BYKdb

Dataset for cluster tadcd of phylum planctomycetes

[Download (right click)] [Alignment] [Repertoires]

204 sequence(s)

>gnl|bykdb|A0A0J1B4A0 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Rhodopirellula islandica] (length=844 residues).
MLFADQSIEFLKIMIRSNPSADDVNGDELDIDLDLLGIVRRRYHLIALGIFVGVTLATIYFVNQVPIYESKLAVLVGQRS
GEVANTGVNNGAKDMASMQEDVLSTHMELFASPKILENAIQIAGLNVKVGDLAENLSVSKGGDGLAKSASVLKATYQDPD
PEVAAAALQAIFDSYQDYIDEQTSSVGNEAAELIARAQVQNEKALREADQAYREFVASVPALISSNINGRDSLEDVHRLR
LNNIEQQLGGIRESLSHAKSRRVVIREFVKGKDPDSLSDVHVMSLLDADEIDRVNAFLAISANRDDQTNDEMLSRAVMQE
STRTEYQQLLTLSSKERLMAAEFGENHPSVRALRTELDNMRRFVDESRENRPEEDKRVEAKPADILASYYQVLQSDISEM
EKREEQLLELSEKESKLAKEVETTFLLGSSLKANLDRAQARYDEVFQRLHEINLTNDYSGFSTDLIVMPLPASVPVWPSR
TKIAALGILAGGMLGLALALLAEMTDRTFHDPAEVERIVGASILAHVPRLKESALKKKVKEGSGISAMIPTFHLPRGTEA
ETFRVLRTSLLFLTKSQSKKVFLLTSPSPSDGKSTTIANLAVSVAQTGKRVLLIDADMRRPTVAANFGVERSPGLSDLLS
HDGPINPATLAECVQASEQDSLTLCTSGSRTSEPSELLESDQWVAFLDLARKTYDVILIDTPPLLAVADPSIVADEVDGV
FLAVRIEKNNRTLVERATEVLTDKGIAIEGVIVNSRDSRSNHYAYSSYDYYGKKQYGYVANYRRYYEANDDDDAGSAPRR
KRSSSKRTAAASTRSLPIPEAASSNGHVANGSTVNGSSNGHPTT
>gnl|bykdb|A0A0J1B719 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Rhodopirellula islandica] (length=786 residues).
MAESAKPTNRLPARGPSSASSDGEETLDVLQILSRQRWLIAFLSIAGLAAGVAYALNAQVWYESNAKVLINQKSAGLGGN
STGTDMVDEDILANHMELIQSRMIVGEALEQNELLDLPSIETHLNEKTDAIDYVIDQLSIVKGGDGSAKTARSLNITFTH
TDPDDAKLILTAVMKRYEQFIIDQVEQVMGRANEMVNKAKTEVETDLIAAEQEHLKARQEAPLFFQGEGSSNIYQDRYRR
LQDELLDLDIQESTVKTRLTRVDQTLKEMDESTDPIDQLDKLALIDSDSLERLGVFAGLQMNSANTAEFKAAMPAKAEEA
RTQITHLLKLNSEKQRLTSVFGPGHPKVQELESEITLVKEFLQDQKDLTSPAEMFGDSALTPEGLLKAYVGFLQHDLAAL
SERRKELTYLAADAETKAKELIEYELTDMILQKKIGRQEALFEGVVQQLRALDTASGLTGYLYEFLAVPRTGEKSWPKLP
LCGLGGLMLGLFSGLFLAVANDVRDGRFRSAAELDDAIGLPSLGRVGKLNSINQGIKGLIATELSPDAEAFRLGRTVLLP
DIRSGSVRTIGFTSPMQGDGKSTVVSNFAVSFSQVGLKVLVIDADLRRPSAHRYFSLGKEDGLCDVLEDRLEISEAIKAT
EADNVFVMTSGSSSHTPAELLQSQRLDEVLAVVKEDYDLVLVDLPPVLAVSDPVVVMPRLDGGILVVKVANVRRDEVVNT
LRRIDSSGGEMLGCMLNAFGAGKKFDSDGGYYGYYKSDYTRPTSSATRQAAPKAATISANGQPKSK
>gnl|bykdb|A0A0S8FY64 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium SM23_32] (length=878 residues).
MEDTLAAEAYPDEVREFDIRHHFGVIRSRFWTIVACAVVLFTVAVLYTFQATPIYEASARLLIERRAPQVSPFEDMQERR
DKEYFATQVSLITSRAVLDKALEDDRLTGLFQAEDMRQMARPGLWHSAFREVRAVLGYEPVRPVEAWELLREIVGVRPVK
DTNLVDILVRAPDANVASLVANLVAQAYVDYSVAARQQSAGEAFEMLQRQMKEQEKALVKAEDDLLTYREQTTIPELGTP
NEQSPVLTRRRALNDEFTRVQLKRIELGVVVQANLGTGEEPQDLEELLSISIVRSDPAVAELYGRLTQIDLDLQGALRSF
GLKHPEVVALNDEREHVLSGLREAMARAVDSIHSEYAVLVAREQELVRVLLEETRVALEQARKVHVYSRLERDAERQARV
FDVIVDRMREVDLTKDVGVTNVSFVERASPPQAPVRPNKQVNLILGALLGVLLGVGLAYGLEYLDDTVKTPDDVERRLNM
PWLGYVPQMHSDGSREGLVSLAQHAIQHATDSSTEAFRSIRTNIYFSGQRGEMKTLMVTSAAPQDGKTVFAANLATTMAQ
DGKRVLLVDADLRRPALHRAFELERSPGLTNLLVEGRALQEIVQQPSDGQLEGLQNLYVLSAGAKTPNPAELLGSSAMAR
LVRQSREQYDVVIFDSCPAMFVADAAPIASGCDGVVIVLKASKSRCKAADRARRQLAAVNGRIIGAVLNDVRPKTLRRYG
SYGYYYYDYHRYYKDYQEDEGDELEMPASVPVAVEDERPDDGPDEEGSAERFEPGTVSFVVRGGQDFSFSFELEDGQQTV
VGRSSAECDIGLPSASVSPQHCRIANSGGRIVVEDLGSANGTFVGYRRVRRATVGPGDVIRISPYTISVEGPTGNRAG
>gnl|bykdb|A0A0S8GZ23 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Phycisphaerae bacterium SM23_30] (length=747 residues).
MDKLEKYQPQEITPNIDYLEADSAPKDSSILHLFQPVLRRWYWVLVIFILVSAVGAPIIWHVKRPIYTTSGTIHIRPLVA
DLLTGAHESGGISNYDIYVNTQAQIIRDNRVLQNVADVLDDNNTLLGTGIDRISALKTALADGTITIKHLTRTEFLGVSM
TSRKPRQAEQIVNAFMKEYMKVVDNIDLGMEDQDLANLRKLKLELENKLKNHLQELRKINEKYGADSLEGLQRVALGDIT
SLREQLRNLELVISDTLTQIELLSDPNHPIDIPPDMLKNRSDSINNDPYVRETTAILVQLQMELSSYKQRLTLKNPEIER
ITKSIETFEKDLEIYRAKAGEKFDEAMVRFMEQKREADLTKAKVQLANYQAMESEYSRRLVEELEQNKDMGNVQFEIRTR
QAEMARDQSEYNLVLERIDDIEIKRQRPARITISDEASTGPPVTKREKLLAALAIGALALGISFALLMGKIDKTIYDPED
IERCIGVPMIGTTSDLTHVEKKLLLEQVAEDYQTIRANLGLLSNGKIPHKMVVTSSGVREGKSTFAVNLATSLAQAGKRV
LLIDGDLRKPDIERLLNLPHDSWGLMDVLYGLKKFEETVRSVPLSGLDVLTADGRNPAEAVELLEKPQTAECINNISQRY
DHVIIDTPPVLAVPDARLWARMADAVVLSSLAGQTESSDLKETLDLLSQINVKILGNVLCNVSPSSSHYRYRYGYGYGYG
RRRGDGNNDKRKRPKPKTLLISGPGSK
>gnl|bykdb|A0A0S8J591 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium SM23_65] (length=698 residues).
MAVKRPERKMHLTDYLWVLKRRVLLILFFWGLVFASVVVATFMQQPLYRAYARIEIERSVDTPDVIEAGARRMATEEFYN
SQVENLRSRRIARKLYNDMGMYNWEYFRKLGPDRDPIAVVRNWIRVSRVPKTHHVEIWVLWPDPKMAARMVNAVTDAYTD
ILKEWRSSAFDASVRALLNRAQDIKREQDKASRAVQDFSAEREIYALPEIRSVVLTNERWLQEAAAQANVEMIAAQSLYD
AVNKAVEEGTYENTRDTDLLQRLRERLYAYQEIVELEKEDKTRRYRDQDRLSRNMEVRVEQVNQQIAVENDRMRRAAQSD
AAQKLATAQANYEFLSDMLLTNRQRLTQISRDMLQLEGLRKQQENIEEMRAVLDKAAETVKTYRSYEDIKARVISQADIP
KGKFSPNPALNLPLGLVVGLMVGIIAAFFFEYLNTTIRMPRDIEDGLGLPVLGFVPAMSPKFKDFATRSLISHLDSRSGP
AEAFRGIRTEVMLRSDLRQVKTGMVTSTSPQEGKTTVAVNWAITLAQAGNKVLLIDGDLRKPMIHRAFNMKPDRGLSTLL
SEKDSATVYIKKTDIENLHVLPGGPIPSNPAELLGSRKMRTLVAEAAERYDSVIIDASPVLGVADANILSTMVDCVVLVV
QASKNRRGLVMRAKNQLASVNARLAGAVLNNVRGTKGDYYYYRQRYQPVAEMMEEAGV
>gnl|bykdb|A0A0S8KNX5 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Phycisphaerae bacterium SM1_79] (length=816 residues).
MSDLEKYHDQVVGQQVVNFQIPPEPGRVGTSNLLAGIFRRWYIVLLILFVMCAAGLPAIWFLIDPVYEVTGAVTIAPIMA
DILTDVPDSGEISNYSSFMNTQAEMITSSRVVRRVADDLADRNLPFLEDEPTDPISKLKRKIDGTQDKRTPEEILKQAIT
NGVIVAAADRLSELIRITVLHPDREQARQIVDAFINAYTAVEVSASVEDEDKKLTILENERKLLAEKMESQRQAIYRLGQ
EYGTVALGSRTDMMLQRVGSLLSTLTEVEAERIKLEAQVQLLELTKTQPIAPGELLSMRQSYINEDPAVVAFTANITELE
QELVVAKQTLSPTNPEIELKAELIQTLKAHLEERRQEASKAFDDLVEKEAAEAGTKQLVAKRSELEQTRQYEKGLRETLS
KEDTETIDLGRTQLTIQELQDGLLLAKEMYDTVQRRIQDLEMQRKRPARISVAYYADIARVLDKRVKYSAALVFTALVCG
MGLAHLRDKADQSLRTPDDVAKRIGIRIIGTTTSLHTVKPALLPERIIGDYQTIRANLGLLGGEGIPKKLVITSPGMKEG
KTTFAINLATSIAESGKRVLLVDGDLRKPDVARLLNLPKGARGLQDVLSGVEFEDVVYSIASSGLDVLAADYHNAADAYE
LLALPSTAHRIDTISKKYDHVIIDTPPALGFPDALLWAKVGDAVILTSFAGHTTMPDLKEATDRLAQINVRVLGTVLSSV
QAEHSYYRHGHSYYAQSAQSRESARRSRRKLMFSVDGGVDHSSGLETSVAERSADNYSYTQSSESRKDTGRKRKKPRLSV
EDGADKTDDPETPRTS
>gnl|bykdb|A0A142WSB9 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomyces sp. SH-PL14] (length=796 residues).
MTQPNPASANGNELAFAPPGLQASSLPGRSIDLVRFVLSIWKWLALGLFAGLTLGVVSYLIMGPVYRASTRVQVSKKASL
PINSQEARRYSDRSQHVHFLTSDAIAAIAIEKYGLKDIPGIANARDPLKAVWEDATAKLVSGQDQSFDAIIEVAYESADK
AVAKTVVEAIVKAYEDWLGQTKDKNSADLYAALQGSRTALIDDISKMEAAWKAWRDASPYFYPTPPVVTVNGVATPQMSP
QAQALDRVIREQESIQTQRANVQGKIATLKKMIAANESPDEIQFWVMHALSAGTGGGAEGGGGGGGGGGGVLQGPSGKAE
LDGRLLAARLVESRLSQLVGDNHADLKNVRSEITTILSAYRSQGIVAPTIEKEDLAAVAQGAAAKSGNKKAGVDLPHVYL
YILESQLEEFKIREDLLAARRTEAEGTAKESSLFDAADQKRKDEIAAKQKELESVRMQIADYNQSRSQEGYKVSQLSQVR
IERSLKQVLKVFGACGLLGLISVFALAYVREWYDTSVRSVDEVRQLTGAHVLGIVPHFQKRNQNSAMAHTGISPQVVYLH
HPGSRESEAYRSLRTTLFFSTRETGEKVIQVCSAEPGDGKSTTTANLAVALAQSGKSVVLIDADLRRPTVHDLFALPRQL
GLAEVLTGAIPLESGLKATPVANLSVLTAGIPPENPAELLSTSNLEGLVQELRGRYDFVLFDSPPVLAVSDPCIIAPQAD
AMLLVVRLEKNNRTVLRRACEQLDAHGIRLLGVIANDAAASTQTEGSYGNYEEYYSTAPATSGGAARSKAAAGKLW
>gnl|bykdb|A0A142YNY8 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomyces sp. SH-PL62] (length=810 residues).
MDTSDRHDSTLPARSHTPSSGVPARAATNFGGGSRELAVGASTMQVNPTSILRGLLRNWWKILGLWLIASLPLVYGIYTQ
VKPTYIAYSVIRIEPTQPELFGSSSRGDGSSSIERIIETARAALISDRVLNGAIIDPQVSGLPFIKGSLSPRTELKERLA
IVNPRNTEFVHVSLESTNPEEAAAIVNAVVASYLQAQNELTEGADGLMKKSLEDYLKKMIDDKKEKVKELSTLMSKGKVD
SQSLTPNQASQANTAGPAAPADGTVQDSSKARNLGDVSIEQYRKWKDRLLETQVDLFQAKALLEQRTADYQNGAEIEQLE
SGLRPSEEELTERIQAAFLADPAIADLRDEILTVRDRLSHVVSNARKGNDPSKRAHEARLKQLEGQHADFWAQRYPEIRA
QILAELEGRPTPTNPVRDESIKSIPELRADVEALERERKAITEALAQAELETKESNSETYTARYLQAEIDSMTHDQQIVH
RRLEDLKFRTDRDMVRVSLYDRAAVPRVPSSSKRIKLMAAAPMGIMALVLGIFSLLEVKAERVGDPDQLSTRVQSEVYSL
PPIPMSRSPRRLGAPGDDDQIERFIQRLDHLRFAVCGDHPEVGLGRCVLISSAVGGEGKTTLAAQLAARCGHSGHSTLLI
DADLRRGALSPLLDVADSKGLSDLLMNEDLNPEDLAIPVQGGTFHLLSAGTPTSDTSRVFQGRAFGMLIARLRQLYDLII
IDSPPILPVPDALIMGRWTDGVVLTSRYDVSRAPQVERARRQLDLAGIPVLGTVINGMRTSDSYYGRYSYSRPGASTTDR
ERPADATSAG
>gnl|bykdb|A0A1C3E6N1 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctopirus hydrillae] (length=748 residues).
MMPEANTMQTLMRFWRSVQYRKGLIILAVLAASALGAAYYIVSTRYYESKAELLILQTGSKVLDGAPEGAAMKDLMPTYE
RIMQGDIVLADAAQKLPVKYRTDFRGVAPADWPGVLKKMVTVRSARQTNVLELTCRSRDPKAAAAILYAVLSASIDFLNK
NHQGTSQEILQILSKEKVELEQKLATREAELIELRGRSLTFVSNGTDNATNVAVARVVRLNEEFMKAKEETLRATAQLAA
LEQAISRGEDVLQFAMASLDVVGKQFMMGELGLDSQEGMAISRMTEQLLQEQAKMRTALESYGPNHPKVIELRDAIQAKE
QWMASRRQVTIDRLKQLRMEELTPRLLQMARQRVQHSQQHEASVSAQFDIERQNALSLNGELAKLEILQMDTKRLRAFYD
LVLERIRGIDLGKDKGIRTAVVGEPKVNPRPVHPKLSLTVAVSLMAGISLGLALVYLADLLDDRFRSPEETSLQLGAPVL
SFIPTLPTYDGNGLDSVHAFVAPHESSTEAFRTLRTAIQFAGDDIRRLVITSTEPGDGKTTVSTNLAVAYAQSGRRTIII
DCDMRRPGLSKTMKLRGSYGLSTILRNDDSIENSLRNNVVVSDLAGLDIIPAGPRPANPLELLSSTRFSELLAYVESQYD
QVLIDAPPILAVSDAGVLGRMVDGVVLVVRPDKNQRRSVIRAAETLRMWGNNLLGLALNNMSSDRAGGYGYGYGYGYGYG
HTDTDGDHDDLLDDHASSHSSYSSRTAA
>gnl|bykdb|A0A1E3X4X0 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Candidatus Scalindua rubra] (length=733 residues).
MLNNKEQTHLTDYIKIIQKRQWVVILVFVVLVATVTISTIRMTPVYQAKARVLIEKEERVNVTGKDIQEVVTYDPYATRG
EFYKNQHEILKSRSLAKRVIEELKLGNGPELPSGSSKRRLIDVYLKKLSITPVRNTGVVNVSFSGNYPDIITDILNAHVK
FYKDQELERRFLASQDAVEWIDGRLKDLGKDLEKDEEELQKYKEDEDLITLDNLGTVEQRQNIVLEKLSELSTELTRAKT
QRIGVETLYNEIQKLSERPEMIEAITPVIENRLIQDLKADYARLEAQVSNLSEKYGPRHPQMVRLLTQMEAIKDKIDFEV
KKIISSIETKYKVARAKEDSIRESLEKQKEEALRLNKKAIKYGILKREADTNKDLYEILLTRLKEASMTGALKTSNIRIL
DAAVVPRHPIKPRVKLNIILAIIVGLTLGVGLAFFLDYLDRTLSTPEDVERYLQVPLLGAVGRIEMDKQKRRSEQPTPAS
GLGGIADDNVFVPELFVHRKSKSNIAEAIRNIRTNIIFTATDTPRKLIMIASANPDEGKTFFVSNLATVIAHTGKKVLMV
DTDMRKPRLNKIFSVERNPGVSNVLAGEASIESCIKDTEISNLNLITSGSVPPNPSEMLGSASMEKFCDDIRKMFDYVLL
DSPPIMSVTDATILARLTDASLLLVKTGETNRDAVKRSIAQFNDINAKVLGVVMNNVDLSKGSYYYHYYQYYYRYGYGEE
EEKKGRKKRRSKG
>gnl|bykdb|A0A1G2XVR0 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium GWF2_40_8] (length=752 residues).
MLTESEIQPKQLDIRKYLTTVLRRKWIIIAFLVISGTYSTYKELTKIPYYTASTQVIITQNTPKGLTFQAFSFEGNNSSS
FTTNERILRSRSLAQKVLSTMDYKDSPEFNPVKKANIFSIKELTRGNSSPTVRKPEPGKESQEPETPVKYDVDDALINNY
LSKLTVQMTGNSDIISISFTGTHPETLAKMCNMHAKKFLETHLELRFAASQDAVKWLQDQLVDKKLKVEEAEEALILYKE
KQNIVGLGETAGIIEQKLEGLKSNLTETKIEKVKLKALSDQIKQYSKDPTLTKLIPEIVKDGSINTLKAKYADLQANKTM
LSEKYGEKHPNIANIDLQLKEIENRIKLETLSLITKVETDYNVLLASEESYEKAYNEQSLVVFDLNRKITVYRRLQREAD
SERAFYDILLKRMKESNIAGDLQTSNVSILDPAMEPRTPIGASRNSQIMKGVMIGLALGIGLAFFLDYLDNTVKSTEDVE
NYLGVTLLGLVERAKQSKENKDANLELLTSEAPKSVFSETIRNIRTGIMLSTTDTPHKSLLITSTKQGEGKSFIAANLAI
AFAQTGKKTLLVDTDFRKPRQHKIFGIDLKPGLSNHFIGEIDYESIIKHVNIPHLNIITCGLIPPNPSELLGSHSMEKFC
DNVRNRFDIIIFDTPPTMTVTDAVVLSRNVDGVVFVIKSGQTPKELTRRALLQYKNSKSDLLGIILNLVDVSKGGYYSYY
YSHYYKYGYGYGAEPPKEKRKREKREKKEINV
>gnl|bykdb|A0A1G2YPI3 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium RBG_13_46_10] (length=755 residues).
METNNEFGQTEIVGHNMIDQQENNGHAGLANSHVGMPLPTQMMSESLVLILWRSRWIVLLTTVAVLAAALIYVTKVTPVY
TSTSRIYVEQSGPKIFAETQEGVMTQSKNYLYTQAELLKSTPILTAVLDTAGIQQMQTFSEVDNHISYLKKTLNATVGKK
DDIISISYDSPYPNEAAQLVNTVIDSYITYHATQKRSTSSEILKILRADKTKRDKELSETLKKLLDFQNDNPDIVLEDSR
GNILIEQLQRWSTLLTEAKLKTIERNSAYESTKEMVSDPVKLQQFIEAQRARGMYIPQDSEKAKIKSRLDELQDRLAGSL
RQMTPGHPVVIAIESDISRSKAQIANLDDEFSQAQLAVSKQESLAAKETEDQIAKYYEDQRKQAVALNQQINKYTLLQSD
WEQTKKDCDILNDRMKELSVTEDVGALNISILEYARPADKPSKPEKAKYMAMALVMGLMLGGGLGLLRDFMDQTLHSAED
ISAVLSMPVLGVVPSMSRRESVTDRGRKTYLDSKSNWAEAYRTIRTAVFFGAPKDEAKTILVTSPMPADGKTTLASNMAI
AMAQAGQRVLILDADFRKPMQHRIFKLNHENRGLSSVLAGAARLEDAIHQTEVKGLDLLACGPEVPNPAEILNSDTFAKL
LERLSNKYDRIVIDSPPVMPVTDAQILAAICDITLLVLRAEKSTRRNCLQAKHGLLSVGAHVLGVVVNDVPKKGHYGYYG
SYGYYYGDDRKKKKTGDRRPDGVVKDSALDAKAID
>gnl|bykdb|A0A1G2YQB7 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium GWF2_42_9] (length=754 residues).
MNSLTKFTENQIIMQKSNMIEPDNESETANLIAIMRKRWKILTVTAIIICGIGLPLIWLLVKPYYLATAAIRVAPVISSI
LFGGEEAIPMYRSYMYTQADLIISDRVLQRVVDDLSDKNIIASDIEKPDPLKSVRNKWSAKKNSDLVLALKNAIASNQLS
VAPEDNTELIKIAVKSSNPTSASKIANAFVQAYMTIVASEEVKDGDHKLTVLENERRVMGEKIERQRKTLNDMAQEFGTI
VLDNRQQMMMNHISRMQEKLTELELERIVLQTKIDLHSSKEEKTITPEMMAKLRHDFINSDLMVQTTASNVANLEQVLIT
AKQQLASTNPELARKESLLSALKQRLEELKEQASKNFDEMATMEFKESDLLEMQSYNDKLNQLSKHEQQLRDMLKSEDSK
TIELGRKQLAMQDVKEQLDSSKQMLETIQKRVGELEMERKRLARISVAYLASTAPYQDRRMQFSIALMMAGCVSGMGLAL
LTNKLDVRLKTPDDMKRIGVRIIGTTTSKEKIKESMWPRQLADDYHAICINLGLMNNCTIPNKLAITSAGPQEGKSTLAV
NLAMNLAKIGKKVLLIDGDLRKPDIAKYLNLDNKGKGMHQLLADFKLRDLLMHADTPGLAVLTAEPCDIAIINKLIHHKN
LVEFINEVSRIFDHVIIDTPPILAAVDALLWSSMVDGVIMTSLAGRTETPDLKESIERLKQININLIGIVLSNVSYNKVY
YRYGHDYYGKPATVKELKQNLPSENTSEKVKQQV
>gnl|bykdb|A0A1G3AQE9 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium RBG_16_64_12] (length=781 residues).
MQEPAVVRDELESESTAHMVHRLVQFAVTVRHRKNVVILALAVAAFLGALSYMTATRYYSASAGVWVLELGSSSAGSVED
NLHQTQLPTQVDIVRSDKVLDAAVRQLRPEDCIDFAGAPKSEWSKKLRDKLSVNALRNKNIITASYRSRDPDAAVSVVSA
VVACYLKFTDSTLKGQAGEVFDVLSQEKNTLGVELSHKEQERLALRQQCGVLRVGPEGEVQHPLVQAAIALSEQLIESQS
RRAKLEASLAAIEAAVHDGEDLEKCILLAAEVVGWEVLRNHLGSSADDGLQAALEKNLVDYRAEWETKRKNLGDNHPELI
ALEDKIRVTEQSLLEYPGRIRQRMQDAGLGPMLIGLVHHKLAEAQWLEATLQEDFQQAQNRAMEIDGQVARLDNLDREVE
RLRRLHDVLCDRINDLDLSREGQQICATLLDEPRVNRTPVSPNLARTVLAVLTLGLGLGLGAVYILDILDDRFRSREEMQ
SVLGVPALAIVQELKMNQNSGIDQLPTYASPNAAEVEAFRTLRTALSLANQETHQLVVSSAEPGDGKTTVLANLAVAIAQ
SGKKTLLIDADLRRPGLTALMAMRGIEGLSSVIRSEEDIVRAAVAHIRPSGLAGLDVLASGPRPSNPAELLSSQRFSELL
AWAESVYDQILIDSPPVLAASDTAVIGRLTSGVVLVVQPAKNRRRAVMRCVENLSVLKIPLLGIVLNRIGSEKEGGYYGY
GYGGYGYGYIYKYGADADSKDESELAEAAAIGKDAAGAQGNGVSRWKEADPPPGLVPRRVA
>gnl|bykdb|A0A1G3B0P0 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium RIFCSPHIGHO2_02_FULL_40_12] (length=752 residues).
MLTESEIQPKQLDIRKYLTTVLRRKWIIIAFLVISGTYSTYKELTKIPYYTASTQVIITQNTPKGLTFQAFSFEGNNSSS
FTTNERILRSRSLAQKVLSTMDYKDSPEFNPVKKANIFSIKELTRGNSSPTVRKPEPGKESQEPETPVKYDVDDALINNY
LSKLTVQMTGNSDIISISFTGTHPETLAKMCNMHAKKFLETHLELRFAASQDAVKWLQDQLVDKKLKVEEAEEALILYKE
KQNIVGLGETAGIIEQKLEGLKSNLTETKIEKVKLKALSDQIKQYSKDPTLTKLIPEIVKDGSINNLKAKYADLQANKTM
LSEKYGEKHPNIANIDLQLKEIENRIKLETLSLITKVETDYNVLLASEESYEKAYNEQSLVVFDLNRKITVYRRLQREAD
SERAFYDILLKRMKESNIAGDLQTSNVSILDPAMEPRTPIGASRNSQIMKGVMIGLALGIGLAFFLDYLDNTVKSTEDVE
NYLGVTLLGLVERAKQSKENKDANLELLTSEAPKSVFSETIRNIRTGIMLSTTDTPHKSLLITSTKQGEGKSFIAANLAI
AFAQTGKKTLLVDTDFRKPRQHKIFGIDLKPGLSNHFIGEIDYESIIKHVNIPHLNIITCGLIPPNPSELLGSHSMEKFC
DNVRNRFDIIIFDTPPTMTVTDAVVLSRNVDGVVFVIKSGQTPKELTRRALLQYKNSKSDLLGIILNLVDVSKGGYYSYY
YSHYYKYGYGYGAEPPKEKRKREKREKKEINV
>gnl|bykdb|A0A1I3DDV4 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomicrobium piriforme] (length=802 residues).
MSDMPQKPDSQMPVKPMMDTRPMLDPNATGSFDVVEIFRRQLPLIACCTVLGLLMAVIYWANAEKWYESSAKMLVTLKDM
RASDKGESSWAADGVQDEILANHMEIVSSRRIIGNALQRVNAEEMPGIKAHTDSKTDAVDYVSEHISLTKGGQGSARDAR
SLNIAFRHTNPDEALLILQALVAEYESFLDEQVSRIMSEANRLITQAQGKIESDLKSLEEQYVQARQSAPIIYVGNESSN
VYLDTFRRLQDELVTVDIERSAVATRLQNVLTSLDQIKQNKGNSLEMLALIDSESLTRLGTFGSFSSAQTQDFQENQATR
LKEAETKFGKLIELQAEMSRLNGLFGPNHPTVENLRKNIEIVEGLLKESQAKTQNNPLFEKLTPELLLNAYTGFLRHDLS
ALDQRKRELLTLAAEAEKNSKSLIEFELKDKMIQAEMTRKQTLYDSIVEQLREMDTAAGLSGYIHEVLEEPQAGEEVWPA
LNICVAGGMFLGLCLGVLVAICNDQFDNRFRTPSEIDSALGVPVIAQVGKITRSRDKRKKGRMIVDAQAPEAESFRLLRT
YLLREVKAGNLRTAMITSSQAKDGKSTILANLGASFAELGLKVLIIDGDMRAPTIHRFLNMPIDRGLSETLQGKTKLDEV
IRPTGIEGLSVMTAGSAVRNPAELLQSEVFDQVLEDCKSRFDMVLVDSGPVLLVSDPAIVSQKCDIAMLVVRPAIDTKRK
VFESIRRLTSSKSNLRGCILNTYGSSKEFTRDSGYYSSYNYYGYGYGYGYGNRGYGRRVKDNGSAETENGHSLAGSTPAG
RK
>gnl|bykdb|A0A1N6DAJ8 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Singulisphaera sp. GP187] (length=742 residues).
MMSNSNSGPRSDSANLPAVVPPYRTAEVFSIAPAPVGTAAGLDPIALLKALRRRWPLAVGAGLLGGVVLAVVTYFVVPPA
KYTARSMLHVNSTQPRILLKVGENESDYVAYQRTQLALLKSRLVLSTALKDPEVAKLEVIAKVVDPIEWLEKELQVDFAS
GSEILRISINGEKPQVPMLLVNAITQAYIDEIVDVETKQRRQRYDLLKETWNRYQENLREKRKELKRLTELAGSDDKKTI
ANIHQHELDRLGRAEDELARVQSELRSLRIEHEVSQEKVTQTASMITPVMIEDAISRDRSIELLKARESAAIKAIERVYH
IARNRSDPSLKKYRDELEAARAELVAQRRKLYPIIQQQLQDMGRDDDDSSEALLPHRISILAKLETLLASDVKRLSERSA
SITQNSVDLFSVQEEIANADEIARTIGKEVEALTVELQAPPRIRLLEKAELPRTKDEIRQIKMAGMAGCGAFALALVGVS
FWEFRSRRVDSAADVIKSLGMNLFGTLPSLPQRSRGFRSGEAENVRWKSMLVESVDAARTTLLHVSRTESVRVVMVASAL
SGEGKTSLSSHLATSLARAGRRTLLIDGDMRRPSAHELFDQPCVPGLSEVLRDEVDVADAIQPTAAGGLWLLPAGLCDSD
SIQALACRDLRAMFDQLKEQYDFIVVDSSPVLPVADAMLIGQHVDAVLFSIMRDVSRIPKVQEAYERLAKLGIRMLGAIV
TGEKSDHYGSKYEYSARTRESV
>gnl|bykdb|A0A1N6KFT7 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Singulisphaera sp. GP187] (length=914 residues).
MAIQQSITGPGSEGPPSRTLQNDLVALWDVLKRGWKFVSLGLLVGLTLASIYLAKTKRIYQASTSLLVIQHGGRPLNVSA
YTDPNRISEGSEDPVPTHMVLIRSPLVIQAAVDSLGSNTPTSLAQSSDPVGFARGNLKVSRPDRLTKIIVLQYQSASTQE
SLQMIHAIVASYKKLLETNYQKNNQEVITLVSRARDDLKKELDLLQAEYHKFRKDNPGFAIGSNGQTLTMRKLEQWSQGI
NNTTDLMIQLKTQLELIKKMESSGSQGNAISLALSQFPTMTPGGSNGQIPQSSGTAGSYEQLQKELAEVKLKRSITQRMV
DNLKAGRPNSEATVSEDDVAGSFKLDPNVAELYRDLKRAQLRYDTAKRATRNTNDPSLKYARERKVELESEIEDLWRQRR
PLLLRQLTREMANEGDLALQKAEAELTSLAAEEASLYETLKESKEKSIEGLKTRHETLVKTLGADAPESIEAKSQVDRAT
EQLGGLGKDGLQSELHDRMASIEHSLKSIGSMREEYETKLKEDLVAAKQSELGLLEEERLHGNLDRQKALYNTVLDQLKQ
AQLVSDYSSISCQVIEPPSALPYPVQPRVKMTLLMGLMTGLFLGIGLAYLADRLDPRIRTLDEVRKVLEFRLIGTIPKLL
VDQLTLMGEVGLVSHAMPRSVWAEAYRSVRTSLEFLRRSRQVQLILVTSAHSGDGKTTTASNLAISFAMAGRKVLLVDGD
LRKPAQHKIFRLKGDQGLSHILRRLLPLSRVVQQTQIENLDFIASGSDVDNPAELLASSALTDFVAEIRNLYDMVVFDSS
PLLAVTDPSILSAVVDGVVLVVRPEATKRHDAERTVELLKTMESPVLGFIVNGIDRQNASGYGQGYGYGYGYGYGTYGRG
DDGLDQITPSTKEITTSVSSSESTNGLPQPLLKD
>gnl|bykdb|A0A1P8WN28 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Fuerstia marisgermanicae] (length=757 residues).
MDPYTLEQLDSTEPQGFHALLRFLRVVNRHRMILVGLVAAAAFLAVVRHKQIPKQYESTARLMVRQVSADPKSQSNSATE
GLLASYRQLLLSDRVLTDTVKELKSLPPELAAEPDRTVWPIRLREMLVVTFETDEYVLEIKCRSTSPESTVNVIEGLSVA
SGKFMDEYQKDLSVELMKQLERKGETVLKGLLAKENELLEARQNCGDIALSKESEDSHPLVQRVSHLNENLTTVQSRRLQ
LEATLVSARELVATNSDLTSALKKLEEIVGEDVLERIPGAGATDPKAIEELRAKVALLETELNGLRRHFGSGHSDIIRRE
QQLVGQKQRLANMQLQLGENVNVGVRDPQVGQWLIKQIEAEVQATRQYEQSLKHEYSVVEADALELSGKLAGIQVAEREV
ETLRELHSSLLKRLNSINPDHGSGAFKVAPLSDPRIPKFAVYPVLTNTLVMFCVAAVALALGVIYVIDLMDDRLRSPEEV
RDELGLNVLGIIRKLPQHEVDQARIYVNDFPQTTHAECFRTLKTSITLSPMDTKCIAITSTEASEGKTTTTVNLAASYAQ
TGQRTLLIDADMRRPGLSRLLEIRGNGGLSEVLRADSDIPQMCKERVVQTEVPLLEVLPCGPRILNAGMLLSMPALADIL
DWAVSEYDQVIVDCPPTLPVSDAAIVGRYVDSMLFLMNPDKTHRRSVARAVDQLRSMGLKIVGIVANTSLSEDTSSYGYQ
YGYGYGNDYGYGHDDEEDDLDSVDFPPPPSSDLGKVA
>gnl|bykdb|A0A1P8WP26 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Fuerstia marisgermanicae] (length=775 residues).
MTTSQRQVNTVGAGGQDALAMTLHAIARFLRTVRHRSGILLLCLVVSGALGTLYYVTAPRIYQSKASLFVVQIGSGVTQD
SVQGASDPSRSMPTFRRLMADDEVMRRALERLPERFKQHFSELTEAEAVAEMQKSLSVSSDFGTNVLDVSYRSTDAKVAA
AVVAHVLVAYNSFMNDVNRGSSDKNIERLEAQFAEVTKELQELQAYRDELTKRSPDFVGVGDGESVVNLSVANMKHLLAR
LSEAQQEAANAQATLETLRQAVANGEDVLQYASELGEQVLAEVMGVSGQSVFQTTQITQDLFDLEAQLQTAMKSYGAKHP
TIIDLQNQIATKRNFMTQNPAMRMQAAEENSRGYLGPKLIEKTEQRLRMARQQVAQIGQDIRAEKTQAMELSMTLREIQD
INREIERRHEYRASLTDKMDLIDLTGDTFIRTEISSPPRVNQLPVSPRPVIVGFLSIFFGTAGGLGIIWVLDIMDDRFRA
PEELKLQLDTQILTMVPALEQFSGEGFNSVLCHVKPNSTEAESFRGLRTNLEFAGGDTGRIVCTSTEPGDGKTTISSNMA
VAFAQSGRRTLIIDADMRRPGLSTLLDLRDDKGLSVILRSTDEFDEAVQGNLRATAVDGLDVISCGPRPVNPAELLSSER
FANLLAWAETRYDQIIVDAPPVLAVSDPLIIARLVDGVVLVVRPDKDRRRMVIRAAEALHNVGSNLLGVVVNHLSGSEAE
GYGYGYGYGYGYEENDTHPTDERRQPSHNQADVAVSLSMIGSGPEPEDSADKKAA
>gnl|bykdb|A0A1U7CZ81 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Paludisphaera borealis] (length=800 residues).
MDTTDSNDSLLPARLPSSSSSHLPAMSAANRHAYDLTTVSSSVQISPQGVLRGLARNWWRILLLWAVVSAPLDYLIYSQI
QPTYEAVSTIRAEPTQLSLYGQQNSNAQAQPIERFIGTQIAFITTNTVLKPAIGDSTVAELPFIKNSTDKLTDLRQKLKV
KNKDGTVHIQVSFDSTDAHEAAAIVNAVVASYLRSYKDVQQSRDESHLKRLTVYLDRLKKDKEEKVEALKEIVERGNVNG
QSAGESKPKESTKTQGSDPAPQTKDASIEKFSIEQYRNFKADILKKKLELNELEFALQKRVADSQEQDSEVAETTGFQKS
QLEARINETFRRDPSVASLIQQILETDEELAHTVGVARKGYDPARQAAEKRKAQLMAKYNSLWDERYGEIRQLVMAEDAS
FAASAAAAGSGTVATNALTIEALRARVELSRHQLDTLNQLVLSMEIERKATQSDTYAAERLKADIETLVEQYKHISEKFE
NLKFAGTTDVDVGLIDAAIAVSEPTNNKRIKYVVIVPSVILCLVLGLFALLEVKAERVADPDALSTRVQSEVFSLPPLPM
VRASNKLNGPAEDDQIDRFIQRLDHLRFAVCGDHPEVGLGRCVLITSAIGGEGKTTLAAQLAARCGHAGHSTLLIDADLR
RGSLCSLLDIPEGLGLSDVLKEEANVEDVAIPVQGGTFHLLCAGTPVADTSRLFQGRNFGMMIARLRQMYDLIIIDSPPV
LPVPDGLIMGRWTDGAVLASRYDISRAPQVERARRQLTNAGIPVLGTVINGMKSSDAYYGRYSYSRGRSGYGEPDASPTT
>gnl|bykdb|A0A1U7GLS6 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetales bacterium 71-10] (length=795 residues).
MDTSDRPDSMLPARPTPPAPPVPSRGPASFGGGPRDLVPTSAAPALQVDPVSILRGLLRNWWKILGLWLILSAPLAYLVY
SQVKPKYMAYSRIMVQLTQPDLFGGIAPGQANERTVAIETEMGRIRTDRVINDALGDATVSELPFIKNSMAPQADLLERL
VVTNQKNTNYVVVSLELNDPEEAALIVNAVVAAYLRNYKDYKAGADKILRANLKTYLDEKQKERKQKEKDLAALVDSGVD
ARNVAQREPAPDRQGEDPATTLQDVSMEELRTIKAQLLDVQIELMTAKSRLQSRTQDYQDLGQIEPTAAETATLPEEEVA
RRIEAEFRSDPMIADLYGQKQEVERRRDHVQKGARKVADPSRVAHDARLAELQAEIEGHWRDRYHDIRRRVLAAGDGPMA
ASGPGEPRQKTVQELKDEVSELESRQASLQKVLDEVKLESKESNSATYQAQFLQNEIRVMVDDERVVNRKLQELEFSTNK
DMVRVEQHDPAVPPKRPSDDKRLKLMAAVPVGVLAVLIGLFSLLEIKAERVGNPDALSTRVQSEVYSLPPIPMARSPRRL
GAPGEDDQIDRFIQRLDHLRFAVCGDHPDVGLGRCVLISSAVGGEGKTTLAAQLAARCGHSGHATLLIDADVRRGALSPL
LDVPEGAGLSDALMNDGLNVEELAIPVQGGTFHLLSAGTPTSDTSRLFQGRAFGMLIARLRQLYDLIIIDSPPILPVPDA
LIMGRWTDGVVLASRFDVSRAPQVERARRQLDLAGIPVLGTVINGMRTSDSYYGRYTYSRQQSDRERPAGATPAD
>gnl|bykdb|A0A1U9NL64 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Anaerohalosphaera lusitana] (length=725 residues).
MNESFKTPQVNSSHEEANGDFEGREEGFQRSLFEVAWANRWLILATTILSLTAAFIYLAKATPIFTSSSRVYVEQSGPKI
LDETQGVMTQSKNYLYTQAELMKSTPIIKEAIEENDMASMRTFDEIDNPTGYLKKQLQVSVGKKDDILSVSFDSPYPAEA
AHVVNEIIDSYITYHSQRKRSTSAEVLKILQKEKTKRAKELEENLHAMMNFKRENEGLAFENNGNNIILDRLANLSQAVT
DAQLALIEAKSEYDTVKAMVSDPKKVKQFVEAKRVSGLYVSSGTENTRLKAELDRLELRLADLKRQVTEDHPSVIALEEK
IASIETDLEESDQEFASAQLAVARERHMAAKKQLDEVSTFFEEQRAAAMDLNDQLAQYTILESEYQQSKKLNDILDERIK
ELNITEDVGALNISILEVARAPKDPSKPQKARVAAMALVLGLMAGGGLALLRDFMDKRIRGAEEITALLGLPVLGVIPLM
SKRKSMAERGRRVALNPSSPVSEAYRTVRTAVFFGVPKESCKTILVTSPQPAEGKSTLISNLGITMAQAGQKTLIVDADF
RRPKQHEVFEFDREPGISNILAGESQIDSVIKNTSIDGLDVLACGPSIPNASELLNSDEFGELLSSLKAKYDRILLDAPP
VMPVADARILAAMCDVTLLVLRADSSTRNVSVAACEALAGVGARPLGVVVTAPGKKMSKYGYGYGYGYGYGYSYEEDDKS
SAKSA
>gnl|bykdb|A0A1U9NNE1 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Anaerohalosphaera lusitana] (length=739 residues).
MNQIDKYYESYLGSYAQEGTKQESENTLTLFKIIKALLRRWYIVLLTVVVLCAIGIPAIFYMFKPSYETVGAIRVSPILP
NVLFDDAETQDVMPNYQGFMNTQAELMSSNEILNRVAEDMAKRGIRICEPDMDPVAILKLMINKETILIEPGEKTELINI
KMKTNNTAFSEELVDSFIRVYMTMQAYEENQGEDNKLALLENKRASTAKQMQQQRKIIRQLAEEFGTTSLTGRQEMMLEQ
VMKLQNELTTLETKRIALEANVQMKVNGDKVLLAPTDRMKLKYEFINADLTIKALTEDMAKLERDVLGDQQTMVSGNPRL
EQRKEILTALKTRLDQRREDIGKKFEELIEEQINRSSEFQVAELKAELAKVRENERRIREKLEGTNAELITLGKRHLAIK
DHQEQLELTKELYDAINRKIQKIEMESQRPARVSVAYYASSVIAKDKRQKLAIVAVLGSICCGGFLGVMIDRSDKRMRTP
TDLNKSLSTRIIGTTVCPTEVKRSELSERLADDYRTIRANISMLEEENQHILAVTSSQPKDGKTTFSINFAASLAQNDRK
VLLIDGDLRKPDIARILNLPEGTTGLSDVLEGKPFANALWYAPSAGFDVLGNYDRCLKACDRLSRPEVQSNIRNLCRYYD
HVVIDTPPVLAFPDALLWARIADATILASFAGKTAADDLKEAYGRLHELNITVLGTVLNGVHTAHSYNKYGYRYYKASSS
PADKNGPTRNRPLLLTSGN
>gnl|bykdb|A0A1V5N3W2 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium ADurb.Bin412] (length=773 residues).
MDSVVKYKPQPHPQEFVYTDVPPEAAPAAPLGLFRALRRRWYIVFLVFVLLAGAGLPAVWFLVKPKYQAAAAIRVAPIIP
SILFSDKDSEGVIPMYESFMNTQADIIVSDQVIQRVADELADKKLALFEDPDPIARYLTKDSKPLNPVVAIRQAIRDGII
AVVPGRKTELIKITMDSLNPKEAELVVDAFVRAYMNIEGSRSMEGGNKNLEVLESERKAIQDKIQRQQETIRKMGEEYGT
IALTGRQDMMLARVSDLRQQLTQIESKKLALQSLVQLSEQTKDKTIVPEKLLERRYDFINSDPTLQMLTQRVAQLEETLV
MAQQTLAPTNPEIEQQTKTLEAFKERTQKQREDLEKTFDEMVAKELTENSQLQLDKAKAELEQIIVQENILRDTLTKENA
DTIDLGRKQLAIQEQQDQLALNQELYETIRRRIQELEVERKRPARISVAYNASSLPLPSKRIKLMGAALFGALAAGIFLA
FVRDKADKNLYTPEDLARTVGVAVVGTTSQLNYRDKIGLRQQLVSDYQTIRSNLRLLSDGEIPKILVVTSPASGDGKTTL
AINLSLSLAQTGQKVLLIDGDLRKPDIAHFLKLPENYWGLQDVLLGLRRWEEAVYTLPEAGVQVLTADHRNNGQAIDQLA
RPETAEIIRTISQNYDHVIIDTPPVLAIPDALLWSKMADAVVLSSLAGHSNLTDFQETFHRLSQLHVRILGNVLANVAAR
HSYNRYGYGYGYGYGHKHNPPDGKQIDMKQLMLLLRPDEKKKDTSPSEESSKN
>gnl|bykdb|A0A1Z8N7H5 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetaceae bacterium TMED10] (length=814 residues).
