BYKdb

Dataset for cluster tadcd of phylum unclassified-candidate-division-zixibacteria

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bykdb|A0A0S7WF54 [Bacteria] Bacterial tyrosine kinase [unclassified candidate division Zixibacteria][candidate division Zixibacteria bacterium DG_27] (length=758 residues).
MRQAPSDEHYQIPPPGYYGSPFQEEREVNLRDYWKVIRKRQWTIIAFFLIVVVTTAVGTFTMSPIYRGTATIQINKENPQ
IVDFKEIFAVNTMDRDYYQTQYKLLESRNLARRVIDLLGLAEHPEFLSKPQSPLQRWRSRITNSLAALFSSSDGDSSEND
RESLLISGFLNRVKIEPMRNTRLVRIHFDSHYPELSSLVPNTLATQYIQQNLETRFVATEQAKEWLTGQLEVLKAKVERA
DEALQAFASKHGIVSLEEKENITMQRLTELNEALTKAESDRIAKEALYKQASEQDYDSLPPILENTLIQDLKQAYIQLDA
QYMRLGETFKPEYPEMVRLKNQMDTIQRRLDAEAGRIIAGIRSDYQASLRRESLLRETFQRQKAKAMQMKQRAIQYNILK
READTNRDLYNALLQRMKEAGVSAAITASNIQIVDGAELPTEPFKPNKRLNLLLATVVGLFLGFGLAFFFEYLDNTVKTP
EDVEQLIQLPSFGMIPEIAYERRRRLDEGNSYPVELVTFAHPKSMLSEAYRNVRTSILLSFSEKPPKRIAISSPNPAEGK
TTTAINTAIALSQTGARVLVVDSDMRKPRVHSILGEENGAGLSNFLSGNTELKSIIKKSDIPNLYYIPAGPVPPNPSELL
GSKLFKATMQFLGEKFDHIVFDSPPVLGFADATILSASVDGIILVVQGGKTPRETLQRAKDILHQVNAKILGVVVNRVDI
GRSDYGYYYYRYHYYYGKEGKRKKLPYTSDRESNSQQI
>gnl|bykdb|A0A0S8KBS7 [Bacteria] Bacterial tyrosine kinase [unclassified candidate division Zixibacteria][candidate division Zixibacteria bacterium SM23_81] (length=747 residues).
MAELDARPVALNEYLRTLYRGRWIIVLAFFTTVIAAAIFSFVAQPVYEAKTTLMIEKDGGMQESLFGVSGFIERETAINN
QVEILKSRSLAEKVLKRLLDAPEKNRFALFKAISQGASDDDAVQALRDNLTIVPLRDTDIIEIKYQAGTPWEASYIANAY
AAQYYQRDLEVSRGEITEVRKFLEEQLNTIQGDLQLSEEQLRRFKENEKVVALSEETEALVQQLAEFEGLYNEAETSRDA
AQKRLDYMKRELAKTKSTMVEDIIQVSSPLIQDLRAEIANLEAIRAGFIARGYTEDFDKMVEIRSQIEKTKAKMKEEATK
VVSRDLAPENPLLYSQDLIDRILSLQIEVSSLNAKARALDDVVQLYEEKLQALPEKSLQLARLERTAKVNENVYLMMREK
WEEARITEAGQIGMVQVIDSAKEPKWPIRPRKKLNLLLGMIIGLGLGIGATLLMDYLDDSLKDIEEVERHTGLRVLGSIP
QIKVNEKKKTLRKTAGSSEEQEIITIASRLVTHLEPRSPVSEAYRSFRTNIQFSQFDRPMKTLLVTSAGPGEGKSTTVAN
LAITMAQMGTKTLLVDADLRRPVLDSIFKCKRSLGLTDILLGNNHMDAALHELEVKNLSLLCCGTLPPNPAELLSSQAMR
DLLEQLKKNFEVILFDSPPVVAVTDAAVLGAHTDGVVLVISSGETTRKAENRAKTLLNNVRAQILGAVLNNVRAEGRYGS
YYHYYYYHYYESGKKGKKKKKLKRAPH
>gnl|bykdb|A0A353BHI8 [Bacteria] Bacterial tyrosine kinase [unclassified candidate division Zixibacteria][candidate division Zixibacteria bacterium] (length=752 residues).
