BYKdb

Dataset for cluster tadcd of phylum thermotogae

[Download (right click)] [Edit] [Sequences] [Repertoires]

33 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K1PI90      ------------------------------------------------------------
A0A1M7RT68      MMDQEMTR----DEITLEDLLRIFKRRFWWFFATVIAVFAVTIVYLMLATPIYEASVTIN
A0A1E3G3X8      -MDGEIVR----EELTFEDILRIFKKRFWWFLGTLVLTIAITVIYLMVATPIYEASVTLK
A0A1M5RQU7      -MDPEIIQ----DELTLEDIIHIFKKRFWVFMTTLILTVVAVVVYLIYATPIYEASATLK
H2J8E1          -MEPEIYE----DELTLEDIIHIFKKRFWWFFATVVVVVALTIAYLFVTTPIYEANVTLK
A0A0H2SBE1      -MDPEIYE----DELTLEDIIHIFKKRFWWFFATVVITVALTILYLLLTTPIYEASVTLK
A0A0H2SAF7      -MDPEIYE----DELTLEDIIHIFKKRFWWFFATVVITVALTILYLFLTTPIYEASVTLK
A0A1M4Y2U3      -MEPEIYE----EELTLEDIIHIFKKRFWWFFATVVVTIVLTLVYLFTTTPIYEASVTLK
A0A0G2ZA83      MDNTPDFERAEYTELTLEDIFRMFRKHRMLFVGVIIAAIALTALYLFFATPIYEASVTVK
A0A182C824      MDNPTDFERSEYTELTLEDIFRMFRKHRLLFVGVIIAAVALTGLYLFFATPIFEASVTVK
A0A101ID04      ---MNQTNGDDYRELTLEDILRIFRKRLLLFFLVVVGVVVATGIYLFLATPIYEASVTIK
A0A3B8NDZ9      ---MNQTNGDDYRELTLEDILRIFRKRLLLFFLVVVGVVVATGIYLFLATPIYEASVTIK
A0A351HB98      ---MSEFEGSDYRELTLEDIFRMFKKRMVLFVSIVLAVVVVTGVYLIFATPIYEASVTIK
A0A2G8DIK4      ---MSEFEGSDYRELTLEDILRMFKKRMILFVSIVLAVVVVTGIYLIFATPIYEASVTIK
A0A421CM38      ---MSEFEGSDYRELTLEDILRMFKKRMILFVSIVLAVVVVTGIYLIFATPIYEASVTIK
I2F2W0          ---MSEFEGSDYRELTLEDILRMFKKRMILFVSIVLAVVVVTGIYLIFATPIYEASVTIK
A0A421CJA3      ---MSEFEGSDYRELTLEDIFRMFKKRMILFVSIVLAVVVVTGIYLIFATPIYEASVTIK
A0A2K1SRT1      ---MSEFEGSDYRELTLEDIFRMFKKRMVLFISIVLAVVVVTGVYLIFATPIYEASVTIK
A0A2T7N3K7      ---MSEFEGSDYRELTLEDIFRMFKKRMVLFISIVLAVVVVTGVYLIFATPIYEASVTIK
A0A318CQN7      ---MSEFEGSDYRELTLEDILRMFKKRMVLFVSIVLAVVVVTGVYLIFATPIYEASVTIK
A0A328IT51      ---MSEFEGSDYRELTLEDIFRMFKKRMVLFVSIVLAVVVVTGVYLIFATPIYEASVTIK
A0A5D0S032      ---MDENS-QDYRELTLEDILRMFRKRWKIFLLVVIAVVVITGVYLLFATPIYEASVTMK
C5CHA4          ---MNELD-NEYRELTLEDILRMFKKRFWFFMAIVIGVVVATGIYLVLATPIYEASVNIK
A0A660RD27      -----MDREFEVQELTLSDIFLIFRKRLFWFLGVFIATVVFTIVYLVVATPIYEASVTIK
A0A328PVB3      ----------MENELTFEDILNIFKKRFWWFFLTVVVTVTITLLYLLNATPIYEATSTLK
A0A2K1P7U2      ----------MENELTFEDILKIFKKRFWWFFLTVVLTVVITLIYLFNTTPIYEANTTMN
A0A2S5EHY0      ----------MENELTFEDILKIFKKRFWWFFLTVVLTVVITLIYLFNTTPIYEANTTMN
A0A4V3GR25      ----------MENELTFEDILKIFRKRFWWFFLTVVVTVVITLIYLFYSTPIYEANTTLK
A0A421CPQ0      ----------MENELTFEDILKIFKKRSWWFLLTVVVTVAITLIYLFNATPIYEANTTLK
A0A2K1NSH7      ----------MENELTFEDILKIFKKRFWWFFLTVVVTVVITLIYLFNATPIYEANTTLK
A9BJS3          ----------MENELTFEDILKIFRKRFWWFFLTVVVTVVITLIYLFNATPIYEANTTLK
A0A0C7NW05      -----MDDGKLDNELTFEDILKIFKKRFWYFFITVVVTVIIALIYLFTTTPIYEASTTLK
A0A2K1P2I4      -----MEEEKQENELTFEDILKIFKNRFWWFFLTVIVTVCITLIYLFTATPIYEATATLK
                                                                            

A0A2K1PI90      -------------------------------MIKSRRNLEKVIDNLNLMEYF--------
A0A1M7RT68      IEPKSKGSLTDLFSATGYTS-SRPDISTEVELIKSRTNIETVVKNLNLVEYF-----KNK
A0A1E3G3X8      IEPQTKSSLTDLFVSQ-YTY-TRPEISTEVELIKSRSNLEKVIENLNLVEYY-----KTK
A0A1M5RQU7      IEPQSAGSITDLFTSQ-VTP-GRPDISTEVELIKSRRNIETVVDDLDLVSYF-----RNK
H2J8E1          IESGKSNSISDLFSTQ-LSS-SRPEISTEIELIKSRTNIEKVIDDLNLIEYF-----SNK
A0A0H2SBE1      IEPQSQGSVADIFTSQ-LTS-SRPEISTEVELIKSRTNIEKVINNLNLTEYF-----KNK
A0A0H2SAF7      IESQQSSSISDIFSSQ-LTS-SRPEISTEVELIKSRTNIEKVIDDLNLVEYF-----KNK
A0A1M4Y2U3      IESQQSSSISDIFSSQ-LTS-SRPEISTEVELIKSRTNIEKVIDDLNLVEYF-----RNK
A0A0G2ZA83      IEPTSKSSISDIFMDQVTGSYTSKDISTEVELIKSRSNFENVIEELGLIDRMIEPEIKEK
A0A182C824      VEPTSKSSMSDIFMDQVTGSYSSKDISTEVELIKSRSNFEKVIADLGLVDRMIEPEVKSK
A0A101ID04      VDPATRSSI-DIFTAGLTGTTSSRDIATEIELIKSRSNFETVIERLELVERIYTSFEIQE
A0A3B8NDZ9      VDPATRSSI-DIFTAGLTGTTSSRDIATEIELIKSRSNFETVIERLELVERIYTSFEIQE
A0A351HB98      VDPTSQSSVGDLFSSSLTGS-SGSNISTEVELIKSRTNIEEIIEVLGLVDRVYSEETKAR
A0A2G8DIK4      VDPTSQSSVSDLFSSSLTGS-SGSNISTEVELIKSRTNIEEIIEVLDLVDRIYSEETKNR
A0A421CM38      VDPTSQSSVSDLFSSSLTGS-SGSNISTEVELIKSRTNIEEIIEVLDLVDRIYSEETKNR
I2F2W0          VDPTSQSSVSDLFSSSLTGS-SGSNISTEVELIKSRTNIEEIIEVLDLVDRIYSEETKNR
A0A421CJA3      VDPTSQSSVGDLFSSSLTGS-SGSNISTEVELIKSRTNIEEIIEVLGLVDRVYSEEAKAR
A0A2K1SRT1      VDPTSQSSVGDLFSSSLTGS-SGSNISTEVELIKSRTNIEEIIEVLGLVDRVYSEDTKAR
A0A2T7N3K7      VDPTSQSSVGDLFSSSLTGS-SGSNISTEVELIKSRTNIEEIIEVLGLVDRVYSEDTKAR
A0A318CQN7      VDPTSQSSVGDLFSSSLTGS-SGSNISTEVELIKSRTNIEEIIEVLGLVDRVYSEETKAR
A0A328IT51      VDPTSQSSVGDLFSSSLTGS-SGSNISTEVELIKSRTNIEEIIEVLGLVDRVYSEETKAR
A0A5D0S032      VEGSSKASLNTIFMDSVSGGFSSQNISTEIELIKSRSNLEKVVDKLNLIDKMIDQEKINE
C5CHA4          VEPTSKSSVSDIFMNQVTGSYSSKDISTEVELIKSRTNFEEVIRRLGLVDKMYEPEVKER
A0A660RD27      IEPSYQNTLADVFSTSFSYT-GRPNISTEIELIKSRTNLEKVIQELNLLDRM--------
A0A328PVB3      IDPVQQSSVADIFGVQMG-G-SSSKISTEIELIKSRRNLEQVIENLNLMEYF--------
A0A2K1P7U2      IDLSQQSSVSDIFGTQMG-I-TSSKISTEIELIKSRRNLEKVIDNLNLMEYF--------
A0A2S5EHY0      IDLSQQSSVSDIFGTQMG-I-TSSKISTEIELIKSRRNLEKVIDNLNLMEYF--------
A0A4V3GR25      IDPSQQSSVADIFGTQIG-S-TSSKISTEIELIKSRRNLEKVIDNLNLIEYF--------
A0A421CPQ0      IDSSKQSSVADIFGTQMG-S-TSSKISTEIELIKSRRNLEKVIDNLNLMEYF--------
A0A2K1NSH7      IDPSQQSSVADIFGTQIG-S-TSSKISTEIELIKSRRNLEKVIDNLNLMEYF--------
A9BJS3          IDPSQQSSVADIFGTQIG-S-TSSKISTEIELIKSRRNLEKVIDNLNLMEYF--------
A0A0C7NW05      VGSSQQGSVVDIFGSQMS-S-GSSKISTEIELIKSRRNLEKVVDNLHLVDYF--------
A0A2K1P2I4      VDSSKQGSVADIFGSQMT-T-GSSKISTEIELIKSRRNLEKVIENLNLVDYF--------
                                               :**** *:* ::  * * .          