MHLIDLLILGLALRRESRVSNEEGSLMSVETDNETYDAPLTNAAGAIHDGFQFLKVVWYRKNSMIMVGFILAIIAGWYAA
TATRYYQSSASILIVRNGMSQEDSALGINRNSQHLMPTHQQLIVSQPVLENAIQYISPECLSEFQGQQRESWHRQLAGKI
STRVVKSTTVLNISYTSTKPQNAVAIVTAVIKSYLQFVDETHKGTAAKIINVMTQEKDDIGRQLMEEETKLADARVASGD
FSISAESNIVHPVVQSVITLNEAFLDAKKDSLIQQSLVEGIQRAIVRGEDLKQYAMAVEETIGKELLIKGLGFNTENIQV
RNQLEQGLLADISSLKSLSSDFGPAHPRIIEIQNRIQTTKQYIEYHDAELKTQLDELESNQLGPLLLQMAQQGLDKARQK
ESILQASLDEARFXAVAHQRDTSHITMLAQNVSRLRRLHDAIIDQIAGVDLRQGHGEIQATIIKDATASGQIVSPKISRI
IVCWILGTLGIGFVLVYVQDTIDDRFRTPEELSKRVGQPLIGLVRALPELSGEGLKKVSAFSDPVSVFVESFRTLRTSLT
LSGVDSTRIAFTSSEPGDGKTTVIANLAVVCAQSGKKTLLIDGDLRRPGLTRLLDLKSKPGLSDLLNADDEVSGMISDYL
APTDAPNLDVLPAGPRRQNPSELLASDRLAQIFAWAETKYDQILVDCPPTLVASDAVLVGRIVDGMVLIVRPDKNRRKLV
XRAXQNLTEMKIPLFGLVANGVGAENNKGYSFGEGEGYGYGYGYGDDENNDEDEGEIEQQGNRDSYQGISFQSKTFDQSE
NXQEKLPAKFRKTA
>gnl|bykdb|A0A225EH48 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Fimbriiglobus ruber] (length=743 residues).
MQRSSASEAQMPIPLTPAQPSGQQYASGFQPSVPGQTLAPTAAARAWPTLPELVNALKRRLVLATFLGMLVGMAAAAAVW
LALPSGKHTAMALIQLKPIVSAGKQSMGEDFESFKQTQMRLLKTRMLLDRVVSNPNVSRLPDIKGTDDPVTFLEDRIKLR
WGSPEILEVSMNGDDPKQILLIVNTMVDEYIKDADSDERQGRQRRRKIIEAHLETLNRLIKSREDRLKDWVKLGQAPGEQ
ASVLKMKLLTDEVSKFNSTVSSLSLEIVSHETNLITLQHKQSVIDMQEVSLDELEKAVAKNEKVAPKVEARNIAIAQFEK
LKTAVKEDSPLYAREKDHLAKLEEDLRTTLEEFRSKVEADIRAALKREIKSDIEREKQFVTYKTTLTKKLGEEIKRLEKE
LELARGANVQGIIDLGDLGPLKEQRAAMEKERLDLDLLDRSDSRIQLRQPAVVSQLLNIQKKILCGIAAFFAGFLLIALA
VAFLEWRSRRVDSVDQVVNELGLRVIGTIPAFPSKSSLRSGDAGQAQNWRFVLNESVNSARTMLLHTAKTQNMQVLMVTS
AMQGEGKTSLASQLATSMATAGLRTLVLDCDLRNPSLHKLFDSPLTPGCAEVLLQEVDVSDAVQPTTVPNLWLIPAGQCS
NRVIAALAQGHPLETLFNRLRGQFDFIVVDSCPVLPVADALLVGQHVDGVVISILQDISQLPKVLTASEKLTQLNIPLLG
AVVNGIKPDIHAYGYNYVKQLPA
>gnl|bykdb|A0A255R1S0 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Rhodopirellula sp. MGV] (length=819 residues).
MSSHSDEAQSDGMEFDIDVVGILRRRYHLIALGLLVGATLATIFYVKQKPVYQSSLAVLVGQRSSQLATTGVREASDNAV
TIQDKILSTHIALMTSPKVLGQAADEHDLGKSAGEIAGKLSVGKDGEASILRATYQDGNPEVAAKVLEAVFETYFDYVET
RSQSVGSEAAELIANAQAKNEEELRAADKAYRDFVASVPALVLSGGNIQRDRLTAIEAELNTIRRTIAEIETRRQKISSS
VKGQRPEELTDAQLATLLSKEDISRLQMFMDFAEGRSKVEEKALTEEERMALALERQAQQEEFRRLMALTTRRDVMRATF
GDSHPSVRSLDSEIVNLRKYVDNFRAGSEKDAGEEIVETVEAGRVFDVPPSEILKTYYSVLKGDIAGLKKREEELVAQSE
QEAKVAKEVELSMLEGTSLKANLERAQARYDEVFKRLQELNLTNDYSGFATDLLVQPVPARFPIWPSKSKIAMAGLMAGG
MLGLALAVLAELIDRTFKNPGEVEKAAGASIIAHLPQMVESKLAKQAKVGSKISPMITTFHQPRGIDAETFRVLRTTLLF
MAKRQSKKIFMITSPSPADGKSTTIANLAVSMAQTGKRVLLVDADMRRPTIASRFGVERGPGLSDYLHGDATLMECLHHT
EQENLVICPSGSRTSSPSELLESDRFLEFIENVREGCDLVFFDAPPVLAVADPAIIALHVDCVLMGVRIEKNNRTLVERA
ADILREQSTPAEAVIVNGRASRRGYGYTGYNYYSKKEYGYVSTYRRYYEADADGQDEDRPIRSARAATSSRVVNGKVNGH
AKHASDVAEAAHPVTLDRK
>gnl|bykdb|A0A257WS34 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetales bacterium 12-60-4] (length=750 residues).
MQQAHHSTVLSELMRFLHIVRLQMWTLILTVAVTGILGGIYYMTADRVYDSSADVLVLQTNGNALDGKDNNQQSIQNLMP
TYQKVLLSDAVIEGAIKGLPSKHRHVLRKVPRARWADTLRSGLSVSAARQTNVMTLRYRSTDPELSAYIVSSVLNSYLKF
MQATHRHSSRETLDVLTREKRDLESQLTQKEQQLHGLKSQVGLLLSGNGTSESGTHIAADRARQLNLTLTTAVEQTAEAR
AFYEAVAYAVRSGGDIQQFITQVADVVGSQVLLRELGMGSQDGFILARFEQQLQEYQAQLQSLLAKLGPAHPEVQALEER
IAATQNYIVNRNVIVTERLKEMRSNELAPRLLQMAQQRLLQAQARENSLRLQFDQAHAAALAMNSQLAELERIESDVKRM
RTYYDHVLDRIKDIDLGADDGLRIRVVSEPRVNEQPVSPKLSTTGILCLFLGTTLGLGVIYLRDAIDDRFKSPDELQAQL
GLPVLAMIRQMPQPEGEGIQQVLTFVKPSAAEAECFRTLRSAISFCAGDTHRLCVTSTEPGDGKTTTLANLAVAFAQAGK
KTLLIDADLRRPGMTQLLGLKGQQGLSHVLRDSRPVQESCLDNIFHLGQENLDVMPSGARPINPSELLSTERFSDVIAWA
ETIYDQILIDAPPILAVADPAIIGRMVDAALVIIRPDKNRRRMVVRAVKSFIGAGVQVVGIAANHLANSPSQDYGYGYGY
GYGYGYGHDDAIEDPALAAMEDDDGYRIAA
>gnl|bykdb|A0A286RD13 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Thermogutta terrifontis] (length=765 residues).
MSDLVRVLGTSPPSTLASGNSVAPTPLQRETLHGPPKPSDVLHAVRRRWWLILIMGVLASAGVMVFAWRTIPVEYTATAW
LQVSLERPRVLFDTKDDDPLLRNRQTQTTLVTSNRVLTAALQRPGISQLPYIRNQVDPIMWLRRNLRVRFADQAEILEIS
MTGGDPEQIAAIVNAVKDAYMSEVGDVSRNYALERKKLLEANYAQTLELVKKRDQRYRELANAVGSADSEVARKKALTAL
ETLADHRKHVNELRQQISGLERRIAILQSRLRYMEEHRPQTSEEERRQRDEAVIQQIVENALRADPWIAAAQARLSYLET
RWFEERQRAAQGEKAPSAQRIQEEMETLRKGLEQRRAELTPQLVEFAREQLAKGRAVAPPTETEQIQAEIAQAELEKAVL
EDELKVALEQFEKEAAEAEQLGKYSADLEAERAEVERLKAIAARMGDELERWNIELAAPPRVRVLEEASTPRISNINDKY
RLVSFLGLMAFLGTGAAVVLLDFFLRPVSSAYQISYGLGLPVLGDLPLIERPIMRWMSRNGHMPETMRSVLIESVDQLRT
ILLHRAERQGLKVVLVTSALAREGKTTLVAQLATSLARAGRRVVVVDGDLRRPRLHRLFRCPLSPGLSELAKNLARPEEI
VRNAEIENLYVVTAGHCDGEVLEAVSQGKLDRFLQSLRDQCDLVLVDSSPILTTADALILAHVADSVVLSVIQDKSRLPR
VFEAVQRLRSVDLPLLGIVLHGTAPSRYRSYYRSYTIDVESRAAE
>gnl|bykdb|A0A286RGB6 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Thermogutta terrifontis] (length=762 residues).
MTPEREAGMSEHQHLPAPVGQDRTGAARPSAPAPLYLDAEWQPIPAAEAGQGFGAYLHAFRRRWLAVAFLGMLCGAAAAA
AAWFLFIPQYTATALIRVSSSVQSVLFPTQQGAGPSFDIYKATQLEYLRSRFVLVAALRQPEVARLPSIREQIDPVQWVS
EHLSVRFPGNSEFMNVSFTSTRPDETAVIVNAIVDAYMREVVDTEQRERRQRLSELDQLYSEKEADVRKLENDLKSLSQQ
LETGDSQALSLKQQITLQQFSTYRNELINVQLRMLRLQGELSIKKAIRDKAAQIPVTDREIEAAARTDPVILQLQLRESE
LKNLVAQTRDVLRPEIAARYGNRYVQELADVQSRIKARREEIRQELEQRRVRDLDEEIENLNFELSILAQQQDQLQKEVE
NVRRSAETFGKGSIEVEFLRAEVELARKTLQTIAEERNRLAIELRAKPRITVVQRAEVPRVADSDRRIQLAIMGGLAGFI
LPGAVLLWWDVRRKPVNTAHELPHAVGVDVWGTIPLVPTRALQMLPEENGRSRRYQRWRALFSESVRKVAARIIRESEHE
RLQVIMVTSAVPGEGKTTLASQLAASLAQMGQKTVILDFDLRRPSLHEVFNLPISPGVSEVLRAEISLKDVVRPTELENL
FVVTAGYWSPHRMAVLANGVIGGLFRQLREDFDFVIVDGSPVLPVADTRFISTHTDGVVLSVVRDISRAPQLRAARQVLE
SFHVRVLGAVMTGSAEDVYYAYPYHSPIVEGDSQRQEAPERG
>gnl|bykdb|A0A286RLF2 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Thermogutta terrifontis] (length=760 residues).
MNESSWIQWAVPDSASHILHAIAQFLVAVRRRWQIMLGAFLAVALLGALYYATAPRIYSAKAELLILQTGDNALSPTIEA
QGSRENSLIPTFVNLITSAKVLEGAIQKLSREDLAVDLNMDKPETWVEGLRRNLAASAVYRTNIITVEYRSKDPGVAARI
VGAVVQSYLDFMRSTTQGTTAEIIRILTTEKDDIAARLSEKEQALQQLSQQIGALDVGVNSQTVHPLVERAKAFNQALVE
VQKERVQLAASLQALENAVQQGADIRQYLFAADDTLGQQILLGVLGFSREETAARLEVERKVVEDRVELARLLQEFGNNH
PRVQALQQRIAANEAFLLAYQDRLRARLDNLNIPELSQMLLGTLRQRVNELWQKEMSLQAQYELARQEAANLAGGLAQLE
MLKNDITGLRELYGGLVRRITSLDLAGDLRASVITEPRENRSPVSPSLPRVLIMVILGGLTLGMFVVYVMDVLDDRFRSV
EEIQWQLRAPVLSIIREMPPREGEGVEVLEVVADPNSPASESFRTLRTALALSDRPTGAVVVTSTQPGDGKSTVSANLAL
TYAHVGKRTLLVDGDLRRPGLTQLLGLRGEPGISEVLRDTAPIAEAIQARLKKNIVPDLDVLPCGRRPANPAELLAGPRT
AELLNWAVEHYDQVIIDSPPAPLASDTAIWGRLADGVILVLQPEKNKRRAVIRAAEYLALLKIPLLGIVINRLSNEKEKD
YSGYSGDYYGQPDESHEEKEVPEITESISTPERTVPRRVA
>gnl|bykdb|A0A286U4B3 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Candiadtus Scalindua japonica] (length=735 residues).
MNNDSFLNQTQDPSNYYSGKTSSLDEIHLRDYFRVVMHRKWVIVAIFTITVLLVTLYTFKQKPIFQAVTTIRIFKEAPKV
LSFEEVMSTEGGRTDFYKTECEVLKSLTLAKRVVDSLRLDLDPEFIGNSKALDGSVNKSVSMDRLARQLLGRTEILSVRN
SQLVKIKVSTGYPELCKKIADTIADEYIKKNLEDKVLTTSGATDEIVEQLKEIKIKIEDSEKKLYKYARENDIVAMDASQ
SIILKELTTISDELTRAEAERIGKEIRFLAVQNSDDLSSLPGIADNKLINELKLEYTRLNAKYASELGRVKEDHPLVQRL
KTEKSLIEQEIKDEQGWLGKAIKAEYQEAVGKEKGLRQHLEELKRENNRLEGKSISYKVLKREVDANTQLYEGLLQRMKQ
ATVSSQIKTTNVQIVDRAALPTRPVKPKKRLNVFLSMVVGLVMGTGIAFFLEYLDNTIKSADDVEKHLNATVLGVLEKVE
VERDEVENFDTILHELPKSTFAEAVRNVRTGIMLSSADNPKRIMLVTSTTPSEGKTFVASNLAIVIAKTGKKTLIVDCDF
RKPRVHKAFNIQMMPGLTNHILGDNDLDSIIKHTAIPNISVITCGLIPPNPSEMLGSHSMEKFCKEIMDRFDTVILDTPP
AMAVTDTIVLSNMVDGIIYVIKSGKISKESARRSLHQFAGKKAEVLGVVINSVDAARGDFYGYGYGYGYGVEEKGKKGII
ERMKWTKGKEKVENT
>gnl|bykdb|A0A2A2W9R6 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Rhodopirellula sp. SM50] (length=807 residues).
MKRYQDETLEADDAAELSIDLLGIVRRRFHLIMLGVLVSVTGATVYFVQQKPVYESKLAVLVGQLSSEMASTGVRGTSDG
AVTMQDEILSTHIELFGSPKVLQQAIDRAKLNRSVGQLRGGLSISKGGQGAGASASILRATYRDSDPETAAKVLQAIFDS
YQLYIDGQSRDVGAEAVELIAKAQVQNEIALQKADQEYRDFVASVPALLNVSGSGVGSLEDIHRTRLKSIEVELATVRAA
LASARSRRLVIADAVKGKRADELTDAGVMALLTEEDIARLETLVSIAKERKGGDSGMDIARIVANTSSTSKVNRLMELLS
QRQVMRASYGAGHPSVVALDTEIASIEKFTPQEGDESSEKKESEFDVPPAEILATYYTVLKSDISEFAKRESELLALSEQ
ESKLAKEVELSFLKGTAFKANLDRAQARYDEVFKRLQELNLTNDYSGFSTDLLVMPAPANFPVWPSKSKIAIMGVMGGIM
LGLGLAMLAELADRTFRNPGEVESVVGAPILAHMPMLRESRLQKQAIKDSEISPMVAAFHVPRATDAETFRFVRTSLLFL
AKKQSKQVFLVTSPSPSDGKSTTIANLAVSMAQAGKRVLLVDADLRRPMVAKTFGIERSPGLSDYLNHVVCFSESLHECE
QINLTLCPAGSRTSAPSELLESESIAEFIANARQSFDMVFIDSPPLLAVTDPAIIALHVDGCLLTVRIEKNNRTLVERAA
EILRDQRVPIDGVIVNGRDSRRRSYGYSSYNYYGKGEYGYVDSYRQYYESEEEDSSPTSKRSQKRINGEAAKLNGRSARD
RLISGKR
>gnl|bykdb|A0A2D5AWU0 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium] (length=720 residues).
MSEIRIPQIEQSSSGGGESVDAGRLFQALWRGKWYFLLFPAIAGGGMYYFLHGQKNLYRSTAQVQVAPREVDPLNGNAGS
TGKARTLLKQQQILVKSPAILKPLSESKALRGLKSFSREIIGSKPMITELNDRIGTVVDPNTDRLSIAYLSPFPDEAAKI
ARATVEEYIAYHKRKKRESAEESAAIIRGELGSILKVRDDLTEKIIRLRTENNITQGGETLIQARLTQTRELWTDAHFDM
LRERATFELFSRAEADAEKFLDLGRNRRSTKQNPNLEPELQEIEKDLLEKELQLQRRERDQGDLLLAELRDEVAVLKERK
RDILLQYARNYKIDAEIAYNEAKNRETSLDLDVTSLQEELGKTNRALQQIDNYESEFDSIRDFSEHLKSRLNELDVENQT
GALNILVIDYGRPSNTPASPDRVSMMAYALAGGVGLAFAIVMLRSFSDKKMRIIGELPHVLNVNVVGVMPRLKGPRSRAR
TGRIVEEQPGSSAAEAIRNLRTATTFALPKDSHGVVLVTSSVSGEGKSVTASNLAFALATGGRRTLLIDGDLRMPSLHEI
YGVENLAGLGQVMTRSITTDKVIVQNVAAGLDLMPAGDPFGKPAELFESGLFPKLLDFLRKKYDCIVVDSPPILESSESR
VMASEVDLCIFVTRLCVSTSPNAIRALGILRGVDARVVGTFVNDDSAKKTNAYAGGIAYGAFRKVEALEAPLPPRSDAGV
>gnl|bykdb|A0A2D5NDU9 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium] (length=746 residues).
MSFGQVLAMLWRGRWTILATTLVVTLAAFIYGEVTGSRWRAESRLFINAGVNAKAGPEVMALGFGATNYAQTQAEVIVSG
EILRSALTRFHEEFPDSEINKDETITVPWLKYHLRAEVGSDNDVITLTLDNRHKHEACALVNEVVEAYQKFQRKMQRNSA
TELYRILDMDRKRYEVEYDTALRALDEYCKKHPAMRLDMQGARASVEEHGRVRKLIHDVDQRLLTARTEAATAADFVDNP
KLLAQLNLGATETGKPLISPPEELSTPSAEAAILAQVEKLGNQRVELLVELQPEHWRVAALDRDIAALNSQLSKMRSVDA
ENLESYAATLLAALDRRVASIQAERQVLLPLLADAEREVLAVSEHELEYNQLNSRAERTKQTLDNAYAQLQRINIDPDSG
KTVAHVLDYAEPNEAKLASGQPIRLPTGILLGLLAGIALAWFQGMLDTRVRTAEELQRRLPVPILASMPQTQAAPKETDA
PTTTWDNEHEFAEAARTLRTAIYFGLAQIEGTSIQITSAEPGPGKSTIASILAIAMAKAGHRTLLIDGDLRKPVQSKRWQ
VSGPGGITSAVAEDLRLIAAVHETEVDGLDLLAAGTPPSNPTEILNSEKFGDLIAQACATYDRVIVDSSPMLPVADARIL
ATKCDATVLAVSGGSTSTKNVSAAYDALTQVNATVLGIVLNNMPKMKGEVAYSYGYGYGGGVQARQPYAFTAAGPEVEVT
RQPTSGPSRDSSAADDGHADERPSAD
>gnl|bykdb|A0A2E0SMM6 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomyces sp] (length=802 residues).
MNPYLDQSSTNEKSGGHDNSTSAMMARVMRFLRVIMLRKKIIVVCVILTSIAGAYWYSTQTPMYQSTAQLLVLSNGGFDT
DDVSGQALLKNQMPTYTRLLSSDHVLQSAAMQLPPEHQIDIGGTPLEMQVKTLRTQLSTSVSPQTSLIDVRFISKSPETA
AYTTNQIIACYIKFMQETHQYGTQNLLTLLQQDQANLIAQYKQNATDLIELQRRSDLLLNNGTETVSLVGQRIIALQNSY
MEAQNQMIKMQTLIDALTEAIENGSNVQQYAEEILGAGPVGNELLGQELGLQDRVVVSRLQDQLKADQAELKSKLATLDY
NHPDVVVLTNRISAAEESLNQRLQSTNNEYHQQHNRKQAERLLRIAEQKLSQLKGRYTALKKSYDEEEEAGRESTLVMSM
IKQKETDQERILHQHDTLLQKIREVDLDDRAEVLAKIVKKPEISRDPISPNKVRTALFSLIMGISLGVGVIVVLEALDDR
FRSADEIKYHLNLPVLAMVRRMEETGGYAIDAVQTHVNPNSVESEAFRTLRTAISFNTHESRRLLVTSTEKSDGKTTVMA
NLAVAFAQANKKTLIVDTDMRRPGMTNLLEMRKEEGLSKLLRSDEPIHQCAVELIQPSGAPNLDILPSGGRPVNPSELLS
SNRLSDFLAWAETVYDQIIIDAPPILAVSDAGIVGRLADTLILIMRPDKNRRGMVFRSIETLQMFGIHISGVVVNHLTPD
QGGEYYGYGYGYGYNEDYGHEDTQAEQGYGDDGYGDDGYVGDGHADDGYRHAPATLEYANYDQQYESGYEDDDYEANPYH
AA
>gnl|bykdb|A0A2E0X4J3 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetaceae bacterium] (length=752 residues).
MSPNSLVETDPFAPPVESRPGPPSAAGSEVNLLAIAWRSRWLILLFMILGGAVSWVLLQRATPRYTSFSKLYVERNMPQI
IDSGMGLSQSKGFLYTQAEMLRSTPVLAAALEAPGMAQLQAVRDSDSPVGMLYEGLAIQVGADNEIITVSLELPDPEEAA
QLVNAVVDAYVSKYAGDYQDSALELLNILREEKRDRQAELDAAQTALDDFRNAHPELAVQVRSSDIVSDRFSALTNELNE
TEIELLEAKALHNRVQRMYESPTLRPLLADMAMDGKPVDTLEERSVLALQEQVQAIEMQIVAEQSRWGEGHPRVEVLLTS
LETLQLRLAEKQAEIAENRATMIAAYVDSVKSAYELLEHKYAELQRSYDRQFSEAKQVSALALKLASLQEAIERSESENE
LVDEQIKEVNLTEKVGATKVNIMEVALPALEPSYPSRPKFLAAGVMLGSLMGFGLGWLRNLLDHRLKSADEIGEALQLPL
VGAIPLAPGVKNRAEAGMMLVNAPRAAFSEAVRTLRTSFHFGLGGPDVRAVCVTSPTAGDGKSTVASNLAIAMARAGQRT
LLIDADMRKPRQHVTFGLSTEIGLSTLLADRRPAADAMQATDVDNLTVITSGPVPSHPVELLNNGYFADLVTSLSEQFDR
VIIDSPPVMPVADARVIAAMSDATLLVLRAERATRRLCQAARNELWQVRAKRLGVVVNGVPMRGAGSYGYGGGYGYGGYG
YGGYGDPVADEPLPSGRRKKSRVIEPVAAETE
>gnl|bykdb|A0A2E0X9P6 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetaceae bacterium] (length=750 residues).
MSHSAKEDHDYQLPAPRPPTEWTRQAVTASRPSRRADDSEGMPPDFVRRVLRNSWKWAIPLGLLLAAAAGCAVMYLHVPK
YQASALIQIESKVPFVAFEQPSTVRDEARYFNTQIELLRGTVVLIPLLGRSEIGAMEEFQNEPEPLKHLQEHLAVAQIGE
SELYSVDYVSPSASDAATVANLVVLEYLQMQGQQERQRTQLVIDLLEQERHARSSRLEQLRRRVVELSREVTGTDPFGQG
AVFNLDRALSPVDTLYQSLNEIDVNQEVLKAELQALNDAPIVYGDETASSGLFALEISNREDIRELESRLAAQRDRLTRI
RKGTQKYAETLADVHDAQSALNERKREVQEELSSARRAERQLQRDRDIVEKKQELQSLATRRVKLAERLEEQLAELKSGG
AQSAQLEFAKAELAREEKVFELIAARKLALQTELDAPDRITLKQSAAVPARPLNPIPYELLLVVCAASLATPFAVGALRE
VSVRRIATADDLERETALNLLGEVTRFPMRPVASRLRSLPAWHHREMIVFAESIDSLRTQLMLTQGLGVGGVRVLAVASA
GSGEGKTSVATSLAVSFAKATQHATLIIDADLRAPSAARMLGLPNQPGLADVLRGDLPAVETIAQVGSSTAFLLPAGRSQ
DNPHHLLLGGRIKELFDRLQRDYALIVVDTPPVLAASESLVLARAADAVVLCLLSDVSQSQQVRRAARCLDATGSRIAGA
VLSGVPMRRYTYAYDYRPRAAADYGSGEAF
>gnl|bykdb|A0A2E1VVJ1 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium] (length=815 residues).
MSTVSGSPPTGPDANTGAKQIDVLELLSAILRHKALIVLCTLLSSAAVMFYSATKEPVFNAEGRVALDSGGFQSGFLSEV
AVLSPVQPPESKEAEILGSRKLVRMVAAHPLSTDGPEFAQGLGIGLSIKVDDFDRYWPEASILRRFTGGSVPNGSLEMEL
LQPYTDPWTHRIELEFLAEGEVLARSSRIAEPETIRFDPNDTEPIVTMFGRRYKLMITGTLSGRKFGVTLRNLDATVGDL
LSRLRIRETSRGSGVLQITYSDTSPSRAQRFVNRLAEMYVAYKHDRLAAQAGATEAFVSKEIERIQGELDAAEDEIVKYQ
EANETPVLPEVAKAIVEQQSSLTLELARLRLTIRAHELVAERLQDPEASLMSLAGAIELDPLLQSLFQALQKVDADAAEL
AIEYTDEWPALKELRERSVELRGSIRDNLASRLEGLRSQESTLLTALDEYDVRLDGLPRAQRELIRLQREASSHEAVYLI
LMQRLQEAKIAQAATIEQVEIIDRALPPRLRALPNVRANLVVGILLGLAIGSILALARESFTRRIRSAAQLEATTQLPVL
GTIPDFRRGLARSQRARGKVFLALLHDPESAAAEAYRSLRASLRFATGGREIRTMAITSAGQGEGKSTTLADLAIALAQG
GKKVLLVDADLRRPVVHKYFDAEVSPGLSEVLLEKNPWQDCVHKAPVANLDVLPAGAMVKNPGDLLASEGLVQLTESFLS
EYDRVLFDVPPVLAVADASAFLHNLEAIFLLCRSNLLPEAVIEQATHRLRVSGAPAIGAILNGHRPSRLQRDYSSYGYGY
GYSYKQEGRSSGSEL
>gnl|bykdb|A0A2E2CCW9 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Gimesia sp] (length=791 residues).
MNTDFQPLDQQSDFAIDGMEENAEINSSGPGVDIVRLLLRNKYLLVLGLAAGLLLGQAAYMKLGPIFSADTKIQVSQKNP
VPIKEGEIQTFGELTAHIDVIKSPRIVGEAVKEARLNQLPSLAGEKDPTQDIIDTLKVKRISGNDRAFLNILTITYENPN
AKDARTVTQAIVDAYKRYLHEVREENTEDIIQQLKEAEKQIAAELELKKNEYKKFRENAPLYWESTPGSEAAVAGSTNVH
QERVKAIDNERRLNLLKLTELKSKIDSLKAAIASGESKETLELLAQQYLMGQTRGQAANGNASEGHHLATPGTSQLDRAR
TALETHLMPLLIQKNRLERDFQKNHPDLDAVNRSIETIINLYRRQGLDISADNLESGEFQVAETKDVDFVNVYLKSMEQQ
LKELENRELELTKLFTQESELAKKVGNFQVIDQSYNEEIAQLKSQRDNIFKQLLVERVSQGNSGYMLTQLAPVKDELVIK
RQLKFLMAGAAGGLGLILAFSYFREMRDTTMKSVDEIRNQLHLPILGEVPCFADSDAAVDESEFAPALWYYYRPASREAE
AFRSLRTSLLLKTDRSGAKVLQMTSAEPGDGKTTSISNLALAIAQTGRKVLIVDADLRRPTIHKLFGLANSVGLGDVLTG
EIDAQTAIRETRVSHLSILTAGMLPENPSEMLMSRAFSELVNQLRKEYDYVLIDTPPLVVVSDPSVIASIVDGVLLVVRI
DKNRRGVIRKVQQIIQTNGIKVAGILANSVKSGKPGDYDYGSGPGYSDYYIVPPQAQAKQADVPAKTKITH
>gnl|bykdb|A0A2E2N5A9 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Phycisphaerae bacterium] (length=742 residues).
MTSKPPSIEHHLTAVPHGPAEAELDLRKLWMSVWLRKWLILGVMLFAALAAAWATSWMTPLYRAGATLLVESERAKLLAI
EQANQNETLNNDFLQTEIELLKSRGLAERVVRQLDLVNHPEFAAQPLSVGQGVGTWFARLGAFVRTKQPDQAAQGEGTSS
KAFDRATEKLMAAISVNPRGKSQVVAVEVLLADSYVAMKAANALVEGYIASKFEAGVATSATATAWMDSRLEELRQKLQE
SENRLQAYRESEGLVDLQGISTIAATELTLTSDRLINARRQRAESESQFRQVEAMKASRLDELASVPAVLSDPVIQQFKA
TKAQAAARVDEVSQRYGPGHPELIAAKADLDAATASLKTQVSQVVSGIQRNYQLAVANEQSQQALFDSNKYQIQNLSSKE
FKVRELALEVEANRALYDTFLVRLKETAATADQNSVNVHVVDRAMVPEEPVKPNRPLIVAVAGLIALFFVAGTGVVKDVL
NDTFTTTEDIENKLNIPVLGIVPLVQQAQGAQLARMYSEGNNPLFTETIRTIRTKLEMANTDHYSQVIVTTSALPGEGKS
TLSANLAHALAQLGKVILIDADLRKPTLAKNFGRPKGSMGLTDIIENRASLESCITQVSGVDMICAGTAVRDPLSLLSSS
RFSALIEALKTRYDRIVVDSPPTQGVSDAMVLAAHAEALLFIVRSEVTSSTEVERGVAQLRQNATPVDWVILNQVDIKKA
ERHGYRYSSYYDYYQYGSGSPS
>gnl|bykdb|A0A2E3GW02 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomyces sp] (length=786 residues).
MKIRLSPEGEFSNVTTLEAKHTPRWSARATEPKPTQNGSDWQFDSPPSSESGFDIRSIVWERKWLLIFFAALGAAIGYLE
FTKQPPVYRSSASILVDRYQPRMPIEGIDPLSGQTDPLSTHIALFNTPVILKKAVEDFRLGELSSISSSNPMASISSGLS
VSRSAKAEDILLFTFTCGHPKDAQKVLEAVIASYFAFLDESQRTASNRTVELIKEAKDDLTESLTKKETAYQQFREDSAL
LWTSDEGNNLHQARLAQIEGQRSELLIKSSQVRAELEAIQNALNRGTSRQALLMMADQARQRAGQSSAEGVQNASITSQL
IPLMLEESMLLEKLGEQHPKVSEVRRRTEVMRTLLSQEAGERTSTKPASARPDLLTLYMQSLQEELRTNQEKLKELDNLF
LSERTHSSNLTMDENRGRVLREDLNRTKKLYDVVLEKLQEISLVDETSVLTATVVNHPSDGSEVRLKVFNYAGMGGMGGL
AIGMLVGLLLEYSDKRFRSPEEMMQMLGVPILGHIPEMPASQKRRKRNKSGDTVPIDPTLVNYHRPNSRIAEAYRLIRGT
LLLTMGGERARVIQFTSPDPGDGKSTTCSNIALATANSGKRTLVIDLDLRRPTVHKLFGLDRDVGVSTFLTSDVEWADCI
QQTSVPNLDVITAGKKNEQYGELLHNPKLASVLDALRDKYDVIFIDSPPVLAVADATAIAPLADSLLLVIKNSKHSRPHA
KQARESLDLVGAPLEGMVVNLVCEETSYRYEGGHYRRGMYGSNYNYGTNYSYHQRRYRYYYEGTDA
>gnl|bykdb|A0A2E3GWC6 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomyces sp] (length=795 residues).
MPADASRSGFERNIAMRQNETMNQPTVESKNNPAPFPSHQMMQTPEPTVDLVQLALRNIIWLIIAGAVGLGLGIAAYKAL
GPSYVAKSQILVKLKTSVPLGDDDNRPTAGERSAHVEIIRSPRVIERAVHESHLDKLPTLAGSEDPARDIIDGLKVERTA
GEDHHKLNILNLQYTSTSEEDAKQILNAVVKAYDEYLQDDAQKSHRELTQLLNQINNDLTPRLNAKTEEYQRFRDEAPLL
WKAPPGADAAPGDVTNIHHQRVDAIAAERVKVELKYQEITSRIQTLRNAVQRGESSEALLLLVRTFLQRDQQSNTQTVMT
GTSERQQLDSQLLPLLLEEQVLLQRYNDGHPDVINIRKRIDIILSYYRKRGIELPVNPANGKAIVGPNGQVEPGSDMIST
YMTALTQQQAEMKNRLDELQKLYDESTKQAKSFARFESQDQSYKEDLQRIRSLHDVVTRRIEELSLAHDEGYQLQQISPS
QAELDFKRILKIVGGITIMLLVATYGLLFLLALRDTTIKSLADVRSLFEAPILGTLPSVTNPQKNLEMARQTGTSPMLYY
YHDPASPEAESCRSVRATFFVRASDAGARIIQFSSPEPGDGKTTTISNLAISMAQAGKKVLLIDADLRRPMVHRLFGLRE
EIGFSEVLQGELELLNAIQPTKIENLSVLSAGAIPAKPAELLSSAKLHYLFGEATREYDFVLVDSPPILAVSDPSITARS
VDAMMLVVRMQKNNRPSIKRTLELLGSHGVNLMGVIANGVEATGGEYSYRGGYGGGYARQQPAKPTTPPPILTKQ
>gnl|bykdb|A0A2E3GWX1 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomyces sp] (length=771 residues).
MVSPEQYDLAAMPLPQETVNPLTTVIRFLQSMLRRKWIVMGWLTITVGLGITYFVLAPRLYESSAELLILHTGEGNMDET
QQSQRTLQDHLPTYTKVLSSEEVLKGTLQRLPRDQQAKFLGMSKRQAIGTLRENLSVSTTRQTNLLSVNYRTTDPKSAAI
IVTEILNSYFAFMQDMHQNSSREMLKLLTAERKKVEQQMTDKQNELLRLRAESDSLLGTGDSVVSVVNERVVELNRSLAA
AQKETIESRSFYTAVEQAIRNGENLQQLMAQTNSSVASELMKIGIGVDSRDQYVYARLQQQMIEDKAKLRDKLNNKLGPN
HPEVQELQQRIDGTNEWLENRSAQVAEGSDKINAELGPRLLQMAKQRYQHAMLNEQEITTRFNHEKTLAADMNQRLVLLQ
MAERDLARLQSDYDMLRERINALDLNQQTSLRTRITKHAEPNPAPVSPRLTLTLAMSIVAGMGLGALTVLLMDLLDDRFH
SPDELKSQLGAPVLAMVRELPMLDVETGLESIYTHTKPNSVETEAFRTLRTAIEFASETHQRISISSTEPSDGKTTVISN
TAVAFAQAGRRTLLIDGDMRRPGLTRLFDLRGQQGLSSILRDDQTIEESAKANMVHTGLMNLDIIAAGPRPSNPVELLTS
DRFAELIAWAEGEYDQILIDAPPSLAVTDPAIIGRLVDGVILTVRPDRNRRRMILRAAESLQSLGANLLGVVVNRLSDSS
GEYSYGYGYGYGYGYGHEDPVQDQPAAWSDFYDAEPERQKKERKRFSRKAA
>gnl|bykdb|A0A2E3RCU8 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetaceae bacterium] (length=787 residues).
MSVETDDGAYELPLTNAAGAIHDVFQFLKIVWYRRNSMLVVGIVCAIVAAWYAATATRYYQSSTSVLIVQNGSADHGNVL
GVNRNDQQLMPTHQQLIVSQPVLENAIQHIPSECLQEFKGNRESWHRELASKISTHVVRSTTVLNISATSTQPKNAVAMV
NAVIQSYLQFVDQTHQGTATKIIQVMTREKDNLARQLSAEEVKLADARLAAGDFSIDPESDVIHPVVQTVVTLNEAFLDA
KKDRLVQQSLVEGIQRAIVRGEDLKQYAMAIEETLGRELLAKGLGFSTDTIHTRSQLEQGLIEDIARLKSLSSDFGPSHP
KIIEIQNRIQTTKQYIEYHDAQLKTQVDNLESNQLGPVLLRMAQQGLNKAKQKESILHASLEEARFKAVTHQRDTAHITM
LEQNVMRLRRLHDAIIDQIASVDLRHGEGEIRATIIKEAAASGQIVSPRLSRVIVFWFLATIGIGFALVYVQDTIDDRFR
TPDEMSKRVGYPIISLVRALPELGGKGIEKVSAYNDPASVFVESFRTLRTSLALSAAESTRLALTSSEPGDGKTTVIANL
AVVYAQSGKRTLLIDGDLRRPGLTRLLDLKSHRGLSDVLAADDPIQEIIPGHVVPTAAANLDVLPAGPRRQNPSELLASD
RLAQILAWAEGEYDQILVDCPPTLVASDAVLVGRITDGMVIVVRPEKNRRKVVFRAAQNLSEMKIPVYGLVANCIKAENG
KGYNFGEGEGYGYGYGYGDDDSGSLDEADGTTLNAEDNYADINFQMRPLDQKVSEIENASIHFRKSA
>gnl|bykdb|A0A2E7EGG1 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetaceae bacterium] (length=735 residues).
MSASTKRRRIENLTQFEHDFSLRMFTSVLIQWWRILIPVTLFALLISTVFVFWSFRPQYRASAWLQINGVQPYVAFPDRE
VRDRDSNRKFVHTQVELLRSPLILGRVLSQPEITAMPEIRSRRDPIDWLSTQGLLIAPKGSSELLEVAFEGVNPENSALL
VNAIIDAYFTMRQEKRGQRAQSVISLLEDERARRSEEIKLLQAEVRQLQKQLVANDPSLTSTSLIGSDVVISESPLKSMQ
ENLAKAQIEHKVLAAQVQALEDSVQTGPAVPDVLIEREIAGREEVQRVLVALNQKKALRDQALNASSRGGTDPRIIKLNQ
DIESLESTLESLRDTNRPRIREEMKAMSGLQRQQELAMLKTQLETQKLIVQSMRSNYDAMVEDISQSGGQTLDLKFKQAE
LNRKQQVFDSISERAAQIATEMYAPSRVELVQKATTPEVPVQNLPWKMLLVSVLASISLPFGLFLIWERTLKRVTSSEQL
QVDNNLPVVGEIACLPEKSITHELDDDIDQLGLFEESIDSLRTGLVLSQKNESIQVVVVSSSVAGEGKSSVASQLAVSLA
RSSGMPTLLIDGDMRSPDIHRIFKVENKPGLVGVLSGECDFEDAVNREWSEHVHVLPAGYLDRSPHKLMANEGFKQLIAK
ARDSYRYIVVDTPPVLAASESLVMARDADATLVCAMRDVSRENHVRMTYHRLLSVGARPVGTVLNGVPTRQYARRYGTYG
YETASSYSADQEEVT
>gnl|bykdb|A0A2E7ENQ5 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetaceae bacterium] (length=771 residues).
MNERRALPPTAGSQTHLVHTAMRLFRIIRHRRIQVVSCLVATALLGALYYCTAAPLYSARVSLMMMYHGGEDSLTGSDTY
RRGMLPTYERLFYSSVVLEQAAARIQELPAPLRVDVTPKPRDEWVEILRKNLTARAVRSTNFIEVSYRSRDDEAAVAILD
AVVESYLDFIDLNQKNVATEIVRILDKGRSDVASQLDAKEQELLVAQRETGDLGLRNGSTITHPLVHNVVRINEALIDVR
KERMRLDASLAAVRRAISQGQDVRQFMLSMEDAGGREMALGMLGMSTKDEDFAKQLKRELNDDYARLESIQDYYGSNHPT
FIEVRQSILKKEEYLAEHGTEGAEIDGFQNQQLGEMLLSSIQGKLNTAIVHEQNLEREFQIAQNQAVEVNGKVARVAIIE
HDLRMLRELHDTLRNRIANLDIRQDQAEVRMAVVSEATASDSPVHPRLLTVLATVIVSGLSLGIGLAYVLDVLDDRFRSV
DELKDQLNVAVLAIVRQLSPTSATGVDSLQVHVAPNDVASESFRTLRSTLAFSEQGSECVAISSSEPGDGKTTVLSNLGA
SSAQAGKRTLLVDADMRRPGLTRLFGFRGKGGLSDVLTKPNDLNELCEERIQKTALAGLDVLPAGPLPTDPSGLLTNRRF
AEFVAWACDHYDQVLIDTPPILAASDASIVSRLTGGLVLIIQPSKNHRRLVHRAVDEIRAANLELIGVVINRISDDGDSA
YGYSYGYGQGYGHGYHEDANVDDDPTTLPIQDPQVFQRPADDASEPRRRAA
>gnl|bykdb|A0A2E7ESJ6 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetaceae bacterium] (length=779 residues).
MRHQTELHQPNQSSTDSPAHWGATSMDTVSSQGVDVGGILSRRKWLVILGFMLGLGLGYVYMLQATPRYESVAQILIEDK
QPPTIPLTGVESQYITTSAEAKHAIVIVSPRILTQAFDNFNLFRLPTFKDDPDPLLKLSENLKVELVEDGTNVLNIRFIG
PYPEDTQKVVNAVLHTYQQFLQEAYEDSGTETRDLIVKAKDDLLKKWQMLEREYGEFKASTPLMYNGQESINVHAQRQAD
YENERVSLQKQMTELGAQIKSVEEALERDDNLESILLLAEKDGHQGLKEKFSSRLALMQDRYMALVLQQEELEGRYGKDH
PDVLTVRRQLERYETTYPELVNGTIKPSRQELFDYVTRYLASLKQKQIQLKGQYESLTGLFNQEEDAAKELQILQAKDEQ
FQNEIARTQQLFEVVVKSLEEISLVSDYEGYNYQTLAKPTVGDKVAPLLLKVMPIAALFGVVVGFGIAYLVDVADKAFRT
PDEVASLMRLPVIGHVPLIDPEKIPKLPGCNIEPIMCTVHKPKSPQAESYRAVRTALYFNSRGERHQVIQVTSPMPGDGK
STLASNLAVTIAQSGKSVLLLDADFRRPTQHEVFAMEAPEIGLASVVAGDAEPADAWQEIPFVPNLRIMACGPRPENPSE
LLSSESFANVLQLLRDQFDFVIVDTPPVLAVSDPMAVAARVDGVILTFRIHKRARPLALRARDALVTTGANVIGVVVNGV
DHETSSYYSEYKYGYAGYRYGYNSRYGEYSSDAQEQKAISKYYDDESSQTLQHESPYQS
>gnl|bykdb|A0A2E7K7A9 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Gimesia sp] (length=790 residues).
MNTEFQPLEPHSDLDFDGMEDSTTNASAPGVDIVRLLFRNKYLIVGGLLAGLLLGQAAYMKLGPVFSANTKIQVSQKNPV
PIKEGEVQTFGELTAHIDVIKSPRIVGQAVKAGKLTELPSLEGEKDPAQEIIDSLKVKRLSGTDRTYLNILNLTYENKNS
NDAKVIMQAIVDAYHHYLDEVRDQNTGEIIDQLNKANESILSDLEKKKQEYKEFRKDAPLYWENTPGSEAAVAGSTNMHQ
ERVKTIDNERRQNLLKLTELKSKINTLKSAIASGESKETLELLAQQFLMGQARGQSGATTGGVESQAITPGNTQVERARL
ALETHLMPLLIQKNRLERDYKKNHPDLDAVNRSIDTIINLYRRQGIEISADNLESGEFQVSKVKDVDFVNIYLKSMEQQL
KELENRETALTRLFDQETELAKKVGNYQVVDQAYNEEIAQLKTQRESIFKQLLLEKVAQGNSGYTMTQLSPVKDELVIKR
QLKFLMAGGAAGLGLVLAFSYFREMRDTTMKSVDEIRNQLHLPMLGEVPQFTEEPAHMDDSQFDSALWYYYRPASREAEA
YRSLRTSLLLKTERNGAKVLQVTSAEPGDGKTTSVSNLALAIAQTGRKVLIIDADLRRPTVHKLFGINNAVGLGDVLAQE
IDAQTSIRETRISNLSILTAGMLPENPSEMLMSRRFAEMVNQLRNEYDYILVDTPPLVVVSDPSVIASTVDGVLLVVRID
KNRRGVIRKVQQIIQTNGIKITGLIANNVITNSLVGYDYIDNEGYQAYFEKPAPEPAKPAANPAKTEVTS
>gnl|bykdb|A0A2E7RYU8 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetaceae bacterium] (length=745 residues).
MSPSPDDRPIAAPNEPQTATLAAIVRFLQVVRIRRGILFCTLFISTVLGGLYFATATRLYESKARLYVLQMGSNVLQNDQ
ENQGGVQENMATNQGVLTSDVVLEEALQKLPAKHRIDLKGIPRSKWTEALRNNLAVTAPRRTNLIDVRYRSRDPQVAATV
VNHIVESYLTLMRGIHKNNAGNDIQFMTAEKKKLDEETNRINSELLDLKRQMQIISGPDNQSINPAAERVAALNKELIVA
QNRTREARATLEAIVDAAARGQNIEQFAMQHLEVVGKEFLLRRMGLDSQDSWMVMRVRQQLINDQVELQNKSGEYGPNHP
LIQKLTTRIRDRQKWLAERPKSVVDQMQKLSEAQLTPSLIDMSRQRLRYAESREAALRQDFERENRTVSSYEYQMSRIKL
LNFDLARKRELSVALIDQINRTDLGKERGGLRTKIVSHPKAAKLPVTPRLLVVALCALACGLGGGLGVIYILDVLDDRFR
SPEELRLQLDVPVLALVGEMPVTDEPGLSSVRMLSEPNSTDTEAFRTLRTALSFAGRPTQQLVVTSTEPGDGKTTVLTNL
GVAFAQSGKRTLVIDADMRRPGLTRKLNLKGPRGLSTILQSEEPIGISAASNLLATELNSLDVIPAGPRPGSPAELLHGG
RFAELIAWAESAYDQILIDAPPTLAVSDPAIIGTMVDGVLLVVRPGTNRRRMVLRAAESITAIDADLLGVVINNVDSDTG
SDYDGYGYEYGGEDEPASSPHRLAA
>gnl|bykdb|A0A2E8B0L9 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetaceae bacterium] (length=777 residues).