MDQTAENKAKETNLYEIIDLLWRRKTLISVCLLGVLVPIAVATFTMHPVYEAQTTIIFEQSREPIPAFDLSENITRKTYI
VNQIEEIKSRSLSEEVARRLDSTLARDLAPETAKTEPIGSQLGYIAGKIKSNISVEPVRESDVLLVKFQGPSPRLAAEAA
NLVTAVLMDRNASVKREQASSTRKFIEDQMPTVEANLNKAEEALKGFKTQNQVVTLSNEASEILSRITAVDVDYNRAVTD
NQTLQRRLEAIYEQLRAQGGDTVGAFTSGSLADGLRQSLIELQMEVTQLSVKGYGQDHPQIVRLNSQIGSTKEKLNRELQ
AITSGKSVTPMPQMASLMAQIPPLQIELATTQARERALKRILDQYEASMGRLPYKELQLARLERAKEVGENLYKLLMEKN
EEAKITEAGKLGNLRVIDPALPPGSPIKPRKALNLAIGLIVGLTLGLVLAFFLESLDNSVKTPEELEHNFGLPVLGLIPV
IQSQESGRKRKRNGMDEVERISSTLVTRYTPRSPISEAYRGMRTNIQFSRIDTPLKTVVITSSAPSEGKSTTVANLAITT
ALMGVKTLLVDADLRRPVVHSLFGLEREPGMINVLAEKLPLEKVVKPSGIESLDILTCGAIPPNPSELLNTQRMRDLIAL
LSSRYDLVLFDSPPVLTVTDTCVLGSRVEGVVLVVNSHATDRRALNRAKILLGNVKANVLGAVLNRIEISTLVGSYDYYY
YHYYYYFDDEGKKKMHRRRKLWDKFKRGRHRA
>gnl|bykdb|A0A419FEM7 [Bacteria] Bacterial tyrosine kinase [unclassified candidate division Zixibacteria][candidate division Zixibacteria bacterium] (length=764 residues).
MTEQHEGSVKLGDYLRIILRGRWIILLCFLVVLGTTTFFTYRMEPVYQASTSIMIEDKGRLEQSVFGFSNLLASQTTIAN
QVEVIKSRTLAERVIHALEASQYRDNLKIMADYDRHDRPVNFNGKVKLLRESITVEPVKETDIIVLKVTANSAFESAYLA
NEIARQFFGQNLEYSKGEVGEVRRFLESQLDSVRMKLSESEEQLKLYKESHKLVALDEETEKLVEQTATFRAHLNEAEAE
LQENVLALQDLRNKFAESKSTLVEDVSRISSPLITELQTRIAEKQALIANLIAKSSPGYEIVVKDVEREIDEAKKALIEE
AHKIANSGISSIDPLKTSQELFDQILRADINIKSLTARTEALGTVVNSYESQLEALPEKNLELVRLMRDAELNEKIFLMR
SEKYEESRIAEAGKTANVRIIDPAVPPPKPIRPNRQLNVFLAIFFGLGLGVAISFAIELLDGSVRTVEDLEKLKVSVLGA
IPTIDPEEIARRMKRHGHKLSPEDRARLTSKLITNFSPKSPVSEAYRSLRTNILFANLDRQAKTLVVSSSATKEGKSTTV
ANLAITMAQMGSRVLIVDADLRRPTMHTLFKIERQIGLSNALLGNYTLDEVIKPTGIENLDIITAGDIPPNPSELLSSNA
MRKTLALLQQRYDMILLDSPPVIAVTDAAVLSTRTDAVLLVVSSGYVTRKEVDRAIQLLGNVRANLIGVLLNGLDVKRIY
GSYYYYYHYYQYYYYYGTKKQRRTSREADLALEDNGPREHQQTG
>gnl|bykdb|A0A7C5B5T4 [Bacteria] Bacterial tyrosine kinase [unclassified candidate division Zixibacteria][candidate division Zixibacteria bacterium] (length=739 residues).
