BYKdb

Dataset for cluster tad of phylum proteobacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

29 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F3CAY8      ------------------------MTVMNRPSLDFHQDSR-IDLAAVLRMLFDHKALILW
G7EJX5      ---------------------------MNQTNQNLKSDDEVIELGIYINVIKRAKWRILS
H8YYB8      ------------------------------------MEEQLLSLDDYIAILKRRKWQLII
E9TE87      ------------------------MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIG
C0QCJ1      -------------------------------MQQIQQNQLPITPAQIIDILIRRRWIIVI
I5B297      -------------------------------MADPFQSQTQIKPDYIIDVLIRGRWFLIV
C7LPS4      -----------------------------------MNHELYQQFERYARILLQRKRVVVV
Q314L4      ----------------------------MNTMLDDVEAGGGLDILRYIRLLWEHALAFWL
Q39U16      ------------------------------------MVSKTEELNKYLKMLMKRRYLFIV
F0JCB9      ---------------------------MTDNKLETPGAEASFDVMHYVQLVGNHRGLFVF
G7QCG0      ------------------------------------MSAFLKEFHHYKQLIYLYKELFLA
I2Q342      ------------------------------------MSAFLKEFHHYKRLIYLYKELFLA
Q74BQ7      ------------------------------------MQQSEFDYRHYLTLIVARKRLFVV
B5EA80      ------------------------------------MQSPETEYKKYLQLLISNKERFVV
C6DZX6      ------------------------------------MQSPETEYKKYLQLLFSNKERFVV
A1ARV9      ------------------------------------MSDSEFDYKKYLELIVRKKELFVK
E8WSZ4      --------------------------------------MQESEYKKYTQLIARRKEFFVV
A5G425      -----------------------------------MSTTNELDYKKYLMLIDKKKKLFII
B9M2X7      -----------------------------------MPTTNDFDYKRYLNLVKQRKTLFLV
G8AU95      MNSSIGKGGTLPGHEAHASVLPDSLLQSGAAESSDVRSRQEATVFATLAVLWRRKLLLLT
F0G6H6      -----------------------MSHLTMPESRGGPTARPPHPFRRYWGMLYGGRRTIVA
A3W0H6      -----------------------MSAI--------------QSFPDLIRLLHRKLWLIVL
A3K8W6      -----------------------MSQF--------------QSVGEVFAALRRRAWVILG
Q0FMP1      -----------------------MNQF--------------QSIGEVLSALKRRALLILL
S9QRP2      -----------------------MTQF--------------QSIESVFAALRRRAWIIIL
F4SM98      --------------------------MPLIKNKKLDKDADEIDLGRIIGELIDHRKLIIA
G5SDT9      -------------------------MTEKAKQSAAVTGSDEIDIGRLVGTVIEARWWVLG
G5LQM7      -------------------------MTEKVKQSAAATGSDEIDIGRLVGTVIEARWWVLG
G5Q4J1      -------------------------MTEKVKQSAAVTGSDEIDIGRLVGTVIEARWWVLG
                                                              :      .  

F3CAY8      TVSLFFLIGLGYAILATPVYQATAMIQIEPR-----------------------------
G7EJX5      FAIVVTLLAIMVTLTLVPKYTATATLLIEAEQTKAVSFEEVYG------------LDSNK
H8YYB8      PAVLLSIVGMITAVVLPPTYRSTATILIEQQEIP-----DELVRSTV--------T----
E9TE87      ITAVFALCAVVYTFFATPIYSADALVQIEQNSGN-----SLVQDIGS--------ALANK
C0QCJ1      PLCITLTVGLYLALTSPRTYMAETSILVQAQTVP-----GNYVKSIV--------S----
I5B297      PLCISLTLGLGMTLTANKTYEAGTMILVQPQRVP-----INYIKSVV--------S----
C7LPS4      VALLVMTLGVITSYVLPRKYEAQSTVFIEQSVIS-----ELVKGIAT--------T----
Q314L4      MAAVVMLAALGFAYSLPKIYQAKSTVAIEQNVIN-----DLVRGIAI--------T----
Q39U16      VSLVVMSVIAWGSFFLPKKYEASSTVFIEKSVIK-----DLVKGITF--------T----
F0JCB9      IVLLAMFIAIVTSYVLPKKYEAKSIVFIEQNVIS-----DLVKGIAV--------T----
G7QCG0      VSLLIMTGAIAVGYLSPKKYEAKSTIFIEQNVIT-----DLVKGIAI--------S----
I2Q342      VSLLIMTGAIAVAYLSPKKYEAKSTIFIEQNVIT-----DLVKGIAI--------S----
Q74BQ7      VALAVMAAAVVYSYVLPKKYEARSTVFIEKNVIS-----ELVKGIAV--------T----
B5EA80      IALLLMTVAFVVSFVLPRKYEASSTVFIEKNVIS-----ELVKGITV--------T----
C6DZX6      IALLLMTVAFVVSFVLPRKYQATSTVFIEKNVIS-----ELVKGITV--------T----
A1ARV9      LALLIMTIAIVTSYVLPKKYEASSTVFIEKNVIS-----ELVKGITV--------T----
E8WSZ4      AALLIMTLVFLVSYLLPRKYESSSTVFIEKNVIS-----ELVKGLAV--------T----
A5G425      TALAIMTVITIVSYFLPRKYEAKSTVFIEKSVIS-----DLVKGIAI--------T----
B9M2X7      TALAVMTITVIVSYVLPEKYEAKCTVFIEKALIN-----ELVRGFAV--------T----
G8AU95      IILLGTATITYVMQSLKPMYRATAMVQLDSRRVELAEFKSVVSNLTPE-------A----
F0G6H6      SALICVAAGALYALCARPVYRSDVLFQVEQSPTD-----TKPASPTGDPSSMFDLK----
A3W0H6      VAVVGAILSIIVALNQPKVFQATAVIQIETPQVG-----SDLAGQTI--------A----
A3K8W6      IFLVGCVISVDYALMQQKVYEATAVVQIEDARVT-----STATGTAAD-------A----
Q0FMP1      VTVLGSAASVWLALNQIKVYEATAVVQIEEGQMP-----DSLAGASAQ-------N----
S9QRP2      VTVVGCALSVWVALNQDKAYEATAVVQIEEARVP-----ERLTGGAAQ-------N----
F4SM98      VTALFTFISLLYALFATPIYQADALLQVEQKQGN-----AILNSLSQ--------MLPDS
G5SDT9      TTAIFALCAVIYTFFATPIYSADALVQIEQNAGN-----SLVQDINS--------ALANK
G5LQM7      TTAIFALCAVIYTFFATPIYSADALVQIEQNAGN-----SLVQDINS--------ALANK
G5Q4J1      TTAIFALCAVIYTFFATPIYSADALVQIEQNAGN-----SLVQDINS--------ALANK
                               : :   . ::                               