A0A2K1PI90      QAKAENPEDVTRNSVVRALEEMITVSPVSDTNIVRISVQSEDKELARSIANNLAVVYNDL
A0A1M7RT68      SKN----SEIDTYDVIKSLSNMITVSPVKDTSIVKISVQNPDPELAKNIANELASVYNEL
A0A1E3G3X8      FPG----SNMDIYSLAKMLSNMITVSPVKDTSIVRIAVQNPDPELAKNIANELAKVYNEL
A0A1M5RQU7      TQN----PEITKNDVIGIVSNMISISPVKDTKIVKISVQSDDPMLASNIANRLAEVYNEL
H2J8E1          SED--KKVEITKTSVVRTLNNMISVSPIKDTNIVKISVQSDDPELAKDIANKLAEVYNEF
A0A0H2SBE1      SKD--SEKEITRLDIIKTVSEMISVSPVKDTNIVKISVQSDDPELAKNIANELANVYNEF
A0A0H2SAF7      TDDEKTKKEINKYNIIKTLSEMITVSPVKDTNIVKISVQSDDPEMAKKIANKLAEVYNEF
A0A1M4Y2U3      TDDEKTKKEINKYNIIKTLSEMITVSPVKDTNIVKISVQSDDPEMAKNIANKLAEVYNEF
A0A0G2ZA83      FIQEGYSEEDFIDSLAKTLSEITTVSPVKDTRIVKISVQHADPVLATEIANKLAEVYNEK
A0A182C824      MLQEGYTEEDIIDSLAKTLSDIVTVSPVKDTRIVKISVQHANPELATDIANKLAEVYNEK
A0A101ID04      MLSEGYTQNDIEASLAKTLSNITSVSPVKDTRIVRVSVQHRDRTIARDVANTLAEVYNEK
A0A3B8NDZ9      MLSEGYTQNDIEASLAKTLSNITSVSPVKDTRIVRVSVQHRDRTIARDVANTLAEVYNEK
A0A351HB98      LLSEGYSDRDLVASLTRSISSMITVSPVKDTRIVRVSVQNKDPVLARDIANTLAEVYNTK
A0A2G8DIK4      LLAEGYSQKDLVTSLTRTISSMITVSPVKDTRIVRVSVQNKDPILARDIANTLADVYNTK
A0A421CM38      LLAEGYSQKDLVTSLTRTISSMITVSPVKDTRIVRVSVQNRDPILARDIANTLADVYNTK
I2F2W0          LLAEGYSQKDLVTSLTRTISSMITVSPVKDTRIVRVSVQNKDPILARDIANTLADVYNTK
A0A421CJA3      LLSEGYSDRDLITSLTRSISSMITVSPVKDTRIVRVSVQNKEPILARDIANTLADVYNTK
A0A2K1SRT1      LLSEGYSDRDLVASLTRSISSMITVSPVKDTRIVRVSVQNKDPVLARDIANTLAEVYNTK
A0A2T7N3K7      LLSEGYSDRDLVASLTRSISSMITVSPVKDTRIVRVSVQNKDPVLARDIANTLAEVYNTK
A0A318CQN7      LLSEGYSDRDLVASLTRSISSMITVSPVKDTRIVRVSVQNKDPVLARDIANTLAEVYNTK
A0A328IT51      LLSEGYSDRDLVASLTRSISSMITVSPVKDTRIVRVSVQNKDPVLARDIANTLAEVYNTK
A0A5D0S032      LLNKGKTMSDIQSSLVKTLGNIVTVSPVKDTSIVRISVQHEDPVLAKKIANTLAEVYNEK
C5CHA4          LLSEGYTEDDLVQSLTYTLSEMITVSPVKDTRIVKVAVQHPDPVLAKDIANTLAEVYNEK
A0A660RD27      KKKN---PDITMNEAIKALNEWITVSPVKDTKIVKISVQHPDPFLAANIANKLAEIYNEL
A0A328PVB3      KAKSENPEEVTKNSVIRTLSEMITVSPVSDTNVVKISVQSEDQQLASEIANNLALVYNDL
A0A2K1P7U2      QAKSENPQEVTRNSVVRALEGMITVSPVNDTNIVRISVQSEDKELAKSIADNLAIVYNDL
A0A2S5EHY0      QAKAENPQEVTRNSVVRALEGMITVSPVNDTNIVRISVQSEDKELAKSIADNLAIVYNDL
A0A4V3GR25      QAKVENPEDVTINSVVRSLEQMITVSPVSDTNIVRISVQSEDKGLARSIADNLAIVYNDL
A0A421CPQ0      QAISENPEDVTRNSVVRALEEMITVSPVSDTNIVRISVQSEDKELARSIANNLAVVYNDL
A0A2K1NSH7      QAKSENPEEVTRNSVVRTLEEMITVSPVSDTNIVRISVQSEDKELARSIADNLAIVYNDL
A9BJS3          QAKSENPEEVTRNSVVRTLEEMITVSPVSDTNVVRISVQSEDKELARSIADNLAIVYNDL
A0A0C7NW05      KERSDNPENVTKNGVIKYLGDIITVSPVKDTNIVKISVQSEDSELARSVADELAIVYNDL
A0A2K1P2I4      RANSENPEGVTINDIIKTLNDMITVSPIGDTNIVKISVQSEDPDLARRVADELSLVYNDL
                                  :    ::**: ** :*.::**  :  :*  :*: *: :**  