MSQTPELRAVSPPHSFDELHDPQDGAAEAVQAVAKFLRVVYYRRSYVITCVVVSALLGGLYYYRASRVYAATASLLITQT
GTDILNSTMMPNAQQDALIPTYERLFSSAVVLDGAIQRLLKSPAEARIDLAGLPRDKWIDALRANLSASGLRRTNIVELN
YRSKSPHAAEAVVDAVVDSYIEFMKENHTDVSVEIVSILEKERVAKEQELQAKQQEMLSLKRAVGALGTEGSTTVVHPMV
QRVITLNNALVEVQQERMQLEASLGAVRMAVRNGSDLRQHMIDLEPLVGRQLVMSGLGLSPEATDLVNSVERKLLADRAR
LDTARDYLGPTHPEVQELVRNIRNAEQHIQEFQANVNRRLDGVQSEQMAPMLLGMVEERLSKTWELEADLEREYVAAEAS
AIRLNDRHAELSIVESQVQRLSNVHDMLLDRIANVDLNSEGGDVRVSMVNEPKANERPVSPRLALTGILSLIGGLGIGCA
LVYVMDLVDDRFRSPDELRDQLGVPVLAMVRRLTVAGNEGAESLQVHVAAGAVESEAFRTLRTTLAFSGQDLQRIAITSS
EPSDGKTTVLTNLAVSYAQAGKRTLLIDCDLRRPGLTKLFQLRGVAGLSDILRGNDEVPAMCEERIQAAGVDGLDVLVCG
PKPPNPVELLTDSRFVDVIAWAETHYDQVLIDCPPVMAASDAAVVGRLVDGIMLVVQPEKNHRRLVLRAAEQLLSMGVNL
IGVVPNRVGDDSSGYYGGYGYGYGYGYGYDDGYGMDEEDEDDIQTSASDSIQPRRAA
>gnl|bykdb|A0A2E8FLY0 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetaceae bacterium] (length=741 residues).
MSRPTDTPIDTSGEPRTATLTAIARFLQVVRIRKGILFSTLFISTILGGLYFATATRLYESKARLYVLQMGSNVLKTEQE
NQGGVQENMATNQGVLTSDVVLEEALQKLPEKHRIDLKGIPRNKWTETLRNNLAVTTPRRTNLIDVRYRSRDPQVAATVV
NHIVESYLTLMRGIHKNNAGNDIQFMTAEKKKLDEETNQINAELLNLKRQMQIISGPDNQNINPAAERVAALNKELIVAQ
NRTRENRATLEAIENAAAQGQSIEQFAMQQIEVVGKEFLLRRMGLDSQDSWMVMRVRQQLINDQVELRNKSGEFGPNHPA
IQRLVARIRDRQKWLADRPKNLIKQMQQLSTAQLTPSLIDMARQRLSYAQSRETALRQDFERENRIVSSYEFQMSRIKLL
NFDLARKRELAVALIDQINRTDLGKERGGLRTKIVSQPKAAKSPVTPRLLVVALCALTTGLGLGLGLIYVLDYFDDRFRS
PDELQLQTNLSVLAMVGELPAADGPGLASVPTFSEPNGVETEAFRTLRTALAFSSNPTTRLAVTSTEPGDGKTTILANLA
VAFAQSGKKTLLIDADMRRPGMTALMDLRGPRGLSTVLRGDEPIANTATANLFATELGTLDVMPAGPRPLNPAELLHGDR
FSELLAWAETVYDQILIDAPPALAVSDAAIISRQVDGGLLVVRPDKNRRRMVIRAAESMAAVEATLIGAVINHIADTAGS
EYYGCGYEYDSKEDEELKQAA
>gnl|bykdb|A0A2E9VK20 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Rubinisphaera sp] (length=780 residues).
MKPSSDKNSRNVDTVHGHPLVKADEPAIDLVKLALKNVVTLGIAAAAGIGLGIFAYKILGPKYTASSQILVKLKSPIEIR
EEGNRIIAGERSAHVEIIRSPKVVERAVRDSQLDQLATLAGSEEPARDIIDSLKVSRTAGEDHHQLNILNLQYTTSKSKD
ATAILNGVIKAYDDYLKDDARKNHAELQTLLEQINNDLSPRLAAKTKEYHEFRRNAPLVWKAPAGADKGPNNVTNIHHQR
VDAIATERVKVELLYEEISSRLSTLKSAIERGESHEALMLLVKTFLQKDQTSNSQTVVSGATERQQLDSQLIPLLLEEQA
ALKRYGSGHPDVINVRKRIDLVKSYYRQMGIDLPTMTTKVNPATGESELVTGNDPIATYVVALEQQQAELKNRIGELQKL
FDRSADQAKDFAQYEEREQTLSDELKRIKSLHDIVANRVEVLSLAPDEGYQLTQISPSRAEPDIKHVIKIVGGCLVMTLM
STYAFLFLREMRDTSVKSLADLRAIVDTPILGTLPSIANPAKNLQAARETGLAPMLYYYHDPGSPEAEACRSVRATFFVR
AADVDAHIIQFTSSEPGDGKTTTISNLAISIAQAGKRVLLIDADLRKPMVHQLFGMREDIGLSECLSGEIEMANAVQDSG
IENLHILSAGAIPAKPAELLSSSKLHYLLGQAKRDYDFVLVDSPPVLAVSDPCITAQSVDTVMLIVRLHKNRRPSVKRAL
EMFEAHEIPLLGVIANGLQDASGDYQYRGGYGGGYDKKSPYQQTNDIPEFLAPTQAVIPS
>gnl|bykdb|A0A2E9VST2 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Rubinisphaera sp] (length=776 residues).
MPAPENYDPQMNMHLQENHNPLQTILRFVQSLIRRKWTVMAWLTLTISLGMTYFALATRKYESSAELLVLHTGEGNVDQT
QQSQRTLQDYLPTYTKVLASDEVLKGALLRLPDTARTKFIGMTKHQAIEKLRSNLTVNSTRQTNLLQVSYCSESPEVASL
IVTEILNSYFQFMHEMHESSSGELLETLTTERDNIQKQIFEKQAELLNLQRDSDSLIGTGDNVMSVVNERVIELNRALAK
AQQDSIQAQSHYTAVEQAIRNGESLQQLMNQSNQTLANELMKLSAGVDSRDSYAYARLQQQLIEDEASLRDKLNGKLGPN
HPEILELKERVKAARDWMNGRGQQASQDSKQLTHDMGPQMLEMAKQRYQHAVTLEQDIYQRFMQEKQVASQMNQRLMMLQ
LAERDLSRLQNDYDMMRDRINTIDLNKQSSLRTRITKHAEPNRIPVTPKLTSTLMLSIFAGLFLGATTVLLLDLLDDRFH
SPDELKRELGAPVMAMVRSLPALPHTHGLESIFTYTKPNSVETEAFRTLRTSIEFACENHQRISITSTQPSDGKTTVISN
TAVAFAQAGKKTLVIDGDMRRPGLTAVFALKGQAGLSTILRDTASIEESALKHITKTRLENLDVISAGPRPSNPVELLTS
ERFEELIGWAEGVYDQILIDAPPSLAVTDPAIIGRLVDGIILTVRPDRNKRRMIIRAAESVTSLGGNLLGVVVNGLSDSR
GEYGYGYGYGYGEGYGEGHDDPTHDDEEEAIPMTQSNSHRPRKRFSRDESSDRYAA
>gnl|bykdb|A0A2G1W1E0 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Rhodopirellula bahusiensis] (length=786 residues).
MAESAKPTNRLPARGPSSSTSDGEETLDVLQILSRQRWLIAFLSIAGLAAGVAYALNAQVWYESNAKVLINQKSAGLGGN
STGTDMVDEDILANHMELIQSRMIVGEALEQTELVDLPSIESHLDEKTDAIDYVIDQLSIVKGGDGSAKTARSLNITFTH
TEPDDAKLILTAVMKRYEQFIIDQVEQVMGRANEMVNKAKTEVEAELVAAEQEHLKARQEAPLFFQGEGSSNIYQDRYRR
LQDELLDLDIQESTVKTRLTRVDETLKEMDESTDPIDQLDKLALIDSDSLERLGVFAGLQMNSANTAEFKAAMPAKMEEA
RTQITHLLQLNSEKQRLTSVFGPGHPKVQELESEITLVKEFLQDQKELTSPAEMFGDSALTPEGLLKAYVGFLNHDLAAL
SERRKELTYLAADAETKAKELIEYELTDMILQKKIGRQEDLFEGVVQQLRELDTASGLTGYLYEFLAVPRIGQKSWPKLP
LCGLGGLMLGLFSGLFLAVANDVRDGRFRSAAELDDAIGLPSLGRVGKLNSINQGIKGLIATELSPDAEAFRLGRTMLLP
DIRNGNVRAIGFTSPMQGDGKSTVVSNFAVSFSQVGLKVLVIDADLRRPSAHRYFSLGKEDGLCDVLEGRLEIPEAIKAT
EADNVFVMTSGSSSQTPAELLQSQRLDEVLAVVKEDYDLVLVDLPPVLAVSDPVVVMPRLDGGILVVKVANVRRDEVVNT
LRRIDSSGGEMLGCMLNAFGAGKKFDSDGGYYGYYKSDYTRPSSSTTRQSAPKAATISSNGQPKPE
>gnl|bykdb|A0A2G2JCA2 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Blastopirellula sp] (length=721 residues).
MNMITNSTPNYRPAKPPAEKKPFISPQLVLHALRRWWMIVIPIGMVLGSAGAAGLWSRYEPVYKASAWLQIEEVSPYLAF
QDRSDSRKFVANQVALMRSHIVLGSVVSNKDVSSTPELKNSVDIIAALGRNINVRAVSGSEMYSVEFQSTDPVKASLIVN
EVAKSYYNLHNQTEAVKDKRVLDLLETEKNSRESGLKDLRGVVKTLAIETTGKDPYVVTSSSERAGTYSPVSELQSRLVS
AKVEKLVLEVEHQALKEIHEKETFIVPETGLNQAVEQHPDVLTLRARIATNGSTALEYEKTAVNFKDNATYQKLQKQILA
DKEDLAKLKIDLKTIGKEDLEARYLASKEEELSHVEIRLNGLNISVTKIQEMLDKEMKLAKKTSGDTFELEIKQRELEEL
SDIHRMIESRILKIRTEQRAPSRVALLPEIPVPTVPIEKLPYKNMLMIFMVGLAAPFGLAVLKEALTVKVSGREQLELQS
NTPVLAEISQLPKRRTMSPGNSTVSTSLRMYEESIDSLRTNIMLPNNSDDIKVIVVSSACSREGKTSVACQLAISLARSS
GRKTLLIDGDMRSPDIHNVFEVPKSPGLAEVLNRDIPLKDAINREWSDSVHLLTAGTLMTSPHKLLGTNVFDKLMKGVRG
RYRYVVLDTPPVLAASEALVMAKQADVSLVCAMRDVSRISQVQSVVERLESVGASPMGTVLNGVSASYYSYHYGHYGYNH
A
>gnl|bykdb|A0A2N1UCJ3 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium HGW-Planctomycetes-1] (length=741 residues).
MTDKKTNIENEAGSVEQMMSGTHRTFAVTLQRRRLSILITAVLFVAAAILYLIKAEPLYTSTARLYVEQTGPKLIADYEG
TMTQSKNYLYTQSEIIKSTPIIAKVVQRSDIKRLRTFEAKPESIAEKIKKQIGLAEPSFTTGEIDNLVIYLKKLLDVQVG
IKDDIIAVSCLSPYREEAAQIVNAVIEAYVDYQTSQKKSSVSEVLKILQKEKITRDQELSANFKELLEFTRQYGVISFEK
SGGNEVFQRLKALGDSLTIAQLDTIKAKATLEAVKKFDSPQKVRQYAMAQPGISSNLFARDMETKLRDELQSLETELENA
LIQCSEGHPTVKALKSRIEAAQNKLAAQIEEFAKNYIELLEIEYDAAKQKEAELSASYEQYKQESQSLNIKATEYAIIET
KLEQSKRFCEILDDRIKELNVSEEAGALNISILETARPAEFATSPKKAPTLAASLILGLLFGLALAITRERLDWRLRSAE
EISMVLATPVLGIVPSMSDKGKKDNGNKGQKVHLEPKSSIAEAYRSIRTSVFFGVPKGQARTILITSPAPSDGKTTMVSN
LAIAMAQAGQKTLIVDADFRKPMQHNIFGFANEVEKGLSSILSGQISLDDAIRSCPTDGLFLLTSGPEILNPSELLNSEA
FSNLLKELTHRYDRVIIDSPPVTSVADSQILAAICDITILVIRAEKSTRKLAQQAREALAGIGARVLGAVVNDVSPKHSR
YGYYSHYSYYGYGYGYGRKKE
>gnl|bykdb|A0A2S8FKY2 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Blastopirellula marina] (length=808 residues).
MSNGNLVISSEKDRRRQGTNVPGTVVANRPQEEDGMQFGQVLHSLRRQWLASIVLGLLVAVPVAIAAWVLQSPTYTSSAY
LRISSNDQPLAFKTIEQTNRNDYRTFKNTQRQLMVTPFVLNSALSREDIMSLDIVREEENPLEWLQEELIVGFPGDAEIL
QVSMMSKDPTSAPKIVNAVVSAYKDEVIETERLARVTRLENLERVHSETENKARQMRSDFKQLAETLGTSDSETLSLAQQ
GSVQHYGLVRNELAQVRFELMRAEGELDFLLSSNKAQIESVSRSGGDGGLTTENAPGVGDDATPRVPVSDADDSVDEVAE
NGDGDSNDGEVADLKLSDVEMDEAIANDPVSVKLQAELDRFEDVRFTLTEAAYERYRQTNSAEINAIETSLKERRAHLEK
LVIERIAQQQAEGDVRKNSMMTTSLKLPEVDNTIPELKVRIGVLRQQQRELSKEVADLEKEVRTFGRSSVEVEMKRSEIA
SLDEILQQLNTEIERTNIELRGAPRITLLSEAKTGTVTDKKKPIMITAAAALAGFVLPGGLLLLRDFRKKHLSDLPTTRD
ELGLELLGTIPRLPRGIVRKPKALSHNLGPYEDQVRDSSDSVAATVLRRSLSEQCQVLLISSAMPREGKSSLTCHLAISL
AQAGRKVVVVDFDLRRPSMHSIFGLPVGPGVGDILVGEAKLADSIRPTDIPNVDLLPAGIKEQSVPRSASTGRLDQLFAD
LRKSYDFIIVDAGPVLGSPSTRFLAQPQHVDGVILSIFKDVSQVAQVDDAKRILNSFGAPIIGTVLSGYSSGMYYSYTNR
STSTVEVE
>gnl|bykdb|A0A2S8G191 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Blastopirellula marina] (length=775 residues).
MSLNNANLPQESSKRDIRVDAPVELVTGHANDFLSNNDVESEELGGGGIGVSQILHALRRRWLPAFSIGIVLATAGVALA
WVLDVPEYTTRAMLRISSSQGSLLKQDGEKTGDFDVYKLTHRQLLRGPFVINAALRDPEVAKLPVIKEKVDPVSWLQGAL
SVNFPDNAEIMEVKLSGESPQSISKIVNAVVQAYMDEVVDAEANMRRSRLSSLERAYSETENELRSKRSEFRRLADTLGT
GDTASLSLVQQNALQQFAALRSELTRVQLDLLRAKGKLAGIQSSVAANLTEPVVAKKPVVEEEENAPDAKQDVPLEEDSD
VELQNILASDEVIAALKSQIMQLEAEILNVEQTAVPGIQEQYVGKYRDTIVELEEHVRLRKDQIVKGRAQWQAANFKASV
DKARSEVVLLEQMEKQLVDSVTTFEKEAKQFGRSSIDVEMMRTEIDSLEGILSRLGHEIENTKIELKSDSRVTFFQDAQP
PKSKNPRSFAKIGMFGFAGMMIPVAGFVFWDLRSQRINAPSDISKNLRINVLGAIPFVPRSVLVNSSRNSKKQEYWKNLI
AESVGGIVARLFRPSATRQYRVVMISSALAGEGKTTLAGQIAYALAESGARTILVDFDLRRPALDTAFDVNLVPGVTEWL
SGEVEIQDAIQETGMRNLDIIAAGDWGHNSFRELTSNRMDAFFKKLRQEYDYVIVDGSPILPVVDARLIGQYVDGVVMAV
LRDISRGVKVEEARELLNVFNVPFLGAVVVGITKEDVYNYTSQRNRKKQLVHVES
>gnl|bykdb|A0A350CI62 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetaceae bacterium] (length=792 residues).
MTDQDRILAGSQDGTNAAATTLHLLFRFLRTVRFRKGILVASLVMSTILGMTYYITAERIYESTASLYVVRKGSGVTSDA
TSNSANPVTEMPTYIALMSEEEVIARALRIMPEKYRRVDLAGYPQSAWVRMVRDNLQASSAYNTNVMDISYRSRDPRAAA
AMLTAMLAGYEQFLNETNRGLSEQGLKTLATRLEAIEQEVKELQSRRLHLKASAPELVDTGERNQNSLNTISKNIEMLTQ
EYTNSRRRTEEARTTSQELQRAIASGEDILQFAMETLDSAGRQLVEQSMGLGTQDSYHVQRIMQEILDRQSALTEARQKY
GAKHARIRALETELAVKEKYLREFPELQRTRTDTMTREVLAPRLVQYLSQQILKLELNEKAVGERLAAEQAKAQKLSQTL
TELGDLDRQIEHLYDQQKSLQSQSDGIGLNKDTFLSTKVSSRPTVPIRPVSPRLPIAVLLSLLIGTGTGLAVIWVLDIMD
DRFRTPEELKLHLETQVLSMIPRMTELPGEGFEAVMCHVRPHSREVEPFRALRTSIEFSPQDTNRLVVTSTEPGDGKTTV
SMNLSVAYAQSGRRTLVIDADMRRPGLSTLLGLRDDVGLSRLLRSPDDLDTAIAANLRTTVVQGLDVISCGPRPVNPAEL
LSSERFAALLSWAETRYDQIIVDAPPVLAVSDPAIAGRLVDAVVLVVRPDKDRRRMVIRAAETLRTLGCTLLGVVVNHLN
VDDAGGYGYGYGYGYGYGYGYGHDQEPEEQSGSGGHSGSPEQPVAAGHSVSAGLYSISVGGSRSSGDSSRAA
>gnl|bykdb|A0A351FYP6 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetaceae bacterium] (length=726 residues).
MEPTSRKENSSDKLHILDYWRIIRVRIVTILLVFLLTAITTTVVTFLIPKTYMSLSRIAVEKDTSDIAPLLGMQATQSSF
DPYFISTEFEKIQSQKVLDEVVKSCELREKWKKHYGGKQLTDVEARKHLEKVIDVSQYRNTSIIELRAYDRDKNLAQQIA
QALAKEYENYRSSLQEERVKAGIDKLRERMKKTNDEITAMQANVDDLRAKLGISDAAGEDSYSIVEPEIVRRYESELITA
KGLYTQQATLLQGLQEQSLEELRESIMTANPDAQLDALIREYQTGQTTLANKSIDLGEGHPTIKSLKAAMESLNQQIDNR
IKGILAGLELRVNSSLAQVRELQKSVDDAKAKEAKVQEEGREYFDAKRKLSNTTRMRDTILFRIMQEEVDLDLPKTSSVE
IIDKADTPLRAVRPNVPLNISLGVIVGLILGVGLAFFIEYLDTSVKTIDDVERALDAAVLGVIPQNVGSLMDEGDESPHA
EAYRVLRTNILFAGRKSEDQTTFTVVSGGAGEGKTTTMFNLAVVFAQMGDRILVVDSDLRRPSMHRYFKVSNTIGLTNLL
LGQNTLDEVIQTSESPNLHFIPSGKLPSSSMGVLNSAKMKEFVAEMKSRYDYVFFDAPPIMGVSDASVLASAVDLCVLVV
QYRKYPQLMTQRAKDMVIKVGGDLVGVVLNNINISQDSYYYYYSGYYYDYYYKSRETEEEPVEDKKDGKEEKLIAQADAA
GEDVNP
>gnl|bykdb|A0A353FIP5 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium] (length=786 residues).
MPIPTSNAPEPKVDFNEAIGILWRRKVQIALITVIAACVAFLVAVTRTPSFEAEGRVLLEEGSAVGGILGDLSMLSSAPP
ATAELEVLQSRMIVDPVVAPQSESSLGLNLTLRVDDLDRYSPWKLVRRKLAGKTLDGALSGELALPIARQNSAPVTVTFH
SSNSGVATSGKILRQQSKAFSLANSPLVEIADTKIRLFPEGDLTGRQFRLNVATRREAVERVLKELAVSETARGSGVLQI
TYKDTDPDRAAQVVNNLISSYAERSRERLALPAEKTVTYIEGQVERIQLELAEAEAELVAFQEEEKASVLSDTAQAIVGR
MSEIDLEQAKLVMMAERQNQLAESLRKGSPVEEVGAAVELDPQTSSMLQELAGLIAQARALEEKHTEKWPPLIRLRGQIK
KLRTNISNAVEARGVALKKQIVSLDRAISRWQGQLDALPAVERKLAKFQRKANAYEQIYTYLLGKEQEARIAAGAAVEAI
SIVDWAVPPLLRASPRLTLSSLAGILLGLFLGSFFALWRESSQKKIRSTAQMEAVTGLTQWASIPDFRHGANKIEAAKGK
EHFLALLDAPDSRVAEAYRGLRANLTFAAKRNEIKSLAITSASQGEGKSTTIADLAISLANSGATVLLVDADLRRPSIHK
LFSIQSNPGLVDAISGESPCEDLAQQVSSIPNLHILPSGKVDVGGINPGDLLAQEKMSEIADSLRGAYDYVFFDVPPVLA
VADASSFLNRLDAILLLVRFNLSSESEVAGACHRLKLAGAKTLGAVLNGQKGGDEKDYYYEEGRSR
>gnl|bykdb|A0A353P687 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Phycisphaerales bacterium] (length=755 residues).
MNTLTKYSDNHNLAQSGGMVYPTNEDGDPALNILTAVRKRWKILLFTMIIICSIGLPAVWMFIKPFYLATAAIRVAPVIS
SILFGGEEGIPMYRNYMYTQADLITSDRVLQRVVDDLSDKNIKLMEEAKSRDPVTAVRNKFSKNNSSDLILLLRKAIADN
KLTVAPEDKTELIKISVKSSNPSNASKIANSFVQAYMTIVATEELKDGDHKLTVLEDERRVMAEKIERQRKTLNDMAQEF
GSVILDNRQQMMMNHLAKLQEKVTELELERIVLQTKIDLHSSQKEKTITPEVMAKLRHDFINSDLMVQTTTSNVANLEQV
LITAKQHLAPTNPELARKESLLNALKQRLEELRQQADKNFDEMAEKEFKESDMLEIQEYKYKLEQISLHQQQLRDMLVHE
DSKTIELGRKQLAMQDVKEQLDNSKDMYSTIQKRIGELEMERKRLARISVAYLANTAPYQDRRMQYSLAITMGSLVFGLG
LALITNKLDLRLKTPDDITKRIGVRIIGTTTSRDKIKKAMWPRQLADDYHSICINLGLMNNCTIPNKLVISSASPREGKS
TLAVNLATNLAKIGKKVLLIDGDLRKPDIAKYLKLDNKGKGMHQLLADFKLRDLLLYSDVPGLSVLTAEPCDISIINRLI
HHKNMVEFINEISRIFDHVIIDTPPVLAAVDALLWASMVDGVILTSLAGHTETPDLKDTIERLKQINVNLLGIVLSNVKY
NQIYYPYGYGYYGKTNVIKDVKQEPADNIVIPEVK
>gnl|bykdb|A0A354PCQ3 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetaceae bacterium] (length=761 residues).
MPSSSAAQFDPWILWVTFRRCWAWALPIGALLAGLAAFFVLRNFVPIYRASSLLEANQDYVVFQGVMPVVKNLAQTEKAL
FLNPIVLGPVLADADLRRAPSLSDPEIAEQNLRKNLSISGGGTASRLVVSYQDSDREAAATVCNAIVQSYLRQRDAFDSI
RVNNLERWLEPEIQRWEQEVAERRRVVQKLSEQTLGYAPGSKTSILENQGAIALLTRLRSQIAELTVELSVRDAQSAMQN
NLMQAESDGAGEVLQVAAEALVPDPVFQPRRKHPSESEIEQLVDRDPKVAEAKTRISRYKSIMINMEDSDLVRVRREYYE
ENRAKMKDWEQRLQEAKLAARDPAIEKLNRLADEELARRTAQAEFDRRLAEVQRQAEAEQGEINRKLSRDQLVTKIAVLR
EQYDEELTRMEQFGGTSAELQFAQEELAVSNSVLMKLRDRVAAIRTERRQDGAVRTLTLATPPSSPVTALPVKHMGMAAS
AAMMVPFLFGLLWELRMRRITDSSMCGELSVIGEIARLPSGTRSYKGRRIFEESIDSLRANLFLSTRWKDTRSIAVVSSI
SGEGKSSVASQLSLSIAKATGQTVLLVDADLRCPDQHRLFGLEMGPGFSAVLAGKASLLDAVNSRLGNLIHLLPAGQLTA
SPHRLMSPERLQEFMREALSHYSYVVIDTAPVLSAGETLAVASTMEATLLCVMRDVSRLDSIHQTTRRLEAAGASVIGTV
FSGVTSRQYVYRYGDYQYALSGGDIHDDEFSDDNVSLGKGG
>gnl|bykdb|A0A354PDV6 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetaceae bacterium] (length=790 residues).
MNREITSTGTDRQFNLNDQELSIDILQVLSRQRWLIVFCSLMGMAAGVLYSIQSTVWYRSTAAILVNSKNAGLESNATNV
VEEDILANHMQMLRSRKIVEGALTKDGLMDLASIQPLLTPAKGEDAADYVISQLEIVKGGAGAAKSARSLSLAFAHTDPE
ESRKILESVLVEYQNYIAGQLESVMSKANEYITHAKDEVESELRNAEQDYLTARKAAPMLFQGEGSSNVYQDKYRRVEEE
LLNVDIEESSLKTRLERVRETLGDMDLDGPLSEHLDKLALIDSESMQRLGLYASLQVNAASTADFQATQPARIAEAQTQY
NNVLQLMSEKQRLTTVFGPSHPKVKDIQDQIDLVKNFLDEKKDGTSVGAGAGMLSPEALLKAYVGFLEHDLATLTQRKRE
LTILAGNAESQAKTLIDYELQDMVLRKKIERQEKLFDGVVQQLRELDTASGLSGYVYELLETPRPGIRSWPKLSICALGG
LMLGLFGGLFLSIANDLRDSRFHSAVEFEQFIGLRTLGRIGKVNSMRQGVKGLIATELTPDAEAIRMMRTLLLMDVKSKK
LQTIAMTSPMQGDGKSTVISNLAVSFSQLGMSVLVMDCDLRRPSIHNFFSVKRENGLVDVLADELEPMEAIRDTDVENVH
VLPAGAPTSTPAELLQSPRFDQLLEILKEKYDVVLLDLPPVLAVSDPLVVAPKVSGVVVVFRAVTARKSEVANTLRRLSS
AGAVTVGSVLNTLGAQKEFSSDGGYYGYYRSGYSEVSVPQRSLQNGAIPSYNGRVGSVITTRASDIGSRD
>gnl|bykdb|A0A355AI52 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetaceae bacterium] (length=758 residues).
MLDHEKQELDSTAQSMRQAVRFLRVLWHRRIIIMSTLALCGMLGGLYYATAARIYEAKAQLLIVDTSRENNPTSMTGSHN
DVAAMATYEKLVSSPLVLQSASTLLEAPVRELFGSQDSEILAEIFSKSLSVRGLRQTNLLELNFRSSHQDATAVVVAAII
QAYAKFMDESHRGTANSIVDLLQNEKEEVDKKIQVKQEEFLAVRKKVGDLGIKEGGKTMHPLVERAIQLNSTLIETQKKR
LLLEASYQSLTEAIKAGQNIRQSLIAIEETLGKEAFLDSMGLGDRDKQTRISVEKQLLEDRAQLDTLQEYYGPNHPKVIE
RTRKIEQMQGYLAQFDVIGSPRSFGGDDTQLANTVANILNQRLESAERQEEWLQKSFERAKEESIGLTSDISQLDIVETD
LNWLRQLRNTLLNQIASVDIRQENGGVRTTVVREPVVAERPVSPKLSLTILAVLTGGLASGIGIIFVIDTLDDRARSPEE
LQAELNLPTLATIGILEEEDFEDGIGLETVHMWNISDDAAAESFRTIRTVLVMGTEDSERIAVTSAEPGDGKTTISSNLA
IAYQQAGKRVLIIDADMRKPGLTKLIDRRGQVGLSDILRGTEEVAEQASGLAIQTGSVPVDIIPAGRRPPNPGELLLGDR
FAELLAWADGEYDQVIVDAPPVLAGTDAAAVGRLCDGLMLVVRPEKNRRRVLIKAVETLRMLGVTLFGTIVNAVGLEEMG
YGYGYGYGYGYGYGDEYGLDDDGEYGDEEEEENYMRAA
>gnl|bykdb|A0A356A6X2 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetaceae bacterium] (length=776 residues).
MPAPENYDPQMNIQLQDNHNALQTILRFLQSLLRRKWTVMAWLTFTVSLGMTYFALAPRKYESSAELLVLHTGDGNVDQT
QQSQRTLQDYLPTYTKVLASDEVLKGALVRLPDTARTKFIGMTKHQAIEKLRSSLTVNTARQTNLLEVKYCSESPEESST
IVTEILNSYFKFMHEMHESSSGQMLDTLTKERDNIQNQILVKQSELLDLQRESDSLIGTGDNVMSVVNERVIELNHALAK
AQQESIQARSYYTAVEQAVRNGESLQQLMNQSNQTLANELMKLSAGVDSRDSYAYARLQQQLIEDESSLRDKLNGKLGPN
HPEVLELQERVKAARDWMNGRGQQASQDSKQLTRDMGPQMLEMAKQRYQHAVTHEQDIYQRFMQEKQLASQMNQRLMLLQ
LAERDLSRLQSDYDMMRDRINTIDLNKQSSLRTRITKHAEPNRTPVTPKLTNTLLLSILAGLFFGATTVLLLDLLDDRFH
SPDELKRELGAPVMAMVRSLPTLPHTHGLESIFTYTKPNSVETEAFRTLRTSIEFACENHQRISITSTQPSDGKTTVISN
TAVAFAQAGKKTLIIDGDMRRPGLTAVFALKGQAGLSTILRDTATIEESASKYITKTRLENLDVISAGPRPSNPVELLTS
ERFEELIGWAEGVYDQILIDAPPSLAVTDPAIIGRLVDGIILTVRPDRNKRRMILRAAESVTSLGGTLLGVVVNGLSDSR
GEYGYGYGYGYGEGYGEGHDDPTNEVEEEAIPISNNNSQRPRKRFSRDQSSDRYAA
>gnl|bykdb|A0A356EME5 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetaceae bacterium] (length=752 residues).
MSRRPDLSHSSLTERSAERAGPPAVSTSGMRPLNAPGVRKRTAGSSQEMSPRFLLNALLHWWKVAMPVGLILAAVAVAGV
WWFFEPVFLSRALIQIRENPPALVFAIEDKSSGYVETQKEMIRSARVLRPVVESPEIRSLPELQEKKDKVQWLQRELRLT
SVGKSEFLQVDFQGPDPKNAAKIVNAVVKRYFDLLAEVTDERVAKVIALLDREIANRKKHVEEKRRQIQTRTLAETGKDP
FATTLHAGSGANWPHPLAGLQTRLTEVEVEREVLEAEWKALNEMPNPLAQQVDEALAGNVTSAVETNPQVQALVQQIWMA
ETTLREMAALARNPSQDPQCVKLSQDLERNKKSLEQMRRELATQYQVQYRTAISAKREADLASKKFEIESRRRMEEALRE
RYEKELKKVAPGVADMVSIEFEQAELTRATDVLNLIEQRVVELRTERQAPARVVLFDEATPPDAPLVEIPLAKMGLAAMV
AFCVPFGLALGWERIVRRISGAEDLEHETNLAVIGEIARLPERSTKAGKTTSRRMAQKLRLYEESIDSMRTFLVLAEEIK
GARVLAVTSAASNEGKTSVAAQLALSLARASGKPTLLIDGDMRAPDIQEVFEVRKSPGLAEVLGGECDLHEAIVPTWTPS
VDVLPGGEAKQNVHKLVGNGELSAILRQVSQKYAYVVLDTPPILAASESLVLAKAADASLVCAMQDVSRASQVRTACERL
VAAGCRPVAAVLNGVSSRRYEYSYGYYESVEE
>gnl|bykdb|A0A356KTN1 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium] (length=713 residues).
MQAPQTGLESDFGRSPTISDPLDAEDLRETLLGFKRRLPLVIGVTLFFGVAAGVRSSNLPTVYASTARLQLAKEAPDPTR
ARYEMYSSDYVATEYLNTQMRILESHSLAVDAVKANPKIARELELELGREATPEELGGMFQRGVRVEALESTYLVDVSYE
STDPKRCDRYANAVAEAYREQLQTLWGEKTQIAEKKVSEQADLLYQKLTKSEQDLRDFLNQSAETPLLEEHEKLLVERIR
INNNALSDIQRQRIQLNAQLESIQRVLEQGRPLESASPIATNHIVLNLRNRLSEAELDLAGLRQRFSDEWHEVRIARARR
DQIKLQLQSEIEKIRERLRSERDEKVAVEQGLLERDRNLREESRVFARRSRLYESLKNEVDANRTFYEEFASRLKDLLHA
APLAVANARIIDRAKGAWRVRPSHSRNVILGLLFGFGLGAVIALIFERLSDRLRTLKDAVNALGIPVLGVVPHQREDEVE
LLALRESRSVYAEAFRRARVQLNAVGAFPSEGCGVLLCVSGIPREGKTLSALNLAIASAQAGRRTLLIDADMRSPRVHRI
LGQPLEPGLADAIEGKVEDLGERLRRTQVENLWVMGAGRCEANPGELLARDDTFHQLVWRLRRRFDRIVIDSPPVVAVSD
ATLMAQAADAVIQVVSARTSSRSAATQANTELSRLGAAPVGLIFNQQPQDEAGAYFYYYSRYGYGGEPKDEES
>gnl|bykdb|A0A3A0DET7 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium] (length=802 residues).
MSAVRTLSRLTECRGNGRVLCGALFRLFGDGKPDGLPLPRHLATPSAKDPPPPMSSLIESDSFSVGEPTSYGAPHGRAAR
TGREVSPLALAWRNRWLLLLTTLVGGGAAWATVQRVTPRYTSVSRLYVERALPRVLESEAPVVQSATYLYTQAELIRSTP
VLAAAADAPENANLETFHGVDNRVAFLRDNINVGVGSQDDIINVSAELPNAADAAQLVNSIVDAYVSKYAEQRKTNTVEV
LTILRNEKHKRDAELAECRKALDDFRQQHMELAVQLEQGNVVTQRFSSLAEELNSTEIELLQAKALFHRVKSMYDTPKQR
PFLLDMAGDDQQALRDIELERQVQEVEQALASERARWGEGHPRVKLLRQSLAELRDKLTKMQEIVIEAYVESVRQQYELL
DQKRSELQAAYDASFAAATQASSLLVQLNSLQEAYERTANMCDILDERIKEVNLTEEFGAMNVSILEVAGPATIPSYPSR
ARFLAVGLMLGGVVGFGLAWLRELLDHRLKSVDEISEVVQLPVFGVVPQSSASADRALAGQLVLQAPRSSVAEAIRTLRT
ALHFGMAGEDVKVLAITSPMPGDGKTTIASNLALAMAQADQRVLLIDADLRKPSQHTIFDLSTEKGLATVLSARMPVGDA
IVRLRESSLEVLPCGPLPANPVELLNNGYFAELLESLKTRYDRIVIDSPPVLPVADARVIAAVSDATLLVLRAERSTRRS
AIGARNELWRVHANRLGVVLNSVPLRKQAAYGYGDPYGYGYGHQYGYGEYAAIEEASAPDRGRKKSRALVKAATEPAITS
QE
>gnl|bykdb|A0A3B8LXG8 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetaceae bacterium] (length=745 residues).
MSPSPDDRPIAAPNEPQTATLAAIVRFLQVVRIRRGILFCTLFISTVLGGLYFATATRLYESKARLYVLQMGSNVLQNDQ
ENQGGVQENMATNQGVLTSDVVLEEALQKLPAKHRIDLKGIPRSKWTEALRNNLAVTAPRRTNLIDVRYRSRDPQVAATV
VNHIVESYLTLMQGIHKNNAGNDIQFMTAEKKKLDEETNRINSELLDLKRQMQIISGPDNQSINPAAERVAALNKELIVA
QNRTREARATLEAIVDAAARGQNIEQFAMQHLEVVGKEFLLRRMGLDSQDSWMVMRVRQQLINDQVELQNKSGEYGPNHP
LIQKLTTRIRDRQKWLAERPKSVVDQMQKLSEAQLTPSLIDMSRQRLRYAESRETALRQDFERENRTVSSYEYQMSRIKL
LNFDLARKRELSVALIDQINRTDLGKERGGLRTKIVSHPKAAKLPVTPRLLVVALCALACGLGGGLSVIYILDVLDDRFR
SPEELRLQLDVPVLALVGEMPVTDEPGLSSVRMLSEPNSTDTEAFRTLRTALSFAGRPTQQLVVTSTEPGDGKTTVLTNL
GVAFAQSGKRTLVIDADMRRPGLTRKLNLKGPRGLSTILQSEEPIGISAASNLLATELNSLDVIPAGPRPGSPAELLHGG
RFAELIAWAESAYDQILIDAPPTLAVSDPAIIGTMVDGVLLVVRPGTNRRRMVLRAAESITAIDADLLGVVINNVDSDTG
SDYDGYGYEYGGEDEPASSPHRLAA
>gnl|bykdb|A0A3B8PNV4 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetaceae bacterium] (length=745 residues).
MSQSPDDRPIAAPNEPQTATLAAIVRFLQVVRIRRGILFCTLFISIVLGGLYFATATRLYESKARLYVLQMGSNVLQNDQ
ENQGGVQENMATNQGVLTSDVVLEEALQKLPAKHRIDLKGIPRSKWTEALRNNLAVTAPRRTNLIDVRYRSRDPQVAATV
VNHIVESYLTLMQGIHKNNAGNDIQFMTAEKKKLDEETNRINSELLDLKRQMQIISGPDNQSINPAAERVAALNKELIVA
QNRTRESRATLEAIVDAAARGQNIEQFAMQHLEVVGKEFLLRRMGLDSQDTWMVMRIRQQLINDQVELQNKSGEYGPNHP
LIQKLTARIRDRQKWLTERPKSVVDQMQKLSKAQLTPSLIDMSRQRLRYAESREVALRQDFERENRTVSSYEYQMSRIKL
LNFDLARKRELSVALIDQINRTDLGKERGGLRTKIVSHPKAAKLPVTPRLLVVALCALACGLGAGLGMIYILDVLDDRFR
SPEELRLQLDVPVLALVGEMPVTDELGLSSVRMLSEPNSTDTEAFRTLRTALSFAGRPTQQLVITSTEPGDGKTTVLANL
GVAFAQSGKRTLVIDADMRRPGLTRKLNLKGSRGLSTILQSEDPIAVSAAGNLFATELGSLDVIPAGPRPTSPAELLHGG
RFAELIAWAESSYDQILIDAPPTLAVSDPAIIGTMVDGVLLVVRPGTNRRRMVLRAAESITAIDADLLGVVINNVDSDTG
GDYDGYGYEYGGEDEPASSPHRLAA
>gnl|bykdb|A0A3B9CTT0 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetaceae bacterium] (length=754 residues).
MELEQPEQSASSQGNSLQGLLRFLRVVNRHKLIIVGFVAAACFLAVVKHNRQPQIYEAGTKMLVRQTGSDMANFGAPLEA
AMAGYKHLMLSDKSLTQTAENLDPKPPELSGVDSLRWPGELRKMLTVKFNSASQDLTISCRSRDPESTVAVIEALQEVSE
QFIEDYQTSLTVTLMNRLQEDRRGVETKLIEKNKELLEERRDCGDIVINKNSTQSHPLVERVGQINQRFTELRSQRMELE
AAMKSARRLVATQADLTPAVQALQRIVGPEVMQQVPGRPGLDVKAIETLEDKLNDEQGELSVLRRHYGSGHPEIISRTSK
IQLFEQRVKAARADLDRRLQIGIRGPEAGQWLMDSLQAELNSIQQFESSLQEEYNEVRAEALNISNKLASIDFKEREIES
LTELRSSLLNRLNSIKISENATHFKVAVLSDAMVPRTPSLESLNSRLIFYCVLAVMAAMGVIYVLDLMDDRLRTPEDVQD
ELGLPVLGIIRRLPEEQLSQCKIYLEKFAQTVQAEAFRTLKTAVTLTAQQSKCLAVTSTDAGEGKTVTTVNLAASFAQTG
QKTLLIDADMRRPGLSRLLEVRGNGGLSEILQADGGIAELASERVTPTDVDGLYVLPCGPRILNAGTLLSMPALSELLDW
AVANYDQVMVDCPPSMPVSDAAIVGRYVDGLLYLMNPATTHRSMISRTVDTLRSLDLTPVGVVVNMGLSSEKEGQGYGYG
YGYGYGYGYESQYGYGHDEDDDEYDQMTDGELAA
>gnl|bykdb|A0A3C0AGX3 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetaceae bacterium] (length=791 residues).
MNTDFQPLDQQSDFAIDGMEENAEINSSGPGVDIVRLLLRNKYLLVLGLAAGLLLGQAAYMKLGPIFSADTKIQVSQKNP
VPIKEGEIQTFGELTAHIDVIKSPRIVGEAVKEARLNQLPSLAGEKDPTQDIIDTLKVKRISGNDRAFLNILTITYENPN
AKDARTVTQAIVDAYKRYLHEVREENTEDIIQQLKEAEKQIAAELELKKNEYKKFRENAPLYWESTPGSEAAVAGSTNVH
QERVKAIDNERRLNLLKLTELKSKIDSLKAAIASGESKETLELLAQQYLMGQTRGQAANGNASEGHHLATPGTSQLDRAR
TALETHLMPLLIQKNRLERDFQKNHPDLDAVNRSIETIINLYRRQGLDISADNLESGEFQVAETKDVDFVNVYLKSMEQQ
LKELENRELELTKLFTQESELAKKVGNFQVIDQSYNEEIAQLKSQRDNIFKQLLVERVSQGNSGYMLTQLAPVKDELVIK
RQLKFLMAGAAGGLGLILAFSYFREMRDTTMKSVDEIRNQLHLPILGEVPCFADSDAAVDESEFAPALWYYYRPASREAE
AFRSLRTSLLLKTDRSGAKVLQMTSAEPGDGKTTSISNLALAIAQTGRKVLIVDADLRRPTIHKLFGLANSVGLGDVLTG
EIDAQTAIRETRVSHLSILTAGMLPENPSEMLMSRAFSELVNQLRKEYDYVLIDTPPLVVVSDPSVIASMVDGVLLVVRI
DKNRRGVIRKVQQIIQTNGIKVAGILANSVKSGKPGDYDYGSGPGYSDYYIVPPQAQAKQADVPAKTKITH
>gnl|bykdb|A0A3C1X4W5 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetaceae bacterium] (length=758 residues).
MTEQDRILTGSQDGQNAAATTLHLIFRFLRTVRLRKGILVAALVMSTILGMTYYITAERIYESTASLYVVRKGSGVTADA
TSTSANPVTEMPTYIALMSEEEVIARALKILPEKYRRVDLEGYPQSAWIRKVRDNLQASSAYNTNVMDISYRSRDPRAAA
AMLTAMLAGYERWLNETNQGLSEQGLKTLGTRLEVIEQEVKSLQARRLQLKASAPELVDTGERNQNSLNTISKNIELLTQ
EYINARRRTEEARTTSQELQRAIAGGEDILQFAMEALDSAGRQLVEQSMGLGTQDSYHVQRIMQEILDLQSHLTEARQKY
GARHARIRALEAELQVKEKYLADFPEMQRTRTDTMTRDVLAPRLVQYLNQQILKLELNEKAVSERLAAEQSRAQKLSQTL
TELGDLDRQIEHLYEQQSSLQSQSDGIGLNKDTFLSTKVSSRPTVPIRPVSPRLPIAVLLSLLIGTGTGLAVIWVLDIMD
DRFRTPEELKLHLDTQVLSMIPRMSELPGEGFDAVMCHVRPHSREVEAFRALRTSIEFSTQDTNRLVITSTEPGDGKTTV
SMNLSVAYAQSGKRTLVIDADMRRPGLSTLLGLRDDVGLSRLLRSADDLETAIAANLRTTVVQGLDVISCGPRPVNPAEL
LQSERFAALLSWAETRYDQIVVDAPPVLAVSDPAIAGRLVDAVVLVVRPDKDRRRMVIRAAETLRTLGCTLLGVVVNHLN
LDDAGGYGYGYGYGYGYGYGYGHDQEPDEQSGAGSQPS
>gnl|bykdb|A0A3D1DR40 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetaceae bacterium] (length=745 residues).
MSQSPDDRPIAAPNEPQTATLAAIVRFLQVVRIRRGILFCTLFISIVLGGLYFATATRLYESKARLYVLQMGSNVLQNDQ
ENQGGVQENMATNQGVLTSDVVLEEALQKLPAKHRIDLKGIPRSKWTEALRNNLAVTAPRRTNLIDVRYRSRDPQVAATV
VNHIVESYLTLMQGIHKNNAGNDIQFMTAEKKKLDEETNRINSELLDLKRQMQIISGPDNQSINPAAERVAALNKELIVA
QNRTRESRATLEAIVDAAARGQNIEQFAMQHLEVVGKEFLLRRMGLDSQDTWMVMRIRQQLINDQVELQNKSGEYGPNHP
LIQKLTARIRDRQKWLTERPKSVVDQMQKLSKAQLTPSLIDMSRQRLRYAESREVALRQDFERENRTVSSYEYQMSRIKL
LNFDLARKRELSVALIDQINRTDLGKERGGLRTKIVSHPKAAKLPVTPRLLVVALCALACGLGAGLGMIYILDVLDDRFR
SPEELRLQLDVPVLALVGEMPVTDELGLSSVRMLSEPNSTDTEAFRTLRTALSFAGRPTQQLVITSTEPGDGKTTVLANL
GVAFAQSGKRTLVIDADMRRPGLTRKLNLKGSRGLSTILQSEDPIAVSAAGNLFTTELGSLDVIPAGPRPTSPAELLHGG
RFAELIAWAESSYDQILIDAPPTLAVSDPAIIGTMVDGVLLVVRPGTNRRRMVLRAAESITAIDADLLGVVINNVDSDTG
GDYDGYGYEYGGEDEPASSPHRLAA
>gnl|bykdb|A0A3D2TNK4 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetaceae bacterium] (length=804 residues).
