BYKdb

Dataset for cluster tadcd of phylum candidate-division-lcp-89

[Download (right click)]

1 sequence(s)

>gnl|bykdb|A0A532UZK7 [Bacteria] Bacterial tyrosine kinase [candidate division LCP-89][candidate division LCP-89 bacterium B3_LCP] (length=762 residues).
MTEDREGSVNFSEYLRIILRGRWIILVCFLLILGSTTYFTYKMEPVFQASTTIMIEDKGRLEQSVFGFAGFMNAQTMIAN
QVEVLKSRKLANRVLMSLETSPYKENLRLLAEHDRNGRPINHEMRLRRLRESITVEPILDTDIIVVKVTANSSFEASYLA
NEIASVFYDMNLEISKGEVGEVRKFLESQLDSVKQKLAKSEDALRKYKEENKLVALDEETVKLVEQTAIFRAHLNETQTE
LHQNKLALQDLKKKHLETKSTLVEDVSNISSPLVVEFQRLIAEKQALIANLIAKSSPGYEIVVDEIEREIDEAKKALAEE
AYKIANSGITSIDPLKTSQDLFDQILQADINIKSLKARGEALEKVVGTYESQLEDIPQKNLELIKLIRQAELNEKIFLLR
SEKYEESRIAEAGKTANVRIIDTAVPPQRPIRPNKKLNVTLAIFFGLGLGVAISFIIELLDSSIRTVEDLEKMRVNVLGA
IPTINPADIARRMKRKGMKLTPEDQALITSKLITNFSPKSPVSEAYRSLRTNILFSNIDTPIKTLVISSSATKEGKSTTV
ANLAITMSQMGSRVLIVDGDLRRPTIHSLFNMDRQVGLTNALLGTYTLDEVIKPSGIENLDVITAGDIPPNPSELLSSNT
MRKVLSLLSERYDLILIDSPPIIAVTDAAVLSTRTDAVLLVVSSGYITRKEVLRAVQLLGNVNANLLGVLLNGLDVKRIY
GSYYYYYHYYQYYYYYSAKKKGRRHKEPAEAPPKERSEALET
© 1998-2020Legal notice