BYKdb

Dataset for cluster tadcd of phylum armatimonadetes

[Download (right click)] [Alignment] [Repertoires]

8 sequence(s)

>gnl|bykdb|A0A068NY62 [Bacteria] Bacterial tyrosine kinase [Armatimonadetes][Fimbriimonas ginsengisoli Gsoil 348] (length=738 residues).
MTNPKRITDDLRSGGGYDVDEQERTELLHYGGVLRRRWPAMLVVALAVFGLVAAYTMLQRKVYEASTKLVVVTKGASIGG
GDTLLATLGAIRQSRTVDTQVEIINSFDLIDRAFRTMTPAERMNGFKSLTAPAWSYEIKSRAETDVILIDSRSFRPDLAA
RFANAIAQTYLDEDLKRNSQATRQAWEYVQREMATSRNQLAIASADLAHYKQKTGLVAAADQVSGLAKAELEVQGSLDSS
RADMLAAERNLARLKGQLRALSPEIDFQRTIAENPEFALVRANVLQLEGRLVELSQEFTPNSPEVTQVKQELQVQKDKLK
ALARTTVSTEEKVRNPLLDKLASDYAEATATQVVASERAKALGGQLVKDQAALRQYPEQERHLAELQQRVDVLYRTFNML
SDRYYALLIEWRSSLPNGLVAALARPPSAHSSPRTSLNLTFGIIIALVLGLGVGVLLERLDTKLHSPEEAERATGLPALT
FVPEATTSGDRLLLGEAQPSHAFIESFRLLRNNIAFAVPDKDLRVVAVTSAAMAEGKSTISVNLAIAMAMDGKRVLIIDA
DLRRPTVHKWVGMTNEKGFTSVVRGVSSLSDAVRSTQWDGLQVLPSGPLPPDPTEFLNSHRSKDVFQLAANEYDVVVVDA
PPCTGLSDMQVISTIVDGVVLVAALDSTSKPMMHATMRMLRQAGAPLLGLVINRIKHSNKGYYGYYGYYGYYGYSSYQDD
PAAEEKVAKTKRSRTSKK
>gnl|bykdb|A0A3D0NA47 [Bacteria] Bacterial tyrosine kinase [Armatimonadetes][Armatimonadetes bacterium] (length=733 residues).
MEHVAAEESRPRHLGLPDYIRILSKRKWFILIVTAVGMLVGGLLALSSERLYEATSLVIIQQRPQGFFWVTGEEAGMPPN
VAMETHARIVRSSDVTQLASEKLQQLPTDSRVIATSTEIQDALNVSVIEPDLLRIDATSPDRRRALLFANYTAFAFVERN
LEDRQRESRDAREFLERQVAQYGTEVESIIEEMTAFARDSGFVDIDSEIGQAVQSLAAYENEERQAQRELMAAEARLAEL
RQVRGSQGDYLVGEAPAPNPEWTTLQASLTEARIGLEKLQSQYTGGNPLVLDQQALVEELAARLADTPQLVRAESTRANP
ATTGIEGEIKAAGVAVQEARARVAAAQGVLGGVQERIKDLPDARQQWQGLTDRLDAAREAYLSLQGELRQARLSEAVKKG
NARVVDQAQEPREIQTSLLHSLLFALAIGLFIGVGLSILLEALDDTIYSVDDLQRVSDLYLLGVVPLHMDDAGPLVTVDA
PKSPSAEAYRTLRSNIRFSLFDRPARTFLITSAGSGEGKSVTTANLAVAQAHSGLSVILVDADLRRPVQHKLFCVPSEVG
VTNVVVGDMSVAEALTPTEVPGLRLLTSGPVPPNPAELLESEQMTAVIQELTQLADLVIFDSPPAVMLTDATVLAAKLDR
TIVVAESGQITERALADVERLFRHARADILGIVLNKLRITGGDYHYYYYYYSDYSEEPQSPRGARNASGSERKAQDLIDL
NSSDERGRDDLEA
>gnl|bykdb|A0A3D4ZY98 [Bacteria] Bacterial tyrosine kinase [Armatimonadetes][Armatimonadetes bacterium] (length=838 residues).
