRRPTVHRLFG-LQ--QSPGLVD
A0A2V8J066      IVTSPAKGDGKSLTAANLALAMAEEFSQ-RVLLIDADLRRPSVHHLFD-LP--EAPGLTD
A0A1I6MMC5      LVSSGLPGEGKSFVSANLAISLARRKQN-RVLLIDGDMRRSSLHKLLG-AP--CEPGLTD
A0A2V9D5W7      LITSAVAGEGKTFVAFNLAQAIVRQPDQ-RVLIIDADLRCSRLHGIFG-AP--NALGLSD
A0A2V9D4I4      LITSAVPGEGKTFVAANLAQAIVRQAER-RVLIIDADLRSSHLHRMLG-AP--AAPGLSD
A0A2V9D6L7      LVTSAVAGEGKTFVVANLAEAIGRQRDR-RVLIIDADLRASRLHLMVG-AS--AAPGLSD
A0A2V8ZJV2      LLTSAVAGEGKTFVAFNLAQSIAQQPDL-RVLLVDADLRSPRLHHLFG-AP--ICPGLSD
A0A2V9AWB5      LITSGVASEGKTFVASNLAQSIAQQPEL-RVLLIDADLRSSQLHVVFG-TQ--GRPGLSD
A0A2V8Z1Y8      LLTSTVAGEGKTFVAANLAQAIIREPER-RVLLLDADLRVPQLHAVLG-AP--SSPGLTD
A0A1Q8AX10      LVTSAVPGEGKTFVSLNLALAIARQHER-RALLIDGDLRASRLHVRMG-AP--SAPGLTE
A0A2V9A773      LVTSTLPGEGKTFVALNLALAIARQHER-RALLIDADLRASRLHVRLG-AP--SAPGLSD
A0A2V9AND3      LVTSTLPGEGKTFVALNLALAIARQPER-RALVIDADLRASRLHVRLG-AP--SAPGLSD
A0A2V9BTJ7      VVTSSLPAEGKTFVAANLAQSIVRQPDR-KVLLIDADLRASRLHQLLG-AP--RSPGLSD
A0A2V8W2M7      LVTSSVPNEGKTFVAANLAQSIVHQPDR-RVLLIDADLRAPLLHVTLG-AP--TSPGLTD
A0A2V8XNW2      LVTSSVPNEGKTFVAANLAQSIVHQPDR-RVLLIDADLRAPLLHVTLG-AP--TSPGLTD
A0A1Q7CJC1      LVTSSVPNEGKTFVAANLAQSIVHQPDR-RVLLIDADLRAPLLHVTLG-AP--TSPGLTD
A0A2V9UEM7      MVTSALPKEGKSFVAANLAQVMVRQHGR-RVLVIDADLRSPGMHRHLG-AS--QTPGLSE
A0A1Q7V300      LVTSPLPKEGKSFVTANLGQVLVRQQGK-RVLLIDADLRNPHLHSTLG-AE--SGPGLSE
A0A2V9ZCI3      LISSSLPKEGKSFVAANLAQVMVKQHGR-RVLLIDGDLRGSRLHQTLG-CP--NTPGLSN
A0A2V9WCB3      LVTSALPKEGKSFTSANLAQVLVRQHGR-RVLLIDADLRGPRLHLMLG-TP--MGPGLSD
A0A2V9VQW5      LVTSALPQEGKSFVAANLAQVLVRQHGR-RVLLIDGDLRVARLHSALG-TT--SSPGLAD
A0A2V9WTP3      LVTSALPKEGKSFTAANLAQVMVRQHGR-RVLLIDADLRGPRLHLMLG-TS--SAPGLSD
A0A2V9NLA9      LVTSALPKEGKSFVAANLAQVLVQQQGR-RTLLIDGDLRGARLHNALG-TE--SSPGLTE
A0A2V9RKJ9      LVTSALPKEGKSFVAANLAQVLVQQQGR-RTLLIDGDLRGARLHNALG-TE--SSPGLTE
A0A2V9RN95      LVTSSLPKEGKSFVAANLAQVMVRQQGR-RALLIDGDLRGPRLHQVLG-TA--SSPGLSE
A0A2V9N406      LVTSSLPKEGKSFVAANLAQVMVRQQGR-RALLIDGDLRGPRLHQVLG-TA--SSPGLSE
A0A2V9U6D9      LVTSSLPKEGKSFVAANLAQVMVRQQGR-RALLIDGDLRGPRLHQVLG-TA--SSPGLSE
A0A2V8DZN4      VLTSASPKEGKTTVVSNLAITVAE-IRR-RVLVIDADMRRPRLHKVFS-VD--NDHGLSN
A0A3N5YKY1      VVTSPMPGDGKTVTSANLALSMAQEFHR-KVLIIDADLRKGALHRMFG-VD--NEPGLTD
A0A2G6HQA4      MVTSAMPGEGKSFVAANLSLAFASGLDQ-YVLLVDGDLRRPSIKKLFG-RD--EDFGLVN
A0A2V7ZTY7      MVSSAVSGDGKTLTSTNLALTLSESYHR-RVLLIDADLRRPSVHRVFQ-LK--NAGGLSE
A0A2V7ZVL9      MVSSAVSGDGKTLTSTNLALTLSESYHR-RVLLIDADLRRPSVHRVFQ-LK--NAGGLSE
A0A1Q7QYI4      MVSSAVSGDGKTLTSTNLALTLSESYRR-RVLLIDADLRRPSVHEVFQ-VK--NVTGLTD
A0A2V8G9Y9      MITSAAPGEGKTLTSTNLALTLSQSYRR-NVLLIDGDLRRPSVHSVFD-VP--NVLGLSD
A0A143PNR5      LVASAVPGEGKSLTAANVALTLTTSYSR-KVLLIDADLRRPSLHGLFR-AP--ETSGLSE
A0A6A7L078      MVTSGMASDGKTLTATNLALTLSESYRR-DVLLIDADLRRPSLHEIFQ-VP--NVSGLNE
A0A143PXU3      LVTSPAPGDGKSHVAVNLALTLSESYRR-KVLLVDADMRRPTLHHLFH-VS--GAHGLLD
A0A2V8D8G9      MITSALPQEGKTLTLVNLALTLSESYAR-RVLVIDADLRWPGLHTVLD-IP--NDRGLSE
A0A2V8ESQ4      MITSALPQEGKTLTLVNLALTLSESYAR-RVLVIDADLRWPGLHTVLD-IP--NDRGLSE
A0A1E3Y5Q0      TVASAMPGEGKTLTAANLALTLSESYQR-KVLLIDGDLRKPSQHAVFG-LP--VSPGLTE
A0A2W4TWK5      AVSSALANEGKSLTASNLAMTLSESYQK-RVLLIDGDLRRPSLQQIFG-LP--GEGGLTA
A0A3N5NYV3      LVASTMAGEGKTLTAVNLALTFSESYGR-NVLLIDGDLRRPTTHAVLE-VP--NILGSGI
A0A2V2RJF9      LITSSRPGEGKTFVACNLAISLAQ-LDK-RVVLIDGDMRNPRVHRVWGI---RNDTGLSR
A0A2G6HNT3      MVTSAMPGEGKSFVAANLSLAFASGLDQ-YVLLVDGDLRRPSIQTLFGR---KENFGLVD
A0A2V7YWD4      AITSPISGDGKTLTAVNLAGTIARGGQS-RVLMVDADLRRPSLAKVLGHSNVHRGWGLVD
A0A2V2R8T6      VITSAGIGEGKTLTALNLAWLLAQAEGV-RALIIDSDLRHPCAADYLGI---DAPVGLAE
A0A1Q7RGF1      VVTSATPGEGKTLTSLNLSLCCAQLHDL-RVLLIDADIRTSGLSRTLGF---PPGPGLVD
A0A2V9BLX2      VVTSATPGEGKTLTSLNLSLCCAQLHDL-RVLLIDADIRTSGLSRTLGF---PPGPGLVD
A0A2V9ZA03      VITSTIKGEGKSVVSANLAVTLAR--RQ-RTLLIDGDLRQSGLRELLTT---HGLPGITD
A0A3N5ZNH4      LVTSSIPGEGKTTTVANIGIVLAQ-TGA-RTLLVDLDMRKPALDDKFNC---RGEKGMSS
A0A2V8GEZ2      MISSAMPGEGKTLTATNLALTLTESFRR-RVLVIDADLRRPSMHHTFGL---PNNTGLND
A0A3N5ZFD3      MVVSSMAGEGKTLTATNLALTLSESYQR-QVLLVDADLRRPSLHRVFGL---PNATGLNE
G8NXD3          LITSPSAEDGKSLNCQNLAWALAE-AGH-KTLLLDLDLRRPSLLAALG----GVCPQSIE
A0A2V9VR38      ------PQEGKTTTSINCAVVLAQ-KGV-RVLLIDADLRRPSIHKTLGM---GPHSGLSN
A0A2V9EY04      AITSSLPGEGKTLTTMNLGLCYAQLPQQ-RVLVIDADLRTCGLTALLDH---PCTLGLAE
A0A2V9HAK9      VITSSLPGEGKTLTTMNLGLCYAQLPQQ-RVLVIDGDMRTRGLTSMIDH---PSSPGLAE
A0A1Q7FS15      VVTSSLPGEGKTLTTMNLGLCYAQLPQQ-RVLVIDADLRTCGLTSMLDH---PSTPGLAE
A0A1Q7K9P1      VVTSSLPGEGKTLTTMNLGLCYAQLPQQ-RVLVIDADLRTCGLTSMLDH---PSTPGLAE
A0A1Q7N989      VVTSSLPGEGKTLTTMNLGLCYAQLPQQ-RVLVIDADLRTCGLTSMLDH---PSTPGLAE
A0A2V9G7Y0      VITSSLPGEGKTLTTMNLGLCYAQLPQQ-RVLVIDGDMRTRGLTAMLDH---PNSPGLAE
A0A2V8T7Z1      AVSSPAVGDGKTTTTVNLAVTMAQNPAA-RVLLVDADVRRPAVGRKLGLGK-VRLPGLVE
A0A2V7U8G5      AVTSPAAGDGKTTTSINLAATLAQTPGS-RVLLVDTDLRRPFVATNLGL-S-PDRPGLAE
A0A2V7UNP9      AITSPAAGDGKTTTAINLAATLAQSSRS-RVLLVDTDLRRPFVAANLGL-D-MDAPGLAD
A0A2V7VLD7      AITSPAAGDGKTTTAINLAATLAQSSRS-RVLLVDTDLRRPFVAANLGL-D-MDAPGLAD
A0A2V7XGA3      AVTSPTAGDGKTTTAVNLAVTLAQSPGA-RVVLIDADLRRPFVATSLGLDD-RRGPGLAA
A0A2V7YAG6      AVTSPTAGDGKTTTAVNLAATLSQLPGA-RVLLMDTDLRRPFVAAGLGLED-GSAPGLAT
A0A2V7VK33      AVTSPDVGDGKTTTSVNLAGTLSQDPGT-RVLLVDADLRRPSAAPLLGFGDRGDGPGLAG
A0A3M1VTE1      VVTSGMPQEGKSLTAVNLALAFAACGDE-RVLLVDGDLRRGGLARFL--EP-APRAGLRE
A0A2V7TTM7      AVSSAAAGEGKTTTAINLAATLAQSPDM-RVLLMDTDLRRPSVASNLALGS-SAGTGLAG
A0A2V8VI82      AVTSAAAGEGKTTTAINLAAALAQDAES-RILLVDADLRVPSAGRLLGLGD-DL-PGIAD
A0A2V7U4P9      AVTSPSGGEGKTTTAINLAGALAQAADQ-RVLLVDADLRRPGVAAQLRIAS-TA-PGLAE
A0A2V7TQY5      AVSSATVGDGKTTTSINLAGTLAQNTTA-RVLLIDVDLRRGSVAAGLRLRA-PEANGLVD
A0A2V7TU87      AVSSATVGDGKTTTAINLAGALAQAADA-RVLLMDVDLRRPAIAERLGLEE-GR-HGLVD
A0A2V8SEH0      AISSPTPADGKTTTAINLAGALAQDPQA-RVLLVDGDLRVPSVSEQLGLGE-VAGPGLVE
A0A2V8VU54      AVTSAVVGDGKTTTAINLAGSLAQARDA-RVLLVDADLRRASAGLQLGLED-PRGAGLAD
A0A1Q7RML7      AVTSATIGDGKTTTAINLAGALAQAREA-RVLLVDADLRRPSVALQLGLDD-PRGAGLAD
A0A1Q7ZIQ5      AVTSATIGDGKTTTAINLAGALAQAREA-RVLLVDADLRRPSVALQLGLDD-PRGAGLAD
A0A2V8TKD8      AVTSATIGDGKTTTAINLAGALAQAREA-RVLLVDADLRRPSVALQLGLDD-PRGSGLAD
                         **:      .            :::* * *                     

A0A1F2U8T6      VL-----GG---RARLRDV----IQ-------------RTVDLNLFAIT----AGPTP-S
A0A2V8BV42      VL-----IG---QARVRDV----IQ-------------RTVDPNLLAIT----AGKMP-P
A0A2V8F916      VL-----IG---QARVRDV----IQ-------------RTVDPNLLAIT----AGKMP-P
A0A1Q7K833      VL-----IG---QARVRDV----IQ-------------RTVDPNLLAIT----AGRTP-P
A0A1Q8AMY4      VL-----IG---QARVRDV----IQ-------------RTVDPNLLAIT----AGRTP-P
A0A2V8BM40      VL-----MG---QARVRDV----IQ-------------RTVDPNLLAIT----AGSTP-P
A0A2V8CRT6      VL-----MG---QARVRDV----IQ-------------RTVDPNLLAIT----AGSTP-P
A0A1F2VH76      LL-----AG---QARMREV----VQ-------------RTHDPNLLVIT----AGRTP-A
A0A1F2R0X5      VL-----VG---QARVRDV----IQ-------------RTVDPNLLAIT----AGRPP-S
A0A2V8B278      VL-----IG---QARVRDV----IQ-------------RTVDPNLLAIT----AGRTP-P
A0A2V8CEF9      VL-----IG---QARVRDV----IQ-------------RTVDPNLLAIT----AGRTP-P
A0A2V8KZG2      YL-----AQ---NGKIDDL----IH--------------HASENLYLMP----AGPTP-P
A0A1Q7LG57      VL-----WG---DTPLETLPISHLV------------RETEVAGLSLLP----GGSCG-I
A0A2V8YMQ4      YL-----TG---QEDWRTA----VC------------PSG-SPGLDLLP----CGPVP-P
A0A1Q7L5B1      FL-----QG---AADASSI----IQ------------TDT-EGKLFFIS----AGSAV-S
A0A2V9DKV4      FL-----QG---AADASSI----IQ------------TDT-EGKLFFIS----AGSAV-S
A0A2V8W380      YL-----TG---QQDWRAV----VH------------PSG-SRGLDLLL----CGPVP-P
A0A2V8ZIV5      YL-----TG---QQDWREA----VR------------PSG-SPGLDLLL----CGPVP-P
A0A2V9EVA0      YL-----RG---DADEFSI----IQ------------SGT-GENLFFIP----AGRPV-S
A0A1Q7RB73      YL-----SG---AKDELAI----LQ------------RGP-LENLFFIA----GGKAA-S
A0A2V9K0H7      YL-----SG---AKDELAI----LQ------------RGP-LENLFFIA----GGKAA-S
A0A3N5YN96      VL-----AG---DVPLEEA----LI------------WIP-EYRLTLLP----AGRPT-N
A0A1Q7Y646      VL-----AG---TATLEES----II------------RLE-PAGLYLLP----GGEPR-D
A0A2V8QZU0      VL-----AG---EATLAES----IV------------RLE-PAGLHLLP----GGAAR-D
A0A2V8RSQ9      VL-----AG---QASLNDT----IV------------RLD-PSGLFLLP----GGTPR-D
A0A2V9LS17      YL-----SG---EANELSV----IQ------------RGP-LENLYFIP----GGKHP-A
A0A2V9AGR3      CV-----RG---ETDEFSV----IQ------------IGA-QSNLAFLP----SGDAV-A
A0A2V9G0N7      YL-----RG---EVDEYAI----IQ------------SGP-DENLCFIP----GGNDV-S
A0A2V9GQ44      YL-----RG---EVDEYAI----IQ------------SGP-DENLCFIP----GGNDV-S
A0A2V9HRN3      YL-----RG---EVDEYAI----IQ------------SGP-DENLCFIP----GGKDV-S
A0A2V8WG13      YL-----RG---EAEKEAV----IQ------------NGL-EGNLCFIP----GGSEV-S
A0A2V8X987      YL-----RG---EADEYSI----IQ------------KGM-EGNLFLIP----GGSPV-F
A0A1Q7KX94      YL-----RG---DADEYAV----IQ------------KGT-KENLFLIP----GGSLV-S
A0A2V8XHT0      YL-----RG---DADEYAV----IQ------------KGT-KENLFLIP----GGSLV-S
A0A2V9L2P7      IL-----TG---GYGLQEA----LL------------RVEDIEGLWVLS----SGPNP-P
A0A2V7UMX0      AV-----QA---RLGLDAV----MQ------------RCPPRVDLWLLT----AGRPP-E
A0A136K497      IL-----TG---DANFKDT----IV------------KLE-PSGLYLLA----GGAAR-P
A0A399W9E4      IL-----TS---DARLQDT----IV------------KLE-PSGLYLLA----GGTAR-P
A0A2V7X0V9      YL-----QG---KNDEFSI----MQ------------RGP-LENLFFIP----SGTGI-E
A0A2V9X518      YL-----LG---ES---------VQ------------RGP-MENLFFIP----SGRTV-S
A0A2V9VC62      YL-----LG---ESDEFSI----MQ------------RGP-MENLFFLP----CGRTV-A
A0A2V9S1P8      YL-----LG---EKDEFAV----MQ------------RGS-MENLFFIP----SGRSI-G
A0A2V9RTW2      YL-----LG---ENDEFGI----MQ------------RGA-MENLFFIP----SGRSV-S
A0A2V9TGF1      YL-----LG---ENDEFGI----MQ------------RGA-MENLFFIP----SGRSV-S
A0A2V9XEV6      YL-----LG---ESDEFSV----MQ------------RGP-MENLFFIP----SGRTV-S
A0A2V9Y3Q6      YL-----LG---ESDEFSI----MQ------------RGP-MENLFFVP----SGRTV-S
A0A2V9R269      YL-----RD---EADEYSI----IQ------------RGS-MENLFLIP----AGRIS-P
A0A2V9PTS3      YL-----AS---ESDEFSI----LQ------------RGP-MENLFLIA----AGHRS-Q
A0A2V9NPF4      YL-----AS---ESDEFSI----LQ------------RGP-MENLFLIA----AGHRS-Q
A0A2V9PNZ0      YL-----AS---ESDEFSI----LQ------------RGP-MENLFLIA----AGHRS-Q
A0A321LMC5      VI-----ER---RAAVSDS----IV------------AIK-PHGMYVLADRSNGDIPN-L
A0A2V8X713      YL-----NG---RADEFSV----LQ------------ADA-KADLFLIP----AGRFV-P
A0A2V8ZLE9      FL-----GA---KVDEFSI----LQ------------ADP-KFELFFVP----AGRPV-P
A0A2V8Y4D3      YL-----SG---KADEFSI----LQ------------ADP-KVELFLVP----AGKPV-P
A0A2V8Z2X8      YL-----SG---HADEFSI----LQ------------ADP-KVELFLVP----AGRPA-P
A0A2V9C3F6      YL-----SG---RADEFSI----LQ------------ADP-KVELFLVP----AGRSA-P
A0A2V9QMU9      VL-----TG---SANVQQT----IV------------RSALLPSLFILP----AGPPP-P
A0A2V9QY75      VL-----TG---GATSQQA----TV------------RSPILPNLFILP----AGTPP-P
A0A2V9SVU9      VL-----TG---NATLQQA----TV------------RSSILPGLFILP----AGTPP-P
A0A2V8W5N5      YL-----RG---EADEMAA----IQ------------YSD-NENLCFMP----GGKQV-T
A0A2V8XG53      YL-----RG---EADEMAA----IQ------------YSD-NENLCFMP----GGKQV-T
A0A6A7LB89      GL-----RR---ESPTTFP----TL------------EIS--DALALLP----AGRPD-P
A0A2V9XV04      YL-----LG---KADEASV----IQ------------RGP-MEGLFFMA----SGESI-E
A0A2V9CBY1      YL-----AG---ESDESAV----IQ------------AGA-QEGLFFIP----GGKPR-S
A0A2V9D656      YL-----AG---ESDECSI----IQ------------ADS-QEGLFFIP----GGKPR-S
A0A352EZH8      IL-----GG---ELSLRDA----IV------------RLD-PAGLYLLP----GGQAR-E
A0A0B6X033      VL-----AG---EAELDAT----IV------------RLE-PAGLYLLP----GGSER-N
A0A2V8R0I3      VL-----TG---VTRLTEA----IL------------KLN-PAGLHVLP----GGASR-E
A0A2V8N1U8      VL-----TG---ETRLAEA----IV------------RLN-PAGLHVLP----GGAAR-E