F3CAY8      ------KIGIEGTPEVRRQAIVSVAGDH--------------------------------
G7EJX5      KEYYLTQFEVMKSDSIAREVITKLNLKTTPILLQSPQ-----------------------
H8YYB8      -SYAAQRVQTISQRVMTTENLGKIIESYQL-YPELMQR----------------------
E9TE87      PPASDAEIQLIR----SRLVLGKTVDDLDL-DIAVSKNTFPIFGAGWDRLMGRQNETVKV
C0QCJ1      -SGISSRISTISQQIMSMSNLEKIIDQFGLFEEEGAKD----------------------
I5B297      -SSIGERISTISQQVLSRSNLEQIIEQFGLYEN--SSG----------------------
C7LPS4      -PSMEAKIKVLTVAMLSRETLFKVMRILDK-DVEFASD----------------------
Q314L4      -PSMGAKIRILNVSLLSRSSLLSVMKELDM-DLGLSGP----------------------
Q39U16      -PSVEDKVRILRYAMLSRTFVTNVLKSLDA-DTKVKND----------------------
F0JCB9      -PSMDTKIKAIKVTMLSRNMLSKVINALDL-DVDLKNE----------------------
G7QCG0      -PSMQQKIQNLAVSLTSRNLLLPVIKQLDK-DITLKTA----------------------
I2Q342      -PSMQQKIQNLAVSLTSRNLLLPVIKQLDR-DITLKTA----------------------
Q74BQ7      -PSMEQAIKGLSEAITSRTLVTKVINDLDL-DVTTKSN----------------------
B5EA80      -PSMEDTINVLTYEITSRTLLTKVMDSLDL-NLGKSDS----------------------
C6DZX6      -PSMEDTINVLTYEITSRTLLAKVVDNLDL-DLGKNDS----------------------
A1ARV9      -PSMEDTIKVLTYAITSRTLLSKAAENLDM-NVTRKGG----------------------
E8WSZ4      -PSMDDTISVLTYAITSRTLLNKVVESLDM-NLGKDGN----------------------
A5G425      -PSMDEKIKVLNYAITSRTLLLKVIDDLDL-NVNKQND----------------------
B9M2X7      -PSMEDKIKGLNYAMASRPLLQKVVSDLDL-NLGKNGD----------------------
G8AU95      -PAVRSEVSIVGSRALAE----RVVEKLGLLNDPE-------------------------
F0G6H6      -TDAATEIEVLKSRAV----MARAVDTTKLYIEARPRY----------------------
A3W0H6      -TDANQRLQLIEQRLMARDNLVKVIERHGLFANAR-------------------------
A3K8W6      -NEASRRLQLIEQRLMSRDNLVSLMDKYDLFAEDP-------------------------
Q0FMP1      -QDGSRRVRLIEQRLMSRDNLLALMEEHGLFDGDT-------------------------
S9QRP2      -ADAARRVRLIEQRLMSRDNLMRIMEEHDLFTDAP-------------------------
F4SM98      QPQSAPEIALLQ----SRMILGKTVDDLNL------------------------------
G5SDT9      PPASDAEIQLIR----SRLVLGKTVDDLDL------------------------------
G5LQM7      PPASDAEIQLIR----SRLVLGKTVDDLDL------------------------------
G5Q4J1      PPASDAEIQLIR----SRLVLGKTVDDLDL------------------------------
                   .                                                    