MTDLNTSADIQSNFEASAESELVPTIMRLLRMLMIRKKTIIISLYLFAVCGVIYYYFAVRLYESSAKILIDEKNQDRVAT
VGDQSIVSNILDTHSDLVTSPVVIEQAIEYLAPEHRTDIEGMPPSTWVRIIGSRLHTRVTRKKSFIEVTYRSKDPKTAAA
VVRAIIRAYLAFVEKHHKGTAGEIIADLTNERNQIQASLKSKQLQLQKFRQEVGHLAVSTEDGVIDPKIQRVMKLNEVLL
TAQEKRLSLQANLATVETAYNRGEDLNQHLMHLEAPLGQQVLLSSVGVSPQDMQVLGDQQKKLFTAQQELQNLSMHYGPN
HPRIIELQQDVRSLDQYINNYHSGAGDRLEAMGKSIPKEVVVNLLRQSTQQAIEKEKQIRQAYQQARAEAAAYSGSLVQF
RALERAVARDEAKSDILTDKIANIDFRQNQAPIRATVVREPIANNNPVTPQIRLIAAVCLLGGTCVGVVMAYAQDVLADR
FNSPEELTLQLGVPVLAMVKKLDALNGENLETIHTHACPNAPETEAFRTLRTVLSLSEQNCERILISSSEPGDGKTTISA
NLSVALAQAGHRTLVIDADLRRPGFTTLMQLKGQPGVADLLTSPETPAQSAPPLIHSTIVKDLDVLPAGLRRPNPAELLS
SKAFIELLAWAESKYDRVIVDCPPVLAVSDAQIVGRLVDGAILVVRPEKNHRRSVMRAVESFHATGCHVFGVVANGLSSD
SSGYGYGYGYGYSYDGGYSHEEEQDMVDTADTMMTPMPEIVQLPSIASEEHLPSASPQEHQSHETPFQTKSANSTTPLKP
RRVA
>gnl|bykdb|A0A3D2U1E1 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetaceae bacterium] (length=749 residues).
MSTDQSHPNRPLDETAPQAATLTRIVRFLHVVRVRKGLLFASVFVAVLLAGLYYATAPRLYESSSRLYVLQMGSNVLQES
MESQGGVRENMANYQGVLTSDLVLEEVLQKLPAKHRVDLKDVPRAKWIDALRKQLGVSAPRRTNLIDVRYRSRDPQTAAA
IVNHVVNSYLKLMREIHKSTASEDVEFLTKKREKLDEETNAINAELLVLKRQMQIISGPDNQNINPAAERLQELNKHLID
AMNRTREARATMQAIREAAARGEDIHQFALQQIEVVGKEVFLRQMGLNPQDSYLDGRTRQQLINDQVAYRNDSAELGPNH
PRMQMLSARIKARQQWLSKRPTDISAQMSSLAKDRLTPTLIDMSAQKLRYAELREQALRDDFNRESQVVSSFEALMGRIR
LLNFDLARKRELAIALATRISRTDLGKERGGLRTKIVSQPKVAKAPVSPRLLIVAFAAIVGGLGSGLGLIYVLDYFDDRF
RSPEELQVQAGLPVLAIVGELPPGNAETKGLDAVQTFAEPNGSENEAFRTLRTTLAFSSEPTARLVVTSTEPGDGKTTVL
ANLAVAFAQSGKRTLLIDADMRRPGLTAMMDLRGQQGLSSILRSNLPPDTATQGNVFSTHLEHLDVIPSGARPANPAELL
HGTRFSELLAWAESIYDQILIDAPPALAVTDAAIISRQVDGGLLVVRPDKNRRRMVVRATESLAAVGSTMLGAVINHVTA
EAGGDYYGYGYGFEYGSGEESSDGLKQAA
>gnl|bykdb|A0A3D3UVZ8 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Phycisphaerales bacterium] (length=825 residues).
MNELEKYHSQATGQEIVNLQIPPEQESEATSDLVAGILRRWYIVLLILILICGSGLPAVWFMVKPIYDVTGAVRVAPILA
DILSGEQDRGEISNYESFMNTQAEKITSNSVVQRVADDLVGKNLFFFEAEPNDLVSNWKRKILGTKKIDPAMKLKLAIVE
DETITVAADRRSELINITMRSANEEEAKQIVDAFIKAYMEIEVVSADEDENRQLAILENRRDYLYEKIENDRQTIYQLGQ
EYGTVALEGRQDMMLQRVASLLDTLTSVEAKRIELEAQVLLLERTREQPISPEELLKMRQDYINQDPAVVAFTGNITQLE
QDLIIAQQTLTAENPELIRKNELLKTLKKHLEDRKQEASNAFDNLVAKESAVAGNKQLVAKRSELEQTREYEKRLQETLS
QQDTQTIGIGRKQLTIQELQEGLESTKEAYQIVLKRIQDLELQRKRPTRISVHYNADIASINDKRVKYSVALVFGSLVCG
MGLAYLRDKADQSLRTPDDVAKRIGIRIIGTTTSLNTVKPALLPEQIVGDYQTIRANLKLLGGRGIPKKLVVTSPGMKEG
KTTFSVNLATSLSESGKKVLLIDGDLRKPDVARLLNLPKGSRGLQDVLCGVKFEQAVFSVASTGLDVLAADFQDSADAYE
MLALPSTAKRINAISRKYDHVIIDTPPALVFPDALMWAKIGNAVILVSYAGHTTMPDLKEAKERLLQINVKVLGTVLSSV
QAEHSYYRHGHSYYAQSAQTRESARVSRRKLMFSMEEGADNTYDSKIPESDKPGEGFSYSQSVESRKSVMRKRTRKKPPV
SNEDIADADNTDTSETDSENRPTEA
>gnl|bykdb|A0A3D3W3A7 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetaceae bacterium] (length=798 residues).
MTEQDRILTGSQDGQNAAATTLHLIFRFLRTVRLRKGILVAALVMSTILGMTYYITAERIYESTASLYVVRKGSGVTADA
TSTSANPVTEMPTYIALMSEEEVIARALKILPEKYRRVDLEGYPQSAWIRKVRDNLQASSAYNTNVMDISYRSRDPRAAA
AMLTAMLAGYERWLNETNQGLSEQGLKTLGTRLEVIEQEVKSLQARRLQLKASAPELVDTGERNQNSLNTISKNIELLTQ
EYINARRRTEEARTTSQELQRAIAGGEDILQFAMEALDSAGRQLVEQSMGLGTQDSYHVQRIMQEILDLQSHLTEARQKY
GARHARIRALEAELQVKEKYLADFPEMQRTRTDTMTRDVLAPRLVQYLNQQILKLELNEKAVSERLAAEQSRAQKLSQTL
TELGDLDRQIEHLYEQQSSLQSQSDGIGLNKDTFLSTKVSSRPTVPIRPVSPRLPIAVLLSLLIGTGTGLAVIWVLDIMD
DRFRTPEELKLHLDTQVLSMIPRMSELPGEGFDAVMCHVRPHSREVEAFRALRTSIEFSTQDTNRLVITSTEPGDGKTTV
SMNLSVAYAQSGKRTLVIDADMRRPGLSTLLGLRDDVGLSRLLRSADDLETAIAANLRTTVVQGLDVISCGPRPVNPAEL
LQSERFAALLSWAETRYDQIVVDAPPVLAVSDPAIAGRLVDAVVLVVRPDKDRRRMVIRAAETLRTLGCTLLGVVVNHLN
LDDAGGYGYGYGYGYGYGYGYGHDQEPDEQSGAGSQPSLSGYGMTSGQSATAGQSVSAGLYSISVGGSRGSGDSSRAA
>gnl|bykdb|A0A3D4PJK1 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetaceae bacterium] (length=780 residues).
MKPSSDKNSRNVDTVHGHPLVKADEPAIDLVKLALKNVVTLGIAAAAGIGLGIFAYKILGPKYTASSQILVKLKSPIEIR
EEGNRIIAGERSAHVEIIRSPKVVERAVRDSQLDQLATLAGSEEPARDIIDSLKVSRTAGEDHHQLNILNLQYTTSKSKD
ATAILNGVIKAYDDYLKDDARKNHAELQTLLEQINNDLSPRLAAKTKEYHEFRRNAPLVWKAPAGADKGPNNVTNIHHQR
VDAIATERVKVELLYEEISSRLSTLKSAIERGESHEALMLLVKTFLQKDQTSNSQTVVSGATERQQLDSQLIPLLLEEQA
ALKRYGSGHPDVINVRKRIDLVKSYYRQMGIDLPTMTTKVNPATGESELVTGNDPIATYVVALEQQQAELKNRIGELQKL
FDRSADQAKDFAQYEEREQTLSDELKRIKSLHDIVANRVEVLSLAPDEGYQLTQISPSRAEPDIKHVIKIVGGCLVMTLM
STYAFLFLREMRDTSVKSLADLRAIVDTPILGTLPSIANPAKNLQAARETGLAPMLYYYHDPGSPEAEACRSVRATFFVR
AADVDAHIIQFTSSEPGDGKTTTISNLAISIAQAGKRVLLIDADLRKPMVHQLFGMREDIGLSECLSGEIEMANAVQDSG
IENLHILSAGAIPAKPAELLSSSKLHYLLGQAKRDYDFVLVDSPPVLAVSDPCITAQSVDTVMLIVRLHKNRRPSVKRAL
EMFEAHEIPLLGVIANGLQDASGDYQYRGGYGGGYDKKSPYQQTNDIPEFLAPTQAVIPS
>gnl|bykdb|A0A3E0MY27 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium] (length=774 residues).
MSNPIDPKKPSERPLDVVSERPGEGALPVPTSGKDAVFDAIQTSTPARVRPEILTAPPKPMDLLRALQRRWLLAFVLGCM
LGIPAAVITWFVVPIEYTAEAFLQFNDEEVIIDAQSRSDGRRIDDPLQTHIQLIKSPFVINTALSEPGIADISWLKEVKA
EGEDQVAWLNERIDVVNPRMTAVLRISMSGDEKEPVRMIVEAVAQAYLENVVRRERNDLLAKLSELERQHQELEADIGRR
RKRYNDMVAEVDVFDGGQADANRELLMAEQKSLREEIGLIRIDILRQQLQISQLQRLEANDPEQVRQRLISNTLAADQQY
GQLRGVVERLRDQEQEMMKLIKNPDRSEVMKRLREQIAEAEKDLAKREADVTLEIEEQEIIPPEVAQLNLLQNSLTATQE
HLAKLQEQSKTLQQRINELTVFKPELERRKDELERLESVSNELGLRLQKLQLELSVQKPKVSLRGEATVPAMYDSSNRDR
YTVLAALAGFGLAIVGVSLYEFQFRRLSSAHDMTEGLGMTVMGDVPLLSERPWRLPGMSGIDPISLQGMMDESVDSIRSL
LLHSASCESVQVVMVTSANSGEGKTTISSSLAASLGRSGRRTLLIDGDMRRPAVHRMLDLPLDTGLSEVLRGEAAVEEAI
RPSRAPGLWVMPAGRCDHESIQSLTKEILGATLEQLRAEFDIIVIDTGPVLSVVDPLLIGQHCDGAIVSVVRRVSQISNV
YETCQRLQGTGIRLLGSVVNGVSGSQVSVGYYGYGYGYEDGYGREELSHEVAES
>gnl|bykdb|A0A3E0MY88 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium] (length=797 residues).
MSHAPDKLDLEAIGTLDDPSVSHIVHHVVQFLRVVRSRINILIIAIVVSSLLGGLYYATATRYFQANASVLIIRNGGSEG
SSSMGIDGENRRYMPTHEQLLKSAVVLSGVRQLVEPSHQVDFQGTRGPGVGVLASNISVSTAKGTNIIHVRYQSKDPDAA
EAVLNSLLTSYKNFIKSTHGRTAEDVMEVLQQEKIQLKGEIDRKKERLLEAQRRFGDFTNGGETDHVHPLVERALALHTE
LTVAETERIKHQAALESIRAAIHSGADLNQFLMSAEQSVGRSVLMTALGINDRDVVGHTNLERTLLQDRATVQGLLENLG
PNHPRVKEMTEKIRMTERHLAEYGERIRAQVGTLQSTTFGPTLTHMMEQALASAWHRENQLRAAFAEAKEDAVRLNRDLH
EIQFLEREIGQLSNLYGALADRIASVDLAKDQGDIRSEIIKEPAASRVPVSPRLKTVAAACLFSGLVIGGVVIFVLDTLD
DRFRSPEDVTMRLGAPTLAMVAQLDMTHQTGVEAVHTHVDPNSPECEAFRTLRTALSFNPEETQRLVVSSAEPGDGKTTV
LSNLGTSIAQSGKKVLMIDADLRRPGLTALFALKREHGLSDVLNAPEPVEEVATRYVRGTGIPDLDVLPSGPRRPNPAEL
LTSRRLADLLAWAETHYDQILVDSPPVLAASDVMVIGRIVDGLVLVINPAKNRRRLVTRAYESLRTMGVTVLGIVANRID
QDQSKGYGYGYGYTYSYNYGGSDEETHHVEEPLPHAESPELAAPGSVSFELDSTAPWPPQTQQQVVHDGTTVPRKVA
>gnl|bykdb|A0A3L7NDH9 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium] (length=806 residues).
MQENMSYSGSADGPHVDAMAQIVQNSMRFLQVLWRRKHLLVASCAAAGLLGGLYYTTSKRTFEAEASILIVGSQGDSLDT
SLTGGRNDPTAMATYEKLIASPLVLESAAKLLDGPTRVALGSQDPEIVAVILKNHLKIKGVRSTNLIDLKYRAQDPRAAA
MAVGAIIKAYSLFMQETHRGSAGTLVEVLTKEKTDVDLRLQKTEAEFLVIRQRVGDLGIKSDGKVMHPLVERAIQLNAAL
IEAQKKRLSLQASQASFQTAIQNKQNIRQSLMAIEESLGKEAFLDSVGLSSRDKDTRTSLEKQLFEERTQLETMLEFYGP
QHPKVIERTNKIRKIEQYLDQFDGVAAPREFAGDDEKFAQMISQILDQKVSAAVQHETWLTQSFEQAKQDSIGLASEMAR
LDIADHDLRWLRELRNTILNQIASVDLRQEHGGVKMSVVREPLVPSKPVSPNLLLTLVAVLVGGGAVGIGMIVVVDVLDD
RIRSPEDLQTFAGLSLLTMMGSLEDEADRDEEGSGLESTHMHKSNDDAASEGFRTLRTVLAMNGSQSQRIAISSSEPGDG
KTTASTNLAVAYSQAGKRVLLIDADMRKPGLTKLVGFRSMPGLSDILRGNQPVSDHASACIRRSGSVPIDIIPAGQRPSN
PAELLLSERFSELLSWAETTYDQIIVDASPVLAGTDAAAIGRVCDGLVMVIRPEKNRRRIIVRSVQTLRAFGVNIFGAVI
NGVGIEADGYGYGYGYGYGYGTPYGDEVEEESIDDAFVTDDALADHEDSNVDDGSDPGVEDRVLPMNPRSGTSSRSRGAS
NPRAVA
>gnl|bykdb|A0A3L7P4E4 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium] (length=740 residues).
MSEFVPPSNPNVEPEEAGFDLWGFLCRRAWLGFFFGTIGATAAYYYYLRQPVVFKATSQILITKQQAEMPVNTVNGLAPN
GRSDPLASDIQTIMSELTVRPAISDGRLRELPSLSGASNLTQTILNGLNAERTVEDGQVLDISFKGTDPDDCAKVVNAVV
ASYDKNLRETYTDQGMVVSNLLKDAKEEWLTTLRKCEDEYAEFRKSSSLIYNGENVTSLSESRMAGIEIERSKVMIAQTE
IQSQIDAIQKALERGGSREAITLMLESFNDKKKSGDGLETSLTPTQKFTREIFQLELEEALALQDHGEDHPKVRSIRKRI
EMTRKYLSNELSDQIAPPAKKMDFLQVYIESLHQQKKAGEERLLQLNSLFEEEQRIAKEQLDLQIKDKRYRNDIARSELT
FNAIVSQFKDADLAVKAGYHRTQVLAPATRGYQVEPNFQKCIIVGSVAGIAVGLLLGLLVEAADKSFRSPDDISQTLRLP
IVGISPQIQLGRRDRTNPIDPAIVTIHRPRSQSAEAFRGVRTYLMAATRGEGHRIVLLTSPEPGDGKSTMSSNLAVTLAQ
TGKSVLLIDADMRRPTVKRLFSLKNKMGLSNLLGDVSLDVNECIESVTFEGSTLDILSSGECPIDPGERLMSDRMESLLN
MLRDRYEWIIIDSPPVLAVTDSATLSRLVDGVILVVRMNGRTRMGAVRAAETLRTLGANILGLIANGIDPTKHGGYGYQY
GVYGAGGRASKYYAEAPNKR
>gnl|bykdb|A0A3L7PEB5 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium] (length=740 residues).
MSEFVTNSPNAEAEEAGFDFWGFLWRRAWLGFLFGTIGATAAYYYYLRQPVVYKATSQVLVIKQQADMPVNSVNGFDPSG
QSDPLASDVRLILSEVTVGPAITDGRLKELPSLSGSPNLPMTILAGLSATRTVEGQILDISFKGSDPVDCAKVVNAVVAS
YDKSLRESYADKGTVVAKLLTNAKDEWTTNLRKLEAEYAEFRKTTSLIYNGESVTSVSESRMAGIEAERSKVLIAQTEVQ
SQIDAIKKALDRGGSREAITLMLESFNDKNNSGEAVEKALTPMQKFTREIFQLELEEELALLDLGEDHPKVQSIRKRIEM
TRKYLSNELDETSSTTGPAKKIDFLEVYVESLQQQKKAGEERLLHLNQLFEEEKRIAKEQLDLQIQDKRYRNDIARSELA
FNTIMTQLKDTDLAIKGGNYRTQVLAPATRGVQVEPNFQKTMIMGSALGVLVGLLLGFLVEAADKSFRSPDDISQTLRLP
IVGISPQIQLGRRDRTNPIDPAIVTIHRPRSQSAEAFRGVRTYLLAATRGAGHSIVLLTSPEPGDGKSTMSSNLAVALAQ
TGKSVLLIDADMRRPTVKRLFGLKNNTGLSELLDEVPPDINECIQTVSFEGSNLDILASGECPIDPGERLMSNRMENLLS
MLRDRYEWIIIDSPPVLAVTDSATLSRLVDGVILVVRMNGRTRMGAVRAAETLRTLGANILGLIANGIDPTKHGGYGYQY
GVYGAGGRASKYYAEAPNKR
>gnl|bykdb|A0A3L7SI46 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium] (length=795 residues).
MSSDFVEIQDSRLGGLSDLADDKVSAKLHFISHWLFRMNTNERLTSDLDSTANGPNLLGEAVRFLQVIRRKLPTLLVCTI
LGGVIGTAWYVTATRKYESVSEIMVLKTDGNVLDTTNQSNQRSIQDIMPTYQKVLTSDRVLEGAITRLPNAHRIDLKGTP
KSRWTAVLKKNLTVSSTRLTNMIQVRYVSKNAKTAKLVVDAIVAAYLEYMNEIHKGNSKESMVLLNREKAQSEVAIRNKE
TDLLGLKRDSGILLHGNDKNSHVIIEQTVKLNDALIEAQKKTLESRALLISVQHALAEGNDIQPYLQQAAGDISREFLLQ
ELGVGANDAYTVAKHQDELLQDQAELQNRLMTLGPKHPTIRQLEDRIQQTQTWLSERRHVVSSAMKDVRERELGPKLLEM
VKQRLYQAGAHEQAIREDFEIIRSQALSLNGQMAQIDIMEMDLKRMRLYYDLILEQMKKIDIGADSGLKISVPTVAKVVP
SAVAPKISTTVFLCTLFGLMSGMAIIYVIDVLDDRFRSPDELQTQLGLPMLAMIREMEALDGSGLDAIVTYAKPDSLEAE
SFRTLRSSITFSTSNTQRLVMTSTEPGDGKTTTLANLSVAFAQAKKKTLLIDADLRRPGMTQLLELKGPRGLSQILRETT
PVAECCLENIFNLGIENLDVMPSGSRPANPSELLASDRFNDILAWAESAYDQILIDAPPVLAVTDPAIIGRLVDGAVVVI
RPDKNRRKLVLRAVESFRMSGVEVIGIVANHIGSKSNSEYGYGYGYSYGYGHDDRSDTTTEATDDEYEVKTPMAA
>gnl|bykdb|A0A3L7UQT9 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium] (length=774 residues).
MNSDVQQPAPAPILNTANVVAGMIRFLHAVRVRRGTLLAALLISASLGAAYYLTATRMYDAHAQVRIVQSERNHDSLTSS
PQSSQANSDVFQMMATYQRIMSGDRVLSAALEDLPKEYCVDFEGFNPEVWPTLLKNHVSVTNERGTTLIDVRYRSRSPKV
AAFIVQRIVTEYINNINRTYGNQTQDAVAKLTEEKKETSRKLTEKNQEFLELQSQTGNIYDGEGKSTNLLSLRVVELNKL
LIEAQRVTLDAWSFLQTVEQAARTGQDLQQLMFQAVETLGASILSKQMGLGEQDAWAVAKLNEELQKLRNDWNDRRNVLG
DNNPDLLELAQRIRAHEDLVNNYFQRAKMNLTANSADLGPQLLGMARQRYQLAMSRQHTLQQQFDREKSEVANHNTLMAN
LIIVEMERNRLQANDESLLKQIEKLQLVSGEGIKVDLNKLPKAGKLPSSPRLVLVVAVCFILGIGGGLGLIYILDLLDDR
FRSPDELRMQLGVPVLAMVRAMEPTGGTGADAVLCHAKPNGVETEAFRTLRTAISFSDRQAQRIVVTSTEPGDGKTTVMS
NLAVAFAQSGKRTLLIDADMRRPGMTALLGLKGQQGLSQVLRDERPIAASVAENLFTQITPGLDVIPSGSRPSNPAELLA
SERFSELLAWAETCYDQILVDAPPVLAVADPIIIGRMVDAAVLVVRPDKNRRRMVIRAAEAFSAVEVNLMGVVVNHLSSD
SSGDYYGYGYGYGYGYGYGYGYGHDDANAAAESEHEAGDEEPASDEVQPLRRAA
>gnl|bykdb|A0A3L7V1F3 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium] (length=776 residues).
MSGPENQILGMQEQGQNTAASTLHLMFRFLRTVRLRSGILVATLVISSIAGATYFITAQRIYQSNASLYIVRKGGNVTEE
TPNSGSSANSDMPTFIELMSRDEVIVRALKTLPKNARVDLVGYPEGQWVRTIKDNLSVSCAFSTTVLDLSYKSKDPKAAQ
AVLRSMLAAYVEFLDDTHNGSSEESIRKLKQQLKDDNERLTLAEAERLRLRNSAPELVETGDKNSGLSIVSETIRLLNID
YSAARRISEQSRTQFDGLQRAIASREDILQFANKTLDTAGRQLIEQSMGLGSQDAFLIQRINQELLDLESQLSDARTRYG
ENHSKIKALTENIQLKKKYLEEYPRQQQQEMKRLAETELAPRMIQYLRQQMESNQQNEDAIRAQLDTEKNKAQRLGQILA
DLARNERENLRLSERIQEYQNQVDGIGINKDKMVITSIPRKPTLSTRPVNPRLAITGILSLMLGSIAGLGIIWVLDIMDD
RFRTPEELKLQLDTQVLSMIPRMEELQGEGFAAVMCHSKPHSKEVEAFRALRTSIEFSPQETNRLVCTSTEPGDGKTTVS
SNLAVAFAQSGKRTLIIDADMRRPGLSTLLGLRDDTGLSKILRDSDELEVSIERNLRKSDVKGLDVISCGPRPVNPAELL
SSERFSNMLAWAETKYDQIIVDAPPVLAVSDPAIVGRLVDAVILVVRPDKDRRRMVIRATETLQTLGCTLLGVVINHLTT
TDTDGYGYGYGYGYGYGYGHENEHEEQPERDVASGLSALASGKSREADLRERNRAA
>gnl|bykdb|A0A3M1QRP3 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium] (length=773 residues).
MSDKPSRAQDESHALAAGEPLTPAAPFAATDAIDVFAADSGEEREPQKLSLSPARILRFKWTILVVFAAVCASALAGVWI
FVEPQYRSIAQIEVRPQRDMIAFKTDNDGITHFYQQFLTTQIHKITSARVIERVLERDDVRQTSLFDEVEQNVLTKLLRS
PSPGKRLMDGLDVNVAHNSSILEIAVTLPDSYDSAVVANAIADEYLRAVREDEQEDSESLAAERRRQEELLRKQIEIKEE
EVDALRKMLRVHTADDLVNTQRLYLDKLESRREDLLLAISNREARLKRLELLAASGDGAASAPAPDRRFSEDSVWRTLSA
ELKKAEFEVESARDQFGESHPTMVRLRRQVDFYKQQLAERERELELAPPATVGVKRDDEFAGMSPRELRWELEDLRAELT
NLEAHIARKQKEFTSTFESAGALSKALRELQTMREQYEQIRRTRQQQEIERFAPASIRKIADARPSGAADVDKRPKLSLA
AVFGAAFAGLLAGLARAYFTGALFEVEGLHDRTVSQAGPLLGPLPLVRDPRSATAEEFTVQSECVRMVRTALLQRLPHDR
CNVIQITSASPGAGKTTFAIMLAKSLAHIGKRVLLVDADLRNPSIAGRLGVSGAGQEFLASLLDAQAGQTPRRDRATNVP
GLRVLVSSRPARLEESEILAGVAPQRCLDAWRERYDMVLLDCSPILPVADARILARLADGTIMVVRDGHSDRRDVLDAIQ
TLRSAGGTILGSVFNGVPSRGGYYYHGSYGYGSAARNVYGPATDNDPLDVRVI
>gnl|bykdb|A0A3M1VCL4 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium] (length=773 residues).
MTQDVPSLVLQQEASRAADLAAVPAINPLASLLRFAHAVRMRKAILLGTLLIAAVFGALYYLTATRYYASNARLLVLQTN
ASVLQEQQSTPRAVLDQLPTLQEVVVSDRVLEDAIERLSPEYRMVDLQDVPRSKWVKEVRSNTYVSTIKQTSLIDVRYRS
RDPKAAAAMVEAILAAYLDFMERTHKKGAHDNLEVLTRKQRQLEEEIRSKESQLAALRSASEEIVTADGRQISLIAEQIA
RLNQALLEAKKETINARVFLNAVENALATGQDVFQLMQGELEPVGRQMLESELGFSQQDALVLSRVEQQLRSDYAELQRR
LAFLGPNHPRILSLRDRIRANEQYVTQYRAGMAQQLRAATETHIKPRLRQMAIRRLMVALEEERSLVEQFEQLKKQAIEL
NNRHLQMEILSLELNRLRSLNDLFLERIKELDLGSDSGALKTEVVSHPKVVPQPVSPRLVLVALVALTLGTTTGLGMIYV
LDSIDDRFRSPEELQLQLGAPVLAIVRKLQQLEGTGVASVLTFAKPNGVETEAFRTLRLKLMFSETPAQRLVVSSTEPGD
GKTTVLSNLAVAFAQAGKRTLLIDADLRRPGMTTLFGLRAAPGLSTVLRSEEPLQVALQGCLFQSGCAGLDFIPSGPRPS
NPAELLGSPRFVDLLAWAETTYDQILVDAPPALAVADPTAVGRFVDGALLVIRPDKNRRKMVIRAAEAFRAVDVPLLGIV
VNNVSAEDGDGYYGYGYGYGYGYGYGYGYAESDDEEHDGKRRSGRGKRAKKAA
>gnl|bykdb|A0A3M2AEL0 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium] (length=808 residues).
MDTFAAPPPEHDDQAVTLSLPRLLGIFWHQRLLVTSLLILGAVLGFFLSMLVPPRFAAEATVLLRPEGSEQSLLREFTLF
EQSPATLAEMEVLGSRAVAQAVALPKGESDLAPEVGLGLSVTVDDVDRNWPWPAVLRKLGRGEEPTGSLRVEVEQLPRDL
TYRAWRIHFSSPEVVEVLPDSLWAAVLPGRKQVVRLDDGKPLELAGARIRLIPDGDLSGRTFRLTLRSVRRAIRDTQESC
RVVETHKGSNVLRLSYFDTDPERAAQVANALLRAYIEHNKSRLSRQASSTVQFIKDEIERVRRELEDAEQELVSYQEAEG
AVALSEEASLLVQRLSELDLRDADLDLRIRTVKNLIETVRTSDSGLERLVSVPDLDPVTRTMLQELGDLKAKRIRLRAVY
TDQWPELVELNQRIEELEGRLLLAVQDTLAALEAQQVSLQDTISRLRENLEELPATERQLARFSRRAAAFEQIYTLLLTR
LQEAQITEAASLATVDVIDWAIPPDSRSRPILAMNTALGLLLGLVAAFALGLYREGRVRKILSIAQLETATGLPQVGVIP
DFRRGGTRSKHSRARDYLPLRDEPDSPTAEAYRALRANLRFLAKGQAIKTLAITSSVQGEGKSVTTCDLAVALAQTGARV
LLVDADLRRPVVHRLFGFPISPGLSDVLKEDASPEKLMHPTNIDGLSVLTAGSRTARPGDLIASPAMQGFLQDVRGSFDY
ILFDIPPVLAVADASGFVSQLDALFMLCRAGVVPEVVAASATKRIRLTGAKLMGCILNGVRAPRLGRYSRYGYSYGYAYG
YGYGDGSK
>gnl|bykdb|A0A432MFP3 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Tautonia sociabilis] (length=772 residues).
MDTSETTRPQYELARLSDLPPALRAPLPPASRPASDGGGLPINPRLVLRGLARHWWQALALWVVGSAALAALVYLKFQPT
YRSFSLLQIERNQANPYGSLEDPRSIEYLQTQIQLITSPRVLSVAKLDPKVASQSGVREAPDAEQYLREMIKVAARPNTS
LIEVAAEAERAHEAADVVNAVVRSYLDANKEWSEARTNNAIRMLVEYEKELGDKVEAQQKKLIELFKEAEDPRRMLGNLA
AMDGGVAPAASGEEGQRAAFQVDVDEYERLSQALLELEYEEIEARADLEAVRRQAAATDPRVWVDRRIEQVFLSDERVNA
LRGAIRDVEARIAEARTRIRNPGDPALSRLMSQRQILMEQYEQLWSDLEPTLRAQLAAEETHPVQIVLRAEQRLLRLERE
RQLLQQKLDLIELADRSESVEQLEISFAMTKLKQYQAMEQQVQRRLEVLRFESRPADTITVIDPATPGLMLSNKRDKFLA
LTPLAMLGLVLGLVTLVELRSGRVGGTEELSGRLAAEVFAVPPLPTTRDAERARLEGPGYDPKFEQFVQQLDHLRVALCG
EGGQDGRGRCVLITSAVGGEGKTTLAAQLAVRCAEAGASTVLIDADLRRATLGRLFEVPDCPGLSDVLRGDAQLEDALVP
ISQVGGCQLLPAGSPEAYPNRILRGKAFAPMLERLRRSFDVVIIDTSPVLPVPDALILGRLADGAVIATRHDQSRFPAVE
RANGLLTGAGIPVLGVVVNGARTSDRRFGTGYATYTYRSDRISDPGGGVSGS
>gnl|bykdb|A0A432MJP4 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Tautonia sociabilis] (length=802 residues).
MRLPDPQGSEADSTMSDRPLASDTNPSAHLGAAELKHLIRVVRREWRWSAVGLAVCLTAAAIYLVRTPRMYQATARVLVL
ETGRQPLKVTEADAGGGEGGVDRFPTYAAILSSPHIVGRAIEQVGVENLPTLQLAKREGKTPTQAAIEELDVSRPDRAAS
VLRIDYRARTKEEAVLLTDALIRSFEAFLEESYQSNNTKVVTLITEARDLISKELVDLEQKYLEIRKKNTVLATDQSGRS
FITRRVDGWDSVINQTLVRAVELRTQLELGKSLREKGVGLAGIAYALGQFRGDPGESLAISSSAGRSQALASDYVRQLIN
EQQRLADRFGADYSRVRDIEEQIARVQQVAADSRRSVESVEVDDLILSIEQAVASVEALQQEYTDRFREDLEQARQILND
QAEEENIRAQLDRQQRLFNTVVDQLKQAQLVGEYSGVVTQTIEPPHALRKAVRPRVLLTLCMALMSGLVLGTMAALAADG
LDSRVRSLDEVRSMLGSRILGVIPRLSKAELAETTEPGLVVHQRPGSLTAEAYRALRTGLEFVRRERDVRVIVVCSPSPG
DGKSTVTSNLAIGLAQAGRRVLLIDCDLRKPSQDRIHGIDRAPGLSEVLRGISTWREVLQPSAAEDLRIMTTGGPVENPA
ELLMSERFRSLVAELRGEFDRVLIDTSPLLYVADPSIVAPSADGVLLVLRPSEIRRAAMHRVAEVVQMMGTPLLGSVVNA
DGSDDAQFLHAGRYYGRYGRSYGSVDGSGPRTGSVWPSGTAAGEGASASWAPASLLRRLRTGGPGPGFGNGGRGVNGNGK
LG
>gnl|bykdb|A0A4P5WQK6 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetia bacterium] (length=792 residues).
MTDQDRILAGSQDGANAAATTLHLLFRFLRTVRFRKGILVASLVMSTILGMTYYITAERIYESTASLYVVRKGSGVTSDA
TSNSANPVTEMPTYIALMSEEEVIARALRIMPEKYRRVDLAGYPQSAWVRMVRDNLQASSAYNTNVMDISYRSRDPRAAA
AMLTAMLAGYEQFLNETNRGLSEQGLKTLATRLEAIEQEVKELQSRRLHLKASAPELVDTGERNQNSLNTISKNIEMLTQ
EYTNSRRRTEEARTTSQELQRAIASGEDILQFAMETLDSAGRQLVEQSMGLGTQDSYHVQRIMQEILDRQSALTEARQKY
GAKHARIRALETELAVKEKYLREFPELQRTRTDTMTREVLAPRLVQYLSQQILKLELNEKAVGERLAAEQAKAQKLSQTL
TELGDLDRQIEHLYEQQKSLQSQSDGIGLNKDTFLSTKVSSRPTVPIRPVSPRLPIAVLLSLLIGTGTGLAVIWVLDIMD
DRFRTPEELKLHLETQVLSMIPRMTELPGEGFEAVMCHVRPHSREVEPFRALRTSIEFSPQDTNRLVITSTEPGDGKTTV
SMNLSVAYAQSGRRTLVIDADMRRPGLSTLLGLRDDVGLSRLLRSPDDLDTAIAANLRTTVVQGLDVISCGPRPVNPAEL
LSSERFAALLSWAETRYDQIIVDAPPVLAVSDPAIAGRLVDAVVLVVRPDKDRRRMVIRAAETLRTLGCTLLGVVVNHLN
VDDAGGYGYGYGYGYGYGYGYGHDQEPEEQSGSGGHSGSPEQPVAAGHSVSAGLYSISVGGSRSSGDSSRAA
>gnl|bykdb|A0A4P5YBU2 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetia bacterium] (length=774 residues).
MNSDVQQPAPAPILNTANVVAGMIRFLHAVRVRRGTLLAALLISASLGAAYYLTATRMYDAHAQVRIVQSERDHNSLTSS
PQSSQANSDVFQMMATYQRIMSGDRVLSAALEDLPKEYCVDFKGFNPEVWPTLLKNHVSVTNERGTTLIDVRYRSRSPKV
AAFIVQRIVTEYINNINRTYGNQTQDAVAKLTEEKKETSRKLTEKNQEFLELQSQTGNIYDGEGKSTNLLSLRVVELNKL
LIEAQRVTLDAWSFLQTVEQAARTGQDLQQLMFQAVETLGASILSKQMGLGEQDAWAVAKLNEELQKLRNDWNDRRNVLG
DNNPDLLELAQRIRAQEDLVNNYFQRAKMNLTANSADLGPQLLGMARQRYQLAMSRQHTLQQQFDREKSEVANHNTLMAN
LIIVEMERNRLQANDESLLKQIEKLQLVSGEGIKVDLNKLPKAGKLPSSPRLVLVVAVCFILGLGGGLGLIYILDLLDDR
FRSPDELRMQLGVPVLAMVRAMEPTGGTGADAVLCHAKPNGVETEAFRTLRTAISFSDRQAQRIVVTSTEPGDGKTTVMS
NLAVAFAQSGKRTLLIDADMRRPGMTALLGLKGQQGLSQVLRDERPIAASVAENLFTQITPGLDVIPSGSRPSNPAELLA
SERFSELLAWAETCYDQILVDAPPVLAVADPIIIGRMVDAAVLVVRPDKNRRHMVIRAAEAFAAVEVNLLGVVVNHLSSD
SSGDYYGYGYGYGYGYGYGYGYGHDDANAAAESEHEAGDEEPASDEVQPLRRAA
>gnl|bykdb|A0A517LWP4 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium EC9] (length=773 residues).
MQRESAPRLSETEHGSDEFQAADAIHAALRFLRMLRRKKQYIAFSLLVTCALGAFYYLTADKVYEAKAQLLVTQTSPDML
NAGVSSNLNNDALVATHERLIESSVVLGGALDRIRKLDSELKVDLAGVPEEKWKDLLRGKLSASAARRTSIIELSYRSKS
TLAARAVLEAVVESYLEFIDTSHKDVSVEIATILKDELREKERNLKAKQEEWVTVSRDAGDLGLRSGSTVVHPLVQRAVK
MNDILVAAREKRLKLQASEVAVKHAIQTGGDLRQYLVELEPTIGRELMLNGLGMSPRFAQVADEMEQKLLADRALLQSQA
KHLGPVHPTIQMLQQKIADSERYLLEYRAKINAANGPQQEQQLGEMLLSMISEALTETQANEEQLEREYAIAEAEAVKLN
GRMTSLQLVENELQRLRNWHDTLLNQIANIDLQTEGGDIRVSVVGEPVASPGAVAPRLRIIGVLSIFAGCAIGIAIAYVT
DLLEDRFQSPDELQEQVGVSVIAMIQSLNGSGEAGGQNLHMFTNPKSAESEAFRTLRTSLSLQGSDFSKLAVTSSEPGDG
KTTVIANLAVTYATAGKRTLLIDCDLRKPGLTRLFDMRGLGGVSQLLTQADVVAPIWNHEVKGTGIPNLSIIPAGPRPQD
PTELFSSSHFGELLAWAEANYDQVLVDCPPVVAASDAAIIGRFVDGLMMVVQPAKNHRKLVIRSVEQLGQLGVQLTGIIL
NRVDDSVSGGQFGYGYGYGYGYGYGYGDEEQDDTVDALPMQQAPTQPPHRKAA
>gnl|bykdb|A0A517MDV3 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium FF011L] (length=778 residues).
MSGDNTVSPQPNLDFWGILRRRWLILFLGLAFGISLAVFYAFVAPKVYASRVEVLVMRKDPGLPQMSDSQTGAAPQQEVG
DALLATHMEIIRSPRVIGDAIDNRQLEELESIRSELDPVLAKFDHRRAVVNYIIEQLWIERGGQELAYAPLTFVAEFRHN
DAADCALVLSAITESYQDFMAATLQDANSEATGLIQQARDDLTLEIDQLEQSYREFRRGTPLLTLGPDSLTKNQIRLAML
HNELIRLQLRESELQSRASILARTQNDESLQDFSDLERLGLIDNRDVERLALLVNVERGDANSDESFVAQQPMRTTAANT
EMDSLLSLKVRLREERSRLGDAHPKVQDLQDAVQDVEQFLTAKRDAIKPLADSPEVRSGTLVNAYAKVIEKDLEDVTQRI
VFVKEEIAKEESDSVDLVDDELRDQEIRDELFATKQLQLAVIDRLRQLNVMQGYGGFVTEILRAPEFGELVWPIIPLVLI
AGLCFGSMTGGGLGLLIDLGDRSFRSTKEIESAVGAPMLGAVGTMKFRRHRGMDKTLSPELVVYHRPDSSDAEAYRHLRT
SLLFRPGGKELRVIQMTSPNPGDGKTLTTTNLAVSIAQTGKQVLLIDCDLRRPRLGTLFGLEDEAGLSNVLTGDTELVDS
IHETPIENLSVMPSGFRPSNPSELLMGKTFFEMLETLRQKYEYILIDSTPLLAVSESTSLGQKVDGVVVALRTSNSSRPE
TERAVQRLQGVGVQAVGFVVNDIDRLAKQGDEVDAGYGYEYGGQRKVNAYFRAPQSNG
>gnl|bykdb|A0A517MLW3 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium FF011L] (length=781 residues).
MNQIENLSGPQHLTAADAIQALLRFGNGMMRRQRMVASVFLLVGLFAGIYYVTADRVYQASAQLLVEEPSIGVFPGASPT
AQSNKLPTQEKIIRSDRVLKQALDQLRQMDSSLQIDLVGLSDEQALTTLQGNLTVQLVRNTNVIELSYRSASPKAAEVVL
DVLVQSYLDFMQQHHQDTSVTVLELLKGEREKIEETLHLEQQRLIKLRDEAHVVGFDNDSLKSHPALQRVNSLNESLTQA
QKTRIELQAISAVVSDAIREGRDPRPHMHAVDPDAARSLTAAVLGVAPEQMRSIHVLEQKLLSDRAEVMRLEKHLGPTHP
SMVALQGEISNAETYLSDFQARVNGRSSNQSGGQFAALLGDLVQQKLNESTQHEALLRKEYDTLEKEVVAMNGSLSEMLL
SQREVDRLSRAYDALLEKIHGVDLGQDQAAVRVAVIGKPKALIAAVSPRLRLVVLAAGFFSTLLSVGLVYIADLRDDRFA
SLEEAERQTRTEILAVVEKLETYGEYGAEAIQMHVAPSTRSSEAFRTLRAGLMLNPAKPRLIAVSSSEPGDGKTTISSNL
AVGLAQAGKRTLVIDADLRKPGMTNLFNVRHAKGLSQLLVEMSPVDVVDKYVMSTGIDNLELIPCGARPLDPAELLASNA
LSDIVQWAASRYDHVVLDCPPVLIANDVALVTRLTDGLVLVVRPEKNSRRHVLRAIERLERFQTNVLGMVINAMDASTAD
GAYGYGYGYGYGYGDELTDEKQAVVMPSQNAVSQSELVVHTDSAAPKTAPVRRSTPRRRAA
>gnl|bykdb|A0A517MPZ6 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium HG15A2] (length=772 residues).
MSSLVEYEDDYSLDADPQPNAGKGDDSALQTNLLSIAWQARWLLLLTVLLGVGCAWLYLQRVVPRYTSVSRIYVERSLPQ
IFASDAQRGTSSSYLYTQAELITSTPVLAAAANAPESSQLETFRSTDNPIGLLKKNLSVQVGKNDDIINVMIELPSAEDA
AQIVNSVVDAYISKYAEERRTDTVEVLNILRNEKQRRDAELEQRIEALEKFRGQNAALAVQVGEENVITKRFAALASELD
RVELALLDSKARHNRTQQMLESPSLRPFLLELASGQQSVAQDISLENRLQVDLEKQIQDIQLQIDALRATWGDGHTRVKL
ALQSKAAMEERLAKQLEATEERKKAIVSAYVETVSQEHQLLEQKREELQRSYDKQFKLAMQVNSQAAKLTTLENSLARTV
RDVDRVDEQIKGINLTEDVGAMNVSIMEVARASSEPTYPIPARFLAIGALLGGLTGFGLAWLRDLMDHRLKSIEEIAATL
QLPVLGALPLSAGKDDRHETGRVVLTHPRSMAAESFRTLRTAIHFGLTRDDAKVIAITSPSPGDGKSVVASNLALTMAQA
DQRVLLIDADMRKPKQHEVFEIQVEHGLSSVLAERRPADEVIQRTEVDTLDLLPCGSRPTNPVELLNNGYFSELLHELQQ
KYDKIVIDSPPVMPVADARVISAQTDATILVLRADCSTRRMSVAARDELWRVRAQRIGIVVNAVPGRKQANYSQGYGYGY
GNYGHSSGTYGDLAYGEPEPPVDISRRKKSRARSQQLPSPEATSEAMEPLDI
>gnl|bykdb|A0A517N8P6 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium K22_7] (length=815 residues).
MQPASHTQTSRSDIGMAPPMSGPSDVSVGGVLWRRKGVILLLILCGLGAGYWFFTTQDETFRAAATIEVYSQNVPTNTGS
ASEIVVETAPNLAFIQAEMTSQDVLSDAIAIGQLTAFDETPADVSSLINMIRANLVLSPPFEGAESPDRTIVEVSFESGD
PTVATAIVNAVVDAYDKSINGRHQGNIENVVGFFRDSRDSIIPKLDELENEFTEFRANAPLEWNGKGEAINPYRDDAIRL
EDNLYNLQSQARQLDSKLRLIREAVKGGRHPYAVFQEVQYLLDDVRDIEQMHQAIVEAPNDNLELQTQLMDLRVQAEMLA
IQFAANHPQRLTVEQKLKATEKALRELQQTRNNVSPEKIDVVKRQDEAAQALLTTYVSSLRKKQDLINEDVADTTKRLED
VRAKALKLMEFEGENASFLRRIARYQETLDLYDTQLEKANLPGMNSGLHVKVLRPAGLGMLVGPLLSRALVMGGFLGLVA
GGALAFLWDWSERTFRSPDEISTLLGLPILAHLPVILTPSKRQLKKSSGNDLFPHTDQIVTVLHHPHAPCSEAVRSVRTS
LFPVAGAPPEYQVLQITSALPGDGKSTVAANLAASVARAGKRVLLIDADLRRPTQAKIFGVQSELGLTSLINGEGQLADI
VVPTDTEDLFVLASGPRPNNPAEALMMPEFGQILDEARLQFDLIIIDTPPLLAVTDASNVATYADGVMVVMRIGRNIKPM
SKRAITMLRMLHVNIIGLVINAVGDSGYSATYSQAWSDSYGGQPGGEYGHSYYRYGSDRYLDASKGQTITVRSQRSRNAD
PARAATLSEPVKTTE
>gnl|bykdb|A0A517NFU9 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium K22_7] (length=817 residues).
MESSVSESASKATVIEINLLGMLRRRWPHIAFGIFVGLSLAGFYYFSTDRMYESKIEILVGQRSSEVTNNGTITGANASG
DNIQEDQLATHLRLFVGRRMLAEAIQKGNLDQLASFQQVVANGGSVIDHILKNIEVNRGGEGSARDAMVLRASYRDTNPE
DAAIVLSAIYDSYRDYVESHGHNSTEQAVELMEKARETHELELATADREYREFVTSVPVLIEGSTVQDVHKDRLENLEAE
LNIVTTSLAESRSRLEVIKSYLATRDSSKINSMDHLALLSQKEVERLKLFLDVTRGETQSEAFQAEQPIRQEVAKAQYNR
MLDLIQKERGFSDAFGAGHPLVEAVRQEIEITRRFISSNQPAETKVQSRKFDAAEMLSTYTSLLSNDIAELEKRKEFLLQ
ESTLEMRLAKEVESDFMKGSSMKSKLTRAQSRYDEVILRLQELKLSRSYAGFSTDLLESPEVSQSAAWPKLPIIAAIGLF
LGMTLGLLLAVGSELMDSTFSDVADLERTVGAPAIAHVPRFNLRKLRKLLNKDSGVQPSLVCSYAPRSTESEVYRVARTA
LMVTNRKDDVRTIMMTSPQPGDGKSTTISNLAISFARAGKSVLLIDADMRRPVIAGLFNVAESPGLSDVLRGEISADTAI
KPSEIPNLNLMANGSPTSDPAELLESARFSMMLSEMSLHFDLVLIDAPPLLAVADPAIIAPIVDSVVMTIRVSKNGRRPV
EQATKILQDIGMQPSAVIVNGVDQDAKSYGYGNYQRDRYGYVGHYHNQYAATNTENLPSVRTVPSPKGELGPKGEAGLSG
ELGPKGRSSRSSERASL
>gnl|bykdb|A0A517NSK8 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium K23_9] (length=801 residues).