A0A2V8QL35      VL-----TG---ETKLTQA----IL------------KLE-PSGLHLLP----GGAAR-E
A0A352FU10      VL-----TG---ETKLTQA----IL------------KLE-PSGLHLLP----GGAAR-E
A0A2V8LCU0      VL-----TG---ETKLTEA----IV------------KLK-PSGLHLLP----GGAAR-E
A0A1Q7NGT0      VL-----TG---ETKLLEA----IV------------KLQ-PSGLHLLP----GGAAR-E
A0A2V8MLP9      VL-----TG---ETKLLEA----IV------------RLR-PSGLHLLP----GGAAR-E
A0A2V8PQZ0      VL-----TG---ETKLLEA----IV------------RLR-PSGLHLLP----GGAAR-E
A0A3B9MKY6      VL-----GG---AVRPEEA----IV------------RLD-PAGLYLLP----GGKAR-D
A0A3D5SKZ1      VL-----GG---AVRPEEA----IV------------RLD-PAGLYLLP----GGKAR-D
A0A2V8NRW2      VL-----SG---EATLEEA----IL------------HLN-PSGLYMMP----GGEAR-D
A0A2V8TKR9      YL-----TR---NIGIDRL----IH-------------KLQIPNLSLLP----CGPIP-P
A0A2V8LBV1      ILQADIEIQ---EYPLEML----VQ------------Q-TVVPNVYITG----SGSGR-E
A0A2V8GAF9      AI-----LD---PQYTLQR----VV------------RRLEGFNLSVLP----AGTPQ-S
A0A2V8CN98      FL-----AG---HVSFEGL----IQ------------T-LKFGSLQFIG----GGSRI-R
A0A1Q7LC46      YL-----AG---VSSLDLV----SV------------PHPAIPNLVAIP----TGPLP-P
A0A1Q8BDC5      YL------A---STNMSPY----CY------------V-RRIESLYFLT----VGGVA-T
A0A2V9Q1Y8      VL-----TG---GTTLQQA----TV------------RSTLLPNLFILP----AGTPP-P
A0A2V8JXG1      YL-----AR---NVEIDEL----IQ------------D-LPGENLRMIS----SGPIP-P
A0A350D2W9      YL-----AL---DLPVQKL----IK------------P-TMVPSLYLIN----SGPIP-P
A0A2V9I4J1      YL------E---NGHLQPY----CY------------M-RRFKNLYIMT----AGGVC-T
A0A2V8PQZ9      VL-----TG---ETKLLEA----IV------------K-LQPSGLHLLP----GGAAR-E
A0A2V8D8B1      LL-----VG---DTKTAEA----VK------------Q-TRSKGLWVLP----AGRIP-P
A0A3B9LSB4      IL--SSDVS---EADMLEM----VS------------T-DEATGLRVLT----SGPIP-P
A0A2V9H7U2      FL-----TG---AHSIEAA----LR------------QFSPVPTLWVLP----AGPKP-P
A0A2V8NJB5      YL------S---NGRLAPH----CY------------V-RRLENLFFLT----SGGIA-E
A0A2V9JMZ4      YL------E---NGHLQPY----CY------------M-RRFKNLYIMT----AGGVC-T
A0A2V9MDJ6      YL------E---NGHLQPY----CY------------M-RRFKNLYIMT----AGGVC-T
A0A2V8QJT6      IL--ASDTT---ADDMLRS----VV------------R-DVSSGLFIMP----SGPVP-P
A0A2V8FSM8      LLMEPEPLD---AAALEGG----CV------------P-TQVPNLFLLP----SGTSR-T
A0A359M0J2      VM--DDAPI---TAERIEP----LL------------QATDFEGLSLLA----AKAASAS
A0A2V8JLJ1      IL-----RG---RSKVEES----LE------------R-CEDLNLYFLS----SGPMS-S
A0A5M8SND8      ML--ESPSD---EVALQAM----TK------------R-TFVGGVDVLP----SGTSSGS
A0A2V9GAQ1      YL-----AG---VSSLDLV----SV------------PHPAIPNLVAIP----TGPLP-P
A0A497EDQ8      LV-----LG---ESQLKDV----IH------------GLADVPNLDMVT----SGPLP-S
G8NS05          VL-----TG---SHTLEQA----IQ------------NVPEMPSLDILV----SGPVP-P
A0A2V8KZ20      IL-----RG---RSKVEES----LE------------R-CEDLNLYFLS----SGPMS-S
A0A3D0NWU2      YL--SGDRN---TKNLIKA----CR---------------DLPRLKVIT----SGPIP-P
A0A2V8EPD9      AL------T---ADEDRQI----VL------------T-RVSDSLFVLP----AGRPE-S
A0A3N5NSX5      LL-----TG---QATARQA----IH------------R-TNVQNLWVMT----AGMTP-P
A0A2V8MUA1      VL-----RG---SATLEES----LV------------E-CSDLNFSLLP----SGTIV-Q
A0A2V8MBH9      IL--SSEIK---PEDMLHA----IH------------R-DEATGLNVLA----SGPIP-P
A0A3N5ZPQ7      YL------S---TNLLRPY----CF------------M-RQVQGLFVLA----AGGIS-D
A0A3N5P5F2      LI------V---GSAKAEV----IR------------R-SRIPNLWIVP----AGEVP-P
A0A2V9G1P7      YL-----TG---QQDWRAV----VR------------P-SGSRGLDLLV----CGPVP-P
A0A2V9BCK9      YL-----RG---EADEFSI----IQ------------A-DSKDDLFFIP----AGRSV-L
A0A2V9TMX2      LI--SGSSN---AEE--VI----LP------------S-SEVPNLWILP----AGPIP-P
A0A2V8N2J7      LL--VHSDG---NPDRYVM---------------------QFKQLYVIP----GGVSQ-A
A0A3N6BI26      YL-----SG---NGDLSSQ----IR------------Q-TSYPNLFLLP----AGFRP-P
A0A2V9JMM3      LL------Q---DPERDIY----RE------------A-VRLKDLFVIP----GGSDF-E
A0A2V9M815      LL------Q---DPERDIY----RE------------A-ARLKDLFVIP----GGSDF-E
A0A2V9A795      YL-----TG---QQDWRAA----VR------------P-SGSPGLDLLP----CGPVP-P
A0A355ESH9      QL-----TG---TAELDAV----IF------------P-TEVPNLWVIP----SGPMP-P
A0A3D0NW85      IL--SSEMS---ENEILGV----IQ------------Q-EPSTKLNLLT----SGPIP-P
A0A353CAT5      LL--SSELS---EAEILKA----IR------------T-DDGTKLNLLT----SGPIP-P
A0A2V9HB55      YL---AGVS---SLDL-VC----VP------------H-PTIANLVAIP----TGPLP-P
A0A2V8CU57      VL---RKTE---TRRLPLC----RA------------S-ET---LWILT----AGMPT-S
A0A2V8BDI4      VL---RKTE---TRRLPLC----RA------------S-ET---LWILT----AGMPT-S
A0A2V8F8T3      VL---RKTE---TRRLPLC----RA------------S-ET---LWILT----AGMPT-S
A0A2V9J901      CL-----TG---HVELAEA----VL------------PAPGVPNLSVIP----CGPIP-P
A0A2V8MKQ7      CL-----SG---ESRDLDA----LI-----------QTSEKQPNLKLLP----LGPIP-P
A0A3M1SNQ5      VL-----SG---EIKLRES----IC-----R--------LEPSSLHLIA----GGAIK-S
A0A2V8QJ59      CL-----SG---EASEIDS----VI-----------QSYAQLPNLKVLP----SGPMP-P
A0A1Q7HTA7      LA-----LG---SRAGLDD----TV------------RWCPPSRLCVLP----AGRTP-A
A0A2W0B5E2      HL-----TG---HDSINDV----IQ------------QYKEQPNLWLIP----SGPIP-P
A0A2V8NMG8      IL-----SSEMKEAEVLAL----IQ------------QHEE-SGLHLMT----SGPIP-P
A0A2V8TBM7      YL-----SG---DSQVADL----VQ------------TYERMPNLKVIT----SGPVP-P
A0A1Q7HEZ8      AI-----AD---TNVWLDQ----VTRQVDGF------------NLSVIP----AGVTR-V
A0A1Q7JW36      AI-----AD---TNVWLDQ----VTRQVDGF------------NLSVIP----AGVTR-V
A0A1Q7MUR4      AI-----AD---TNVWLDQ----VTRQVDGF------------NLSVIP----AGVTR-V
A0A3N5PFU4      LV-----VS---ARASLGE----AVRPLDGF------------NVDVLP----AGVVA-G
A0A4R1LDF1      YI-----TA---PDWHECI----W---------------GLKPNLHALV----LSSPA-D
A0A1F2T1R8      VL-----SG---NRDAAEV----FR-----R--------IEPFNLSVLP----AGATR-A
A0A2V9BW09      VL-----QG---RLDVRAA----IR-----R--------LDPSGLYYLP----AGHPP-P
A0A3M1SSE1      LL-----SS---EIKRDKV----LD----------SIYFDMSSRLYLLP----SGPVP-P
A0A2V9GQV7      IL-----SG---DVAPDEA----IV-----A--------TNQKNLFILP----AGMVS-S
A0A2V7YV88      LT-----VQ---DADEREA----IT------------AVEEVPNLWLMT----SGPIP-P
A0A2V8YCY6      YL-----AG---VSSLDLV----SV------------PHPAIPNLVAIP----TGPLP-P
A0A2V8EGM3      II-----AA---ADERRVP----LV--------------QLTETLTLLP----GGRPN-P
A0A2V8FGH1      II-----AA---ADERRVP----LV--------------QLTETLTLLP----GGRPN-P
A0A2V8D468      LM-----VG---TAQSREA----MH-----P--------SGVKDLWILP----AGHIP-P
A0A1F2R977      GL-----RS---ERVQIPF----YE---------------LSPTLTVLP----AGPLH-A
A0A2U3LF12      LL-----AL---TDREVSP----FV--------------SKAGNLHVMP----GGTQL-S
A0A3N5G7M6      FL-----IG---EGRIANL----IR-----R--------TRIPRLHLLT----AGTLP-P
A0A1F2S3Q7      AL-----GS---GRGA-AD----VVRTVDGC------------LLDVIP----AGSPR-A
A0A2V8GVG4      VV-----EN---AQTSLGA----VTQKLKPF------------NLSIVT----AGTRK-G
A0A2V8PJQ0      FL-----SG---ELPLDEV----IQ------------PFEKLPNLKLLP----SGPIP-P
A0A2V8H566      VL-----YA---RDAALRC----EL-----F--------TMTAQLCVLT----AGRPN-P
A0A2V8UVN4      VL-----MG---TCRLEDA----IV-----R-------LEQFPNLCVLP----SGKPT-A
A0A321LXF5      IL-----ES---DCAYDQA----VL-----Q--------TDVPDLYVLP----AGKSS-T
A0A5M8SBZ0      YL-----AG---TASAFSI----VQ-----Q--------SPVPDLFFIP----GG-PA-R
A0A1Q7JFB1      SL-----KA---ENDRRLP----LI--------------QASAYLSLLL----AGRPD-S
A0A2V8DMJ9      AI-----LD---PAYDLAA----VVRCLDTF------------NLSVLP----AGTPQ-V
A0A2V8GGF6      LL-----RD---PDYEIDQ----VTHRLERF------------NLSVVP----AGSPQ-P
A0A2V8HKU7      LL-----RD---PDYEIDQ----VTHRLERF------------NLSVVP----AGSPQ-P
A0A1Q6Y875      YL-----RG---DADEFSI----IQ-----S--------GTGENLFFIP----AGRPV-S
A0A523DJA9      VL-----VG---QARIREA----IQ-----R--------THDPNLFVVT----AGQPP-P
A0A2V8I604      IL-----MG---GSTLEES----LV-----S--------IAEHHLTILP----SGPVP-T
A0A2V8J066      VL-----MG---GATLDDA----LV-----T--------LADHHLTVLP----SGVPP-S
A0A1I6MMC5      YL-----SG---NASMFDV----MQ-----RAHASDGMPSALSSLTFIA----GGGDA-D
A0A2V9D5W7      YL-----GG---RADELAI----IQ-----S--------GHEGNLYLIP----GGTRI-A
A0A2V9D4I4      YL-----RG---DANELAV----TQ-----S--------GQEGNLWFIP----GGTNI-A
A0A2V9D6L7      YL-----RG---DIDEVAA----IQ-----S--------GQDSSLYLIP----GGTKI-A
A0A2V8ZJV2      YL-----RG---DVDEYAI----VQ-----K--------GMNESLFLIP----GGSLV-S
A0A2V9AWB5      YL-----RG---DADEYAV----IQ-----K--------GMSKNLFLIP----GGNLV-S
A0A2V8Z1Y8      YL-----LG---DADECAI----IQ-----Q--------GLQPNLFLIA----AGRAV-S
A0A1Q8AX10      YL-----RG---EADEFSI----IQ-----A--------DSKDDLFFIP----AGRSV-L
A0A2V9A773      YL-----GG---RADEFSI----LQ-----A--------DPKVELFLVP----AGRPV-G
A0A2V9AND3      YL-----NG---RADEYSI----IQ-----A--------DPKVELFLVP----AGRPV-H
A0A2V9BTJ7      YL-----LG---MADEFRV----VQ-----K--------GSESNLCFIP----AGSEA-P
A0A2V8W2M7      YL-----RG---EANEYDV----IQ-----H--------SSEVNLCFIP----CGHPV-S
A0A2V8XNW2      YL-----RG---EANEYDV----IQ-----H--------SSEVNLCFIP----CGHPV-S
A0A1Q7CJC1      YL-----RG---EANEYDV----IQ-----H--------SSEVNLCFIP----CGHPV-S
A0A2V9UEM7      YL-----MG---ECDEFAI----MQ-----R--------GPMDNLFFVP----AGRQA-T
A0A1Q7V300      FL-----KG---EMDEFTI----IQ-----S--------GPMENLFLIP----AGTRN-E
A0A2V9ZCI3      YL-----MG---ENDEFAV----VQ-----R--------GPLENLFFVP----AGKQV-S
A0A2V9WCB3      YL-----QS---KNDEFSI----IQ-----Q--------GPMENLFFMP----SGSGI-E
A0A2V9VQW5      YL-----MG---ESDEFSI----MQ-----R--------GPMENLFFVP----CGRTV-T
A0A2V9WTP3      YL-----QG---ANDEFSI----MQ-----R--------GALENLLLIP----SGCEV-S
A0A2V9NLA9      YL-----LG---EADEFAI----LQ-----R--------GPMDNLFFIP----CGRKV-T
A0A2V9RKJ9      YL-----LG---EADEFAI----LQ-----R--------GPMDNLFFIP----CGRKV-T
A0A2V9RN95      YL-----LG---EADEFGA----IQ-----R--------GPMDNLFFIP----SGRTV-S
A0A2V9N406      YL-----LG---EVDEFGA----IQ-----R--------GPMDNLFFIP----SGRTV-S
A0A2V9U6D9      YL-----LG---EVDEFGA----IQ-----R--------GPMDNLFFIP----SGRTV-S
A0A2V8DZN4      LL-----ME---PEPLDAA----ALEGGCVP--------TQVPNLFLLP----SGTSR-T
A0A3N5YKY1      VL-----AG---DVPLEEA----LI-----W--------IPEYRLTLLP----AGRPT-N
A0A2G6HQA4      YL-----EH---QTALPKL----IV-----R--------SRKPKLSLLL----AGKPP-S
A0A2V7ZTY7      CL-----TA---EIE-RRL----PL-----V--------QATPYLSLML----AGRPD-S
A0A2V7ZVL9      CL-----TA---ETE-RRL----PL-----V--------QATPYLSLML----AGRPD-S
A0A1Q7QYI4      SL-----KA---END-RRL----PL-----I--------QASAYLSLLL----AGRPD-S
A0A2V8G9Y9      GL-----KS---EVE-HKL----SL-----I--------QISEHLTVLP----AGRPD-S
A0A143PNR5      GL-----DA---ATA-SRV----SA-----I--------QLSPLLALLP----AGRPV-E
A0A6A7L078      AL-----QA---AAD-EKL----ST-----L--------RVSDTLTLLP----AGRPN-A
A0A143PXU3      AL-----RA---EAE-DVP----AV-----V--------PVTGTLSLLP----AGRPQ-A
A0A2V8D8G9      AL-----R----DGR-HEL----PF-----V--------EVSSRLSVLT----AGKPG-P
A0A2V8ESQ4      AL-----R----DGR-HEL----PF-----V--------EVSSRLSVLT----AGKPG-P
A0A1E3Y5Q0      GV-----V----GTD-AAL----SL-----H--------RVSPTLTVIT----AGEPT-D
A0A2W4TWK5      AF-----AP---RSD-HRI----RL-----H--------RITPHLTVLT----AGRPT-T
A0A3N5NYV3      GS-----KQ---ETD-QKL----SL-----I--------QVSPRLSVLT----AGQPD-P
A0A2V2RJF9      FL-----TS---DVKAGEV----IR-------------PSKVKGLSLIT----SGSKT-P
A0A2G6HNT3      YL-----QQ---QGSLPEL----IV-------------RSRKPKLSLLL----AGDTP-P
A0A2V7YWD4      AI-----LD---RRLSLEQ----IA------------WPLQPFNLSVVT----SRRPQ-A
A0A2V2R8T6      VL-----GG---QARFEDA----IV-------------RLDPAGLYLLP----GGGVR-N
A0A1Q7RGF1      VL-----SG---KCEPRNA----IL-------------ATDIPNLYTLG----SGSHT-T
A0A2V9BLX2      VL-----SG---KCEPRNA----IL-------------ATDIPNLYALG----SGSHT-T
A0A2V9ZA03      -W-----WQ---ETADVSE----FL------------RRVNGFPLWYLP----AGEAM-G
A0A3N5ZNH4      YL-----SG---N-SDLSS----LI------------RPTAYPNLFILP----AGFRP-P
A0A2V8GEZ2      AL-----LG---R-DNMPT----AF--------------EMSSRLTVLP----AGCPN-P
A0A3N5ZFD3      AL-----TE---EAGNPPA----LF--------------SISPQLTLLA----GGRPH-P