F3CAY8      ------------------------------------------------------------
G7EJX5      ------------------------------------------------------------
H8YYB8      ------------------------------------------------------------
E9TE87      TTFNRPKEMADQVFTLNVLDNKNYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHARPGS
C0QCJ1      ------------------------------------------------------------
I5B297      ------------------------------------------------------------
C7LPS4      ------------------------------------------------------------
Q314L4      ------------------------------------------------------------
Q39U16      ------------------------------------------------------------
F0JCB9      ------------------------------------------------------------
G7QCG0      ------------------------------------------------------------
I2Q342      ------------------------------------------------------------
Q74BQ7      ------------------------------------------------------------
B5EA80      ------------------------------------------------------------
C6DZX6      ------------------------------------------------------------
A1ARV9      ------------------------------------------------------------
E8WSZ4      ------------------------------------------------------------
A5G425      ------------------------------------------------------------
B9M2X7      ------------------------------------------------------------
G8AU95      ------------------------------------------------------------
F0G6H6      --------------------------------VPLIGWRLVNGADGLSSPLPGGYVYGTE
A3W0H6      ------------------------------------------------------------
A3K8W6      ------------------------------------------------------------
Q0FMP1      ------------------------------------------------------------
S9QRP2      ------------------------------------------------------------
F4SM98      ------------------------------------------------------------
G5SDT9      ------------------------------------------------------------
G5LQM7      ------------------------------------------------------------
G5Q4J1      ------------------------------------------------------------
                                                                        

F3CAY8      ------------------------------------------------------------
G7EJX5      ------------------------------------------------------------
H8YYB8      ------YGLVSAVEQMREDIEL-----------------EMISADVIDPRSGRPSEATIA
E9TE87      EFTVTKYSTLGMINQLQNSLTV-----------------TE----------NGKDAG--V
C0QCJ1      ------MYLEDKIEAMRKRIKV-----------------TL----------SSARSGADA
I5B297      ------MYQEEKIEALRKRIKV-----------------KI----------EHSRGGSEA
C7LPS4      ------MDREAYIKDLRERISI-----------------RL----------DEKRG---I
Q314L4      -------ALEERITSVRRKVSV-----------------GL----------DEKRG---L
Q39U16      ------KEMEGLVEDFQKRTQI-----------------SI----------KGN-D---L
F0JCB9      ------ISLDSTIKSLRGRIKI-----------------GL----------DEKRG---V
G7QCG0      ------YDQEVYIKDLQRRIMV-----------------NL----------NERQG---L
I2Q342      ------YDQEVYIKDLQRRIMV-----------------NL----------NERQG---L
Q74BQ7      ------AEIEARVRAIQQNITI-----------------KL----------KGD-N---I
B5EA80      -------ETEELIKQLQLSTKV-----------------KV----------KDK-N---L
C6DZX6      -------ETEELIKQLQLNTKV-----------------KV----------KDK-N---L
A1ARV9      ------ADMEALYLTLQKNTVV-----------------KV----------KDK-N---L
E8WSZ4      ---------EELIRDLQKNLTV-----------------KV----------KEKNN---L
A5G425      ------AQLEELVAKFQKNTVI-----------------KL----------KNDEN---F
B9M2X7      ------T--DTLISQFQKDTKV-----------------EL----------RDKEN---L
G8AU95      FNPSLKAPDGTDDHWLKRVTKAGVGALPPEGNDVL----RQIVQQATALFRADDGPVARD
F0G6H6      RIDVAAFDVPKRLYDKSFALTVGRGGAYTLQRTGLFGRKGPVWQGRIGEPLHAETPDGNI
A3W0H6      -----DMPMAEKVHQLRISARI-----------------TPITVGVPGMGPAT-TPSG--
A3K8W6      -----ALNDGERIYMMRQAARI-----------------TPITRPGPTFSAAAQAPSG--
Q0FMP1      -----GMSVGQRLFRMREAVSI-----------------QEIRTNSNSFAAQQEMPSG--
S9QRP2      -----EMTMNERVYQMRMAARI-----------------EEIRSNSGSFQASQEVPSG--
F4SM98      ------------------------------------------------------------
G5SDT9      ------------------------------------------------------------
G5LQM7      ------------------------------------------------------------
G5Q4J1      ------------------------------------------------------------
                                                                        

F3CAY8      ------------------------------------------------------------
G7EJX5      ------------------------------------------------------------
H8YYB8      --------------------------------------------FSLSFESESPTVAQRV
E9TE87      --------------------------------------------LSLTYTGEDREQIRDI
C0QCJ1      --------------------------------------------FTISYKGSDPDKVMRI
I5B297      --------------------------------------------FSISFTGSEPQRVMRI
C7LPS4      --------------------------------------------FFISFQDSDPRYARDF
Q314L4      --------------------------------------------FFISYESSNPVLARDF
Q39U16      --------------------------------------------FIVSIRDKDPKLATDY
F0JCB9      --------------------------------------------FDIRFADTDPVLARDV
G7QCG0      --------------------------------------------IVLNFSDKDPRFARDF
I2Q342      --------------------------------------------IVLNFSDKDPRFARDF
Q74BQ7      --------------------------------------------FTISYVDKDPRVARDF
B5EA80      --------------------------------------------FTISFTHTNPRIARDY
C6DZX6      --------------------------------------------FTISFTHTNPSIARDY
A1ARV9      --------------------------------------------FTISYTDKNPQMARDF
E8WSZ4      --------------------------------------------FTISFVHTDPRIARDL
A5G425      --------------------------------------------FIISFTNENPRLARDY
B9M2X7      --------------------------------------------FTISYTGENPKRARDY
G8AU95      PNQARLLTIDTLLRRIEARNDDRSFT------------------IIIEASSVDPAKAAAI
F0G6H6      DLLVRGIDGEPGARFDLTRHGEAETTAWLQKNVLISERGKQSNIIGATLDGSDAAHISSI
A3W0H6      --------------------------------------------LSVTVNLNDPVKAAEV
A3K8W6      --------------------------------------------LMISVMLPDPEKAAVV
Q0FMP1      --------------------------------------------LRISVVLPDPQKAADV
S9QRP2      --------------------------------------------LTITVRLGDPQKAADV
F4SM98      ------------------------------------------------------------
G5SDT9      ------------------------------------------------------------
G5LQM7      ------------------------------------------------------------
G5Q4J1      ------------------------------------------------------------
                                                                        

