BYKdb

Dataset for cluster orphancd of phylum proteobacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

1007 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1M6N1X5      ------------------------------------------------------------
A0A561M3U0      ------------------------------------------------------------
A0A2T4ZJZ6      ------------------------------------------------------------
A0A1T2KYM8      ------------------------------------------------------------
A0A2G9ZR82      ------------------------------------------------------------
A0A6J4YZ98      ------------------------------------------------------------
A0A844XH11      ------------------------------------------------------------
A0A0P1H2H0      ------------------------------------------------------------
A0A377N8F8      ------------------------------------------------------------
A0A4Q3LR91      ------------------------------------------------------------
A0A6C9IKN8      ------------------------------------------------------------
A0A4V1TR68      ------------------------------------------------------------
A0A6L3ZR06      ------------------------------------------------------------
A0A3E0WKI3      ------------------------------------------------------------
A0A1H3I2J1      ------------------------------------------------------------
A0A521LJG5      ------------------------------------------------------------
A0A1V4WHZ7      ------------------------------------------------------------
A0A1E5AJN5      ------------------------------------------------------------
A0A2N3D2J1      ------------------------------------------------------------
A0A2N2GVE1      ------------------------------------------------------------
A0A2N2INV3      ------------------------------------------------------------
A0A233IKJ2      ------------------------------------------------------------
A0A1Y5DXG5      ------------------------------------------------------------
A0A0B8P2H5      ------------------------------------------------------------
A0A380AQW6      ------------------------------------------------------------
A0A2G2GD62      ------------------------------------------------------------
A0A524P331      ------------------------------------------------------------
A0A4V1SSM5      ------------------------------------------------------------
A0A4Q3K8G7      ------------------------------------------------------------
A0A7C7W7M2      ------------------------------------------------------------
A0A1M7HC79      ------------------------------------------------------------
A0A1D3JZN6      ------------------------------------------------------------
A0A1V6ESG1      ------------------------------------------------------------
A0A850NXS7      ------------------------------------------------------------
A0A1H7YHK3      ------------------------------------------------------------
A0A3S1MCW7      ------------------------------------------------------------
A0A528AX40      ------------------------------------------------------------
A0A528MV95      ------------------------------------------------------------
A0A838IR38      ------------------------------------------------------------
A0A328C2K5      ------------------------------------------------------------
A0A5C6X8M3      ------------------------------------------------------------
A0A3D8MRR7      ------------------------------------------------------------
A0A5C6UBJ7      ------------------------------------------------------------
A0A5C6XGM3      ------------------------------------------------------------
A0A849WSS0      ------------------------------------------------------------
A0A7Y3GUU1      ------------------------------------------------------------
A0A090R136      ------------------------------------------------------------
A0A661JU93      ------------------------------------------------------------
A0A0M3GBT1      ------------------------------------------------------------
B3Q577          ------------------------------------------------------------
A0A3R9C3P5      ------------------------------------------------------------
A0A7W6FJX0      ------------------------------------------------------------
A0A2E2T3V8      ------------------------------------------------------------
A0A367UAB4      ------------------------------------------------------------
A0A1F2ZW35      ------------------------------------------------------------
A0A377V641      ------------------------------------------------------------
A0A1F2YJ88      ------------------------------------------------------------
A0A5N8AL61      ------------------------------------------------------------
A0A0J7XGZ1      ------------------------------------------------------------
I4CBA7          ------------------------------------------------------------
A3VE95          ------------------------------------------------------------
A0A1G0NL95      ------------------------------------------------------------
A0A024KA69      ------------------------------------------------------------
A0A0L1KFN4      ------------------------------------------------------------
A0A3D5UYX7      ------------------------------------------------------------
A0A524QFS4      ------------------------------------------------------------
A0A832MZU0      ------------------------------------------------------------
A0A520JSW4      ------------------------------------------------------------
A0A4Q3LTF3      ------------------------------------------------------------
A0A840SQK7      ------------------------------------------------------------
A0A7C3N3Y1      ------------------------------------------------------------
A0A537UTP9      ------------------------------------------------------------
A0A1D2RNR5      ------------------------------------------------------------
A0A4V1TQ46      ------------------------------------------------------------
A0A3A0FZC0      ------------------------------------------------------------
A0A1N7JVZ7      ------------------------------------------------------------
A0A091C4A8      ------------------------------------------------------------
A0A844YBH7      ------------------------------------------------------------
A0A4R3H6P6      ------------------------------------------------------------
A0A3S1NQ09      ------------------------------------------------------------
A0A443GJ52      ------------------------------------------------------------
A0A2W6S588      ------------------------------------------------------------
A0A483E0N4      ------------------------------------------------------------
A0A2J4YQQ6      ------------------------------------------------------------
A0A483THX4      ------------------------------------------------------------
A0A534MVS2      ------------------------------------------------------------
A0A444I5K6      ------------------------------------------------------------
A0A154VE85      ------------------------------------------------------------
A0A3C1S9Y1      ------------------------------------------------------------
A0A353EH49      ------------------------------------------------------------
A0A1Y1Q9C1      ------------------------------------------------------------
A0A3M7LJH0      ------------------------------------------------------------
A0A1E4JHX8      ------------------------------------------------------------
M2U8P2          ------------------------------------------------------------
A0A1H7KZF8      ------------------------------------------------------------
A0A6N3UC48      ------------------------------------------------------------
A0A257NG76      ------------------------------------------------------------
A0A1T4TW59      ------------------------------------------------------------
A0A1Q3MB35      ------------------------------------------------------------
A0A259LUN7      ------------------------------------------------------------
A0A2D7AVL1      ------------------------------------------------------------
A0A3B9KZE9      ------------------------------------------------------------
A0A358L616      ------------------------------------------------------------
A0A4U9HNE9      ------------------------------------------------------------
A0A7X7Z1H8      ------------------------------------------------------------
A0A7C5N053      ------------------------------------------------------------
A0A2G2CXY6      ------------------------------------------------------------
A0A3M1D4H3      ------------------------------------------------------------
A0A7C1A2A2      ------------------------------------------------------------
A0A840RX77      ------------------------------------------------------------
A0A5C8BYM7      ------------------------------------------------------------
A0A7V2RUR3      ------------------------------------------------------------
A0A1J5ICP0      ------------------------------------------------------------
A0A379B9V4      ------------------------------------------------------------
A0A0Q6TS97      ------------------------------------------------------------
A0A0Q6UYB4      ------------------------------------------------------------
W7Q5J0          ------------------------------------------------------------
A0A654AKT6      ------------------------------------------------------------
A0A847E0Q2      ------------------------------------------------------------
A0A7W9WQN4      ------------------------------------------------------------
A0A0G9MZA5      ------------------------------------------------------------
H0T8B0          ------------------------------------------------------------
A0A7Y4X614      ------------------------------------------------------------
A0A5C7N981      ------------------------------------------------------------
A0A534TV22      ------------------------------------------------------------
A0A351CXR4      ------------------------------------------------------------
A0A2N6GLF5      ------------------------------------------------------------
A0A1W9LJP0      ------------------------------------------------------------
A0A0W1ICB0      ------------------------------------------------------------
A0A7C1C8G2      ------------------------------------------------------------
A0A832F8F3      ------------------------------------------------------------
A0A2E0UL88      ------------------------------------------------------------
A0A2N1WQN5      ------------------------------------------------------------
A0A0T2QIS1      ------------------------------------------------------------
A0A376KYN0      ------------------------------------------------------------
A0A377E5P7      ------------------------------------------------------------
A0A2X1JB05      ------------------------------------------------------------
A0A376RML0      ------------------------------------------------------------
A0A6N3QTV2      ------------------------------------------------------------
A0A0P7Y1D0      ------------------------------------------------------------
A0A7Y2FUF7      ------------------------------------------------------------
A0A7W6DRI0      ------------------------------------------------------------
A0A542J310      ------------------------------------------------------------
A0A2M7JRZ7      ------------------------------------------------------------
A0A167IR75      ------------------------------------------------------------
A0A3B8T2U6      ------------------------------------------------------------
A0A365PWR2      ------------------------------------------------------------
A0A2E9H5Z8      ------------------------------------------------------------
A0A2E2BR79      ------------------------------------------------------------
A0A6I4IKZ3      ------------------------------------------------------------
A0A7H4JZ79      ------------------------------------------------------------
A0A0Q4Q524      ------------------------------------------------------------
A0A0Q4CFJ9      ------------------------------------------------------------
A0A0Q4FE58      ------------------------------------------------------------
A0A0Q4JWC8      ------------------------------------------------------------
A0A0Q4KFL8      ------------------------------------------------------------
A0A7W8RVL5      ------------------------------------------------------------
A0A831Y0Z8      ------------------------------------------------------------
A0A522R8R0      ------------------------------------------------------------
A0A2U9NDY5      ------------------------------------------------------------
A0A0Q4IGG1      ------------------------------------------------------------
A0A352G2C2      ------------------------------------------------------------
A0A7Y3BMU7      ------------------------------------------------------------
A0A534RUJ5      ------------------------------------------------------------
V4Q8B7          ------------------------------------------------------------
A0A3M1CJM3      ------------------------------------------------------------
A0A2R7SVD4      ------------------------------------------------------------
A0A0Q8XKK5      ------------------------------------------------------------
A0A2E0Q2W0      ------------------------------------------------------------
A0A660NIR6      ------------------------------------------------------------
A0A142W0R3      ------------------------------------------------------------
A0A0S4XR18      ------------------------------------------------------------
A0A7C5CFF1      ------------------------------------------------------------
A0A7X6WZW5      ------------------------------------------------------------
A0A7X2SVT1      ------------------------------------------------------------
A0A2E0GW64      ------------------------------------------------------------
A0A1A7QJ97      ------------------------------------------------------------
A0A832UVD3      ------------------------------------------------------------
A0A7W5IBY1      ------------------------------------------------------------
A0A661LW70      ------------------------------------------------------------
W7Q8F9          ------------------------------------------------------------
A0A524PXH8      ------------------------------------------------------------
A0A4Q3P0E4      ------------------------------------------------------------
A0A3M2BE89      ------------------------------------------------------------
A0A4Q4A6K6      ------------------------------------------------------------
A0A257G674      ------------------------------------------------------------
A0A661M5M6      ------------------------------------------------------------
A0A1I1UM01      ------------------------------------------------------------
Q44573          ------------------------------------------------------------
A2W025          ------------------------------------------------------------
A0A534Z362      ------------------------------------------------------------
V4J283          ------------------------------------------------------------
A0A536T443      ------------------------------------------------------------
A0A0Q4UFQ5      ------------------------------------------------------------
A0A527W7E6      ------------------------------------------------------------
A0A432EMV7      ------------------------------------------------------------
A0A7Y3M8P5      ------------------------------------------------------------
A0A7C1SEU7      ------------------------------------------------------------
A0A7Y1SPC5      ------------------------------------------------------------
A0A7V6YC94      ------------------------------------------------------------
A0A534WLI3      ------------------------------------------------------------
A0A7V6CBY2      ------------------------------------------------------------
A0A7C6FBW0      ------------------------------------------------------------
A0A087LTV7      ------------------------------------------------------------
A0A7D7WSS2      ------------------------------------------------------------
A0A318KWA2      ------------------------------------------------------------
A0A522MT86      ------------------------------------------------------------
A0A4Q3I221      ------------------------------------------------------------
A0A534SAL6      ------------------------------------------------------------
A0A534ZDB4      ------------------------------------------------------------
A0A534X3M7      ------------------------------------------------------------
A0A534SPC6      ------------------------------------------------------------