G8NXD3          QV-----LK---GEVTPEA----AI------------RSVGDLPLYIIG----LDKAV-S
A0A2V9VR38      VL-----TG---STTTEQA----IT------------RTTILPNLFVLA----AGTPP-P
A0A2V9EY04      VL-----AG---KATLEEA----MV-------------ATNQKNFFVLP----AGTIS-S
A0A2V9HAK9      IL-----SG---DVAPDEA----IV-------------ATNQKNLFILP----AGTVS-S
A0A1Q7FS15      VL-----AG---EVTPDEA----IV-------------ATNQKNLFVLP----AGTVL-S
A0A1Q7K9P1      VL-----AG---EVTPDEA----IV-------------ATNQKNLFVLP----AGTVL-S
A0A1Q7N989      VL-----AG---EVTPDEA----IV-------------ATNQKNLFVLP----AGTVL-S
A0A2V9G7Y0      IL-----SG---DVGPDEA----IV-------------ATNQKNLFILP----AGTIS-S
A0A2V8T7Z1      LI-----AD---PSLGIGG----LA-----------RRVGPA-NLSVLL----AGRSH-A
A0A2V7U8G5      AA-----ID---EGLQLSD----VV------------QSTPY-NLAVLP----AGAPP-A
A0A2V7UNP9      AV-----RD---EQIDLAA----VV------------QATPY-TLAVVP----AGAAP-A
A0A2V7VLD7      AV-----RD---EQIDLAA----VV------------QATPY-NLAVVP----AGAAP-A
A0A2V7XGA3      TA-----LD---PKLELEQ----LV------------RPTPF-NVDVVP----AGPST-P
A0A2V7YAG6      MA-----LD---PDLELDQ----MV------------RRTPY-NFDIVP----AGPAA-P
A0A2V7VK33      AI-----LD---SHRSLAS----VV------------RARPPFNLSVLP----AGRFH-D
A0A3M1VTE1      LL-----EG---KVPEEEA----LL-------------EVSGTRLAVVP----AGRPV-A
A0A2V7TTM7      AV-----LD---PRVELAT----VV------------RPTPF-GFSILP----AGTSP-S
A0A2V8VI82      AV-----RE---PGALLED----FV-----------RRRPPS-RLSILP----AGRTS-D
A0A2V7U4P9      AV-----AD---GARPLDE----LC------------QQVAGFNLWVLP----AGHAV-M
A0A2V7TQY5      AI-----LT---PGLDLSA----VV------------RELPEFRLSVVP----SGRCP-A
A0A2V7TU87      AI-----LS---HDLKLAD----VA-----------RPCGPL-NLAVVT----AGVFS-D
A0A2V8SEH0      AI-----LD---PGRSLDD----VV------------RDLPLFNLSVLP----AGRSP-S
A0A2V8VU54      AI-----LD---PDRSLPG----LV------------QSLPA-NLGILP----AGRLA-P
A0A1Q7RML7      AI-----LD---PERSLES----VI-----------LRRLPL-NLGVLT----AGRLP-P
A0A1Q7ZIQ5      AI-----LD---PERSLES----VI-----------LRRLPL-NLGVLT----AGRLP-P
A0A2V8TKD8      AI-----LD---PERSIES----VI-----------LRRLPL-NLGLLT----AGRLP-P
                                                            .               

A0A1F2U8T6      EPSELLASERMKMLLSSLAQGPF--D--WIIIDTPPVLGVSDAVVLTPLVTGVTFVVGAE
A0A2V8BV42      NPSELLASERMRTLLTNLAHGPF--D--WIIIDTPPVLAVTDAVILAPMVSGVTFVVGAE
A0A2V8F916      NPSELLASERMRTLLTNLAHGPF--D--WIIIDTPPVLAVTDAVILAPMVSGVTFVVGAE
A0A1Q7K833      NPSELLASERMKTLLTNLSHGPF--D--WIIIDTPPVLAVTDAVILAPAVSGVTFVIGAE
A0A1Q8AMY4      NPSELLASERMKTLLTNLSHGPF--D--WIIIDTPPVLAVTDAVILAPAVSGVTFVIGAE
A0A2V8BM40      NPSELLASERMKTLLTNLSHGPF--D--WILIDTPPVLAVTDAVVLAPMMSGVTFVIGAE
A0A2V8CRT6      NPSELLASERMKTLLTNLSHGPF--D--WILIDTPPVLAVTDAVVLAPMMSGVTFVIGAE
A0A1F2VH76      NPSELLAADRMRALISGLENGPF--D--WVIIDTPPVLAVTDAVIIAPLVAGVTFVVGSE
A0A1F2R0X5      NPSELLSSERMKTLITNLRSGPF--D--WIVIDTPPVLAVTDAVILAPLVNGVTFVIGAE
A0A2V8B278      NPSELLSSERMKTLLTNLAHGPF--D--WIIVDTPPVLAVTDAVILAPLVSGVTFVVGAE
A0A2V8CEF9      NPSELLSSERMKTLLTNLAHGPF--D--WIIVDTPPVLAVTDAVILAPLVSGVTFVVGAE
A0A2V8KZG2      NPAELLSSGKMKRLIEIMAE-RY--D--HVVIDTPPLGSVTDPVILSTMVDGVVLVVHAG
A0A1Q7LG57      TPTNLFYSPRMARFLKRMRK-EF--E--MVMIDAPPMIHLADARVLGRHADGVILVMRAG
A0A2V8YMQ4      NPAELLSSKSMGAFLGSAKS-EY--A--FVILDSSPLLTLADSRILASLVDGVLLVAKSG
A0A1Q7L5B1      NPTELLSTERLECFLRQMAA-LF--D--WVIIDAPPVLPVSDAIVLAGRCDGVIVVVRAG
A0A2V9DKV4      NPTELLSTERLECFLRQMAA-LF--D--WVIIDAPPVLPVSDAIVLAGRCDGVIVVVRAG
A0A2V8W380      NPSELLSSQSMGALIRSASA-EY--G--FVILDSSPMLALADSRILAPLVNGVLLVVRSG
A0A2V8ZIV5      NPAELLSSKSMGAFLVSAKS-EY--A--FVILDSPPLLTLADSRILASLVDGVLLVVKSG
A0A2V9EVA0      NPTELLGSTRAKSLFERLNT-LF--D--WVIVDTSPVLPVSDATVLAPMCDGVILVVGAG
A0A1Q7RB73      NPTELIGNGRLRLLLRRLCP-AF--D--WIIMDSPPVIPVSDAKLLAEYLDGVLIVVQSD
A0A2V9K0H7      NPTELIGNGRLRLLLRRLCP-AF--D--WIIMDSPPVIPVSDAKLLAEYLDGVLIVVQSD
A0A3N5YN96      QPTELLGSFEMRRAVDTLRT-HF--D--RIVIDTPPALALADVGVVGPLSDGVLLVVRAG
A0A1Q7Y646      DVAELLSGPKFDKVLAEARR-MF--D--YIIIDAPPMGIFTDANLLINSADGAMLVVRAG
A0A2V8QZU0      DVAEMLSGPKFSAVLKEARR-MF--D--YVIIDAPPLGIFTDASVLINRADAALIVARAG
A0A2V8RSQ9      NVAELLSGPKFSAVLAELRR-SF--N--YIIIDAPPLGIFTDATVLINRADGALVVVRAG
A0A2V9LS17      NPAELVSNGRFKNLLRRLSP-VF--D--WIVVDTPPAIAVSDAQVLAAACDGVLLVVAAG
A0A2V9AGR3      DPAELILGGRVKKLLDFVTP-AF--D--WVILDSPPALAVHDPSLFADLCDGVLFVVKAG
A0A2V9G0N7      NPSELLPSDRMRHLLDVVTP-MF--D--FVILDSPPATPVHDPIVLADLCDGVLFVVRAG
A0A2V9GQ44      NPSELLPSDRMRHLLDVVTP-MF--D--FVILDSPPATPVHDPIVLADLCDGVLFVVRAG
A0A2V9HRN3      NPSELLPSDRMRHLLDVVTP-MF--D--FVILDSPPASPVHDPIVLADLCDGVLFVVRAG
A0A2V8WG13      NPSELLLGDRMKKLLDLVTP-IF--D--WIILDSPPALAVHDASSLADLCDGVLFVVKAG
A0A2V8X987      NPSELLLHERMKRLLDLLTS-AF--D--WIIIDSPPALLVHDASILADLADGVLFVVQAG
A0A1Q7KX94      NPSELLLNERMKHLLNLVAP-SF--D--WIIIDSPPTLPVHDASILADLVDGVLFVIRAG
A0A2V8XHT0      NPSELLLNERMKHLLNLVAP-SF--D--WIIIDSPPTLPVHDASILADLVDGVLFVIRAG
A0A2V9L2P7      NPAELLCSTKMQELLKQMRE-RF--D--HVIVDSPPVLPITDATILSSRVDGVIMVVENE
A0A2V7UMX0      DPYDVIRSPHFADLLEEARR-RF--D--FVVIDTPPILPVPDGREIARWVDGFLVVVAAH
A0A136K497      DVAELISGPKFAEILAEARE-MF--D--YVIIDAPPLAIFTDATVLINKADGALLVVRAN
A0A399W9E4      DVAELISGPKYAELLAEARE-MF--D--YIIIDAPPLAIFTDATVLINKADGALLVVRAN
A0A2V7X0V9      DPAELVGNGKLKTFLQRVEP-LF--D--WIIVDSPPAIPVSDASVLAKACDGVLMVVRSN
A0A2V9X518      NPAELVANGRLKFLLTRVEP-LF--D--WIIIDSPPTVPVSDSSLLDNFCDGVLIVVRSN
A0A2V9VC62      HPAELIANGRLKMLLQRVEP-LF--D--WIILDSPPAVPVSDASQLANFCDGVLMVVRSN
A0A2V9S1P8      NPAELVANGRTRFLLNRVEP-LF--D--WIIIDSPPAVPVSDAGLLANYCDGVLMVVRSN
A0A2V9RTW2      NPAELVANGRLKILLNRVEA-LF--D--WIIIDSPPAVPVSDASLLANYCDGVVMVVRSN
A0A2V9TGF1      NPAELVANGRLKILLNRVEA-LF--D--WIIIDSPPAVPVSDASLLANYCDGVVMVVRSN
A0A2V9XEV6      NPAELVANGRLKFLLTRVEP-LF--D--WIIIDSPPTVPVSDSSLLANFCDGVLIVVRSN
A0A2V9Y3Q6      SPAELVANGRLKFLLNRVEP-LF--D--WIIIDSPPAVPVSDASLLANFCDGVLIVVRSN
A0A2V9R269      NPAEMLSNGRIKTLLHRLEP-LF--D--WIIIDSPPAVPVADAAMLANHCDGVLLVVRSN
A0A2V9PTS3      NPAELLANGRMKFLLERLQP-IF--D--WIIIDSPPAALVSDAGLLAKYADGVLLVVRSN
A0A2V9NPF4      NPAELLANGRMKFLLERLQP-IF--D--WIIIDSPPAALVSDAGLLARYADGVLLVVRSN
A0A2V9PNZ0      NPAELLANGRMKFLLERLQP-IF--D--WIIIDSPPAALVSDAGLLAKYADGVLLVVRSN
A0A321LMC5      SAGDILTTSRVEGVLDELES-AF--D--FVVIDAPPITDFADAQRLAALADGTVLVVKAG
A0A2V8X713      NPAELLANGLLKGLLDRVSP-LF--D--WVILDAPPVLAVSDAGVLAGLCDGVIVVVRAG
A0A2V8ZLE9      NPSELLANGMLKAFIHGISP-VF--D--WVIVDAPPVLAVADAGIIADFCDGVIVVVRAG
A0A2V8Y4D3      NPSELLANGMLKSFIDGVSP-VF--E--WVIVDTPPVLAVADAGIIAEFCDGVMVVVRAN
A0A2V8Z2X8      NPSELLANGMLKGFIDKIGP-IF--D--WVIVDAPPVLAVADARIIAEFCDGIMVVVRAG
A0A2V9C3F6      NPSELLANGTLKRFLDGMSP-IF--D--WVIIDAPPVLAVADPSIIAEFCDGVLVVVQAG
A0A2V9QMU9      NPAELLSSGNMKKVLDELRE-QY--D--HIVVDTPPTLSVTDPVILSTRADAVVLVIRSG
A0A2V9QY75      NPAELMASQQMFDLLAELRE-QY--D--HIVIDTPPTLSVTDAVVLSTRSDAVVLVIRSS
A0A2V9SVU9      NPAELLASSNMKDVLAELRE-QY--D--HIVVDTPPTLSVTDAVVMSTRADAVVLVIRSG
A0A2V8W5N5      NPSELLSNGRLKILLDRLTP-IF--D--WIIVDSSPCLLVADASMVAGVSNGVLLVVRAG
A0A2V8XG53      NPSELLSNGRLKILLDRLTP-IF--D--WIIVDSSPCLLVADASMVAGVSNGVLLVVRAG
A0A6A7LB89      DPMAGLTSARMRQLIEEARL-KF--D--WVVIDTPPVTLMPDAKLLAGMVDAVVLVVGAA
A0A2V9XV04      DPAEMVASSRLKVLLQRIEP-VF--D--WIIIDSPPAIPVSDASVLAKACDGVLMVVRSN
A0A2V9CBY1      NPAELLANNKLRALFSRVLA-LF--D--WIIVDAPPALPVSDASVLSGMCDGVIFVVRAG
A0A2V9D656      NPAELLANNLLRALFSRVLP-LF--D--WIIVDAPPALPVADASVLAGMCDGVIFVVRAG
A0A352EZH8      DVAELLSGPTFAGVIAEARR-LF--D--FIIIDAPPLGIFTDANVLISRADGALLVVRAG
A0A0B6X033      DVAEMLSGPRFSSVLAEVRR-MF--D--YIVIDAPPLGIFTDATVLINRADAALIVVRAG
A0A2V8R0I3      DVAELLSGPRFARLLDEARK-LF--D--YIIIDAPPLGIFTDANLLINRADAAMLVVRAS
A0A2V8N1U8      DVAELLSGPRFGRLLDEARK-MF--D--FVIIDAPPLGVFTDANLLINRADAAILVVRAS
A0A2V8QL35      DVAELLSGPRFGRLLEEARK-LF--D--YIIIDAPPLGVFTDANLLINRADAALLVVRAG
A0A352FU10      DVAELLSGPRFGRLLEEARK-LF--D--YIIIDAPPLGVFTDANLLINRADAAMLVVRAG
A0A2V8LCU0      DVAELLSGPRFGRLLEEARR-LF--D--YIIIDAPPLGVFTDANLLMNRADAALLVVRAS
A0A1Q7NGT0      DVAELLSGPRFGHLLDDARK-MF--D--YIIIDAPPLGVFTDANLLINRADAALLVLRAA
A0A2V8MLP9      DVAELLSGPRFGHLLDDARK-MF--D--YIIIDAPPLGVFTDANLLINRADAALLVLRAA
A0A2V8PQZ0      DVAELLSGPRFGHLLDDARK-MF--D--YIIIDAPPLGVFTDANLLINRADAALLVLRAA
A0A3B9MKY6      DVAELLSGPSYARILTDVRR-MF--D--YIIIDAPPLGIFTDANVLMNRADGALLVVRSG
A0A3D5SKZ1      DVAELLSGPSYARILTDVRR-MF--D--YIIIDAPPLGIFTDANVLMNRADGALLVVRSG
A0A2V8NRW2      DVAEILSGPKFGQLLAELRR-MF--D--YIIIDAPPLGIFTDATVLINRADAALLVVRSG
A0A2V8TKR9      NPAELISSARMRDLLKEMAA-RY--D--HILIDSPPMMNVTDPVILSRMVDGVILVVHGG
A0A2V8LBV1      SSVHLLHSKRLPDLLRRVRK-EF--D--VVLIDAPPVSQIADARVLARLSDGVIFVVRSA
A0A2V8GAF9      TPYELLNSRRLEGLLSEARR-LY--D--FVLIDTPPLVPFPDCRLLGRWADGFVLIVGAN
A0A2V8CN98      ESPELLGSPRMVELLVRLRA-MY--P--VIIVDSPPLGAGVDPYTLGTMTGAMMLVLRTG
A0A1Q7LC46      NPADLLSSHRLADAIAELRT-KF--K--FIVIDSPPIMAATDAVILSVLADGVLLIVRSG
A0A1Q8BDC5      NSIEILSLRKMKELIESLRK-DF--D--TIILDAPPFAPIADARIVTGLSDGLIMVLRRG
A0A2V9Q1Y8      NPAELLASSQMLDLLAELRE-QY--D--HIIVDTPPTLSVTDAVVLSTRSDAVVLVIRSG
A0A2V8JXG1      NPAELLSSDRMKRLLAQLSE-RY--D--HIVLDSPPLGSVTDAVILSTMVNGVILVVHGG
A0A350D2W9      NPAELLGSDRMSKLLALLKD-QF--D--FVLIDTPPILTVTDAQILGKLVDGLVLVVQAG
A0A2V9I4J1      NPVELLSQDKMRELIQYLKT-EF--D--TIIFDAPPFAPIPDARIIMGLSDGLVLVVRRG
A0A2V8PQZ9      DVAELLSGPRFGHLLDDARK-MF--D--YIIIDAPPLGVFTDANLLINRADAALLVLRAA
A0A2V8D8B1      NPAELLGSTRFKDFVTTVGQ-HF--D--WVVIDSPPVMAVADAAVIANIASGVVFVVGAE
A0A3B9LSB4      NPAELLGSDQMRRLMATLQS-QF--S--HVVVDSPPVNSFTDGVLLSSMVDGVLLVVHGG
A0A2V9H7U2      NPAQLLSSSAMESLLKELRQ-RF--K--FIVIDSPPVLPVTDAMILSTFVDGVAFVVESG
A0A2V8NJB5      NPIELLSLRRMKDLIEYLKN-DF--D--TIILDAPPLSPIADARIVTALSDGCIMVIRRG
A0A2V9JMZ4      NPVELLSQDKMRELIQYLKT-EF--D--TIIFDAPPFAPIPDARIIMGLSDGLVLVVRRG
A0A2V9MDJ6      NPVELLSQDKMRDLIQYLKT-EF--D--TIIFDAPPFAPIPDARIIMGLSDGLVLVVRRG
A0A2V8QJT6      NPAELLGSDQMRKLLATLSE-KF--T--HIVIDSPPVNSFTDGVLIGSMVDGVLLVVHGG
A0A2V8FSM8      HASSLVHTERLAEIVVLARE-HF--D--MVIIDTPPMVNIADARVLARHSDALILVVRSG
A0A359M0J2      TIHSIFNSPRLGELLAVLRQ-RF--A--MVLLDSPPVLQFPEARLAGRFADGAVVVLRSR
A0A2V8JLJ1      NPGELLSSAHIELVLRECAE-SF--D--WVIVDTPPILGAADVNLMAPFCDAILLVVQSG
A0A5M8SND8      SEASLFYSPSLAKIVQTARK-QY--D--VVLIDTPPCLHLADARVIGKVSDAVILVTRAG
A0A2V9GAQ1      NPADLLSSHRLVEAVAELRT-KY--K--FIIIDSPPIMAATDAVILSVQTDGVLLVVRSG
A0A497EDQ8      NPPELFGKKSFKDLLATARE-NY--D--WVILDSPPTASVTDPVVAAQLVDMVLAVVKYG
G8NS05          FPTEMLSSETMAELLEKCRG-IY--T--HILIDSPPLLSVTDGIILGRDADAVVLIVRHG
A0A2V8KZ20      NPGELLSSAHIELVLRECAE-SF--D--WVIVDTPPILGAADVNLMAPFCDAILLVVQSG
A0A3D0NWU2      NPAELLSSNEMRNLLQFLRS-KY--K--HVIIDSPPAISFTDAAILSTQVDGVILVAMAG
A0A2V8EPD9      DPMSGLTSDRMKRVLAQAAS-HF--D--WVLVDSPPVGLLPDASLLATLVDGVLLVIRSG
A0A3N5NSX5      NPSELLASDRMKTLIANVQTGPF--D--WVLIDTPPVLAVTDAVIIAPWVSGVVFVIGSE
A0A2V8MUA1      NPTEVLSSPEFERVMKDLAQ-FF--D--WIVVDSPPSLAMADADLLLRQCDAALLVVNAD
A0A2V8MBH9      NPAELLGSEQMRKLIAVLSG-AF--T--HIVIDSPPVSSFTDGVLIASMVDGVLLVVHGG
A0A3N5ZPQ7      SPIELLSLRKMRELFDYLRI-EF--D--VVIIDSPPLNPISDTRLISGFSDDVILVIRRG
A0A3N5P5F2      NPAELLSAQQFEHFLNSLSA-RF--D--WVILDAPPVLAVTDASIVAHSASGVVFVTSAD
A0A2V9G1P7      NPSEMLSSQSMSALIRSASA-EY--G--FIILDSSPMLALADSRILAPLVNGVLLVVKSG
A0A2V9BCK9      NPAELLADNRMKVLIDRMAP-VF--D--WVIVDAPPVHPVGDAGVLAGLCDGVIVVVRAK
A0A2V9TMX2      QPTELLGSTVMKDYISRWRN-EF--D--HIIIDTPPCLSVTDAVLLSPEADRVILVARSG
A0A2V8N2J7      NPVAALSSAKARAVFEQLKQ-KF--A--YIIVDAPPVLPIADSQILAGIVDKVLFVIRAR
A0A3N6BI26      NPAELIGSERMESALRLLGD-YF--K--YILIDTPPILSVTDGLLLCPHVDGVVMVIKGG
A0A2V9JMM3      NPVGVLGSERMRRLVERLRL-EF--R--FIVLDAPPILPIADPQVLAGYADGVLLVVRAR
A0A2V9M815      NPVGVLGSERMRRLVERLRL-EF--R--FIVLDAPPILPIADPQVLAGYADGVLLVVRAR
A0A2V9A795      NPAELLSSKSMGAFITSAKS-EY--G--FVILDSSPLLTLADSRIVASLVDGVLMVVKSG
A0A355ESH9      NPSELLASERLRDLLRTLRS-RF--D--YVIVDTPPALAVTDATLVGIQTDGVVLTLRSH