F3CAY8      ------------------------------------------------------------
G7EJX5      ------------------------------------------------------------
H8YYB8      ANDITSLFLSENLKDRQESAKETTAFLQKELAKLTDKLSLLEARLAQFKEEHGQS-LPEL
E9TE87      LNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLE
C0QCJ1      TNTLTSFFMDENLKLREAQAIGTSEFLDAELEKTRKKLVDREEQLSSYRAKNMGG-LPDE
I5B297      ANTLASYFMDENLKVREAQAIGTSEFLDSELEKTKKRLEEKEQKLAAFRAKYLGG-LPDE
C7LPS4      VNTITQVYIESNTASKRDESLEATRFLSEQIESFKKRLDAVEDEINQYRAEHGLQ-LATD
Q314L4      VNTLTRHYIEQSTSDKREESFEATRFLADQIEVFRKRIEAVQAEIDSFKASRGQI-LNMS
Q39U16      VNTLVRKYVEENVSSKRQDSFGADRFISEQLKTFKDKLDESENKIVAFRQKRGVS-VGID
F0JCB9      VNTLTRVYIEDSVSNKRKESYEATRFLADQIEVFKKRIDEAKKEIEDYKVASGKV-LTTN
G7QCG0      INTMARVYIERNTSTKREESTEATKFLAEQIETFKKRVDAADEAINAFRSERGML-LSSD
I2Q342      INTMARVYIERNTSTKREESTEATKFLADQIETFKKRVDTADEAINAFRSERGMI-LSSD
Q74BQ7      VNTLVRRYVEENISSKREESYGAIKFLSEQIDTFRGKLEEAEGELNRYKTEKGGV-IAID
B5EA80      VNTLVRLYIEGNISSKRGESYDATKFLSEQIDTFNAKLQKVESEVNAYKRDKGGV-IAID
C6DZX6      VNTLVRLYIEGNISSKRGESYDATKFLSEQIDTFNEKLQKAENEVNAYKRDKGGI-IAID
A1ARV9      VNTLVRLYIEENTSSKRGESYDATKFLGEQIDTFREKLEKAEKELNDYKRDKGGV-IAVD
E8WSZ4      VNTLVRLYVEQSTSSKRGESYDATKFLSEQIQAFNRKLQSAEAEVNAYKRSKGGV-ISID
A5G425      VNTLVRRYIEENVSSKREESYGATKFLSEQIEVYKEKMDKAEAEVNNFKIGKMGV-IATD
B9M2X7      VNTLVRRYIEENSSSIRAESYGASKFLSEQITVLKEKMDKAEAEVSRFRMEKGSV-ATAD
G8AU95      ANAFGQAYLDYRTEMNRDMTERVNQWLGGRLIEAREAVRGAEEAIRSFRKENSLL-----
F0G6H6      LNAVGDAYLAQNTQRKSEAADKLIRFMDAQLPQLKAQLEAAEGRFNAYRASH--------
A3W0H6      ANDFVETVIAENRERRMALVRETFDFFSAEETRVSARIAEVEGVIADFKRANA-------
A3K8W6      ANDLMTKVIAESRDRSAEQASETLAFYQTEEARVDAEIVALEDRIADYKKANS-------
Q0FMP1      ANEMMYQVINQSRDRSLSSARDTLAFFESEEARVETEIEAMEAKIATFKRENA-------
S9QRP2      ANELMTTVIEQSRSRSASSARDTLEFFEKEEARIGAEISEQESRLADFKRANA-------
F4SM98      ---------------QAIAEKNYFPIFGRGWARLIGHKPE--------------------
G5SDT9      ---------------DIAVTKNTFPLFGAGWERLMGRHNE--------------------
G5LQM7      ---------------DIAVTKNTFPLFGAGWERLMGRHNE--------------------
G5Q4J1      ---------------DIAVTKNTFPLFGAGWERLMGRHNE--------------------
                                                                        