A0A2K1PI90      LKSLSQNEYTARRRFIEEQIPLAESDLNAAQDDLRNFKEENNIFLLDEEAKSILQFLVSY
A0A1M7RT68      LQRLSRNEYTARREFIEQQIPKVEEELKQVEDQLKKFKQTNKVYVLNVESQNLLNTLYNL
A0A1E3G3X8      LQKFSKSEYTVRREFIEEQIPKLESELKQLEDELRKFKEKHGIYVLNVEVQNLLNTVYNF
A0A1M5RQU7      LKSLSKNEYTVKRHFIEQQIPIVEEELKKAEDNLRKFKEENNVFVLDEEAKNLLSLMLNY
H2J8E1          LKTLSKNEYTVKREFIEEQIPKVEKDLKAAEERIRKFKEENQVFLLDEEAKNILSFTLEY
A0A0H2SBE1      LKTLSKNEYTVKREFIEKQIPKVENDLKAAEEKIRKFKEENKVFLLDEEAKNILSFTLEY
A0A0H2SAF7      LKTLSKNEYTVKREFIEKQIPKVENDLKAAEEKIRKFKEENKVFLLDEEAKNILSFTLEY
A0A1M4Y2U3      LKTLSKNEYTVKREFIEEQIPKVENELKAAEERIRKFKEDNKVFLLDEEAKNILSFTLEY
A0A0G2ZA83      LAELSKRDVKTKREFIDSQIPLIEADLRKATDALKTFKETYKIYVLEEHARSLLQVLSNY
A0A182C824      LADLSKRDVRTKREFIESQIPIIEADLRKATDALKEFKETYKIYVLEEHARSLLQILSKY
A0A101ID04      LAELSRRDATTRREFIESQIPSVEEQVRRSSDALREFKEKTGIYVLDAQARWLLDMLSNY
A0A3B8NDZ9      LAELSRRDATTRREFIESQIPSVEEQVRRSSDALREFKEKTGIYVLDAQARWLLDMLSNY
A0A351HB98      LAELSKRDLARKREFIEAQIPLLESDLNEATDKIKQFKEETGIYVLDKHADQLFQMLSNY
A0A2G8DIK4      LAELSKRDLTRKREFIEAQIPLLESDLNEATDRIKDFKEETGIYVLDKHADLLFQMLSSY
A0A421CM38      LAELSKRDLTRKREFIEAQIPLLESDLNEATDRIKDFKEETGIYVLDKHADLLFQMLSSY
I2F2W0          LAELSKRDLTRKREFIEAQIPLLESDLNEATDRIKDFKEETGIYVLDKHADLLFQMLSSY
A0A421CJA3      LAELSKRDLTRKREFIEAQIPLLESDLNEATDKIKQFKEETGIYVLDKHADQLFQMLSGY
A0A2K1SRT1      LAELSKRDLTRKREFIEAQIPLLESDLNEATDKIKQFKEETGIYVLDKHADQLFQMLSNY
A0A2T7N3K7      LAELSKRDLTRKREFIEAQIPLLESDLNEATDKIKQFKEETGIYVLDKHADQLFQMLSNY
A0A318CQN7      LAELSKRDLTRKREFIEAQIPLLESDLNEATDKIKQFKEETGIYVLDKHADQLFQMLSNY
A0A328IT51      LAELSKRDLTRKREFIEAQIPLLESDLNEATDKIKQFKEETGIYVLDKHADQLFQMLSNY
A0A5D0S032      LAELARRDIAMRKNFIESQIPTLEKELNEATNALREYKEETGIYVLNEQAKWVLQMLSKY
C5CHA4          LAELSKRDITMKKQFIESQIPVLEEDLKKSTNELKAFKEKTGIYVLEEQARWLLQMITTY
A0A660RD27      LRDLSKNQYTAKRKFIEEQIPKIEDDLKRIEEKIRKFKEKNNVFILDEEAKWLLQMLSQY
A0A328PVB3      LKSLSQNEYTARRRFIEEQIPIAEKDLNVAQDNLRKFKEENSIFLLDEEAKAILQFLVSY
A0A2K1P7U2      LRSLSQIEYTARRRFIEEQIPLAEIDLNAAQDNLRNFKEGNNIFLLDERAKFILQFLVSF
A0A2S5EHY0      LRSLSQIEYTARRRFIEEQIPLAERDLNAAQDNLRNFKEGNNIFLLDERAKFILQFLVSF
A0A4V3GR25      LKSLSQNEYTARRRFIEEQIPLAESDLNASQDDLRNFKEENNIFLLDEEAKSILQFLVSY
A0A421CPQ0      LKSLSQNEYTARRRFIEEQIPLAESDLNAAQDDLRNFKEENNIFLLDEEAKSILQFLVSY
A0A2K1NSH7      LKSLSQNEYTARRMFIEEQIPLAESDLNAAQDDLRNFKEENNIFLLDEEAKSILQFLVSY
A9BJS3          LKSLSQNEYTARRMFIEEQIPLAESDLNAAQDDLRNFKEENNIFLLDEEAKSILQFLVSY
A0A0C7NW05      LKSLSQNEYTSRRKFIEEQIPKAESELNTAQDNLRLFKEENNVFILDEEAKAILQFLVTY
A0A2K1P2I4      LKSLSQNEYTARRVFIQEQIPKVEEELQNAQDNLRKFKEENNVFILDEEAKAILQFLVSY
                *  ::. :   .. **: ***  * ::.   : :. :*:   :::*:     ::.     

A0A2K1PI90      DQQINTYQIQMEETKIRLQTLNDTLKSMDQE---------IISSETISINPVVSNLRNQI
A0A1M7RT68      DTQINTYKIKVEEVKAKISALTQQLKSMNQK---------IVSSETISVNPVVSQLKAKL
A0A1E3G3X8      DNQINQYKIQLEETRAKIVALNEQLKRTNQK---------IVSSETISINPVVSQLRSKL
A0A1M5RQU7      DSQVNSYMLQLQENKATIAALNEMLKKVDEK---------IISSETITTNPIVSQLKSKL
H2J8E1          DRQINQYSLQLEETKSKIKAFNDLLKKLDEK---------IISSETISTNPLVSQLKSKL
A0A0H2SBE1      DKQINSYNLQLEENNAKIKAFNDLLKKVDEK---------IISSETISTNPFINQLKSKL
A0A0H2SAF7      DKQINSYNLQLEETKAKVRAFNDLLKKVDEK---------IISSETISTNPFINQLKSKL
A0A1M4Y2U3      DRQINQYNLQLQETKAKIKAFNDLLKKVDEK---------IISSETISTNPFINQLKSKL
A0A0G2ZA83      DQQYNDLSLQLKEKEAEKEAYLELLQEFETSEAETRVSKWIKTSETY-MNPVITQLKTKR
A0A182C824      DQQYNDLSLQLNEKQAEKDAYLQLLKEFESSEAEARVSKWIKTSESF-TNPVIAQLKSKR
A0A101ID04      DKQFNALVIELEEKKAEVVAYQKLLDEFDSPEAGALQEKWINTSHTLSLNPVITQLRNKL
A0A3B8NDZ9      DKQFNALVIELEEKKAEVVAYQKLLDEFDSPEAGALQEKWINTSHTLSLNPVITQLRNKL
A0A351HB98      DKQHNELMISAEEKKAEIETYQSMLDDFDSTDSKSIKALWVQTSESFSVNPVLTSLRQSL
A0A2G8DIK4      DKQYNELMISAEEKKAEIETYQSMLDDFDSNDSKSIKALWVQTSESFSVNPVLTSLRQSL
A0A421CM38      DKQYNELMISAEEKKAEIETYQSMLDDFDSNDSKSIKALWVQTSESFSVNPVLTSLRQSL
I2F2W0          DKQYNELMISAEEKKAEIETYQSMLDDFDSNDSKSIKALWVQTSESFSVNPVLTSLRQSL
A0A421CJA3      DNQYNELMISAEEKKAEIETYQSMLDDFDSDDSKSIKALWVQTSESFSVNPVLTSLRQNL
A0A2K1SRT1      DKQHNELMISAEEKKAEIETYQSMLDDFDSIDSKSIKALWVQTSESFSVNPVLTSLRQSL
A0A2T7N3K7      DKQHNELMISAEEKKAEIETYQSMLDDFDSIDSKSIKALWVQTSESFSVNPVLTSLRQSL
A0A318CQN7      DKQHNELMISAEEKKAEIETYQSMLDDFDSSDSKSIKALWVQTSESFSVNPVLTSLRQSL
A0A328IT51      DKQHNELMISAEEKKAEIETYQSMLDDFDSTDSKSIKALWVQTSESFSVNPVLTSLRQSL
A0A5D0S032      DEQYNSLQIQLEETLAEKESYGRLLDEFDSSEAEEIKQKWIKTSESLSRNPILSQLKSKL
C5CHA4          DQQYNNLQISMEEKIAQKKSYEELLKQFDSSEDKTFRDKWLKTSETLSRNPIIQQLKSKL
A0A660RD27      DSQLNNVNIQIDETKARIKAIKDLLSKTDQK---------IVSSETISMNPVVLQLKQKL
A0A328PVB3      DQQINTYQVQLQEANVRIQTLNSMLENMDQE---------IISSETISINPVVSNLRNQM
A0A2K1P7U2      DQQINTYQIQMEETKIRLQTLNDTLKSMDQE---------IISSETISINPVVSNLRNQI
A0A2S5EHY0      DQQINTYQIQMEETKIRLQTLNDTLKSMDQE---------IISSETISINPVVSNLRNQI
A0A4V3GR25      DQQINTYQIQMEETKIRLQTLNDTLKSMDQE---------IISSETISINPVVSNLRNQI
A0A421CPQ0      DQQINTYQIQMEETKIRLQTLNDTLKSMDQE---------IISSETISINPVVSNLRNQI
A0A2K1NSH7      DQQINTYQIQMEETKIRLQTLNDTLKSMDQE---------IISSETISINPVVSNLRNQI
A9BJS3          DQQINTYQIQMEETKIRLKTLNDTLKSMDQE---------IISSETISINPVVSNLRNQI
A0A0C7NW05      DQEINTYQVQLEQSKVRIEAINDLLKNIDQE---------IITSETISINPVVSNLRNQI
A0A2K1P2I4      DQQLNAYQVQLNGSKAKIDALNDVLKSMDQE---------IISSETISINPVVSNLRNQI
                * : *   :. .       :    *.  :           : :* :   **.: .*. . 