A0A535AD60      ------------------------------------------------------------
A0A4Q3SY08      ------------------------------------------------------------
A0A7U1E9W6      ------------------------------------------------------------
A0A4Q3LG23      ------------------------------------------------------------
A0A522EX52      ------------------------------------------------------------
A0A1H3KC95      ------------------------------------------------------------
A0A5P8Z4P3      ------------------------------------------------------------
A0A2E9HXF7      ------------------------------------------------------------
A0A0B3RZC9      ------------------------------------------------------------
A0A6F8QET1      ------------------------------------------------------------
A0A520HUH4      ------------------------------------------------------------
A0A2K8U7M6      ------------------------------------------------------------
A0A5B9DKL8      ------------------------------------------------------------
A0A238KJM1      ------------------------------------------------------------
A0A3A0FJZ4      ------------------------------------------------------------
W4HJV8          ------------------------------------------------------------
A0A0P1GDI0      ------------------------------------------------------------
A0A2R8ATV5      ------------------------------------------------------------
A0A1U7D3R6      ------------------------------------------------------------
A0A2D4UVV2      ------------------------------------------------------------
A0A0W7WHP4      ------------------------------------------------------------
A0A238J8F6      ------------------------------------------------------------
A0A238JQI6      ------------------------------------------------------------
A0A222E077      ------------------------------------------------------------
A0A239E3Y2      ------------------------------------------------------------
A0A1F9CFF0      ------------------------------------------------------------
A0A2M8B0G5      ------------------------------------------------------------
A0A363TNU9      ------------------------------------------------------------
A0A445MZQ4      ------------------------------------------------------------
A0A0M9E0E3      ------------------------------------------------------------
A0A351Z9A2      ------------------------------------------------------------
A0A6G6X2Z4      ------------------------------------------------------------
A0A0C5VQ86      ------------------------------------------------------------
A0A3S1WTQ1      ------------------------------------------------------------
A0A354EF47      ------------------------------------------------------------
A0A536T0W8      ------------------------------------------------------------
A0A2G6MSP7      ------------------------------------------------------------
A0A3N5FRH4      ------------------------------------------------------------
A0A1V4Y2C3      ------------------------------------------------------------
A0A2N2KTJ4      ------------------------------------------------------------
A0A2N2LQX0      ------------------------------------------------------------
A0A4U8YMP3      ------------------------------------------------------------
A0A1Q8QQ99      ------------------------------------------------------------
A0A7C2SIB2      ------------------------------------------------------------
A0A3D5ZY44      ------------------------------------------------------------
A0A1G5C236      ------------------------------------------------------------
A0A432HIS7      ------------------------------------------------------------
A0A401FQP5      ------------------------------------------------------------
A0A7C3Q9R6      ------------------------------------------------------------
A0A7C2AA26      ------------------------------------------------------------
A0A351Z4H9      ------------------------------------------------------------
A0A2N2KML4      ------------------------------------------------------------
E1YJF1          ------------------------------------------------------------
A0A1Q6DMW3      ------------------------------------------------------------
A0A3A6P8F8      ------------------------------------------------------------
A0A1J5EVZ6      ------------------------------------------------------------
A0A2G2DSM4      ------------------------------------------------------------
A0A1F9NI02      ------------------------------------------------------------
A0A4U1ABX4      ------------------------------------------------------------
A0A6L4AM84      ------------------------------------------------------------
A0A840UW68      ------------------------------------------------------------
A0A2G6FCC5      ------------------------------------------------------------
A0A1F9MR25      ------------------------------------------------------------
A0A2G6M7F1      ------------------------------------------------------------
A0A5Q2QDL1      ------------------------------------------------------------
A0A4Z0M4C7      ------------------------------------------------------------
A0A1V8MBH1      ------------------------------------------------------------
A0A7V9E085      ------------------------------------------------------------
A0A6J4X8D4      ------------------------------------------------------------
A0A1E7HSL6      ------------------------------------------------------------
A0A2M7JX59      ------------------------------------------------------------
A0A7V4PLT3      ------------------------------------------------------------
A0A7X7Y8R3      ------------------------------------------------------------
A0A832A361      ------------------------------------------------------------
A0A1M5GH86      ------------------------------------------------------------
A0A1W1XQZ5      ------------------------------------------------------------
A0A3D6C3I2      ------------------------------------------------------------
S0G1D4          ------------------------------------------------------------
A0A661T246      ------------------------------------------------------------
A0A850T4Q7      ------------------------------------------------------------
A0A2G6CSG7      ------------------------------------------------------------
A0A2G6NB59      ------------------------------------------------------------
A0A5K8A7T9      ------------------------------------------------------------
A0A1W9U045      ------------------------------------------------------------
A0A1F9L9G4      ------------------------------------------------------------
A0A328FD76      ------------------------------------------------------------
A0A348UX90      ------------------------------------------------------------
A0A357Z0N5      ------------------------------------------------------------
A0A0F2R2U0      ------------------------------------------------------------
A0A5K7ZK00      ------------------------------------------------------------
A0A5K7YCX8      ------------------------------------------------------------
A0A5K7Z388      ------------------------------------------------------------
A0A520CSP5      ------------------------------------------------------------
A0A1E7HFN0      ------------------------------------------------------------
A0A7J0BHG1      ------------------------------------------------------------
A0A6V8LMJ3      ------------------------------------------------------------
A0A2K8WHP8      ------------------------------------------------------------
A0A1J5N774      ------------------------------------------------------------
A0A2C8F781      ------------------------------------------------------------
A0A2E3R6G0      ------------------------------------------------------------
A0A7J0BUD3      ------------------------------------------------------------
A0A3M8EMP2      ------------------------------------------------------------
A0A2J6J6K6      ------------------------------------------------------------
A0A1F8XMK2      ------------------------------------------------------------
A0A661PSB9      ------------------------------------------------------------
A0A661QBT6      ------------------------------------------------------------
A0A6I2SLK2      ------------------------------------------------------------
A0A7Y7NC38      ------------------------------------------------------------
A0A0A8WSG4      ------------------------------------------------------------
S7TK97          ------------------------------------------------------------
S7UE93          ------------------------------------------------------------
A0A3D5BR56      ------------------------------------------------------------
A0A1I3PSR2      ------------------------------------------------------------
A0A2N2IB15      ------------------------------------------------------------
A0A7C8B5M6      ------------------------------------------------------------
A0A7V4UW39      ------------------------------------------------------------
A0A1W7QPT7      ------------------------------------------------------------
A0A6S6M1Y8      ------------------------------------------------------------
A0A6V8MCR2      ------------------------------------------------------------
A0A6V8N3X1      ------------------------------------------------------------
A0A6M4XJ81      ------------------------------------------------------------
A0A0M4D373      ------------------------------------------------------------
A0A1L3GKM9      ------------------------------------------------------------
A0A2T5R3J5      ------------------------------------------------------------
A0A1G6EKK9      ------------------------------------------------------------
A0A7C1DJX8      ------------------------------------------------------------
A0A3A4XVN3      ------------------------------------------------------------
A0A1E7JEV6      ------------------------------------------------------------
A0A2N2KDY5      ------------------------------------------------------------
A0A3N5YUD9      ------------------------------------------------------------
A0A4Q3ZDI7      ------------------------------------------------------------
A0A537PRC6      ------------------------------------------------------------
A0A7Y8L8B9      ------------------------------------------------------------
A0A5C4N0H6      ------------------------------------------------------------
A0A7V4UXV1      ------------------------------------------------------------
A0A7C3Y7G3      ------------------------------------------------------------
A0A7V5R3L0      ------------------------------------------------------------
A0A7V2SYN1      ------------------------------------------------------------
A0A6H9HII8      ------------------------------------------------------------
A0A7S6SHD5      ------------------------------------------------------------
A0A7C1UTU6      ------------------------------------------------------------
W9VVY5          ------------------------------------------------------------
A0A1E2URD3      ------------------------------------------------------------
A0A2T6MY81      ------------------------------------------------------------
A0A7Z0VN76      ------------------------------------------------------------
A0A2T6NBQ8      ------------------------------------------------------------
A0A421K431      ------------------------------------------------------------
A0A7C3Z8T7      ------------------------------------------------------------
A0A1V4QMH7      ------------------------------------------------------------
A0A496XZQ4      ------------------------------------------------------------
A0A7C3UZM2      ------------------------------------------------------------
A0A1F9BJF7      ------------------------------------------------------------
F2NDF5          ------------------------------------------------------------
A0A7Y4XWU8      ------------------------------------------------------------
A0A4V2SPR5      ------------------------------------------------------------
A0A7W8W7P8      ------------------------------------------------------------
A0A7W8WPN5      ------------------------------------------------------------
A0A519ERR1      ------------------------------------------------------------
A0A4Q3Q1M2      ------------------------------------------------------------
A0A4Q3MHR1      ------------------------------------------------------------
A0A520GDZ4      ------------------------------------------------------------
A0A372IH36      ------------------------------------------------------------
A0A540VW45      ------------------------------------------------------------
A0A1H9C241      ------------------------------------------------------------
A0A2E3FCR1      ------------------------------------------------------------
A0A4S3MG69      ------------------------------------------------------------
A0A3E0H727      ------------------------------------------------------------
A0A7X8XJJ0      ------------------------------------------------------------
A0A1I3TTC3      ------------------------------------------------------------
A0A1H3IZW6      ------------------------------------------------------------
A0A0M6YG59      ------------------------------------------------------------
A0A1H7G8B0      ------------------------------------------------------------
A0A2G2I5M1      ------------------------------------------------------------
A0A2G2M6F0      ------------------------------------------------------------
A0A352B502      ------------------------------------------------------------
A0A430DNP0      ------------------------------------------------------------
A0A410V446      ------------------------------------------------------------
A0A1B1UCM8      ------------------------------------------------------------
A0A1N6JQ20      ------------------------------------------------------------
A0A0R3KGJ5      ------------------------------------------------------------
A0A0R3N604      ------------------------------------------------------------
A0A1M5TI07      ------------------------------------------------------------
A3X191          ------------------------------------------------------------
A0A160UA87      ------------------------------------------------------------
A0A1Q5SFV5      ------------------------------------------------------------
A0A1H4RKV5      ------------------------------------------------------------
A0A7Z2Q199      ------------------------------------------------------------
A0A3A0FQ32      ------------------------------------------------------------
A0A7Y3GV54      ------------------------------------------------------------
A0A3E0WXH2      ------------------------------------------------------------
A0A1A9KEF8      ------------------------------------------------------------
A0A5E6PKN5      ------------------------------------------------------------
A0A0N9W1V6      ------------------------------------------------------------
A0A423GQ41      ------------------------------------------------------------
A0A423H7J2      ------------------------------------------------------------
A0A502HNM8      ------------------------------------------------------------
A0A4Q7H223      ------------------------------------------------------------
A0A1H4N2K9      ------------------------------------------------------------
A0A2K4KWF7      ------------------------------------------------------------
A0A1E4UZA0      ------------------------------------------------------------
A0A1H9KL56      ------------------------------------------------------------
A0A7X0BTK5      ------------------------------------------------------------
A0A2N2TRC8      ------------------------------------------------------------
A0A1V4CIZ7      ------------------------------------------------------------
A0A1M3BXA5      ------------------------------------------------------------
A0A1Y2R3U6      ------------------------------------------------------------
A0A167HVD6      ------------------------------------------------------------
A0A1V3SCT6      ------------------------------------------------------------
L0H287          ------------------------------------------------------------
A0A495VG93      ------------------------------------------------------------
A0A4R3MYM4      ------------------------------------------------------------
G2E3C0          ------------------------------------------------------------
A0A1W9J9F8      ------------------------------------------------------------
A0A2S5LFJ9      ------------------------------------------------------------
