BYKdb

Dataset for cluster tadcd of phylum candidate-division-wor-3

[Download (right click)] [Alignment] [Repertoires]

13 sequence(s)

>gnl|bykdb|A0A0S8GJS7 [Bacteria] Bacterial tyrosine kinase [candidate division WOR-3][candidate division WOR_3 bacterium SM23_60] (length=768 residues).
MKQQYTLTDYINIMREHIRPIAVCTAAAAVVALLMSFILPKTYEAEVTFKLDLSESKPLFYSPIYSQKQIDPVESQLEII
QSRTLAQTVVKELGLNFVVKDSYRTYFDSVFVADDCPPGTYYVRFHNSEFTIVGSRGEVIGTGTVGEHYDSGALRFRINE
KRADNMKLTIMTLNKRARELQKQVRVDQIRNSQLVRLKARSRNPQVAAAIANTLANEYINYSLRTVREVARGSKEFIESQ
ILIFGEELNHAEEDLRQYKEKAGIFLLNASAHEIISSLAQFETERERAIVALHESESAIENLEAELSRDAASYGAYKQMA
SFPTLSSSPIIVSLKDKLQTLELQKQEMAQTDVGSNDVPRIEAQIQKTEEELQKATRQIVLAGPSIDDPVFRSIITQIID
QETRAISLQSRIAALNQIIGRQNARLKQLPEAEVELAQLERQKMANENIYTMLLGKLEESKIAEAMQISEARIIDVANVP
ERPTHPRPVLNAVLGVLLGLMIGVGGVILKERLDTSVKTAKELEELTGSSVLASIPLMKGKERALIATVEEPHSEIAEAY
RILRTNIAFATTARPIQTLLVTSTIPQEGKTTTCINLAITLSQQGHKVIVVDCDFRRPMLHNYFAQYVTDNRHGLSDVLI
GRLKLESAIVRNSVHNLSFITSGTIPSNPAELLGSEKMVQMIEKLKASFEFVIIDAPPTLGVADARVLGRICDAVLVVVK
AQMTNREAVIDVKNEIERSGEKVIGFVLNGIDITSSYYRRRYHYYRSA
>gnl|bykdb|A0A1F4UBB9 [Bacteria] Bacterial tyrosine kinase [candidate division WOR-3][candidate division WOR-3 bacterium RBG_13_43_14] (length=771 residues).
MKSEPTLQDYIGVIIERRWLVISCVIGVTFCALVISLFLPKIYEARVRFKLDLSESKPMFFSEIYTPQRVDVVESQLEII
RSRTLARTVVQDLGLNFVVNNHKIYFLDSIRVANDFPPGKYSVRFRSENFGIYDKGDREIGTGKVGDLFDNGKLRFLIRE
RPNEDMRITIKNINKSAEELQDIVNASQIKNTVLVMLKAKSNSPELAAKIANTLAYEYINYSLSSIREAARSSKEFIESQ
ISIFGEELNNAEEDLRHFKEKTGIFLLSETATEIISSLAEFEVSREQAVVELNEMESSIVNLEDELSKDEATFGVYKKMA
SFPTISNSPIITNLKDKLKSLELKKQELVQINAKAGEIAEIDRKIQAAEIELKKATEQIVLSGPSIKDPIYQSLISQIIN
NGTKAIALQSRIDALNQIISRQNRRLKQLPEAEVNLAQLERQKMANEEIYTMLLGKLEESKIAEAMQISEARIIDEAIVP
DEPYSPKPKQNTILGFILGLFIGVGAAFLLEYLDTSLKTSKEIEELTGLSVLAAIPLVKNKERTHIPTIDEPHSQIAEAY
RILRTNIGFAATAKPIKTLLVTSTMPQEGKTTTCLNLGTTLAQQGHKTIVIDCDFRRPMLHRYFSAFIKDNTHGLSDVLV
EHLQLKEAIVKSTTPNLFFITSGTIPSNPAELLGSQKMQQVLNTLKETFEFILVDAPPALGVADARVLGKIVDAIAVVVM
AKKSSRDAVLEIKEELERSGEKIIGFVLNGIDLSRHYYRNRYYYYYHTTAE
>gnl|bykdb|A0A1V4QH99 [Bacteria] Bacterial tyrosine kinase [candidate division WOR-3][candidate division WOR-3 bacterium 4484_100] (length=771 residues).