A0A3D0NW85      NPAELIGSQPMAELLVTLQK-NF--T--HVVIDSPPITSFTDGVLIASMVDGVILVVHSG
A0A353CAT5      NPAELIGSEQMASLLKVLQK-HF--T--HVVIDSPPITSFTDGVLIASMVDGVILVVHSG
A0A2V9HB55      NPADLLSSHKLADGITELRT-KF--K--FIVIDSPPIMAATDAVILSVQADGVLLVVRSG
A0A2V8CU57      DPMSALASEEMKLLLGEAIE-HF--D--WVIVDSPPVALLSDANLVAAMVDATILVIGAA
A0A2V8BDI4      DPMSALASEEMKLLLGEAIE-HF--D--WVIVDSPPVALLSDANLVAAMVDATILVIGAA
A0A2V8F8T3      DPMSALASEEMKLLLGEAIE-HF--D--WVIVDSPPVALLSDANLVAAMVDTTILVIGAA
A0A2V9J901      NPAEVLSSSLAAESLRKLRA-DF--D--YVLVDSPPLLSVADGRILATMVDGAVLVARAF
A0A2V8MKQ7      NPAELLGSDEMRRLLASLSE-KF--T--HIVVDSPPAISFTDASILSTVVDGVILVVHGG
A0A3M1SNQ5      DSSELLSGPKFRDLLQHLKK-MF--D--YILIDAPPLAIFSDAKVSINQSDAAILVVRSG
A0A2V8QJ59      NPAELLGSEEMRKLLIALSK-KF--T--HVIVDSPPAISFTDASILSTFVDGVILVVHGG
A0A1Q7HTA7      NPYEVLKSAGIGEVIQAARR-RY--D--AVVVDTPPLLPVPDNRALAKWVDGFLLVVAAH
A0A2W0B5E2      NPAELLCSEAMESLFGELRR-RF--K--HIIIDSPPLLAVTDATVLASAVDGVILVVESG
A0A2V8NMG8      NPAELIGSEQMRRLITTLQS-TF--T--HIIIDSPPIASFTDGVLIASMVDGVVLVIHGG
A0A2V8TBM7      NAAELLGSEEMRKLLYLLTE-NF--T--HIIIDSPPAISFTDASILSTMVDGVMLVVHGG
A0A1Q7HEZ8      PIHEILRSPRLERLLQEARQ-RY--D--FIVLDTPPLLPVFDAATISKLVDGLIVVVAAN
A0A1Q7JW36      PIHEILRSPRLERLLQEARQ-RY--D--FIVLDTPPLLPVFDAATISKLVDGLIVVVAAN
A0A1Q7MUR4      PIHEILRSPRLERLLQEARQ-RY--D--FIVLDTPPLLPVFDAATISKLVDGLIVVVAAN
A0A3N5PFU4      PIHDVFRSARLPQLLSEARA-RY--D--YVVLDTPPLVPVVDSVLLSRVVDGVLVVVAAN
A0A4R1LDF1      RPEEAVHSEGVKKVLEAARQ-EY--D--MVIIDSAPLLLAVDTHVLLPMVDHALLVVRAD
A0A1F2T1R8      GVTEMLRSPRLEQLLQEARR-EY--A--YVVIDTPPLLPIFDASVLAKLADGVLMIVAAN
A0A2V9BW09      NPAELLQSPRIQELLTQISS-AF--D--WIVLDAPPVNLFADARHLANLADAVVLVLRVG
A0A3M1SSE1      NPAELIGSAQMSTLMEIFQK-EF--T--HVIIDSPPIASFTDGVLIAAMVDGVIMVVHSA
A0A2V9GQV7      PPPELFAGTRWQEFLGHCGE-MF--K--VILIDAPPILPRVDFELISAACDGIVMVVRAH
A0A2V7YV88      NPSELLGSGRMKELIAQMLS-HF--T--HVIFDTPPINAVTDAVILAASADGTIVVVEQG
A0A2V8YCY6      NPADLLSSHKLADAIVELRA-KF--K--FIVVDSPPIMAATDAVILSVHADGVLLVVRSG
A0A2V8EGM3      DPLSGISSLRMQQLLREAVE-RF--D--WVILDTPPVGVAADAGLLCPMVDGTLLVVRAG
A0A2V8FGH1      DPLSGISSLRMQQLLREAVE-RF--D--WVILDTPPVGVAADAGLLCPMVDGTLLVVRAG
A0A2V8D468      NSAELLTSQQFKDLLSALGG-HF--D--WIVLDSPPVSAVTDAVQLSHDVSGVLFVVGAG
A0A1F2R977      SSVGGLASNRMKAVIDGAAP-RF--D--WVLVDTPPIGLLSDAQFLAGLVDGVLLVIGAA
A0A2U3LF12      DPVELLSSRRTREILARLRQ-EY--Q--LIVLDSPPIVPIADSHFLAGLADGVILVIRAR
A0A3N5G7M6      NPSELLDSQRFRKFLARLGN-HY--D--WVILDSPPVMPVTDAIVLAEAATGVIFVTAAE
A0A1F2S3Q7      GISEILRSPRLDAFLQELRQ-RY--A--YIVLDTPPLLPVFDAALIAKSVDGVLMVVSAN
A0A2V8GVG4      AVHQVLRSPRLDAVLAEARG-RY--D--FVVLDTPPLLPVFDSALLANAVDGVLMVVAAN
A0A2V8PJQ0      NPAELLGSEQMRRLLTLLGE-KF--A--HIIVDSPPAVSFTDASILSTFVDGVILVIHSG
A0A2V8H566      DPIGGLTSERMRQLVAAGTA-EF--D--WVVIDTPPVGLLTDARLMSSMVDAVIFVISAG
A0A2V8UVN4      HPTELLDSNRWTALCASVRQ-QF--K--FVILDTPPIAAVADYDLIDAQCDGVVLVVRPD
A0A321LXF5      PAPELFSRAAWKEFIGWSSE-SF--K--LVLIDSPPMLDLADFELIASPCEAVMLVARSG
A0A5M8SBZ0      SPAELMSNGKMKGLLDELEP-HF--E--WIVIDSPPVSVVSDVASLAAVSHGIVLVVRSG
A0A1Q7JFB1      DPMSGLTSGRMRRLIGEAAA-TF--D--WVIIDTPPVVLLPDANLLAAMVDAAILVIGAG
A0A2V8DMJ9      TPYELLNSPRLEGLLRDARR-TY--D--CVLIDTPPAVALPDCRLIERFVDAFLVVVAAH
A0A2V8GGF6      AAYELLNSTRLESSIETARR-RY--D--YVLIDTPPLVPLPDCRLLAKCVDGFLLIVAAH
A0A2V8HKU7      AAYELLNSARLESSIEEARR-RY--D--YVLIDTPPLVPLPDCRLLAKCVDGFLLIVAAH
A0A1Q6Y875      NPTELLGSTRTKSLFERLNT-LF--D--WVIVDTSPVLPVSDAAVLAPTCDGVILVVGAG
A0A523DJA9      NPSELLASDRMRNLLASLATGPF--D--WIILDTPPVLAVTDSVILAPLLSGMVFVVGAE
A0A2V8I604      RPAELLGSSAMRRLLDTVRT-QF--D--RVLLDMPPVAPLADVSIVASMIDGVLMIVRAG
A0A2V8J066      HPAELLGSAAMRRTIDTLRT-RF--D--RLILDMPPVAPLADVNIAAAVADGILLIVRAG
A0A1I6MMC5      NAADLSSNNRFKELIVKASA-FF--D--WIIVDSSPVNVIADGVNLAHACDGVLLVARGG
A0A2V9D5W7      NPSELLANGRFKRLIERVAP-LF--D--WIIVDSTPCLPVTDANIAANSCDGLLLVVKAY
A0A2V9D4I4      NPSELLSNGRLKSLLDHMAP-FF--D--WIILDSPPCLPVMDANVVADLCDGLLFVVKAG
A0A2V9D6L7      NPSELLSNGRLKKLLDRVAP-LF--D--WIIIDSPPCLPVADANVVSNFCDALLFVVKAG
A0A2V8ZJV2      SPSEVLRTERMKQLLNRVTP-LF--D--WIILDSPPSLRADDAGILADLADGVLLVIQAG
A0A2V9AWB5      NPSELLLSERMKHLLNVVSP-AF--D--WIILDAPPTLPVHDASILADLVDGVLFVIRAG
A0A2V8Z1Y8      NHSDLLLSKKMKHLLNYLTP-IF--D--WVIMDSPPTLPVHDASVLADLADGVLLVVQAG
A0A1Q8AX10      NPAELLADNRMKVLIDRMAP-VF--D--WVIVDAPPVHPVGDAGVLAGLCDGVIVVVRAK
A0A2V9A773      NPSELLANGKLKGFLNGINS-VF--D--WVIVDAPPVLAVADAGIIAQFCDGVIVVVRAG
A0A2V9AND3      NPSELLGNGLLRDFLHGMSP-IF--D--WVIVDAPPVLALADAGIVAEFCDGVIVVVRAG
A0A2V9BTJ7      NPSELLLNDRMKRLLDLMTP-IF--D--WIIIDTPPALPVHDASMMADLCDGVLFVVRAG
A0A2V8W2M7      NPSELLSGDRMKKLLDLVTP-VF--D--WVILDSPPSLAIHDASILADLCDGVLFVVRAG
A0A2V8XNW2      NPSELLSGDRMKKLLDLVTP-VF--D--WVILDSPPSLAIHDASILADLCDGVLFVVRAG
A0A1Q7CJC1      NPSELLSGDRMKKLLDLVTP-VF--D--WVILDSPPSLAIHDASILADLCDGVLFVVRAG
A0A2V9UEM7      GAPELLANGRLKLFLQRVEP-LF--D--WIILDTPPVIPVADSTLLANFCEGVLMVVRSN
A0A1Q7V300      NPAELVASGRMSTLLHRLEP-LF--D--WIIVDSPPAVAVSDAALLAKYCDGVIMVVRSN
A0A2V9ZCI3      SPAELVANGRLKFLLNRVES-LF--D--WIIVDSPPAVPVSDASLLANFCDGVLIVVRSE
A0A2V9WCB3      DPSELIANGRLKMLLQRLEP-LF--D--WIIVDSPPAIPVSDASVLAKACDGVLMVVRSN
A0A2V9VQW5      HPAELIANGRLKMLLQRVEQ-LF--D--WIIVDSPPAVPVSDASQLANFCDGVLMVVRSN
A0A2V9WTP3      NPAELVANGRLKFLLQRVEP-LF--D--WIIIDSPPAVPVSDASLLANSCDGVLMVVRSN
A0A2V9NLA9      SPAELVANGRLKTLLNRLEP-LF--D--WMVLDSPPAVPVSDAGLLANYCDGVLMVVRSN
A0A2V9RKJ9      SPAELVANGRLKTLLNRLEP-LF--D--WMVLDSPPAVPVSDAGLLANYCDGVLMVVRSN
A0A2V9RN95      SPAELVANGRLKFLLNRLEP-LF--D--WIIIDSPPAVPVSDAGLLANYCDGVLIVVRSN
A0A2V9N406      SPAELVANGRLKFLLNRIEP-LF--D--WIIIDSPPAVPVSDAGLLANYCDGVLIVVRSN
A0A2V9U6D9      SPAELVANGRLKFLLTRVEP-LF--D--WIIIDSPPAVPVSDAGLLANYCDGVLIVVRSN
A0A2V8DZN4      HASSLVHTERLAEIVVLARE-HF--D--MVIIDTPPMVNIADARVLARHSDALILVVRSG
A0A3N5YKY1      QPTELLGSFEMRRAVDTLRT-HF--D--RIVIDTPPALALADVGVVGPLSDGVLLVVRAG
A0A2G6HQA4      NPSELLGSILMKDLIAELSS-RY--TDRTIIFDAPPVLLTAEARTLAHHVDGVVMVVRQG
A0A2V7ZTY7      DPMSGLTSNRMRRLVGEAAA-TF--D--WVIIDTPPIVLMPDANLLAAMADAAILVIGAG
A0A2V7ZVL9      DPMSGLTSNRMRRLVGEAAA-TF--D--WVIIDTPPVVLMPDANLLAAMADAAILVIGAG
A0A1Q7QYI4      DPMSGLTSGRMRRLIGEAAA-TF--D--WVIIDTPPVVLLPDANLLAAMVDAAILVIGAG
A0A2V8G9Y9      DPMSGLTSDRMRRLVAEAAA-RF--D--WVLIDTPPVGFLSDANLLAAMADVTLFVVRAG
A0A143PNR5      NPVPLLTSERMGELVRDARQ-HF--D--WIVIDTPPVALLTDANLLTKECDGALLVIHAN
A0A6A7L078      DPMSSLTSERMRSIIDEASA-RF--D--WVILDTPPVGLLADGNLLADMVDGALLVILAE
A0A143PXU3      NPVGDLSSGRMSRLIANAGS-TY--D--WVIVDSPPAAGLADARIILETVDGAILVVRAA
A0A2V8D8G9      TPLAGLTSSRMGEVIEECAA-RF--D--WVLIDTSPVGVLPDAQVLARLVGAVILVIGAG
A0A2V8ESQ4      TPLAGLTSSRMGEVIEECAA-RF--D--WVLIDTSPVGVLPDAQVLARLVGAVILVIGAG
A0A1E3Y5Q0      DPMVTLAAERMQALITEARE-QF--D--WIVIDTPPVGLLPDAGLISGLADGTVVVVRAD
A0A2W4TWK5      DPMAVLASERMRDLLADVRE-DY--D--WVVIDTPPIGLLADANLLADVSDGMVLVVKAG
A0A3N5NYV3      DPMSRLASDRMRRVLMEAAT-QF--D--WVIIDTPPVGTVPDANLLATMADVVLLVVQAG
A0A2V2RJF9      RPAELLSSHRLTQLLEQLKA-EF--D--HVIVDSPPLMPVTDAVILAAKSNCVVMVVHGG
A0A2G6HNT3      NPSELLSSVLMKDLIKELSS-RYTDR--TIIFDAPPVLLTAEARILAHHVDGVVMVVRQG
A0A2V7YWD4      DTYELLASGRFGELLRDARQ-RY--D--CVVVDTPPVLPAPDSRLLAEWIDGYVIVVAAD
A0A2V2R8T6      DVAELLGGPTYARLLTDARR-MF--D--YVIIDAPPLGVFTDASVLISRADGALLVVSAG
A0A1Q7RGF1      QPAELFASSHWQEFISWCSE-SF--K--LVLIDSPPVLNLTDVDLIAAACDGVVMVVRAQ
A0A2V9BLX2      QPAELFASSHWQEFISWCSE-SF--K--LVLIDSPPVLNLTDVDLIAAACDGVVMVVRAQ
A0A2V9ZA03      QPLEILQSQRMSEMLTQVAE-WF--E--WVIIDSPPLAPVADPNLWAMQADGTLLVVEQG
A0A3N5ZNH4      NPAELIGSDKMETGLKLLGE-YF--K--YVVVDSPPVLAVTDALVISPLVDGVVLVVRGG
A0A2V8GEZ2      DPIGVLTSPAMRQLVKFARD-GY--D--WVLIDTPPVGLLTDAHLVAQMVDAVVMVVSAG
A0A3N5ZFD3      DPMAVLTSDRMRRLMEEAAA-GF--D--WVVVDTPPVGLLPDANLLAAMVHAAVLVVEAG
G8NXD3          KPVPLLRAPELSNLLKWAQK-NF--Q--WVLLDAPPVLPVADVEQLLPSADLVLMVVRER
A0A2V9VR38      NPAELLASTNMRDLLAQLRE-QY--D--HIVIDTPPSLSVTDAVVLSPRADAVVLVIRSG
A0A2V9EY04      PPPELFTGSHWQELLGRCSE-LF--E--VVLVDTPPIIPLADFELISVACQGVVMVVRAR
A0A2V9HAK9      PSPELFIGTRWQEFLGHCGE-MF--K--VILIDAPPILHLADFELISAACDGIVMVVRAH
A0A1Q7FS15      SPPELFTGTHWQEFIARCSE-LF--K--VILIDTPPILPLADFELISAACDGVLMVVRAH
A0A1Q7K9P1      SPPELFTGTHWQEFIARCSE-LF--K--VILIDTPPILPLADFELISAACDGVLMVVRAH
A0A1Q7N989      SPPELFTGTHWQEFIARCSE-LF--K--VILIDTPPILPLADFELISAACDGVLMVVRAH
A0A2V9G7Y0      PSPELFTGTRWQEFLGQCGE-MF--K--VILIDAPPIRPLADFELISAACDGIVMVVRAH
A0A2V8T7Z1      DPFDVLRSPRFEEFLRQARE-SY--D--SVVLDTPPLLMVPDCRQLSAWVDGILLVVAAH
A0A2V7U8G5      NPYQALESPRIGQLLEQARD-AY--E--YVVLDTPPVLLVPDCKLMSQWIDGFLLVVAAH
A0A2V7UNP9      DAYRVLESARVGQLLDTARG-SY--D--CVILDMPPVLLVPDCRLMSQWIDGFLLVVAAH
A0A2V7VLD7      DAYRVLESARVGQLLDTARG-SY--D--CVILDMPPVLLVPDCRLMSQWIDGFLLVVAAH
A0A2V7XGA3      SAYRLFDSARVGQLLDQARR-RY--D--HVLVDTPPVLLVPDCRLMSQWVDGFIVVVAAH
A0A2V7YAG6      NAYRVFDSPRVGELLEQARR-TY--D--YVVLDTPPVLLVPDCRLMSQWVDGFLIVVAAH
A0A2V7VK33      LPFELLRSPRLADLLAEARQ-QY--D--YVVVDTPPLLLLPDCRAVAQQVDGFLLVGA--
A0A3M1VTE1      NPVGLLSSGRMAGLLAEWRS-RF--Q--RVVVDTPPIVPFADAGILGELSDGVLLVARAG
A0A2V7TTM7      NAYQILESPRIGQLLQEARR-SY--D--RVVLDTPPLLLVPDCRLLSQWVDAFVIVVAAR
A0A2V8VI82      NPYDVLKSPRMGEIVQAARR-RY--D--TIVIDTPPIVPVPDSRVLAKWVDGFLLVVAAH
A0A2V7U4P9      APYEILRSPRVAELLAEAHS-LY--D--YVIIDTPPVIPCPDYRLLEPFIDGVMLVVAAD
A0A2V7TQY5      APYEMLKSPRLGQLIGQARD-RY--E--YVVIDTPPLVPVPDARVVEKWVDGFVIVVRAH
A0A2V7TU87      IPYELLRSSRLGDLLDQARR-DY--D--YVVLDTPPLVPIPDARVISKWVDSFLLVVRAN
A0A2V8SEH0      APYEVLKSPRLGDLFQEARR-RF--D--YILVDTPPIVPVPDCRVISKWVDGFMVVVAAH
A0A2V8VU54      QPYEVLKSPRFGAVLEEARR-MF--D--YVVVDTPPLIPVPDCRLIARWVDGLLMVVAAH
A0A1Q7RML7      APYEALKSPRLGALFEQARR-LF--D--YIVVDTPPLVPVPDCRLLARWVDGLLMVVAAH
A0A1Q7ZIQ5      APYEALKSPRLGALFEQARR-LF--D--YIVVDTPPLVPVPDCRLLARWVDGLLMVVAAH
A0A2V8TKD8      APYEALKSPRLGALFEQARR-LF--D--YIVVDTPPLVPVPDCRLLARWVDGLLMVVAAH
                                      :      ::.* .*     :                  

A0A1F2U8T6      MTRRQVAEHAIETIL-SSRPKLLGVVLN----KV-----D-FARNKYYYSRY--------
A0A2V8BV42      MTRRRLAERALETIM-SSRPRYAAIILN----RV-----D-FARNKYYYSRY--------
A0A2V8F916      MTRRRLAERALETIM-SSRPRYAAIILN----RV-----D-FARNKYYYSRY--------
A0A1Q7K833      MTRRRLAERAIETIL-QTRPKYTAVVLN----KV-----D-FARNKYYYSRY--------
A0A1Q8AMY4      MTRRRLAERAIETIL-QTRPKYTAVVLN----KV-----D-FARNKYYYSRY--------
A0A2V8BM40      MTRRRLAERAVETVM-QARPKYAAVVLN----KV-----D-FARNKYYYSRY--------
A0A2V8CRT6      MTRRRLAERAVETVM-QARPKYAAVVLN----KV-----D-FARNKYYYSRY--------
A0A1F2VH76      MTRWRLAERAVETLL-SGNPRHLCAVLN----KV-----D-FARNKYYYSRY--------
A0A1F2R0X5      MTRRRLAERAIETIM-EARPRQVGVVLN----KV-----D-FARNKYYYTRY--------
A0A2V8B278      MTRRRLAERAIETVM-QTHPKYAAVVLN----KV-----D-FARNKYYYHRY--------
A0A2V8CEF9      MTRRRLAERAIETVM-QTHPKYAAVVLN----KV-----D-FARNKYYYHRY--------
A0A2V8KZG2      RNKRNAVQRACRELS-AVGARIFGVVLN----NV-----NMKREGYADYQYY--------
A0A1Q7LG57      QTTTESALYASQRFA-EDGTRVLGTVLN----SW-----D-PKNSHRYGYGS--------
A0A2V8YMQ4      ATPREQIRQSQSGIR-SAGANLIGVVLN----NV-----T-LHTNGYYGLGI--------
A0A1Q7L5B1      STGYDVVSTALQELR-G--KKILGVVLN----RA-----E-EKEATYGAYPY--------
A0A2V9DKV4      STGYDVVSTALQELR-G--KKILGVVLN----RA-----E-EKEATYGAYPY--------
A0A2V8W380      TTPREQLLHAQSGIR-SVGGNLIGVVLN----SV-----D-IRTN--GYY-N--------
A0A2V8ZIV5      ATPREQVMQSQSSIR-TAGANLIGVVLN----IV-----R-LHTN--GYY-G--------
A0A2V9EVA0      RTSSDLARTACQELR-E--SRLLGVVLN----GV-----E-DDAVGSPYA-Y--------
A0A1Q7RB73      ATPHDLARKACQEFA-S--KKIVGVVLN----RV-----K-PEYSYGSQY-Y--------
A0A2V9K0H7      ATPHDLARKACQEFA-S--KKIVGVVLN----RV-----K-PEYSYGSQY-Y--------
A0A3N5YN96      QTPRPAIERALRQVA-P--ARVLGLVLN----DV-----G-EI---SSGY-A--------
A0A1Q7Y646      KTRYATVERLLEQLP-R--ERMLGVVLN----RS-----E-ETMEDSSAY-Y--------
A0A2V8QZU0      RTRYAALERLLEPLP-R--ERLLGVVLN----GS-----D-EQLSEQNYY-Y--------