A0A2K1PI90      VNIQVQLAGLEGTKSPSDPEVLRLKEELNQAQEMLKNEIST--IVTSQVKTANPMYISLY
A0A1M7RT68      VDLQIQLSALLNTYSENDQQVKSLRKQIEETEKMLKNQVES--IVTSQVQTTDPNYASMY
A0A1E3G3X8      AELQVELAALLNNYSENDQRVRDTRKKIEETEKMLRNEVEK--IVTAQVQTLNPDYQNIY
A0A1M5RQU7      VEYRIELAGLTQTYSESDPKVLEIKEKISETEKLLKEEVAK--IVTSQVQTINPAYQELY
H2J8E1          INYRVELAGLVNVYSETDPKVKELKDKIAETEKLLKDEVSK--VVSSQVQTVNPAYQDIY
A0A0H2SBE1      INYKVELAGLTNIYSETDPKVKEIKDKIAETEKLLKEQVTK--IVTSQVKTINPAYQDIY
A0A0H2SAF7      INYKVELAGLTNIYSETDPKVKEIKDKIAETEKLLKEQVTK--IVTSQVKTINPAYQDIY
A0A1M4Y2U3      IDYKVELAGLTNIYPETDPKVKEIKDKIVETEKLLKNEVSK--IVSSQVQTINPAYQDIY
A0A0G2ZA83      AELEIELASLKQQYPITDPKVQAKLSEIAKTDELIKRETE-NFIRTGESQTLNPAYEEAL
A0A182C824      ADLEIELAALKQQYPTTDPKVQAKLTEIAKTDELIKKETE-NFIRTGESQTLNPAYEEAL
A0A101ID04      ALLKVDLAALEDQYPATDQRIRAKKAEIAATEKLIQEEIENEFIRTGEGMSLNPTYQTIL
A0A3B8NDZ9      ALLKVDLAALEDQYPATDQRIRAKKAEIAATEKLIQEEIENEFIRTGEGMSLNPTYQTIL
A0A351HB98      ATLQVELASLEEQYPKTDPRVRSKITEISKTESLIAEQIQNEFIISGQGMTLNPAYQQII
A0A2G8DIK4      ATLQVELASLEEQYPKTDPRVRSKITEISKTESLIEEQIQNEFITSGQGMTLNPAYQQIM
A0A421CM38      ATLQVELASLEEQYPKTDPRVRSKITEISKTESLIEEQIQNEFITSGQGMTLNPAYQQIM
I2F2W0          ATLQVELASLEEQYPKTDPRVRSKITEISKTESLIEEQIQNEFITSGQGMTLNPAYQQIM
A0A421CJA3      ATLQVELASLEEQYPKTDPRVRSKITEISKTESLIAEQIQNEFIVSGQGMTLNPAYQQII
A0A2K1SRT1      ATLQVELASLEEQYPKTDPRVRSKITEISKTESLIAEQIQNEFIVSGQGMTLNPAYQQII
A0A2T7N3K7      ATLQVELASLEEQYPKTDPRVRSKITEISKTESLIAEQIQNEFIVSGQGMTLNPAYQQII
A0A318CQN7      ATLQVELASLEEQYPKTDPRVRSKITEISKTESLIAEQIQNEFIISGQGMTLNPAYQQII
A0A328IT51      ATLQVELASLEEQYPKTDPRVRSKITEISKTESLIAEQIQNEFIISGQGMTLNPAYQQII
A0A5D0S032      VDLKIELASLRQQYTESDPKVVAKKTEIAETEKLISEQTK-EFILTGENQTLNPVYQEIL
C5CHA4          VELQVELAALRQQYPETDPRVRAKLTQIAETENLIKKETE-EFIRTGETQTLNPAYETAL
A0A660RD27      TDLNVELSGLLATYPETNSKVVAVKKKIAETEQLLKKEVEK--IITSQVQTINPVYSDLI
A0A328PVB3      VNIQVQLAGLEGTRSSNDPDVLRLKEELNQAQEMLRNEITT--IVTSQVKTSNPQYTSLY
A0A2K1P7U2      VNIQVQLAGLEGTKSPSDPEVLRLKEELNQAQEMLKNEIST--IVTSQVKTANPMYISLY
A0A2S5EHY0      VNIQVQLAGLEGTKSPSDPEVLRLKEELNQAQEMLKNEIST--IVTSQVKTANPMYISLY
A0A4V3GR25      VNIQVQLAGLEGTKSTSDPEVLRLREELSQAQEMLKNEIST--IVTSQVRTTNPQYNSLY
A0A421CPQ0      VNIQVQLAGLEGTKSPSDPEVLRLREELNQAQEMLKNEIST--IVTSQVKTANPMYTSLY
A0A2K1NSH7      VNIQVQLAGLEGTKSPSDPEVLRLREELSQAQEMLKNEIST--IVTSQVKTANPQYNSLY
A9BJS3          VNIQVQLAGLEGTKSPSDPEVLRLREELSQAQEMLKNEIST--IVTSQVKTANPQYSSLY
A0A0C7NW05      VNIQVQLAGIEGTKSANDPEVLKLKEQLFQAQEMLKKEINT--IVTSQLKSINPQYSSLY
A0A2K1P2I4      VNIQVQLAGIEGTKSPNDPEVLKLKEQLAQAQEMLKNEIAT--IVTSQVKTANPQYNSLY
                    ::*:.:    . .:  :     ::  ::.::  :     : :.:  : :* *    

A0A2K1PI90      SQLIQEQAGQQVLQGTIQSLTTLRNT-YQSQLKQLPALEQRLMNYEREVRVKENLYVLLL
A0A1M7RT68      SELIQSNTELLVYQSTISSIESIKSK-YEQKISTLPMLEQQLFELERDRKVKENLYSILL
A0A1E3G3X8      SQLIEAHAKYEMINSTIAAVERMREK-YTAKVAQLPAVEQQLLQLERDRKVKESLYSLLL
A0A1M5RQU7      TQLIEAQYKGEVYDSIIKSLNKLRDT-YQEKLSKLPLLEQKLLELNRDIKVKENLYTLLL
H2J8E1          LQLIEAQYQAEVLKATITALQKLKDS-YNRKFSRLPLLEQQLLELERDIKVKENLYTLLL
A0A0H2SBE1      LQLIEAQYTTEILKSTIQALTKLKET-YNQKFARLPLLEQQLLELERDIKVKENLYTLLL
A0A0H2SAF7      LQLIESQYTTEVIKSTIQALTKLKET-YNQKFAKLPLLEQQLLELQRDIKVKENLYTLLL
A0A1M4Y2U3      LQLIEAQYTTEVLKATIESLIKLKET-YNKKFAKLPLLEQQLLELQRDVKVKENLYTLLL
A0A0G2ZA83      INYISSNSSIQVLESRLKAVEELKAR-YEAELNRLPALEQRLLELQRQVTVKENLYTLML
A0A182C824      INYIGSTSSIQVLESRLQAVEKIKQG-YEKQLAQLPELEQRLLELQRQVTVKENLYTLML
A0A101ID04      TAVITSETSLQIIESTIQSVDMLRKT-YLDALAEIPRLEQQLLELQREVYISENLYTLLL
A0A3B8NDZ9      TAVITSETSLQIIESTIQSVDMLRKT-YLDALAEIPRLEQQLLELQREVYISENLYTLLL
A0A351HB98      TGVISSEAGFQILQASIQAVGLLRDQXYQSELRNLPAKEQQLLDLERQIAVKESLYTLLL
A0A2G8DIK4      TGVISSEAGFQILQASIQAVGLLRDQ-YQSELRSLPAKEQQLLDLERQIAVKESLYTLLL
A0A421CM38      TGVISSEAGFQILQASIQAVGLLRDQ-YQSELRSLPAKEQQLLDLERQIAVKESLYTLLL
I2F2W0          TGVISSEAGFQILQASIQAVGLLRDQ-YQSELRSLPAKEQQLLDLERQIAVKESLYTLLL
A0A421CJA3      TGVISSEAGFQILQASIQAVALLRDQ-YQSELRNLPAKEQQLLDLERQIAVKESLYTLLL
A0A2K1SRT1      TGVISSEAGFQILQASIQAVGLLRDQ-YQSELRNLPAKEQQLLDLERQIAVKESLYTLLL
A0A2T7N3K7      TGVISSEAGFQILQASIQAVGLLRDQ-YQSELRNLPAKEQQLLDLERQIAVKESLYTLLL
A0A318CQN7      TGVISSEAGFQILQASIQAVGLLRDQ-YQSELRNLPAKEQQLLDLERQIAVKESLYTLLL
A0A328IT51      TGVISSEAGFQILQASIQAVGLLRDQ-YQSELRNLPAKEQQLLDLERQIAVKESLYTLLL
A0A5D0S032      TGIISSESKIHVLEARSDAVEKLRKE-YEDQLSTLPKIEQKLLELQRKVTIKEKLYTLFL
C5CHA4          TGVISAESTIQILEARLKAVDRLRKE-YEKELSKLPTIEQQLLELQRQIAVKENLYTLLL
A0A660RD27      TELSSEEASLQVLIANKKAVEKIREE-YQNKIAQLPSIEQQLLEMQRDLKVKENLYMLLL
A0A328PVB3      SQLIQEEAKRQVLQGTIQSITTIRNN-YQNQLNQLPALEQRLMDFEREVKVKENLYVLLL
A0A2K1P7U2      SQLIQEQAGQQVLQGTIQSLTTLRNT-YQSQLKQLPALEQRLMNYEREVRVKENLYVLLL
A0A2S5EHY0      SQLIQEQAGQQVLQGTIQSLTTLRNT-YQSQLKQLPALEQRLMNYEREVRVKENLYVLLL
A0A4V3GR25      SQLIQEQARQQVLQGTIQSLTMLRII-YQSQLNQLPALEQRLMNYEREVRVKENLYVLLL
A0A421CPQ0      SQLIEEQARQQVLQGTIQSLTTLRNT-YQSQLNQLPALEQRLMNYEREVRVKENLYVLLL
A0A2K1NSH7      SQLIEEQARQQVLQGTIQSLTTLRNT-YQSQLNQLPALEQRLMNYEREVRVKENLYVLLL
A9BJS3          SQLIEEQARQQVLQGTIQSLTTLRNT-YQSQLNQLPALEQRLMNYEREVRVKENLYVLLL
A0A0C7NW05      SQLIEEQANLQVIQGTIQALTSIRNT-YQSELVKLPALEQKLMDYEREVKVKENLYVLLL
A0A2K1P2I4      AQLIEEQTRQQVTQSTIQSITAIRDT-YQTQLNKLPALEQKLMDYQREVQVKENLYVLLL
                           :  .   ::  :.   *   .  :*  **.*:: :*.  :.*.** ::*