A0A2D8R8F8      ------------------------------------------------------------
A0A1G0KSD0      ------------------------------------------------------------
A0A4P6WX84      ------------------------------------------------------------
A0A1D2S760      ------------------------------------------------------------
A0A5B8RW94      ------------------------------------------------------------
A0A6I4JXQ8      ------------------------------------------------------------
A0A010SNS0      ------------------------------------------------------------
A0A0C2I782      ------------------------------------------------------------
A0A2N8BYF5      ------------------------------------------------------------
A0A558FKX2      ------------------------------------------------------------
A0A1H1DBA0      ------------------------------------------------------------
J3H699          ------------------------------------------------------------
A0A0K1QRZ4      ------------------------------------------------------------
A0A560RJW9      ------------------------------------------------------------
A0A5E7CRU7      ------------------------------------------------------------
A0A1H5J974      ------------------------------------------------------------
A0A5E7C564      ------------------------------------------------------------
A0A2W7MAV4      ------------------------------------------------------------
W6VFG3          ------------------------------------------------------------
A0A1P8ENT1      ------------------------------------------------------------
A0A2N7XRV4      ------------------------------------------------------------
A0A0Q6QPG8      ------------------------------------------------------------
A0A0F4SWA7      ------------------------------------------------------------
A0A423J219      ------------------------------------------------------------
A0A4P6G9U8      ------------------------------------------------------------
A0A4Y8JE06      ------------------------------------------------------------
A0A502I1X9      ------------------------------------------------------------
A0A502J776      ------------------------------------------------------------
A0A5B0EZF6      ------------------------------------------------------------
A0A059L434      ------------------------------------------------------------
A0A0F4UWN2      ------------------------------------------------------------
A0A5E7WEF5      ------------------------------------------------------------
A0A258TN88      ------------------------------------------------------------
A0A7Y8MN30      ------------------------------------------------------------
A0A3N5J7U8      ------------------------------------------------------------
A0A1S7S3I8      ------------------------------------------------------------
A0A655ZZQ1      ------------------------------------------------------------
A0A1S0ZAI3      ------------------------------------------------------------
A0A3C0L0A8      ------------------------------------------------------------
A0A176S762      ------------------------------------------------------------
A0A1W9WUD9      ------------------------------------------------------------
A0A1W1ZQK0      ------------------------------------------------------------
A0A7X1GRP5      ------------------------------------------------------------
A0A6I1R304      ------------------------------------------------------------
A0A1W9PMU6      ------------------------------------------------------------
A0A7Y4X3V7      ------------------------------------------------------------
A0A1G3VVY5      ------------------------------------------------------------
A0A7C3S273      ------------------------------------------------------------
A0A7C4WJ18      ------------------------------------------------------------
A0A351B422      ------------------------------------------------------------
F2NEE9          ------------------------------------------------------------
A0A7C3V565      ------------------------------------------------------------
A0A7V6A3E1      ------------------------------------------------------------
A0A318D3U4      ------------------------------------------------------------
A0A7V0JSN8      ------------------------------------------------------------
A0A7V5V784      ------------------------------------------------------------
A0A352Q5C1      ------------------------------------------------------------
A0A355TB56      ------------------------------------------------------------
A0A1F9E324      ------------------------------------------------------------
A0A435NNF5      ------------------------------------------------------------
A0A3S2AQS7      ------------------------------------------------------------
A0A527ZPD6      ------------------------------------------------------------
A0A529KRW3      ------------------------------------------------------------
A0A530ZLX0      ------------------------------------------------------------
A0A4Q3LBH4      ------------------------------------------------------------
A0A4Q3LWP3      ------------------------------------------------------------
A0A7C3JPP4      ------------------------------------------------------------
A0A534V9L7      ------------------------------------------------------------
A0A7C3JJT4      ------------------------------------------------------------
A0A524M660      ------------------------------------------------------------
A0A7C3JSX5      ------------------------------------------------------------
A0A7I8MQ67      ------------------------------------------------------------
A0A0C1TRU6      ------------------------------------------------------------
A0A2Z5SSF4      ------------------------------------------------------------
A0A7Y7TF97      ------------------------------------------------------------
A0A4Q4CIB1      ------------------------------------------------------------
A0A522ACJ9      ------------------------------------------------------------
A0A3N5Z7F8      ------------------------------------------------------------
A0A239HD34      ------------------------------------------------------------
A0A3D2M6Y9      ------------------------------------------------------------
A0A519E8D7      ------------------------------------------------------------
A0A3S1FD32      ------------------------------------------------------------
A0A434DUT4      ------------------------------------------------------------
A0A528D3U3      ------------------------------------------------------------
A0A3S3UPT3      ------------------------------------------------------------
A0A3S1E286      ------------------------------------------------------------
A0A531AC71      ------------------------------------------------------------
A0A436K268      ------------------------------------------------------------
A0A434IDQ0      ------------------------------------------------------------
A0A435IRM5      ------------------------------------------------------------
A0A3S2C404      ------------------------------------------------------------
A0A435F6C0      ------------------------------------------------------------
A0A435BMN6      ------------------------------------------------------------
A0A529XQ54      ------------------------------------------------------------
A0A530BJC1      ------------------------------------------------------------
A0A0P7ZZE4      ------------------------------------------------------------
A0A369R0Q9      ------------------------------------------------------------
A0A327LYE6      ------------------------------------------------------------
A0A5A9ZTV3      ------------------------------------------------------------
A0A258WKV0      ------------------------------------------------------------
A5G4N9          ------------------------------------------------------------
A0A812HT29      ------------------------------------------------------------
A0A444IY46      ------------------------------------------------------------
A0A6I7N627      ------------------------------------------------------------
A0A1V5DJV0      ------------------------------------------------------------
A0A520IUC4      ------------------------------------------------------------
A0A7Y7M8F4      ------------------------------------------------------------
A0A0P1FWI8      ------------------------------------------------------------
A0A6L8LHC6      ------------------------------------------------------------
A0A848ST88      ------------------------------------------------------------
A0A7U1HWF1      ------------------------------------------------------------
A0A534SH66      ------------------------------------------------------------
A0A3M0ZZ99      ------------------------------------------------------------
A0A238LBD3      ------------------------------------------------------------
A0A537NZJ1      ------------------------------------------------------------
A0A7C4R3C4      ------------------------------------------------------------
A0A0P1FRV5      ------------------------------------------------------------
A0A4Q4CVW6      ------------------------------------------------------------
A0A8B6LS25      ------------------------------------------------------------
A0A6L3ZWI0      ------------------------------------------------------------
A0A1M7BLL7      ------------------------------------------------------------
A0A0H4KZM1      ------------------------------------------------------------
A0A7V2W904      ------------------------------------------------------------
A0A1V1UJT2      ------------------------------------------------------------
A0A0L6CVX1      ------------------------------------------------------------
A0A1V0RR48      ------------------------------------------------------------
A0A0A0HJJ4      ------------------------------------------------------------
A0A5E7YA28      ------------------------------------------------------------
A0A316KRG4      ------------------------------------------------------------
A0A0J5Q9T7      ------------------------------------------------------------
A0A1I5YYQ0      ------------------------------------------------------------
A0A5P9FE62      ------------------------------------------------------------
A0A7U3CQW5      ------------------------------------------------------------
X7F6S5          ------------------------------------------------------------
A0A1G8NKI0      ------------------------------------------------------------
A0A355QPE4      ------------------------------------------------------------
A0A357RN98      ------------------------------------------------------------
A0A1I6U4V1      ------------------------------------------------------------
A0A6B2P8H8      ------------------------------------------------------------
A0A1P8USW9      ------------------------------------------------------------
A0A1G7CFZ2      ------------------------------------------------------------
A0A7G2TPW1      ------------------------------------------------------------
A0A1V6FYJ1      ------------------------------------------------------------
A0A4Q3IRI1      ------------------------------------------------------------
A0A7J5VV32      ------------------------------------------------------------
A0A1E7H876      ------------------------------------------------------------
A0A7C1C6X5      ------------------------------------------------------------
A0A7X1GMT8      ------------------------------------------------------------
Q44570          ------------------------------------------------------------
A0A509L3P8      ------------------------------------------------------------
A0A3A4S038      ------------------------------------------------------------
A0A1F9N669      ------------------------------------------------------------
A0A1F9PFA7      ------------------------------------------------------------
A0A1H2EN09      ------------------------------------------------------------
K0NP00          ------------------------------------------------------------
A0A2N6BZD5      ------------------------------------------------------------
A0A0F2NF69      ------------------------------------------------------------
A0A1F9NFD0      ------------------------------------------------------------
A0A1W9M770      ------------------------------------------------------------
A0A1W9M7R6      ------------------------------------------------------------
A0A7W0IR34      ------------------------------------------------------------
A0A7V5FUI1      ------------------------------------------------------------
A0A7T6AQC8      ------------------------------------------------------------
A0A7U4DQ89      ------------------------------------------------------------
A0A1M5YLH5      ------------------------------------------------------------
A0A4U1A4C7      ------------------------------------------------------------
A0A7C4N0I9      ------------------------------------------------------------
A0A1V4M8I1      ------------------------------------------------------------
A0A7C0XE92      ------------------------------------------------------------
A0A7U4QIX5      ------------------------------------------------------------
A0A800BQ44      ------------------------------------------------------------
A0A1E7JCL5      ------------------------------------------------------------
A0A7Z9XET3      ------------------------------------------------------------
A0A800C5N3      ------------------------------------------------------------
A0A496YAH9      ------------------------------------------------------------
A0A1V4S7E4      ------------------------------------------------------------
A0A847DGI3      ------------------------------------------------------------
A0A2N2H8D2      ------------------------------------------------------------
A0A2N2KC63      ------------------------------------------------------------
A0A3A4ZYW4      ------------------------------------------------------------
A0A800BMM4      ------------------------------------------------------------
A0A1V4MCJ4      ------------------------------------------------------------
A0A661M0W4      ------------------------------------------------------------
A0A3N5RNY4      ------------------------------------------------------------
A0A1M7Y300      ------------------------------------------------------------
A0A4U1ALN4      ------------------------------------------------------------
A0A849F908      ------------------------------------------------------------
A0A2N6BEI9      ------------------------------------------------------------
A0A0D5N3E9      ------------------------------------------------------------
A0A2N2G716      ------------------------------------------------------------
A0A1F9EUS2      ------------------------------------------------------------
A0A3N9VAW3      ------------------------------------------------------------
A0A6I1KNW9      ------------------------------------------------------------
A0A1H4B8T3      ------------------------------------------------------------
A0A1E7IQC3      ------------------------------------------------------------
A0A1M6KEN5      ------------------------------------------------------------
A0A1X0YE57      ------------------------------------------------------------
A0A2K2H9Q8      ------------------------------------------------------------
A0A1F8X5S3      ------------------------------------------------------------
A0A353QLL3      ------------------------------------------------------------
A0A847C207      ------------------------------------------------------------
A0A399I453      ------------------------------------------------------------
A0A651FBV9      ------------------------------------------------------------
A0A562VHD2      ------------------------------------------------------------
A0A7K0J0R7      ------------------------------------------------------------
A0A6I6JNB5      ------------------------------------------------------------
A0A847UFK5      ------------------------------------------------------------
A0A1G0LDK7      ------------------------------------------------------------
A0A6F9WVL7      ------------------------------------------------------------
A0A7Y7TLN9      ------------------------------------------------------------
A0A5C1MDH8      ------------------------------------------------------------
A0A7J4ZSX4      ------------------------------------------------------------
A0A5A9XE04      ------------------------------------------------------------
A0A643G9R1      ------------------------------------------------------------