F3CAY8      ------------------------------------------------------------
G7EJX5      ------------------------------------------------------------
H8YYB8      KSLNMQLIQRSEDQLRDTEQSIRTLVERKIYLEGQLAQIDPYSELFSADGRRVL------
E9TE87      AKAVLDSMVNIDAQLNELTFK---------------------------------------
C0QCJ1      LDSNLRTLDRLQLQLTDKQAMLRDAKNAINTLSAQIAQASKMGSQGMDDQ----FDFSDF
I5B297      LESNLRTLDRMQKQVTDKAMLLREVNNSISQLDSQISSMAATGGSGSGGDDFLSFDFDDS
C7LPS4      ETTIRFEIADAERKLEAIRARKLELETKLQLMPSG-----G-------------------
Q314L4      EPALRREIQMAQEELQALRIRKTDLLAQRGVMLRN-----T-------------------
Q39U16      EALLVNDIRQYQGELDSMRIKRNELTATRDALRRQL----K-------------------
F0JCB9      EYAVRREIEKGEDQIKDIDIRISTLESSRTMLLSN-----S-------------------
G7QCG0      GAFIRSEIKAAEQKLEELSLRRAQLEAQRKMLASGK----G-------------------
I2Q342      GAFIRSEIKAAEQKLEELSLRRAQLEAQRKMLVSGKGPARG-------------------
Q74BQ7      EAKLFEEINVAQQKLYDIQLRRRHLEGLRPVTRKAG----D-------------------
B5EA80      EGKLFQEINVAQQKLYDLELRRHQLEGMRQITRRTG----D-------------------
C6DZX6      EGKLFEEINIAQQKLYDLELRRRQLEGMRQITKRTG----D-------------------
A1ARV9      EAKLFEEINVSQQKLYDLELRRRQLEGMRRVTRKSG----D-------------------
E8WSZ4      EGKLFEEINTAQQKLYDLELRRRQLEGMRLVTRKAN----D-------------------
A5G425      PATLQKEINDAQQKIDDMRLKRAQLESLRIQIKK-N----N-------------------
B9M2X7      PAALEREISGAQQRIDEIAFRKAQLEASRNQLKK-H----N-------------------
G8AU95      ----------------------------------------E-------------------
F0G6H6      ------------------------------------------------------------
A3W0H6      ----------------------------------------E-------------------
A3K8W6      ----------------------------------------A-------------------
Q0FMP1      ----------------------------------------E-------------------
S9QRP2      ----------------------------------------E-------------------
F4SM98      ------------------------------------------------------------
G5SDT9      ------------------------------------------------------------
G5LQM7      ------------------------------------------------------------
G5Q4J1      ------------------------------------------------------------
                                                                        

F3CAY8      ------------------------------------------------------------
G7EJX5      ------------------------------------------------------------
H8YYB8      --------GPADRLKAL------------EAEYATVAARYSSQHPERMRIEREIATLRQQ
E9TE87      -----------------------------EAEISKLYTKVHPAYRTLLEKRQALEEEKAK
C0QCJ1      GEEVGMGGEDEATLAEA------------EKRLDAMLLRYTRQHPDVRRLEAVIEKLRAK
I5B297      QE------GDDSALQAA------------QEKYDALLLRYTEKHPDVKKLKRIIEKLKQN
C7LPS4      --------GRSAHLADM------------ERQLATLLTAYTDQHPKVVRLQGQIRAVKSS
Q314L4      --------PLRNRLETL------------EAQLAAMLVSYTEKHPAVIRTKQEIEGLRRE
Q39U16      --------SIKPTTVALSSRENSSEVEMLERRLKQLSANYTDNYPEVIRIKSIIASLKKK
F0JCB9      --------PSRSRLRQQ------------EQLLDDMLARYTENHPRVRQLENAIAETKRQ
G7QCG0      --------PAKASRASSGGNPR-------EAELRRLLAVYTEKNPKVIKARAAAKAWRPS
I2Q342      --------PAKAGRASSGGNPR-------EAELRRLLALYTEKNPKVIKARAALRAWRPS
Q74BQ7      --------PLQVKLVAL------------QKQLEELRVSYTDSYPEVLRVRGEIETLKEQ
B5EA80      --------PLQSRLAGL------------QKRLDELLVEYTDSFPEVVKVKGDIETVKAQ
C6DZX6      --------PLQNRLAGL------------QKRLDELLVEYTENFPEVVKVKGDIETVKAQ
A1ARV9      --------PLQARLSAL------------QRRLDELRVQYTDSYPEVLQIKGDMETIRAQ
E8WSZ4      --------PLQAKLASL------------QKRLDDLRVQYTDSYPEVLTVKGDIETVKEQ
A5G425      --------PLQQKMLSL------------QKKLDEMLVEYTESYPEVIRVKTELQAVKEQ
B9M2X7      --------PAQMRLQTL------------EKKLEEMRVEYTDRYPEVMRLKSEIESVREQ
G8AU95      --------LPPDGRNMV------------QQQMNELATQLTAAQAQKAAAEARVRQARDQ
F0G6H6      ------------GSVNT------------SDEALALRQQSVDIETRILTLQ----QQRQE
A3W0H6      --------SLPTSITPV------------REELRTLNETLLALDQQIITLETEASRQRQE
A3K8W6      --------QLPAGVAAL------------RTELTTLRETELDLSQEIITIQGDTARKRPE
Q0FMP1      --------ALPSGTGAL------------RSQLTTLEDSQLALARDIVEMEGNSTRQREE
S9QRP2      --------ALPGGITSL------------RSQLVTLEENELELDREIVALRTNSARQRED
F4SM98      -----------------------------NLTITRLYLPSSDKELPELNLTVKDKLHYTV
G5SDT9      -----------------------------MVKVTTFTRPETMSG-QIFTLKVLGDKRYQL
G5LQM7      -----------------------------RVKVTTFTRPETMSG-QIFTLKVLGDKRYQL
G5Q4J1      -----------------------------RVKVTTFTRPETMSG-QIFTLKVLGDKRYQL
                                                                        