MKSEPTLQDYFNIIMERRRLIIICVAVTTVVALIASFVLPKVYEARVKFKLDLSESKPMFFSEIYTPQTVDPVESQLEIV
RSRTIAKSVIKKLGLNFIPANENYSYFDSISVSEKFPPGKYYLKFNDNNFVFLDKDGNEIGQGQVGRLFKKGSIQFRVKT
KPKDILEVKIMDMEKRVDKLLSNISANQIKNTALVLLKARSRNPYLAALIANTLAREYINYCLQVVRESARGSKEFIESQ
IRIFGDELNRAEEELRKYKEKSGIFLLQESAKEIIKSLADFETQKEKALVELHEVESSIKNLETELSKDEAAYGAYKRMA
SFPTLSRSPIILSLKKKLKSLQLQKQELLSRGEKGEKLIRVEADIQATEQELSKATHQIALAGPSINDPIFQSIISNIIN
KETKKIALQSSIDALNQIISRQNRRLKQLPEAEVNLAQLERKKLANEEIYTMLMGKLEESKIAEAMQISEARIIDSATPP
KNPMAPKKKQNTILGFFLGLIIGIGGAFLLEYFDTSLKSTKEVEELTGLSVLATIPLVKNRNQHIPTIHEPYSQIAEAYR
ILRTNLAFTAATKPLKSLLITSTLPQEGKTTTCINLGITFAQQGHKVILLDCDFRRPMLHTYFGELAKDNHHGLSDVLIR
KLKLNEAIRKGTLGNLFFVTSGTIPSNPSELLGSPRMREVLQELKKQYEFILIDAPPSLGVADARVLGKICDGIIVVVMA
RRTSRDAVIEIKEELERAGDKIVGFVLNGVDFEGHYYRHRYYYYHYPSVKK
>gnl|bykdb|A0A235BXH5 [Bacteria] Bacterial tyrosine kinase [candidate division WOR-3][candidate division WOR-3 bacterium JGI_Cruoil_03_44_89] (length=703 residues).
MEEEQVSFEDYLRIIYERKWIIIVAFFAVVISTAVFTYRQEPVYEATCTIMVESRKRQRDIFELVYPRWVNILNYSEILK
SVAIAKSTIEKIAGSDLPISKTGNPVGVLRGGLSVTRVRDTDILEISVKGKTPQEASVLANTIAEVLIESELATGRKEYT
EQRHFLEEQIPKVKERLEIIENNLKKFKEETGLIALSEETGQLTEKLFEFDRLRGQTESELEFQKTKLVSLEASLEETQR
TLVEKISQVSSPYILELRRRLVELETTHSMYLVQGLPENNPKLVSLRKSIDETKAKLIEETNKIKDKELPTLDPLSFSQK
LVDEIISLRTEITAGETRLNVIKNILKEYERRLQRVPGQELRLVGLEREREINASTYELLVQRYEEVKIAEAGKTSNVRV
IDPARPPGRPISPKKRMNLTLAVVIGLIVGVGGAFVVDYMDNSIKTSKDIERYTGLSILGSVPIVKKKNDTPLLLLKGFP
SRSALHEAYRGIRTSLQFINPDNPIRTFLVTSPLPREGKTTIALNLAVVLSQLGLKTMVLDADMRKPAVHKFLGIEGKSL
AEFLAHGGDIESFILPTEIENVSVIISKETPPNPAELLSSNKMKKLLLDLKERFDVIIIDTPPVLSCTDATVLAPLTDGV
LIAVQSHKTNRNALGRVRDVMESVRAKLIGVVLNAVPSGRGGYGYYHYYHYYHYYPEEEGKGN
>gnl|bykdb|A0A348MM93 [Bacteria] Bacterial tyrosine kinase [candidate division WOR-3][candidate division WOR-3 bacterium] (length=722 residues).