A0A1G0M8Q7      ------------------------------------------------------------
A0A353MI14      ------------------------------------------------------------
A0A4S1CAW7      ------------------------------------------------------------
A0A655R819      ------------------------------------------------------------
A0A655RNN3      ------------------------------------------------------------
A0A354EI73      ------------------------------------------------------------
A0A6D0ELN7      ------------------------------------------------------------
A0A0B8PTA8      ------------------------------------------------------------
A0A0B8QF75      ------------------------------------------------------------
A0A4U9I390      ------------------------------------------------------------
A0A2X3M011      ------------------------------------------------------------
A0A2H9EHM4      ------------------------------------------------------------
A0A380B3D7      ------------------------------------------------------------
F5NSX0          ------------------------------------------------------------
A0A7A9K1G5      ------------------------------------------------------------
A0A811C967      ------------------------------------------------------------
A0A479JNB1      ------------------------------------------------------------
A0A5C9AF52      ------------------------------------------------------------
A0A6D0EYC7      ------------------------------------------------------------
D8EEU7          ------------------------------------------------------------
A0A0R0BVC7      ------------------------------------------------------------
A0A4U8YLL7      ------------------------------------------------------------
A0A2M7WWF7      ------------------------------------------------------------
A0A534QGR3      ------------------------------------------------------------
A0A0Q6QV61      ------------------------------------------------------------
A0A2Z3IKG4      ------------------------------------------------------------
B7RS54          ------------------------------------------------------------
A0A7R7CAD2      ------------------------------------------------------------
A0A7R7CQL5      ------------------------------------------------------------
A0A1I3XJ27      ------------------------------------------------------------
A0A562CGU2      ------------------------------------------------------------
A0A7C9VCB3      ------------------------------------------------------------
A0A1I7DCG1      ------------------------------------------------------------
A0A3A3H6D9      ------------------------------------------------------------
A0A0Q6VA36      ------------------------------------------------------------
A0A1B2EQN1      ------------------------------------------------------------
A0A1G8QZS5      ------------------------------------------------------------
A0A1H2Y469      ------------------------------------------------------------
A0A497ZQU7      ------------------------------------------------------------
A0A443K010      ------------------------------------------------------------
A0A6I7NYG5      ------------------------------------------------------------
A0A1I0R9R6      ------------------------------------------------------------
A0A2N3BVE7      ------------------------------------------------------------
A0A7C2IB02      ------------------------------------------------------------
A0A6N6SI00      ------------------------------------------------------------
A0A2S5JE21      ------------------------------------------------------------
A0A2R8BKZ2      ------------------------------------------------------------
A0A2S8S361      ------------------------------------------------------------
A0A1X7ACC1      ------------------------------------------------------------
A0A238KUF6      ------------------------------------------------------------
A0A095CTW3      ------------------------------------------------------------
A0A2E3UGD6      ------------------------------------------------------------
A0A840CE00      ------------------------------------------------------------
A0A2T0RFH0      ------------------------------------------------------------
A0A285D390      ------------------------------------------------------------
A0A497VHN4      ------------------------------------------------------------
A0A6M1UAR9      ------------------------------------------------------------
A0A520ZTR8      ------------------------------------------------------------
A0A7Y2NU38      ------------------------------------------------------------
A0A849GJU0      ------------------------------------------------------------
A0A316GHM6      ------------------------------------------------------------
A0A848VYK1      ------------------------------------------------------------
A0A7C9INT8      ------------------------------------------------------------
A0A238IZI1      ------------------------------------------------------------
A0A7Y2U0H6      ------------------------------------------------------------
A0A848WN80      ------------------------------------------------------------
A0A1I6ENM4      ------------------------------------------------------------
A0A2E2P4I0      ------------------------------------------------------------
A0A2U2CM86      ------------------------------------------------------------
A0A212AR83      ------------------------------------------------------------
A0A2M8J3R9      ------------------------------------------------------------
A0A1I6X762      ------------------------------------------------------------
A0A843YIS7      ------------------------------------------------------------
A0A0P1EFX8      ------------------------------------------------------------
A0A2G5KB39      ------------------------------------------------------------
A8LNM8          ------------------------------------------------------------
A0A844B423      ------------------------------------------------------------
A0A0T5NSU3      ------------------------------------------------------------
A0A5P9I718      ------------------------------------------------------------
A0A2N3CNV1      ------------------------------------------------------------
A0A257F1F4      ------------------------------------------------------------
A0A2D5J8T8      ------------------------------------------------------------
A0A2E3P9W6      ------------------------------------------------------------
A0A2G2B1P9      ------------------------------------------------------------
A0A258GCD5      ------------------------------------------------------------
A0A443INY4      ------------------------------------------------------------
A0A2D9YR88      ------------------------------------------------------------
A0A4Q3ZBK4      ------------------------------------------------------------
A0A1G9FY29      ------------------------------------------------------------
A0A6N9RUN2      ------------------------------------------------------------
A0A1W9HS52      ------------------------------------------------------------
A0A2D5LFD8      ------------------------------------------------------------
A0A4D8PLT4      -------------------------------------------------------MIIYD
A0A1G3JY11      ------------------------------------------------------------
A0A3A4NIE9      ------------------------------------------------------------
A0A3A4NUI9      ------------------------------------------------------------
A0A524I3Z6      ------------------------------------------------------------
A0A524PCL7      ------------------------------------------------------------
A0A356GQV1      ------------------------------------------------------------
A0A1J5DAY8      ------------------------------------------------------------
A0A524P237      ------------------------------------------------------------
A0A4P7EP83      ------------------------------------------------------------
A0A348SRI7      ------------------------------------------------------------
A0A833GQE1      ------------------------------------------------------------
A0A661N3U1      ------------------------------------------------------------
A0A7X1T426      ------------------------------------------------------------
A0A432SAI6      ------------------------------------------------------------
A0A855HUH5      ------------------------------------------------------------
A0A6L6H5T1      ------------------------------------------------------------
A0A7V5C3K7      ------------------------------------------------------------
A0A7Y9AV38      ------------------------------------------------------------
A0A2W5J775      ------------------------------------------------------------
A0A3M3H5V6      ------------------------------------------------------------
A0A7V2YBQ6      ------------------------------------------------------------
A0A7X8Z4Y1      ------------------------------------------------------------
A0A377ZC40      ------------------------------------------------------------
A0A534XP85      ------------------------------------------------------------
A0A377LY04      ------------------------------------------------------------
A0A2X3K9R3      ------------------------------------------------------------
A0A484X141      ------------------------------------------------------------
A0A5N9VWI6      ------------------------------------------------------------
A0A5C9ABR5      ------------------------------------------------------------
A0A6D0EJQ0      ------------------------------------------------------------
A0A444R390      ------------------------------------------------------------
A0A376LLF8      ------------------------------------------------------------
A0A6L7CT21      ------------------------------------------------------------
A0A378BPJ7      ------------------------------------------------------------
A0A377ZDN3      ------------------------------------------------------------
A0A2J5PAJ7      ------------------------------------------------------------
A0A7Z9CQS8      ------------------------------------------------------------
A0A2W4RFS2      ------------------------------------------------------------
A0A1Y6DC43      ------------------------------------------------------------
A0A2S6HE06      ------------------------------------------------------------
G3J0M3          ------------------------------------------------------------
V5C6R5          ------------------------------------------------------------
A0A7V0Z1K0      ------------------------------------------------------------
A0A7Y8IFK0      ------------------------------------------------------------
A0A4Q2XLV7      ------------------------------------------------------------
A0A4Q5QYC4      ------------------------------------------------------------
A0A0U2VAW2      ------------------------------------------------------------
A0A454CTF1      ------------------------------------------------------------
A0A6B3Q2G1      ------------------------------------------------------------
A0A6N9S3L5      ------------------------------------------------------------
A0A656BWB0      ------------------------------------------------------------
A0A6D0IFH4      ------------------------------------------------------------
A0A0A0FHV8      ------------------------------------------------------------
A0A2I8SDU4      ------------------------------------------------------------
A0A2I8SU55      ------------------------------------------------------------
A0A7I6T806      ------------------------------------------------------------
A0A7I6TQE9      ------------------------------------------------------------
A0A7I6U296      ------------------------------------------------------------
S1EXJ6          ------------------------------------------------------------
A0A376UBS1      ------------------------------------------------------------
A0A4Q6G931      ------------------------------------------------------------
A0A2T0VBD8      ------------------------------------------------------------
A0A7W5DMU7      ------------------------------------------------------------
A0A378APS2      ------------------------------------------------------------
A0A443VCQ6      ------------------------------------------------------------
A0A447RKQ7      ------------------------------------------------------------
W1DSK1          ------------------------------------------------------------
A0A2N1XK22      ------------------------------------------------------------
A0A850R066      ------------------------------------------------------------
A0A1W9F5M9      ------------------------------------------------------------
A0A352MMI7      ------------------------------------------------------------
A0A4Z0LWV1      ------------------------------------------------------------
A0A376RY66      ------------------------------------------------------------
A0A377K431      ------------------------------------------------------------
A0A6D0I9G1      ------------------------------------------------------------
A0A379W6R2      ------------------------------------------------------------
A0A379TA56      ------------------------------------------------------------
A0A655C5P0      ------------------------------------------------------------
A0A3C2BN18      ------------------------------------------------------------
A0A447LR75      ------------------------------------------------------------
A0A759KJJ5      ------------------------------------------------------------
A0A376D8L7      ------------------------------------------------------------
A0A1V2FV46      ------------------------------------------------------------
A0A6N8QLT3      ------------------------------------------------------------
A0A376SB61      ------------------------------------------------------------
A0A3D1BYV9      ------------------------------------------------------------
A0A3P5DSS6      ------------------------------------------------------------
A0A483YEL5      ------------------------------------------------------------
A0A844PX38      ------------------------------------------------------------
A0A8B4SQI1      ------------------------------------------------------------
A0A483QWI8      ------------------------------------------------------------
A0A483UXD3      ------------------------------------------------------------
A0A0A8J8L3      ------------------------------------------------------------
A0A660DJ38      ------------------------------------------------------------
A0A378G3G7      ------------------------------------------------------------
A0A2X5NHJ9      ------------------------------------------------------------
A0A2J4QEC3      ------------------------------------------------------------
A0A485ADM3      ------------------------------------------------------------
A0A3D0KAC8      ------------------------------------------------------------
A0A4U9HGU4      ------------------------------------------------------------
A0A3S4JGG5      ------------------------------------------------------------
A0A377ZDH2      ------------------------------------------------------------
A0A3S4HTS8      ------------------------------------------------------------
A0A3N5MZ53      ------------------------------------------------------------
A0A534E4H4      ------------------------------------------------------------
A0A534I2B6      ------------------------------------------------------------
A0A1C2JGD0      ------------------------------------------------------------
A0A259LQ70      ------------------------------------------------------------
A0A3N5PM86      ------------------------------------------------------------
A0A2E5YSA4      ------------------------------------------------------------
A0A0N0XAV4      ------------------------------------------------------------
A0A0P9QD19      ------------------------------------------------------------
F3FHG4          ------------------------------------------------------------
F3GGI0          ------------------------------------------------------------
A0A0P9LE74      ------------------------------------------------------------
A0A3M4ZQ14      MCAAAAPCRTPGQPRAAAPGRADPGDGTAAHARPAQVRARSTWQNFLDWPVARPARSRCS
A0A3M5YLE8      MCAAAAPCRTPGQPRAAAPGRADPGDGTAAHARPAQVRARSTWQNFLDWPVARPARSRCS
A0A3M3RP89      MCAAAAPCRTPGQPRAAAPGRADPGDGTAAHARPAQVRARSTWQNFLDWPVARPARSRCS
A0A0P9QIY7      MCAAAAPCRTPGQPRAAAPGRADPGDGTAAHARPAQVRARSTWQNFLDWPVARPARSRCS
A0A0P9VVH7      MCAAAAPCRTPGQPRAAAPGRADPGDGTAAHARPAQVRARSTWQNFLDWPVARPARSRCS
A0A0Q0FJK6      MCAAAAPCRTPGQPRAAAPGRADPGDGTAAHARPAQVRARSTWQNFLDWPVARPARSRCS
