BYKdb

Dataset for cluster orphancd of phylum kiritimatiellaeota

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bykdb|A0A6C2U416 [Bacteria] Bacterial tyrosine kinase [Kiritimatiellaeota][Kiritimatiellales bacterium] (length=730 residues).
MDKEGIYQGGTQKVIPRAAQAGKATGGSLFEPMNLLRMVLRRWMTVALLTLFGGLAGVFVAQHATRTYVAKAELEMSVRR
PKVINNEAVYDDSTARDEGVIFNTRFKKFKSPAMERLATQEYFKRYPEDEQSKGGTIGKYTLATLIRDVNWYKDPSANIV
YVSYLSTNPEFAAKLVNVLSHCAGLLMMQENQTMSDEAVKWLITQLDDQRDELEEVELQLAGIRDELQLGSLEQRKEAQS
QALVAVSGEREGLVSTLASRETVYGFVMELNGTDPNLEILPTGLPKEEQLNELIGTWRSAHDELLSVASRYTDIHPEYKA
AEDKEARAKNRLEQFIDMSAKAVQNEIDLLGKQLKQVDERIVKIEREILDLEQQIVSGNQKLQRLERKRDAADNAYQSML
RRMEEARLSADENMAFTKIIRNAEVPRIPESPSKKKIVATGIFFGGAAGCALVLLLSIFGDKIESVTDLKSLGLHILGTL
PTHKKVDSRSELATIGLRDKFCHMIEIFAGVNALISSNKYAEKTKVLLVNSAMPGEGKTVASCNLAISAAMNGSRTLLID
GDLRRPQLAKVFAIGEDHPSLLEWLVDGDSLMGHRDLVSHGVIENLDVVTSRPIKEINPAELLGRGRLSELLDWARVHYD
RIIIDSPPLGAVGDAQVLANLSDAIIIVSRIGKTRRRTLKFVLAKFEEIDALVFGCIANDVPHSISGMFQGAEGYGYTSK
YGAYKPYGGE
>gnl|bykdb|A0A6C2UNA8 [Bacteria] Bacterial tyrosine kinase [Kiritimatiellaeota][Kiritimatiellales bacterium] (length=731 residues).
MISTSETPSGAESHSGHQRSTQPNVSGGGSGLNPIKLLRMVLRRWYLPGALAFVGLGVGVYLAMTAVRIYKAEAEIEMSV
SRPQIIKSDVVFDDGGESRDIDVVFNTRFAKFRSPAMEELVTEEYFKRYSNDEYITCPSWVGLEELAYWVRQVYWWKDGQ
ANIVHISFECPDAEFAAQLVNVMIDCASKLMVQENKARSDGAVQWLVDQAEEQRSDLEELEQQLADLRQDLQMDSLLQRR
EVLSQMLGTLTQEKAQIENRLASKNTNWEYVTSWKDGNNALETLPAGLPKEERLVELIDAWRAASDELDQLATRYSEIHP
RYQQAATTKARTLARLEQFVDVSAQAVENEIQLLEKQIEQMSVRIASMETELLELEMTLAAGERKVQKFERKRDAAEVSY
LSVLERTESTRLAAEQDTAFVKILRAAEIPIIPVAPDKKKIVITCIFVALLFGAGLAVLIEFLMDRITSVNDLKEYNLNI
LGALPSDKLVKSRAELATASIRDKFGPMVEVFAGINGIMLSEAFKSRSKVVVVCSVSPGEGKTVSACNLATSSARNGAKT
LLIDGDLRRPRIAEVFAVDEKHPSLFEWFFNSDTGLDHAHLISSNVIEDLDLITSRPLKESNPATILGRKELVALINWAR
LHYDRVIIDSPPLGPVGDGMILASHADSVILVSRIGKTSRRKLKLVLSRLIKVDVYILGCIANDVPYSLAGKFGGAEGYG
YGQGYKSYTSD
© 1998-2021Legal notice