BYKdb

Dataset for cluster orphancd of phylum candidate-division-wor-3

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bykdb|A0A7C0VB03 [Bacteria] Bacterial tyrosine kinase [candidate division WOR-3][candidate division WOR-3 bacterium] (length=477 residues).
LKTKLDNIKENLSSQIVEVTGRYINDLRDKLVSLERDLTLYEIEGLPQNHPKIVEIKKDIEDLKKKLKDEISNFTADTLG
LSDPISITGNLIDRIMETEIDLLVLKTRKEVLESMREKYLKKIKALPEKETRLAELQREYDMASDIYKLLTEKYEEFKIE
EARKVGNVRVIEYAETPSFPVKPKKKLSFALAFIGGIILGIIGITLVELIDTTVKDEADIEEITDIPVIGIIPHLENHKK
GNGVLSITEKLIVHYKPQSSISEAYKTLRANLDFIGTPDKGEGHTYLITSAIPQEGKSTISANLAISTAQTDNKTLIIDT
DLRYPMIHRIFEMEHTEGLSEYLIGKLSIEKVIRDCDIKNLWILPSGTVPPNPAELLAKDKFKKLINTLMKRFDYIFIDS
PPVIFSDTRYLVSHIKNVLLVTRAGLAKKEIVIKALNTLENIGSPPEGIVLNDVEYRGTHYHYYYPYYGYSKREEKQ
>gnl|bykdb|A0A7C2P0I9 [Bacteria] Bacterial tyrosine kinase [candidate division WOR-3][candidate division WOR-3 bacterium] (length=237 residues).
SKLILHKNPLSPEAEAFKKLKFNIDILTKEFPKIIAVTSIIENEGKSTIVANLAIAYSLAGYKTLIIDGDLRKPSLHKIF
ETPNEHGFTELVTKNILKPYPSRFQNLFILPAGEDSLNVLKILDAFDLRKIRELLTENFDVVILDTPPVLPVAEVNTLAD
FAGHLLLVVRADYTPKKLLFEFETSIPENIRLIGFVLNFYKRAESHYRYYKYYHHETEKENNSLSNLLKKLKIVKED
>gnl|bykdb|A0A7C4S1E9 [Bacteria] Bacterial tyrosine kinase [candidate division WOR-3][candidate division WOR-3 bacterium] (length=332 residues).
KLMRDIEVLQKIYSLLREKNEEAKINEAGRISGITLVETFTPAKKIKPSLSFNLISALFLGIFFSFSAAFLMDYLNNTIK
SISDIEKMNISVLTTIPNLNGNERKKGTKRYIIPFSDEKTTCAESYRLLKTSLSWLFLEENKKIILITSPSQNEGKSTIA
ANLSYVFAQTGLKTLLIDLDLRKPTIHSIFSVERKPGFTDLILNNVNGNIKKSAFENLYIIPAGSLVPSPADLLEKKNVD
EWLKKLKEEYGVIIIDAPPALIAADVSILAKKVDGILLVCGFMKTELPMLEETIKMLNNGEKKIIGCVLNFYQPLKKYHN
YYYYHYKYQKKG
>gnl|bykdb|A0A7C6A9Y5 [Bacteria] Bacterial tyrosine kinase [candidate division WOR-3][candidate division WOR-3 bacterium] (length=535 residues).
VREFIEAQLQTQVLRLDSAERALQSFKQKHKIFSLADAATAQINQLAAYETMLQQTIMERKTAEEQLNHLLAESILPKAA
NQFASGNLFNTLQRLEIERTNLLLQGFEKTHPRILELERQIQLLQATCDLPQSNLPLDGSIRQVVQTISDLQMEHYRLKT
REEFISNLVSNYETKLTQLPERERELAKLIRQVEVNRSVYLTLSQRYEEAKIAEASRMSQVRIIGLAEKSVKVKPNLPLN
ISLGFILATILAIAGGLGIEYFDNTLKTRDDVEKILPVLATIPKLLQPACALPPESAHREKGTIRPETHEAFFVLRTALL
YSQLSVEEDSMKDSESEGKILLITSPGSGEGKSTIATNLAIVLASANYKTLLIDADLRKPTLHTIFSGKNYPGFTDVVVR
SLDDAIRQTPVSNLWLLTSGTLPPSPADILNSKGCSELLIRLKQTYDFIIIDTPPVLVAADASILAAKVDGVLLTVKANQ
TTKETLLHSQKVLLYSRANILGAVVNYVKTSKRYGYYYYDRYKYQSRLHKAGTSF
© 1998-2021Legal notice