BYKdb

Dataset for cluster orphancd of phylum unclassified-candidate-division-zixibacteria

[Download (right click)] [Alignment] [Repertoires]

16 sequence(s)

>gnl|bykdb|A0A1F4X8I1 [Bacteria] Bacterial tyrosine kinase [unclassified candidate division Zixibacteria][candidate division Zixibacteria bacterium RBG_16_50_21] (length=258 residues).
MKKNSNHPRYPKTILELYDKESPAATEFRRLYSNLRHMDGFADLKSILVTSATSEEGKTLVAGFLAITIAHYHDCKTLLI
DSDLRRPVVHQLFDLESKKGLAEVLEGKLPLKDCLRKTGIGNLQVLTAGNGEKTPTELLDSPRLTEVLEEAKFYFDLIVV
DSAPIIPVSDVMILMPEVEGALIVVKAGATPREVVKRAADLVQNAGGKILGIVMNNLEGVLPYYYNYNYYGYEYGYGGKR
DSRTGKLTPSRQKPRSES
>gnl|bykdb|A0A1F4YLC6 [Bacteria] Bacterial tyrosine kinase [unclassified candidate division Zixibacteria][candidate division Zixibacteria bacterium RBG_16_53_22] (length=243 residues).
MKKSLIPLKVTQEDFDRGKSYEKDGKELLFLEQFKALRAKFEYQVDIHKYKVVAVTSAIAEEGKTLTSANLATNLASVGR
KKVLLVDTDMRKSDIARMFDASPKPGLKEFLAGSVPLEKIILSSNSVRGLSFISGGEKGTTPPDLLAGETFRSFLQEMRS
KFDVVLLDTPPILPVADTMSLRDQVDGFILIFRIGLTPYVMLQQALEEIDKNKIIGVVLNGVEMHKYKYYQRYYGDYYHK
KPE
>gnl|bykdb|A0A1W9S6P8 [Bacteria] Bacterial tyrosine kinase [unclassified candidate division Zixibacteria][candidate division Zixibacteria bacterium 4484_95] (length=235 residues).
MKIESIASFYDMESPEATEFRRLYSNIKKSNNDQLKSVLVTSSTIEEGKSLISSFLAITMAEAKEGKVLLLDADLRRPMI
NVLFKLPLEKGLSDILEKKCKVGKTIKDTSISGLKIITAGRISESPTLIFNQENIRKVTEELKFYFDFIIIDAPPVIPVS
DPLLIASEVDGVLLVIKAGTTKKEVVKRTTNLLINSNIKILGAVINDFDSVLPFYYSSKYYGYKYYHKKAGGKGE
>gnl|bykdb|A0A2M7WK57 [Bacteria] Bacterial tyrosine kinase [unclassified candidate division Zixibacteria][candidate division Zixibacteria bacterium CG_4_9_14_3_um_filter_46_8] (length=249 residues).
MKKQNKKSIIEYYDRESPEATEIRRLYSHIARVPATDGEWIRSLAVTSSTLGEGKSTLASMLAISIADHARKNVLLVDSD
FRRPKIHEMFNLELGRGFSDILAGDQSGETAVKGTPFTNLKIITAGRRHSNLSKILDRVRLKEFFDKAKHHFDYIILDCP
PVIPVSDIIDLSPEIDGVMMVIKAGQTPKEVTKRAVNLLQNYGVKIVGLVLNDVERVLPYYYDYSYYHYRPTKPETKEKP
IAKAREVKV
>gnl|bykdb|A0A2N1P8H2 [Bacteria] Bacterial tyrosine kinase [unclassified candidate division Zixibacteria][candidate division Zixibacteria bacterium HGW-Zixibacteria-1] (length=236 residues).
MTSKSTNLSIIEYFDPESAESTEFRRVLYNLNGIQSGGNKKAVLITSAMLSEGKSIISAYLAMTSARFKNRKTLLVDFDL
RRPMVHKLFDVPLENGISDILAKGIASRNVIKKTAIDNLDLLTAGKIMPNPSELFNGPSIHRIIEEMKFYYELILVDSPP
LLPVMDPMLLLEELDGVILVIKAGSTQKEIVARARDLLASQKNKVAGVVINNLDQTLPYHYNYDYYGYHYRPVTKK
>gnl|bykdb|A0A3M1CJ11 [Bacteria] Bacterial tyrosine kinase [unclassified candidate division Zixibacteria][candidate division Zixibacteria bacterium] (length=229 residues).