MTQVDPNLNNQTADDSEALDLIGVLRRRIGFIVLGVTLGLIAAGLYLLLTTPTYRAEMEILVGQKSADMVNGASSNTSVE
GANTDGDVLSTHIQLMTSRRILKKAIADHELTDIASVSNAIDEGKNPLEYIRDHLHVTKGGLGVAKDAHTLQATYDDPSP
EDCAVVLRAIFDAYDVYLKEHFSSNSSQAIDLLSQLANDTADEVREAEQNLTKHLASSKVMWDGSKTTNIYKKRLESIEI
DLLELTENEAHIESRLAVISDFVENADPEKVSDFDRLALLSEKEVNRLKVLFDVTRGDTMSEAFVQDNPIRQETAKAEYN
DYLNLVMREKKLTENFGDDHPTVVSIREQITMMRKFIDDKAAEVGDGAVIEKMKPDEMLQTYVGLLENDLAGLQREREVL
VRRSEAELVSAKKLEEEEMMAESLKLELVRKQALYEKMSDTLSELNFVRDYAGFDTDVIGDADIQEQSSWPDPKIVLPLG
MIAGLALGVMLAFIADLCDTTFADPEDVEKTLGAPVLAHVNRFAPIRRKRNEPAFEIDSSVYAFHRPRSPEAEIYRVIRT
SMLMSAKAKDQRIIQVTGPLPGDGKSTTSANLAVAFAQAGKRVLLIDADLRKPRVAKLFRLENTLGLSEAIGGLADAADV
ISDTVVDNLWAVGSGAVPANPAELLQSEDFASLLKHWAEEFDYVIVDSPPVLAVSDAAIISQKCDVTLLALRIVKNGRRI
AHRAITLLRQHDANVVGLVINGYQSSNKNYGYIEKYDSDSYGYGYGPTSGGYYRSADATAETVKVSSRDAEEAPVAAGSR
V
>gnl|bykdb|A0A517PTS5 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium HG66A1] (length=790 residues).
MNTEFQPLEPHSDLDFDGMEDSTTNTSAPGVDIVRLLFRNKYLIVGGLLAGLLLGQAAYMKLGPVFSANTKIQVSQKNPV
PIKEGEVQTFGELTAHIDVIKSPRIVGQAVKAGKLTELPSLEGEKDPAQEIIDSLKVKRLSGTDRTYLNILNLTYENKNS
NDAKVIMQAIVDAYHHYLDEVRDQNTGEIIDQLNKANESILSDLEKKKQEYKEFRKDAPLYWENTPGSEAAVAGSTNMHQ
ERVKTIDNERRQNLLKLTELKSKINTLKSAIASGESKETLELLAQQFLMGQARGQSGATTGGVESQAITPGNTQVERARL
ALETHLMPLLIQKNRLERDYKKNHPDLDAVNRSIDTIINLYRRQGIEISADNLESGEFQVSKVKDVDFVNIYLKSMEQQL
KELENRETALTRLFDQETELAKKVGNYQVVDQAYNEEIAQLKTQRESIFKQLLLEKVAQGNSGYTMTQLSPVKDELVIKR
QLKFLMAGGAAGLGLVLAFSYFREMRDTTMKSVDEIRNQLHLPMLGEVPQFTEEPAHMDDSQFDSALWYYYRPASREAEA
YRSLRTSLLLKTERNGAKVLQVTSAEPGDGKTTSVSNLALAIAQTGRKVLIIDADLRRPTVHKLFGINNAVGLGDVLAQE
IDAQTSIRETRISNLSILTAGMLPENPSEMLMSRRFAEMVNQLRNEYDYILVDTPPLVVVSDPSVIASTVDGVLLVVRID
KNRRGVIRKVQQIIQTNGIKITGLIANNVITNSLVGYDYIDNEGYQAYFEKPAPEPAKPAANPAKTEVTS
>gnl|bykdb|A0A517QBG9 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium Enr10] (length=790 residues).
MNTEFQPLDPHSDLDFDGMEESNMNSSGPGVDIVRLLFRNKYLIVGGLIAGLLLGQAAYMKLGPIFSATTKIQVSQKNPV
PIKEGEVQTFGELTAHIDVIKSPRIVGQAVKAAHLTELPTLEGEKDPAQEIIDSLKVKRLSGTDRTYLNILNLTYENPNS
HDAKVIMQAIVDAYQHYLDEVRDQNTGEIIQQLNKANKSLLAELERKKKEYTEFRKDAPLYWESTPGSEAAVAGSTNMHQ
ERVKAIDNERRQNLLKLTELKSKINTLKAAIASGESKETLELLAQQFLMGQARGQAGAAAGGVETQALAPGNTQVERARA
ALETHLMPLLIQKNRLERDFKKNHPDLDAVNRSIETIVNLYRRQGLEISADNLESGEFQVSKMKDVDFVNIYLKSMEQQL
KELENRETELTRLFNQETELAKKVGNYQVVDQAYNEEIAQLKSQRESIFKQLLLEKVAKGNSGYTMTQLSPVKDELVIKR
QLKFLMAGGAAGLGLVLALSYFREMRDTTIKTVDEIRNQLHLPMLGEVPQFTETPAHVDESQFDSALWYYYRPASREAEA
YRSLRTSLLLKTDRSGAKVLQVTSAEPGDGKTTSVSNLAMAIAQTGRKVLIIDADLRRPTVHKLFGINNAVGLGDVLAQE
IDAQTSIRETRISNLSILTAGMLPENPSEMLVSRRFAETVNQLRNDYDYVLIDTPPLVVVSDPSVIASIVDGVLLVVRID
KNRRGIIRKVQQIIQTNGIRITGLIANNVITNSLAGYDYIDSEGYQEYFQNPAQKTETPVEKPARTEVTS
>gnl|bykdb|A0A517RK10 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium Pan241w] (length=790 residues).
MNNEFQPLDQQSDFAIDGMEEHAPINSSGPGVDIVRLLFRNKFLLVTGLVAGLLLGQVAYMKLGPIYSASTKVQVSQKNP
VPIKEGEVQTFGELTAHIDVIKSPRIVGEAVKEAKLNELPSLAGEKDPTQDIIDTLKVKRISGNDRAYLNILSITYENPL
SADAKAVTEAVVKAYRKYLNDVSDENTKDIIKQLNVANQQISTDLEQKKKEYKEFREKAPLYWENTPGSEAAVAGSTNVH
QERVKAIDNERRLNLLKLTELKSKIDSLKAAIASGESKETLELLAQQFLMGQTRGQAGNANANQGQIATPNTTQVDRARA
ALETHLMPLLIQKHRLERDYQKNHPDLDAVNRSIETVINLYRRQGLDISAENLESGDFKIAKVKDVDFVNVYLKSMEQQL
KELNNRETELTKLFDQETALAKNVGNFQVVDQSYNEEIAQLKSQREDIFKQLLLEKVSQGDAGYTLTQLAPVKDELVIKR
QLKFLMAGGAVGLGLVLAISYFREMRDTTVKSVDEIRNQFHLPILGEVPAFAESEAAMDDSDFDPALWYYYRPASREAEA
FRSLRTSLLLKTDRSGAKVLQMTSAEPGDGKTTSISNLALAIAQTGRKVLIVDADLRRPTVHKLFGLANAIGLGDVMAEE
IDAQTAIRETRISNLSIMTAGTLPENPSEMLMSRRFIDLIKQLRNEYDYVLIDTPPLVVVSDPSVIASTVDGVLLVVRLD
KNRHGVIRKVQQIIQTNGIKVTGVLANGIFSGRYGEYDYGAGEGYQEYFEAQPKKKIRQPAVPVNSDITG
>gnl|bykdb|A0A517TMV0 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium MalM25] (length=753 residues).
MGTAIEEYSNRQDALAEPALGGGGDAFESLVRLVRIVRYRHQAVLWIVAGCLALGLTYYAMAPRYYRSEARLQVIDQSGE
DLASISEQSGTDSLMATQREVVRSSEVIRRAIERLSPEHRVDLADTPPRKWISSINSRLSASTVRKTNIIRLGYESLDPE
TAAAVVRAVLDSYLDFVSESHRGAAADFLDKLIVQREKFETELANKQVQLLQIRERIGHLALPDRENVVDPIVARAIHLN
ESLLEAQRERIEIEASQATIQSAIDNGSDLSRHLALVEESLGEQAVLAAMGMGPNDLEVLAVQQSRLLDLRMELQKVAPF
YGPAHPQVATLQQQVAGVEQYLASYRSDTTGRPGGLADAELGPMLMGMLDQAWRQAVQREQQITESFAAARAEASKQSGD
LVRVEMLQREINRIEEHNKLSYEKMQSIDLQQVSAPIQTTIVEEPLPSERPASPQLRMVLAASLLGGLVLGVGVVYTQDL
LDDRFGSPEEMAHQLGCRVLSVVRELQPLASHGLQAVQMFAKPQATESEAFRTLRTAITLGAEVSDRLVISSSEPSDGKT
TISSNLAVSYAQTGKRTLLIDCDLRKPGLTALMDLKRMPGVTDILTAGGDIAAIAERCVRRTDLETLDVIPAGPRRPDPA
ELLLGPNLAELLAWADSRYDQVLLDCPPILAVSDAQIAARLVDGVVLVVTPEKNHRRLVSRACDSFLTSGTPLLGVVANR
ITEQAGKGYGYGYGYGYGHDDTAEALEEKPLAA
>gnl|bykdb|A0A517TY85 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium I41] (length=762 residues).
MNLPPEPTREPTNLVVRPTQSRAPALANMTPAGGSDAAAAMQGITPALVLKVLRGRWPVVIPLGLVLAAAAAAIVLLLYV
PKYRASALIKIEAQPTFIAFAQDKVSATDDRYVQTQIELLRGPVVLGPALDWSPQTKNGQKLPKLGELAEVKEQADPVDY
LKRNLSVSQVGKSELFEVAFHSRSPDDAATVVNAVVMTYLEKNREKETDRSKLVISELEKESADRSMRVELLRKEVIALA
RKLTGTDPFQPGLVTDVGAITAAGSFHQGIVEAEVGAEIARAELEAIKRPIASDDQGSVSGILTLEVANRPDVRRLEEEI
EQLQDQMSAIKVKSRTKIGDSWSSDPEYLSLEAAAKEANAALEQLKATARAESLAARRADQEGEQRKLLAAKEQELAAWI
MKRKLLSEKLAAHVKERESGGAQSAELEFKKSELEREESVFELIAARKLALQTEQRAPERVFLMQVAEPPSMALEPIPYK
YLLVACLASMLAPLGLAVAYEALLRRISSTDQLTKESLLPVIGEVARFPRRRVGAAPVIAGPPSKEMFVFAESIDSLRTQ
LLLTEHLGVPGERKVVAICSAASGEGKSSLATALAMSIAESSKQPTLLIDADLRSPDIARLLGTPAGPGLAELLSGRATL
REVIHRVGETEAFVLPAGKLRGSPHHIFEGVKIEGVLKGLREKFNTIIIDTPPILAASESLVFAKAADLTVVCSLADVSR
AKQVRVAVERLHATGANVAGAVLSGVSPSHYVYNYGAYGAHR
>gnl|bykdb|A0A517VID8 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium Pan161] (length=790 residues).
MNTDFQPLDQQSDFALDGMEENAEFDSSGPGVDIVRLLLRNKYLLVIGLVAGLILGQAAYVKLGPIFSATTKIQVSQKNP
VPIKEGEIQTFGELTAHIDVIKSPRIVGEAVKEAKLNQLSSLAGEKDPTQDIIDTLKVKRISGNDRAFLNILTITYENPN
AKDAQAVTQAIVDAYKRYLSEVREENTEDIIQQLKDAEQQIATELELKRNEYQKFRENAPLYWESTPGSEAAVAGSTNVH
QERVKAIDNERRLNLLKLTELKSKIDSLKAAIASGESKETLELLAQQFLMGQTRGQAANKNTSEGRIATPATSQLDRART
ALETHLMPLLIQKNRLERDFQKNHPDLDAVNRSIETIINLYRRQGLDISAENLESGEFQVAKTKDVDFVNVYLKSMEQQF
KELENRELELTKIFDQETELAKKIGNFQVVDQSYNEEISQLKSQRDNIFKQLLVERVSQGNSGYILTQLAPVKDELVIKR
QLKFLMAGTAAGLGLILAFAYFREMRDTTMKSVNEIRNQLHLPVLGEVPSFAESEAVVDDSEFAPALWYYYRPASREAEA
FRSLRTSLLLKTDRSGAKVLQMTSAEPGDGKTTSISNLALAIAQTGRKVLIVDADLRRPTIHKLFGLANSVGLGDVLSGD
IDAQTAIRETRVSHLSILTAGMLPENPSEMLMSRGFSELVNQLRNDYDYILIDTPPLVVVSDPSVIASIVDGVLLVVRID
KNRRGVIRKVQQIIQTNGIKVTGILANGVQSGKLGDYDYGSGPGYSDYYIVPSQVQAKQADATAKTKITQ
>gnl|bykdb|A0A517VTK3 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium V144] (length=792 residues).
MNTEFQPLENHSDFEFDGMEGHTQSNTSGPGVDIVRLLFRNKFLLISGLAVGLILGQAAYMKLGPIYSASTKVQVSQKNP
VPIKEGEIQTFGELTAHIDVIKSPRIVGEAVKEAKLYNLPSLAGETDPTEEILGSLKVKRISGNDRAYLNILNILYENPR
SQDAKIVTQAIVDAYQRYLHEVRQVNTNEIREQLDQANKQILNDLERKKKEYREFREDAPLYWENTPGSDAAVAGSTNVH
QERVKAIDNERRLNLLKLTELKSKISSLKAAIASGESKETLELLAQQFLMGQTRGGQPGSTSSAGASISAPGTSNLDRAR
TALETHLMPLLIQKNRLERDFGENHPDLDAVNRSIKTIVNLYRKQGIEISADNLNSGDFKLSNVKEADFVNIYLKSMEQQ
LKELHNREQELTKLFDEETELAKKIGNYQVVDQAYNEEIAQLKSQRDNIFKQLLVEKVSQGNSGYTLTQLSPVKDVLVIK
RQLKFLLAGGAVGLGLVLAISFFREKQDTTLKSVDEIRNQLHLPVLGEVPTFDESVSIDDSECEFDRALWYYYRPSSKEA
ESFRSLRTSLLLKTDQSGAKVLQMTSAQPGDGKTTSISNLALAIAQTGRKVLIVDADLRRPTIHSLFGIVNGIGLGDVLS
EEIDAQTAIRETRIKDLSLMTAGTLPENPSEMLMSKRFTHLLKQVRNDFDYVLVDTPPLAVVSDPSIVASSVDGVLLVVR
VDKNRRGVIRKVQQIIQTNGINVTGILANGIYNGKSGKYRYRGGEGYHDYYLTPQQNNSPEPTVSVHTEVPG
>gnl|bykdb|A0A517WHH5 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium V6] (length=790 residues).
MNTEFQPLEPHSDLDFDGMEDSTTNASAPGVDIVRLLFRNKYLIVGGLLAGLLLGQAAYMKLGPVFSANTKIQVSQKNPV
PIKEGEVQTFGELTAHIDVIKSPRIVGQAVKAGKLTELPSLEGEKDPAQEIIDSLKVKRLSGTDRTYLNILNLTYENKNS
HDAKAIMQAIVDAYQHYLDEVRDQNTGEIIEQLNKANKALLTELEQKKKEYKEFRKDAPLYWESTPGSEAAVAGSTNMHQ
ERVKTIDNERRQNLLKLTELKSKINTLKSAIASGESKETLELLAQQFLMGQARGQAGAVTGGVESQAIAPGNTQVERARL
ALETHLMPLLIQKNRLERDYKKNHPDLDAVNRSIDTIINLYRRQGIEISADNLESGEFQVSKMKDVDFVNIYLKSMEQQL
KELENRETELTRLFDQETELAKKVGNYQVVDQAYNEEIAQLKSQRESIFKQLLLEKVAKGNSGYTMTQLSPVKDELVIKR
QLKFLMAGGAAGLGLVLAFSYFREMRDTTMKSVDEIRNQLHLPMLGEVPQFTEEPAHMDDSQFDSALWYYYRPASREAEA
YRSLRTSLLLKTDRTGARVLQVTSAEPGDGKTTSVSNLALAIAQTGRKVLIIDADLRRPTVHKLFGINNAVGLGDVLAQE
IDAQTSIRETRISNLSIMTAGMLPENPSEMLMSRRFAEMISQLRNEYDYILVDTPPLVVVSDPSVIASTVDGVLLVVRID
KNRRGVIRKVQQIIQTNGIKITGLIANNVITNSLVGYDYIDSEGYQAYFEKPEPQTTKPAANPAKTEVTS
>gnl|bykdb|A0A517WQT4 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium V202] (length=792 residues).
MNTEFQPLENHSDFEFDGMEGNTPSNTSGPGVDIVRLLFRNKFLLISGLAVGLILGQAAYMKLGPIYSASTKVQVSQKNP
VPIKEGEIQTFGELTAHIDVIKSPRIVGEAVKEAKLYNLPSLAGETDPTEEILGSLKVKRISGNDRAYLNILNILYENPR
SQDAKIVTQAIVDAYQRYLHEVRQVNTNEIREQLDQANKQILTDLERKKKEYREFREDAPLYWENTPGSDAAVAGSTNVH
QERVKAIDNERRLNLLKLTELKSKISSLKAAIASGESKETLELLAQQFLMGQTRGGQPGSTSSAGASISAPGTSNLERAR
TALETHLMPLLIQKNRLERDFGENHPDLDAVNRSIKTIVNLYRKQGIEISADNLNSGDFKLSNVKEADFVNIYLKSMEQQ
LKELHNREQELTKLFDEETELAKKIGNYQVVDQAYNEEIAQLKSQRDNIFKQLLVEKVSQGNSGYTLTQLSPVKDVLVIK
RQLKFLLAGGAVGLGLVLAISFFREKQDTTLKSVDEIRNQLHLPVLGEVPTFDESVSIDDSECEFDRALWYYYRPSSKEA
ESFRSLRTSLLLKTDQSGAKVLQMTSAQPGDGKTTSISNLALAIAQTGRKVLIVDADLRRPTIHSLFGIVNGIGLGDVLS
EEIDAQTAIRETRIKDLSLMTAGTLPENPSEMLMSKRFTHLLKQVRNDFDYVLVDTPPLAVVSDPSIVASSVDGVLLVVR
VDKNRRGVIRKVQQIIQTNRINVTGILANGIYNGKSGKYRYRGSEGYHDYYLAPQQNNSPEPTVSVHTEVPG
>gnl|bykdb|A0A517ZCB5 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium Mal4] (length=764 residues).
MNKLVLEGAGDATGRGESLDFVRGVVRFGRVVRNRLHIVLGILVSVSILGGISYVLSPPVYESAAELLVLQTGSSVLDSE
RNPQGTLSDQMPNFERVLRSDEVVKRTLKQLPPEHRSDFRGVRPERWIESFQSHLEVSAERKTNVMNIRYRSGDADTAYV
VVSTLIGAYLEYMDHVMENTARDLLGILSQRKDALERDLKAREAELIEMKSRSQLLFASDEDRMISVLNQRVIKLNESLV
KAQHEAIDARSFLLAIEEAIRQGEDIQQFASRMSEGLATELLKRHAGIASGDVYTQSRMQQELLSAQTELRNKLSFYGPK
HPEILELQDKIRITQQYLTDQPRMTSESVKRASTEDLGPRLLQMARHRYLMAANQEQQLLAEFERERDNALQLNQQLAEI
QIAELEIQRMRTYDDVLLDAITNIDLNKDNHLRTAVISEPQVNPVPVSPRLTVVAMLCLIIGTGGGLATVYLMDIIDDRF
RSPDQLRSELGLPILAMIRKLPPLADSGLSSLYPFSKPNAVESEAFRSLRTTLEFSNEDTKCMTISSTEPGDGKTTVMAS
LGVAFAQSGRRTILIDGDMRRPGLTRLFNLTGHPGLSTVLMSDRSVEEAIDTLPHHTELPNLDVLPAGPRPANPVELLSG
DRLSMLVAWAETHYDQVLIDAPPSLAAADGQIIGRMVDGAIMTVRPDKNRRRMVMRAVEALSELGCNVYGLIVNHVSPQS
DSEYSYGYGYGYGYGEHDNDADEDAQTLPAGPKFVSPEQLRKSA
>gnl|bykdb|A0A518AAQ5 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium Pan110] (length=790 residues).
MNTEFQPLEPHSDLDFDGMEESNMNSSGPGVDIVRLLFRNKYLIVGGLVAGLLLGQAAYMKLGPVFSANTKIQVSQKNPV
PIKEGEVQTFGELTAHIDVIKSPRIVGQAVKAAHLTELPTLEGEKDPAQEIIDSLKVKRLSGTDRTYLNILNLTYENPNS
HDAKVIMQAIVDAYQHYLDEVRDQNTGEIIQQLNKANKSLLAELERKKKEYTEFRKDAPLYWESTPGSEAAVAGSTNMHQ
ERVKAIDNERRQNLLKLTELKSKINTLKAAIASGESKETLELLAQQFLMGQARGQAGAAAGGVETQALAPGNTQVERARA
ALETHLMPLLIQKNRLERDFKKNHPDLDAVNRSIETIVNLYRRQGLEISAENLESGEFQVSKMKDVDFVNIYLKSMEQQL
KELENRETELTRLFNQETELAKKVGNYQVVDQAYNEEIAQLKSQRESIFKQLLLEKVAKGNSGYTMTQLSPVKDELVIKR
QLKFLMAGGAAGLGLVLALSYFREMRDTTIRTVDEIRNQLHLPMLGEVPQFTETPAHVDDSQFDSALWYYYRPASREAEA
YRSLRTSLLLKTDRSGAKVLQVTSAEPGDGKTTSVSNLAMAIAQTGRKVLIIDADLRRPTVHKLFGINNAVGLGDVLAQE
IDAQTSIRETRISNLSILTAGMLPENPSEMLMSRRFAETVNQLRNDYDYVLIDTPPLVVVSDPSVIASIVDGVLLVVRID
KNRRGIIRKVQQVIQTNGIRITGLIANNVITNSLAGYDYIDSEGYQEYFQGPAQKTASPVAKPARTEVTS
>gnl|bykdb|A0A518AKT8 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium Pan181] (length=760 residues).
MLKTPESNNLSSMEQSDDISTSDMIHAGLRIWRTLSYRRYYVIASLVVCCVLGFAYYLAAPRYYQSTAKLLINERKADEL
TSVGDQIANDDLMANQRDLVTSAIVVSNALANLDSEHLIDLERVPRSDWVEDLTDRLSASISRKGSFVEVRYRSLDPDAA
AAVVSEVVNSYLSFVDQTHKGSAGDTIEMLDGRLKQVQTDIQDKQRQLIELRDRVGHLALGDEKEAIDPIVQRALSLNES
WIEAQQQRVDLEARLAAVNSSIARGDDMRQHLMSLEETLGQQVLISSLGMSSDDLSSIRERERERLEAEREMQSLSPYLG
PNNPRMLELKARIDGIDQYLTNYRTAAGQRIAGMTGNELGPMMQELLRQSIAQTLEQEKQKEAAFVAARTEAAKQSSQLV
ELRTCERDLVRLENLHDSLIDRLDSADIYQSQGPIQAVVVEDPLPELKPVSPRIKTVFLMSVLSGLIVGVSLAYIQDALD
DRFNSPEELTAQLGVPVLTLVQRLEPLVGDGLQSLHTHMCPNASDSEAFRTLRTSLSLMTDASERILVSSAEPSDGKTTV
SANLAVAFAQAGKRTLVIDADLRRPGMTTLLGLKGQAGVADILTSEEPTASIAPRHVVHTDEPRLDVIPAGLRRPNPAEL
LSSQEFIELLAWADSQYDQVLVDCPPVLAVSDAQIVGRLVDGAILVVRPDKNHRRLVARACESFRNTGSQVLGVVANDVS
DMHGSGYGYGYGYSYHSEDEEEPLPGEASLPHDDDSRRAA
>gnl|bykdb|A0A518ALT3 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium Pan181] (length=760 residues).
MSESHPNSKDSRHQLTTTHEELAISRRRNITHARQGSGSKQPTQSGITPLFVWRVFRNWWKFLVPCSLLLAVAAAALVLW
LHVPQYEARALIKIESNIPYIAFDSNNSNSRDSDRYVQTQIETMKSPIVLGPLLSRPSVSEIEEINSEFDPQAYIREHLS
VRQVGKSELYEVAYTSSSADDAATVANYVVAEYMTVENDETDKRTNMVINTLREELKDREGHIEQLRTRVVDLAKDVTGR
DPFGQGAIVGVTAFSPSTSVYQELTETEVSLEVAKAELQALKTSDIISADNAIATGHFELEISNRADVRRLEDQIRDIEQ
QITEIKSKPRPRISDTWEKDPDYLRVNALLIETRRSLTALREHARTELAQQQLERNKQESEQAILSKQQEITTLAKKLEL
LEIRRQEHVAELEKGGARSAELDIVKSELEREQNVFELISARKLALETERGAPTRASLMHTASPPRLSIEPIPFKLLAIA
CLSALIAPLGLATVREVVVKRVCNADELANETQLPLLGEVACLPVRKVGTRHQLMAPNQHDLLVYTESIDSLRTTLALTE
GVGVRDCHKTVAVCSGVSGEGKTNISTALAMSIAHASKMPTLIIDADLRSPDVSEYLDVPSGPGLSEVISGSVPLNEAIY
RVGDSLTFVLPAGSERINPHQVVEGSAIPDLLRKLGKRFSTVIIDTPPVLSASEALVYAKASDLVVYCSLSDVSRARQVR
LATEKLEATGARIAGTVLSGVSTKSYVYAYGRYASLQGQA
>gnl|bykdb|A0A518BBX8 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium Pan216] (length=771 residues).
MDRQEPFDPNASDDSPIIAMPDLTRLVQIVWERRWTFLVGPVVFLALATLYYVQATPRFESEAKVLVINKKPTLMTDRAG
LPVSHFEDYVETHQVLIESPLIVERAIRTNPEILQLESAKPSSEDEDAVDVIIEEIDVKRTTGRLSSSPDNVLEVSFSGK
LPEESRLILAAVIDSYRDFLDETYKNITDETATLMTQARDVLRKELRDKEEGYREFRLESPLLGRSSEGVDTNLESLASI
QREISQLKLERAEVESDLLTLQRAIQEKEPFDALLVMATEIAQKSKQTDTKDDSRLNLDNQLFPLLLSERELAVDFGPDH
PKLKMLRDRIQLARNFFARPTAAFAAFSGDHESAETLLSKSGSAAEAVEMHLDYLNQKLDYLKVAEDRLDELYKEEYDEA
RKIAAYDIKDEAFRKEIDQTQQLYDSIITRLQDAGLVTQSGGYEAKIIAPPELGEQVWPMAIIIFPVAGLLGIMSGLGLV
YLVDMADTSFRTSQEIQRRLGLPIVGLIPFIAAPKTKGSGEDAQIDAAIDMTLCAHLRPRSVHAEAYRGLRTALYFSMNA
HNQNVVQVTSPNAGDGKSTTASNLAITFAQLGRKTLLIDADLRKPRVHRLFNLSGKKGLVSVIRDGADLDDVIHDTGIDG
LSVIPCGPLPENPAELLTSPHFEELVEGVREKFDFVVIDTPPVLAVSDPSVVAVRVDGVLLVLRLSKSGRHPAERAKELL
SRHGVNVIGVVVNNSDRGTRYGYGGYGYAYSYGNEKYLDESPLSSDSQDAT
>gnl|bykdb|A0A518BJJ1 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium Pla133] (length=974 residues).
MFRHDQNTAGGVRDAVPELRAILDLIRKRWLAIGACAAATVAAGIGWLSLQPPVYRATATILLDQSQPTGGVLGELAALS
SAPAAASEIALLRSRSLAEKTIQSPPDGSIPTPENPHAQRNQGLTTVVESPDQQPVRRIFDRMVGIRRGKGALHARARAL
ADGAAEAIRVSFDGEGQIRLTPVDVAASPDDDAREARPQRPDGRYRVGGVELNLAVRGDVSRREFVVRRVSEASAVKRLL
SDTRVVESQRNSGVIALTVDDSDPERAAAVANALCHNYFDLNVERGRKRASQTVGFIQSQLDEQLAALETAEHEVVDLQA
ENLDAIDSVATAESLIRNLSDLEVQRMRLDLQASSLSESLALLRGGDFDALGRIAQELDDPLAKSLLEQLSVLHMRLLLK
GRSDGDPYALLLAQRSELLEERAGELAMQIVAVRETIQAIDDGVPGAYGFLSANSNAPGITVDPLTTGYLSEIARLEGEI
ASLQHEFLPGYPPLAQAIAALDELRAKVRDSLRGRLTGLQRLFEDRSELAKTAALAATDLPDANARVDRAALEDLRERVE
RQLASRLDAVALENDELGRYVAVLEERLGNLPEQQRRLASPMRRLETHKQIAAFLLTSLQEAEITRASTVAAADFIDAAA
APDLRYSPRIGFTLMLSSVLGLGLGLGLAWLRESLRRSLQGPSELEAVTGLPVLTTVPDFKHGKHRVAKATTDFIALRDD
PHGVVAEAYRSLRANLRFAVGDVNALRTMAATSCAPGEGKSTTNIDIAWAFASGGRRVLLVDADMRRPSVHRYLKLDRGP
GLAEVLAGTSEWRDVARSTDNPLLSVIPAGVLRASAGDALGTTKAQELIDEFTKSYDLVVFDLPPALAVADVETFAHRLD
AVLLLYRSDGLPREAVSLATTRLRQAGAKLVGCVMNAHRADRSSASDRYQGDYGYGYTDAGGDGGPPALEGVEAALPSEL
EREVASASARDERF
>gnl|bykdb|A0A518CHE5 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium Pla110] (length=791 residues).
MNPYLDQSNSNESSNHDNSTSAMMARVMRFLRVIMLRKKIIVVCVILSSVAGAYRYSTQIPMFQSTAQLLILSNGGFQTD
DVSGQSLLKNQMPTYTRLLSSDRVLETAASHLPPEHQVDVSGNPMEMQVKILRSQLSTSVSPQTNLIDIRFTSQSPETAA
YTIDQVIMAYLKFMEETHQNGTQNLLKLLTEDQTKMENQYQENANQLIELQRRSDLLLNSGSETVSLVGQRILSLQTAYT
EAQNQMIKLESLIKVLKQAIEKGSNAQQYAEEILGPGPVGNELLSQEMGLQDRLIVSRLQDQLKVDQAELKSKLTTLDYN
HPDVMVLTNRIQSAEDALQQRLQSNQSSYHVQQNRRQAQRLLEIAEQKLVQYEERYRALKESYLSEEEKGRESTLVMLKI
KQLETHQTRIMAQHDTLLQKIREVDLDDRASVLAKTVKKPEISRYPISPNKIRTAMFSLILGIAMGIGVIVVLEALDDRF
RSPDEIKYHLNLPVLAMVRKMEETTGYAIDAVQTHVNPNSVESEAFRTLRTAISFSSHESRRLLVTSTEKSDGKTTVMAN
LAVAFAQSNKKTLIVDTDMRRPGMTNLLELRKEEGLSKLLRSEEPVDQCAVELIQPSGSPNLDILPSGSRPVNPSELLSS
NRLSDFLSWAETVYDQIIIDAPPILAVSDAGIVGRLVDTLVLVMRPDKNRRGLVYRSVETLQMFGIHISGIVVNHLTPDQ
GSDYYGYGYGYGYSEDYGHEESTGEDGYDEDGYGDGNYQKEPAILGYTSPDSGQDAGYEDDDYETNPYQAA
>gnl|bykdb|A0A518D182 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium Pla163] (length=947 residues).
MPLTHEGTDRNGSPDPAAGLRHVLDLALRRRLALALFAVAGLGLALGWIGAQAPVYRATATVLIDEQDGASATLSELSLF
GSAPRASAEIALLSSRALAEQVVATPADVLDADERARHLGLEAQVDDLARRPLAAAVGRLTGQIPAPRIAVRSERLDGSA
PERVRLRFVSPTRVELAALGDMAYAEHFGSDATELDYAAGEPVEWSGLRLWIDADADRSLGTYVVHVRTPDDAARDLMNN
TRVMETQRNSGVLELTVSDSDPLRAAAKANALCLNYFDLKVERSRRRASQSIGFIEDQLDEQTAALETAEADVVALRKQY
PDLIDLTTSAGRIVEQLSGFEVERLRLDLARHALEEALELTQAGDDRGLSQLSSELADPLSKGLVERLETLGLERFAAAR
ADGGPYRTLLQQRAVELDERADEARVELAALRAVLTAAEADEQGAFAGLSSSPSSGATVDPLTLGYLAELGRLQSQREVL
ASTYTVEHPERARIERAIVELRARLTQNLAQRAEALAALADDRDELAATARDAAMAQSGRDLESIDAALAATRARIADHL
ASRREALGRQYTELDRVCADLEAQLGALPEKERLLAAPLRRLETHKELTALLLKSLQEAQIARASALSSADFVDRAAAPD
RRYAPRIGFTLGLGLVAGVLAGLALLLVREHLAESLESEGELERITGLPVLASVPDFKDGGRVATRTKDFVAMRDDPSGP
VAEAYRSLRASLRFAVGDLGQMRTLAVTSSAPGEGKSTTNIDLAWCLASPSRRVLLVDADLRRPSVHRYLGLGDQVGLAE
CLTDEADWRERRQPSGRDHLDVLVAGRSRQVSADLLGSDAMSELVDEWLAEYDLVVFDLPPALVVADVEVFAHRLDAIVL
LYRAGGLPSRVVENTAKRMRASGAKIVGLVMNACRPEKAKGAGAYSDYYKARSAYYQDDRSPDRQAA
>gnl|bykdb|A0A518D7F9 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium Pla175] (length=757 residues).
MKQSPTAALAREEEWQDDSGAAGAALEGVLRFLRVVQRRQKLVALIVAGHLAVGAAYYFTATRYYESTAKLLVIEQNPDQ
LSSMGDQAGSDNVTANHQQIVRSPVVVREAIQALEPQHRLDLLGVPSQRWLEDILSRLSASSVRKTNVIEVRYRSKEPEA
ATAVVTSVINSYLAFVDRTHRGAALDIHEMLTTKHAQLVEELDAKQRELQQVRNEVGRLVAAGDSDAVDPMVARALKLND
ALMDAQAKRLEVEASLATVREALASGQDLRRYVALVEEAVGQQMLMSAMGVAPDDLALIAQQRQKLLEDEQELRRVAPFL
AENNPTVTALNERIAATKQYLAGRHVGAGEALGGIGDSELGPLLISMLQQSAQQLARLETQLTDSFEAARAHALEQSSGL
IRLSMLERDVARLEKLHDVLFEKLETVDTHQLQAPVRVTVIEEAMPNERPVSPQLRLVVLASLCGGLAVAAGVVYAQDLL
DDRFGSPEEMSRELGLPILSIVRQLNPTGGERLEAVHMFRDGNSPDAEAFRTLRTALTLTGDVADRIVVSSAEPSDGKTT
VSSNLAVAFAQIGKRTLVIDADLRKPGLTALLGLKGQPGVTDLLTARGEMSKLAPGVVRKTDQPGLDVIPAGPRRPDPAE
LLVGPALTELLAWADSRYDQVLIDCPPVLAVSDAQIVGRLVDGVVLVVSPEKNHRRLVSRACESFLSAGVHVLGVVANRI
TQGGGHGYGYGYGYGYGYGHDEPDTEDDTPIAPLRAA
>gnl|bykdb|A0A518DRX3 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium Pla85_3_4] (length=803 residues).
MTTELSLVSPDAEGSSPRDIMQAALRFLQVLRRRKGYVLAMLAGAAVLGAAYYVAAPRMYEAKASLLITQTGPDVMSGST
PAASGGDSLIPTYEKLFTSAVVLNSAVEKLQDAPPEVVLAFDAAPSKEWAKTIEQNLRASSKRGTNLIELSYRAKSPEAA
TAVVAAILSSYLDFMDKNHKDVSLEIVTILDQERKQVEETLAEKQDQMLDLQHRVGDLGMREGSTVVHPAVQRVVELNRT
LIEAQKNRVHLEALQTAVGDAVREGRDLRQHLLTFSPEIGRELLVSSMGLGPEFATNLRQIERQLIDERGQLNNMLAHYG
EAHPKVIALRNSIVSGEQYMADIRFKAETQQNSIAGQQLAPLLTSLIAQRLAETRANEKQLLVEYQSSEAEAVSLNDRVA
ALQLVDNEVQRLRRLHETLLNQISKIDINQNQSDVRVAVVGEPLANENPVSPNLKMTVLLSLLIGLGGGAALVYGIDLLD
DRFRSPEEMVEQLGAKLLAAIRPLSLTETHGAQAVQVHVNPTAVESEAFRTLRTVLSFGDLEGNRLIVTSTEPSDGKTTV
ISNLGASFAQSGKRTLLIDCDLRKPGLSTLFQVRGLPGLSDLLRSSEPVGAMCEQRILSTGIPDLDLLPCGPKAFDAAEL
LSGSRIEELIAWAEIHYDQLLIDTPPILAASDAALAARHTDGILMVVQPVKNNRRLVMRAVDEIRALDLNLIGVIANRID
VAQAGYYGYGYGYGYGENDSDDDHISPTSTTATSTPQHSPVVRRPDRSTSSQPTSTPTTPTRRRPAATQSDDHQPQVTRR
RAA
>gnl|bykdb|A0A518DZF9 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium Pla85_3_4] (length=803 residues).
MTTELSLVSPDAEGSSPRDIMQAALRFLQVLRRRKGYVLAMLAGAAVLGAAYYVAAPRMYEAKASLLITQTGPDVMSSGT
ASAASGDSLIPTYEKLFTSAVVLNSAVEKLQDAPPEVVLAFDAAPSKEWAKTIEQNLRASSKRGTNLIELSYRAKSPEAA
TAVVAAILSSYLDFMDKNHKDVSLEIVTILDQERKQVEETLAEKQDQMLDLQHRVGDLGMREGSTVVHPAVQRVVELNRT
LIEAQKNRVHLEALQTAVGDAVREGRDLRQHLLTFSPEIGRELLVSSMGLGPEFATNLRQIERQLIDERGQLNNMLAHYG
EAHPKVIALRNSIVSGEQYMADIRFKAETQQNSIAGQQLAPLLTSLIAQRLAETRANEKQLLVEYQSSEAEAVSLNDRVA
ALQLVDNEVQRLRRLHETLLNQISKIDINQNQSDVRVAVVGEPLANENPVSPNLKMTVLMSLLIGLGGGAALVYGIDLLD
DRFRSPEEMVEQLGAKLLAAIRPLSLTETHGAQAVQVHVNPTAVESEAFRTLRTVLSFGDLEGNRLIVTSTEPSDGKTTV
ISNLGASFAQSGKRTLLIDCDLRKPGLSTLFQVRGLPGLSDLLRSSEPVGAMCEQRILSTGIPDLDLLPCGPKAFDAAEL
LSGSRIEELIAWAEIHYDQLLIDTPPILAASDAALAARHTDGILMVVQPVKNNRRLVMRAVDEIRALDLNLIGVIANRID
VAQAGYYGYGYGYGYGENDSDDDHISPTSTTATSTPQHSPVVRRPDRTSSQPTSTPTTPTRRRPAATQSDNHQPQVTRRR
RAA
>gnl|bykdb|A0A518FTU3 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium Pan153] (length=790 residues).
MNTEFQPLDPHTDLDFDGMEESNMNSSGPGVDIVRLLFRNKYLIVGGLIAGLLLGQAAYMKLGPIFSATTKIQVSQKNPV
PIKEGEVQTFGELTAHIDVIKSPRIVGQAVKAAHLTELPTLEGEKDPAQEIIDSLKVKRLSGTDRTYLNILNLTYENPNS
HDAKVIMQAIVDAYQHYLDEVRDQNTGEIIQQLNKANKSLLAELERKKKEYTEFRKDSPLYWESTPGSEAAVAGSTNMHQ
ERVKAIDNERRQNLLKLTELKSKINTLKAAIASGESKETLELLAQQFLMGQARGQTGTAAGGVETQALAPGNTQVERARA
ALETHLMPLLIQKNRLERDFKKNHPDLDAVNRSIETIVNLYRRQGLEISAENLESGEFQVSKMKDVDFVNIYLKSMEQQL
KELENRETELTRLFNQEVELAKKVGNYQVVDQAYNEEIAQLKSQRESIFKQLLLEKVAKGNSGYTMTQLSPVKDELVIKR
QLKFLMAGGAAGLGLVLALSYFREMRDTTIKTVDEIRNQLHLPMLGEVPQFTEKPAHVDESQFDSALWYYYRPASREAEA
YRSLRTSLLLKTDRSGAKVLQVTSAEPGDGKTTSVSNLAMAIAQTGRKVLIIDADLRRPTVHKLFGINNAVGLGDVLAQE
IDAQTSIRETRISNLSILTAGMLPENPSEMLVSRRFTETVNQLRNDYDYVLIDTPPLVVVSDPSVIASIVDGVLLVVRID
KNRRGIIRKVQQIIQTNGIRITGLIANNVITNSLAGYDYIDSEGYQEYFQNPAQKTATPVEKPARTEVTS
>gnl|bykdb|A0A518GJT2 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctopirus ephydatiae] (length=742 residues).
MQTLMRFWRSVQYRKGLIILAVLAAIALGAAYYIVSTRYYESKAELLILQTGSKVLDGAAPEGAAMKDLMPTYERIMQGD
IVLADAAQKLPVKYRTDFRGVAPSDWPGVLKKMVTVRSARQTNVLELTCRSRDPKAAAAILYAVLSASIDFLNKNHQGTS
QEILQILSKEKVELEQKLTTREAELIELRGRSLTFVSNGTDNATNVAVARVVRLNEEFMKAKEETLRATAQLAALEQAIS
RGEDVLQFAMASLDVVGKQFMMGELGLDTQEDMAISRMTEQLLQEQAKMRTALESYGPNHPKVMELRDAIQSKEQWMASR
RQVTIERLKQLRTEELTPRLLQMARQRVQHSQQHEASVSTQFDIERQNALALNGELAKLEILQMDTKRLRAFYDLVLERI
RGIDLGKDKGIRTAVVGEPKVNPRPVHPKLSLTVAVSLMAGISLGLALVYLADLLDDRFRSPEETSLQLGAPVLSFIPTL
PTYDGNGLDSVHAFVAPHESSTEAFRTLRTAIQFAGDDIRRLVITSTEPGDGKTTVSTNLAVAYAQSGRRTIIIDCDMRR
PGLSKTMKLRGSYGLSTILRNDDSIENSLRNNVVVSDLAGLDIIPAGPRPANPLELLSSTRFSELLAYVESQYDQVLIDA
PPILAVSDAGVLGRMVDGVVLVVRPDKNQRRSVIRAAETLRMWGNNLLGLALNNMSSDRAGGYGYGYGYGYGYGHTDTDG
DHDDLLDDHASSHSSSSSRTAA
>gnl|bykdb|A0A518HFS8 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium ElP] (length=694 residues).
MPALLRALRLRWKLAVSGAILLGAAAGAVAFVAMPPAEYSSRSLVHVAEKRPRDLFETRESGVSYAIYQHTQTTLIRSNK
VLEAALKKSGIGSLEMVRSRTDPVAWLRERLRTEFGNSEILTISMSGGNPEAVATVVNAVTEAYLEQIVRQEEQERVERL
ERLEQLFEKYQEELRAKREDYREQAQSAGASDQKGSALRQQMVAEHLGQSRRELVQLQSEIRKARAEVTVLAEDAATPAA
AAHRDLGFEGLIGRDPVVAKLRADLAEYSGRLEQVRRIVRNPGEPSRKRLEQAVASLAESLRMRYEELRGFHGAQQSGDR
PAARDPGLEQAGRYLEILEEQERILREEIASLEQEMGTLGIQSLDLHWVEDEIDLSTEVARAVGSEVRAVTVELEAPPRI
RLLEPAKPQGPADPMERYKFCAMAAVASMGAFVGLVSLWEFRAQRIDATAEVAGRLGIGVVGALPTSPRGDRGGATAVRR
RALIESVDAVRTALLRASQVEPLQVIMVTSATKGEGKSSLSCHLATSLARAGRRTLLLDCDLRSPAIHLLMDEPLAPGLC
EVLRGEVALDDAVHATAASPLEVLPAGCCDAAAVDALAREEFPRLIQDLRGRYEFIIVDSAPALIVTDTLMLSQHVDAAL
LSVLRLVSRAPDVGEAYERLATLGVRILGAVVSGVRDDPNLSDDRYHYLSGVKR
>gnl|bykdb|A0A518HKC1 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium Enr13] (length=807 residues).
MKRYQDEALDADDGAELNIDLLGIVRRRFHLIMLGVLVGATCATIYFVKQKPVYESSLAVLVGQLSSEMASTGVRGTSDG
AVTMQDEVLSTHIELFSSPKVLQQAIDRANLNRSVGQLRGGLSISKGGQGAGASASILRATYRDGDPETAAKVLQAVFDS
YQLYVDGQSHDVGAEAVELIAKAQVQNEIALQEADQAYRDFVASVPALLNVSGSGVGNLEDIHRTRLKSIEGELASVRTA
LASARSRRLVIADAVKGKRPEDLTDAEVMTLLTEDDMARLQTLVSIAKERKAKDDGLDIARIVANTSSTSKVNRLMGLLS
QRQVMRATYGAGHPSVVALDTEIASIQKFAPQEGDEPSEEKESDFDVPPAEILAAYYAVLKSDINEFAKRETELLALSEQ
ESKLAKEVELSFLKGTALKANLDRAQARYDEVFKRLQELNLTNDYSGFSTDLLVMPVPASLPVWPAKSKIAMMGIMGGIM
LGLGLAMLAELADRTFRNPEEVESVVGAPILAHMPMLRESKLQKQAIKDSAISPMIAAFHVPRATDSETFRVVRTSVLFL
AKKQSKQVFLLTSPSPSDGKSTTIANLAVSMAQAGKRVLLVDADLRRPTVAKNFGIERSPGLSDYLNHVVCFSESLHECE
QINLTLCPAGSRTSAPSELLESESFGEFIAEARQSFDMIFIDSPPLLAVTDPAIITLHVDSCLLAVRIEKNNRTLVERAT
EILRDQCVPIDGVIVNGRDSRRRGYGYSSYNYYGKGQYGYVDGYRRYYESDEEEAVISNGRSRKRVNGEAVKMNGRGASD
RLITGKR
>gnl|bykdb|A0A518IH18 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium Enr17] (length=792 residues).