A0A2K1PI90      EKLEEAKIAEAGVIGTASIIDPAFVSPNAVKPNKTLTAAIGGILGIFLGILVVFLIEYLD
A0A1M7RT68      EKLEETRISEAGVVGRATLVDSAITPTQPVKPNKKLTLAIGGVLGIFLGILLVFLLEAFD
A0A1E3G3X8      EKLEETRISEAGVIGRATIVDPAITPTVPVKPNKRLLLAVASVLGFFLGIMVIFMVESLD
A0A1M5RQU7      EKLEETRIAEAGVVGTASIIDKAIVPDKPVKPNKKLTLAIGGVLGIFLGILFVFLVEYAD
H2J8E1          EKLEETRIAEAGVIGTAKLIDSAIVPDKPIKPNKKLTAAIGLVLGFFLGILVIFIIEYAD
A0A0H2SBE1      EKLEETRIAEAGVIGTAKLIDSAITPDKPIKPNKKLTAAIGLVLGIFLGILVAFIIEYAD
A0A0H2SAF7      EKLEETRIAEAGVIGTAKLIDSAITPDKPIKPNKKLTAAIGGVLGIFLGILVAFIIEYAD
A0A1M4Y2U3      EKLEETRIAEAGVIGTAKLIDSAITPDKPIKPNKKLTAAIGGVLGIFLGILIAFIMEYAD
A0A0G2ZA83      EKLEEAKISEAAVVGNAAVVDYAKPPKVPVKPNKKLSLAIGSVLGIFLGMLTVFLVEYLD
A0A182C824      EKLEEAKISEAAVVGNAAVVDYAKPPRIPVKPNKKLSLAIGGVLGIFLGMLTVFLVEYTD
A0A101ID04      ERLEEAKISEAAVIGNAAVIDSALIPSAPVKPNRRLSLAIGGVLGIFLGMLGVFLAEYLD
A0A3B8NDZ9      ERLEEAKISEAAVIGNAAVIDSALIPSAPVKPNRRLSLAIGGVLGIFLGMLGVFLAEYLD
A0A351HB98      ERLEEAKISEAAVVGNAAIVDPATVPQSPVKPNKKLSLAIGGVLGIFLGMLMVFLAEYLD
A0A2G8DIK4      ERLEEAKISEAAVVGNAAIVDPATVPQSAVKPNKKLSLAIGGVLGIFLGMLMVFLAEYLD
A0A421CM38      ERLEEAKISEAAVVGNAAIVDPATVPQSAVKPNKKLSLAIGGVLGIFLGMLMVFLAEYLD
I2F2W0          ERLEEAKISEAAVVGNAAIVDPATVPQSAVKPNKKLSLAIGGVLGIFLGMLMVFLAEYLD
A0A421CJA3      ERLEEAKISEAAVVGNAAIVDPATVPQSPVKPNKKLSLAIGGVLGIFLGMLMVFLAEYLD
A0A2K1SRT1      ERLEEAKISEAAVVGNAAIVDPATVPQSPVKPNKKLSLAIGGVLGIFLGMLMVFLAEYLD
A0A2T7N3K7      ERLEEAKISEAAVVGNAAIVDPATVPQSPVKPNKKLSLAIGGVLGIFLGMLMVFLAEYLD
A0A318CQN7      ERLEEAKISEAAVVGNAAIVDPATVPQSPVKPNKKLSLAIGGVLGIFLGMLMVFLAEYLD
A0A328IT51      ERLEEAKISEAAVVGNAAIVDPATVPQSPVKPNKKLSLAIGGVLGIFLGMLMVFLAEYLD
A0A5D0S032      EKLEEAKIEEAAVVGNAAVVDSAIVPNSPVKPNKKLSLAIGGVLGIFLGMLAVFLMEYLD
C5CHA4          ERLEEARISEAAVVGNAAIIDPARVPRYPVKPNKKLSLAIGGVLGIFLGMLAVFLVEYAD
A0A660RD27      EKLEEARIAEAGVIGNAQIVDKANVPTIPVKPNKKLTLAIGGVLGIFLGILIVFIVEYLD
A0A328PVB3      EKLEEAKIAEAGVIGTANIIDSAFVSPNPVKPNKTLTAAIGGVLGIFLGILVIFLVEYMD
A0A2K1P7U2      EKLEEAKIAEAGVIGTANIIDPAFVSPNAVKPNKTLTAAIGGILGIFLGILVVFLIEYLD
A0A2S5EHY0      EKLEEAKIAEAGVIGTASIIDPAFVSPNAVKPNKTLTAAIGGILGIFLGILVVFLIEYLD
A0A4V3GR25      EKLEEAKIAEAGVIGTANIIDPAFVSPNPVKPNKPLTAAIGGVLGIFLGILVVFLIEYLD
A0A421CPQ0      EKLEEAKIAEAGVIGTANVIDPAFVSSNPVKPNKTLTAAIGGVLGIFLGILVVFLIEYLD
A0A2K1NSH7      EKLEEAKIAEAGVIGTANIIDPAFVSPNPVKPNKTLTAAIGGVLGIFLGILVVFLIEYLD
A9BJS3          EKLEEAKIAEAGVIGTANIIDPAFVSPNPVKPNKTLTAAIGGVLGIFLGILVVFLIEYLD
A0A0C7NW05      EKLEEAKIAEAGVIGTADIIDLAFVSPTPVKPNKTLTVVISGVLGIFLGILVVFLIEYMD
A0A2K1P2I4      EKLEEARIAEAGVIGTANIIDSAYISPNPVKPNKTLTAAIGGVLGIFLGILVVFLMEYMD
                *.***:.* **.*:* * ::* *  .  .:***. *  .:. :**:***::  *: *  *