MPERVVEDEGKELKTYFFLLLENKILFLTTFFIVIALVFIVTKVTKPTYQSTALILIETSDKGLSFLPITDMNPRKTVIN
NHIEMIQSRTLFERVENAISNSGYMDSLFIGKYKEKEGRISYLRKNLMVIPVKDTDILKIVYNDRTPEDAFYITKIIVDQ
YYNINLEMTRGELSEVRKFLEEQLVKIESDLQKNEENLKKFKENNSIIELSEETSKLVEMISNFEGQKKQYFVEREMLLS
KLTYLKENLSQSNKMIAEGFLNELDPFLERSKRELDSLQSNYAYFLSIGYDTTHPKMKEIKTRVENLKNNIIQNSKTSFQ
KKYFASNPLDYSKNLMDEIITVQLDVKVKESMIEAFNNVLKIFEEKMKKIPFQELMLARLERNKKVSEELYLMLKGKFEE
AKVAEAGKLGSVKIIDKPVLNKSPVLPKKNRNYLFGFFLALILGVGIVFLKEYIDDSVKDIDEIERELKINIIGNIPSIK
IKNGKQVSAEKGKLLTELPENSPIVESYKILRTNLLYHSDGKEPPKVVVVTSATKGEGKSTTASNLGIVMAQLDKKVLLI
DGDLRRPVLDKMFKINFDKGFTNLLKGEISVEDVIYSSGIDNLWIIPFGERTSHSTELLEGRITKKIFEQLRNMFDFIVI
DTSPVLSVADPTIISRLSDGLLWVVQFKKAKKRELHYTKKLLKNLNIPVIGFVFNNINTESFYGKYYYYHYYYHYHTKEG
ER
>gnl|bykdb|A0A7C0XDY3 [Bacteria] Bacterial tyrosine kinase [candidate division WOR-3][candidate division WOR-3 bacterium] (length=803 residues).
MNSEEKGREVSLYDYINLIYRHRVLIIVVFVITTLGAWIFSLLSPPVYKASSVVKLALKETRLNVIPEISPALRTVDPVQ
SQIEIIKSRALLENLVMKHGLNISFLTPVDAFEFDTLWTTRKAKEGIYTVKFKGEYFQVFAPDGSVIGNGRLGEPFNGGV
LGFLIRAKRKDYPLVIKFIVTAPDRVALSLKGIFKVTQKGQTDLAVISAQGSSPDFVKKMADALADEYVAFTLYGMQEEA
KALRSFLEEQLNKVEKELKLAEDSLRAFKEKAGIFLLDESARTLIERLSALQSELAKAETEKQEAEHKLASLRAQLGEKT
ATFEKYKQTASSPEVSSNPLVRSLKEKLTSLEIQKAMLLEKYTELHPEVVAVNREIAKTKEELNRAVANALKSGPSAGDP
IFQNLIAGIIESETKIQSTEGRINALKQLIKKYEAQMKLLPQKEVQLAELTRNVEANRAVYSMLINKLEETKIAEAQKST
DAKVIEYATRPIAPIKPRKKMNVLLGAILGLVLGVGGAFVLEYVDVNVKTPEEVEELLGVQVLGNIPYIKSAEDAEPRVR
LITNLDPKSVTVEAYRSLKVNLKFASTGEPIRTFMVSSAKAEEGKTLTAVNLAITSVQAGERVILVDADMRNPSVHRFLE
MTKSPGFTDVLKGEETLDDAIKHPEFLRDLAVLTCGSDVVNTLEVINSESFGRLLNELVNRYDTVIFDSAPILLVSDTLA
MADRVKNLLLVVRAGYTERPALVAALRALKRANVNLVGAVVNAIHLQKHYGYYYPYKYYGYEEREKRKGKKSRSWWRYFT
KRG
>gnl|bykdb|A0A7C0ZBM3 [Bacteria] Bacterial tyrosine kinase [candidate division WOR-3][candidate division WOR-3 bacterium] (length=695 residues).