MGRRTPGALIDIFTLESPFATDIRRVLHQITRAGKEQEVKTVLFTSATTGEGKSTLTALSAITAARKGKRVLIVDSDLRR
PVQHTLFQLPREQGVVEGILEGGQLRSFVKKTKLDKLDLLTSGRMTSAPAEVFDAARIVELLEELKFYYDLILIDCAPLL
PVSDPMMLAPDVDGVVMVVKAGETDRELVKRGVQILKSADARIIGVVLNNMKRALPHYYNYEYYDGGYY
>gnl|bykdb|A0A496PTD7 [Bacteria] Bacterial tyrosine kinase [unclassified candidate division Zixibacteria][candidate division Zixibacteria bacterium] (length=269 residues).
MALRPVSILDFYSPELPFATEFRRLLQRIDNSSKKLDRKAILITSAVLAEGKSTICSFLALSAARQKKMKTLLIDADLRR
PSIHKFFAMQRENGLVEVLSGDLGAAEAVKHTNLENLHIITAGRFIHEPSELFDAEAIGRIVNEMKFYYDLVLVDCAPVL
PVSDPMLLASKLDAIILVIKAGETQKEVVERAVDILGSNGSRILGVVLNNMNNSLPYYYDYKYYNYNSSTDKSRHKRKAR
QISSNSQHSHRKNSAKNPEPKNNIAERSS
>gnl|bykdb|A0A523WSI3 [Bacteria] Bacterial tyrosine kinase [unclassified candidate division Zixibacteria][candidate division Zixibacteria bacterium] (length=254 residues).
MTEKKRKEVKAKGQKLWIKELARGETAATVESRRLFFNLNNLRHQSSSKEVLVTSATVGEGKSTVAALLALAAVENTEEE
VLLVDADLRRPIIHSLFGLKRDGGFKELLSGKIDLELALKDSFQPNLKIITSGSGREFVWQLLEPAKLRGLFRSLRSRFS
YLIVDTPPVIPVSDVLSLASELERVLLVVKAGETPREVVKRATDLLKEAGTQILGVVLNNARQVLPYYYNYSYYHYHYRE
PTLQKASPLELSSR
>gnl|bykdb|A0A660PI23 [Bacteria] Bacterial tyrosine kinase [unclassified candidate division Zixibacteria][candidate division Zixibacteria bacterium] (length=235 residues).
MKIESIASFYDMESPEATEFRRLYSNIKKSNNDQLKSVLVTSSTIEEGKSLISSFLAITMAEAKEGKVLLLDADLRRPMI
NVLFKLPLEKGLSDILEKKCKVGKTIKDTSISGLKIITAGRISESPTLIFNQENIRKVTEELKFYFDFIIIDAPPVIPVS
DPLLIASEVDGVLLVIKAGTTKKEVVKRTTNLLINSNIKILGAVINDFDSVLPFYYSSKYYGYKYYHKKAGGKGE
>gnl|bykdb|A0A660PQY1 [Bacteria] Bacterial tyrosine kinase [unclassified candidate division Zixibacteria][candidate division Zixibacteria bacterium] (length=267 residues).
MAKKTLSIDQFYSPDAPFANEFRRLLVKIKKEGANQEVKSILFTSAMLSEGKSTICSLLGLTSARQNGLKTLIVDSDLRR
PSIHKFFHLERTKGLTDILVDGFDTGEAIKKTKVEKLDVITSGTNYEHPAEIFDAESIGYMLDELKFYYDLILVDSAPLM
PVSDPLLLSDKTDKVILVVKAGSTDREVVKQAKGILNNSNDKILGVILNNLNNSLPYYYDYQYYGYDYSPSKGTADSQVK
LNPDKINKRKNRKFNKKPDSNQTKNIS
>gnl|bykdb|A0A660PRX7 [Bacteria] Bacterial tyrosine kinase [unclassified candidate division Zixibacteria][candidate division Zixibacteria bacterium] (length=235 residues).