A0A2K1PI90      KKVKDENELKMIVKGYPVLGRIPHLHVD---NETKDELIVLRDPVSPISEAYKMLASNIN
A0A1M7RT68      KTISDEEYIKHMLKGSPVLGRIPNIEFP-ETSESP-ELVVVNSPTSPQAEALKLTATNIE
A0A1E3G3X8      KTITDEEYIKHLLKDKPILGRIPEIQFP-AGSEHP-ELVVLNSPTSPGAESLKLVSTNIE
A0A1M5RQU7      KSIKDEEELKRIAKGKVILGRIPRFELK-KDLKNP-ELIVLNSPTSPQAESLKLVSTNIN
H2J8E1          KSIKDEEEIKRMAKNKIILGRIPTFEQN-KEFDNP-ELIVLNSPTSPISESIKLTAANIN
A0A0H2SBE1      KSIKDEEEIKRMAKGKIVLGRIPTFEKK-KEYENP-ELIVLNSPTSPVSESVKLTATNII
A0A0H2SAF7      KSIKDEEEIKRMAKGKTILGRIPTFEMK-KEYSNP-ELIVLNEPISPVAESIKLTSANIN
A0A1M4Y2U3      KSIKDEDEIKRMAKGKIILGRIPTFEMK-SKYMNS-ELVVLNEPISPVAESIKLTSANIN
A0A0G2ZA83      KTLKSEEEIERYSG-LSVIGRVPEI--E-NLSESEDELYVRIHPTAPQSEAIKLAASNIS
A0A182C824      KTLKSEEEIERYSG-LNVIGRIPEI--E-DLTENEDELYVRSHPTAPQSEAIKLAASNIS
A0A101ID04      KTLKSEEDIERVAS-EPILGRIPLA--N-GIRN---ELFVQSDPTSPPSEAVKIASSNIS
A0A3B8NDZ9      KTLKSEEDIERVAS-EPILGRIPLA--N-GIRN---ELFVQSDPTSPPSEAVKIASSNIS
A0A351HB98      KTLKTEEEIERFSR-QPIIGRIPSI--E-GTSE---EMYVEKNPTAPSSESIKLAASNLS
A0A2G8DIK4      KTLKTEEEIERFSR-QPIIGRIPNI--E-GASE---EMYVEKNPTAPSSESIKLAASNLS
A0A421CM38      KTLKTEEEIERFSR-QPIIGRIPNI--E-GASE---EMYVEKNPTAPSSESIKLAASNLS
I2F2W0          KTLKTEEEIERFSR-QPIIGRIPNI--E-GASE---EMYVEKNPTAPSSESIKLAASNLS
A0A421CJA3      KTLKTEEEIERFSR-QPIIGRIPNI--E-GTRE---EMYVEKNPTAPSSESIKLAASNLS
A0A2K1SRT1      KTLKTEEEIERFSR-QPIIGRIPSI--E-GTSE---EMYVEKNPTAPSSESIKLAASNLS
A0A2T7N3K7      KTLKTEEEIERFSR-QPIIGRIPSI--E-GTSE---EMYVEKNPTAPSSESIKLAASNLS
A0A318CQN7      KTLKTEEEIERFSR-QPIIGRIPSI--E-GTSE---EMYVEKNPTAPSSESIKLAASNLS
A0A328IT51      KTLKTEEEIERFSR-QPIIGRIPSI--E-GTSE---EMYVEKNPTAPSSESIKLAASNLS
A0A5D0S032      KTLKTEEEIERYSG-EKIIGRIPLITED-ELTN---ELVVKNNPVSPQAEAIKLAAGNIG
C5CHA4          KTLKTEEEIERYSG-VQILGRIPQI--Q-DLKD---ELHVKASPISPESEAIKMAASNIS
A0A660RD27      KTLKGEEEIQRIVPEVPIVGRIPSYEPD--KRKVASELVVKNHPTSPVSESFKLIATNLL
A0A328PVB3      KKIKDEKELKSVVKDKPILGRIPHFRIE---KGLMNELIVLRDPVSPISEAYKMLATNIN
A0A2K1P7U2      KKVKDENELKMIVKGYPVLGRIPHLHVD---NETKDELIVLRDPVSPISEAYKMLASNIN
A0A2S5EHY0      KKVKDENELKMIVKGYPVLGRIPHLHVD---NETKDELIVLRDPVSPISEAYKMLASNIN
A0A4V3GR25      KRVKDENELKMIVKGYPVLGRIPHLHMG---GEENDELIVLRDPVSPISEAYKMLSTNIN
A0A421CPQ0      KKVKDENELKMIVKGYPVLGRIPHLHVD---NETNDELIVLRDPVSPVSEAYKMLATNIN
A0A2K1NSH7      KRVKDENELKMIVKGYPVLGRIPHLHVD---NETNDELIVLRDPVSPISEAFKMLATNIN
A9BJS3          KKVKDENELKMIVKGYPVLGRIPHLHVD---NETNDELIILRDPVSPISEAYKMLATNIN
A0A0C7NW05      KKLKDENELKSIIKGVPVLGRIP----SFEINQESGELPVLKDPVSPISESYKMLATNIS
A0A2K1P2I4      KRLKEESDVKRILKNAPILGRIPHVNYNYDEEESKRELIVLNDPVSPISEAYKLLTTNID
                * :. *. ::       ::**:*             *: :   * :* :*: *: : *: 

A0A2K1PI90      FSNAKEPNVITFSSGGPAEGKTMTASNVAISYAQSGNKTLLIDADMRRPRVERILN----
A0A1M7RT68      YSNTPAPKIVAVTSSGPGEGKTLIAANIALAYAQNGNRTLLLDLDMRKPRIEKVLG----
A0A1E3G3X8      YSDTVPPKAVGITSAGPGEGKTFLAANIAISYAQNGLRTLVLDLDMRKPRVEKVFG----
A0A1M5RQU7      YSVTPEPKVIAISSSGPGEGKTITAANLAISYAQNGVNTLLLDLDMRKPRVEKVLG----
H2J8E1          YSTSPEPKVIAITSSGPGEGKTVSSANLAISYAQNGLKTLLIDIDMRKPRIEKALG----
A0A0H2SBE1      YSVTPEPKVIAVTSSGPGEGKTVSSANLAISYAQNGLKTLLIDIDMRKPRVEKALG----
A0A0H2SAF7      YSVTPEPKVIAVTSAGPGEGKTITSANLAISYAQNGLKTLLIDIDMRKPRVEKALG----
A0A1M4Y2U3      YSVTPEPKTIAITSAGPGEGKTVSAANLAISYAQNGLKTLLIDIDMRKPRIEKVLG----
A0A0G2ZA83      FLMGDEKKAIAITSVSPGEGKSFVAANVAFYMASSGYRTVLVDLDMRRPRVEKILGLNKK
A0A182C824      FLIGDEKKAIAMTSVSPSEGKSFVAANTAFYLASSGYKTILIDLDLRRPRVEKILKLDSK
A0A101ID04      FTLGDG-KVIGVTSPLPGEGKTTVAANIAYSYAMSGQRVLLVDLDMRKPRIEQLLGM---
A0A3B8NDZ9      FTLGDG-KVIGVTSPLPGEGKTTVAANIAYSYAMSGQRVLLVDLDMRKPRIEQLLGM---
A0A351HB98      FTMGEG-KTVAVTSVLPTEGKSFVIANIAYSMANSGQRVVLLDLDLRRPRVEKILK----
A0A2G8DIK4      FTMGEG-KSVAVTSVLPTEGKSFVIANLAYSMANSGQRVILLDLDLRRPRVEKILK----
A0A421CM38      FTMGEG-KSVAVTSVLPTEGKSFVIANLAYSMANSGQRVVLLDLDLRRPRVEKILK----
I2F2W0          FTMGEG-KSVAVTSVLPTEGKSFVIANLAYSMANSGQKVILLDLDLRRPRVEKILK----
A0A421CJA3      FTMGEG-KTVAVTSVLPTEGKSFVIANIAYSMANSGQRVVLLDLDLRRPRIEKILK----
A0A2K1SRT1      FTMGEG-KTVAVTSVLPTEGKSFVIANIAYSMANSGQRVVLLDLDLRRPRVEKILK----
A0A2T7N3K7      FTMGEG-KTVAVTSVLPTEGKSFVIANIAYSMANSGQRVVLLDLDLRRPRVEKILK----
A0A318CQN7      FTMGEG-KTVAVTSVLPTEGKSFVIANIAYSMANSGQRVVLLDLDLRRPRVEKILK----
A0A328IT51      FTMGEG-KTVAVTSVLPTEGKSFVIANIAYSMANSGQRVVLLDLDLRRPRVEKILK----
A0A5D0S032      FMLQDN-KILGITSVTPGEGKTFISANIAYAFALKGNRTLLIDFDMRRPRVEKMLKLRSV
C5CHA4          FILGDK-KSFAITSVSPSEGKSFIAANLAYSMASNDTKVILVDLDMRRPRVEKILKL---
A0A660RD27      FMDGAKKQVVAVTSPGPDEGKTFIAANVAVTFAQNGFKTLMLDLDMRKPRIERVFGL---
A0A328PVB3      FSDTKEPNVISFSSSGPAEGKTITATNVAISYAQSGKKTLLMDADMRRPRVEKILGI---
A0A2K1P7U2      FSNAKEPNVITFSSGGPAEGKTMTAANVAISYAQSGNKTLLIDADMRRPRVERILNL---
A0A2S5EHY0      FSNAKEPNVITFSSGGPAEGKTMTAANVAISYAQSGNKTLLIDADMRRPRVERILNL---
A0A4V3GR25      FSNAKEPNVIAFSSGGPAEGKTMTAANVAISYAQSGNKTLLIDADMRRPRVEKILNL---
A0A421CPQ0      FSNAKEPNVITFSSSGPSEGKTMTATNVAISYAQSGNKTLLIDADMRRPRVEKILNL---
A0A2K1NSH7      FSNAKEPNVITFSSGGPSEGKTMTAANVAISYAQSGNKTLLIDADMRRPRVEKILNL---
A9BJS3          FSNAKEPNVITFSSGGPAEGKTITAANVAISYAQSAKKTLLIDADMRRPRVEKILNL---
A0A0C7NW05      FSTTKEPNTICFSSAGPSEGKTITASNVAIFYAQNGKKTLLMDGDLRKPRVDKIMRI---
A0A2K1P2I4      FSSSKEPNVICFSSPGPSEGKTTTAANVAISYAQIGKKTLLMDADMRRPRIEKIFEL---
                :      : . .:*  * ***:   :* *   *    ..:::* *:*.**::. :     