MHEDRVELEHYIGVFRRRWWIISSVMVLTLVFSIIYYIKAPPVYETSTTMLIRQKPVGIFGTPNYQVVSGNEMVNHTLLL
KSQSLMKMVAENLPDSALALSGLSSREEAFRRILSDIYSGRIQIEPLRNSNIIKITVQENNPYMAYYFANGIAQNYQKFD
IQNKKLQVSALKEFVEAQLKKMEKVLKESEEKLKEYKKKHLTLEISSETSALVEKLTDFEAEYQKLFVEKEALKERITLV
QSRMDNQQKKLLETTWESILPLIEDLRNSLAELENERSRLLIQGFSKDDPKVLSIQKRIDNTRKALKDKVSELFSSDETP
DPVGNIQELLKQSILLKIDLAALEAKEGAYKKILEKYRAKLESIPDKEIELARLERERKANEKIYMMLLEKSEEARITEA
SEIGDVILLDQAPLVKTPLKLPKTKKTIFFIFLGLIISLGLAFIVDYFDPSIKSEEEVSAILKVPALGLIPRMDGEDGLL
YVMEHPDSHVAEAFRTLRTNIVLSSPKEKPGVILITSLTTGEGKSFVSSNLAYSFSLSKKTLLIDADMRKPRLYQAMGVE
RTPGLSDYLSGELKKPPIVKVDGLDFLPSGSSSPSPVELLDSERMRKLLIDLKEIYDVIILDSPPLFSVADAVVLSARVD
SMALVISHGETPRPLLLRAKDQLTSQNNLLGFIINKVNIQREYRYYHYYRREYTS
>gnl|bykdb|A0A7C3J6H2 [Bacteria] Bacterial tyrosine kinase [candidate division WOR-3][candidate division WOR-3 bacterium] (length=722 residues).
MPERVIEDEGKELKTYFFLLLENKILFLTTFFVVIAMVFIITKITKPTYQSTALILIETSDKGLSFLPMTDMNPRQTVIN
NHMEMIQSRTLFERVENAISNSGYMDSLFIGKFKEREGRISYLRGNLMVIPVKDTDILKIVYKDRTPEDAFYITKIIVEQ
YYNINLEMTRGELSEVRKFLEEQLVKIESDLQQNEENLKRFKENNSIIELSEETSKLVEMISNFESQKKQYYVEREMLLA
KLNYLKENLAQSNKMIAEGFLNELDPFLERSKRELDSLQSSYAYFLSLGYDTAHPKMKEIKIRVENLKNNIIQNSKTSFQ
EKYFASNPLDYSKNLMDEIIIVQLDVKVKESMIEALNNVLKIFEEKMKRIPFQELMLARLERNKKVSEELYLMLKGKFEE
AKVAEAGKLGSVKIIDKPVLNKSPVLPKKNRNYLFGFFLAIILGVGIVFLKEYIDDSVKDIDEIERELKINIIGNIPLIK
IRNGKQVSTEKGKLLTEVSESSPIVESYKILRTNLLYHSEETNPPKVIVVTSATKGEGKSTTASNLGIVMAQLDKKVLLI
DGDLRRPVLDKMFNLDFDKGFTNLLKGETSVENVIYPSGIDNLWIIPFGERTSHSTELLEGKLTKKIFEQLREMFDFIIV
DTSPVLSVADPTIVSRLSDGLLWVVQFKKAKKRELHYTKKLLKNLNIPILGFVFNNINTESFYGKYYYYHYYYHYHTKEG
EK
>gnl|bykdb|A0A7C3N5N8 [Bacteria] Bacterial tyrosine kinase [candidate division WOR-3][candidate division WOR-3 bacterium] (length=723 residues).
MLEDLQEQEKLSLNDYLAIVSKYKVLILVIALLIFFLSVVLTLLEKPKYTAKTILMFERVNTGSTFFPVTDPLGMEALLN
NQTQILKSRSLMERVNLALKEDTILKQKGYTKVSASRQNLSISKIQDTYIIEVVYKTTDPFLAAYITNKIAREYYKMNLD
AMRMTVSQVRIFLEEQLKKIETELNHSELLLRDYKKSNKISSLEDETKILINQVSQFETDYKGILLNIDTYTKQKEYLLR
ELDQTQKEMLENISSYRTNVMENIFAEISKLETDKAYFISQGYSNEHPKILEINSKIESLKNQLKDETEKSLKENTVPKN
PLKYSGDIVQQIVEINNNISLLQAKAEALKKVIDVYNSRLENVPDQSIQLVRLERNAKVNEDIYLMLKRRYEEAKLQEVA
EVGNVSIIDTAVVSKIPVSPKKEKNFLMGIILGIFFGITVAFILFFLDESIRTTEEVEHYTGEQILGIITYIGGNGRKDK
SKGEKKVSEDEMIEKMRKKLIINMEPHAPIAEAYRSIRTQIKYRSKEGEKLVYVFTSSIPGEGKSTTISNLGITMANLGK
KVVLIDADMRKPVIHKIFNVRNGIGLAHYINGKATFEEIKRDTEVDNLTVITYGTRPINPSELLENPKMKELLEICKNDY
DYVLVDAPPVNVVTDPIVLANYADKLLWVVSPGKVKRKDLRHARKLLVPVKRKILGVILNSSKTEVSSYYSVYYKKYYGE
GEL
>gnl|bykdb|A0A7C4TFL4 [Bacteria] Bacterial tyrosine kinase [candidate division WOR-3][candidate division WOR-3 bacterium] (length=783 residues).