A0A3M3LF66      MCAAAAPCRTPGQPRAAAPGRADPGDGTAAHARPAQVRARSTWQNFLDWPVARPARSRCS
A0A0P9WIR8      MCAAAAPCRTPGQPRAAAPGRADPGDGTAAHARPAQVRARSTWQNFLDWPVARPARSRCS
A0A3M3KPE5      ------------------------------------------------------------
A0A3M4C263      ------------------------------------------------------------
A0A3M5AD05      ------------------------------------------------------------
A0A0Q0D3D2      ------------------------------------------------------------
A0A0N0FS39      ------------------------------------------------------------
A0A3M6GHH2      ------------------------------------------------------------
A0A0P9R9W0      ------------------------------------------------------------
A0A0Q0B9T0      ------------------------------------------------------------
A0A3M6CFI7      ------------------------------------------------------------
A0A0P9JXN0      ------------------------------------------------------------
A0A3M6FIV7      ------------------------------------------------------------
A0A3M3PLW9      ------------------------------------------------------------
A0A3M4ENY1      ------------------------------------------------------------
A0A3M5EZK7      ------------------------------------------------------------
A0A0P9SPP5      ------------------------------------------------------------
A0A658KL17      ------------------------------------------------------------
A0A3M3NNF2      ------------------------------------------------------------
A0A7Z6UK49      ------------------------------------------------------------
A0A3M4A0E8      ------------------------------------------------------------
A0A3M4PBZ2      ------------------------------------------------------------
A0A7Z6U7Q8      ------------------------------------------------------------
A0A3M6AI26      ------------------------------------------------------------
A0A0P9IWP8      ------------------------------------------------------------
A0A0P9KZ49      ------------------------------------------------------------
A0A0P9V840      ------------------------------------------------------------
A0A0Q0AIE5      ------------------------------------------------------------
A0A3M2ZQH6      ------------------------------------------------------------
A0A0N8SQG2      ------------------------------------------------------------
A0A0W8HFU1      ------------------------------------------------------------
A0A0P9VHH8      ------------------------------------------------------------
A0A0P9YV98      ------------------------------------------------------------
A0A3M3G2W8      ------------------------------------------------------------
A0A3M6C224      ------------------------------------------------------------
A0A0P9SCD7      ------------------------------------------------------------
A0A0P9T4G3      ------------------------------------------------------------
A0A0P9VKB0      ------------------------------------------------------------
A0A0Q0BM35      ------------------------------------------------------------
A0A3M3TPR7      ------------------------------------------------------------
A0A3M3U4Q3      ------------------------------------------------------------
A0A8B3FSE5      ------------------------------------------------------------
A0A3M5K254      ------------------------------------------------------------
A0A7V8M007      ------------------------------------------------------------
A0A3M5JFB0      ------------------------------------------------------------
A0A3M3TQV3      ------------------------------------------------------------
A0A3M4A376      ------------------------------------------------------------
A0A3M3EF92      ------------------------------------------------------------
A0A3M5J1E2      ------------------------------------------------------------
A0A3M5M873      ------------------------------------------------------------
A0A3M5G7H9      ------------------------------------------------------------
A0A0Q0A5T8      ------------------------------------------------------------
A0A0P9QCJ2      ------------------------------------------------------------
A0A0P9UCX7      ------------------------------------------------------------
A0A0P9Q329      ------------------------------------------------------------
A0A3M5GJ64      ------------------------------------------------------------
A0A0P9S1F1      ------------------------------------------------------------
A0A3M2XYQ3      ------------------------------------------------------------
A0A0P9XCE1      ------------------------------------------------------------
A0A3M3EFX7      ------------------------------------------------------------
A0A3M5B9D9      ------------------------------------------------------------
A0A0P9RRZ3      ------------------------------------------------------------
A0A3M2VEK7      ------------------------------------------------------------
A0A0N8R9B3      ------------------------------------------------------------
A0A0P9VA27      ------------------------------------------------------------
A0A3M4YBJ4      ------------------------------------------------------------
A0A0P9J470      ------------------------------------------------------------
A0A0Q0EVJ8      ------------------------------------------------------------
A0A3M5UI30      ------------------------------------------------------------
A0A3M5YQT8      ------------------------------------------------------------
A0A3M5F5X1      ------------------------------------------------------------
A0A3M5R8G1      ------------------------------------------------------------
A0A3M5V012      ------------------------------------------------------------
A0A3M3GA16      ------------------------------------------------------------
A0A3M3CJL0      ----------------------------------------------------MAGPARHH
A0A3M3F6F5      ----------------------------------------------------MAGPARHH
A0A3M3P9B7      ----------------------------------------------------MAGPARHH
A0A0N8QB74      ----------------------------------------------------MAGPARHH
A0A0Q0AUD0      ----------------------------------------------------MAGPARHH
A0A3M5VR55      ----------------------------------------------------MAGPARHH
A0A0Q0FK97      ----------------------------------------------------MAGPARHN
A0A3M3UCT3      ----------------------------------------------------MAGPARHH
A0A7Z6Y5I3      ----------------------------------------------------MAGPARHH
A0A3M5KZ75      ------------------------------------------------------------
A0A3M5L3G5      ------------------------------------------------------------
A0A7Y2TRV5      ------------------------------------------------------------
A0A318DSU0      ------------------------------------------------------------
A0A538PF21      ------------------------------------------------------------
A0A1W1ZH10      ------------------------------------------------------------
A0A1W2FF24      ------------------------------------------------------------
A0A524JYQ6      ------------------------------------------------------------
A0A4Q3MA17      ------------------------------------------------------------
A0A0N0M5F7      ------------------------------------------------------------
A0A537M754      ------------------------------------------------------------
A0A1V1PDB4      ------------------------------------------------------------
A0A2M7C324      ------------------------------------------------------------
A0A4Q3HHG6      ------------------------------------------------------------
A0A3B7DTA4      ------------------------------------------------------------
A0A432ZK62      ------------------------------------------------------------
A0A1V5EEP4      ------------------------------------------------------------
A0A1V5EF48      ------------------------------------------------------------
A0A0S6X1X6      ------------------------------------------------------------
A0A537Y5L8      ------------------------------------------------------------
A0A4Q3L2X2      ------------------------------------------------------------
A0A4Q3T8J1      ------------------------------------------------------------
A0A4Q4ANM4      ------------------------------------------------------------
A0A4Q3UEC7      ------------------------------------------------------------
A0A1H5YYQ4      ------------------------------------------------------------
A0A1X4NLK2      ------------------------------------------------------------
A0A1X4NWB5      ------------------------------------------------------------
A0A1M5UQ38      ------------------------------------------------------------
A0A327YI48      ------------------------------------------------------------
A0A1B1PNL6      ------------------------------------------------------------
A0A2U8H9H9      ------------------------------------------------------------
A0A845UXY6      ------------------------------------------------------------
A0A1X6YIC0      ------------------------------------------------------------
A0A1I5E9E9      ------------------------------------------------------------
A0A1X6Z7N7      ------------------------------------------------------------
A0A2E1DQ13      ------------------------------------------------------------
A0A1H8C800      ------------------------------------------------------------
A0A2N3EZ05      ------------------------------------------------------------
A0A844ZIR7      ------------------------------------------------------------
A0A850H7C5      ------------------------------------------------------------
A0A845AYQ8      ------------------------------------------------------------
A0A0W1DLQ3      ------------------------------------------------------------
A0A246JVD8      ------------------------------------------------------------
A0A2N3BB54      ------------------------------------------------------------
A0A1H6G7A3      ------------------------------------------------------------
A0A0A7PGL6      ------------------------------------------------------------
A0A4Q2Z4L0      ------------------------------------------------------------
A0A7W0BRL7      ------------------------------------------------------------
A0A0W1GMS6      ------------------------------------------------------------
A0A0Q8RMY3      ------------------------------------------------------------
A0A1A7QC21      ------------------------------------------------------------
A0A832FJD1      ------------------------------------------------------------
A0A7C0U459      ------------------------------------------------------------
A0A7W0ITF0      ------------------------------------------------------------
A0A832C120      ------------------------------------------------------------
A0A318CT66      ------------------------------------------------------------
A0A3N5P205      ------------------------------------------------------------
A0A2G9XLE5      ------------------------------------------------------------
A0A6L3MM74      ------------------------------------------------------------
A0A7X8CDM1      ------------------------------------------------------------
A0A7C3QM04      ------------------------------------------------------------
A0A7I8MVM0      ------------------------------------------------------------
A0A7C0Y3J7      ------------------------------------------------------------
A0A7C3LF61      ------------------------------------------------------------
A0A4R1HDF2      ------------------------------------------------------------
A0A6N1DL48      ------------------------------------------------------------
A0A534HBS8      ------------------------------------------------------------
E1Y9C0          ------------------------------------------------------------
A0A1N6SH58      ------------------------------------------------------------
A0A4Q3AQN2      ------------------------------------------------------------
                                                                            

A0A1M6N1X5      ------------------------------------------------------------
A0A561M3U0      ------------------------------------------------------------
A0A2T4ZJZ6      ------------------------------------------------------------
A0A1T2KYM8      ------------------------------------------------------------
A0A2G9ZR82      ------------------------------------------------------------
A0A6J4YZ98      ------------------------------------------------------------
A0A844XH11      ------------------------------------------------------------
A0A0P1H2H0      ------------------------------------------------------------
A0A377N8F8      ------------------------------------------------------------
A0A4Q3LR91      ------------------------------------------------------------
A0A6C9IKN8      ------------------------------------------------------------
A0A4V1TR68      ------------------------------------------------------------
A0A6L3ZR06      ------------------------------------------------------------
A0A3E0WKI3      ------------------------------------------------------------
A0A1H3I2J1      ------------------------------------------------------------
A0A521LJG5      ------------------------------------------------------------
A0A1V4WHZ7      ------------------------------------------------------------
A0A1E5AJN5      ------------------------------------------------------------
A0A2N3D2J1      ------------------------------------------------------------
A0A2N2GVE1      ------------------------------------------------------------
A0A2N2INV3      ------------------------------------------------------------
A0A233IKJ2      ------------------------------------------------------------
A0A1Y5DXG5      ------------------------------------------------------------
A0A0B8P2H5      ------------------------------------------------------------
A0A380AQW6      ------------------------------------------------------------
A0A2G2GD62      ------------------------------------------------------------
A0A524P331      ------------------------------------------------------------
A0A4V1SSM5      ------------------------------------------------------------
A0A4Q3K8G7      ------------------------------------------------------------
A0A7C7W7M2      ------------------------------------------------------------
A0A1M7HC79      ------------------------------------------------------------
A0A1D3JZN6      ------------------------------------------------------------
A0A1V6ESG1      ------------------------------------------------------------
A0A850NXS7      ------------------------------------------------------------
A0A1H7YHK3      ------------------------------------------------------------
A0A3S1MCW7      ------------------------------------------------------------
A0A528AX40      ------------------------------------------------------------
A0A528MV95      ------------------------------------------------------------
A0A838IR38      ------------------------------------------------------------
A0A328C2K5      ------------------------------------------------------------
A0A5C6X8M3      ------------------------------------------------------------
A0A3D8MRR7      ------------------------------------------------------------
A0A5C6UBJ7      ------------------------------------------------------------
A0A5C6XGM3      ------------------------------------------------------------
A0A849WSS0      ------------------------------------------------------------
A0A7Y3GUU1      ------------------------------------------------------------
A0A090R136      ------------------------------------------------------------
A0A661JU93      ------------------------------------------------------------
A0A0M3GBT1      ------------------------------------------------------------
B3Q577          ------------------------------------------------------------
A0A3R9C3P5      ------------------------------------------------------------
A0A7W6FJX0      ------------------------------------------------------------
A0A2E2T3V8      ------------------------------------------------------------
A0A367UAB4      ------------------------------------------------------------
A0A1F2ZW35      ------------------------------------------------------------
A0A377V641      ------------------------------------------------------------
A0A1F2YJ88      ------------------------------------------------------------
A0A5N8AL61      ------------------------------------------------------------
A0A0J7XGZ1      ------------------------------------------------------------
I4CBA7          ------------------------------------------------------------