A0A2V8RSQ9      RTRYGTLDRVLEPLP-R--ERLLGVVLN----GA-----D-SAPDAQSYY-Y--------
A0A2V9LS17      STSCEASQKTRDQFK-G--RRVLGVVLN----RV-----D-PRGSSSYKY-Y--------
A0A2V9AGR3      ETSYENAVKGSSEFR-E--KNLLGVVLN----QI-----Q-EADMYAGDY-Y--------
A0A2V9G0N7      VTDFEVAERAVAEFR-E--KNLLGVVLN----GA-----E-QGAAY-GEY-Y--------
A0A2V9GQ44      VTDFEVAERAVAEFR-E--KNLLGVVLN----GA-----E-QGAAY-GEY-Y--------
A0A2V9HRN3      VTDFEVAERAVAEFR-E--KNLLGVVLN----GA-----E-QGAAY-GEY-Y--------
A0A2V8WG13      ETNHQLAEKASAEFL-K--KNLLGVVLN----SA-----E-IDASY-GDY-Y--------
A0A2V8X987      MTHVGEAEKAAEEFQ-N--KNLLGVVLN----KV-----E-KRDSY-GAY-Y--------
A0A1Q7KX94      STDAAIAERTAAEFQ-G--KNLLGVVLN----QV-----E-RSDSY-GDE-Y--------
A0A2V8XHT0      STDAAIAERTAAEFQ-G--KNLLGVVLN----QV-----E-RSDSY-GDE-Y--------
A0A2V9L2P7      VTTRATLSRACSVIR-HSGGKILGAVVN----KV-----D-ARRDGYYGH-Y--------
A0A2V7UMX0      RTPRPLLAEALGVLE-P--DKVVGLVLN----GD-----D-SFSSEYYRY-Y--------
A0A136K497      RTKYGALDRILEPLP-K--DRMLGVILN----QS-----E-EVLDESHYN-Y--------
A0A399W9E4      RTKYSALDRILEPLP-K--DRMLGVILN----QS-----E-EVLDESHYN-Y--------
A0A2V7X0V9      ATPCDVARKAREEFP-D--QSLIGVVLN----GT-----S-DDAASYARY-Y--------
A0A2V9X518      TTPFDMARKARLEFQ-D--KHLIGVVLN----GI-----E-ADSSPYSRY-Y--------
A0A2V9VC62      ATPYDTAQKARQEFQ-G--KTLVGVVLN----GI-----T-RGDS-YSRY-Y--------
A0A2V9S1P8      ATPFDVARKARQEFR-D--KHLVGVVLN----GV-----S-TESS-YTQY-Y--------
A0A2V9RTW2      ATPVDMARKARQEFR-D--KHLVGVVLN----GI-----E-ADSSPYNQY-Y--------
A0A2V9TGF1      ATPVDMARKARQEFR-D--KHLVGVVLN----GI-----E-ADSSPYNQY-Y--------
A0A2V9XEV6      TTPFGMARKARLEFQ-D--KHLIGVVLN----GI-----E-ADSSPYSRY-Y--------
A0A2V9Y3Q6      TTPFDIARKARQEFE-D--KHLVGVVLN----GI-----E-PDSSPYSRY-Y--------
A0A2V9R269      STPIDAARRARAEFT-G--RNVVGVVLN----GI-----T-AEMSPYMQY-Y--------
A0A2V9PTS3      TTPADAARKARQEFA-D--HNIVGVVLN----GI-----T-PELSPYSQY-Y--------
A0A2V9NPF4      TTPADAARKARQEFA-D--HNLVGVVLN----GI-----T-PELSPYSQY-Y--------
A0A2V9PNZ0      TTPADAARKARQEFA-D--HNIVGVVLN----GI-----T-PELSPYSQY-Y--------
A0A321LMC5      RTHHSAVANALKLIP-K--ERRVGVVLN----VA-----E-VFNEEVTYY-Y--------
A0A2V8X713      ATAHDLVQTTLQEFR-G--KNLLGVVLN----RA-----E-REANYGAYS-Y--------
A0A2V8ZLE9      ETAHNLVKTTLQEFR-G--SNLLGVVLN----GG-----S-EAANYGGYA-C--------
A0A2V8Y4D3      KTPHDLVKTTLQEFR-G--NNLLGVVLN----DA-----S-EGANYGGYS-F--------
A0A2V8Z2X8      QAGRDLVKTTLQEFR-G--NNLLGVVLN----GS-----D-QDASCASYS-Y--------
A0A2V9C3F6      ETAHDLVKTTLQEFR-G--NNLLGVVLN----GA-----N-EGTNYGGYS-Y--------
A0A2V9QMU9      QTTRQALRRARDILL-QVNAHATGVLLN----AV-----D-LNSGDY-YY-Y--------
A0A2V9QY75      QTTKPALRRTRDILT-QVNARVAGVLLN----AV-----N-LNSPDYSYY-Y--------
A0A2V9SVU9      QTTKQALRRSRDLLM-QVNARIAGVLLN----AV-----D-LNSPDYYYY-Y--------
A0A2V8W5N5      STSVDVAEKVCQQLK-G--KNIVGVVLN----GA-----E-KSDLVDSHY-H--------
A0A2V8XG53      STSVDVAEKVCQQLK-G--KNIVGVVLN----GA-----E-KSDLVDSHY-H--------
A0A6A7LB89      HASFDIVKQAAKTIG-R--KKILGVVLN----RA-----A-SQPMPYSSY----------
A0A2V9XV04      STPSDVARKARMEFP-D--QMLVGVVLN----GT-----D-RDEAEYARY-Y--------
A0A2V9CBY1      MTAFDMAQAACGELR-N--KNLLGVVLN----GV-----E-EEAIYGAYG-Y--------
A0A2V9D656      VAAFDMAQAACGELK-H--KNLLGVVLN----GV-----E-EEAIYGAYG-Y--------
A0A352EZH8      KTRYAQVNELLEQLP-R--ERMLGVVLN----RA-----D-EELESGAYY-Y--------
A0A0B6X033      YTRYSLLDRLLEPLP-R--ERLLGIVLN----GV-----D-ETLDEHSYY-Y--------
A0A2V8R0I3      KTRYAVVDRLLEQLP-R--ERVLGVVLN----RA-----E-TRLDDAAYY-Y--------
A0A2V8N1U8      KTRYSIVDGLLEQIP-R--ERLLGVVLN----RA-----Q-AATDETAYY-Y--------
A0A2V8QL35      VTRYAVVDRLLEQLP-R--ERMLGVVLN----RA-----Q-GKPDDAVYY-Y--------
A0A352FU10      VTRYAVVDRLLEQLP-R--ERMLGVVLN----RA-----A-GKTDDAAYY-Y--------
A0A2V8LCU0      ATRYSVVDRLLEQLP-R--ERILGVVLN----RA-----E-AKPEDTAYY-Y--------
A0A1Q7NGT0      KTRYSVVDRLLEQLP-R--ERMLGVVLN----RA-----E-IEPDETAYY-Y--------
A0A2V8MLP9      KTRYSVVDRLLEQLP-R--ERMLGVVLN----RA-----E-IGPDETAYY-Y--------
A0A2V8PQZ0      KTRYSVVDRLLEQLP-R--ERMLGVVLN----RA-----E-IGPDETAYY-Y--------
A0A3B9MKY6      KTRYALIDRLLEQIP-R--EKLLGVVLN----RV-----D-EQFDETAYY-Y--------
A0A3D5SKZ1      KTRYALIDRLLEQIP-R--EKLLGVVLN----RV-----D-EQFDETAYY-Y--------
A0A2V8NRW2      KTRYAALDRIIEQLP-R--ERLLGVILN----RS-----D-EQLDETSYY-Y--------
A0A2V8TKR9      KSPRTTVQRARQELQ-GVGAKIYGVVLN----NI-----D-LRREGY--DSY--------
A0A2V8LBV1      ETTRDMAMAACRQFS-EDRSRVLGTILN----MW-----D-PREHNQG---H--------
A0A2V8GAF9      KTPRKLLAQALNLLD-P--AKLIGVVLN----GE-----D-RPLSSHYGYYY--------
A0A2V8CN98      ATNLDLARTKVAMLE-NLPIRVVGAVLN----DV-----R-LGQ-------M--------
A0A1Q7LC46      ETPKAAFTRTRDLLN-SVKSRILGVVLN----AV-----D-SSAPDYY---Y--------
A0A1Q8BDC5      KTSYADTDRAFQAID-R--NKLLGVVFN----DV-----Q-RLFKTYS---H--------
A0A2V9Q1Y8      QTTKPALRRSRDILA-QVNARVAGVLLN----AV-----D-LDSPDYY---Y--------
A0A2V8JXG1      RNSRQAVQRACHELS-AVGARVFGIVLN----NV-----D-LRREGHD------------
A0A350D2W9      TTPREALVQTRELID-LLKLRTLGVVVN----SL-----N-LENHGYYGRHY--------
A0A2V9I4J1      KTPFSAIEKAFKVLD-R--KKLLGIVFN----DV-----K-PMLLHTH---Y--------
A0A2V8PQZ9      KTRYSVVDRLLEQLP-R--ERMLGVVLN----RA-----E-IEPDETA---Y--------
A0A2V8D8B1      MTSRTVARTAVEQLA-NARGRVIGAVLN----RV-----D-LDNNAYY---Y--------
A0A3B9LSB4      KSSRHVVRRSRQLLH-DVGAKIFGVVLN----NV-----A-LQSHDYY---Y--------
A0A2V9H7U2      VTARGAVVRARRVLE-NAGARILGLVLN----KV-----D-VRHNGYY---G--------
A0A2V8NJB5      KTSYRSIEGAFRVID-Q--AKLLGIVFN----DV-----K-PMLFHTY---Y--------
A0A2V9JMZ4      KTPFSAIEKAFKVLD-R--KKLLGIVFN----DV-----K-PMLLHTH---Y--------
A0A2V9MDJ6      KTPFSAIEKAFKVLD-R--KKLLGIVFN----DV-----K-PMLLHTH---Y--------
A0A2V8QJT6      KSSRDVVRRSRQLLL-DVGAKIVGVVLN----NV-----S-VRSHEYY---Y--------
A0A2V8FSM8      QTTRDAARWAQARFA-EDGTAVLGTILN----FW-----N-PKTPGYA---Y--------
A0A359M0J2      HTERDAAMIALRRMA-EDGIPLLGTILN----DW-----D-PKSGAHHSHGY--------
A0A2V8JLJ1      KTPLKVIKDSIKRVG-R--EQICGVILN----RV-----K-VARYGSY---Y--------
A0A5M8SND8      HTTWTEGRAVAQNFT-EDGTRILGTVLN----DL-----K-QSVGAYS---Y--------
A0A2V9GAQ1      ETPKKAFTRTRDLLS-SVKCRILGVVLN----AV-----D-SSAPDYY---Y--------
A0A497EDQ8      GPRRQVVADAMRTLK-RSGVRVAGVLLN----NV-----D-IERDHYY---S--------
G8NS05          KSNKHTIRRARDLLL-RAGVHITGIALN----AI-----D-LNSPE-Y---Y--------
A0A2V8KZ20      KTPLKVIKDSIKRVG-R--EQICGVILN----RV-----K-VARYGSY---Y--------
A0A3D0NWU2      KSSMHLMRRFKQRLG-NIGARIYGVVLN----GI-----K-QGSVEYG---Y--------
A0A2V8EPD9      KAPFPLVKRAVEIIT-H--QRILGVVMN----AI-----D-FKHDRNA---G--------
A0A3N5NSX5      MTQRRLAERAVETLL-TSRPHVLGAVLN----RV-----D-IIRNKYY---Y--------
A0A2V8MUA1      KTPLKLIRDAVERMG-R--DRICGVLMN----RV-----R-NLSSSHY---Y--------
A0A2V8MBH9      KSSRGVVRRSRQLLT-DVGAKIFGVVLN----NV-----S-ARSHDYY---Y--------
A0A3N5ZPQ7      RTPFATIEQGLKVVD-R--KKILGVVFN----DL-----D-EKESQFS---Y--------
A0A3N5P5F2      LTDRNAAVQAVSQLR-SAKANFLGVVLN----RV-----N-LSRNAFF---Y--------
A0A2V9G1P7      TTPREQFMHAQSGIR-GVGGNLIGVVLN----NV-----D-ICT-NGY---Y--------
A0A2V9BCK9      LTAYDLVQTTLQEFR-G--KNLLGVVLN----GA-----D-EEAT---------------
A0A2V9TMX2      QTTRPALRRACDLLL-QVNARVMGIVLN----AL-----N-LHSVEGY---Y--------
A0A2V8N2J7      QTPRELFQHAIEGFE-A--ANLLGAVLN----DV-----D-YQRSRYA---Y--------
A0A3N6BI26      STPKEAARKAGNHLT-SVGARILGALIN----NV-----D-MNAPEYS---Y--------
A0A2V9JMM3      RTRRELFKHAIESFR-A--TNVLGVVLN----GA-----D-YAGSRYA---R--------
A0A2V9M815      RTRRELFKHAIESFR-A--TNVLGVVLN----GA-----D-YAGSRYA---R--------
A0A2V9A795      ATPRDQVMQSQAGIR-SAGANLIGVVLN----SV-----T-LHT-KGY---Y--------
A0A355ESH9      KVTREEVRLVRDRLR-QADVKILGAVLN----RY-----R-ALQAGAA---A--------
A0A3D0NW85      KSSRQIVRRAKQLLN-DVGARIFGVVLN----NV-----D-LRSQENY---Y--------
A0A353CAT5      KSSRQVVRRTKQSLI-DVGAKIVGVVLN----NV-----N-LRSQDNY---Y--------
A0A2V9HB55      ETPKAAFTRTRDLLN-SVKCRILGVVLN----AV-----D-SSAPDYY---Y--------
A0A2V8CU57      TTPYPLVRRAVESVG-A--SRIIGTVLN----RI-----E-RG--QMV---G--------
A0A2V8BDI4      TTPYPLVRRAVESVG-A--SRIIGTVLN----RI-----E-RG--QMV---G--------
A0A2V8F8T3      TTPYPLVRRAVESVG-A--SRIIGTVLN----RI-----E-RG--QMV---G--------
A0A2V9J901      ETPYDLVCRARSLLY-GAGARILGVALN----DV-----D-LRREGYGHNGS--------
A0A2V8MKQ7      RSSRAVVRRTKQQLM-DVGANIFGVVLN----NV-----K-VESHDYYYQGY--------
A0A3M1SNQ5      HTKYSTMTRILEGLP---REKMLGVVLN----DS-----E-DLLQNESYYRS--------
A0A2V8QJ59      RSSRAVVRRAKQQLL-DIGAHIFGVVLN----NV-----KIEKTHDYYYGGY--------
A0A1Q7HTA7      RTPRHLLEEGLRVLE---HARVAGIVFN----GD-----D-RPSSAC--YGY--------
A0A2W0B5E2      VTPKKFVSRARNILD-GANARLLGVALN----KV-----H-MRHDGYYGSYY--------
A0A2V8NMG8      ETSRSLVRRSKQQLQ-DIGAKIFGVVLN----NV-----D-LHRHDYY--YY--------
A0A2V8TBM7      RSSRAVVRRAKQQLQ-DVGAHIFGIVLN----NV-----K-LEGTDYY--YY--------
A0A1Q7HEZ8      QTPRKLLAEALTLLD---PATVLGLVFN----RD-----V-QPLFGYYNSSY--------
A0A1Q7JW36      QTPRKLLAEALTLLD---PATVLGLVFN----RD-----V-QPLFGYYNSSY--------
A0A1Q7MUR4      QTPRKLLAEALTLLD---PATVLGLVFN----RD-----V-QPLFGYYNSSY--------
A0A3N5PFU4      KTPRRLLEEGLNALD---SAKVLGLVFN----SD-----V-RPLYG-YDNNY--------
A0A4R1LDF1      HSPIACAQDAVKML----GDKALGCVLN----DV-----K-KMKYEEYYRAY--------
A0A1F2T1R8      QTPRKLLAEALNLLD---PAKVLGIVFN----QD-----D-RPLFGYYNSYS--------
A0A2V9BW09      VTPRESTQQVSAALD---GAFIAGVVVN----GD-----V-NPLQDRYYYSY--------
A0A3M1SSE1      KTSRQIVRRSCQLIQ-DVGAKIFGVLLN----NV-----N-ISSQ----DNY--------
A0A2V9GQV7      HGQRERLQNTASTLD---RKKLLGVVFN----AT-----D-VSAKDYHGYEY--------
A0A2V7YV88      RTTFPTLRHAKQMLD-RVGGHTLGVVMN----KV-----R-ASGGSSYSYAY--------
A0A2V8YCY6      ETPKVAFMRTRDLLA-SVKSRVLGVVLN----AV-----D-SSAPDYYYSYR--------
A0A2V8EGM3      KTPYKAIEHALEAIG---RDRLLGVVLN----GV-----Q-EHDRAEAYESG--------
A0A2V8FGH1      KTPYKAIEHALEAIG---RDRLLGVVLN----GV-----Q-EHDRAEAYESG--------
A0A2V8D468      KTGRRIAQWALDQLG-LAQATMFGAILN----GI-----N-VDRHPYYYSGY--------
A0A1F2R977      KTPYPLVQRAVAALG---PDRLIGIVLN----RV-----E-EQTITADAYYR--------
A0A2U3LF12      QTRRELLQRAVESLG---ATNIVGVVLN----DV-----E-YGDTRYAYAYR--------
A0A3N5G7M6      TTPIPASRSAVDQLR-RAPAPLLGVVLN----RA-----D-LKRRGYYTRYY--------
A0A1F2S3Q7      RTPRKLLGEALNLLD---ASKVLGIVFN----RD-----A-HPLFGYYDAYC--------
A0A2V8GVG4      QTPRKLLGEALNMLD---PGKVLGIVFN----RD-----A-KPMFGYYDAYY--------
A0A2V8PJQ0      RSSRAVVRRAKQQLLDV-GAHIFGIVLN----NV-----K-LDTHGYYYGGYYGRYYYKY
A0A2V8H566      RTPYRLVHRAVEAVG---RDRIFGVVLN----KV-----A-VQDLWRDYGSY--------
A0A2V8UVN4      HTDRKLCMQAIDIVP---KDRLLGVVLN----CV-----R-D---WFLWKTQ--------
A0A321LXF5      KTSLETFTKTCARVD---PKKLAGVVLN----AC-----E-EVGD----KDY--------
A0A5M8SBZ0      FTRFGVVQHAREELK---DRPLVGVVLN----AA-----S-KNEST---AAY--------
A0A1Q7JFB1      KTPHKLIMRAIDALG---RNRILGVVLN----RV-----D-PSCL----AGG--------
A0A2V8DMJ9      KTPRTLVAEALNVLD---PAKIAGVVFN----AD-----D-RSR-----PSE--------
A0A2V8GGF6      RTPRKSLARALDMLD---PSKLIGIVFN----GD-----D-ASG-----SHQ--------
A0A2V8HKU7      RTPRKSLARALDMLD---PSKLIGIVFN----GD-----D-ASG-----SHQ--------
A0A1Q6Y875      RTSSDLARTACQELR---ESRLLGVVLN----GV-----E-DDALG---SPY--------
A0A523DJA9      MTRSAHALRAVEMLKAGGNGNVIGVVLN----RV-----D-FARNRY--YYS--------
A0A2V8I604      ATTKPAIERALSGLD---ASKVLGIVLN----EA-----G-SDG-AG--YAY--------
A0A2V8J066      MTQKPAIERALGGLD---TTKVLGLVLN----EV-----G-AEA-TY--QDY--------
A0A1I6MMC5      VTKFETAQRALSQLK---ASNVLGIVLN----AV-----S-DPP-VS--GGY--------
A0A2V9D5W7      STPAEIAQRARQELQ---DRNVLGVVFN----SV-----Q-ESIVSY--GSY--------
A0A2V9D4I4      STPAEIAQRARQELG---GRNLLGVVLN----AV-----S-EKALAY--GSY--------
A0A2V9D6L7      STPAEIAQRARHELE---GRNVLGVVLN----SV-----S-EKGLAY--GSY--------
A0A2V8ZJV2      STAAQIAERTAAEFQ---GKNLLGVVLN----QV-----E-KRD-CW--ND---------