F3CAY8      ------------------------------------------------------------
G7EJX5      ------------------------------------------------------------
H8YYB8      VGQSANARAELERSLKEQQEELAGLRERYSTEHPDVKAQTGAIAITQRQLAQARQGGSAN
E9TE87      LNGR--------------------------------------------------------
C0QCJ1      IEAAQA----------------------------------------QEAAETLEPLETEN
I5B297      LEAAKE----------------------------------------E---EELPSAESEE
C7LPS4      PSGGMT----------------------------------------GNSGAAAKT-----
Q314L4      VARKGE----------------------------------------EERKIIYGT-----
Q39U16      QEPGHQ----------------------------------------ADTGAKEEFSTANP
F0JCB9      IAHNSE----------------------------------------EELSLIYSS-----
G7QCG0      ---GGG----------------------------------------GGESAGEGV-----
I2Q342      GGGGGG----------------------------------------GGESAGEGV-----
Q74BQ7      MKNRSP----------------------------------------Q-QETVVDP-----
B5EA80      ISERRG----------------------------------------Q-PSQPLDP-----
C6DZX6      LSARRG----------------------------------------Q-QSQSLDP-----
A1ARV9      LKTR-G----------------------------------------T-TFQPLDP-----
E8WSZ4      MKLRKG----------------------------------------A-ASQPLDP-----
A5G425      LRNRNT----------------------------------------GFDMSPAET-----
B9M2X7      ALASSG----------------------------------------QARLGGAEM-----
G8AU95      TAANNA------------------------------------------------------
F0G6H6      LLTR--------------------------------------------------------
A3W0H6      VFARQ-------------------------------------------------------
A3K8W6      DLARQ-------------------------------------------------------
Q0FMP1      VLARQ-------------------------------------------------------
S9QRP2      VLDRQ-------------------------------------------------------
F4SM98      EYNG--------------------------------------------------------
G5SDT9      VSDGGF------------------------------------------------------
G5LQM7      VSDGGF------------------------------------------------------
G5Q4J1      VSDGGF------------------------------------------------------
                                                                        

F3CAY8      ------------------------------------------------------------
G7EJX5      ------------------------------------------------------------
H8YYB8      SPGVIDADNPAYIQLQAQLQAAVVELASLQESREEIRSKLADLEERIAKGPRIELEYQAL
E9TE87      ----------------------------------------------VTAMPKTQQEIVRL
C0QCJ1      LDVVEPGMNFAVMQQKTQLAQMNREIQALNAEIKSIQEKMVVYQKRVEDTPKKEQDLLSL
I5B297      DILPDMGMD-PVAPLKAQRAQLVAEANNIQAEVSAIQEKMKIYAQRVEDTPKRELELQSL
C7LPS4      --------------------LVQAEIEAATLQEKAQLATIEEKTELLRRIPTLRTGLNEL
Q314L4      ------------SEYQR----IKVELTAVEQQEAQLVSKIADNERLLREIPSVATELADL
Q39U16      ----------VYQNLEQQLYQVEAELEAVNAKQRQLHATIGGKEHELRNVPADQKTLTDL
F0JCB9      ------------PEYQH----LKVQIRALNTQKANIEEEMASNKALLDQIPRAQAELQEL
G7QCG0      ------------AEGTRNAQILQYQLDSIKAMEDYQNKIIGENKGALRDLPRVKATLAEL
I2Q342      ------------AEGTRTVQILQYQLDSIKAMEDYQTKVIGENKGALRELPRVKATLAEL
Q74BQ7      ------------QEYEK----AEAELQALKVSEDGLKRYIATNQALLRNIPSAKAGLEKL
B5EA80      ------------GELAK----IESEISAIKITESGLRRYIDTNRALLQTIPSAKAGLEKL
C6DZX6      ------------AELAK----IESEISAIKITESGLRRYIDTNRSLLQTIPSAKAGLEKL
A1ARV9      ------------QELEK----IDSEVAAIRASESSLRRYISTNQSLLRSLPSAKADLERL
E8WSZ4      ------------QELAR----IDSEIAALRITEDGLRRHVATNRQLLQSIPDAKAGLAKL
A5G425      ------------PDLDR----VEAELKALKAAEANQYVIISSTRSLLHNIPVAKATLEQL
B9M2X7      ------------QELER----IDAELRVLRSAESKQYANIASSRAMLRNIPAARAELEQL
G8AU95      --------------AAIPEVLASPLIQKLREAEAMLERRLAELQQGLWRQASGHRESSPR
F0G6H6      ---------------------------FMNKHPAVVA---------------VDAQLADA
A3W0H6      -------------------------IGQLTEQRALVAGRIAENEAALAAAPRVERELGAL
A3K8W6      -------------------------VAQLEDQRALVAARATEIEGQIASAPEVERQLGQL
Q0FMP1      -------------------------LGLMREQQSLIEQRISEIEETLLQAPEVERELSAL
S9QRP2      -------------------------VALLQEQKALIAQRSETIRDTLRRAPDVERELNEM
F4SM98      ------------------------------------------------------------
G5SDT9      ------------------------------------------------------------
G5LQM7      ------------------------------------------------------------
G5Q4J1      ------------------------------------------------------------
                                                                        