MSTEFQPLDQQSDFAIDGMEEHAPTNSSGPGVDIVRLLFRNKFLLITGLIAGLMLGQVAYIKLGPIFSASTKIQVSQKNA
VPIKEGEAQTFGELTAHIDVIKSPRIVGEAVKEAKLNELPSLAGEKDPTQDIIDTLKVKRISGNDRAYLNILSITYENPL
SQDAKAVTEAVVKAYRKYLNDVSDENTKDIIKQLNEANQQILSDLEQKKKEYKEFREKAPLYWEHTPGSEAAVAGSTNVH
QERVKAIDNERRLNLLKLTELKSKIDSLKAAIASGESKETLELLAQQFLMGQTRGQAGSANGNTSQGQIATPNTTQVDRA
RTALETHLMPLLIQKHRLERDFQKNHPDLDAVNRSIETVINLYRRQGLDISAENLESGDFKIAKVKDVDFVNVYLKSMEQ
QLKELNNRETELTKLFEQETALAKKVGNFQVVDQSYNEEIAQLKTQREEIFKQLLVEKVSQGDGGYTLTQLAPVKDELVI
KRQLKFLIAGGAVGLGLVLAISYFREMRDTTVKSVDEIRDQLHLPILGEVPTFAESEAAMDDSEFDPALWYYYRPASREA
EAFRSLRTSLLLKTDRSGAKVLQMTSAEPGDGKTTSISNLALAISQTGRKVLIVDADLRRPTVHKLFGLSNAIGLGDVMA
NEIDAQTAIRETRISNLSIMTAGTLPENPSEMLMSRRFTDLIKQLRDAYDYVLIDTPPLVVVSDPSVIASTVDGVLLVVR
LDKNRRGVMRKVQQVIQTNGIKVTGILANGIFSGRYGEYDYGAGEGYQEYFEAQPKKKTTQPVVPANTEITS
>gnl|bykdb|A0A518INW8 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium Mal33] (length=790 residues).
MQTNHPMNEMTLPAEGITDSQPGDMTRILRRRWPLLMFGLVVGLGIAFAYHQNAKDVFESSMEILVSQRATELMTSSGPD
GRSFDANVVQADLLATHIALLESPMILNDAIESGKLSDLDSFVAARREGISALGLLKQDLNISRGGSGDAEGASVLQVSF
QSADPEDAQHVLEVIYERYCHHVESRTQNVGQEAATLINQAQLTNEQELQQATQAYTNFLSTSVGMFDGDQLQSVSHNRL
QSIEQELANVRSQLTYAKSKLETIAEIQAEDVEHQRTDIERLALLNPRDTERLRFFMDVASGDPSGSGALRDDPQRTAAL
NLEHTKVLGLMLREQALTADYGDDHPLVQRVRDELASVRQYIREKAPEGIEELVASNLSPTEILDAFSTLLKNDVKELTK
QLAQLTEEAKAVRVAAKEVESEYLEGTALKAKMTRAQQRYDVVMERLQELELTSDYAGYTIDLLSPPGPGSLVWPVLAKI
LLNGGLAGLLVGGLLAFWAEHADQTFRDPSDLQHSLNASVIAHVPRFVVTRKEKKAAKQSAISPLCRTVFAPHSVESEVL
TMARTSLFVHAGQTNDNVIQVTSPMPGDGKSTMTVNLAAAIAKAGKRVLLIDADLRRPTLYKLLGTQNANGLAEYLMGDA
GLDEVAVPSEIERLDFISHGHHASEPAELLESFALERLIAEARQEYDFVFIDSPPLLAVADPLIIASLVDSVLLVVRVQK
NGRRPVERSRELLASNKVKVAGVIVNGGERADKHFGYGEYVKPYEYGYATQYTRSYASKPNERPVASSSV
>gnl|bykdb|A0A518IQ30 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium Mal33] (length=773 residues).
MQRESAPRLSETEQGSDEFQAADAIHAALRFLRMLRRKKQYVAFSLLVTSALGAFYYLTADKVYEARAQLLVTQTSPDML
NAGVSSSVTNDTLVATHERLIESSVVLGGALDRIRQLDSDLKIDLAGVSPEKWKDTLRNNLSASAARRTSIIELSYRSKS
TPAAQAVLQAVVESYLEFIDTSHKDVSVEIATILKDELREKERDLKAKQEEWVQVSRDAGDLGLRSGSNVVHPLVQRAVK
MNDILVAAREKRLKLQASEVAVKHAVETGGDLRQYLVELEPTIGRELMLNELGMSPRFAEVADRMEQRLLADRALLQSQA
KHFGPVHPKIQMLQQKIADSERYLAEYRAKMQAANGPGQEQQLGEMLLSMIREALAETQANEQQLEHEYALAEAEAVKLN
GRMTSLQLVENELQRLRNWHDTLLNQIANIDLQTEGGDIRVSVVGEPVASPNAVAPQLKVIGLLSLFAGCGIGIAIAYIT
DLLEDHFQSPDELEEQVGVSVIAMIQSLNGSGEAGGQNLHMFTNPKSAESEAFRTLRTSLSLQGSDFSKLAITSSEPGDG
KTTVIANLAVTYATAGKRTLLIDCDLRKPGLTRLFDLRGLGGVSQLLTQADTVEPVWGNEVKATGIGNLSIIPAGPRPQD
PTELFSSSHFGELLAWAEANYDQVLVDCPPVVAASDAAIIGRFVDGLLMVVQPAKNHRKLVIRSVEQLAQLGVQLTGIIL
NRVDDSTAGSQFGYGYGYGYGYGYGYGDEEQDDVVESLPLQQAPTQAPHRKVA
>gnl|bykdb|A0A518JNW8 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium Poly24] (length=773 residues).
MQRESAPRLSETEHGNDEFQAADAIHAALRFLRMLRRKKQYIAFSLLVTCALGAFYYLTADKVYEAKAQLLVTQTSPDML
NAGVSSNLNNDALVATHERLIESSVVLGGALDRIRKLDSELKVDLAGVPEEKWKDLLRGNLSASAARRTSIIELSYRSKS
TLAARAVLEAVVESYLEFIDTSHKDVSVEIATILKDELREKERDLKAKQEEWVTVSREAGDLGLRSGSSVVHPLVQRAVK
MNDILVAAREKRLKLQASEVAVKHAVQTGGDLRQYLVELEPTIGRELMLNGLGMSPRFAQVADEIEQKLLSDRALLQSQA
KHLGPVHPKIQMLQQKIADSERYLLEYRAKMNAANGPQQEQQLGEMLLSMIGEALAETQANEEQLEREYAIAEAEAVTLN
GRMTSLQLVENELQRLRNWHDTLLNQIANIDLQTEGGDIRVSVVGEPVASPGAVAPRLKVIGLLSIFAGCGIGIAIAYIT
DLLEDRFQSPDELQEQVGVSVIAMIQSLNGSGEAGGQNLHMFTNPKSAESEAFRTLRTSLSLQGSDFSKLAVTSSEPGDG
KTTVIANLAVTYATAGKRTLLIDCDLRKPGLTRLFDMRGLGGVSQLLTQADVVAPIWANEVKGTGIPNLSIIPAGPRPQD
PTELFSSSHFGELLAWAEANYDQVLVDCPPVVAASDAAIIGRFVDGLMMVVQPAKNHRKLVIRSVEQLGQLGVQLTGIIL
NRVDDSVSGGQFGYGYGYGYGYGYGYGDEEHDDAVEALPMEQTPTQSPHRKAA
>gnl|bykdb|A0A518JPH9 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium Poly24] (length=790 residues).
MQTNHSTKEIAFPADGMLDSPPSDVTRILRRRWPLLLFGLVVGLGIAYAYHKNTKVVYQSSMDILVSQRASELMTSNSPN
GRSFDASVVRADLLATHIALLKSPMILNDAIEVGNLSDLDSFVAARREGNSALGLLSGNLNIQRGGAGGSQGASVLQVTY
QSSDPEDAEYVLEVVYERYCHHIESRTQNVGEEAAALIIQAQATNEQELQDATQAYTAFLATSVGMLDGEQLHSVSHDRL
QTLEQEIAEVRSQLVYAKSKLESIAEIEASGSDQEQMDIERLALLNARDADRLKFFMDIANGDVGSTGASREDPLRAAAI
NLEHTKVLGLMLREQALTADYGDEHPLVQRVRDELTSVRNYINEKAPTGLEEIVSSGMTPSQILTAFSTLLNNDIKDLSK
RQQHLMEEAATVRVAAKAAESEFLEGTALKAKMTRAQQRYDVIMGRLQELELTSDYAGFTIDLLSPPGVGGQIWPKLSKI
LMNGALAGLLVGGLLAFWAEYADQTFRDPSDLERSLNANVIAHVPRFQVTRKEKKAAKQSSLSPLCRTVFAPHSVESEVL
TMARTSLFVHTGQTDENVIQVTSPMPGDGKSTMTVNVAAAIAKAGKRVLLIDADLRRPTLYKLLGIQHPKGLAEYLMGDA
SLEEVTVSSEIPGLDFICHGHHASEPAELLESFALETLIAEARQDYDFVFIDSPPLLAVADPLIIAAQADTVLMVVRVQK
NGRRPVERSRELLTSNKIKVAGIIVNGAERGDKNFGYGEYVKPYEYGYATQYTKSYSSKPQPRPVSSASV
>gnl|bykdb|A0A518K5H4 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium Spa11] (length=753 residues).
MASSPANPYAPTPVAMSHVSPLATAAMSVDQEDDSDGVNVLAVAWQSRWLILLFTLLGGVAAWAYLQQATPRYTSLSRIF
VEQKLPSVLAGESLGAFSTKHLYTQAQLICSPSVLNAAIEAPENVGIETFRNTDNPLALLREEIEVVVGERDDIINISIE
LENPTDAAQIVNSVVDAYITKYAEERRSDVVDVVNILRSEKQRSDQDLEERRQALDEFRRDHVTLAVQSKEGREGNVVTE
LFAALSRELNATQIELLEAKTRYARAQKMLENPDQIPFLMELARTAQAGSRSGDLDGQIQMMEQNLIAQQAKWGPGYPAV
RLLEESLAKLRERRAEQQQATLNAYVDGLRQNYELLAQRRDELQKAYDKQFALATEVSQQAAKLADLQEAYEQTSEYCDT
LNKQIREVNLSENVGAMNVSILEVATPGIQTFPGRRKTLSLGLAFGSMLGFGLAWLRSMLDQRLKSIEEIASVMQLPVIG
AVPLMAGSRGREGDRSVGGRLVALQPRSTAAEAIRTLRTALYFGIGGESKTFVVTSPAPGDGKSTVASNLAIAMAQANQR
VLLIDADMRKPTQHETFGMTPTTGFSDVLTGAVLAIEAVVSGVAPNLDLLPCGPIPPNPVELLNNGMFSEVLEQLLRQYD
QIVIDSPPVMPVADSRMISAMVDCSLLVLRAERSTRRISVGARDELLRVRTQRLGVVVNAAPIHRSNFGGYSGYGYGSYG
QVAYGHEDAAEARPAVRRRLKSMADEDLTSIDG
>gnl|bykdb|A0A518KBK3 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium Spa11] (length=755 residues).
MSLDTVNDRGEPWGNELDAGGHALEAVVRLTRVVQYRRNTVLWTLAGCLAIGAVYYVTAKRYYRSTAKLLVVDQSAGELT
TMNDQAGADNLMATHRELVKSSEVVTRAIERLAPEHRIDFVDQKPNRWVETIGDSLTASTVRKTNFINVGYDSLDPEAAA
AVVRAVIEAYVDFVGETHRGTAAEVLDVLTIERDQLEQSLAAKQLELQQSRERVGHLSLPDRDDVVDPIISRAIQYNDAL
LEAQRRRLDLQSSLTTIQMAIDRGDDLSQHLGLVEQSIGEAAMLAAMGMGPNDMEVLAKQQAKLIDLRDELGRLEPFYGP
SHPQVATLKSQIDSTQQFLASYRSDASGRPTGLTAAELGPFLVGMLNQAMSQSVERERQLEEAFQVARADAARQSGDLVK
VDMLDREVERLEKLHDLLFEKIATVDIHQVQAPIRATIVEEPLPSDLPASPQLRLVLVASLMAGLCLGVGLVYVQDLLDD
RFGSPEEMAMQLGCRVLAVIRELPLRTGVGLEKVQMFSQPQATESESFRTLRTAITLGAEVSERLVITSSEPGDGKTTVS
ANLAVSYAQTGRRTLVIDCDMRKPGLTSLLELKGYEGVTDILSAEGNVGLIAQRCVVRTALESLDVIPAGPRRPDPAELL
LSPNFAELLAWADSKYDQVLIDCPPILAVSDAQIAARLVDGVVLVVSPEKNHRRLVNRACGHFTSGGAPLVGVVVNRVSD
QIGKGYGYGYGYGYGYGHEEEEHVSHADENRPMAA
>gnl|bykdb|A0A518L3P0 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium TBK1r] (length=808 residues).
MKRYQDEALDADDGPELNIDLLGIVRRRFHLIMLGVLVGATCATIYFVKQKPVYESQLAVLVGQLSSEMASTGVRSTSDG
AVTMQDEILSTHIELFGSPKVLQQAIDRAKLNRSVGQLRGGLSISKGGQGAGASASILRATYRDGDPEVAAKVLQAIFDS
YQLYIDGQSHDVGAEAVELIAKAQDQNEVALQKADQEYRDFVASVPALLNVSGSGVGNLEDIHRTRLKSIESELANVRTA
LASARSRRLVIADAVKGKTPEDLTDAAVMTLLTEEDIARLQTLISIAKERKAGDDSLDIARIVANTSSTSKVNRLMGLLS
QRQVMRATYGAGHPSVVALDTEIASIQKFSPQDGDEQPDSAKSEFDVPPAEILATYYAVLKSDINEFARRESELLALSQQ
ESKLAKEVELSFLKGTALKANLDRAQARYDEVFKRLQELNLTNDYSGFSTDLLVMPVPASLPVWPAKSKIAMMGIMGGIM
LGLGLAMLAELADRTFRNPEEVESVVGAPILAHMPMLPESKLQKQAIKDSDISPMVAAFHIPRATDAETFRVIRTSILFL
AKKQSKQVFLITSPSPSDGKSTTIANLAVSMAQAGKRVLLVDADLRRPMVSKTFGIERSPGLSDYLNRVVCFSECLHECE
QINLTLCPAGSRTSAPSELLESDSFAEFIAEARQSFDMVFIDSPPLLAVTDPAIITLHVDSCLLTVRIEKNNRTLVERAA
EILRDQCVPIDGVIVNGRDSRRRGYGYSSYNYYGKDQYGYVDGYRRYYESDDEDAPTSSNGRSRKRVNGKAAKMNGHAAS
DRLITGKR
>gnl|bykdb|A0A532UD06 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium B3_Pla] (length=824 residues).
MDHEALANGSQDLMSEQGHSQPQEGLFQIALIVLQHRWTILLTTVGFLVVGFAYIMKATPIYTSASRLYVEQSGPKIINE
YEGVMTQSHNYLYTQSELIRSIPIISDAVNDTRIGHLETFAGIDNLVGYVKRELKVAVGRKDDIITVSFDSPYPQEAAQL
VNAMVDSYVRYHSARQKSTVSEVLRIIEKEKVRRDEELSGKFSELLAFTRENGVVSFNDNGGNIVLERLTRLSNALTETQ
LAALNAKADFEATKKMANEPAKIRQFAGAAAGAGAQVSGSDRETQLRAELRRVEMDLENARYHCTEDHPSVKAIQSEIHR
INKELNEQAKEFADAYIEVMQLRWLAAKQREDELMTSFESQHQAARELSVKAAQYAVLQSELNRAERICEILDNRIKELN
VTEDTGALNISVLEVARPARNPSEPQKRKIMATALALGLVFGTCLAFLRDWIDYRLRSCEEISSVLHIPVLGVIPEISEG
QRSTITRGREIWLKLKSIFADISRTAYSRTVPGEPKGKAKPGAQPIMAQVRAYRALRATGTKAQPFAVGASSPNKDETTT
EEQALEEQALVEFGQVVHFKPRSIAAEAYRTLRTSIFFGVPKGGAKTILVTSPAPGDGKTTLVSNLAIATAQAGQGTLVI
DADLRKPRQHRIFEIDHELGLTNVLAGTVRLDEAIQPGPVTGLDLLSCGSQVPNPSEMLNSDVFAQMLKDLPKCYDRVII
DSPPVLPVADSQIIAASCDVTLLVLRADKSTRRLSRQACDSLVSVGGHLLGAVVNDVKHKRGRYSYYNYSGYGYDSGYDY
GGYYDDDISAESRDQDEANVHVHV
>gnl|bykdb|A0A532UIN2 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium B3_Pla] (length=834 residues).
MPLYIDSQPTARLSVLSSILQALQRAQIPRMLCVSFLSRMTLSPWNIRREPVRRYFGTGYSDSISALIYAPKTFSEMTDQ
NRRRTRGSDVISQYENNRTFARDALQGGPRSAGITSESLVQIMWRGRWLILLATILAVAAAVVYLVKATPIYSSTSRIYV
EQSGPKIFSETETSVMTQSKNYLYTQSELLKSTPIVAAVLDVPGIAQMKTLAGVDNSIAYLKKELDVSVGKKDDIISLSF
NSPYPAEAAQLINEAVDSYITYHATRKRSTSAEVLKILQSEKTKRGKELTEKLTTMLDFKKENEALAFEGSRGNIVITRL
ERLSQELTEAQLATIESKSAYESVGEMVSDPVKLKQFIEAQRARGIYVSTDSAKASLRSKLDQLELRRADRRRQLKSSHP
AVMALETEIAHVKAQIADLDAEFARAQLAVAEQQYVSAKKKEGQIAKYHNEQRKQALDLNEQLAQYTILQSDWEQTRRLC
DILDERIKELNVTEDVGALNISILEVARAADKPSEPEKAACLAKALIMGFMLGIGLALLRDWMDHRLHSAEEISAVLNLP
ILGVVPSMPRRLSIADRGQKVHKDSDSPVAEAYRTIRTAVFFGAPKNQAKTILVTSPAPADGKTTLVSNLAIAMAQAGQK
TLIIDGDFRKPMQQKIFNVNHGDVGLSSTLAGITTSGEAIRPTEIEGLELLPCGASVPNPSELLNSDGFAQLLEILSDRY
DRVIIDSPPVMPVTDAQILAAICDVTLLVLRAKKSTRKTSQQAKDGLSSVGAHILGALVNDVQGNGRYGYYNGYGRNGKK
KTGNREPAAGVRRTVVSPSRMAKDSRWRTPLMKT
>gnl|bykdb|A0A532UT69 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium B3_Pla] (length=715 residues).
MTSDMTDKNTDLKMVGVARSIANTPPTSGFMPESLIRIIWRSRGIVLLTTFVSLAAAAVYVTTITPVYKSTSKIFVEQSG
PKIITETEQGVLTQSKNYLYNQAALLKSTPILTAVLNDHNARQMQTFTGAGNPIGVLRSGLDVSVGKRDDIISVSFSSPY
PDEAVEIVNAAVDSYKAHYVSRKRNTSAEVLKIIQSEKTKRTQELSEKLKTMTDFKKANEALALEGERGNVVTERLARLS
SVLTEAQLATVEARHTYESMKAMVSDPAKLSQFIEAQRATGPYGTNGEKAALETRLEQLQLRLSDRLQWVTREFPAITAL
EAEILRTKSKIAEQDTKFAQTQLAVAEQQYLNAREKENEIARYYDEQRQQALSLNEQVAEYTMLQSDWEQTKKLCDILNE
RIKELDVTEETGALNISVLELARPANAPSEPQKTRYMATALLAGLMLGGGLALARDWMDQTLRSGDEISALLRMPVLGAV
PAMLGERSGRARGQKVHLDPDSPAAEAYKTIRTAIFLGVPNGKAKTILVTSPESAEGKTTMVSNLAISMAQAGEKTLILD
ADFRNPVQHLVFDVDVFEVNGSKGLASLLSRRATLEDIAEKTDIKDLDLLPCGEQLINASEVLNSKSFTTLLKDLAKKYD
RIVIDSPPVVHVADAQILAATSDVTLLVLRADKSTREASRRACASLSSVGAHILGVVVNNVSKKNSYGYYGGYKV
>gnl|bykdb|A0A532UTJ0 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium B3_Pla] (length=776 residues).
MNEIKKLNEPVAGQELVNLQIPPEQSSEPTSDLVAGIFRRWYIVLLVFLLICGAGLPATLFLVKPIYSVTGAIKVAPIIA
DIMTDEGDHGGISNYESFMNTQAEKVTSSSVVQRVANALVDKNLSFFDTEPAGLLTKWKQKLLGTTPKPEIAARLKQAIV
GEKSIVVAADRRSELIHVTMQTTKPEEARQIVDAFITAYMDIEVLSAVEGENARLTLLEDRRKGLYEKIDNERKTIYQLG
QEYGDIVLEGRQEMMRERVIALLDRLTAVQLDKISLEAQVQLLERSTERAIAPEELLRMRQEYINQDPTVVAFTNHITQA
DQELISMRLILQPENPDLKRKAELLETLKNHLKQREQEASQAFDERVTKEIAEAGHKELVAARSKLDETTVIEESLRQAI
SEEDTETITVGRKQLTIQELQETLEFNKETYASVVRRIQDLELQRDRPKRISVYYHADVANINDKRIKLSVAVIFGALVC
GMGLAYLRDKADLSLRTPDDVAKRIGIRIIGTTTSLHTVKPALLPEQIVGDYQTIRANLGLVGDKGIPRKLVITSPGMKE
GKTTFAVNLATSMAESGKKVLLIDGDLRKPDVARLLNLPKGSRGLQDVLCGVKFEQAVYSMASTGLDVLAADFDNAADAY
EMLAMPATKKRINTISRKYDHVIIDTPPTLGFPDALMWAKIGGAAILVSFAGHTTMPDLKEAKDRLAEINVKVLGTVLSS
VDAGHGYYRHHGYYTQSAQSREAAVGHKRKLMFSMEEGADDGKDSETPDGGVTTDV
>gnl|bykdb|A0A533Q6B7 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Candidatus Jettenia ecosi] (length=731 residues).
MIPVDQRKPQSHTNRRENTEVHLLDYLKIIQKRMWICVIVFIAIVAVVVVYTLRTQPLYQTTASIMLEQKEFNVGIQQIL
SEDKNIYNFYTDQCEIIKSRLIAKKVIDILDLKNHPGFNPYKGIENPALAADNPSDPFTETYLINAFLSGLNVSLMRNSG
VVCITYTGDDPYLITTITNAIVKTYIEQDWERRYSVAKEALEWLNKQMENVKDAVEQSELALQKYKKENNIFGIEPVGSG
ESGRIEDPQHNVVFQKLEEINAAITKAKIERLRLETLYNKLAILKNAQNQAEIIQSIAPVVQNDLIQNLKGESIRIQNEI
SLYSNRYGPKHPKVVQLNTELHTMRNHIIKEVERLCNHITIEYEIAKSNEATLLSLFEQQKNEVFTQGDRSIQYGVLKRE
ADTNRQMYETLLTRIKETNLAEDFKVSNIRVIDYAEVPLGPYKPNKSINTLVGIITGLACGVGIAFLMEYMDKTIKTQED
VKKYFGTVLLGIVGHIPQKKKDARTMQLITYNLPKYPITESIKRIRTSIMFSHPDNPKKTLLISSAIPSEGKTLLTSNLG
VVMAQTGKKVLLVDADLRNPSLHKTFELDESSGLSNSLINPVNLHRVARVTKVPNLYVITSGPPSPNPSELLSSSAMVEF
LKVAREEYDWIIIDSPPLLTVTDGSILARMVDGIVFVLRNKKTSIAIAQKGAGCISAVHDKILGVVINDLDFSDEYRYHY
YDKKERYYQKA
>gnl|bykdb|A0A533Q9U4 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Candidatus Jettenia ecosi] (length=726 residues).
MLPFKGDESEEIHILDYVKIIRKRMWMVIIFFVVIVAIVTIKTFKTTPVYQATARVVLEQNKLNVGFQQVISESQFTPLD
FYTNQCEIIKSRSIAKKVIDTLNLKNDPVFNPPEKDEYPESAGNRTQDPSAETQFINRFLSPLKVSLMRNSGVVSISYDG
HNPQLITRIANMIVKTYIEQDWEKRYNVAKDALDWLNKQLKDVKIALEESEAALQRYKRENDLISVEAVGSENLTSEKQN
VVLQKLMELNTAVTYARTERIKLEVLYNKLKDFKSIQYKDDIIQSIPAVVQSPLIQNLKADYARVENDFSLYSQRYGMKH
PKIAGLKAELDTMRDNIMKEVEQICDSIATEYEVAINRETTLVTILEQQKNEVFALGDKAIQYGVLKREADTNRQMYETL
LTRMKETNLTEDLKTSNIKVLDHAEVPIKPIKPKKALNILLGIIAGLGCGVGIAFVMEYMDNTIRTQEDVEKYLKTSLLG
IVGHIPLDKKDTDFTELIAHSSPKHSITEALKGIRTSIIFSHPDKPKKVILVTSSAPSEGKSLISANLAIVMAQTGKKVL
LIDADLRKPTMHKLFKIDKSLGLSNVLVKSGDLRTVAKETTIPNVRAIACGPIPPNPSELLSSSAMVEMLQLAKEEFEWI
IIDSPPILTVTDARILARVADGAVFVIKSNKTTKDAARKAIDHFSDMRDKLLGVVINDVDFSRDKYYYQYYYQYYYHYGE
KEAKEA
>gnl|bykdb|A0A5A8BGT3 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Gimesia sp. JC646] (length=790 residues).
MNTEFQPLEPHSDLDFDGMEDSTTNASAPGVDIVRLLFRNKYLIVGGLLAGLLLGQAAYMKLGPVFSANTKIQVSQKNPV
PIKEGEVQTFGELTAHIDVIKSPRIVGQAVKAGKLTELPSLEGEKDPAQEIIDSLKVKRLSGTDRTYLNILNLTYENKNS
HDAKAIMQAIVDAYQHYLDEVRDQNTGEIIEQLNKANKALLTELEQKKKEYKEFRKDAPLYWESTPGSEAAVAGSTNMHQ
ERVKTIDNERRQNLLKLTELKSKINTLKSAIASGESKETLELLAQQFLMGQARGQAGAATGGVESQAIAPGNTQVERARL
ALETHLMPLLIQKNRLERDYKKNHPDLDAVNRSIDTIINLYRRQGIEISADNLESGEFQVSKMKDVDFVNIYLKSMEQQL
KELENRETELTRLFDQETELAKKVGNYQVVDQAYNEEIAQLKSQRESIFKQLLLEKVAKGNSGYTMTQLSPVKDELVIKR
QLKFLMAGGAAGLGLVLAFSYFREMRDTTMKSVDEIRNQLHLPMLGEVPQFTEEPAHMDDSQFDSALWYYYRPASREAEA
YRSLRTSLLLKTDRTGARVLQITSAEPGDGKTTSVSNLALAIAQTGRKVLIIDADLRRPTVHKLFGINNAVGLGDVLAQE
IDAQTSIRETRISNLSIMTAGMLPENPSEMLMSRRFAEMISQLRNEYDYILVDTPPLVVVSDPSVIASTVDGVLLVVRID
KNRRGVIRKVQQIIQTNGIKITGLIANNVIINSLVGYDYIDSQGYQAYFEKPAAQDKKSAVNPVKTEVTS
>gnl|bykdb|A0A5B1CIK7 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Rubripirellula obstinata] (length=789 residues).
MANTNEISASRVRQNARPSVEEEQDSLDVFAILGRQRWLIAALSLAGLAAGIAYALTAEVWYSSQAKVLINERSAGLGSE
GNATNVVDEDILANHIELLQSRLIVGEALEANGLLELDSILPHLNEKIDSVDYVIEHLSIVKGGDGSAKTARSLKVLFDH
TDAEDTQLVLTAILKRYEEFIISQVEQVVGQANQMVNQAKNEVETELVAAEQEYLTARQNAPLFFQGEGSSNIYQDRFRS
LQEQLLDIDIQESSIKTRLKRVEVTLNEIDETNTSAVDQLDKLALIDSESLERLGVFAGLQMSASNTAEFKSAMPAKMEG
ARAEITHLLQLNSEKQRLTAVFGPGHPKVQDIQGQIEGVKEFLQSNENLAESASMFGESTLTATGLLKAYVGFLNHDLAT
LGEQRKELNFLAADAETKAKDLIEYELNDMVLRKKIERQEALFDGVVQQLRDLDTASGLSGYLYEFLEVPRLGEKSWPKL
PICGLGGLMLGTFGGLFFAVANEFRDRRFRSAAELDEAIGLPNLGMVGKLNSIRDGISGLIAVENSPNAEAFRLGRTVLL
PEVRSGKLRTIGFTSPMQGDGKSTVCSNFAVSFSQIGLRVLVIDADLRRPSAHRYFSVAKGAGLCDVLEGRAEFADVIKE
TDAENVSVITAGSSPKMAAELLQSEKLDEILSQAKEQYDLVIVDLPPVLAVSDPIVVMSRLDGGVLVVRVANVRRDEVIN
TMRRIAASGGNFVGCVLNAFGSGQKFNVQGGYYGYYQSDYTKSPKKNGAVKPLPARSAAISSDIAGRDG
>gnl|bykdb|A0A5B9MKP1 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium] (length=810 residues).
MKRYEDEAFEADDGAELNIDLLGIVRRRFHLIMLGLLVGSTCATIFFVKQKPVYQSSLAVLVGQLSTKVAATGVRDASDG
AVTMQEEILSTHVELFGSPKILKQAIERESLGRSVGQLQRGLSISTGGEGAGSAASLLKATYKDEDPEVAARVLQAIFDT
YQNYVEGHSENVGAEAAELIAKAQLRNEMDLRKADEEYRNFVASVPALVNVSGSGVGTLEDVHRARLKSIEEELASVRRV
LAETRSRRSVIAEAVDGKAPEEITDADVMTLLSDTEVTRLQALISIKKQRQPGSAGESESQAIARSSRQSAAQRLLELTS
KRRVLVTAFGMGHPSVVALDAEIRAFEKIGELSDAEQAGGAGEKAFDVPPSEILGTYYAVLKSDLNEFARREAELLALSD
QETKLAKQVELDFLKGASLKANLDRAQNRYDEVFKRLQELNLTNDYSGFSTDLLVMPVPASVPIWPSKSKIAMMGIMGGL
MLGLGLAMLAELADRTFKDPGEVESVVGAPILAHMPMLRESKLQKRVIKGSAISPMVASFHLPRAVDSETFRVVRTSVLF
LAKKQSKQVFLLTSPSPADGKSTMVSNLAVSMAQAGKRVLLVDADMRRPTIDKVFGVERSPGLSDYLNGVVSFSECQQDC
EQLNLAVCPAGSRTSSPSELLESEQFAEFIAQARQSFDMVFIDSPPLLAVTDPAIITLHVDSCLLAVRIEKNSRTFVERA
AEILRDHHVPIDGVIVNSRDSRRRGYGYSSYNYYGKGQYGYVDSYRRYYEAEEEDEPARVNGRSHKRINGQVAKVNGRTA
TSDRLISGKR
>gnl|bykdb|A0A5B9PJZ8 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Mariniblastus fucicola] (length=787 residues).
MSGLRPVQNNNNNYGIPQPQGSGSMPSSGGGLSELYNFDVFDMVRRKIWLILFFTLLGIAAALLFFFQAPKTYRSTAKVF
VDEKSAPSISEEDGYAQDTVEKYIEILRSTATLKNAIRDGKFEQMETFEDVDSVIRYLRDGKALIAKSADVKSNSGVIKI
SFDGGNQKEAEQILDAVVKAFGSYIDSDAEEIGGQTTQLWKTLNENMLSRTKEVQEEIEKLMGLPEMLIVDGRVQNPYQL
QQARLHEELHQLRRERTRLEARVTSIQQAKAMGKNPESLVIGVLQEFSETNMGAYTSTHNKYVELKMLEQELLQQYGSNH
PELKNVRKQIAMVDSMRMQELSSLRGEENELQGKPDMVADFVERVAGQIAMISAQEKSLEESILDEQRKAAQTSVNIERL
LALQRERDRLELYSDNTIDKLGEVEVLKDFKWRKMSELNPASVAEQVAPSLPLCLGGGLFLGTLLGFLFAGVKEMAEKTF
RSSEDIAAILGSRVIGHVGLFQRVRPRKDSPFSNVAPELIALHQPSNQNCEAYRSIRTSIFFRAQETGAKIIQMTSPTPG
DGKSTTIANLAASMAQSGRKVLLIDADLRKPRQHKYFGVDNDYGLTSVVYGQMEPEEAVRVIQPEYLSVVTCGPIPPNPS
ELLTSARFEAIIGVYREQYDYILIDTPPLLAVTDPAIVCRFVDLVYMVMRITNGVRSNSVRAKEVIDSMGVELSGVIING
LRRRDQKTYDYKGGKYGYGGYTYGGGYGSSYGKNYSGNAPTPAANTPSHQPPIPNLVDAKSSSKSRN
>gnl|bykdb|A0A5B9QEI7 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Bythopirellula goksoyri] (length=756 residues).
MNNSPNPPEHESTGSGLPARIPVAHALRRPMPAAARQNSTPNEQGITPAFVWRVFTGWWKWVVPLGLILAAGAGAIVLMF
YVPKYEASALVKIEAETPFIAFQQGALNKDSERYVQTQIELLRGPVVLTPVLGRPEIASIPEIKRSPDPLKYLQKQLTVR
QIGKSELYEVSFVSPSSQDAASVANVVVAEYLALQNREERQRSQMVIEVLEKERLERGTKVDQLRKRVVELAKDLTGKDP
FGQGVVTDAVAFSPAGSLYQSLTETDVEFEVLKAELQAINNSPMLGEDRAVASGLLELEISNRADVRRLEERGDFIHQQM
AEIKSQPRLKKDVTWEEDPQYIQLQEQAKNVEAELKELKELVKRELIALRREERKAEQEALVGAKQQELGLLSKKREMLS
AKLAEQMNELKSGGAQSAELEFAKAELEREESVFELIAARKLALQTEQRAPTRVTLMQSASPPHIAIEPIPYKYLLLASL
VSLVTPLGLAIAYEFLAKRISTPEQLTNESSLPLLGEVAQFPRQRVATTQAQIAAPQQRQMFVYTESIDSLRTQLMLTEQ
VGQPGVDKIIAICSAASGEGKSSLAAALTLSIAKASKKPTLLIDADLRSPDVSSFLEVPSQPGIVELLGGEVALEKAIHR
VGKTQAYVLPAGVLKGNPHHLIDQAKIEKLLDKLRGSFDTILIDTPPVLSASDSLIYAKAADLVLFSSLADISRAKQVRC
AVERLQTTGANLAGVVLSGVSVNRYVYHYGSYGQHE
>gnl|bykdb|A0A5B9QF68 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Bythopirellula goksoyri] (length=790 residues).
MTNTDCKHNLREDAFMPAVDAVSAIARFLSLVRRRKQVVITSVVISGLLGMTYYLLATRKYASTAELLIIQQKQDQLATV
GDHESSEDTMATHQKLIASPIVLQNAIKRLPPKHRIDLVGEPTHKWVEKLSENLSARVTRKTNFINVSFRSKSPDAAAAV
VRAIIHSYLQFVQEKDRGTAVDALHSLLQKGAELEAKLTEKQNELQSFSQAVGHLAVSQDDSAVEPTIQRALRLNDALMD
EQQRRLELQATLLSVEGALDRGENIHQYLVAMEESVGRQMMLSSLGLSSEDLNVIEEQQKQILASQAELSSLSKFYGPNH
PRILDLQNRIANSQQYVRDYRANLGNPSNGMAESHLGPVVKRMLEQSVQQAWQKEQQMSASFEEARQEAAKHSGDLVQLR
MLEREVTRLEAQYDLLFEKISTVNMRQMQAPIQATVVREPVPDRVPVSPQIRFLVFFCLASGTAVGAVIVYVQDVLDDRF
SSPEELTAQLGVPVLAMVRNLTPLPGEGMETVHTHTLPHAVETEAFRTLRTAISLSGVACGRLLISSSEPGDGKTTISVN
LSVAMAQAGKRTLVIDADLRKPGFTSLLQLRGRPGLADVLTSGLSPAESAPSMVVATEVPGLDVLPVGLRRPNPAELLSS
HEFVELLAWADSQYDRVIVDCPPVLAVSDAQVVGQLVDGAILVVRPEKNHRRSVIRAFESFQSVGCNVLGVVANALSDES
QSYGYGGYGYGYGYGSDYGSDYGNDEEAFEEEVSDADEPQESIPDPATKRSRTPRRKQGPTEPIRPRRAA
>gnl|bykdb|A0A5B9QGF0 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Bythopirellula goksoyri] (length=784 residues).
MINSDFNQNQADADFMPSVDAVSAVARFVGIVRRRKQVVIASVVISGLLGMTYFMLATRKYASTAELLIIQQKQDHLATV
GDHESSEDTMATNRKLISSPIVLQNAIKQLAPQHLIDLVGKPTHEWVETLSENLSAQVTRRTNFIDVTYRSKSPDAAAAV
VRAVINSYLQFVQEKHQGTAGDALHSLLQKGAELEAKLTEKQNELQSFSQEVGHLAMSQDDSAVEPTIQRALRLNDALMD
VQQRRLELQATLASIDGALERGEDINQYLVAMEESVGRQLMLSSLGLSSEDLSVIEEQQKQILTLQAELSSLSKFYGPNH
PRILDLQTSIANSERYVREYRANLGNQSNGMAQNHLGPVVKRMLEQSVEQTWQKEQQMSASFEEARKEAARHSGDLVQLH
MLEREVTRLEAQYDLLFEKISTVDMRQMQAPIQATVVREPVPDRVPVSPQIRFLVFICLASGIAVGTAIVYVQDILDDRF
SSPEELTSQLGVPVLAMVRNLTPLPGEGMDTVHTYKLPHAVETEAFRTLRTAISLSGTSCERLLISSSEPGDGKTTISVN
LSVAMAQAGKRTLVIDADLRKPGFTSLLKLKGRPGVADVLTSGLSPSESAPSMVVETEVPGLDVLPVGLRRPNPAELLSS
NEFVELLAWADSQYDRVIVDCPPVLAVSDAQVVGQLVDGAILVVRPEKNHRRSVIRAVESFQSVGCNVLGVVANALSDES
QTYGYGGYGYGYGYGYGYGHDEEEFGDEVADEPLETIPHPSTKMSVTPRRKTSPTDPIRPRRAA
>gnl|bykdb|A0A5B9QNZ7 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Roseimaritima ulvae] (length=865 residues).
MPGQTVGPVSIKREYRCSPQDRPDIPPIFTGFTYSQALPCFTDYFSGLNETDRGPVTTGTIVPPPAVDSPPPGRFPWQSY
ANESIPMSHEPTTSPEPVLDLWGVLRRRWIIVFLGLALGISLAVFYAVVAPKIYSSQVEVLVMRKDPGLPMMAQNQQGAP
QQEIGDSLLATHMEIIRSPRVIGDAVDNRQLEALESIRQQLDPELARLDHRRAVITYILDNLWVERGGQELAYAPLTFVA
EFRHGQAADCATVLTAITESYQDFMAETLQDANSEATGLIQQARDDMSLEIDQLENTYREFRRSTPLLTLGPDSLNKNQI
RLAALHSELIRLQLRESELESRAIILKNTAGQESLREFSDLERLGLIDARDVERLALLVTVERGDATTDESFVAQQPQRT
TTATTEMDSLLTLKVRLREEQSRLGSEHPRVLELRDTVRDVEQFLEAKNQALQPQQDSPEIRSGTLVKAYAKVIDKDLED
IRKQIEFTQQQIKQDEQESVDLVDDELRDQQIRDELYATKQLQLAVIDRLRQLNVMQSYGGFVTEILRAPEFGELAWPIL
PLVLAAGLCFGSLLGGGLALLVDLGDRSFRSTADIETATGAPMLGAIGAMKFRRNKQLSRLISPELVVYHRPESPQAEAY
RHLRTALMFSPGGKDLRLLQMTSPNPGDGKTLTTVNLAASLGQTGKRVLLIDCDLRRPRVGKLFSLDPDNTAGLADVLTG
KTELLDAIYETEVPEVSVMPSGFRPHNPSELLQTNEFFNLLAAVREKFDYVLLDSTPLLAVSESASIGQRVDGVVLALRT
ANTSRPEAERAVQRLQSVGVEPLGFVVNDIDYLSRQGDEGKYGYGYHYGAGGKAEKYFRPTASAK
>gnl|bykdb|A0A5B9QVD0 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Roseimaritima ulvae] (length=744 residues).
MYRRQRLVVGVFAVVGMLAGLFYVTADRVYQADAQLLVEEPGLGMLPGSGVMAQPNKLPTQEKILRSDRVVQSTLRSLRE
QPAAAQIDIRDKSDEAAVKTIRANLSVNLLRNTNVVELSYKSGSPEAAKAVLDTLVDAYLAFMQQHHQDTSIQVLELLQA
ERTKVEKRLGEQQEKLVELRDETRVVAFDDQSLASHPAVQRVNSLNASLTDAQKTRIELQAIAGVVEQSIREGRDPRPHM
HAVDPEAARSLTAAVLGVAPEQMRSVHALEQKLLNDRAELQTLAAHYGPTHPEIQQLNAEIANGQNYLENFQERVNGQVS
QTSGQQFARLLGDLVVQKLDEAKQHEALLAAEYEALEKEVVAMNGNLSEMLLTQREVERLNRSYDTLLEKIHGVDLGSDQ
AAVRVAVIGDPKAGMGAVAPRLKVTAALALMLAMGISVGLVFFLDLRDDRFASLDDIERQTQTEILAVVEKLEPHGETGP
QAIQMHVDPSARVSEAFRTLRAGLMLNPDQPRLIAVSSSEPSDGKTTVSSNLATSLAQAGKRTLLIDADLRKPGMTNLFD
LRQCRGFSQLLVEANVAATVKSYIQPSGIEDLDLLPSGARPLDPAELLSGPRFSEVLEWATTQYDQIVLDCPPVLVANDV
ALASRLADGLVLVVRPEKNSRRHVLRAIERLARFNTNVYGLVINGLDSASSDRAYGYGYGYGYGYGYGDDNQDEKIHLIA
EPTADQPPAAPQAPRRAAPRRRVA
>gnl|bykdb|A0A5B9WF77 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Aquisphaera giovannonii] (length=785 residues).
MNTPDRSDANLPARLTSSPRYPAQVSAMRREMDVAGAPSVTIDTRQLFRGLARNWWRILLVWLVVSAPLVYVIYTLVEPT
YQASSLVLVESNQNDPFSAFSNPALSGQAPTYLKTQLVSVTSDPVLAGAFVVEPRIAKFSMFKNSNDPAAELRKRLEVQI
LPDTNFIKISLESTNPQEAADTVNAVALAYKLATQPDDTQLVPPAITGLRKDTAQAEVAALEEYRKKEIDSKIKMKKDAL
LKLAKNGGVQFKKDANAKGEPVDTPQATSDDLLEQFRSTNELLMQTDFQLIEAEAKLTARQAQAAGDVASQSQAPDSNVP
NEQIREEFTRDPEVIELVDRIKQVKNELDHLESISRKKSDPSRKAAQTQLSKLEKQYYDLWETKKGQIRERLLVTTSGVA
SNGERGESIPELMQQIAVLKTKKDKLTELYKKFEVTQKDSHADTVQAAFLNTELANLTTAGQQIERRLLQLKFTQDKSAV
TIPRIDRAKAPRDSFNNKRLKFMAIVPVVVLGALLGLFLLLEIRAERVVNPDSLSSRVQSEVYALPPIPRQRAIGASGPD
DQIDRFIQRLDHLRFAVCGEPHDAEMGRCVLVTSAIGGEGKTTLAAQLAARCGNAGISTLLIDADLRRASLCPLLEVPEG
PGLSDALQGDVKVDELIIPVQGGTFHLLAAGTPVPDASRIVQGRSFPMLIAQLRQTYEMIIIDSPPVLPVPDALALGRWT
DGALLATRFEVSRSPQVERARRQLDNAGIPVLGTVINGLRSSDSYYGRYTYSRQRATQTPSADAV
>gnl|bykdb|A0A5C5V7Z9 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium KOR34] (length=778 residues).
MTAADHQPGFQDEGVQEGSLAESLHGLVRLLRLMQRNQSTIAWCVAGCVALAMAYYVAAPRIYRSTAKLLLIEQDSDKVS
GVADAGRADDVMATHRELVKSPVVLQNAIANLPPEHRVDLLTVKPSRWIEALNENLSATTVRRTKFIQVSYRSHQPESAV
AVVNSVINSYLRFVEETHRSTAADVLDVLTVERDQLQEELLQKQRLLQACRERCGHLAIDQKDSVVDPLIGRAIHLNDSL
MQAQQQRLDLQASLASVSAALARGEDMRNYLSVVEEAVGEQMMLASLGLSHQDLEMLSSQQKRLMETQDELRRLTPHYGP
NHPRVVSLTEQAAALQQYLSNYHAASGSRYASINNQDLGPMIKRTLEQSVAQAIERERVLSSSFDEARIEAAKQSGELVE
LDMRSREVERLESLHDVLFEKIAAVDIHQVQAPIRASIVEEPLPEETPVSPRFASLFGSAILGGLALGAVIVFVRDQLDD
RFTSPDEMSAQLELPVLSVVRTLNPLPGVGLDAVHMHVDGNSVEAEAFRTLRTSLTLRGDETERLVISSAEPSDGKTTVT
SNLGVAFAQIGKRTLIIDADLRKPGMTSLMDLKGQAGVTDILLCEGGVAELAERCLVKTPLEKLDVIPAGPRRPDAAELL
SGPNFTELLAWAEARYDQVLVDCPPVLAVSDAQIIGRLVDGVVVVVTPEKNHRRLVVRACDSFLHAGCHVHGVVANRISN
KSEGGYGYGYGYGQQYGYGHTEEEELAPVAAPPTSPVDPDPRDWRRLGGDDADPARAA
>gnl|bykdb|A0A5C5VEK8 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium KOR34] (length=758 residues).
MTSLVSSQQGQFDPVPNDQFGPGPSSQAPQSTDLLALAWRGRWLILLGVLIGGTASWVYLQRVTPLFLSQSRIYVERSLP
NLLGAEYQVGRSNSYLFTQAELIRSTGVLAAVAESPEAASMETFRGVENRVAMLYEALSVGVGQDDEIINVGLELPNRFE
AAQLVNAIVDAYITQYAEKRRNDTVEVLKILRSEQERRDAALAEARQDLTAFREANPELSVQVDNQDVASDRFSRLMNEL
NQTELEQLTAKAEYERVKQMAASPSLRPMLLDTALDAFGSKSDLDRDLERLRNQAQDLELALMTEQSKWGDEYPTVKSIQ
RSLDQAEQRIVQKEADIAKSKEMALKAYAFDIKERYEFQTNKLNELRSRYQEQFEEAKESSANSLKLMSLQEAYERAVSQ
ADVVEQRIKELDLTTQAPVNVSIIETASVAPDPSYPSRPKFLGAGVMLGALCGFGIAWLRDMLDHRLKSVDEIQEVLQLQ
VFGAMKRQMGRLGREELGKLVHLQPRSTSAEAFRTLRTAVHFGLAGDDCKVLVVTSPSPGDGKSVIASNLAIATDQADRR
VLLIDADMRKPTQHSIFGVDSKQGLSTMLRERRPVEDFIIPNALGSLDFLPAGPSPSNPLELLNNDYLIEVLERLKARYD
RIIIDSPPVMPVADSRVIAAMSDAVLLVLRAEKSTRSLSLAARNELWRVRTQRLGVVVNAVPQSRGSSYGYGYAYGGYGA
YGEIAYGHEEDATLSSRKKRLIKSRPAPAESATVVEQT
>gnl|bykdb|A0A5C5WDJ1 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium Pla22] (length=813 residues).