METSARTLEVKDYVRIFTKRWLLILIITAAVGMMATLFALRAPSYRAEALVLIRTEPIQRLEVMEGEAIESRDVQSELTL
DTHARIVTSYSVASRTAAKLAARESGQKMEVEPAEIIKTLQVIPQDPDRLVIQSTSSERDRAREFANETAETFVQISAEL
RRKDVTAAREFLEEQIGNLHARLLTLEEELAKYQHQVGIVVPEVEATSAVAQLQDYQRELNSATTQLEALNSKQAELRRQ
LQGEPQILEIPGREPDPERIVVEAQLRQERLGLTGLQARYQDEHPAVSEAKRRIEALEARIAALPETRDVTQMQTNPRLP
ALKAELDGTRVNIAETRSRISRLQSIVTGLRADTVDLPLELAAIERLESQINLARRTYETFLAQLEQSKLREAIKQGSAT
VIDRAVEVEELRASLGRTFGFGIALGLFVGLLAALLLEALDDTFHSPEDLAYYTDVPFLGMVPMLDQPGDELVTIVAPKS
PPAEAYRVLRSNIHFAQADNPARTFLVTSAGAGEGKSMTTANLAVVFAQSGQKILLIDSDLRRPTLQRRFKVPRDTGLTN
LLIGEMSLEEVVIEVERVPGLYVMPTGPLPPNPADLLGSDRMIEIIAEATRFADIVIFDSPPAIVLTDAVVLSSKIDRTI
LVAECDHVNRTAFIEMIRLIRNARGNILGAILNKMRLSTADYYYYYYYYDYAKETPVSRPLDGAPTPAPEIDVEEPLEVL
XRCGPPRPAPTRSSGLRSSPGKRRRASSTSCTAIRRPSRRPRLRPHCRLTTCRSRSRRRKRRRSPTAPGATATRTATATA
TATTAAACSMTCSGQTMTTSERTPVFLSPVENRNLRTQ
>gnl|bykdb|A0A7C3N1I4 [Bacteria] Bacterial tyrosine kinase [Armatimonadetes][Armatimonadetes bacterium] (length=763 residues).
MNQPEPRNQGTNSYLPAQVEGTQLYAEQPYYGAEVWTVADVLSVLRRYALLIGVVFAACVGAAYIYNARQTPIYSASADI
LVDVGGTTQGSSEVDPVAEMLNAGRARSIQTQVEVLKRRPIVEAALKSMKPPLSRKRKPDLKVENIKDTDIIRVTVEDPS
PKVAAGFANAVANAYIAKSQASNRRSATVTRVFLEQQLADKKRELDEATNRLKSYKETSGIASLDAETTGRMQRLAATED
QLASAQTQVRSIEAQLRAVRAQLSTAEQTYLASTSSSVDPVVTSMEGTIATLEVQRAGLLREFQPTAPEVQALDDQIAEA
RKTLQARVRQRMTTSGQTVAANPMRMALMQQVADLEAQADAQQARIRALEPMVRAERRAVSELPERERRLAALTRDVANL
EQAYTTLQAKHQEVSVMEQAKLASASLLEPAEVPGAPIKPRKGLNLAVGALMGLMLGTMLAFFLDMLEKADDSVKSPDEA
ERALGLPVLGVIPGLPRSPQRLLIGSNDNSIIAESFRLLRSNVRFSNPDQPLRSIMVTSAASGEGKTTVAANLAIALAAN
GLRVILVDCDLRRASLAKLFGVENSRGLTSVVVGEMPIEEALQQVQRENLRLLATGPTPPNPVEFLDSQRCHEVLKELSG
MADFVILDTPPASFLTDATVLCPQVDGVLIVARTRQTKQAAIRRVMNQLLMTKGNLVGMCLNRMPMSGHGYYYNYYMYGD
YRAYCDQPRSRKGRRREALRATRAPELGREGQDSKDGRGHAGL
>gnl|bykdb|A0A7C3S9U8 [Bacteria] Bacterial tyrosine kinase [Armatimonadetes][Armatimonadetes bacterium] (length=732 residues).