F3CAY8      ------------------------------------------------------------
G7EJX5      ------------------------------------------------------------
H8YYB8      TRDHENAMSSYSEVKQRLVAAELGEAMEAERKGERFSLIEPPRLPEQPAKPNRLAIAFLG
E9TE87      TRDVESGQQVYMQLLNKEQELKITEASTVGD----VRIVDPAITQPGVLKPKKGLIILGA
C0QCJ1      KRDYANIQSVFNSLLDRKLEAELSVNMEKKQKGEQFRILDHARIPEKPISPDVRKMLVFS
I5B297      TRDYSNIQNVYNSILDRKLEAELSVNMEKKQKGEQFRILDHARLPEKPISPNVKLMFLLS
C7LPS4      LRKKDNETLIYSQLVTRYGQSEVSKQMEMENKSMNFRVVDPAVMPDTTVSPKRVPIMLLS
Q314L4      ENRKRKESLIYEQLVGRYGQSEVSKQMELQDKAVSFRIIDPAVLPSVPVSPKRWLILLAG
Q39U16      IKERDANRQLYEQLLTRQGQAQLTKEMEVEDKATTFRVVDPAIVPMKPVSPDRVKMIIMG
F0JCB9      KRKEKNEVIIYEKLVSRYGQSEVSKEMELQDKAVSFRVLDPAVIPTIPSSPNRPLIMLAG
G7QCG0      VNKKDQEAAIYNQLVNRYGQSEISKEMELKDKSVMFRIVDPAVIPEVPVSPNRPVIILIG
I2Q342      VNKKDQEAAIYNQLVNRYGQSEISKEMELKDKSVMFRIVDPAVIPEVPVSPNRPVIILIG
Q74BQ7      ELEKKNRKDLYDQLMARHGQSEVSKQMEVQDKTTTFRIVDPAVTPSSPISPNRVKIMLMG
B5EA80      ELEKKNQKNIYDQLFARHGQSEVSKQMEVQDKSTTFRVVDPALLPVKPSSPDRLKLMLLG
C6DZX6      ELEKKNQKNIYDQLFARHGQSEVSKQMEVQDKSTTFRIVDPALLPVKPSSPDRLKLMLLG
A1ARV9      ETAKNNQKNIYDQLFARHGQSEVSKQMEVQDKSTTFRIVDPALLPQKPVSPNRLRIMLLG
E8WSZ4      EVERENQKKIYDELYSRHGQSEVSKQMEVQDKSTTFRIVDPAMLPTRPASPNRLLIMLLG
A5G425      ERDKNNQKNLYEQLVTRHGQSEVSKQMEVQDKATTFRIVDPAIMPINPVSPNRVNIILMG
B9M2X7      ERDKANQKQVYDQLVTRHGQSEFSKQMEVEDKGTTFRIVDPAVLPVKPISPNRIAIILGG
G8AU95      RR----------------------------------------------------------
F0G6H6      QRSLAAV----------------------REQIQKLPAVEQGVL----------------
A3W0H6      TRNLTQLQDQLSTITTSRVEAEMASVLESRQQQERFEILETAIPPEFPVSASRKKLVIAG
A3K8W6      EREMDRLKDQYSVITRGKAEAEMGQALQDRQAAGRYEVLETALVPDDPVTSSRKKIAGMG
Q0FMP1      ERDLERLKDQYSVITRRKADAEMGQMLEDRQQTDRFEVLETALVPEFSASSGRKKIVLAG
S9QRP2      ERQLGSLQEQYSVITRRKAEAEMGSMLEDREQTDRFEVLETALVPEVPASQSRRKLAMAG
F4SM98      ----------------------------------------------------KKLTELLV
G5SDT9      -----------------SAQGVVGQPLNKDGVTMRVEAIDARPDTEFTVSTVSKFSTLGI
G5LQM7      -----------------SAQGVVGQPLNKDGVTMRVEAIDARPDTEFTVSKK--------
G5Q4J1      -----------------SAQGVVGQPLNKDGVTMQVEAIDARPDTEFTVSKPVLIQNLR-
                                                                        

