BYKdb

Dataset for cluster orphancd of phylum candidatus-cloacimonetes

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bykdb|A0A2A5AMW6 [Bacteria] Bacterial tyrosine kinase [Candidatus Cloacimonetes][Candidatus Cloacimonetes bacterium] (length=704 residues).
MAMKNSELEMYQLKQFFIDVFYKEFFLIILLFFASISAGSYIIYVKTSINYKSSTILNLKSSFVGEKALFPWIKESSGFK
PNYIKKKLRDSDILKDVMLETKTKISVGMILKKLKIKNYSDDSNERQRVLGTVDIGKSSSSNIFTLEFSLGGTLKNDLPL
ILKLLISKFVKNENDEIHLSLEKKLSIFAFQREEIRKKLSELILKKSSYQEKNNSLDIQAEMDSIILFINKNMGVLDRLD
GETLVLSQRKIEVSKELKNRLKESIDLSLFDKSYGELRNQLLELEADKSVLEETYIKGHPKLRSIGSKIKVLRTRANELN
DRFNNGSGRMSLDPVARSLNQEIRGLGFKVAALIQQRKSISEITKKEKKNYKSLNEAQSQILSLVNLEKDLRNEESDLTK
LIEIGGLNSKTIFLDFEYVKEVSDAVKFNNQFRNFGPILVFILALISVALVLYTKYFFSGKFMRSSDVSRVLPQPVYGMI
TNSKILNGDEIVCIENKTPAAESFRKLRANLSFHFDDLKTITISSAERGDGKSFVAVNLAASMAMMGKKVLLIDGDVRLP
RDHLMLGLENLLGFVDLMDDCSLDDVIQETKVNNLDFMSSGITSQNSADFLHSSRFGTIFTMLEERYDFILFDTPPVAYA
TDAFIYAKRTSVTLFVLSIDKTKVVNVEKYLSELENLGIDTMGLVINRVSEAELFGARSYKYYY
>gnl|bykdb|A0A496ZQC0 [Bacteria] Bacterial tyrosine kinase [Candidatus Cloacimonetes][Candidatus Cloacimonetes bacterium] (length=268 residues).
DNQLRTAKGETKKNLLIAKHQMEAKLITNYSPKSSSAEAFRILRTNIVTKKKPGESLTILITSSGPGEGKSTIHSNLATT
LAQMDAKVILVDLDLRRPMIHKLVDLDKEHGISDFLVDKTSQLETFIKRSHIPHLDVITSGFVPPNPSELLASRRMDEAL
DILKSKYDYILLDSPPVIAVTDTMVMARKSDMLTLVVRVGQADKNVIKRAKELLENINISLAGAVINGIHPQKYYSTYEY
NYYYYYYYGKKEDNKRSSKLFGKNKSIS
>gnl|bykdb|A0A7C5HW13 [Bacteria] Bacterial tyrosine kinase [Candidatus Cloacimonetes][Candidatus Cloacimonetes bacterium] (length=388 residues).
PDTEIELARLQRNFEINDKIYSMLTEKYEDAKIAEKSKIGNVRIVEEAQIPTKPIKPNKKLNLMISIVLGMALGVGMALL
MHALDSKIRTFDDVRKFVALPLLGTIPFIHVYESDIDHIEKMMTDSEDTDEDKLKIIRQQIESRLITHYAPKSSVSESFR
ILRTNIVAKRKEKKPMTILITSSGPKEGKSTALSNLAIALAQMDEKVILVDLDLRRPVVHTLFGQDKEMGVSDFLVDKST
KIERFIKKSRVPSLDLITSGYIPPNPSELLASHRMDEVLDILKEKYDWILLDSPPAIAVTDTMILANKVDILLLVVRVSM
ADKQVIKRAKELLTNIDVNITGAIINGVQPHKYYSSYEYNYYYYYYYGREEEESKRMPKISRKNKSIS
© 1998-2021Legal notice