MVCNFDPRDIFVAVIYRSKMNKELTFQDYLYVIIKRRWLIIICILLGTFGAFLASLRLPKVYEAKVKFRLDLSQTKPTFF
TEFYPSQRVDPVESELEIIRSRAIARSVVKKLGLNFILKNPRRALFDSVKISENARPGRYLMKLENNHFTILTNGGEIIG
KGYVGELFDNGSIRFLIKETPRENLEFAIVPVERATDDLIDRISVSQIRNTNLVLLKVKYFIPELCARIANTIAYEYIQY
SLENIRESARGSKEFIETQIEIFGSELDSAEEKLRRYKQKSGVFLLSETAEEIITALAQFEVEKEKAVVELNETETSIKK
LEAELAKDEASYGVYKKMASFPTISNSPLILSLKEQLKNLELKKQEYTLDPNKTAELKIVEEQIAQVKEEINKATKQIVL
AGPSIDDPIFKNIITNIMNYETKIFALQSRIEALNQILSRYNLRLKQLPEAEVNLAQLERQRKANEEIYTMLLSKLEESK
IAEAMQISGAKIIDYAITPDYPVEPKPRQNALLGFLLGLLIGVGGAFLLEYLDSSIKSAKEIEDITGISVLASVPRIKDK
EMKIIPSIFEIDSELAEAYRILRTNISFTAAEKSIKSLLVTSTAPQEGKTTTSINLGITFNQLGYRVLLMDCDFRRPMFY
RYFKTFIKDNQLGLSDVLANQIKLKDVIIQTSEPNLKFITSGTVSVNPAELLGSQKMANVLDELKSEFDFLIIDAPPALA
VADTRILGKICDGIIVVVMAGRTNRNAVLDVKEELQKAGEKIIGYVLNGVDRVSPYYYYRHRS
>gnl|bykdb|A0A7C4U9D2 [Bacteria] Bacterial tyrosine kinase [candidate division WOR-3][candidate division WOR-3 bacterium] (length=696 residues).
MDEERVDLEHYIMMLKRKFYVFLSIFFISLVYSFIYYFRTPEIYRTTASIFVVKKSINIFSPYTFQGIEEKDMVDHTLLL
KSNMVIKMVSEALTDEELSRANLSSKEEAYKRLLWDYSNERIVIEPFRNSSIIKINVTEENPYRAYYFANYIAQCYRDFD
IENQRRQVSSLKEFTRSQLLKMEKVLKESEERLKEYKMKHKTFDISQETREIINKLTSFEAEYQNLYIEKIGLEEKIKSI
DSSMTQEQKKFVETKWISLLPIVEELGENLSELETQLSNMVIQGLKEDDPKVISIKNRIKSTQNEMRQKVEELFQSKDIS
DPIGNIREMLKNTLFLKIDLAVNDAKMNAYKNIIDDYQKKLLLIPEREIELARLEREANANEKIYMMLLEKAEEASITEA
SEIGNILVLDPAPLNTTPLKGVKVRRIIFYLFVGLSLGIVFTILADYLDISVKSEEDVNFILKIPLYGIIPKIQNNKGNV
FDEHKKSLISEPFRTLRTNIILSDTDEKKTILITSIREEEGKSFVASNLALSFILSDKKVLLIDADFRKPQIHRFCGVEK
EPGLSDYLSGNVKDVPIIKKEKLFILASGSSTPNPTELLDSKKMREFMRNIKKDFDIVIIDSPPIFTVADTMIISNMTDK
TILVVRYSKTPKILLQRLKMFMNNKSIKIDGYVLNAVNLSRGYRYYYYYKDYYTKR
>gnl|bykdb|A0A7C4Y470 [Bacteria] Bacterial tyrosine kinase [candidate division WOR-3][candidate division WOR-3 bacterium] (length=701 residues).