A0A2V9AWB5      STHAEIVERTASEFQ---DKNLLGAVLN----QV-----E-KSD-SY--GA---------
A0A2V8Z1Y8      STAVDDARKAAEEFR---NKNLLGVVLN----QV-----E-KSD-AY--IAP--------
A0A1Q8AX10      LTAYDLVQTTLQEFR---GKNLLGVVLN----GA-----D-EEA-TY--GAY--------
A0A2V9A773      ETAHDLVKTTLQEFR---GNNLLGVVLN----GA-----N-EGA-DY--GGH--------
A0A2V9AND3      QTSHDLVKTTLQEFR---GINLLGVVLN----GA-----N-LEA-NY--SSY--------
A0A2V9BTJ7      ATDHEMATKAAAGFQ---DKNLLGVVLN----RV-----D-GDA-GY--GGY--------
A0A2V8W2M7      ETNHETAERAASEFR---NKNLLGVVLN----RV-----E-QAA-GY--GDY--------
A0A2V8XNW2      ETNHETAERAASEFR---NKNLLGVVLN----RV-----E-QAA-GY--GDY--------
A0A1Q7CJC1      ETNHETAERAASEFR---NKNLLGVVLN----RV-----E-QAA-GY--GDY--------
A0A2V9UEM7      STPSDLARRAREEFQ---DKLLLGVVLN----GI-----P-ADQLPK--SRY--------
A0A1Q7V300      ATPFDIAQRARQEFG---DN-LVGVVLN----GI-----D-TLP-EY--SQY--------
A0A2V9ZCI3      VTPFDMARKARMEFR---DKQLLGVVLN----GI-----D-SSSSAY--SRY--------
A0A2V9WCB3      ATPSDAARRARQEFP---ENALVGFVLN----GT-----S-EENAPY--ARY--------
A0A2V9VQW5      ATPYDTAQKARQEFQ---GKLLVGVVLN----GI-----M-RSDSYY--SRY--------
A0A2V9WTP3      ATPVDMARKARQEFP---DKVLVGVVLN----GT-----S-ADTEAY--SRY--------
A0A2V9NLA9      STPFDMARKARQEFS---GKQLVGVVLN----GI-----D-QGN-SY--SQY--------
A0A2V9RKJ9      STPFDMARKARQEFS---GKQLVGVVLN----GI-----D-QGN-SY--SQY--------
A0A2V9RN95      ATPFDIARKARQEFR---DTSLVGVVLN----GI-----D-VGS-SY--TQY--------
A0A2V9N406      ATPFDIARKARQEFR---DTSLVGVVLN----GI-----D-VGS-SY--TQY--------
A0A2V9U6D9      ATPFDIARKARQEFR---DTSLVGVVLN----GI-----D-VGS-SY--TQY--------
A0A2V8DZN4      QTTRDAARWAQARF-AEDGTAVLGTILN----FW-----N-PKT-----PGY--------
A0A3N5YKY1      QTPRPAIERALRQV-APA--RVLGLVLN----DV-----G-EI------SSG--------
A0A2G6HQA4      IVGKAKIEETINAI-GPE--RILGIVFN----DH-----H-GAYF----SKS--------
A0A2V7ZTY7      KTPYKLITRAVDTL-GRA--KIIGVVLN----RV-----D-RRHV----AGG--------
A0A2V7ZVL9      KTPYKLITRAVDTL-GRG--KIIGVVLN----RV-----D-RRNV----AGG--------
A0A1Q7QYI4      KTPHKLIMRAIDAL-GRN--RILGVVLN----RV-----D-PS-CLA--GGY--------
A0A2V8G9Y9      RSPFRLIQRALDAV-GRN--RIIGVVLN----AV-----K-ES-DDV--VGF--------
A0A143PNR5      RTPYALVQKAVQAL-GKP--KIFGVVLN----RL-----E-DHITVH--SGY--------
A0A6A7L078      RTPYKVVSKAVEVV-GRD--RILGVVLN----GV-----K-AL-----------------
A0A143PXU3      ATRFAELQAATDAL-GPG--RLLGVILN----AV-----D-PREI----HRE--------
A0A2V8D8G9      STPAAAVERAVAELGGPD--SIIGTVLN----RV-----E-EGRI----PDA--------
A0A2V8ESQ4      STPAAAVERAVAELGGPD--SIIGTVLN----RV-----E-EGRI----PDA--------
A0A1E3Y5Q0      ATQYDFVQRSIAEL-GRE--RILGVVLN----LA-----T-PPTDVRYGANY--------
A0A2W4TWK5      TTPYDVVQKAVELL-GRD--RILGVVLN----QA-----E-PDS-----L-A--------
A0A3N5NYV3      RTPARLVQRTADAL-GRE--RVMGVVLN----RA-----D-DLV-----VSS--------
A0A2V2RJF9      VTPRDVVQMAKQKLV-KSDATMAGVVLN----YI-----DLTDPYY--YYSY--------
A0A2G6HNT3      VVGKAKVEETINAIG-P--ERILGIVFN----DHHGAYFSKSSKYG--YGYG--------
A0A2V7YWD4      KTPRKLLEETFALLG-P--AKILGLVFN-----------RESYKGS-RYGRY--------
A0A2V2R8T6      KTRYSVVDKLLDQLP-R--DRVLGVVLN----RT-----DEALEPSTYYQYR--------
A0A1Q7RGF1      HAKREVLQKCAGQID-P--KKLLGVVYN----AV-----ESGAHDHYSYGGY--------
A0A2V9BLX2      HAKREVLQKCAGQID-P--KKLLGVVYN----AV-----ESGAHDHYSYGGY--------
A0A2V9ZA03      KTPKKLLRKSLESIE-N--LKLIGVVMN----GS-----QDADHQY--YRQY--------
A0A3N5ZNH4      ATPKDVVRKAGGHLV-GVHARILGAVIN----NV-----NMDAPEYVHYYRH--------
A0A2V8GEZ2      AVPYRVVQRSADALG-R--DRIIGVVLN----RAAAAPFERAYG-YGGYGGY--------
A0A3N5ZFD3      KTDYASVQRAVAAIG-R--DKIIGIVLN----RA-----ERPAGTYGNYERY--------
G8NXD3          VTRRAAVQRAAEMLG-E---HLSSLIFN----DV-----TMSIAAG--YGAN--------
A0A2V9VR38      QTTKQALRRSRDVLT-QVSANVVGVLLN----AV-----DLSSPDY--Y--Y--------
A0A2V9EY04      HGQRETLQKSASSVD-R--KKLLGLVFN----GT-----DANEKHY--YGYK--------
A0A2V9HAK9      HGQRETLQKTASTLD-T--KKLLGVVFN----AT-----DVSVKDY--DVHE--------
A0A1Q7FS15      HGQRETLQKTARALD-P--KKLLGLVFN----AT-----DVSRKDY--YGYG--------
A0A1Q7K9P1      HGQRETLQKTARALD-P--KKLLGLVFN----AT-----DVSRKDY--YGYG--------
A0A1Q7N989      HGQRETLQKTARALD-P--KKLLGLVFN----AT-----DVSRKDY--YGYG--------
A0A2V9G7Y0      HGQRETLRKTASTVD-K--KKLVGVVFN----AT-----DVSVKDY--DGYE--------
A0A2V8T7Z1      RTPRRLVEEALNVME-P--DRLVGLVFN----GD-----DRPLSGY--Y-RS--------
A0A2V7U8G5      RTPRKLLGEALSALD-E--SKMLGIVFN----GD-----DRPMGGY--YGKY--------
A0A2V7UNP9      RTPRKLLGEALSAMD-E--AKVLGIVFN----GD-----DRPLSGY--YGGD--------
A0A2V7VLD7      RTPRKLLGEALSAMD-E--AKVLGIVFN----GD-----DRPLSGY--YGGD--------
A0A2V7XGA3      RTPRKLLVDGLGALE-E--GKVLGVVFN----AD-----DRPLSGY--FGR---------
A0A2V7YAG6      RTPRKLLAESLGAIH-Q--DKVLGIVFN----AD-----DRPLSGY--FTR---------
A0A2V7VK33      ------VAAALDALE-E--EKTIGIVFN----NE-----NRPPSSY--YKRY--------
A0A3M1VTE1      RTPKALIEQVVEEAG-S--VKLLGVVLNDWTGSL-----ADRRTGY--DSRY--------
A0A2V7TTM7      RTPRKLLAETLGSVD-A--GKLAGIVFN----GD-----DRPLGGY--YKGY--------
A0A2V8VI82      RTPQRLVEEALHLLS-H--AKVAGIVFN----GD-----DRPSSAY--Y-GY--------
A0A2V7U4P9      KTAREMMDTALDLLD-K--PKTLGVIFN----GE-----TPQADRS--S-YY--------
A0A2V7TQY5      RTPQRLLEDALNMVS-P--EKLIGLVFN----GD-----QRPTSRH--Y-GY--------
A0A2V7TU87      TTPRSLLEESLNLME-P--QKVLGLVFN----ND-----ERPRTTY--N-DY--------
A0A2V8SEH0      KTPRRLLQEALNVTE-P--GKLMGLVFN----RD-----ERLLTRA--Y-GY--------
A0A2V8VU54      RTPRKLVEEGLNLME-P--SKVIGIVFN----GD-----ARAFSGY--Y-GY--------
A0A1Q7RML7      RTPRKLVEEGLNLVD-P--AKAIGVVFN----GE-----RRSRSGY--Y-GY--------
A0A1Q7ZIQ5      RTPRKLVEEGLNLVD-P--AKAIGVVFN----GE-----RRSRSGY--Y-GY--------
A0A2V8TKD8      RTPRKLVEEGLNLVD-P--AKTIGVVFN----GE-----RRSRSGY--Y-GY--------
                                           *                                

A0A1F2U8T6      --------YGRQYENHYAEAV---------------------------------------
A0A2V8BV42      --------YGHQYKNYYAEATG--------------------------------------
A0A2V8F916      --------YGHQYKNYYAEATG--------------------------------------
A0A1Q7K833      --------YGHQYKNYYAEATV--------------------------------------
A0A1Q8AMY4      --------YGHQYKNYYAEATV--------------------------------------
A0A2V8BM40      --------YGHQYKNYYAEAVS--------------------------------------
A0A2V8CRT6      --------YGHQYKNYYAEATS--------------------------------------
A0A1F2VH76      --------YGHQYKSYYAEAPAA-------------------------------------
A0A1F2R0X5      --------YGHQYKNYYAEKAS--------------------------------------
A0A2V8B278      --------YGHQYKNYYAEAAI--------------------------------------
A0A2V8CEF9      --------YGHQYKNYYAEAAV--------------------------------------
A0A2V8KZG2      --------YYGYSSKEEVSEN---------------------------------------
A0A1Q7LG57      --------YADYEEYVGQ------------------------------------------
A0A2V8YMQ4      --------YGSNGNSHSETISDPAEPWNRLSK----------------------------
A0A1Q7L5B1      --------YGGNGMDKK-------------------------------------------
A0A2V9DKV4      --------YGGNGMDKK-------------------------------------------
A0A2V8W380      --------YGSYGSNRGDPPQETFVPTNLHLPPQQKASD---------------------
A0A2V8ZIV5      --------LGMYGMNGNSHGKTSSDEADSWRTLSK-------------------------
A0A2V9EVA0      --------YGRSEHVRS-------------------------------------------
A0A1Q7RB73      --------ATTPETKK--------------------------------------------
A0A2V9K0H7      --------ATTPETKK--------------------------------------------
A0A3N5YN96      --------YGRVDNQNAGRRVARSGA----------------------------------
A0A1Q7Y646      --------YRRYYRRDDAVEDKTEKEVDEKA-----------------------------
A0A2V8QZU0      --------YRRYGSRRDAGK-------EQEG-----------------------------
A0A2V8RSQ9      --------QRRYYRRDETQPGAPTKDVEEDV-----------------------------
A0A2V9LS17      --------DYYRGAAENANGKGRRAKT---------------------------------
A0A2V9AGR3      --------YGKTYGRTRK------------------------------------------
A0A2V9G0N7      --------NHYTGR----------------------------------------------
A0A2V9GQ44      --------NHYTGR----------------------------------------------
A0A2V9HRN3      --------NHYT------------------------------------------------
A0A2V8WG13      --------SGYATDDQKDSY----------------------------------------
A0A2V8X987      --------HGHLSENAEKAT----------------------------------------
A0A1Q7KX94      --------QNYYAERD--------------------------------------------
A0A2V8XHT0      --------QNYYAERD--------------------------------------------
A0A2V9L2P7      --------HYYGYYSKGYYDYAEGKGNGQG------------------------------
A0A2V7UMX0      --------RGYGTAARQSSDLTPGEAADGASRAPDSPPSSHPSTIQE-------------
A0A136K497      --------GYYNYRRMAEDAAS--------------------------------------
A0A399W9E4      --------GYYNYRRMAEDAAS--------------------------------------
A0A2V7X0V9      --------YEAYEKRQPTTV----------------------------------------
A0A2V9X518      --------YGVNGNNKEMQETVQG------------------------------------
A0A2V9VC62      --------YEAYEKTAKPKA----------------------------------------
A0A2V9S1P8      --------YATYG-RTNGRHESQG------------------------------------
A0A2V9RTW2      --------YGAYG-RPDAKGATQR------------------------------------
A0A2V9TGF1      --------YGAYG-RPDAKGATQR------------------------------------
A0A2V9XEV6      --------YGVNGNNKEMQETVQG------------------------------------
A0A2V9Y3Q6      --------YGSYG-NKETQETIQG------------------------------------
A0A2V9R269      --------YSAYSPNVRTEDKN--------------------------------------
A0A2V9PTS3      --------YSVYSEDGKAKG----------------------------------------
A0A2V9NPF4      --------YSVYSEDGKAKG----------------------------------------
A0A2V9PNZ0      --------YSVYSEDGKAKG----------------------------------------
A0A321LMC5      --------GAKNKRRGWFGKKH--------------------------------------
A0A2V8X713      ----------GYGVDTK-------------------------------------------
A0A2V8ZLE9      --------SAGFGLAKR-------------------------------------------
A0A2V8Y4D3      --------RAGFGTDKK-------------------------------------------
A0A2V8Z2X8      --------YAGFELDRK-------------------------------------------
A0A2V9C3F6      --------YAGFGMDKK-------------------------------------------
A0A2V9QMU9      --------EYQGKHGQRYFGQDEPAIAEEAKATSSGA-----------------------
A0A2V9QY75      --------EYQGKHGQRYY-----------------------------------------
A0A2V9SVU9      --------EYQGKYGHRYY-----------------------------------------
A0A2V8W5N5      --------AYGYGEPMETPVSGLRRRVSPLHSWGPR------------------------
A0A2V8XG53      --------AYGYGEPMETPVSGLRRRVSPLHSWGPR------------------------
A0A6A7LB89      ------------------------------------------------------------
A0A2V9XV04      --------YESYEKKPALPSVLPASRSCAAGGRGPDCLVVVCRGDHPSEPGELVASAERG
A0A2V9CBY1      --------Y---------------------------------------------------
A0A2V9D656      --------YYGGNGTGGE------------------------------------------
A0A352EZH8      --------QQRHYRQPRVP-------AGEDR-----------------------------
A0A0B6X033      --------RRYYRRA---------------------------------------------
A0A2V8R0I3      --------QSRYQRQSPLVEAG----TEEV------------------------------
A0A2V8N1U8      --------QPRHQRAATEF-------VEDTV-----------------------------
A0A2V8QL35      --------QPRYQRAASAAD------VGDA------------------------------
A0A352FU10      --------QPRHQRVASAAT------TDVA------------------------------
A0A2V8LCU0      --------QPRHVRSVAVPDAPSKVKASEE------------------------------
A0A1Q7NGT0      --------QPRHQRMMAAP-------VEGT------------------------------
A0A2V8MLP9      --------QPRHQRVMAVP-------LEET------------------------------
A0A2V8PQZ0      --------QPRHQRVMAVP-------LEET------------------------------