MTESTKSFSFASGEIDPLGMIRRRWRLLVFGVFVGIALSALYYTTATQQYQSSIEVLVGQRSSEMTSRGTINGNSGSGES
IRDDQLATHMRLFIARKVLTQAIELGDLTQYPSFAEIRQSGGSYVDHILDSIEVERGGDGNAQNAMVLRVTYRANDPEEA
AMVLSSIYNSYKTYIDSQDQDKSKLAVELIDAARETHEKELRDADEDYRNYVASVPVLLEGDKVRDIHKERLADIEKELN
DVRSGLAESKSRLEVIESTLERNGGTTGDMGHLALLSQKEVERLKFFLDMARGGAQSEAFQAAQPMRAEVAKAQYNRLLD
LIQKEKALSDTFGPEHPLVEAAREETMITRQFIDANRPENTAREQKDMDPAEMVMTYVMLLKNDISEFEMRKAVLLSESQ
KEMLLAKEVEADFMKAGALRAIRSRAQSRYDQVIERLQELELSRSYAGFSTDLLASAEVPMNPVWPRLSIVLAIGLVNGA
ILGLILVVAAETLDSTFSSVEELEGTTGAAVIAHVPRMALRDLRKAANVKSMLDPSLMTFHSPRSPEAEIFRVGRTSMMI
ANRKGSVQTIMVTSPQPGDGKSTTISNMAISFAQTGKKVLLIDADMRRPVIAKLFGIDQEPGLSDYLERRIPFEGAVTRT
EVANLDIVPNGGPTAEPAELLESVQLTRLLQEACAKYDLVLIDAPPVLAVADPAIIAPMVDSVLLTVRVIKNGRSIVEDA
VRVLHDIQVEPTAVIVNGVDKNALRSYQYGGYGQNKYGYVGRYHHQYGSKPVTKDDSNTTTLEDTWENRLRHSDDLGSRL
HHNIDRLNEIVKN
>gnl|bykdb|A0A5C5WHS2 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium Pla22] (length=787 residues).
MATSTENTSLRTQLSNRLSSDEDNDGLEIFAILSRQRWLIGLLTLAGLAVGLIYALNAEVWYRSQAKVLINEKSAGLGAG
SAATDIIDEDILANHMELLQSRLIVGEALESNGLMNLESITPHLGDSGDPVEYVIDRLELVKGGDGSAKTARSLNIALTH
TDPEDTQLILTAVLKRYEQFIINQVEQVMGRANEMVNKAKTEVETDLVAAEQEYLTARQEAPLFFQGEGSSNIYQDRYRR
LQEQLLDIDIQESTIRTRLERVEETLSEMDEEKSTAADQLDKLALIDSESLERLGVFAGLQMNSANTAEFRAAMPAQTEK
ARAEITHLLQLNSEKQRLTAVFGPGHPKVQDIQSEIESVKAFLQENDELAEPAAMFADSTLTPTGLLRAYVGFLNHDMSA
LNEQRKELTFLAADAEEKAKALIEYELKDLVLQKKISRQEALFDGVVQQLRDLDTASGLSGYLYEFLEVPRLGKKSWPKL
PICGLGGLMLGLFSGLVLAVANEVRDRRFRSASELDEAIGLPNLGMVAKLNSIREGISGLIAAENSPNAEAFRLGRTVLL
PEIRSGELRVLGFTSPMQGDGKSTVTSNFAVSFSQIGLKVLVIDADLRRPSVHRYFSVAKGAGLCDVLEGREQFKDMIRE
TEAEGVHVVTAGSSPKMAAELLQSDKLDEVIAEAREMYDLVLVDLPPVLAVSDPIVVMPRLDGGVLVVRVSRVRRDEVIN
TMRRIESSGGNFVGCMLNAFGAGKKFNVEGGYYGYYRSDYSRPASKNGSSKRIASPARASSIPTDMN
>gnl|bykdb|A0A5C5WTY6 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium Pla22] (length=812 residues).
MNSSNGPSSKGMTSRLSKVEAAKAHYADESPATAPQSRRGASYYGYGYEQPKWGETINPLSIVRRRWKWIAGFACLGILA
TAIYLSQTPPTFRSQAKILVNPNRVEVGDSDTSNDVVDEDVLANHVELIRSRRTIESALNQAGLIAEPSIVAKAEPPEDT
VTYVASNLRIDRGGLGAAKKARSLTVTFDHSDPVVAQQVLQAVIDQYLQTLSQKVDEILERSHRVVLDTQQQLAAKIGEL
EQRQKLARDQAPILFDGSNTTNVYEERYRSLQSELVSADLEVSKLRSRLEQVNSTIEQIAASDRKSDHIDKLALIDVESL
QRMGVFTDMQRDAASSTEARAELPGEVERARIEISQVLELSSERQRLVSVFGSKHPKVADIEKQITLTKQFLFDQAKREE
DSSQASSPTLDPEAMLKAYVGFLRNDLASHLERKTELQRLVELAEEQAREFVAFERSDRLLQNEIDRQRALFDGVMERVV
NMNSAGDTASFTQEILEDPRVGELVWPKPLLCLALGLLGGVLVGSGVGVSREFMDQRFASVEQFETALGLQAFGVIDDLS
GIELSTSPKATGNAKGSRETFRLTRTILAQSIQSRGIHSMGITSPTPGDGKSTMVSHLSTSFIRSGMRVLLIDADLRRPT
IHKLFGLPNELGLSQFISGSATLDEVIQSTKSDDFKVITSGEISLDSPEWLQTAALEELLRQTEDFDLVLFDLPPVLAVS
DAAVVLPRLDASLLVSRVATNKRHQVINAAKRIDAAGGQWIGALLNIVQAPKEFHEQGYGYQSDSYRSRIPVKSQPSKMA
AIRSFAAEESVI
>gnl|bykdb|A0A5C5X547 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium KOR42] (length=827 residues).
MSTDVGKPLAANGRSSRGLNNPQAPYLVQNTVSTAPAEEGSGIQLSAIWHAFRRRWALGLLIGILLTPLAIVPWLLMEPQ
STAVVQLHLHQDDPMLIFNTADQVQTSAITYKLFQSTQAQLIRSDLNISQVLELDSEISNLPQVVAEPDPIEWILENLHV
MQLPDTELLNVSFRDPDPQAAMAIANAVVKNYYDKYVKADEQKDNKRLADLQLLYQEKTKELKAARTRLVDLAETAGSGS
SESLTLNQQSTLSEREILEKQRHELRFKRMELEAQLFALLETQKHRQAVGETAPNEDGQPVVSEEPVDPSLRAPLPPLPV
GQSTNQWVLTEEILEEEYAFDPEIRRLNDEKEALEEKFQALAKRLQGSGLEKSRQQYESDLAKIDDDLNFRKSLIKRSFK
KEYERENRRLQEQFEQDQLAYELDWRRIEAERLRALKAQGGGTLIVGDTGENQDQLMAQFNEVDLRSRIKKIIEQEAELE
AMSSSLRDNFKLLGKTSADVEMLRGDIASLEQVVSNLAAELERTRVESKGQSKRIEVMAYATRAQKDDPKKQIALTIGVG
LAGLFAPLILLMWRDITKQHVDDLKTMRLAIGLEHMGGIPRLPMKQLSGKNGKDDKKDSKLQRALSESVRGIVAQLIRRK
ASENQNCIMVSSATAGEGKTTASVEISRMLARSGQKTVLIDFDLRRPRIHEIFEVDGATGIYDILTGNETLDGALKYIEE
DKLTVIPAGNVESEVYLESYSGMLAELFATLQEQYDFVIVDCCPVLPVVDARIVSEYVDGVILALTRDVSVVPDAISARD
ILRSHGATVIGTIVSGHPVRGRYDLYN
>gnl|bykdb|A0A5C5XLF4 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium Pan54] (length=779 residues).
MPSSDKNSNNADAVHGHPLIKADEPAIDLVKLALKNVVILGIAAVAGIGLGIFAYKILGPKYTASSQILVKLKNPVEIRE
GGNRVIVGERSAHVEIIRSPKVVERAVRDSHLDQLATLAGSTEPARDIIDSLKVTRTAGEDHHQLNILNLQYTTSKSKDA
TAILNGIIKAYDDYLKDDAQKNHSELQTLLEQINNDLSPRLAAKTKEYHEFRRSAPLVWKAPAGADKGPNNVTNIHHQRV
DAIATERVKVELLYEEISSRLSTLKAAIERGESHEALMLLVKTFLQKDQTSNSQTVVSGATERQQLDSQLIPLLLEEQTA
LKRYGSGHPDVINVRKRIDLVKSYYRQMGIDLPTMTTKVNPVTGEPELVTGNDPIATYVVALEQQQAELKNRIGELQKLF
DRSADQAKDFAQYEEREQTLSDELKRIKSLHDIVANRVEVLSLASDEGYQLTQISPSRAEPDIKHVIKIVGGCLVMTLMS
TYAFLFLREMRDTSLKSLADLRAIVDTPILGTLPSIANPAKNLQAARETGLAPMLYYYHDPGSPEAEACRSVRATFFVRA
ADVDAHIIQFTSSEPGDGKTTTISNLAISIAQAGKRVLLIDADLRKPMVHQLFGMREEIGLSECLSGEIEMANAVQDSRI
ENLDILSAGSIPAKPAELLSSSKLHYLLGQAKREYDFVLVDSPPVLAVSDPCITAQSVDTVMLIVRLHKNRRPSVKRALE
IFEAHEIPLLGVIANGLQDGSGDYQYRGGYGGGYDKKSPYQQTNDMPEFLAPTQAVIPS
>gnl|bykdb|A0A5C5XLM3 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium Pan54] (length=776 residues).
MPAPENYDPQMNIQLQDNHNPLQTILRFLQSLLRRKWTVMAWLTFTVSLGMTYFALAPRKYESSAELLVLHTGDGNVDQT
QQSQRTLQDYLPTYTKVLASDEVLKGALVRLPDTARTKFIGMTKHQAIEKLRSSLTVNTARQTNLLEVKYCSESPEESSM
IVTEILNSYFKFMHEMHESSSGQMLDTLTKERDNIQNQILVKQSELLDLQRESDSLIGTGDNVMSVVNERVIELNHALAK
AQQESIQARSYYTAVEQAVRNGESLQQLMNQSNQTLANELMKLSAGVDSRDSYAYARLQQQLIEDEASLRDKLNGKLGPN
HPEVLELQERVKAARDWMNGRGQQATQDSKQLTRDMGPQMLEMAKQRYQHAVTHEQDIYQRFMQEKQLASQMNQRLMLLQ
LAERDLSRLQSDYDMMRDRINTIDLNKQSSLRTRITKHAEPNRTPVTPKLTSTLMLSILAGLFFGATTVLLLDLLDDRFH
SPDELKRELGAPVMAMVRSLPSLPHTHGLESIFTYTKPNSVETEAFRTLRTSIEFACENHQRISITSTQPSDGKTTVISN
TAVAFAQAGKKTLIIDGDMRRPGLTAVFALKGQAGLSTILRDTATIEESASKYITKTRLENLDVISAGPRPSNPVELLTS
ERFEELIGWAEGVYDQILIDAPPSLAVTDPAIIGRLVDGIILTVRPDRNKRRMILRAAESVTSLGGTLLGVVVNGLSDSR
GEYGYGYGYGYGEGYGEGHDDPAYEGEEEAIPISNNNSQRPRKRFSRDQSSDRYAA
>gnl|bykdb|A0A5C5XS91 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium CA85] (length=816 residues).
MIMAEPNEPKNRIQALTRPKSDDDQADSLDVLQILQRQRWIILFLCICGLTAGVAYSLYAPVWYQSSATVLINQKSAGLD
SDGTGQEMVEEDILANHIQLIKSRMIVGEALEQNELSELPSITTHLNQERPGFDATDYVVEHISISKGGEGSAKAARSLR
VTMTHTDPDDAQLILTAVMKRYEQFIIAQVEQLMGRANEMVNEAKQDIEADLVAAEQEHMKSRQSAPLFFQGEGSSNVYQ
DRYRRIQEELLDLDIKESTVRTRLQRVDATLKEMDGSDNPVDHLDKLALIDSESLERLGVFAGLQMNASNTAEFKAAMPA
KVEEAHTQITHLLELNSEKRRLSSIFGAAHPKVLEIQNQIDLVKEFLQDKQELTNPAMAFTDTALNPEGLLKAYVGFLNH
DLATLTERRKELTFLAADAERKAKELIEYELTDMVLQKKITRQEALFEGIVQQLRDLDTASGLSGYLYEFLEVPRRGEKS
WPKLSLCGLGGLMLGLFSGLFLAVANDLRDGRFRSAAELDEAIGLTSLGRVGKLESIKKGVSGLIATGESPDAEAFRLGR
TMLLPEIRSGALRTIGFTSPMQGDGKSTVVSNFAVSFSQIGLKILIIDADLRRPSAHRFFNLSKENGLCDLLEGRIDFNE
AVKETKVDNVHVMPAGSSSTSPAEFLQSEELDEVLATARSQFDFVLVDLPPVLAVSDPVVVLPRLDGAILVVRVSKVRRD
EVVNTLRRVETAGGNFVGCMLNTYGAAKAFDADGGYYGYYRSDYTRPTSKSASAERTSRVATVQVNGKSQANGKAQANGK
ASAGGNASANGKAKTK
>gnl|bykdb|A0A5C5XXG1 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium Pan14r] (length=954 residues).
MRLVVDVVGVDDSSESPAVAESRIPPAIDTPSSEGVVESAPWIARRRAAWVILSGPAGHSSHHEGCQGCKRSTCQSKRFH
VDDKSYRPVRLAKPVEPRQVLTPPPPGRRDKLAAVKGRSVYSLPPLGPDLSYHFAVSPSIYGTLAILASSTGLLVDFIDL
PIRPSIRMTENNAKPSAPAKSESRVTEDVVTLDVLQILFRQRWLIAFLTLAGLAAGVAYALQARVWYESTARVLINEKSS
GLASSSSSEMVEEDILANHIELLLSRKIVGEAMAAQDDDGNSLMTLPSVVEHLDPEIETVDAVDYVIDHMEVVKGGEGGA
KTARTLRISLNHTEPEDAQRLLTAVLQTYSRYLDQQISDMMDLATAKINEAKNEVEGELHIAEKKYLEHRQTAPMLFQGE
GSSNVYQDKYRRLQDELIDLQIQESTIKTRLARVENELEDLDGKTLSMTESMDKLALIDSESLERLGLFAGLQISASNTA
EFKATMPVRAEEARTRFAYLLKLNSEKQRLQAKFGASHPDVQDIDDEIRLVRKFIDESNEDTVAEAPFGENSVNPESLLK
AYVGFLNHDMATIAERKSELTALANQAETDARELIEYELTDVVLRKEVERNEALFDGVVQQLRDVDIASGLRGYLYELLE
TPRIGAKSWPSLPLCGLGGLMLGVFAGLTLAVANDVRDGRFRSAAEVEETVSLPSLGRVGKLNSMRRGVRGLIAGELSPN
AEALRLGRTMLLPKIKSRDMRSIGVTSSMQGDGKSTITANLAASFSQVGLSVLVVDGDLRRPTVHRYFSVAPEGGLTDLL
TGSMDLDDAIKPTEADGVSVITAGASTRTPAELLQSEKLEELTQQLEERFDLVIFDLPPVLAVSDPLVVAPRIDGMVLVI
RAASARRDEVMNSLKRVTDAGGNMVGCVLNTFGAGKSFDLGGGYYGYYESGYSRPTNRTKPVTSARIVEVDNDA
>gnl|bykdb|A0A5C5Y033 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium Pan14r] (length=792 residues).
MTGSTSVTQHQPNGRGGSTGSPRSGLGLPLRNSVEAINLPQLIARQRWLILFLGSCGLAMGVAYATHAEVLYESQAKVLV
AQRSAGLNNSGTGTDVVDEDVLANHMGLIRSRKIVSEALAEYGLMELPSLVAKVSDETDQVDYVIQNTSIGKGGDGSARS
AAIMNITLQHNSPEDVQKILAAIMRRYERFIVSQVESVMGEAGRMIQDAKRALEADLQAAEEEYLVSRQNAPLFFQGEGS
SNVYQDRYRRLSEELLELDIQQSTMRTRLERVRESLKHIGGGSDLSDHLDKLALIDSDSLERLGAFAGLQVSASNSAEFK
AAMPAKMEEARAQVTRLLMLNAEREKLTAVFGSGHPKVREINNEIQLVEDFVRKSKEQTSPEMTFGSQAIKPDALLRAYI
GFIEHDIAAIGERRKELIALTTDAESKAKELIEFELKDLVLQKKIARHEAIFDGIVGQLQELNTASGLSGFLYEFLEVPR
LGKRVWPNVPLCSLGGLVLGLLCGMVLAVGNELRDSRFRTAQEVDEAIGLLNLGHVGQMSAIDQGIAGLVATDGSSESEA
FRLGRTILLPDIKSKKVRSIGFTSSMQGDGKSTIVANFAQAFAQVGLNVVVVDCDLRRPSQHRYLSLQDQQGMSEVLQAK
LPLAEVIQPTEIENLSAISAGKTPENPAELLQGVNLDKAIESLSNHFDLVLVDLPPVLAVSDPAVVLPRLDGAVLVVRVA
RIRREQLANALQRLQSTGANLIGSMLNVVGADKEFDAGVSQYGYYRNDYTRSSSQRKRGRAAATPGSVNNAA
>gnl|bykdb|A0A5C5YT05 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium Pla123a] (length=777 residues).
MTAVDQQGGFPEEAAHEGSLADSLHGLVRLLRLMQRNQATLAWCVAGCTVIAMAYYVAAPRFYSSTAKLLLIEQDPDSVS
SVAEGGRADDLMATHRELVKSPVVLQNAISDLPPEHRIDLETINPSHWVEELGRGLSASTVRRTKFIQVSYKSRRPESAV
AVVNAVINSYLHFVEETHRSTAAEVLDVLTIERDQLQSELLRKQKLLQEARERCGHLAIDQKDGVVDPMIGRAIHLNDAL
MEAQQRRLDLQGSLASVAMAMARGDDMRNYLSVVEEAVGEQMMLAALGLSHQDMEMLTSQQQRLMETQDELRRLSPHYGP
NHPQIKELTEQVAALQQYLSSYHAASGSRYASINNGDLGPMIKRTLEQSVAQAMEQERILAESFEDARVNAARQSGDLVE
LDMRKREVERLESLHDVLFEKIAAVDIHQVQAPIRASIVEEPLPEETPVSPRFARLFGSALVGGVLLGAGIVFIRDQLDD
RFASPDEMSQQLELPVLSVVRTLNPLPGTGLDAVHMHVDANSVEAEAFRTLRTSLTLRGEETERLVISSAEPSDGKTTVS
SNLGVAFAQVGKRTLIIDADLRKPGMTSLMGLKGHAGVTDILICEGAIGALAERCLVKTGLDKLDVIPAGPRRPDAAELL
SGPNFGELLAWAEGRYDQVLVDCPPVLAVSDAQIIGRLVDGVVVVVTPEKNHRRLVVRACDSFLHAGCHVHGVVANRISN
KSEGGYGYGYGYGYGYGHSDEEERVEEKVEHDLSPVEPAAASWRRPTEGPADADRAA
>gnl|bykdb|A0A5C5YU10 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium Pla123a] (length=755 residues).
MNPLVTTPHGALDSEPIGQMQSSAAAPPQSTDLLALAWQGRWLILIGVLIGGSAAWVHLQRVTPLYQSTSRVYVERSLPK
LLSSDMQLGHSNSYLFTQKELIKSTGVLASVADSPMASGMETFRGVENRVGLLYSGLNVDVGRDDEIINVSLTLPNPVEA
AQLVNEIVAAYITQYAEKHNTETFKILEILNGEKQRRDKVLIEARRELTAFREANPELAVLVDNQDVASDRFSRLMSELN
QTELEQLTAKAEYERVKEMAASPTLRPMLLDMALDSVGKANLNDDLEALLNQQQELELLLMAEQAKWGDAYPTVKSIQRS
LDQSGLRIEAKRESIEAEKEAALRAYAFNVKERFEFHTNKLNGLRSKYQDQFEAAKESSANSLKLFSLEETYARAISDSD
EVEERIKELDLNKKVGAMNVSIIETASAPKLPTYPSRAKFLGAGVMLGALSGFGLAWLRDMLDHRLKSVDEIQELLQLQV
FGAVRRQLGKIGREELGKLVHLQPRSTSAEAFRTLRTAVHFGLAGDDCKVLVVTSPSPGDGKSVVTSNLAIATDQADRRT
LLIDADMRKPTQHTIFGVDNTQGLSTALSERRPIEELIVSSEIGTLDFLPAGPTPSNPLELLNNDYFAEMLERLKLQYDR
IIIDSPPVMPVADSRVIASMSDAVLLVLRAEKSTRRLSLAARDELWRVRAQRLGIVVNAVPQSKGGSYGYGYGYGYGYGN
YGEVAYGHEDQRSLGNRKKRLIQARPETPAVVEQT
>gnl|bykdb|A0A5C5YWH4 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium CA13] (length=793 residues).
MDSPTTESASKAPVIEINLLGMLRRRWPLIVFGILVGVSLAAFYYAATTRMYESKIEILVGQRSSEVTSSGTLSGAAASG
DSIQDDQLATHMRLFVSRRLLSDAIKDGKLAELESFKNAAKEGRGGIDHILQHIEVIRGGEGSSRDAMVLRAAYRDSSPE
DAALVLSTIYDSYRDYVESHGHDSTEQAVELIQQARQTHEEELAAADIAYREFVKSVPVLIEGDSVQDIHKERLANLEKE
LHLVTNSLAESRSRLEVIATYLADRNGQEINNIDHLALLSHNEVERLKLFLDMTRGETQSEAFQAEQPIRQEVAKAQYNR
LLDLIQKEQSLADAFGPGHPLVEAARQEAEITRQFIAKNAPTNAKVATKKLDPAEMLKTYTSLLQNDISELEKRKEILLA
DSEVEMRMAKQVEGDFMKGASLRARHSRAQMRYDEVIRRLQELNLSRSYAGFSTDLLASPEVSRGAAWPKLPIICALGLF
LGAMLGLALAITTELLDSTFSDVHDLERTLGAPAIAHVPRFNTRDLKSKTRSGSLIQPSLVTFHAPRSAESEVYRVARTS
LMVANRKTNVRTMMMTSPQPGDGKSTTISNLAVSFARAGKKVLLIDADMRRPVIAGLFGVQREPGLSDVLSGTISARESI
QNTEVSNLDLIPNGRPTADPSELLESDRFGAMVAELTQRYDLVLIDAPPLLAVADPAIIAPLVDAVVLTVRVNKHARGPV
EQASKILQDQGLAPAAIVVNGVDQSSKSYGYGSYSAGKYAYVGDYHSQYEATDIESTIPQRSPRILAAERSVG
>gnl|bykdb|A0A5C5Z0D6 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium CA13] (length=788 residues).
MNDTTISSPNESAGDTDILDLLGMLRRRKGFIALGLFLGVAAAVLYFFLTPPTYRAKMEILVGQKSGDLVKGATSDSSVE
GAEAAEDVLSTHIELMTSRRILQTAIDKHGLEDLASIAEVVAEGRSSLKFVMDNLSVSKGGEGVARDAHILQASYDDPSP
SDCAVILRAIFDEYAAYLKEHFEGTSTQAVDLLTELSDKTAQDVKDAEEAFASHVASSTLMWDGQKARNIHKDRLMKIEE
SLLELTEQEAEVESRLAVITDFLQNTDPNSITDFNRLALLSEKEVNRLKLLYEITRGDVASEAFQAEQPIRQETARAEYD
EYLQLVMKEKKLAEKFSEGHPQVVSIREQIDLMRQFIDENSAKITASEIRERMEPAEMLQTYVGLLKNDLSGIQKRREVL
IRRSGAELILAKELEQVEMQTETMRREVLRRQELFKDTQDTLKELNFVRDYAGFSTDVIGDAETQRRPSWPNPLIVLALG
IFAGGLLGFGTALLADVMDTTFVDPDDVQHTLGAPVLAHVPRFEPFKRKRKDPPLKIDSSIRVYHQPRSPSAEVFRVMRT
GLLVEAKAKGLHVFQVTSPLPGDGKSTTSVNLATAFAQTGKRTLIIDADLRKPRVGRLLHLEGSLGLSDALRQSLDPSKV
VQTTVQDNLFAVSAGSIPENPSELLQSDKFAQLLNAWRSEFDFIIVDTPPVLAVSDATIVSEETDAVLLTVRIVKNGRRS
AKRARDILRQTGASIAAIVVNGYQTKDRSYGYTGGYDAEAYGYGYGETHKAYYRESKKGSRPLQSTSS
>gnl|bykdb|A0A5C5ZIP0 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium Mal64] (length=755 residues).
MTQNQEHFHEPEITVSSAGPNEALQGVLRLVRLAEQRHQTLLWIVAGCLGIGALYYGFAPRYYRSEAKLMVIQQVADELS
SMSDQIGSDNLMTTHKDLVRSPVVVRNAIEQLKPEHRIDLVESPPHKWVDSISDRLSASATRKTNFVSVAYESLHPEAAA
AVVNAVINSYLEFVEETHRGTAADVLNVLTVERDQIEQDLIVKQQLLQEFRQRIGHLALPKDNEVVDPIIGRALQLNTAL
MEAQQERIGMQASLATVRRAMSQGEDLRQYLSLVQEAVGEQMLLSALGMGENDVRAMADQQTRLFDVEAQLSRLEPFYGP
AHPEVVALSTQAQAIKKYLAEYRNGASGRADFLGQEELGSMLSTMLNQALAQAGERERQLDHSFELARDEAARQSGDFVK
LEMLSREVERLEKLHDLLFNKIATVDIRQVQAPIRATIVQEPLPSDRPSSPQLKLVLVASLLSGLAIGLGLIYVQDLMDD
RYGSPDEMALQLGCQVLALVRQLQPIAGSGIQSVQMFAKPQAVDSEAFRTLRTAIALGADAPDRLVISSAEPSDGKTTIS
SNLAVSYAQVGKRTLLIDADLRKPGMTALMDLKGKSGVTDILTTSGDVAAEARRCLLKTEQPNLDVIPAGPRRPDPAELL
LGPNFSELLAWADANYDQVLIDCPPVLAVSDAQIVGRMVDGVVLVVSPEKNHRRLVARAYNSFLTAGVNMVGVVANRISE
QAGKGYGYGYGYGYGYGHTETNDEILENNAPGKAA
>gnl|bykdb|A0A5C5ZM48 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium Mal64] (length=753 residues).
MNKMITPPTQDLTGAAIPAPMVIDAEGDDQSHSALSGQAIVGAVRRWWVVATPVGLFLSVAAVVAICLMSQPVYRASAWL
KIKAESPYVVFKDEETALDAKRFVETQVELIRSPMVVAPLLGDPAIAQLEILRGELDPIGMLGELVHVFQRGDSELFRLS
MESTDPQAAKDVINALARSYLDFRSKQESETKRRVIALLQQQKEKYFEDIKRLRGNLVTVADQATKNDPYGGLMSGGGGV
SPLVEDSVRRLIEIDLARVSLTAERENLKQDTPNHAADYAAAEAAVVELIGRDEQLRAWREQQMLMESRVESYRQTMRRP
EQSREYRDLNAGLQDIVSAMAGRVEMLRSQVMSESIGSMKPSGPSEESEAIDLRLAALDLQEDYLRKSLEAEQRKRRDNA
GGLLEVEFMRAELTLAEEMQQEVASRITRMQVESQAIDRVELLREGEIEQTPVVGMPWKKMAAAALGCWFLPFAVALIAE
RSLRRVCDVRSLEAHANAPVLCEIARLPSRPNSSGRRSEYRLEQALRVFEESTNVLATTIRWADGFKGIRVVSVMSAMKN
EGKTSLSSQLSICLAEAGGKTLLIDGDLRSPDIHSAFDIDPSPGLGDVLDGHASLQQTVVAAEQPGLWVLPAGKAVSTPH
RKLSWLQERVLAAAREDYDYVVIDTPPLLVASEALMLARAADASILCAMRDKSRGEQVREAGQRLQAAGVRLAGVVLNGV
PAKQYATRYGQPYGDEGAEPVGAESYAANETSV
>gnl|bykdb|A0A5C5ZR72 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium Mal64] (length=765 residues).
MNEDQKSKQSQLTHRTAGSEGARGGSAHARHALKPSRAEAAQPQIGPMFFWWVFTMSWRTVVPIGLLLAIPVAAVIYLTY
TPMYEATGLIRIEDSPQYVAFRSGSVDAGGRKFIQTQIELMRNPVVLRETLADEDVGSAEHLKEESNRVKAIQKRLKVKQ
VGGSELYEVAYTSPSAKESADVVRAVLQQYFARQSDEEYQRAQRVIDLLERERARRQFEVERLRKHVIDLAKDLTGMDPF
GHRTMTNADRAFSPLSGYHRQLAEIEVKKEVLRAELESIQEAEVVNTDFRERSGAIDLEVDMNGEVQQRERQISQLRSGL
RELRKTVKHPQSNRDYMALSERVRQEEQSLSEFKDKLRQSLLLSARMSRQKSGKTLADTKREELEMLSALEASVREKYEA
ELAKVQEGGGKNVELEFAKSELAREAKVFEMIASRKLALQTESKAPARVEVMDEVMSSNVPEEAIPWKQLFVACAMSMVV
PYGVVVLREMALRRVTDSDQIYQDTNLRILGEISSFPKRKVAANPQMLPRRLRREMYVFAESINALRTSLVFAAEPDQPL
VIALTSAVSGEGKTSISVALAMSFANASGKPTLLIDGDTRKPGVPDLIDLRHGQGLTEVLAGQCTLDEALQPARGVANLQ
VLPAGKSRSDHQLLLQPQRLSQLIESARDRFDTILIDTPPVLGASEALSLCRSADMTTLCALRGVSRSRQVKMAAEKLDS
AGANLAGAALSGVAPMGYGSVYAYGYGFPEQEERPEGLVGVPGGV
>gnl|bykdb|A0A5C5ZZN3 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium Pla100] (length=797 residues).
MNKAENVEPVNRIARRPASSAMEDPSETLDVLEILSRQRWLIIFLCLCGLTAGIAYALYAPVWYETNATVLINQKSAGLG
GDSTGQSIVDEDILANHIELIQSRMIVGEALEQNSLVSLPSIVEQLDETKPQFDAVDYVIEQLSIVKGGEGSAKTARSLS
VTFTHTEPDDAQIILTAVMKRYEQFIIAQVEQLMGRANEMVNEAKQEVESELLAAEQEHLQSRQNAPLFFQGEGSSNVYQ
ERYRRLQEELLDIDIQESTVRTRLTRVEDTLKEMDDSGDAFDHLDKLALIDSESLERLGVFAGLQSNAADTAEFKAAMPA
KMEEARTQITHLLQLNSEKQRLSSVFGPAHPKVQELESEITLVKQFLQDNQDLTSPTSAFGESALTPEGLLKAYVGFLQH
DLAALAERRKELTFLASDAETKAKDLIEYELTDMILQKKIARQEALFDGIVQQLRELDTASGLSGYLYEFLEVPRMGVKS
WPKLPLCALGGLMLGLFGGLFVAVANDVRDGRFRSSAELDEAIGLLSLGRVGKLNSVKQGVTGLIATELSPDAEAFRLGR
TVLLPDIRSGKIRTIGFTSPMQGDGKSTVASNFAVSFSQIGLRVLLIDADLRRPSAHRFFSVGREEGLCDILNDRTPFAD
AIKETRADNVWVIPAGSSSSTPAELLQSSKFDEILRMASTQFDLVLVDLPPVLAVSDPVVVMPRLDSGILVVRVANVRRD
EVINTIRRIESAGGQFAGCMLNAFGAGKKFDGGGGYHGYYKSDYTRPTNAGSKPARSGSLNGFSAAPAEAPVNGKAH
>gnl|bykdb|A0A5C6AA28 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium Pla108] (length=749 residues).
MALPPSAPASTYAMTPSSASLPAPGMIIDQDEDAGGVNVAAIAWQSRWLILLFTLLGGLASWLYLQRVVPRYTSLARVFV
EQNLPRALNGDALGTFSNKYLFTQAELIRSSSVLSAAVEAPENAALETFRKTDNPVGLLRESLEVAVGERDDIINIAIEL
ENPTDAAVIVNSVVDAYITQYAEERRTNVVDVVNILRSEKQRRDDELESRRKALESFRQEHVSLAIQSKEGNVVNELFSA
LSQELNATQIQLLESKTRYARAKKMLENPDQAPFLMELARSAHSNSRGSDLEGQIQSVEQSLVSQQTKWGPGYPSVRLLQ
DSLDKLRSKQAEQQQAILNAYVDGLRQDYELLTQRRDELQRAYDKQFALATAVSQQAAKLDALQEAHDRTARMCDILDER
IKEVNLSEEVGAMNVSILEVAGPGMQTFPDRPKTLSLGLAFGAMLGFGLAWLRNLLDHRLKSIEEIASVMQLPIVGAVPL
VTGARSREGERNIGGRIVALQPRSVAAEAIRALRTSLHFGLAGDARTYVVTSPAPGDGKSTVASNLAIAMAQANQRVLLI
DADMRKPTQHEIFGVEVESGFAAVLSGVTPAIEAVVATSVPSLDLLACGRIPASPVELLNNGNFSEALEQLSRHYDQIII
DSPPVMPVADARLISAMVDCSLLVLRAERSTRRISVSARDELLKVRTQRLGVIVNAAPLHRASYGGYYAYGYGSNGQVAY
GGEVAPEPAPSRRRLLKQDLEPELGAVDS
>gnl|bykdb|A0A5C6AKF9 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium Pla108] (length=755 residues).
MSLESANEHGEPWRDDNDASEHALEALVRLARVIRYRQQTVLWTLAACLVVGAAYYATAPRYYRSTAKLLVVDQSGGEMV
SLNEQAGADNLMATHRELVKSSEVVSRAIDRLGPEYRIDFVDKKANEWVETINEQLTASTVRKTNFINVGYDSLDPEAAA
AVVRAVIEAYLDFVAETHRGTAAEVQDVLTTEGTKLKQELSAKQLELQQTREQVGHLSLPDHENVVDPIVGRAIQYNDAL
MGAQRRRLDLTASLATIQVAIARGEDLSQHMGLVEESIGQAAMLAAMGMAPNDIEVLAAQQSKLIGVRDELRRVEPFYGP
SHPQVVTLRSQIEATEQYLASYRSDASGRPTGLSREELGPLLIGMLNQALAQSNERERQLAEAFEVARSEASRQSGDLVK
LEMLNRDVARLEKQYDAVCDKISAIDMTQVQAPIRATIVQEPLPADRPASPQLRMVLMASLLGGLCLGIGVVYVQDLLDD
RFGSPEEMALQLGCPVLAVVRDLPARSGVGLEKVQMFAQPQGAESEAFRTLRTAITLGAAVSDRLVISSSEPGDGKTTIS
ANLAVSYAQTGKRTLVIDCDLRKPGLTALLELKGQAGVTDILTTRDDVAAVAERCVLRTALDTLDVIPAGPRRPDPAELL
LGTNFADLLAWADSRYDQVLVDCPPILAVSDAQIAARLVDGVVLVVTPEKNHRRLVTRACSHFSTGGAPLLGVVANRISE
QAGKGYGYGYGYGYGYGVDEADHDEPNDRSLPVAA
>gnl|bykdb|A0A5C6B6G8 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium Pla52n] (length=798 residues).
MAPTNSQNPNNNPRRRSAKTTSENADSLDVLETITRQRWLLAFFAMLGLVVGVAYSLNAQIWYKSNAKVLIAEKTAGLGE
GSATGQGMVEEDTLANHMELIASRMIVGDALQETQVPGQDYSLMELPSIKAQLSDTEDAIDYVIDHLELVKGGEGSAKTA
RSLNVSFKHTEPDDAQLVLTAVMKRYEQFIIDQVEQVMGRANELVQTAKSEVEAELNAAEQEHLASRKAAPLFFQGTGSS
NVYQDRYRRLQEELLDLDIKESTLRTRMERVQATLEDMDTSTDPVDHLDKLALIDSESLERLGLFAGLQMNSSNTAEFKA
AMPAKMEEARTQITGLLRLNSEKQRLTAVFGPGHPKVQELENEIQLVKQFLQDNEELTNVSTGFSDTMLTPESLLKAYIG
FVNHDIAALGERRKELIFLSEDAETKAKELIDYELQDMVMLKKIDRQEALFEGVVSQLRDLDTASGLSGYLYEFLELPRI
GRKVWPSLPICGLGGLMLGLATGVFLAFANEIRDGRFRTAAELDEAIGLPSLGRVGKLNSIDMGIRGLVSAELSPDAEAF
RLGRTVLLPEIRSGKLQTIGFTSPMQGDGKSTVTSNFAVSFAQLGLKTVVVDADLRRPSIHRYFSVSKTGGLCDVLEGRL
QLADVIKDTDAEKVSVITAGSSSKMPAELLQMEKLDELLEELKQQFDVVLVDLPPVLAVSDPVVVMPRLDGGVLVIRVAR
VRRDEVINTMRRIRSSGGNFVGCMLNALGAGANFDGAGGYYGYYRSDYTRKKKNGRAEAARPIGSLPAAAKTENESDA
>gnl|bykdb|A0A5C6C4E6 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium Poly21] (length=822 residues).
MIMAEPNEPKNRIQSLTRPKPDDDQADSLDVLQLLHRQRWIIIFLCICGLTAGVAYAKYATVWYQSSATVLINQKSAGLD
KDGTGQEMVEEDILANHIQLIKSRMIIGEALQQNDLATLPSIVERLNPERTGFDATDYVVEHLSISKGGEGSAKAARSLR
VTLTHTDADDAQLILTAVMKRYEQFIIAQVEQLMGRANEMVNEAKQDIEADLIAAEQEHLKSRQDAPLFFQGEGSSNVYQ
DRYRRIQEELLDLDIKESTVRTRLQRVDATLKEMDGSDDPADHLDKLALIDSESLERLGVFAGLQMNASNTAEFKASMPA
KAEEAHTQITHLLELNSERQRLAALFGAGHPKVQEIENQIALVKQFLQEKRELTTPSLSFNESSLSPEGLLKAYVGFLNH
DLATLTERRKELTYLSADAERKAKELIEFELTDMVLQKKITRQEALFDSIVQQLRDLDTASGLSGYLYEFLEVPRRGEKS
WPKMSLCGLGGLMLGMFSGLFLAVANDLRDGRFRSAAELDEAIGLTSLGRVGKLNSMKKGVAGLIATGESPDAEAFRLGR
TMLLPEIRSGALRTIGFTSPMQGDGKSTVVSNFALSFSQIGLKVLVIDADLRRPSAHRFFNLNKERGLCDLLDGRISFEE
AVKETKADNVYVMPAGSSSTSPAEFLQSEELDEVLATARSHFDFVLVDLPPVLAVSDPVVVLPRLDGAILVIRVSKVRRD
EVVNTLRRVETAGGNFVGCMLNTYGASKAFDADGGYYGYYRSDYTRPKSKSAAAAAERSNRVATAQVNGKAHTNGHANGT
SQTNGTSQTSGKAKTNGKVKSK
>gnl|bykdb|A0A5C6CK24 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium Pla144] (length=784 residues).
MTSTDFNQNQNDAEFMPSVDAVSAIARFVGIVRRRKQVVITAIIIHVLLGTTYYMLATRKYASTAELLIIQQKQDHLATV
GDHESSEDTMATNQKLIASPIVLQNAIKQLSPQYLIDLVGEPTHKWVETLSKNLSARVTRKTNFIDVTYRSKHPEAAAAV
VRAIINSYLQFVQDKHQGTAGDALHSLLQKGAELEAKLTEKQNELQDFSQQVGHLAVGQDDSAVEPIIQRALRLNDALMD
VQQRRLELQATLVSVEGALERGEDINQYLVAMEESVGRQMMLSSLGLSSEDLSVIEEQQKQVLAAQAELSSLSNFYGPNH
PRILDLQKSIANSERYVREYRANLGKQQNGMVQQHIGPVVKRMLEQSVQQTWQKEQQMSDSFEEARQEAAKHSGDLVQLR
MLEREVTRLEAQYDLLFEKISTVDMRQMQAPIQATVVREPVPDRVPVSPQIRFLVFICLASGTAVGTVIVYVQDVLDDRF
SSPEELTAQLGVPVLAMVRNLSPLPGEGMETVHTHKLPHSVETEAFRTLRTAISLSGSSCDRLLISSSEPGDGKTTISVN
LSVAMAQAGKRTLVIDADLRKPGFTTLLKLKGRPGVSDVLTSERSPAESAPDLVVHTEVPGLDVLPVGLRRPNPAELLSS
NEFVELLAWADSQYDRVIVDCPPVLAVSDAQVVGQLVDGAILVVRPEKNHRRSVIRAVESFQSVGCNVLGVVANALSDES
QTYGYGGYGYGYGYGYGYGHDEQDFEDVDADSEELIVPHPATQVGVSLRRKETSTDPIRPRRAA
>gnl|bykdb|A0A5C6CNV7 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium Pla144] (length=774 residues).
MSSLIEYDSNTQLEPSGMAHDHAAGAGQTNLLELAWQARWLLLLTVLTGLGAAWILLQRVEPRFTSVSRLYIERNMPRIL
EQEVQLGNSASYLYTQAELIRSTPVLAAAAEQGENASLETFRDVDNRVAFLRKNIDVQVGQNDDIINVSAELANSADAAQ
LVNSVVEAYISKYAEERRTDTVEVLTILRNEKQRRDAELEARRQELIEFRQQNAALAVQVGEENVITKRFSSLAQELDRV
ELELLDAKARYNRTKSMYETPSQRPFLLELASSQQQVANEIRSESQLSLDLENKIRDLDLQIASLQSTWGDGHPRVRIML
ESREKLQARLDKQQADIEKNKEAIVSAYVETMSQEYQLLEQKRAELQRNYDSQFKLALQVNSQAAKLALLEESLARTARL
TDILDERIKEVNLIEDVGAMNVSILEVAGPTTVPTYPNRTRFLGVGGLLGGLVGFGLAWLRNLMDHRLKSIDEIAQVLQL
PVLGALPLSSERANDRKGRSAIGTVLLTHPRSTAAEAFRTLRTAIHFGLARDDAKIICVTSPSPGDGKSTVASNMAIAMA
QADQRVLLIDADMRKPTQHTIFEVTCEQGLSTVLTERRPVRELIVSTEVVNLDLLPCGVCPANPVELLNNGFFSELLDKL
RLDYDKIVIDSPPVMPVADARVIAAQTDATILVLRADRSTRRMSVASRDELWKVHAQRIGVVVNAVPARQQSSYSSGYGY
GGYGAYGHAGGSYGESAYQLDAYPANGRRQKGLAISAKAETPSTDPAETSEIST
>gnl|bykdb|A0A5C6DDS2 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Candidatus Brocadiaceae bacterium S225] (length=736 residues).
MKNDSYQNQTEDSFYNGETAFLEEINLRDYFRVVMHRKWVIMAIFSITVLLVTLYTFKQKPVFQAVTTIRIYKDAPKVLS
FEDVVNTGGGLADFYKTECEVLQSRTLAKRVINRLRLDLHPEFIAKLKTKESDADKPVSVEKLVTIFLNMINIELVRNSQ
LVKLKAETGSPGLCVSIVDTLADEYIKKNLEDKVLTTTGATGEIGKQLKEIKKRIEDSEKELYKYARQNDIVAMDASQNI
FMKELITISEELTKAEAVRIAKEVRFLAVQNSDDLSSLPGITDNVLINELKLEYTKLQAKYAGELDRVKEDYPLVQRMKA
EKDFIEQQINSEQGWVAKAIKAEYQEAVGKERGLRQRLEELKRENNELEGKSIGYKVLKREVDANTLLYEGLLQRMKEAA
VSSEIKTTNIQVVDKAVLPTTPIKPKKKLNVLLSMIVGLTLGTGIAFFLEYLDNTIKSADDVEKHLKSTVLGVLEKVAVD
KDEVQNFDLISHELPMSTFAEAVRNVRTGIMLSSTDNPKKIILVTSTTPGEGKTFVAGNLAIVIAKTGKKTLIVDCDFRK
PRVHKAFNIETMPGLSNHFVGEGDLDLIIKPTAIPNLSVITCGLIPPNPSEMLGSHSMEQFCMEVRERFDTVIFDTPPSL
AVTDTVILSNIVDGIIYVIKSGVVAKEAAKRSLSQFAGKKGEVLGVVMNSVDVAKGGYYQYGYQYGYQYGYGYGEDTGKK
KGLIERMKGKIKLKNV
>gnl|bykdb|A0A5C6FFI9 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium Poly51] (length=801 residues).
MLRRRWFHLVLGTCLGIAFALLYFYATKPTYESHIEILVGQRSSELTTSGTMSNSQASGDTIQEDLLATHVQLLTSRLLI
SDAIATENLEKLPSIGAVVAGGDNAVDYIIENLDVARGGKGASKNAMVLSATFRDPNPDDAATILAAIYGSYERYVESHT
QDTSREAAELIDAARIENEKELDAADREYREFISSVPVLLEGERVRDVHKTRLEQLESELNTVRTSLAEAKSRLKVIEAF
TDENETSVNDFDKLALLSQKDVTRLKLFLDMTRGESQSETFQAEQPARAEAARAQYSRLLDLLQKERTLVSVYGVSHPLI
KSTREEIDVIERFVAANAPAALEEEKSTMNPRTMLTTFTRLLKNDIAEYEMREAILVETSSEELQLAKDVENAFLEGNAK
KAKVTRAQIRYDEVIRRLQELNLAGSYAGFSTDLLSNPEPAKSPAWPRLPIVLVLGSFLGFFLGIATGISAELLDTTFRD
VEDLETTLQASAIAHVPLFNLRKLPIPSPDQTPLAPSLVTAHCPRSAEAEVYRVARTSLMIRADGSDTKVLMMSSPHPGD
GKSTTISNLAISFAQAGKRVLLIDSDLRRPVIAGLFGVDGGRGLGDILMGEATLEDSTVASSVENLDILPHGKATSVPAE
LLQSNRMSVLVQEARRTYDLVLIDAPPVLAVADPSIVAPLADGVILTVRIAKNGRRPVEQAGRILNDNGIVPLALIVNGV
DAGKRSSYGYGGYRANEYAYVGKYHNEYAASEPSSISTLPRVKGATKSATSSGSPNASRAVVLGSATPTLPGMASQKAAL
E
>gnl|bykdb|A0A5C6FZ02 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium V7] (length=787 residues).