MPSETTHYDFLKLLKVIRRRQWIIYLSILFILFLTTLYIIFAPKYYEASSKILITTRRYSIGPEMIYQDEEKAVDNELEI
LNSANFIMKVFENLKKSKNLPILSSRNPFYEFTKSVSIIPIGRSNTIKLSFISRNPEEAMIVANTLAETAVEFSLDFEKA
EIVQVMRFLESQIPVAKERLKDIEKKLEEYKSSTGIISVDEYVNTLSSELSNFDHIYNETIIEYSSKETQLKSLKERLNE
VKKNLSIDLSGIVNSSIKNIRTELFNLENELLTYELKGITQDNQRVSILKKNIEDLKKKLQEEVVKVAGDSIFVNDPLSL
TSELSLKIIETEIDFEILKSKMEVLENLKKDYEKKIRSFPFQETKFLSFIREYKIAEDVVKLLTEKYEEFRIEEAKKIGN
VKVIEYATIPIFPVKPQKKLSLLLGFFGGILIGIIGVVLLEIFANKIVDEDDVRENCHIPVIAIIPEVKIKNNDGFSKYL
ITNLEKNKELIEAYRIMKTNINFLNIERRSKVFLVTSSLPEEGKSTVSSNIAITTANAGYNTILIDLDLRKPSLHKVFGI
ENSIGLTDIVMNPKRLEDSIHKIKDNLYFLKSGTIPPDASEIISSNNMKEIMEKISRKFDYVFIDSPPLIIPETRLIGLL
SDGVILVLKSNYISPETLHRSINVINSIEKRIIGIVITRLKKHHRSYYYYQYYYNKEEKND
>gnl|bykdb|A0A7C6EHP6 [Bacteria] Bacterial tyrosine kinase [candidate division WOR-3][candidate division WOR-3 bacterium] (length=791 residues).
MVGAFEYWHIDFTNFNLRKMNKEPTFQDYIDIIYKRRLLIIICVIVASFSALLISLQLPKVYEAKVRFKLELSEAKPVFF
TELYTPQRVDPVESELEIIRSRALARSVVKKLGLNFVINNHGRAFFDSIQVNDNFPAGRYLIKMEDDRNFVVYNSKEEIL
GKGSVGENFSSNGLRFILKEKPTRDYLEFSITNIEKATEDLMHNISASQIKNTSLVLLKARSTLPELAAKIANSLSQEYI
LYTLESLRESARGSKEFIETQIKIFGTELDSAEENLRRYKQQSGVFLLSETAKEIINAVAQFEVEREKAVVELHETESSI
KKLESELAKDEASYGYYKRMASFPTISNSPLIITLKEQLKNLEIQKQEYQNDPVKLRQIQEQIAQVEQEINQTSKQILQA
GPSVGDPVFQALITNIINSETHLIALQSRVDALNQIIEKHNRRLKQLPEAEVNLAQLERQKKANEEIYTMLLSKLEESKI
AEAMQISQARIIDHAIVPDRPVEPKPKQNAILGFLIGLLIGVGGAFLLEYIDTTVKTSKEIEDLTGISVLATVPLVKNKH
HIDIPTIQEPYSDIAESYRILRTNLAFSAAARPIKSLLVTSTIPQEGKTTTCLNLGITLSQQGHKVVMLDCDFRRPKLHN
YFRDIVKDNHNGLTDVLINRIKLKDAIVKSQFENLYFITSGTIPSNPAELLGSNRMVDILNDLKGNFDYVLIDAPPALGI
ADARVLGKVCDAILVVVMSGKTNRDAVLEVKDELERAGEKIIGYVLNGVDVGQRYYRHRYYYYRHYTKPSA
© 1998-2021Legal notice