MAEAVQRPEVPEEDVIDLRQIVRILQRRWKIVVAVPVLTVIATLGYLRTAPRIYEAISILRVQPSTQPLVLTGLPIPMPR
QPQQIDLKTIERLITTRLTAQEAVRILKGRRLRAIERLVYANSTIHDALKTARNKVGDEKKLEELAAEVLMKAIKTKTIE
PDLVEVRVRHPDPELAALVANSIAEAMVQRFTREAQRDATQERRYIERSLKTLEEQLRNLEAQIAREKKRLGIVDIPEET
KALLTSLRTYELEWHDAQAQRDAATAEVERLRRQIEREQPIVSVDVLKEDPIFKQMRDQLATLELERAKLLALFTPEHPD
VQQVEERIKTLRESLAKQARQLVKEREVAPNPAYQLLYQQLVTAEANRFAAEARLQALSRFLPELRKRLEALPENQRRLG
ALLRKAQAAEQVYTNLLMRLEEARIREVTKTGDLVIADLAAPPHEPVSPRPLLSLAIALVLGLMLGVMAAFLAEGLNETV
TTADEIQERLGIPVLASIPKTRSELTHEYVLDLMASRRSAAEAVRSLRANLKFLSRDKPMKVILITSTAPGEGKTFLATS
LAIAWAQSGHKTVLVDFDLRRPQVHECLGLENERGLGNFLVGAATLEEILQKTPLKHLQAITSGPLPPNPAELLDSEQIS
RLMKDLRERAEVVILDTPPILAVSDTALLVPYADGVIAVVVPGQTLRPMLRQLKEQVAIAQGHLIGAVLNKVAPPHGGYY
YRYYSRYYGESE
>gnl|bykdb|A0A7C4V1U4 [Bacteria] Bacterial tyrosine kinase [Armatimonadetes][Armatimonadetes bacterium] (length=744 residues).
MDAYRNQSWPAPSAGYEDDQPIDLKFYLEALLRHKWLILFLTVALSLGATGYVLTAKRVYSATARVQVQQSSGRYITITG
QPAYGGSPVDAAESLKTQVKFVYSSLTLGEAVRYLREQQGIVVPPDAFRGLKVMPEEPDVIAISVEHESPRMAAALANAI
ATAYRDQNTLQARRQARGAQEYIRQRLDEIRSDLARVEEQMKPLKIRQHIPWNETGDMTRAMQIAAYEDQARQAEMEVAS
LRNRVRVLRGQLAAHPRFRQMERPAEDPFLTGLRQEKVRLEVELAKLRADYKETDPRILTIQDKINSIQNQIDEQSKKTF
KTVTTEEDPNYNLLASQLFMTENSLAEAEAKALALRNLASQKRAQSPQLTEDQMNLARLQRQADVLQRTYTVLLERLQEE
RINEAQQLGNVNIIDFAQIPTRPVRPVPEKTIPLAAAVGLLLGVGLAMLREFLGSSVVATTDDIEKTAKLLPLGFIPASR
RLRSLSNYLPVVDQPGHPLSEAIHSIRASLKFATVDAPARSITVSSASAGEGKTFVAADLAASMAVSGQKVVLVDADLRR
PKIHNIFGLERSPGLAELLADGLDVEDVLQATQTNNLKVITAGCPVPSPGILFDTQRMTDVIAKLSSIADVVVFDVPPIL
PVSDALTLASKTDGLILVVEQSRVAKAALADVRRMCDLAKVRIIGAVLNKAETGGGYYYGYHYKYYTDYYKHYKSDGSDQ
KALPTASDATPPSERQQTGSQPNE
>gnl|bykdb|A0A7C5BMB1 [Bacteria] Bacterial tyrosine kinase [Armatimonadetes][Armatimonadetes bacterium] (length=754 residues).