A3VE95          ------------------------------------------------------------
A0A1G0NL95      ------------------------------------------------------------
A0A024KA69      ------------------------------------------------------------
A0A0L1KFN4      ------------------------------------------------------------
A0A3D5UYX7      ------------------------------------------------------------
A0A524QFS4      ------------------------------------------------------------
A0A832MZU0      ------------------------------------------------------------
A0A520JSW4      ------------------------------------------------------------
A0A4Q3LTF3      ------------------------------------------------------------
A0A840SQK7      ------------------------------------------------------------
A0A7C3N3Y1      ------------------------------------------------------------
A0A537UTP9      ------------------------------------------------------------
A0A1D2RNR5      ------------------------------------------------------------
A0A4V1TQ46      ------------------------------------------------------------
A0A3A0FZC0      ------------------------------------------------------------
A0A1N7JVZ7      ------------------------------------------------------------
A0A091C4A8      ------------------------------------------------------------
A0A844YBH7      ------------------------------------------------------------
A0A4R3H6P6      ------------------------------------------------------------
A0A3S1NQ09      ------------------------------------------------------------
A0A443GJ52      ------------------------------------------------------------
A0A2W6S588      ------------------------------------------------------------
A0A483E0N4      ------------------------------------------------------------
A0A2J4YQQ6      ------------------------------------------------------------
A0A483THX4      ------------------------------------------------------------
A0A534MVS2      ------------------------------------------------------------
A0A444I5K6      ------------------------------------------------------------
A0A154VE85      ------------------------------------------------------------
A0A3C1S9Y1      ------------------------------------------------------------
A0A353EH49      ------------------------------------------------------------
A0A1Y1Q9C1      ------------------------------------------------------------
A0A3M7LJH0      ------------------------------------------------------------
A0A1E4JHX8      ------------------------------------------------------------
M2U8P2          ------------------------------------------------------------
A0A1H7KZF8      ------------------------------------------------------------
A0A6N3UC48      ------------------------------------------------------------
A0A257NG76      ------------------------------------------------------------
A0A1T4TW59      ------------------------------------------------------------
A0A1Q3MB35      ------------------------------------------------------------
A0A259LUN7      ------------------------------------------------------------
A0A2D7AVL1      ------------------------------------------------------------
A0A3B9KZE9      ------------------------------------------------------------
A0A358L616      ------------------------------------------------------------
A0A4U9HNE9      ------------------------------------------------------------
A0A7X7Z1H8      ------------------------------------------------------------
A0A7C5N053      ------------------------------------------------------------
A0A2G2CXY6      ------------------------------------------------------------
A0A3M1D4H3      ------------------------------------------------------------
A0A7C1A2A2      ------------------------------------------------------------
A0A840RX77      ------------------------------------------------------------
A0A5C8BYM7      ------------------------------------------------------------
A0A7V2RUR3      ------------------------------------------------------------
A0A1J5ICP0      ------------------------------------------------------------
A0A379B9V4      ------------------------------------------------------------
A0A0Q6TS97      ------------------------------------------------------------
A0A0Q6UYB4      ------------------------------------------------------------
W7Q5J0          ------------------------------------------------------------
A0A654AKT6      ------------------------------------------------------------
A0A847E0Q2      ------------------------------------------------------------
A0A7W9WQN4      ------------------------------------------------------------
A0A0G9MZA5      ------------------------------------------------------------
H0T8B0          ------------------------------------------------------------
A0A7Y4X614      ------------------------------------------------------------
A0A5C7N981      ------------------------------------------------------------
A0A534TV22      ------------------------------------------------------------
A0A351CXR4      ------------------------------------------------------------
A0A2N6GLF5      ------------------------------------------------------------
A0A1W9LJP0      ------------------------------------------------------------
A0A0W1ICB0      ------------------------------------------------------------
A0A7C1C8G2      ------------------------------------------------------------
A0A832F8F3      ------------------------------------------------------------
A0A2E0UL88      ------------------------------------------------------------
A0A2N1WQN5      ------------------------------------------------------------
A0A0T2QIS1      ------------------------------------------------------------
A0A376KYN0      ------------------------------------------------------------
A0A377E5P7      ------------------------------------------------------------
A0A2X1JB05      ------------------------------------------------------------
A0A376RML0      ------------------------------------------------------------
A0A6N3QTV2      ------------------------------------------------------------
A0A0P7Y1D0      ------------------------------------------------------------
A0A7Y2FUF7      ------------------------------------------------------------
A0A7W6DRI0      ------------------------------------------------------------
A0A542J310      ------------------------------------------------------------
A0A2M7JRZ7      ------------------------------------------------------------
A0A167IR75      ------------------------------------------------------------
A0A3B8T2U6      ------------------------------------------------------------
A0A365PWR2      ------------------------------------------------------------
A0A2E9H5Z8      ------------------------------------------------------------
A0A2E2BR79      ------------------------------------------------------------
A0A6I4IKZ3      ------------------------------------------------------------
A0A7H4JZ79      ------------------------------------------------------------
A0A0Q4Q524      ------------------------------------------------------------
A0A0Q4CFJ9      ------------------------------------------------------------
A0A0Q4FE58      ------------------------------------------------------------
A0A0Q4JWC8      ------------------------------------------------------------
A0A0Q4KFL8      ------------------------------------------------------------
A0A7W8RVL5      ------------------------------------------------------------
A0A831Y0Z8      ------------------------------------------------------------
A0A522R8R0      ------------------------------------------------------------
A0A2U9NDY5      ------------------------------------------------------------
A0A0Q4IGG1      ------------------------------------------------------------
A0A352G2C2      ------------------------------------------------------------
A0A7Y3BMU7      ------------------------------------------------------------
A0A534RUJ5      ------------------------------------------------------------
V4Q8B7          ------------------------------------------------------------
A0A3M1CJM3      ------------------------------------------------------------
A0A2R7SVD4      ------------------------------------------------------------
A0A0Q8XKK5      ------------------------------------------------------------
A0A2E0Q2W0      ------------------------------------------------------------
A0A660NIR6      ------------------------------------------------------------
A0A142W0R3      ------------------------------------------------------------
A0A0S4XR18      ------------------------------------------------------------
A0A7C5CFF1      ------------------------------------------------------------
A0A7X6WZW5      ------------------------------------------------------------
A0A7X2SVT1      ------------------------------------------------------------
A0A2E0GW64      ------------------------------------------------------------
A0A1A7QJ97      ------------------------------------------------------------
A0A832UVD3      ------------------------------------------------------------
A0A7W5IBY1      ------------------------------------------------------------
A0A661LW70      ------------------------------------------------------------
W7Q8F9          ------------------------------------------------------------
A0A524PXH8      ------------------------------------------------------------
A0A4Q3P0E4      ------------------------------------------------------------
A0A3M2BE89      ------------------------------------------------------------
A0A4Q4A6K6      ------------------------------------------------------------
A0A257G674      ------------------------------------------------------------
A0A661M5M6      ------------------------------------------------------------
A0A1I1UM01      ------------------------------------------------------------
Q44573          ------------------------------------------------------------
A2W025          ------------------------------------------------------------
A0A534Z362      ------------------------------------------------------------
V4J283          ------------------------------------------------------------
A0A536T443      ------------------------------------------------------------
A0A0Q4UFQ5      ------------------------------------------------------------
A0A527W7E6      ------------------------------------------------------------
A0A432EMV7      ------------------------------------------------------------
A0A7Y3M8P5      ------------------------------------------------------------
A0A7C1SEU7      ------------------------------------------------------------
A0A7Y1SPC5      ------------------------------------------------------------
A0A7V6YC94      ------------------------------------------------------------
A0A534WLI3      ------------------------------------------------------------
A0A7V6CBY2      ------------------------------------------------------------
A0A7C6FBW0      ------------------------------------------------------------
A0A087LTV7      ------------------------------------------------------------
A0A7D7WSS2      ------------------------------------------------------------
A0A318KWA2      ------------------------------------------------------------
A0A522MT86      ------------------------------------------------------------
A0A4Q3I221      ------------------------------------------------------------
A0A534SAL6      ------------------------------------------------------------
A0A534ZDB4      ------------------------------------------------------------
A0A534X3M7      ------------------------------------------------------------
A0A534SPC6      ------------------------------------------------------------
A0A535AD60      ------------------------------------------------------------
A0A4Q3SY08      ------------------------------------------------------------
A0A7U1E9W6      ------------------------------------------------------------
A0A4Q3LG23      ------------------------------------------------------------
A0A522EX52      ------------------------------------------------------------
A0A1H3KC95      ------------------------------------------------------------
A0A5P8Z4P3      ------------------------------------------------------------
A0A2E9HXF7      ------------------------------------------------------------
A0A0B3RZC9      ------------------------------------------------------------
A0A6F8QET1      ------------------------------------------------------------
A0A520HUH4      ------------------------------------------------------------
A0A2K8U7M6      ------------------------------------------------------------
A0A5B9DKL8      ------------------------------------------------------------
A0A238KJM1      ------------------------------------------------------------
A0A3A0FJZ4      ------------------------------------------------------------
W4HJV8          ------------------------------------------------------------
A0A0P1GDI0      ------------------------------------------------------------
A0A2R8ATV5      ------------------------------------------------------------
A0A1U7D3R6      ------------------------------------------------------------
A0A2D4UVV2      ------------------------------------------------------------
A0A0W7WHP4      ------------------------------------------------------------
A0A238J8F6      ------------------------------------------------------------
A0A238JQI6      ------------------------------------------------------------
A0A222E077      ------------------------------------------------------------
A0A239E3Y2      ------------------------------------------------------------
A0A1F9CFF0      ------------------------------------------------------------
A0A2M8B0G5      ------------------------------------------------------------
A0A363TNU9      ------------------------------------------------------------
A0A445MZQ4      ------------------------------------------------------------
A0A0M9E0E3      ------------------------------------------------------------
A0A351Z9A2      ------------------------------------------------------------
A0A6G6X2Z4      ------------------------------------------------------------
A0A0C5VQ86      ------------------------------------------------------------
A0A3S1WTQ1      ------------------------------------------------------------
A0A354EF47      ------------------------------------------------------------
A0A536T0W8      ------------------------------------------------------------
A0A2G6MSP7      ------------------------------------------------------------
A0A3N5FRH4      ------------------------------------------------------------
A0A1V4Y2C3      ------------------------------------------------------------
A0A2N2KTJ4      ------------------------------------------------------------
A0A2N2LQX0      ------------------------------------------------------------
A0A4U8YMP3      ------------------------------------------------------------
A0A1Q8QQ99      ------------------------------------------------------------
A0A7C2SIB2      ------------------------------------------------------------
A0A3D5ZY44      ------------------------------------------------------------
A0A1G5C236      ------------------------------------------------------------
A0A432HIS7      ------------------------------------------------------------
A0A401FQP5      ------------------------------------------------------------
A0A7C3Q9R6      ------------------------------------------------------------
A0A7C2AA26      ------------------------------------------------------------
A0A351Z4H9      ------------------------------------------------------------
A0A2N2KML4      ------------------------------------------------------------
E1YJF1          ------------------------------------------------------------
A0A1Q6DMW3      ------------------------------------------------------------
A0A3A6P8F8      ------------------------------------------------------------
A0A1J5EVZ6      ------------------------------------------------------------
A0A2G2DSM4      ------------------------------------------------------------
A0A1F9NI02      ------------------------------------------------------------
A0A4U1ABX4      ------------------------------------------------------------
A0A6L4AM84      ------------------------------------------------------------
A0A840UW68      ------------------------------------------------------------
A0A2G6FCC5      ------------------------------------------------------------