F3CAY8      ------------------------------------------------------------
G7EJX5      ------------------------------------------------------------
H8YYB8      LVLAFGGGVGNLALQEALDKS-VHNARDVELITMGPPLAVIPFIETEADVHRRTRR--RL
E9TE87      IILGLMLSIVGVLLRSLFNRG-IESPQVLEE-HGISVYASIPL-----SEWQKARDSVKT
C0QCJ1      LAAGLGVAGGIIFLLEVLDFS-IRRDEDIEK-LGLLVLASIPPLKNPGD-RLKKRLEMIF
I5B297      IAGGLGLGGGILFLKELLTFSVIRRDDQIDTLLGLPILASIPPLEKPNG-RTKKKIEWAM
C7LPS4      ALAGIGIGMAVIMVPYLMRGS-VESLADLRS-LNQRVLAVLPAISKPKEERQRVRGDRIF
Q314L4      MAAGLGGAFGVLFLFDLLNPR-VRSVEDLRR-LGFHVMAVVPSISDVAEERRIFRRRAAV
Q39U16      IIMGFVAGAASVFVMEMFDSS-VKDVTSLKK-LGFEVLAVIPTIFNQEEASKVAKKDRKI
F0JCB9      MAIGVAFGLGVIFLMDLIDPS-IKNVDDLRE-FGIPVLAVIPKLKNVEEERKTSRRNLRI
G7QCG0      IVLGLGAGAGATYLADRFNHS-IRSLHELRT-LGLPVFAVIPRISSEKEIRRQARRDHLV
I2Q342      IVLGLGAGAGATYLAERFNHS-IRSLNELRT-LGLPVFAVIPRISSEKEVRRQARRDHFV
Q74BQ7      IVAGLGCALGLIVLLDRLNNS-VHSVDALKE-TRIPVLAVIPKIRTIEAVARERSENIRV
B5EA80      MVGGVAGSFALLFLVDHLNIT-VKEVEFVKG-LGVPVLAVIPRLQDPEVEAKRRRRSRLI
C6DZX6      MVGGVAGSFALLFLIDQMNNT-VKEVEFVKG-LGVPVLAVIPRLQDPEVEAKRRRRSRLI
A1ARV9      FIGGLAGSFGLLFLLDQMDGT-VKDVDFLKQ-FGVPVLAVISRIRIQRDIELQRRRTKRL
E8WSZ4      IFGGAAGSLFLLVLRDQMDTT-AKEVDFVKS-LGGPVLAVVPRMQIPEEVARLHRKSLGV
A5G425      IGAGLVIAFCLLMLLDYLDQS-VKNVDALKS-FGLPILAIIPKMQNPVELLLQKKKNVKL
B9M2X7      IAGGLAVAFGLVLLLDYYDES-VKSLDGLKA-LGLPVLAVIPKMQIPAEIKLQKAHDVRL
G8AU95      ------------------------------------------------------------
F0G6H6      ---------------------------QLQRDVTVDTALYTNLLNARQQMMLARASKTGT
A3W0H6      AVASLVAGIGFAVLLEIMNPA-IRSAAQLEQELEITPVVTIPIVRLRHERRRRALKIAGT
A3K8W6      AVASLIAGLIVALVFEIMNPA-IRTQKQMERVLGIQPVVVIPVISTRRDRTWGGLKFLAK
Q0FMP1      VVASVLAGVVIAFVAELLNPA-IRSAAQMERVLGLQPVVSIPVVEARRDRRSRQLRSVTA
S9QRP2      GVASLLAGLGIAFLAELMNPA-IRSAAQMERSLGIQPVIAVPVIRSRGHHRRRGLGLLAL
F4SM98      FY----------------------------------------------------------
G5SDT9      LR----------------------------------------------------------
G5LQM7      ------------------------------------------------------------
G5Q4J1      ------------------------------------------------------------
                                                                        

F3CAY8      --------------------------------------------------------
G7EJX5      --------------------------------------------------------
H8YYB8      IAVLGSILGVVLATAAVHQF-----VMPLDVLWIKVLDRAGLLHTETPNPS-----
E9TE87      IKGVKRYKQSQLLAVGIQPIWRLKPSAVCVPVCTSR--------------------
C0QCJ1      LSLAATYALVMLAAFIVLNDKGLDRVVNFIKSFING--------------------
I5B297      FICCCSYSAVFLAFFAILNHKGLDRTMNFIKTTLNL--------------------
C7LPS4      MSGAALYFLMLVTIGVMEAL-----GNSPLDVLFERALGPWL--------------
Q314L4      TACGVLLCGGVVAVAAAEFL-----QLRFMENFIAGAVFTVKSWF-----------
Q39U16      YLVAGCYFALICLMLTHELL-----GLTLIEKVLTKLGLDQFIMS-----------
F0JCB9      YVIVAVGLMIFLAFLGSEFL-----GLGLVDKLIAKGALVVQQWRM----------
G7QCG0      MAVAGGYFALVVGVLVLETLRAQGVGTAWLQKIAHSIL------------------
I2Q342      MAVAGGYFALVVGVLVLETLRAQGVGTAWLQKIAHSIL------------------
Q74BQ7      FAAAGACFMVILAFLVMELL-----NISPVDRIISRLHGML---------------
B5EA80      LGCALVYFLVLMVFPGMELL-----GLPYMDKVLDLLSGPEARLRIKGLLQ-----
C6DZX6      LGGALMYFLVLMVFPGMELL-----GLPYMDKVLDLLSGPEARLRIKGLLQ-----
A1ARV9      CLYAGAYFLFLLCFPLSELI-----GLTFMDTLVDALRPANLVQNVKDQVR-----
E8WSZ4      FALSAFYFLLLLVFPTMELM-----GLPYMDQVLDRVSSSGITQGVKGILH-----
A5G425      YVIASVYFSLILTVLLLEVL-----NSSLSNTFIDSIEIKQYLPDLMSQIKYHGGN
B9M2X7      YAISACYFSLILIVLLLELL-----QIPLFSSSLNSLQLKQYLSQAVGQFK-----
G8AU95      --------------------------------------------------------
F0G6H6      VRI-----------------------------------------------------
A3W0H6      VVMILLIVPILVRFAQE--------------RLMPLRMLSGN--------------
A3K8W6      ALGIVALVGGVAAWLTKISG-----LGALFGGGAPRRAVRG---------------
Q0FMP1      VGLLAALMLGLYRLFTDILP-----WQGLLDRFLPRMARS----------------
S9QRP2      VALLAGAVWAGLRFVGDLGP-----LQGLLERILPRSVQSS---------------
F4SM98      --------------------------------------------------------
G5SDT9      --------------------------------------------------------
G5LQM7      --------------------------------------------------------
G5Q4J1      --------------------------------------------------------
                                                                    

© 1998-2020Legal notice