MNTPQPTLQHYLAILLRRRWLIISCFFLILAGTVLITLTTAPVYESSTKIMLDEERGIKKEVFEISSFVKQETMLKNQVE
ILRSRNLTEKVLEALLDSDYRSEILAWIKTKQIPHDKEELLEQLAKRTKISPVRETDIIEIKAQASHPHLAAFMANTIAD
KYYQQSLSASKGEITEVREFLENQLESVQKELKLSEEALKNYQKLEEVAALSEETKELVKQLATFEGMYKEAQTEYEVYL
RRLESLKSQLSESKKHLVDNVASISTPMIASLRQKLTELETLRAGYLAQGFSPEHPKLKEVGQRLTEIKQKLAEEAGRVL
SSEYLPEDPLAYSQELVTQILQLEIELESRKARQQILAKIVSEYNAKMNSLPDKSLMLARLERGAKVNENIFLMLKEKYE
EAKIQEAGQIGMLRIVDPAYPAPEPIKPKKKLNLLGGAFLGIFLGWGLALLKEKMDTSVKTMEELEQIGHTVLANIPVIR
GKNGSRSRKSEETLSQEQQAKQIASSLVTHFEPKSAVSEAYRTFRTNIQFAQLDKPVKTLLVTSPGPSEGKSTTISNLAI
TLAQQEIKTVLIDADLRKPVLHSVFGLSREKGLTHYLMGKAALEQVVRPTRIENLSLISCGALPPNPAELLGSQKLKELL
EKLKTKFEMVLFDSPPAMAVTDAVVLSTLLDGVVLVVSSGQTNRNSLRYGTSALKNVGANLLGVVLNKIKMESLYGSYHY
YHYYHYRAYESEKKSEVTA
>gnl|bykdb|T0LIM2 [Bacteria] Bacterial tyrosine kinase [unclassified candidate division Zixibacteria][candidate division Zixibacteria bacterium RBG-1] (length=739 residues).
MEKKEKTWQEYLFILFRRRWVWLMAFFSVIAVTVLLTFTAKPVYEAKTSILIDVEERMQKAIFDMMSPLGQREAKIKNQV
EILKSRTLALGVLEFVSHSEFSPFFEKLASDLQNHKKLEQKLAYLKKNLKIQPVRGTDVIELKTTASDPVMASFLANAFA
DQYFQQSLKFTKGEISEVRQFLEVQLDNIQKELKISEEALKAYKEKEKVTALPDETSELVKKLVEFDGLYNEAKTDLESA
VKRMEYMQSQLDTRRSKLVQDITTVSSPLIIQLRNEIANLEAVKASYIAQGFSVNHPKIVEINQRIEDTKKSLITESSKI
VSSELLSGDPLALSTDLVNKILLIEIEIHSLSAKAKALGTVVQTYAAQLNSLPEKSLQLARLERQAKVSENIFMMLKEKY
EEARIKEAGQIGSVRIIDQAYPPLSPIKPKKKLNLILGALLGILFATTMILSVEAFDTTVKTVPEIERAGIPVLGTIPLI
KENNKVWSGNGKHRSKIESEELKISSNLVTHLDPKSAVSEAYRTFRTNLQFTQADTPLKTILVTSPGPGEGKSTTISNLA
ITLSQSGFKILVVDTDLRKPVLHGIFGVPKEPGVVHYLSGKADLKSIIKPTPVENIFLIPAGIIPPNPNELIGSQKFKNM
VEELKGEFDFVLFDSPPMMAVADATVLSTILDGVILVISAGQSHFANMEKVASSLKGLKANLLGGVLNKLKFEKIYGGYP
YYYYYHHYYEDGEKKATPS
© 1998-2021Legal notice