A0A1F9MR25      ------------------------------------------------------------
A0A2G6M7F1      ------------------------------------------------------------
A0A5Q2QDL1      ------------------------------------------------------------
A0A4Z0M4C7      ------------------------------------------------------------
A0A1V8MBH1      ------------------------------------------------------------
A0A7V9E085      ------------------------------------------------------------
A0A6J4X8D4      ------------------------------------------------------------
A0A1E7HSL6      ------------------------------------------------------------
A0A2M7JX59      ------------------------------------------------------------
A0A7V4PLT3      ------------------------------------------------------------
A0A7X7Y8R3      ------------------------------------------------------------
A0A832A361      ------------------------------------------------------------
A0A1M5GH86      ------------------------------------------------------------
A0A1W1XQZ5      ------------------------------------------------------------
A0A3D6C3I2      ------------------------------------------------------------
S0G1D4          ------------------------------------------------------------
A0A661T246      ------------------------------------------------------------
A0A850T4Q7      ------------------------------------------------------------
A0A2G6CSG7      ------------------------------------------------------------
A0A2G6NB59      ------------------------------------------------------------
A0A5K8A7T9      ------------------------------------------------------------
A0A1W9U045      ------------------------------------------------------------
A0A1F9L9G4      ------------------------------------------------------------
A0A328FD76      ------------------------------------------------------------
A0A348UX90      ------------------------------------------------------------
A0A357Z0N5      ------------------------------------------------------------
A0A0F2R2U0      ------------------------------------------------------------
A0A5K7ZK00      ------------------------------------------------------------
A0A5K7YCX8      ------------------------------------------------------------
A0A5K7Z388      ------------------------------------------------------------
A0A520CSP5      ------------------------------------------------------------
A0A1E7HFN0      ------------------------------------------------------------
A0A7J0BHG1      ------------------------------------------------------------
A0A6V8LMJ3      ------------------------------------------------------------
A0A2K8WHP8      ------------------------------------------------------------
A0A1J5N774      ------------------------------------------------------------
A0A2C8F781      ------------------------------------------------------------
A0A2E3R6G0      ------------------------------------------------------------
A0A7J0BUD3      ------------------------------------------------------------
A0A3M8EMP2      ------------------------------------------------------------
A0A2J6J6K6      ------------------------------------------------------------
A0A1F8XMK2      ------------------------------------------------------------
A0A661PSB9      ------------------------------------------------------------
A0A661QBT6      ------------------------------------------------------------
A0A6I2SLK2      ------------------------------------------------------------
A0A7Y7NC38      ------------------------------------------------------------
A0A0A8WSG4      ------------------------------------------------------------
S7TK97          ------------------------------------------------------------
S7UE93          ------------------------------------------------------------
A0A3D5BR56      ------------------------------------------------------------
A0A1I3PSR2      ------------------------------------------------------------
A0A2N2IB15      ------------------------------------------------------------
A0A7C8B5M6      ------------------------------------------------------------
A0A7V4UW39      ------------------------------------------------------------
A0A1W7QPT7      ------------------------------------------------------------
A0A6S6M1Y8      ------------------------------------------------------------
A0A6V8MCR2      ------------------------------------------------------------
A0A6V8N3X1      ------------------------------------------------------------
A0A6M4XJ81      ------------------------------------------------------------
A0A0M4D373      ------------------------------------------------------------
A0A1L3GKM9      ------------------------------------------------------------
A0A2T5R3J5      ------------------------------------------------------------
A0A1G6EKK9      ------------------------------------------------------------
A0A7C1DJX8      ------------------------------------------------------------
A0A3A4XVN3      ------------------------------------------------------------
A0A1E7JEV6      ------------------------------------------------------------
A0A2N2KDY5      ------------------------------------------------------------
A0A3N5YUD9      ------------------------------------------------------------
A0A4Q3ZDI7      ------------------------------------------------------------
A0A537PRC6      ------------------------------------------------------------
A0A7Y8L8B9      ------------------------------------------------------------
A0A5C4N0H6      ------------------------------------------------------------
A0A7V4UXV1      ------------------------------------------------------------
A0A7C3Y7G3      ------------------------------------------------------------
A0A7V5R3L0      ------------------------------------------------------------
A0A7V2SYN1      ------------------------------------------------------------
A0A6H9HII8      ------------------------------------------------------------
A0A7S6SHD5      ------------------------------------------------------------
A0A7C1UTU6      ------------------------------------------------------------
W9VVY5          ------------------------------------------------------------
A0A1E2URD3      ------------------------------------------------------------
A0A2T6MY81      ------------------------------------------------------------
A0A7Z0VN76      ------------------------------------------------------------
A0A2T6NBQ8      ------------------------------------------------------------
A0A421K431      ------------------------------------------------------------
A0A7C3Z8T7      ------------------------------------------------------------
A0A1V4QMH7      ------------------------------------------------------------
A0A496XZQ4      ------------------------------------------------------------
A0A7C3UZM2      ------------------------------------------------------------
A0A1F9BJF7      ------------------------------------------------------------
F2NDF5          ------------------------------------------------------------
A0A7Y4XWU8      ------------------------------------------------------------
A0A4V2SPR5      ------------------------------------------------------------
A0A7W8W7P8      ------------------------------------------------------------
A0A7W8WPN5      ------------------------------------------------------------
A0A519ERR1      ------------------------------------------------------------
A0A4Q3Q1M2      ------------------------------------------------------------
A0A4Q3MHR1      ------------------------------------------------------------
A0A520GDZ4      ------------------------------------------------------------
A0A372IH36      ------------------------------------------------------------
A0A540VW45      ------------------------------------------------------------
A0A1H9C241      ------------------------------------------------------------
A0A2E3FCR1      ------------------------------------------------------------
A0A4S3MG69      ------------------------------------------------------------
A0A3E0H727      ------------------------------------------------------------
A0A7X8XJJ0      ------------------------------------------------------------
A0A1I3TTC3      ------------------------------------------------------------
A0A1H3IZW6      ------------------------------------------------------------
A0A0M6YG59      ------------------------------------------------------------
A0A1H7G8B0      ------------------------------------------------------------
A0A2G2I5M1      ------------------------------------------------------------
A0A2G2M6F0      ------------------------------------------------------------
A0A352B502      ------------------------------------------------------------
A0A430DNP0      ------------------------------------------------------------
A0A410V446      ------------------------------------------------------------
A0A1B1UCM8      ------------------------------------------------------------
A0A1N6JQ20      ------------------------------------------------------------
A0A0R3KGJ5      ------------------------------------------------------------
A0A0R3N604      ------------------------------------------------------------
A0A1M5TI07      ------------------------------------------------------------
A3X191          ------------------------------------------------------------
A0A160UA87      ------------------------------------------------------------
A0A1Q5SFV5      ------------------------------------------------------------
A0A1H4RKV5      ------------------------------------------------------------
A0A7Z2Q199      ------------------------------------------------------------
A0A3A0FQ32      ------------------------------------------------------------
A0A7Y3GV54      ------------------------------------------------------------
A0A3E0WXH2      ------------------------------------------------------------
A0A1A9KEF8      ------------------------------------------------------------
A0A5E6PKN5      ------------------------------------------------------------
A0A0N9W1V6      ------------------------------------------------------------
A0A423GQ41      ------------------------------------------------------------
A0A423H7J2      ------------------------------------------------------------
A0A502HNM8      ------------------------------------------------------------
A0A4Q7H223      ------------------------------------------------------------
A0A1H4N2K9      ------------------------------------------------------------
A0A2K4KWF7      ------------------------------------------------------------
A0A1E4UZA0      ------------------------------------------------------------
A0A1H9KL56      ------------------------------------------------------------
A0A7X0BTK5      ------------------------------------------------------------
A0A2N2TRC8      ------------------------------------------------------------
A0A1V4CIZ7      ------------------------------------------------------------
A0A1M3BXA5      ------------------------------------------------------------
A0A1Y2R3U6      ------------------------------------------------------------
A0A167HVD6      ------------------------------------------------------------
A0A1V3SCT6      ------------------------------------------------------------
L0H287          ------------------------------------------------------------
A0A495VG93      ------------------------------------------------------------
A0A4R3MYM4      ------------------------------------------------------------
G2E3C0          ------------------------------------------------------------
A0A1W9J9F8      ------------------------------------------------------------
A0A2S5LFJ9      ------------------------------------------------------------
A0A2D8R8F8      ------------------------------------------------------------
A0A1G0KSD0      ------------------------------------------------------------
A0A4P6WX84      ------------------------------------------------------------
A0A1D2S760      ------------------------------------------------------------
A0A5B8RW94      ------------------------------------------------------------
A0A6I4JXQ8      ------------------------------------------------------------
A0A010SNS0      ------------------------------------------------------------
A0A0C2I782      ------------------------------------------------------------
A0A2N8BYF5      ------------------------------------------------------------
A0A558FKX2      ------------------------------------------------------------
A0A1H1DBA0      ------------------------------------------------------------
J3H699          ------------------------------------------------------------
A0A0K1QRZ4      ------------------------------------------------------------
A0A560RJW9      ------------------------------------------------------------
A0A5E7CRU7      ------------------------------------------------------------
A0A1H5J974      ------------------------------------------------------------
A0A5E7C564      ------------------------------------------------------------
A0A2W7MAV4      ------------------------------------------------------------
W6VFG3          ------------------------------------------------------------
A0A1P8ENT1      ------------------------------------------------------------
A0A2N7XRV4      ------------------------------------------------------------
A0A0Q6QPG8      ------------------------------------------------------------
A0A0F4SWA7      ------------------------------------------------------------
A0A423J219      ------------------------------------------------------------
A0A4P6G9U8      ------------------------------------------------------------
A0A4Y8JE06      ------------------------------------------------------------
A0A502I1X9      ------------------------------------------------------------
A0A502J776      ------------------------------------------------------------
A0A5B0EZF6      ------------------------------------------------------------
A0A059L434      ------------------------------------------------------------
A0A0F4UWN2      ------------------------------------------------------------
A0A5E7WEF5      ------------------------------------------------------------
A0A258TN88      ------------------------------------------------------------
A0A7Y8MN30      ------------------------------------------------------------
A0A3N5J7U8      ------------------------------------------------------------
A0A1S7S3I8      ------------------------------------------------------------
A0A655ZZQ1      ------------------------------------------------------------
A0A1S0ZAI3      ------------------------------------------------------------
A0A3C0L0A8      ------------------------------------------------------------
A0A176S762      ------------------------------------------------------------
A0A1W9WUD9      ------------------------------------------------------------
A0A1W1ZQK0      ------------------------------------------------------------
A0A7X1GRP5      ------------------------------------------------------------
A0A6I1R304      ------------------------------------------------------------
A0A1W9PMU6      ------------------------------------------------------------
A0A7Y4X3V7      ------------------------------------------------------------
A0A1G3VVY5      ------------------------------------------------------------
A0A7C3S273      ------------------------------------------------------------
A0A7C4WJ18      ------------------------------------------------------------
A0A351B422      ------------------------------------------------------------
F2NEE9          ------------------------------------------------------------
A0A7C3V565      ------------------------------------------------------------
A0A7V6A3E1      ------------------------------------------------------------
A0A318D3U4      ------------------------------------------------------------
A0A7V0JSN8      ------------------------------------------------------------
A0A7V5V784      ------------------------------------------------------------
A0A352Q5C1      ------------------------------------------------------------
A0A355TB56      ------------------------------------------------------------
A0A1F9E324      ------------------------------------------------------------
A0A435NNF5      ------------------------------------------------------------
A0A3S2AQS7      ------------------------------------------------------------
A0A527ZPD6      ------------------------------------------------------------