A0A3B9MKY6      --------QRHYYNR-DRG-------LTEAK-----------------------------
A0A3D5SKZ1      --------QRHYYNR-DRG-------LTEAK-----------------------------
A0A2V8NRW2      --------QRRYYRREDKG-------ITKSA-----------------------------
A0A2V8TKR9      --------YYHYNRY-----YGGYPSDTNV------------------------------
A0A2V8LBV1      --------YSHYYDG-----YYTYYAKK--------------------------------
A0A2V8GAF9      --------DTHARDRHAGWWRRVWNARHSQGPQHLR------------------------
A0A2V8CN98      --------YGEYYGY-----MAGYGTTTEDGGTRIARRRLQGAL----------------
A0A1Q7LC46      --------SYRYYPY-----SYGYGPQEAGEPAQGDDASESVTEALSRHHDDDSQAL---
A0A1Q8BDC5      --------YGQYYYG-----PPADAKKVKGPKSKNYLQS---------------------
A0A2V9Q1Y8      --------YYEYQGKYGQRYYDEDMTGGDSVRAASGSA----------------------
A0A2V8JXG1      --------DYYYYSY-----QYSYSADGKRTKT---------------------------
A0A350D2W9      --------YRHYYKESRG------------------------------------------
A0A2V9I4J1      --------DHGYYRYGKQGAYPYYGTRKPRSRSKTYLEN---------------------
A0A2V8PQZ9      --------YYQPRHQRMMAAPVEGTEYDQGAANPEMIYLEEDMVS---------------
A0A2V8D8B1      --------SQYYRRQ-----YGEYYTSTSASA----------------------------
A0A3B9LSB4      --------YQRYYGA------RNYKSDGDDDIEPTSHARRNGSHNTLDLN----------
A0A2V9H7U2      --------YYGHYYY-----SSGSGKTKRTPASESVSSHLQG------------------
A0A2V8NJB5      --------KRGYYDYGRDSQYMYSRGRKRLEKPKNYLES---------------------
A0A2V9JMZ4      --------DHGYYRYGKQGAYPYYGTRKPRSRSKNYLES---------------------
A0A2V9MDJ6      --------DHGYYRYGKQGAYPYYGTRKPRSRSKNYLES---------------------
A0A2V8QJT6      --------YYQRYYH-----QSYYTQDPSEEVVATRS-----------------------
A0A2V8FSM8      --------YKHYYAG-----YYHYYGDGSGKGGGNSVGPQDGEEPVAAERAAGASRWVAD
A0A359M0J2      --------GADYYSK-----YYEYQTMAESGKSGTS------------------------
A0A2V8JLJ1      --------DAYYRQP-----LNESSQRNSNLQLREGI-----------------------
A0A5M8SND8      --------VTEA------------------------------------------------
A0A2V9GAQ1      --------SYRYYPY-----SYGYGPQEAAEAPHEEDSEAIAHRVSRDRDDDSQAL----
A0A497EDQ8      --------TYYYSYY-----HYGYDEDGKRDKG---------------------------
G8NS05          --------GYYGYSG-----YSGYGSAGMDAAGWESQSGKSTGKGQK-------------
A0A2V8KZ20      --------DAYYRQP-----LNESSQRNSNLQLREGI-----------------------
A0A3D0NWU2      --------YGSGYYD-----YYKSADADTTTPRMDSDANGNGSNGRA-------------
A0A2V8EPD9      --------GYYEYYG-----AGYYGAPSTK------------------------------
A0A3N5NSX5      --------SRYYGYK-----YKNYYVKSNAA-----------------------------
A0A2V8MUA1      --------SRYYRQV-----SLSSK-----------------------------------
A0A2V8MBH9      --------YYQRYYH-----QSYYSHDVESDGADERASA---------------------
A0A3N5ZPQ7      --------YQHSYYH---------------------PGKDRQSSRTRRRKRNAP------
A0A3N5P5F2      --------APYYRRE-----YTDYYSRALRS-----------------------------
A0A2V9G1P7      --------NYGPYGL-----NPDCPSHETVVTANFQMPPQQKASD---------------
A0A2V9BCK9      ---------YGAYSY-----YAGYGMDRK-------------------------------
A0A2V9TMX2      --------YYGTQYS-----NNYYSEES--------------PNNKPKAASKIS------
A0A2V8N2J7      --------AYEYYKK-----LA--------------------------------------
A0A3N6BI26      --------YYRHYFD---------------------------ERYNTDLSSAAG------
A0A2V9JMM3      --------AYEYYRR-----TY-----------------------YKQNIRTGT------
A0A2V9M815      --------AYEYYRR-----TY-----------------------YKQNIRTGT------
A0A2V9A795      --------GLGIYGS------NGNSHSEIISDTADSWGTLSK------------------
A0A355ESH9      --------GYRYAEA------YGYGAEE-----------------TGSKAGSAA------
A0A3D0NW85      --------YYQSYYS-----QSQYRRDEE-------------------------------
A0A353CAT5      --------YYQSYYH-----RDNYRSGD-----------------------DPK------
A0A2V9HB55      --------SYRYYPY-----SYGYGPQEVVEAPHEEDSEAVTERVSRDDDSEAL------
A0A2V8CU57      --------GYGFYDY------YGYGTRD------DGARKAGKADAAREAAMDAA------
A0A2V8BDI4      --------GYGFYDY------YGYGTRD------DGARKAGKADAAREAAMDAA------
A0A2V8F8T3      --------GYGFYDY------YGYGTRD------DGARKAGKADAAREAAMDAA------
A0A2V9J901      --------YGYSYTG-----YGAPGSEASSRHGNT-------------------------
A0A2V8MKQ7      --------YSGYYQA-----ADYQEDTAPNPADSRAASS---------------------
A0A3M1SNQ5      --------YQKYAEV-----VDS-------------------------------------
A0A2V8QJ59      --------YGYYKSN-----YYTAEEDPEADQGSTAST----------------------
A0A1Q7HTA7      --------YYGYGRG-----RGGGAARGEHPAWRKAAAPWR-------------------
A0A2W0B5E2      --------SGYH-----------------------------A------------------
A0A2V8NMG8      --------HRYYSSS-----YYKAEADDTEQVASSAH----G------------------
A0A2V8TBM7      --------SGYY-SG-----YYSDDDTAPEGAATAGERPGAG------------------
A0A1Q7HEZ8      --------RGYFGEA-----RTA-------------------------------------
A0A1Q7JW36      --------RGYFGEA-----RTA-------------------------------------
A0A1Q7MUR4      --------RGYFGEA-----RTA-------------------------------------
A0A3N5PFU4      --------RRYFSRA-----H---------------------------------------
A0A4R1LDF1      --------YK--------------------------------------------------
A0A1F2T1R8      -RY-----YREYFTD-----PTQIASGA--------------------------------
A0A2V9BW09      --------YPRHKNA---------------------------------------------
A0A3M1SSE1      -YYYQSYYYNSYYKK-----EEEEE-----------------------------------
A0A2V9GQV7      --G-----YGYGKD----------------------------------------------
A0A2V7YV88      --G-----YGNYGSK-----SNQGTTTVRSADPSAFQPRITHRERLARIALRLFWRLRSD
A0A2V8YCY6      -YYPYSYGYGPQEAG-----EAAQGEASESVGGAISRHHDDDSQAL--------------
A0A2V8EGM3      -YY-----YSSQASD-----NVTS------------------------------------
A0A2V8FGH1      -YY-----YSSQASD-----NVTS------------------------------------
A0A2V8D468      --Y-----RKEYTNQ-----YTRTL-----------------------------------
A0A1F2R977      -HY-----YPSSGAK-----DG--------------------------------------
A0A2U3LF12      --Y-----YQRHYVG-----RR--------------------------------------
A0A3N5G7M6      RRA-----YQAYYGH-----PTPA------------------------------------
A0A1F2S3Q7      RQY-----FPGVSRI-----AGQA------------------------------------
A0A2V8GVG4      KDY-----FP--EQA-----VTRA------------------------------------
A0A2V8PJQ0      GYY-----YSDYSDD-----DGKKAQTASG------------------------------
A0A2V8H566      --S-----YSYYGYG-----SPRTKD----------------------------------
A0A2V8UVN4      -DY-----YSYTEN----------------------------------------------
A0A321LXF5      -KY-----YRYAVGG-----PSSS------------------------------------
A0A5M8SBZ0      -HY-----YGHDAAS-----PDGMDKENQD------------------------------
A0A1Q7JFB1      -YG-----YGYYSYG-----ERG-------------------------------------
A0A2V8DMJ9      -YG-----YGYYGYP----------ERVTWWQRLFGTVRSARVR----------------
A0A2V8GGF6      -NS-----YYAYYTP-----QGRDRQRRRWWRRG--------------------------
A0A2V8HKU7      -NS-----YYAYYTP-----QGRDRQRRRWWRRG--------------------------
A0A1Q6Y875      -AY-----YGRSEHV-----RG--------------------------------------
A0A523DJA9      -RY-----YGYTYKN-----YYGNTSTAA-------------------------------
A0A2V8I604      -DG-----YGYIGG----------------------------------------------
A0A2V8J066      -AG-----YKYVAG----------------------------------------------
A0A1I6MMC5      -YG-----YDAPGKQ-----TT--------------------------------------
A0A2V9D5W7      -YN-----YPQNGHD-----EVKKTQAHRNKFRQ--------------------------
A0A2V9D4I4      -YN-----HGYGNGR-----VKEPMKEKSD------------------------------
A0A2V9D6L7      -YN-----Y---RDH-----AHDPLKESTNRILD--------------------------
A0A2V8ZJV2      --Y-----YGGRIVQ-----LETTDRALPAGERLS-------------------------
A0A2V9AWB5      --E-----Y-----Q-----NYHSDRD---------------------------------
A0A2V8Z1Y8      -DY-----H---------------------------------------------------
A0A1Q8AX10      -SY-----YAGYGMD-----RK--------------------------------------
A0A2V9A773      -SY-----YAGFGMD-----TE--------------------------------------
A0A2V9AND3      -SG-----YAGVGMD-----KK--------------------------------------
A0A2V9BTJ7      --Y-----YSYPSGE-----E--VKKSS--------------------------------
A0A2V8W2M7      --Y-----YGSLGEE-----EQPVLRAS--------------------------------
A0A2V8XNW2      --Y-----YGSLGEE-----EQPVLHAS--------------------------------
A0A1Q7CJC1      --Y-----YGSLGEE-----EQPVLHAS--------------------------------
A0A2V9UEM7      --Y-----YGEAVSS-----PA--------------------------------------
A0A1Q7V300      --Y-----YTAYGNP-----NGKDPA----------------------------------
A0A2V9ZCI3      --Y-----YG-YGDQ---------------------------------------------
A0A2V9WCB3      --Y-----YEAYENK-----GTATKA----------------------------------
A0A2V9VQW5      --Y-----YESYEKT-----ARQKA-----------------------------------
A0A2V9WTP3      --Y-----YGAYEKR-----GTEAKA----------------------------------
A0A2V9NLA9      --Y-----YDAYGKP-----NGKNEQR---------------------------------
A0A2V9RKJ9      --Y-----YDAYGKP-----NGKNEQR---------------------------------
A0A2V9RN95      --Y-----YSSYGHP-----NSKGDGRR--------------------------------
A0A2V9N406      --Y-----YSSYGHP-----NSQGDGRR--------------------------------
A0A2V9U6D9      --Y-----YSSYGHP-----NSQGDGRR--------------------------------
A0A2V8DZN4      -AY-----YKHYYAG-----YYHYYGDGSGKGGGNSVGPQDGEEPVAVERAAGASRWVAD
A0A3N5YKY1      -YA-----YGRVDNQ-----NAGRRVARSGA-----------------------------
A0A2G6HQA4      -SK-----YG-YGYG-----YNYRYE----------------------------------
A0A2V7ZTY7      -YT-----YGYYGER---------------------------------------------
A0A2V7ZVL9      -YT-----YGYYGER---------------------------------------------
A0A1Q7QYI4      -G------YG-YYSY-------------GERG----------------------------
A0A2V8G9Y9      -GY-----YG-YYGH-----YGPQRKRGARRA----------------------------
A0A143PNR5      -GK-----YGGYYND-----YGRGGQ----------------------------------
A0A6A7L078      --E-----ENEYYDR-----HYRQ------------------------------------
A0A143PXU3      -DY-----YGNY-YG-----YGSK------------------------------------
A0A2V8D8G9      -DY-----YGQYGSS-----RDGR------------------------------------
A0A2V8ESQ4      -DY-----YGQYGSS-----RDGR------------------------------------
A0A1E3Y5Q0      -GR-----YAERTSP-----PGRR------------------------------------
A0A2W4TWK5      -DR-----YQSYYYS-----PARS------------------------------------
A0A3N5NYV3      -DS-----SSSYAYG-----PNNN------------------------------------
A0A2V2RJF9      --------YSRYYAYRYGEQPKALPPKFIQ------------------------------
A0A2G6HNT3      --------YGSKYE----------------------------------------------
A0A2V7YWD4      --------YYAYSSRS--------------------------------------------
A0A2V2R8T6      --------YYNQRSLPPGDPNELVNQQQEVVTVN--------------------------
A0A1Q7RGF1      --------TAARKEST--------------------------------------------
A0A2V9BLX2      --------TAARKEST--------------------------------------------
A0A2V9ZA03      --------YKSPANSRASAGHERRLS----------------------------------
A0A3N5ZNH4      --------YYDETYSNDFSAA---------------------------------------
A0A2V8GEZ2      --------YGAHSHEDQEQA----------------------------------------
A0A3N5ZFD3      --------YAGYAKRTEG------------------------------------------
G8NXD3          --------YDRGYR----------------------------------------------
A0A2V9VR38      --------YYEYQGKYARYYREDDSSEHDHDEEHAVEESSPSSSSA--------------
A0A2V9EY04      --------YAEAKA----------------------------------------------
A0A2V9HAK9      --------YGY-------------------------------------------------
A0A1Q7FS15      --------YGSSKS----------------------------------------------
A0A1Q7K9P1      --------YGSSKS----------------------------------------------