MTGKSNLISILDIFNPESPESTEFRRILHNLDKSKKGGDKQVILITSATLSEGKSLTSSFLAMTSATYKNNKTLLIDFDL
RRPTIHKLFGVNRRGGISEIMLGGLAPKKAVKPTNLDKLDLLTAGKSTGNISELIKGPNVHRIIEEMKFYYDTIIVDSPP
LIPVMDTLIFVEEFDAVLLVIKAGVTQKEIVDRARNLLANHNGKLVGVIMNNLKKSLPYYYDYSYYDYNYKSSEE
>gnl|bykdb|A0A660Q066 [Bacteria] Bacterial tyrosine kinase [unclassified candidate division Zixibacteria][candidate division Zixibacteria bacterium] (length=270 residues).
MRDYVPVIDCFSQESPVATELRRLLSSMKKLEGQSELKSILVTSATESEGKSTICSLLSITSARRGYKTLLVDCDLRRPM
IHAMFALERRHGIVEVLSEGVAIKSVIKKTSLDNLDVVTSGKVTSQPTELFDSRAIEGLIRELKFYYDFIFVDTPPVIPV
SDPMLLAQELDGTLFVVRAGATAREVLKRAADIMTSNNVNLLGAVLNDVKGNLPSYYDSSNYNYDYKPSAEDRKIDRKEN
QSYSLPKPVQKKKNNQGSNSTPISGKQLDR
>gnl|bykdb|A0A660Q2E5 [Bacteria] Bacterial tyrosine kinase [unclassified candidate division Zixibacteria][candidate division Zixibacteria bacterium] (length=238 residues).
MIVVKKDKNLSLIDYFDPESPESTEFRRVLYNLNGIPGGGAKKAVLVTSAMLSEGKSVISSYLALTSAYFKSRKTLLMDF
DLRRPMIHNLFSVPLANGISDILAKGVASRNMIKKTSNDNLDLLTAGQTMPNPSELFNGPAIHRIIEEMKFYYDLILVDS
PPLLPVMDPMILLEELDGAILVIKAGSTQRDIVARARDLLEPQKDKIAGVVINNLDQTLPYHYNYDYYGYNYKPIQKK
>gnl|bykdb|A0A6I7LZR0 [Bacteria] Bacterial tyrosine kinase [unclassified candidate division Zixibacteria][candidate division Zixibacteria bacterium] (length=249 residues).
MRFLISRKKAIEEDLLDTKNGLNXIXYYDAESPEASEFRRLLHNINGNLSEGGRKSLLVTSAMTSEGKSIISTFIALTSA
RHKNKKTLLIDFDLRRPRIHRLFNLPREKGVSEILEEGVPVRNLIKPTSLDKLDILTAGKPIPNPSDLINGPAVHKIIEE
MKFYYDLIVIDTSPVIPVSDPMLLIEEVDAALLVVKAGVTPKGVVSRACGLLAPNRKKLLGVVINNLESTLPYYYNYNYY
GYHYKPSKH
>gnl|bykdb|A0A7C0W9K1 [Bacteria] Bacterial tyrosine kinase [unclassified candidate division Zixibacteria][candidate division Zixibacteria bacterium] (length=236 residues).
MVKKDKNLSLIDYFDPESPESTEFRRVLYNLNGIPGGGAKKAVLVTSAMLSEGKSVISSYLALTSAYFKSRKTLLMDFDL
RRPMIHKLFSVPLANGISDILAKGVASRNMIKKTSNDNLDLLTAGQTMPNPSELFNGPAIHRIIEEMKFYYDLILVDSPP
LLPVMDPMILLEELDGAILVIKAGSTQRDIVARARDLLEPQKDKIAGVVINNLDQTLPYHYNYDYYGYNYKPIQKK
>gnl|bykdb|A0A7C5F759 [Bacteria] Bacterial tyrosine kinase [unclassified candidate division Zixibacteria][candidate division Zixibacteria bacterium] (length=255 residues).
MGRNPEPHRFQKTILELYEKESPAATEFRRLYSNLRHLNGFGEIKSLLVTSATSEEGKSLVASFLAITISHYHDCKTLLL
DTDMRRPVVHQLFNLEQQPGLAEVLEGRKVLKECFQKTPLSNLQVLTSGEPHRSATELLDSPRLTEVFEEMKFYFDLIVV
DSAPVIPVSDVMVLLPEVEATLMVVKAGATPREVVKRAAELVQNSGGKIVGMVLNNLEGVLPYYYNYNYYGYHYGYSGKK
SSADKPDRKTEKRIQ
© 1998-2021Legal notice