A0A2K1PI90      -LKSKNVGLVNHLLRGVSIEQSVKKPFESLNNFFVLPVGTLPPNPTSILTSNEFKDLLDK
A0A1M7RT68      -IERINIGVTNHLLKDIPVER-IIVNYG--ENIDIIPVGPIPPNPTALLTSKKMEDFIQK
A0A1E3G3X8      -IERAHAGIVNHILKNAPIED-ITIKYM--ENLDIIPVGPIPPNPTALLTSKKMEEILQI
A0A1M5RQU7      -LKRFNMGVVNHILKDVPIEK-ITQNYM--ENLDIIPVGPLPPNPTVVLTSKKFKELINT
H2J8E1          -LERFNIGLVNHILKDVPIER-ITQNYM--ENLDIIPVGPIPPNPTALLTSKKFREFFNV
A0A0H2SBE1      -LERFNIGLVNHILKNVPIER-ITQNYM--ENLDVIPVGPLPPNPTALLTSKQFGELINT
A0A0H2SAF7      -LERFNIGLVNHILKNVPIER-ITQNYM--ENLDVIPVGPLPPNPTALLTSKQFGELINT
A0A1M4Y2U3      -LERFNIGIVNHILKDVPIER-ITQNYM--ENLDVIPVGPLPPNPTALLTSKKFGEVMDK
A0A0G2ZA83      -NKKNDRGITDLIKGDIKLEEAVIKDYD--TNLDVIPMGSRATNPTLLLSSKKLDELLKV
A0A182C824      --KTDGKGITDLIKGEVDLNQVIVKNYD--ENLDVIPVGSRATNPTLLLSSKTLEAILDQ
A0A101ID04      -DDRSSEGIVDIVLDNRNVGD-LIIKYA--ENLDVLPVGKIPPNPTVLLSSKKIAALIEG
A0A3B8NDZ9      -DDRSSEGIVDIVLDNRNVGD-LIIKYA--ENLDVLPVGKIPPNPTVLLSSKKIAALIEG
A0A351HB98      -AGKRTKGAVDVIMGTASIDE-VVENYA--ENMDFIGVGSIPPNPTIVLSSKRIDTLLSE
A0A2G8DIK4      -AGKITKGAVDVIMGNTTVDE-VIQHYA--DNMDFIAVGTIPPNPTIVLSSKNVDALLSE
A0A421CM38      -AEKITKGAVDVIMGNTTIDE-VIQHYA--VNMDFIAVGTIPPNPTIVLSSKNIDALLSE
I2F2W0          -AEKITKGAVDVIMGNTTIDE-VIQHYA--VNMDFIAVGTIPPNPTIVLSSKNIDALLSE
A0A421CJA3      -AGKRSKGAVDVIMGTASIDE-VVENYA--ENMDFIGVGSIPPNPTIVLSSKKIDTFLSE
A0A2K1SRT1      -AGKRTKGAVDVIMGTASIDD-VVENYA--ENMDFIGVGIIPPNPTIVLSSKRIDTLLSE
A0A2T7N3K7      -AGKRTKGAVDVIMGTASIDD-VVENYA--ENMDFIGVGIIPPNPTIVLSSKRIDTLLSE
A0A318CQN7      -AGKRTKGAVDVIMGTASIDE-VVENYA--ENMDFIGVGSIPPNPTIVLSSKRIDTLLSE
A0A328IT51      -AGKRTKGAVDVIMGTASIDE-VVENYA--ENMDFIGVGSIPPNPTIVLSSKRIDTILSE
A0A5D0S032      NGSGELKGIADLLTDDITLDE-AIIHYD--ENLDVIPHGNIPPNPTILLSSRKLDEQLKL
C5CHA4          -NGRKTKGIVDVVLGKITLNE-AILNYE--GVFDVLPVGSIPPNPTVILSSKKLTEIFEE
A0A660RD27      -GEKAKVGIVNHIFRGIPIEEIT---IHFMENLDIIPVGPLPPNPTIVLTNPKFSETLER
A0A328PVB3      -KTK-D-GLVNHLLRHMPIEQVIQKPIEELENFSVLPVGVLPPNPTTILTSNEFKDLLDR
A0A2K1P7U2      -KSK-NVGLVNHLLRGVSIEQSVKKPFESLNNFFVLPVGTLPPNPTSILTSNEFKDLLDK
A0A2S5EHY0      -KSK-NVGLVNHLLRGVSIEQSVKKPFESLNNFFVLPVGTLPPNPTSILTSNEFKDLLDK
A0A4V3GR25      -KSK-NVGLVNHLLRGASIEQSVIKPFEFLDNFFVLPVGTLPPNPTSILTSNEFKDLLDE
A0A421CPQ0      -KSK-NVGLINHLLRGVSIEQSIKKPFASLDNFYVLPVGTLPPNPTTILTSNEFKDLLDK
A0A2K1NSH7      -KSK-NEGLVNYLLRGASIEQSVKKPFETLDNFFVLPVGTLPPNPTTVLTSNEFRDLLDK
A9BJS3          -KSK-NEGLVNYLLRGASIEQSVKKPFETLDNFFVLPVGTLPPNPTTVLTSNEFKELLDK
A0A0C7NW05      -KNK-NLGLVNYLMRRVPLEKILFKPVESLPNFDVLPAGVLPPNPTSLLTSNEFLELLQT
A0A2K1P2I4      -KSR-NVGLVNHLLRGVPLERAIQSPIEGLDTLDILPVGVIPPNPTAVLTSNEFKIMLEK
                       *  : :     :             : .:  *  ..*** :*:.  .   :. 