A0A1Q7N989      --------YGSSKS----------------------------------------------
A0A2V9G7Y0      ------------------------------------------------------------
A0A2V8T7Z1      --------YRAYG-----------YPPRLARAAARRPRLR--------------------
A0A2V7U8G5      --------YGGYYHDRSRRETGG------GRSSRQRDQKPRRSSWR--------------
A0A2V7UNP9      --------YRSYYHHPSAPRRGGWWRSWRGQAKTKRGQKARPQPWR--------------
A0A2V7VLD7      --------YRSYYH---------WWRSWRGQAKTKRGQKARPQPWR--------------
A0A2V7XGA3      --------YEGYYGYHQPH-----------------------------------------
A0A2V7YAG6      --------YQGYYGYGQPANGGRSW----WRFPWRRAAQGRFRPWR--------------
A0A2V7VK33      --------Y---------------GAPPGPRATRNRVTAGRGWRFWR-------------
A0A3M1VTE1      --------YSRYY-----------GKGGR-------------------------------
A0A2V7TTM7      --------YMGYDGDRA-------GAGSKGRWSSWWRRRRSGRKPWR-------------
A0A2V8VI82      --------YYGYG-----------RPRGDGRYDRGERPGSRKVAALWR------------
A0A2V7U4P9      --------YSAAR-----------PEPSRWSWFKRK------------------------
A0A2V7TQY5      --------YSSYY-----------HEPTNGQGTLWTRIADTAKRPFRSRVSGTAV-----
A0A2V7TU87      --------YAGSGRHDKGGAPTWWRPFAKIRSVFDPDAAGRRRPERRREIR---------
A0A2V8SEH0      --------Y-GYG-----------QQHGRARAAERGRGGAPRSQPCP-------------
A0A2V8VU54      --------YHAYG-----------RPPGRGR---RPPQPATRETAPREAAPEPPLK----
A0A1Q7RML7      --------YHAYG-----------RPPGRAR---RSGARSPAHDTLR-------------
A0A1Q7ZIQ5      --------YHAYG-----------RPPGRAR---RSGARSPAHDTLR-------------
A0A2V8TKD8      --------YHAYG-----------RPPGRAR---RPGARSPAHDTLR-------------
                                                                            

A0A1F2U8T6      -----------------------
A0A2V8BV42      -----------------------
A0A2V8F916      -----------------------
A0A1Q7K833      -----------------------
A0A1Q8AMY4      -----------------------
A0A2V8BM40      -----------------------
A0A2V8CRT6      -----------------------
A0A1F2VH76      -----------------------
A0A1F2R0X5      -----------------------
A0A2V8B278      -----------------------
A0A2V8CEF9      -----------------------
A0A2V8KZG2      -----------------------
A0A1Q7LG57      -----------------------
A0A2V8YMQ4      -----------------------
A0A1Q7L5B1      -----------------------
A0A2V9DKV4      -----------------------
A0A2V8W380      -----------------------
A0A2V8ZIV5      -----------------------
A0A2V9EVA0      -----------------------
A0A1Q7RB73      -----------------------
A0A2V9K0H7      -----------------------
A0A3N5YN96      -----------------------
A0A1Q7Y646      -----------------------
A0A2V8QZU0      -----------------------
A0A2V8RSQ9      -----------------------
A0A2V9LS17      -----------------------
A0A2V9AGR3      -----------------------
A0A2V9G0N7      -----------------------
A0A2V9GQ44      -----------------------
A0A2V9HRN3      -----------------------
A0A2V8WG13      -----------------------
A0A2V8X987      -----------------------
A0A1Q7KX94      -----------------------
A0A2V8XHT0      -----------------------
A0A2V9L2P7      -----------------------
A0A2V7UMX0      -----------------------
A0A136K497      -----------------------
A0A399W9E4      -----------------------
A0A2V7X0V9      -----------------------
A0A2V9X518      -----------------------
A0A2V9VC62      -----------------------
A0A2V9S1P8      -----------------------
A0A2V9RTW2      -----------------------
A0A2V9TGF1      -----------------------
A0A2V9XEV6      -----------------------
A0A2V9Y3Q6      -----------------------
A0A2V9R269      -----------------------
A0A2V9PTS3      -----------------------
A0A2V9NPF4      -----------------------
A0A2V9PNZ0      -----------------------
A0A321LMC5      -----------------------
A0A2V8X713      -----------------------
A0A2V8ZLE9      -----------------------
A0A2V8Y4D3      -----------------------
A0A2V8Z2X8      -----------------------
A0A2V9C3F6      -----------------------
A0A2V9QMU9      -----------------------
A0A2V9QY75      ---DESQTDENSIAAAS---GGA
A0A2V9SVU9      ---REEEMDNGGASLPSVRAGSA
A0A2V8W5N5      -----------------------
A0A2V8XG53      -----------------------
A0A6A7LB89      -----------------------
A0A2V9XV04      GWVRQDSGRDSNRALDFALARPV
A0A2V9CBY1      -----------------------
A0A2V9D656      -----------------------
A0A352EZH8      --LRLVSELEEDEEVAIAS----
A0A0B6X033      ---------EEAKKKAVAEGVAV
A0A2V8R0I3      ---ADDEATDQPEMIYIEEGFVS
A0A2V8N1U8      --AREHEDTDQLEMIYLEEDMVS
A0A2V8QL35      ---G-DAFEDRPGMIYIEEEGVS
A0A352FU10      ---DREAVEDEPEMIYIEEEGVS
A0A2V8LCU0      ---RYESTPGEPEMIYIEEEGVS
A0A1Q7NGT0      ---EYDQGGANPEMIYLEEEMVS
A0A2V8MLP9      ---EDDHG-ANPEMIYLEEDMVS
A0A2V8PQZ0      ---EDDHGAANPEMIYLEEDMVS
A0A3B9MKY6      --TKQLPGERQEEVALVN-----
A0A3D5SKZ1      --MKQLPGERQEEVALVN-----
A0A2V8NRW2      --T-QAEMKNAEEVIVAG-----
A0A2V8TKR9      -----------------------
A0A2V8LBV1      -----------------------
A0A2V8GAF9      -----------------------
A0A2V8CN98      -----------------------
A0A1Q7LC46      -----------------------
A0A1Q8BDC5      -----------------------
A0A2V9Q1Y8      -----------------------
A0A2V8JXG1      -----------------------
A0A350D2W9      -----------------------
A0A2V9I4J1      -----------------------
A0A2V8PQZ9      -----------------------
A0A2V8D8B1      -----------------------
A0A3B9LSB4      -----------------------
A0A2V9H7U2      -----------------------
A0A2V8NJB5      -----------------------
A0A2V9JMZ4      -----------------------
A0A2V9MDJ6      -----------------------
A0A2V8QJT6      -----------------------
A0A2V8FSM8      VDVHPDEGSRRRPRYARSEA---
A0A359M0J2      -----------------------
A0A2V8JLJ1      -----------------------
A0A5M8SND8      -----------------------
A0A2V9GAQ1      -----------------------
A0A497EDQ8      -----------------------
G8NS05          -----------------------
A0A2V8KZ20      -----------------------
A0A3D0NWU2      -----------------------
A0A2V8EPD9      -----------------------
A0A3N5NSX5      -----------------------
A0A2V8MUA1      -----------------------
A0A2V8MBH9      -----------------------
A0A3N5ZPQ7      -----------------------
A0A3N5P5F2      -----------------------
A0A2V9G1P7      -----------------------
A0A2V9BCK9      -----------------------
A0A2V9TMX2      -----------------------
A0A2V8N2J7      -----------------------
A0A3N6BI26      -----------------------
A0A2V9JMM3      -----------------------
A0A2V9M815      -----------------------
A0A2V9A795      -----------------------
A0A355ESH9      -----------------------
A0A3D0NW85      -----------------------
A0A353CAT5      -----------------------
A0A2V9HB55      -----------------------
A0A2V8CU57      -----------------------
A0A2V8BDI4      -----------------------
A0A2V8F8T3      -----------------------
A0A2V9J901      -----------------------
A0A2V8MKQ7      -----------------------
A0A3M1SNQ5      -----------------------
A0A2V8QJ59      -----------------------
A0A1Q7HTA7      -----------------------
A0A2W0B5E2      -----------------------
A0A2V8NMG8      -----------------------
A0A2V8TBM7      -----------------------
A0A1Q7HEZ8      -----------------------
A0A1Q7JW36      -----------------------
A0A1Q7MUR4      -----------------------
A0A3N5PFU4      -----------------------
A0A4R1LDF1      -----------------------
A0A1F2T1R8      -----------------------
A0A2V9BW09      -----------------------
A0A3M1SSE1      -----------------------
A0A2V9GQV7      -----------------------
A0A2V7YV88      LDRS-------------------
A0A2V8YCY6      -----------------------
A0A2V8EGM3      -----------------------
A0A2V8FGH1      -----------------------
A0A2V8D468      -----------------------
A0A1F2R977      -----------------------
A0A2U3LF12      -----------------------
A0A3N5G7M6      -----------------------
A0A1F2S3Q7      -----------------------
A0A2V8GVG4      -----------------------
A0A2V8PJQ0      -----------------------
A0A2V8H566      -----------------------
A0A2V8UVN4      -----------------------
A0A321LXF5      -----------------------
A0A5M8SBZ0      -----------------------
A0A1Q7JFB1      -----------------------
A0A2V8DMJ9      -----------------------
A0A2V8GGF6      -----------------------
A0A2V8HKU7      -----------------------
A0A1Q6Y875      -----------------------
A0A523DJA9      -----------------------
A0A2V8I604      -----------------------
A0A2V8J066      -----------------------
A0A1I6MMC5      -----------------------
A0A2V9D5W7      -----------------------
A0A2V9D4I4      -----------------------
A0A2V9D6L7      -----------------------
A0A2V8ZJV2      -----------------------
A0A2V9AWB5      -----------------------
A0A2V8Z1Y8      -----------------------
A0A1Q8AX10      -----------------------
A0A2V9A773      -----------------------
A0A2V9AND3      -----------------------
A0A2V9BTJ7      -----------------------
A0A2V8W2M7      -----------------------
A0A2V8XNW2      -----------------------
A0A1Q7CJC1      -----------------------
A0A2V9UEM7      -----------------------
A0A1Q7V300      -----------------------
A0A2V9ZCI3      -----------------------
A0A2V9WCB3      -----------------------
A0A2V9VQW5      -----------------------
A0A2V9WTP3      -----------------------
A0A2V9NLA9      -----------------------
A0A2V9RKJ9      -----------------------
A0A2V9RN95      -----------------------
A0A2V9N406      -----------------------
A0A2V9U6D9      -----------------------
A0A2V8DZN4      VDVHPDEGSRRRPRYARSEA---
A0A3N5YKY1      -----------------------
A0A2G6HQA4      -----------------------
A0A2V7ZTY7      -----------------------
A0A2V7ZVL9      -----------------------
A0A1Q7QYI4      -----------------------
A0A2V8G9Y9      -----------------------
A0A143PNR5      -----------------------
A0A6A7L078      -----------------------
A0A143PXU3      -----------------------
A0A2V8D8G9      -----------------------
A0A2V8ESQ4      -----------------------
A0A1E3Y5Q0      -----------------------
A0A2W4TWK5      -----------------------
A0A3N5NYV3      -----------------------
A0A2V2RJF9      -----------------------
A0A2G6HNT3      -----------------------
A0A2V7YWD4      -----------------------
A0A2V2R8T6      -----------------------
A0A1Q7RGF1      -----------------------
A0A2V9BLX2      -----------------------
A0A2V9ZA03      -----------------------
A0A3N5ZNH4      -----------------------
A0A2V8GEZ2      -----------------------
A0A3N5ZFD3      -----------------------
G8NXD3          -----------------------
A0A2V9VR38      -----------------------
A0A2V9EY04      -----------------------
A0A2V9HAK9      -----------------------
A0A1Q7FS15      -----------------------
A0A1Q7K9P1      -----------------------
A0A1Q7N989      -----------------------
A0A2V9G7Y0      -----------------------
A0A2V8T7Z1      -----------------------
A0A2V7U8G5      -----------------------
A0A2V7UNP9      -----------------------
A0A2V7VLD7      -----------------------
A0A2V7XGA3      -----------------------
A0A2V7YAG6      -----------------------
A0A2V7VK33      -----------------------
A0A3M1VTE1      -----------------------
A0A2V7TTM7      -----------------------
A0A2V8VI82      -----------------------
A0A2V7U4P9      -----------------------
A0A2V7TQY5      -----------------------
A0A2V7TU87      -----------------------
A0A2V8SEH0      -----------------------
A0A2V8VU54      -----------------------
A0A1Q7RML7      -----------------------
A0A1Q7ZIQ5      -----------------------
A0A2V8TKD8      -----------------------
                                       

© 1998-2021Legal notice