MKRFGTNNETEHNGNGKSVSDDGIDKLVSQRQFNEPETEELREYIDILYRRRKIVVFTLLAILIIGIVYTLTRTPIYESS
ARIVVVTNNNTSPQLGDNIQMINDLRALVRSRSIDTQLEIISSPDVLNNAFENIDPKLRAKGFRSDHLPSWACKVSAKKN
TDIIIVTARAFDPKAAAELANNVSKSYFEQDLERSRRATRQAREYAEEQLAVLHRDLAKANTELSEYKRKTGLIAPDAQI
SKIAERMANLQMEIDAVQANIAAGRNDLEATKQGILQEKADVITSSTITRNPLFDEVVTRLDRLQSQRAEMLQEYTPQSR
EIRALDERIKIEEERLKTVAGNVVASRTESRNPIRDSLLKRYAEGIATNAALTARNRALLYAMNSQKTFLATLPEKERKL
TDLIQSVELLKGTYQNLSQRYYSLLLSERAMIPNGQLISKAAPSSTPTYPNKKRNFALFFVLGIMIASIAAVTIEKLDVR
VHDQQSVEQIANTPVLTLVPKVAETSKKLIEGKSSDSKLLESFRILRSNILFSIIDHDTVLIAVTSAGPSEGKSTVSANL
AIAMAMDGKKVLLIDGDMRKPNLHNLFGMTRENGLSRVIAGSCRQEDAIKATHVQNLDLLPSGPTPPNAPEMLNSRHCRN
LLEHLKSIYDIVIIDCPPCVGLSDVQVVSTLADGVVLVVAMNETRKPHLKIASHVLSRVSAPLIGVVLNKIDSLGNSYYY
KYYSNYTYLESCQKTSPKNGKRRKTIKRWPAFKS
>gnl|bykdb|A0A7C7PWR2 [Bacteria] Bacterial tyrosine kinase [Armatimonadetes][Armatimonadetes bacterium] (length=725 residues).
MAAGEPTLSRELPEVDARMYLWIIYKRIWLIVTLIALSLVVAAAYLNTRITMYEAKALVRLEQKVMPFNAFAMQQTGATR
RELPLSTAARLITSQLCAQHAQELIQEENPDIIIPVEEILRSIEVETTEPDLVEISCRSTVPERAVLIVNAVAQAFVDNR
TQEARAEASQTRRFLEQQLTKMQSELARIQRQMEEFKRRTGIMDVNAQMEAILTAVANYESEAANARVELSSARSQLAAL
RARLNAEQRIEWVDLPQEHPLLQALKEQLIEKQVELIQLRSRYTDEHPDVQRVKDELSAIQNRLSNHLERTVTLKRANPN
PIYDALRQQLVTTQLRTVQLEARERAFNELVKRERAKLTELLDKKQQWDQLQELASVTRETYKMLVARLQDAKIQEAAKL
GDAHIADLASAARQLTVNRVRTLLFSAMLGLILGIGLAVLLEFLDTTIRSPEEVERLIGVKALALVPYIREERYQQDIVA
LMRSKSPPSEALRVLRSNLKFVSAGNTMKAWMITSTHAREGKTLVSSALGIALAQGGQRVVLLDADLRHPGLHRVFGLNN
AVGLTSILVGDFDLQQALQPTGVDNLELLASGPIPPNPAELLDSPRMQSLIEQLKNYADVVVIDTPPAGLVTDPMVLATH
ADGVLLVLEPGRVSREALKRIKDLMEMAHGRIVGAVMNKITPKSSYYYYYAYADYYYYRYYRYYRHYYSAERTKEGTSAP
TQSGS
© 1998-2021Legal notice