A0A2K1PI90      LKEYYDKVIIDLPPIMVAPDAMIASRYSDGLVLVTRYGQTLKPTLKAAIENITTSGVKLI
A0A1M7RT68      LSEKYERIVIDLPPILAAADSLIVSKYTDGIVLVVRAGKTQKPSLRVAYENIQTSSAKLL
A0A1E3G3X8      FKERYDRIVVDLPPVLAAADAVIVSKYIDCLVLTVRAGKTQKPSLRVAYENIVTSASKLL
A0A1M5RQU7      LKEKYERIVIDLPPILAAADALIVSKHTDGMVLVVRAGTTQKHSLRIAIENIETSGANLL
H2J8E1          LRQKYDKIIIDLPPILAAADALIVSKHTDGLILVVRAGKTQKHSLKVTLENITTSGNNIL
A0A0H2SBE1      LKEKYDKIVIDLPPILAAADALIVSKHSDGLILVVRAGKTQKHSLKVALENITTSDNNLL
A0A0H2SAF7      LKEKYDKIIVDLPPILAAADALIVSKHTDGLILVVRAGKTQKHSLKIALENVITSDNTLL
A0A1M4Y2U3      LKEKYDKIIIDLPPILAAADALIVAKHTDGLILVVRAGKTQKHSLKIALENIITSDNKLL
A0A0G2ZA83      LKERYDRIIIDTPPALVTSDVSLIANKLDGIVLVVRPGVALRDGLRITINNLQTVGASLL
A0A182C824      LKERYDRIVVDTPPALVTSDVSLIASKLDGIVLVVKPGIALKDGLRITINNLRTVGAPLL
A0A101ID04      LKNEYDRIIVDLPPAVITSDVALVGHLFDGVLMVTQPGTTLRDALRMAISNLKTSGAKVL
A0A3B8NDZ9      LKNEYDRIIVDLPPAVITSDVALVGHLFDGVLMVTQPGTTLRDALRMAISNLKTSGAKVL
A0A351HB98      LKQRYDRVLIDMPPAVVTSDVSLVGNKLDGIVLVVRPGRAIKDGLRIVVENLKTVGVKIL
A0A2G8DIK4      LKQRYDKVLIDMPPAVVTSDVSLIGNKLDGIILVVRPGRAIKDGLRIVVENLKTVGIKIF
A0A421CM38      LKQRYDKVLIDMPPAVVTSDVSLIGNKLDGIVLVVRPGRAIKDGLRIVVENLKTVGIKIL
I2F2W0          LKQRYDKVLIDMPPAVVTSDVSLIGNKLDGIVLVVRPGRAIKDGLRIVVENLKTVGIKIL
A0A421CJA3      LKQRYDRVLIDMPPAVVTSDVSLVGNKLDGIVLVVRPGRAIKDGLRIVVENLKTVGVKIL
A0A2K1SRT1      LKQRYDRVLIDMPPAVVTSDVSLVGNKLDGIVLVVRPGRAIKDGLRIVVENLKTVGVKIL
A0A2T7N3K7      LKQRYDRVLIDMPPAVVTSDVSLVGNKLDGIVLVVRPGRAIKDGLRIVVENLKTVGVKIL
A0A318CQN7      LKQRYDRVLIDMPPAVVTSDVSLVGNKLDGIVLVVRPGKAIKDGLRIVVENLKTVGVKIL
A0A328IT51      LKQRYDRVLIDMPPAVVTSDVSLVGNKLDGIVLVVRPGKAIKDGLRIVVENLKTVGVKIL
A0A5D0S032      IKERYDKIIVDTPPALITSDVSQLAHKLDGLSIVVRPGLALRDGLKISTQNLKNIGVNIF
C5CHA4          LKKRYDTIVIDMPPAMVTSDVSMVGNKFDGVLLVVKPGTTPRDGLRIAVQNLRTVNINVL
A0A660RD27      LKDRYDKIVIDLPPVLAAADPLIVGKHANGILLVVRAAMTQRSSLKIAFENIKTSGNRLL
A0A328PVB3      LKEYYEKIVIDLPPIMVAPDAVIASRYTDGLVLVTRYGQTMRPTLKSAYENILTSGTNII
A0A2K1P7U2      LKEYYDKVIIDLPPIMVAPDAMIASRYSDGLVLVTRYGQTLKPTLKAAIENITTSGLKLI
A0A2S5EHY0      LKEYYDKVIIDLPPIMVAPDAMIASRYSDGLVLVTRYGQTLKPTLKAAIENITTSGLKLI
A0A4V3GR25      LKEYYDKIIIDLPPIMVAPDAMITSRYSDGLVLVTRYGQTLKPTLKAAVENITTSGVKLI
A0A421CPQ0      LKEYYDKVIIDLPPIMVAPDAMIASRYSDGLVLVTRYGQTLKPTLKAAIENITTSGVKLI
A0A2K1NSH7      MKEYYDKVIIDLPPIMVAPDAMIASRYSDGLVLVTRYGQTLKPTLKAAIENITTSGVKLI
A9BJS3          LKEYYDKIIIDLPPIMVAPDAMIASRYSDGLVLVTRYGQTLKPTLKAAIENITTSGVKLI
A0A0C7NW05      LKEHYEKIIIDLPPIMVAPDAQIVSRYSDGLILVTRYNGTLKPMLKVAYENIVSSEVKLL
A0A2K1P2I4      LKEQYEKIIIDLPPVLVSSDSVIASRYSDGIVLITRINGTIKTGLRNAYDNINVSGVKLL
                : . *: :::* ** : :.*    .   : : : ..   : .  *.   .*:      ::

A0A2K1PI90      GTVINDVNEKSSNYYYYYY-YYYSDDGDKSKTKK--------RRRKTRT-----------
A0A1M7RT68      GAVINDITANQMGYYYYYYYYYYTTEGKKKKKRR--------KSKEK-------------
A0A1E3G3X8      GAVINGIGEKHMGYYYYYYYYYTQDGKRKKKVSR--------RRKQINQTKKVLGGLIND
A0A1M5RQU7      GIIINDINEKSSNYYYYYYYYYYDEEGGKKKRRF--------KRHKK-------------
H2J8E1          GLIINDINEKSSN-YYYYYYYYYQDGEKKKRRKH--------KK----------------
A0A0H2SBE1      GLIINDINEKSSNYYYYYYYYYYQDGQKTKRKKN--------KKNKY-------------
A0A0H2SAF7      GLIIDDINEKNSG-YYYYYYYYYEDGQKKKRKKN--------KKNKN-------------
A0A1M4Y2U3      GLVIDDINEKNSGYYYYYYYYYYEDGQKKKRKKE--------KKNGIIK-----------
A0A0G2ZA83      GVLVNGVNQQTSGYYHYYYYYYYSEGGKKRKRKT--------KVDDKI------------
A0A182C824      GVLVNGVNQHTSGYYH-YYYYYYGEKGKKKKRGH--------KEEQQV------------
A0A101ID04      GFVVNGVTVKTSGYYYHYY-YYHYSEGTKKRKEH--------RKVR--------------
A0A3B8NDZ9      GFVVNGVTVKTSGYYYHYY-YYHYSEGTKKRKEH--------RKVR--------------
A0A351HB98      GVIVNGVDEKNSSYYYHYY-YYYNEEGKRKKRRK--------RTSXDVSGNNVAFWQAMK
A0A2G8DIK4      GVIVNGVDEKNSSYYYHYY-YYYNEEGKRQKRRK--------RTKK--------------
A0A421CM38      GVIVNGVDEKNSSYYYHYY-YYYNEEGKRQKRRK--------RTKK--------------
I2F2W0          GVIVNGVDEKNSSYYYHYY-YYYNEEGKRQKRRK--------RTKK--------------
A0A421CJA3      GVIVNGVDEKNSSYYYHYY-YYYNEEGKKQKRRK--------RKEK--------------
A0A2K1SRT1      GVIVNGVDEKNSSYYYHYY-YYYNEEGKRKKRRK--------RTSK--------------
A0A2T7N3K7      GVIVNGVDEKNSSYYYHYY-YYYNEEGKRKKRRK--------RTSK--------------
A0A318CQN7      GVIVNGVDEKNSSYYYHYY-YYYNEEGKRKKRRK--------RTSK--------------
A0A328IT51      GVIVNGVDEKNSSYYYHYY-YYYNEEGKRKKRRK--------RTSK--------------
A0A5D0S032      GIIINGAEKHSSSYYYY---YYYSEKGKKKRRRKTKNILDYFRGNK--------------
C5CHA4          GLLVNGVDEKTSSYYYYYYHYYYTQDGTKKKIRRKKSR----RTGE--------------
A0A660RD27      GIVVNDISQKYSAYYYYYY-YYYTKTGEKVKRKK--------R-KKLEESLMNTFFRRKK
A0A328PVB3      GTVINDVDEKSSNYYYYYY-YYYYSENSDESKKK--------E-KKSKNP----------
A0A2K1P7U2      GTVINDVNEKSSN--YYYY-YYYSDDGEKSKERR--------R-RSKTRT----------
A0A2S5EHY0      GTVINDVNEKSSN--YYYY-YYYSDDGEKSKERR--------R-RSKTRT----------
A0A4V3GR25      GTVINDVNEKSSN-YYYYY-YYYSDDGDKSKKKR--------R-RRKTRT----------
A0A421CPQ0      GTVINDVNEKSSNYYYYYY-YYYSDDGDKSKTKR--------R-RRKTRT----------
A0A2K1NSH7      GTVINDVNEKSSN-YYYYY-YYYSDDGDKSKTKR--------R-RRKTRT----------
A9BJS3          GTVINDVNEKSSNYYYYYY-YYYSDDGDKSKTKR--------R-RRKTRT----------
A0A0C7NW05      GTVIVDIDEKTSN-YYYYY-YYYSDDGKKVKKRK--------RIDTTLKN----------
A0A2K1P2I4      GTVINDLNVQSSN-YYYYY-YYYSEDGEKKKRRK--------R-RTTVND----------
                * :: .   :     :    **                                      

A0A2K1PI90      -----
A0A1M7RT68      -----
A0A1E3G3X8      LLKRK
A0A1M5RQU7      -----
H2J8E1          -----
A0A0H2SBE1      -----
A0A0H2SAF7      -----
A0A1M4Y2U3      -----
A0A0G2ZA83      -----
A0A182C824      -----
A0A101ID04      -----
A0A3B8NDZ9      -----
A0A351HB98      TTY--
A0A2G8DIK4      -----
A0A421CM38      -----
I2F2W0          -----
A0A421CJA3      -----
A0A2K1SRT1      -----
A0A2T7N3K7      -----
A0A318CQN7      -----
A0A328IT51      -----
A0A5D0S032      -----
C5CHA4          -----
A0A660RD27      -----
A0A328PVB3      -----
A0A2K1P7U2      -----
A0A2S5EHY0      -----
A0A4V3GR25      -----
A0A421CPQ0      -----
A0A2K1NSH7      -----
A9BJS3          -----
A0A0C7NW05      -----
A0A2K1P2I4      -----
                     

© 1998-2020Legal notice