MTENNAKPSAPAKSESRVTEDVVTLDVLQILFRQRWLIAFLTLAGLAAGVAYALQARVWYESTARVLINEKSSGLASSSS
NEMVEEDILANHIELLLSRKIVGEAMAAKDDDGNSLMTLPSVVEHLDPEIETVDAVDYVIDHMEVVKGGEGGAKTARTLR
ISLNHTEPEDAQRLLTAVLQTYSRYLDQQISDMMDLATAKINEAKNEVEGELHVAEKKYLEHRQTAPMLFQGEGSSNVYQ
DKYRRLQDELIDLQIQESTIKTRLARVENELEDLDGKTLSMTESMDKLALIDSESLERLGLFAGLQISASNTAEFKATMP
VRAEEARTRFAYLLKLNSEKQRLQAKFGASHPDVQDIDDEIRLVRKFIDESNEDTVAEAPFGENSVNPESLLKAYVGFLN
HDMATIAERKSELTALANQAETDARELIEYELTDVVLRKEVERNEALFDGVVQQLRDVDIASGLRGYLYELLETPRIGAK
SWPSLPLCGLGGLMLGVFAGLTLAVANDVRDGRFRSAAEVEETVSLPSLGRVGKLNSMRRGVRGLIAGELSPNAEALRLG
RTMLLPKIKSRDMKSIGVTSSMQGDGKSTITANLAASFSQVGLSVLVVDGDLRRPTVHRYFSVAPEGGLTDLLTGSMELD
DAIKPTEADGVSVITAGASTRTPAELLQSEKLEELTHQLEERFDLVIFDLPPVLAVSDPLVVAPRIDGMVLVIRAASARR
DEVMNSLKRVTDAGGNMVGCVLNTFGAGKSFDLGGGYYGYYESGYSRPTNRTKPVTSARIVEVDNDA
>gnl|bykdb|A0A5C6G1Y2 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium V7] (length=792 residues).
MTGSTSVTQHQPNRRGGSTGSPRSGLGLPLRNSVEAINLPQLIARQRWLILFLGSCGLAMGVAYATHAEVLYESQAKVLV
AQRSAGLNNSGTGTDVVDEDVLANHMGLIRSRKIVSEALAEYGLMELPSLVAKVSDETDQVDYVIQNTSIGKGGDGSARS
AAIMNITLQHNSPEDVQKILAAIMRRYERFIVSQVESVMGEAGRMIQDAKRALEADLQEAEEEYLVSRQNAPLFFQGEGS
SNVYQDRYRRLSEELLELDIQQSTMRTRLDRVRESLKHIGGGSDLSDHLDKLALIDSDSLERLGAFAGLQVSASNSAEFK
AAMPAKMEEARAQVTRLLMLNAEREKLTAVFGSGHPKVREINNEIQLVEDFVRKSKEQTSPEMAFGSQAIKPDALLRAYI
GFIEHDIAAIGERRKELIALTTDAESKAKELIEYELKDLVLQKKIARHEAIFDGIVGQLQELNTASGLSGFLYEFLEVPR
LGKRVWPNVPLCSLGGLVLGLLCGMVLAVGNELRDSRFRTAQEVDEAIGLLNLGHVGQMSAIDQGIAGLVATDGSSESEA
FRLGRTILLPDIKSKKVRSIGFTSSMQGDGKSTIVANFAQAFAQVGLNVVVVDCDLRRPSQHRYLSLQDQQGMSEVLQAK
LPLADVIQPTEIENLSAISAGKTPENPAELLQGVNLDKAIESLSNHFDLVLVDLPPVLAVSDPAVVLPRLDGAVLVVRVA
RIRREQLANAMQRLQSTGANLIGSMLNVVGADKEFDAGVSQYGYYRNDYTRSSSQRKRGRAASATGSVNNAA
>gnl|bykdb|A0A5M6CY44 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Rhodopirellula sp. JC645] (length=787 residues).
MRQLPMPAAKSSSTRPRRPVAPEPDSLDLLDIFRRQRWMIIFLAVLGLAAGILYALNATVWFESRAKLLISERTAGLGGT
GTGTGMVEEDTLANHIELISSRMIVDEALKTNGLTEIESLQSQVSPETDAAEYVIEHLEIVKGGSGGAKTARTLNISFSH
PDPEDARLILTAVMKQYEKFIVAQVEQVMGRANELVQKAKSDVEESLATAEQEQLKARQEAPLFFQGEGSSNVYQDRFRR
LQDEMLDLDIQESTLRTRLDRVQAVLAELEESNDPVDNLDKLSLIDSESLERLGLFTGLQMNSSNTAEFKAAMPAKIEEA
RTQFTHLLQLNSEKQRLNAVFGPGHPKVQEIEGEIELVKQFLQDNEELTNPDGLMADTMLTPEGLLNAYTGFLQNDLAAL
AERRKELGFLTADAEKKAKELIEYELRDLVLQKNIERQEALFDGIVTQLRELDTASSLSGYLYEFLEVPRVGEPVWPKLP
LCAVGGLALGLCGGLALAFGTDVRDRRFRSAAELDEMIGLPNLGRVGKMMSINQGVNGLISAELSPDAEAFRLGRTMMLM
DIKAGKLKTIGFTSPLQGDGKSTIMSNFAVSFAQVNLKVLVIDADLRRPTVHRYFSVENELGLSDLLENETSIEETIRST
AIDNVSVMTAGSSTKTPAELLQTSRLDEILDELKQEFDVILLDLPPVLAVSDPVVVLPRIDGSVLVIRVSRARRDEVLNT
MRRIRESGGNFVGWMLNSLGAGTKFDSAGGYSGYYESDYTRKSSRNGKAVNGRAKAGRQLSARKTDS
>gnl|bykdb|A0A5Q4GFE7 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetaceae bacterium] (length=786 residues).
MMQHEQHSSADESMLPSSADSIHALIRFLQVVYHRKIYVVSAVVVASLLGGLYYTTATPIYQATSQLLILSTGPDILSPT
LTAESSRQALIPTYERLFTTQEVLEGAIESLLQGPAENRIDFASAPRHRWANILRGNLSAQAIRRTNVIEISYKSRSPGA
AEAVVGAVVQSYLEFMERSHKDVSTEIVQILDRERLEIEGRLSTKQEEILDVQRRLRDLGLSGNQNVVHPAVQRVIRLNE
TLLKVQQDRLQLEASLWAIRTAIRDGNDLRQHLTAIEPLIGRELTMSVMGLNSKDMETRAQIERRLMEDQTRLESLQQHY
GRAHPKVIELMQQIQAGRQYLMNYQEMVNQRLAGLSDGRLGPMLLARVEEQLSNLREHEERLDLQYEQAESEAVMLNDRM
AEMKMIEHDLARMRNLHDTLLNRIANIDIGHSRSDVRVAVVSEPKASDRPVSPKLPLVAMLCLVGGLGIGLALVYVIDVL
DDRFRSPEELQQQLGAPVLAMIRELATPATAGLQAIQVHVSPESVESEAFRTLRTTLAFSGSDLERIAITSTEPSDGKTT
VLANLAVSYAHSGKRTLVIDADLRRPGMTKLFEMRSNGGLSEILRGDSPIDAMCRPRVLPSGIAHLDVMPCGPKPSNPAE
LLSGPRLADVLAWAEANYDQVLIDCPPILAAADAAIIGRLTEGLIVVIQPEKNHRRLVLRAIAGMSSMGVGLIGIVANRI
RHESGGGYFGYGGYGYGYGYGYRDGYGQPADEARIDQDRFASGETDWSDEEDSDVPPGAPHPRNAA
>gnl|bykdb|A0A5S9IJB5 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium SRT547] (length=687 residues).
MDKQEFNIHQYIEIITSRWYIIFLSITLFVGMAFYYAKTTKRIYQSTGTIAILPKNLNLARDRIDLSMFRNMQNYLQTQY
DLIVSTPLLQKTFDHFNFAEKEKFRNVPDPLKVFRGLFTVTPLRKSFIVRVSFKWTDPRLPPRVVDFLQKAYIQQDRERR
VGLSGTGIDILYRKEGELRAELETFANQIQDYVLKNKLINVESRQNIIFQRLNDINEKLTEIELKRISAYTSYRETIDNY
NKAKIISTPEILKSRTIQELKVQSLVVDQEIQSLVTGRNLGINHPQVVALKSKKKVIEERLTAEVLGIMQSLKDQYYRYK
KEEDRLKKLVVAQQREALIFSQKVTQYQLLKKKYNALEETYLSVKQRLGQLELDKDSQGEEENIYIASPPRIPKTPIWPK
TLYILVGAFLFSCFSGLGLCFALEFLDNSVKGKDQLEKMMQRPVLGLIAEGKKNKKSQYPEVLALSTRSPVAESFRSLRT
TLSFSIEKNSTFFVTSPVPGDGKSFCAANLSVAFTQNDAKVLLIDADMRKSRQHQIWNTPRYPGLSNLIADSEVNLDDVV
QNVDVENLSFLPAGVSPPNPIELVEKERFKEIIAECEQKYDYVIIDCPPIAIVADGVSVSKVCQTGLLVVKNFKTPAKAV
HIAKDVLSSNQVKLSGIILNNMEVPKGRYYNSGYYNYGYYGNDGLTT
>gnl|bykdb|A0A5S9IPR9 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium SRT547] (length=739 residues).
MNKSEMNLPAFATSNPMLSSVTEEFRPEVDSEMSLLSYWAILRKHLILVAFCGVVGAITAVFYTSRLPNMYRAGASVAVI
KPTKNTQGLPVNQTYYSKRLSTQVAILQSRAMAKKVIERLPEAICLSFFGRERTDVTAGQLLRTISVAVGDGTDILYITC
RGKNAENVAYIANLYVDVFVDENEREIKNAQDKLLNWLKQVVPNLEKKIREKRDILIKLQQEYPEIRTYNLEKEGRAISR
VEAAKSDLYELERSMYDVKLRYGKCQEVKKKKSLEAILSSDLFVQNAMIDDLQKKKFLYENQLRDLKTRYKPAHPSIKKT
INNIAQVKKQIFHYAKRIIMQEEEKYENFKSRRAYYQKKLKELEEQNLAFHQKILMYEDINAEVAALRDRYNDYREKMKE
YDSQRSYQFDILNPIDSAGIPGRPFSPNRTQNYLVGTFLGVMLGVIFVFLIEFLDQSIKTVEEVQQLTPARIMGFIPFIS
PKIFMGKTTHVVEEKENTNVAEAFRAISTSIFFAEEQTKNKTFVITSALAQDGKTTIFCNLALMMAKAGHKVLLIDGDLR
RPRLRRLFELPQGEGFTELLRRDVSSEEVVHKINENLSCITSGKIPADPYETIHNSHIKELIRELEHEYDYILIDAPPIG
ITTDALLLGKKLGGLLFAITVHRTPKRMVKQLIHRMQTLDIELSGLILNDVKGSYSSQLSYYNYYGLYYSKSYYTRGLNK
NPLGRNSKINPLVDNTKKS
>gnl|bykdb|A0A660URN1 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium] (length=796 residues).
MRTDNISNPGAQMDKDSPVDNGAYNIAPAAGADHLQSSLLQIALRHRWVILAAVLVSLIAAFGYILKATPIYTSASKLYV
EQSGPKIITEYKGVMTQSKNYLYTQGELIKSTPIVANVADDSEIGRFKTFEQIDNPAAFLKKNINVAVGKKDDIIKVSFD
SPYPAEAAQIVNAVVNSYVDYHSSRKRSTVSEVLKILQKEKVKRDAQLTEKFQQLVQFTKENGIVSFDDKNGPIVFQRLA
KLSTALTDAQLATINAKADFEAILSMVDEPEKIKQFAMAQPNAGVRVFVNDVQSQLQSELKDLELQLANAKLHCTEDHPS
IEAIRGRIKYIKQLLGEKAKNFADAYLEVMRLRWTTAGQREDELLASFDAERKAAQDLGVKAAEYSVLQSELKRTERLCD
ILDNRIKELNVTEDVGALNISILEVAYPAIHPSRPQKAKIMMAALVLGLMLGFALALVRDWMDYRLRSADEISAVLGLPV
LGVVPTILPEQNIAIHSGKALLKFKSGASRIWRTIQAGISSDAAGVETKTVSAVPRSEDTAQGALDTKAIAERGQRVHLA
PKSHVAEAYRTIRTAVFFGVPKGQAKTIVITSPAPGDGKSTLASNLALTMAQAGQRTLVLDADFRKPVQHKIFEIDHGKG
LSNVFAGAITLDEAIEAGPVEGLDILPCGPEVPNPSEILNSDTFANMLNELVQKYDRVIIDSPPVTPVADSQILAAICDV
TIMVLRAEKSTRRLSRHARDNLLSVGGHLIGVVVNDVSQRSGRYGYGRYGQYGYYGYCSYYGHYGYGRDERQRQYA
>gnl|bykdb|D5SZ21 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctopirus limnophila] (length=741 residues).
MQTLMRFWRSVQYRKGLIILAVLAASALGAAYYIVSTRYYESKAELLILQTGSKVLDGAPEGAAMKDLMPTYERIMQGDI
VLADAAQKLPVKYRTDFRGVAPADWPGVLKKMVTVRSARQTNVLELTCRSRDPKAAAAILYAVLSASIDFLNKNHQGTSQ
EILQILSKEKVELEQKLATREAELIELRGRSLTFVSNGTDNATNVAVARVVRLNEEFMKAKEETLRATAQLAALEQAISR
GEDVLQFAMASLDVVGKQFMMGELGLDSQEGMAISRMTEQLLQEQAKMRTALESYGPNHPKVMELRDAIQAKEQWMASRR
QVTIDRLKQLRMEELTPRLLQMARQRVQHSQQHEASVSAQFDIERQNALSLNGELAKLEILQMDTKRLRAFYDLVLERIR
GIDLGKDKGIRTAVVGEPKVNPRPVHPKLSLTVAVSLMAGISLGLALVYLADLLDDRFRSPEETSLQLGAPVLSFIPSLP
TYDGNGLDSVHAFVAPHESSTEAFRTLRTAIQFAGDDIRRLVITSTEPGDGKTTVSTNLAVAYAQSGRRTIIIDCDMRRP
GLSKTMKLRGSYGLSTILRNDDSIENSLRNNVVVSDLAGLDIIPAGPRPANPLELLSSTRFSELLAYVESQYDQVLIDAP
PILAVSDAGVLGRMVDGVVLVVRPDKNQRRSVIRAAETLRMWGNNLLGLALNNMSSDRAGGYGYGYGYGYGYGHTDTDGD
HDDLLDDHASSHSSYSSRTAA
>gnl|bykdb|E8R3W3 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Isosphaera pallida] (length=812 residues).
MNPTDPVSAPPRDSHPSSPRPGTAMTRVAVDARPAKPALPPREEALATTLELGDLLRALRRRWLMAAIVAPLTAVLAMVV
AYPLVIKERYSSEATLQLALFGRSIVFNNGVSMGDAHAYMRTQSQLLRSPIVVEDALKDEKYKGLKTLEDLNENERFNWL
SANIQSSFAGDLMMVSIPTPYPEEASTLTNTLVNSYLRFANVLEMDRKMDEFSQLRDSYVKFNESLNTKRKELQKLAEQY
GSGDPIILEMRYQFHQNKVARLEQLLEEVNQRIRLAEIRRQILLEEQRTNRTGTGLTPRRDAEGKSDSNAASRSPAATSP
GRLDSREIDDLVEEYLQRDRNLLTAQVRLQTIKDSMKKFRNTQDPSYKKLETELRYREIDFLRLQNEAREAIRRDLEASR
LGNRLSSSPRSATPNDLFANATLEQIERSLREDYEWAELLQQDLQQQTRLLVTHNSNSFKIEQIKEELNTADRISELLSN
RIEEMRVELDAPPRITLINPADAVRIVGDPTKRLKLSGMIGAGVFFASLVGIALLEFYSNRVDNLNVLGASMGMNVIGAI
PTLPRQTNSSRSISKPNDRQVVWEGMLRESINEIRSHVLHANMPTPPRVLLVTSSMPREGKTTLSSYLAVSMASCGHRTL
LVDCDFRRPMSHQLFGTQKSPGLAEIFRNEIDLWSAIQTTSFNLLSTLAAGEGDPQTIELLNHNLLAGLIEQARGVFDFI
IIDSAPVLPVSDTLLVGRAVDAALFVVMRNQSRRDRVYDAYERLHRFGIPVLGTVVTAATSPKRYGYDPYGYYSYGYTYY
YQHQRASEDGAA
>gnl|bykdb|F0SG60 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Rubinisphaera brasiliensis] (length=771 residues).
MVSPEQYDLAAMPLPQETVNPLTTVIRFLQSMLRRKWIVMGWLTITVGLGITYFVLAPRLYESSAELLILHTGEGNMDET
QQSQRTLQDHLPTYTKVLSSEEVLKGTLQRLPRDQQAKFLGMSKRQAIGTLRENLSVSTTRQTNLLSVNYRTTDPKSAAI
IVTEILNSYFAFMQDMHQNSSREMLKLLTAERKKVEQQMTDKQNELLRLRAESDSLLGTGDSVVSVVNERVVELNRSLAA
AQKETIESRSFYTAVEQAIRNGENLQQLMAQTNSSVASELMKIGIGVDSRDQYVYARLQQQMIEDKAKLRDKLNNKLGPN
HPEVQELQQRIDGTNEWLENRSAQVAEGSDKINAELGPRLLQMAKQRYQHAMLNEQEITTRFNHEKTLAADMNQRLVLLQ
MAERDLARLQSDYDMLRERINALDLNQQTSLRTRITKHAEPNPAPVSPRLTLTLAMSIVAGMGLGALTVLLMDLLDDRFH
SPDELKSQLGAPVLAMVRELPMLDVETGLESIYTHTKPNSVETEAFRTLRTAIEFASETHQRISISSTEPSDGKTTVISN
TAVAFAQAGRRTLLIDGDMRRPGLTRLFDLRGQQGLSSILRDDQTIEESAKANMVHTGLMNLDIIAAGPRPSNPVELLTS
DRFAELIAWAEGEYDQILIDAPPSLAVTDPAIIGRLVDGVILTVRPDRNRRRMILRAAESLQSLGANLLGVVVNRLSDSS
GEYSYGYGYGYGYGYGHEDPVQDQSAAWSDFYDAEPERQKKERKRFSRKAA
>gnl|bykdb|F0SI78 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Rubinisphaera brasiliensis] (length=773 residues).
MTTLEAKHTPRWSARATEPKPTQNGSDWQFDSPTSSESGFDIRSIVWERKWLLIFFAALGAAIGYLEFTKQPPVYRSSAS
ILVDRYQPRMPIEGIDPLSGQTDPLSTHIALFNTPVILKKAVEDFRLGELSSISSSNPMASISSGLSVSRSAKAEDILLF
TFTCGHPKDAQKVLEAVIASYFAFLDESQRTASNRTVDLIKEAKDDLTESLTKKETAYQQFREDSALLWTSDEGNNLHQA
RLAQIEGQRSELLIKSSQVRAELEAIQNALNRGTSRQALLMMADQARQRAGQSSAEGVQNASITSQLIPLMLEESMLLEK
LGEQHPKVSEVRRRTEVMRTLLSQEAGERTSTKPASARPDLLTLYMQSLQEELRTNQEKLKELDNLFLSERTHSSNLTMD
ENRGRVLREDLNRTKKLYDVVLEKLQEISLVDETSVLTATVVNHPSDGSEVRLKVFNYAGMGGMGGLAIGMLVGLLLEYS
DKRFRSPEEMMQMLGVPILGHIPEMPASQKRRKRNKSGDTVPIDPTLVNYHRPNSRIAEAYRLIRGTLLLTMGGERARVI
QFTSPDPGDGKSTTCSNIALATANSGKRTLVIDLDLRRPTVHKLFGLDRDVGVSTFLTSDVEWADCIQQTSVPNLDVITA
GKKNEQYGELLHNPKLASVLDALRDKYDVIFIDSPPVLAVADATAIAPLADSLLLVIKNSKHSRPHAKQARESLDLVGAP
LEGMVVNLVCEETSYRYEGGHYRRGMYGSNYNYGTNYSYHQRRYRYYYEGTDA
>gnl|bykdb|F0SLB0 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Rubinisphaera brasiliensis] (length=795 residues).
MPADAGRSGFERHIAMRQNETMNQPTVESKNNPAPFPSHQIMQTPEPTVDLVQLALRNIIWLIIAGAVGLGLGIAAYKAL
GPSYVAKSQILVKLKTSVPLGDDDNRPTAGERSAHVEIIRSPRVIERAVHESHLDKLPTLAGSEDPARDIIDGLKVERTA
GEDHHKLNILNLQYTSTSEEDAKQILNAVVKAYDEYLQDDAQKSHRELTQLLNQINNDLTPRLNAKTEEYQRFRDEAPLL
WKAPPGADAAPGDVTNIHHQRVDAIAAERVKVELKYQEITSRIQTLRNAVQRGESSEALLLLVRTFLQRDQQSNTQTVMT
GTSERQQLDSQLLPLLLEEQVLLQRYNDGHPDVINIRKRIDIILSYYRKRGIELPVNPANGKAIVGPNGQVEPGSDMIST
YMTALTQQQAEMKNRLDELQKLYDQSTKQAKSFARFESQDQSYKEDLQRIRSLHDVVTRRIEELSLAHDEGYQLQQISPS
QAELDFKRILKTVGGITIMLLVATYGLLFLLALRDTTIKSLADVRSLFEAPILGTLPSVTNPQKNLEMARQTGTSPMLYY
YHDPASPEAESCRSVRATFFVRASDAGARVIQFSSPEPGDGKTTTISNLAISMAQAGKKVLLIDADLRRPMVHRLFGLRE
EIGLSEVLQGELELLNAIQPTKIENLSVLTAGAIPGKPAELLSSAKLHYVFGEATREYDFVLVDSPPILAVSDPSITARS
VDAMMLVVRMQKNNRPSIKRTLELLGSHGVNLMGVIANGVEATGGEYSYRGGYGGGYARQQSAKPTTPPPILTKQ
>gnl|bykdb|F2AXG2 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Rhodopirellula baltica WH47] (length=799 residues).
MAESAKPTNRLPSRSPSNSTSDGEETLDVLQILSRQRWLIAFLSIAGLAAGVAYALNAQVWYESNAKVLINQASAGLGGD
STGTDMVDEDILANHMELLLSRKIVGEALDPEDVKDEETGELIKREKLIDLPSVLPHLDEKTDAIDYVIDQLSIVRGGDG
SAKTARTLNITFTHTDPDDAKRILTAVMSRYQQFLIDQIDQVMSHADKMVQEAKSVVQKNLKEAEDEYLAARRKAPLSFQ
GEGSSNIYQDRYRRLQDELLDLDIQESTVKTRLARVDETLKEMDGSVDPIDQLDKLALIDSESLERLGVFAGLQMNSANT
AEFKAAMPAKAEEARTQITHLLRLTSEKQRLTSVFGPGHPKVQELESEITLVKEFLQDQKDLTSPAEMFGDSALTPEGLL
KAYVGFLQHDLAALSERRKELEYLADEAGKEAQTLITYELNDMMLRKAIARQEALFDGVVKQLHDLDTTSELTGYLYEIL
SIPRTGEKSWPKLPLCGLGGLMLGLFSGLFLAVANDVRDGRFRSAAELDEAIGLPSLGRVGKLNSINQGIKGLIATELSP
DAEAFRLGRTVLLPDIRSGKVRAIGFTSPMQGDGKSTVVSNFAVSFSQVGLKVLVIDADLRRPSAHRYFSIGKEDGLCDV
LEGRLEIPESIKVTEAENVSVMTAGSSSQTPAELLQSQRLDEVLAVVREDYDLVLVDLPPVLAVSDPVVVMPRLDGGILV
VKVANVRRDEVVNTLRRIDSSGGEMLGCMLNAFGAGKKFDSDGGYYGYYKSDYTRPSSSTTRQAAPKAATISSNGRVAE
>gnl|bykdb|K5E235 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Rhodopirellula baltica SH28] (length=785 residues).
MAESAKPTNRLPARGPSSSTSDGEETLDVLQILSRQRWLIAFLSIAGLAAGVAYALNAQVWYESNAKVLINQKSAGLGGN
STGTDMVDEDILANHMELIQSRMIVGEALEQTELLDLPSIESHLDEKTDAIDYVIDQLSIVKGGDGSAKTARSLNITFTH
TEPDDAKRILTAVMKRYEQFIIDQVEQVMGRANQMVNKAKTEVEAELVAAEQEHLKARQEAPLFFQGEGSSNIYQDRYRR
LQDELLDLDIQESTVKTRLTRVDETLKEMDESTDPIDQLDKLALIDSDSLERLGVFAGLQMNSANTAEFKAAMPAKMEEA
RTQITHLLQLNSEKQRLTSVFGPGHPKVQELESEITLVKEFLQDQKELTSPAEMFGDSALTPEGLLKAYVGFLNHDLAAL
SERRKELTYLAADAETKAKELIEYELTDMILQKKIGRQEDLFEGVVQQLRELDTASGLTGYLYEFLAVPRIGQKSWPKLP
LCGLGGLMLGLFSGLFLAVANDVRDGRFRSAAELDDAIGLPSLGRVGKLNSINQGIKGLIATELSPDAEAFRLGRTMLLP
DIRNGNVRAIGFTSPMQGDGKSTVVSNFAVSFSQVGLKVLVIDADLRRPSAHRYFSLGKEDGLCDVLEGRLEIPEAIKAT
EADNVFVMTSGSSSQTPAELLQSQRLDEVLAVVKEDYDLVLVDLPPVLAVSDPVVVMPRLDGGILVVKVANVRRDEVVNT
LRRIDSSGGEMLGCMLNAFGAGKKFDSDGGYYGYYKSDYTRPSSSTTRQAAPKAATISSNGRVAE
>gnl|bykdb|L0DC26 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Singulisphaera acidiphila] (length=740 residues).
MMLNSNPGPGADSVNLPAVVPPHRAEVLSVTPAHFESSASLDPITLLRALRRRWALAFGTGLLGAAVIATLTFYLVPPAK
YMARAMLHVNSVKPRILLQTGEVQSDYGSYQRTQLALLESRLVLSAALKQASVAKLPILTKMSDPIEWLEGQLQVDFAPG
SEILRISMTGEKPEIPMLLVNAVTQAYMDEIVDVEMKQSRQRYDLLKSTWNRYQESLREKRKQLKRLTELAGSDDKTTLA
SIHQHELDRLGRAEDELSRIQSELRSLRVEAEVLEEQATLNETMVTPAMIEDAISRDRSIELYKEKEGLAQRAIDRVYRI
ARNKNDPAIKKHRDDLEAARAGLAAQHRKLYPIVARQLQDAGRESSGSKTTLLQHRISILSKLEGAMEDDVKRLNGRTRS
ITQNSVDLFSIQEEIANADEVARTIGKEVEALTVELQAPPRIRLLEKAELPHTKDEIRQIKMAGMAGCGAFALTLLGISL
WETRARRIDSAADVIQCLGMNLFGTLPILPRRSRILGSGDAEHRRWGSMLIESVDAARTALLHVSRTESVRVVMVASALG
GEGKTSLSSHLATSLARAGRRTLLVDGDLRRPSAHELFDQPCVPGFCEVLRGEIDIVGAVQPTVISGLSLLTAGFSDSDS
IQALASLDLRAMFDQLKEHYDFLVIDSSPVLPVADALLIGQHVDAVIFSVMRDVSRIPTVHAAYERLSRLGIRMLGAIVT
GEQTDHYGSSYPSVSRTDKR
>gnl|bykdb|L0DFG4 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Singulisphaera acidiphila] (length=920 residues).
MANQQSITGSVSEGYPSRTLQNDLIALWEVMKRGWKLVIFGLLVCLTLASIYLAKTKRAYQASTSLLVIQHGGRPLNVTA
YTDPNRINEGSEDPVPTHMVLIRSPLVIQTAVESLGPKKTPSLALATNPLEAVRGSLKVTRPDRLTKIIVVQYQSASPQE
SLDMIRAVVASYKKLLETNYQKNNQEVITLVSRARDELKSELDTLQDEYHKFRKNNPGLAIGANGQTLMMRKLEQWSQGI
NNTTDLMIQLKTQLELIKKMESSGSQGNAIALALNQFPTVSSNGAGHLTQGMTGAAIGTSGTGSYEQLQKELADVKLKRA
MTQRLVENLKGARPNAEGKVTEDHVAGSFKLDPYVAELYRDLKRAQVRYNTAKRATRNTNDPSLQYARDRKEEIESEIED
LWRQRRPLLLRQLSREMADEGDQAIQKAEAELTSLEAEENSLYETLKESKEKAIASLREKHENLTKTLGPNSPETIQAKA
DVDQATEQLGGLGKDVLQSELRDRMTSIEHSLKSIGTMREEYEIKFKDDLVSAKQSELERLEEERLHGNLERQKALYNTV
LDQLKQAQLVSDYSSISCQVVDPPSALPSPVQPRVRMTLALGLMGGLLLGMGLALLVDRLDPRIRTLDEVRKVLNFALIG
TIPKLRSDQISLMGEIGLVSHAMPRSVWAEAYRSVRTSLEFLRRSRQVQVILVTSSHSGDGKTTTASNLAISFAMAGRRV
LLVDADLRKPSQHKIFGLKADQGLSHVLRRLLPLSRVVQQTQTENLDFIASGPEVDNPAELLASATFTDFVSEIRNIYDM
VVFDSSPLLAVTDPSILSAMVDGVVLVVRPEATKRHDAERTVELLKTMESPVLGFIVNGMDRQGTGSYGQGYGYGQGYGY
GYGTYGRDEVSPIVSDGKEIAAFGPPSKPTNGLPQGILKD
>gnl|bykdb|L7CLQ6 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Rhodopirellula baltica SWK14] (length=785 residues).
MAESAKPTNRLPSRSPSSSTSDGEETLDVLQILSRQRWLIAFLSIAGLAAGVAYALNAQVWYESNAKVLINQKSAGLGGD
TTGTDMVDEDILANHMELIQSRMIVGEALEQTKLLDLPSILQQLSEKTDAIDYVIDQLSIVKGGDGSAKTARSLNITFTH
TEPDDAKLILTAVMKRYEQFIKDQIEQVMGQANNLVEQAKTDVQGKLTNLEAEHLKFRRDAPLFFQGEGSSNIYQDRYRR
LQDELLDLDIQESTVKTRLTRVDETLKEMDESVDPIDQLDKLALIDSESLERLGVFAGLQMNSANTAEFKAAMPAKAEEA
RTQITHLLRLNSEKQRLTSVFGPGHPKVQELESEITLVKEFLQDQKDLTSPAEMFGDSALTPEGLLKAYVGFLNHDLAAL
SERRKELTYLAADAESKAKELIEYELNDMILQKKIAREEALFDGVVQQLRELDTAKGLTGYLYEFLAVPRTGEKSWPKLP
LCGLGGLMLGLFSGLFLAVANDVRDGRFRSAAELDEAIGLPSLGRVGKLNSINQGIKGLIATELSPDAEAFRLGRTVLLP
DIRKENVRAIGFTSPMQGDGKSTVVSNFAVSFSQIGLKVLVIDADLRRPSAHRYFSLGKEDGLCDVLEGRLEIPEAIKVT
EAENVSVMTAGSSSQTPAELLQSQRLDEVLAVVKEDYDLVLVDLPPVLAVSDPVVVLPRLDGGILVVKVANVRRDEVVNT
LRRIDSSGGKMLGCMLNAFGAGKKFDSDGGYYGYYKSDYTRPSSSTTRQAAPKAATISSNGRVAE
>gnl|bykdb|M2BB46 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Rhodopirellula europaea 6C] (length=799 residues).
MAESAKPTNRLPSRSPSSSTSDGEETLDVLQILSRQRWLIAFLSIAGLAAGVAYALNAQVWYESNAKVLINQASAGLGGD
STGADMVDEDILANHMELLLSRKIVGEALDPEPVKDEETDELIKREKLIDLPSVLPHLDEKTDAIDYVIDQLSIVKGGDG
SAKTARTLNITFTHTDPDDAKRILTAVMSRYQQFLIDQIDQVMGHANDMVTEAKSKVEKSLEDAENEYLAARQKAPLFFQ
GEGSSNIYQDRYRRLQDELLDLDIQESTVKTRLTRVDETLKEMDESVDPIDQLDKLALIDSESLERLGVFAGLQMNSANT
AEFKAAMPAKMEEARTQITHLLRLNSEKQRLTSVFGPGHPKVQELESEITLVKEFLQDQKDLTSPAEMFGDSALTPEGLL
KAYVGFLNHDLAALSERRKELTYLADDAGTKAKELIEYELRDMMLRKAIERQEALFDGVVQQLQNLDTTSELTGYLYEIL
TIPRTGEKSWPKLPLCGLGGLMLGLFSGLFLAVANDVRDGRFRSAAELDEAIGLPSLGRVGKLNSINQGIKGLIATELSP
DAEAFRLGRTVLLPDVRNGNVRAIGFTSPMQGDGKSTVVSNFAVSFSQVGLKVLVIDADLRRPSAHRYFSIGKEDGLCDV
LEGRLEIPEAIKVTEADNVSVMTAGSSSQTPAELLQSQRLDEVLAVVKEDFDLVLVDLPPVLAVSDPVVVMPRLDGGILV
VKVANVRRDEVVNTLRRIDSSGGEMLGCMLNAFGAGKKFDSDGGYYGYYKSDYTRPSSSTTRQAAPKAATISSNGRVAE
>gnl|bykdb|M5RT57 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Rhodopirellula maiorica SM1] (length=702 residues).
MGPRYLIHSLTTYWYLTIPLAIVLAGLSATAVLMTFTPVYRATAVMKIASYAPFIAYTTPEPQMNPEDFTETQIELIRSS
LVAEQVLDDSEIAELPGLQSIEKPIAWLTDNIRVQQVGSSELYNISLATSDPESSAKLVNAILDTYFAVRAKDNEDQTAR
VLELLGQEKQARSVEIQNLREKMRQLGQDVVGMDPYTGMPQKNGGQAGAGPLERLRERLTAAEVDRKMLEMEITAIREAM
AKEDLRIAEVDVEMAVGESQEVLDLRALIADRKSMMHRVESTAAGGRNDPSYLRLEAEVEGYEASLKRAVASSRPKITDQ
LKSLAELDRRDTLHELEARLETQLVLENLLGLRYKEMLGTAGESGNKLLELEFARAELEREERVFDLIAERSMALTTESR
APGRIVLLQPAEPTLHPVASFPLRNMAIAAFLSGCLPFGLALLWELSTKPISDVDQLTSNTTQTTVSEVAKLPVRTISIG
SRQTKAMSIFEESIDSLRVGLLLGEKHNDIQTLVVTSAVHGEGKSSISSQLAVSIGRATGEPVLLIDGDLRAPDIHNIFQ
VSNNLGMTSVLEGRATLDEAVIRDWSDQIHLLPAGRLRVNPHQLMTRESLNKIFNELRAQYRYIVIDTPPILSASEAILL
ARCADGSLLCTRRNVSREGQVKIAHDRLTKAGIKPLGTVLNGVPTRSYAKTYGSYDYARRFE
>gnl|bykdb|M5SZR3 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Rhodopirellula sp. SWK7] (length=875 residues).
MNSNRKLVSRNANSQDEQLLDLKKVALRHKSLIALGIAIGLVIGALYYAQSTPVFRSSAQVLIVRKTPNTEIKGQNAFYN
DYMSTHQALIKSSVIISRASQLPEISALKTKTKELHQGLNVELDENADNILHVSFEGEVPEECPVIIRGILNTYQDYLEE
TYDTMSTDTVQLISEARDLLLRDIRKQEFEYREFRRESPLLTTDEGGSNPVYSRIAAIQRQQSELLLRRTELESLIQSLE
NAIESGLEPKHLAMLISNAGVQLAAMDDDAEPMGLDRLRMDQKFHSLELEDERDLAEGLEAMLLPLKQQERELLTLFGPG
HPTLASVRLRIEEAKNFYKTLEKEYEEHHVAIREYADEAVDVGGYRKWKDASGTMEVSARLISEEESKVTLEREDNGKRV
TLATASLSGDDQRLLAKIRADRIRKHEELSEMVEMGLTQLRQELDRTVRTQELLRGIYDTEYVSAKELTDYEIAEEEFQS
NMEHTRQLYDGVVAQLQAASLSRDYGGFKANVISPPGFSWKVKPEALIVFPMAIFVGTFFGFGLACLAELANRTFRTSDE
ISKHLMLPVIGRIALARVSAKPQLDPEEMDDSLDRSLCTYFRPISVESESYRALRTTLFFHNRSREQSVIQVTSACPGDG
KSTVAGNLGVSIAQSGKRVLLIDADLRKPRQHLFFGSEIGIGLSNMIVDGAEPTDAIRATPVHNLWLLSAGQKTPDPAEL
LTSTRFAELMAQFREDYDYVIVDSGPLLAVSDPRIVMAHTDGLLLSVRLDKTTRKQAETAREILLSLDAPIVGIVANCVR
TSELDALGRARYGYGAYEGYHQSRNGTTSKSPNRLTSNNGHANGALVTSTGDVEVNGHGDKHSSNPLEERGNPNS
>gnl|bykdb|M5TIT3 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Rhodopirellula sp. SWK7] (length=773 residues).
MEELSDSIDVLEILSRQRWAIVFLTLCGFTAGVAYAMYSQEWFESHAKILINQKSAGLEGDSTGQAIVDEDILANHIELI
QSRMIVGEALEQSNLMALPSIVERIDVDNPSSDAVDYVINHLSVSKGGDGSAKNARSLSVSFEHTNPEDAQVLLTAVMKR
YEQFIIAQVEQLMGKANEMIHEAKQEVESELLASEQEHLKARQNAPLFFQGEGSSNVYQDRYRRLQEELLDVDIKESTVR
TRLQRVADTLNEMDDSGDAFDHLDKLALIDSESLERLGVFAGLQMNAADSPEFKAAMPAKAEEARTQITHLLQLSSEKQR
LSSVFGAAHPKVQELEGEIALVKQFLQDKQDLMNPASAFGSSTLSPEGLLKAYVGFLQHDLATLSERRKELTFLAADAET
KAKELIEYELTEMVLQKKILRQEALFDGVIQQLRDLDTASGLSGYLYEFLEVPRLGVKSRPKKSLCALGGLMLGLFMGLS
LAVANEIQDGRFRSSAELDEAIGLPRLGSVGKLNSINQGVAGLIATELSPNAEAFRLGRTVLLPEIRSGKLRTIGFTSSM
QGDGKSTVAANFAVSFSQIGLRVLVIDADMRRPGVHRFFSVDKANGLSEVLEGQLAFEDAVKETRADNVFVVTGGATSPR
PAELLQSDKLGEVLEAAKTQFDLVLVDLPPVLAVSDPIVVMPRLDGGILVVKIANVRRDEVVNTLHRVESAGGNFVGCMI
NAFGSGKKFDSDGGYYGYYKSDYTRAASSNGRKPRVGESSASAATVNGRASHD
>gnl|bykdb|M5TW92 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Rhodopirellula sallentina SM41] (length=875 residues).
MNSNRKLVSRNANSQDEQLLDLKKVALRHKALIALGIAIGLVIGALYYAQSTPVFRSSAQVLIVRKTPNTEIKGQNAFYN
DYMSTHQALIKSSVIISRASQLPEISALKTKTKELHEGLNVELDENADNILHVSFEGEVPEECPVIIRGILNTYQDYLEE
TYDTMSTDTVQLISEARDLLLRDIRKQEFEYREFRRESPLLTTDEGGSNPVYSRIAAIQRQQSELLLRRTELESLIQSLE
NAIESGLEPKHLAMLISNAGVQLAAMDDDAEPMGLDRLRMDQKFHSLELEDERDLAEGLEAMLLPLKQQEQELLTLFGPG
HPTLASVRLRIEEAKNFYKTLEKEYEEHHVAIREYADEAVDVGGYRKWKDASGTMEVSARLISEEENKVTLERENNGKRV
TLATASLSSDDQRLLAKIRADRIRKHEELSEMVEMGLTQLRQELDRTVRTQELLRGIYDTEYVSAKELTDFEIAEEEFQS
NMEHTRQLYDGVVAQLQAASLSRDYGGFKANVISPPGFAWKVKPEALIVFPMAIFVGTFFGFGLACLAELANRTFRTSDE
ISKHLMLPVIGRIALARLSAKPQLDPEEMDDSLDRSLCTYFRPISVESESYRALRTTLFFHNRSREQSVIQVTSACPGDG
KSTVAGNLGVSIAQSGKRVLLIDADLRKPRQHLFFGSEIGIGLSNMIVDGAEPTDAIRATPVHNLWLLSAGQKTPDPAEL
LTSTRFAELMAQFREDYDYVIVDSGPLLAVSDPRIVMAHTDGLLLSVRLDKTTRKQAETAREILLSLDAPIIGIVANCVR
TSELDALGRARYGYGAYEGYHQSRNGTTSKSPSRLTSNNGHANGALVTSTGDVEVNGHGDTHSSNPLEERGNPNS
>gnl|bykdb|M5UE94 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Rhodopirellula sallentina SM41] (length=790 residues).
MNDTAAPQPRSYPEQQETDLLDLLGILRRRKGLIALGLFIGVAAAVLYYVLTPPTFRAEMEILVGQKSGDLVRGANSSSS
VEGVDTKEDVLSTHIQLFSSRRILKSAIEKHDLDEVKSVVDAISESENLSPLAYILDNLEVTKGGDGVAKDAHTLKATYD
DPSPVDCALILRAIFDEYKIYLDDHFAGTSTQAVELLTQLSEETAQEVRDAERKLAEHLAGSQIMWDGEKTRNIHKERLE
KIEDDLHELTEREAESSSRLTVISDFLASKDASEITDVDRFSLLSEKEVNRLKLMIEMTRGDVASEAFQADQPIRQATAQ
AEYDEYLTLVMKEKKLREKFSDGHPQIVSLREQIEMMRKFIDNNSSKIQARDAQERITPAEMLQTYVGLLKNDVMGLQRQ
RQVLQTRSEQELKLAKQLEQAEVQAESMRRDLERRQAIFDDTQSTLKELNFVRDYAGFSTDVIGDAESQERPAWPRPLIV
LALGIFAGGMFGMGMALLADLMDTTFVDPDDVQATLGAPVLAHVPRFDPIKRKRKDPPFEIDSSIRVHHQPRTPAAEVFR
VLRTGLLVAARKNGHQVIQVTSPLPGDGKSTTSVNLAMAFAQTGKRTLIVDADLRKPRVARLLHLSGESGFSEALQDLCD
PTDVVQSTVSDNLFAVSAGAIPANPSELLQSDRFSQLINVWRDKFDFIVVDTPPVLAVSDAAVVSEEMDNVLLAVRIIKN
GRKSAIRACDILQRSGSEVGAIIVNGYQSKDKKYGYTGGYDADAYGYGYGESHKAYYGEKSAPFDLQSVS
>gnl|bykdb|M5UQ35 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Rhodopirellula sallentina SM41] (length=845 residues).
MTNQEDDIDGDDFELDLDVLGILRRRYHLIALGVFVGALLACLFYVKQVPVYQSNLAVLVGHRSADLNRASSSSLLEGAT
TIEDVILSTHMELFRSRKVIERAISVARLDRTVGEIQENLAVGRGGSGDAEAANMLTATFQDEDPEMAAKILQAVYESYF
SYIDNQSRAIGSEAADLIANAQLKNEETLRRADKAYREFLASMPALVDTNQDGEASLQDVHRIRLAQIESELSETRKKLA
QVRARRQTIRDFVGGRSRDEITDAEVLAILTEEELSRLKTLVTLNRGDQDDLESVMLSRYLSQQSAKLEYDKMLELSSKL
SFLRLTLGGGHPSVREVENEIESLKQYVAKQQQDKPEVADDEVVVSTVDMLGHYFNVLKSDVREYEARERDLGSLAEVEA
KAAKEVQMAFMEGNSLKANLDRAQARYDEVFQRLQEINLTNDYTGFSTDLLVTPSPAMLPVWPAKSKIAAIGILLGAMLG
AALAMIAELLDRTFKNPEEVERVVGAPILAHLPLLKTSKLKRHVRPGSVVSPMIVAFHAPRSSEAETFRVLRTGIIFRCK
SEGKRAFMITSPSPADGKSTMIVNLAASMAQTGKRVLLVDADMRRPTVAASLGVSAEYGLVDYLKGKAGFEDVLHPCEQA
GLFVCTDGSRTSQPAELLETDRFAEFMAEARSAFDVILIDTPPLLAVADPVIVSEHVDGCLLAVRVAKNNRTIVQRAAEI
LDEHGSRAMGVVINTQSPRSGDYGYSSYNYYGKKENGYVASYRRYYAASDVADEETPVSSSARLSAAKLRGVSGLPAQEG
RPSRIDVFADGPVMEEQSVNGHSHENVKSGGLNGVASTEARLSDR
>gnl|bykdb|Q7UF18 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Rhodopirellula baltica] (length=785 residues).
MAESAKPTNRLPSRSPSSSTSDGEETLDVLQILSRQRWLIAFLSIAGLAAGVAYALNAQVWYESNAKVLINQKSAGLGGN
STGTDMVDEDILANHMELIQSRMIVGEALEQTELVNLPSIESHLDEKTDAIDYVIDQLSIVKGGDGSAKTARSLNITFTH
TEPDDAKRILTAVMKRYEQFIIDQVEQVMGRANEMVNKAKTEVEAELVAAEQEHLKARQEAPLFFQGEGSSNIYQDRYRR
LQDELLDLDIQESTVKTRLTRVDETLKEMDESTDPIDQLDKLALIDSESLERLGVFAGLQMNSANTAEFKAAMPAKMEEA
RTQITHLLRLNSEKQRLTSVFGPGHPKVQELESEITLVKEFLQDQKDLTSPAEMFGDSALTPEGLLKAYVGFLNHDLAAL
SERRKELTYLAADAETKAKELIEYELTDMILQKKIGRQEDLFEGVVQQLRELDTASGLTGYLYEFLAVPRTGEKSWPKLP
LCGLGGLMLGLFSGLFLAVANDVRDGRFRSAAELDEAIGLPSLGRVGKLNSINQGIKGLIATELSPDAEAFRLGRTVLLP
DVRNGNVRAIGFTSPMQGDGKSTVVSNFAVSFSQVGLKVLVIDADLRRPSAHRYFSLGKEDGLCDVLEGRLEIPEAIKVT
EAENVSVMTAGSSSQTPAELLQSQRLDEVLAVVKEDYDLVLVDLPPVLAVSDPVVVMPRLDGGILVVKVANVRRDEVVNT
LRRIDSSGGEMLGCMLNAFGAGKKFDSDGGYYGYYKSDYTRPSSSTTRQAAPKAATISSNGRVAE
© 1998-2020Legal notice