A0A529KRW3      ------------------------------------------------------------
A0A530ZLX0      ------------------------------------------------------------
A0A4Q3LBH4      ------------------------------------------------------------
A0A4Q3LWP3      ------------------------------------------------------------
A0A7C3JPP4      ------------------------------------------------------------
A0A534V9L7      ------------------------------------------------------------
A0A7C3JJT4      ------------------------------------------------------------
A0A524M660      ------------------------------------------------------------
A0A7C3JSX5      ------------------------------------------------------------
A0A7I8MQ67      ------------------------------------------------------------
A0A0C1TRU6      ------------------------------------------------------------
A0A2Z5SSF4      ------------------------------------------------------------
A0A7Y7TF97      ------------------------------------------------------------
A0A4Q4CIB1      ------------------------------------------------------------
A0A522ACJ9      ------------------------------------------------------------
A0A3N5Z7F8      ------------------------------------------------------------
A0A239HD34      ------------------------------------------------------------
A0A3D2M6Y9      ------------------------------------------------------------
A0A519E8D7      ------------------------------------------------------------
A0A3S1FD32      ------------------------------------------------------------
A0A434DUT4      ------------------------------------------------------------
A0A528D3U3      ------------------------------------------------------------
A0A3S3UPT3      ------------------------------------------------------------
A0A3S1E286      ------------------------------------------------------------
A0A531AC71      ------------------------------------------------------------
A0A436K268      ------------------------------------------------------------
A0A434IDQ0      ------------------------------------------------------------
A0A435IRM5      ------------------------------------------------------------
A0A3S2C404      ------------------------------------------------------------
A0A435F6C0      ------------------------------------------------------------
A0A435BMN6      ------------------------------------------------------------
A0A529XQ54      ------------------------------------------------------------
A0A530BJC1      ------------------------------------------------------------
A0A0P7ZZE4      ------------------------------------------------------------
A0A369R0Q9      ------------------------------------------------------------
A0A327LYE6      ------------------------------------------------------------
A0A5A9ZTV3      ------------------------------------------------------------
A0A258WKV0      ------------------------------------------------------------
A5G4N9          ------------------------------------------------------------
A0A812HT29      ------------------------------------------------------------
A0A444IY46      ------------------------------------------------------------
A0A6I7N627      ------------------------------------------------------------
A0A1V5DJV0      ------------------------------------------------------------
A0A520IUC4      ------------------------------------------------------------
A0A7Y7M8F4      ------------------------------------------------------------
A0A0P1FWI8      ------------------------------------------------------------
A0A6L8LHC6      ------------------------------------------------------------
A0A848ST88      ------------------------------------------------------------
A0A7U1HWF1      ------------------------------------------------------------
A0A534SH66      ------------------------------------------------------------
A0A3M0ZZ99      ------------------------------------------------------------
A0A238LBD3      ------------------------------------------------------------
A0A537NZJ1      ------------------------------------------------------------
A0A7C4R3C4      ------------------------------------------------------------
A0A0P1FRV5      ------------------------------------------------------------
A0A4Q4CVW6      ------------------------------------------------------------
A0A8B6LS25      ------------------------------------------------------------
A0A6L3ZWI0      ------------------------------------------------------------
A0A1M7BLL7      ------------------------------------------------------------
A0A0H4KZM1      ------------------------------------------------------------
A0A7V2W904      ------------------------------------------------------------
A0A1V1UJT2      ------------------------------------------------------------
A0A0L6CVX1      ------------------------------------------------------------
A0A1V0RR48      ------------------------------------------------------------
A0A0A0HJJ4      ------------------------------------------------------------
A0A5E7YA28      ------------------------------------------------------------
A0A316KRG4      ------------------------------------------------------------
A0A0J5Q9T7      ------------------------------------------------------------
A0A1I5YYQ0      ------------------------------------------------------------
A0A5P9FE62      ------------------------------------------------------------
A0A7U3CQW5      ------------------------------------------------------------
X7F6S5          ------------------------------------------------------------
A0A1G8NKI0      ------------------------------------------------------------
A0A355QPE4      ------------------------------------------------------------
A0A357RN98      ------------------------------------------------------------
A0A1I6U4V1      ------------------------------------------------------------
A0A6B2P8H8      ------------------------------------------------------------
A0A1P8USW9      ------------------------------------------------------------
A0A1G7CFZ2      ------------------------------------------------------------
A0A7G2TPW1      ------------------------------------------------------------
A0A1V6FYJ1      ------------------------------------------------------------
A0A4Q3IRI1      ------------------------------------------------------------
A0A7J5VV32      ------------------------------------------------------------
A0A1E7H876      ------------------------------------------------------------
A0A7C1C6X5      ------------------------------------------------------------
A0A7X1GMT8      ------------------------------------------------------------
Q44570          ------------------------------------------------------------
A0A509L3P8      ------------------------------------------------------------
A0A3A4S038      ------------------------------------------------------------
A0A1F9N669      ------------------------------------------------------------
A0A1F9PFA7      ------------------------------------------------------------
A0A1H2EN09      ------------------------------------------------------------
K0NP00          ------------------------------------------------------------
A0A2N6BZD5      ------------------------------------------------------------
A0A0F2NF69      ------------------------------------------------------------
A0A1F9NFD0      ------------------------------------------------------------
A0A1W9M770      ------------------------------------------------------------
A0A1W9M7R6      ------------------------------------------------------------
A0A7W0IR34      ------------------------------------------------------------
A0A7V5FUI1      ------------------------------------------------------------
A0A7T6AQC8      ------------------------------------------------------------
A0A7U4DQ89      ------------------------------------------------------------
A0A1M5YLH5      ------------------------------------------------------------
A0A4U1A4C7      ------------------------------------------------------------
A0A7C4N0I9      ------------------------------------------------------------
A0A1V4M8I1      ------------------------------------------------------------
A0A7C0XE92      ------------------------------------------------------------
A0A7U4QIX5      ------------------------------------------------------------
A0A800BQ44      ------------------------------------------------------------
A0A1E7JCL5      ------------------------------------------------------------
A0A7Z9XET3      ------------------------------------------------------------
A0A800C5N3      ------------------------------------------------------------
A0A496YAH9      ------------------------------------------------------------
A0A1V4S7E4      ------------------------------------------------------------
A0A847DGI3      ------------------------------------------------------------
A0A2N2H8D2      ------------------------------------------------------------
A0A2N2KC63      ------------------------------------------------------------
A0A3A4ZYW4      ------------------------------------------------------------
A0A800BMM4      ------------------------------------------------------------
A0A1V4MCJ4      ------------------------------------------------------------
A0A661M0W4      ------------------------------------------------------------
A0A3N5RNY4      ------------------------------------------------------------
A0A1M7Y300      ------------------------------------------------------------
A0A4U1ALN4      ------------------------------------------------------------
A0A849F908      ------------------------------------------------------------
A0A2N6BEI9      ------------------------------------------------------------
A0A0D5N3E9      ------------------------------------------------------------
A0A2N2G716      ------------------------------------------------------------
A0A1F9EUS2      ------------------------------------------------------------
A0A3N9VAW3      ------------------------------------------------------------
A0A6I1KNW9      ------------------------------------------------------------
A0A1H4B8T3      ------------------------------------------------------------
A0A1E7IQC3      ------------------------------------------------------------
A0A1M6KEN5      ------------------------------------------------------------
A0A1X0YE57      ------------------------------------------------------------
A0A2K2H9Q8      ------------------------------------------------------------
A0A1F8X5S3      ------------------------------------------------------------
A0A353QLL3      ------------------------------------------------------------
A0A847C207      ------------------------------------------------------------
A0A399I453      ------------------------------------------------------------
A0A651FBV9      ------------------------------------------------------------
A0A562VHD2      ------------------------------------------------------------
A0A7K0J0R7      ------------------------------------------------------------
A0A6I6JNB5      ------------------------------------------------------------
A0A847UFK5      ------------------------------------------------------------
A0A1G0LDK7      ------------------------------------------------------------
A0A6F9WVL7      ------------------------------------------------------------
A0A7Y7TLN9      ------------------------------------------------------------
A0A5C1MDH8      ------------------------------------------------------------
A0A7J4ZSX4      ------------------------------------------------------------
A0A5A9XE04      ------------------------------------------------------------
A0A643G9R1      ------------------------------------------------------------
A0A1G0M8Q7      ------------------------------------------------------------
A0A353MI14      ------------------------------------------------------------
A0A4S1CAW7      ------------------------------------------------------------
A0A655R819      ------------------------------------------------------------
A0A655RNN3      ------------------------------------------------------------
A0A354EI73      ------------------------------------------------------------
A0A6D0ELN7      ------------------------------------------------------------
A0A0B8PTA8      ------------------------------------------------------------
A0A0B8QF75      ------------------------------------------------------------
A0A4U9I390      ------------------------------------------------------------
A0A2X3M011      ------------------------------------------------------------
A0A2H9EHM4      ------------------------------------------------------------
A0A380B3D7      ------------------------------------------------------------
F5NSX0          ------------------------------------------------------------
A0A7A9K1G5      ------------------------------------------------------------
A0A811C967      ------------------------------------------------------------
A0A479JNB1      ------------------------------------------------------------
A0A5C9AF52      ------------------------------------------------------------
A0A6D0EYC7      ------------------------------------------------------------
D8EEU7          ------------------------------------------------------------
A0A0R0BVC7      ------------------------------------------------------------
A0A4U8YLL7      ------------------------------------------------------------
A0A2M7WWF7      ------------------------------------------------------------
A0A534QGR3      ------------------------------------------------------------
A0A0Q6QV61      ------------------------------------------------------------
A0A2Z3IKG4      ------------------------------------------------------------
B7RS54          ------------------------------------------------------------
A0A7R7CAD2      ------------------------------------------------------------
A0A7R7CQL5      ------------------------------------------------------------
A0A1I3XJ27      ------------------------------------------------------------
A0A562CGU2      ------------------------------------------------------------
A0A7C9VCB3      ------------------------------------------------------------
A0A1I7DCG1      ------------------------------------------------------------
A0A3A3H6D9      ------------------------------------------------------------
A0A0Q6VA36      ------------------------------------------------------------
A0A1B2EQN1      ------------------------------------------------------------
A0A1G8QZS5      ------------------------------------------------------------
A0A1H2Y469      ------------------------------------------------------------
A0A497ZQU7      ------------------------------------------------------------
A0A443K010      ------------------------------------------------------------
A0A6I7NYG5      ------------------------------------------------------------
A0A1I0R9R6      ------------------------------------------------------------
A0A2N3BVE7      ------------------------------------------------------------
A0A7C2IB02      ------------------------------------------------------------
A0A6N6SI00      ------------------------------------------------------------
A0A2S5JE21      ------------------------------------------------------------
A0A2R8BKZ2      ------------------------------------------------------------
A0A2S8S361      ------------------------------------------------------------
A0A1X7ACC1      ------------------------------------------------------------
A0A238KUF6      ------------------------------------------------------------
A0A095CTW3      ------------------------------------------------------------
A0A2E3UGD6      ------------------------------------------------------------
A0A840CE00      ------------------------------------------------------------
A0A2T0RFH0      ------------------------------------------------------------
A0A285D390      ------------------------------------------------------------
A0A497VHN4      ------------------------------------------------------------
A0A6M1UAR9      ------------------------------------------------------------
A0A520ZTR8      ------------------------------------------------------------
A0A7Y2NU38      ------------------------------------------------------------
A0A849GJU0      ------------------------------------------------------------
A0A316GHM6      ------------------------------------------------------------
A0A848VYK1      ------------------------------------------------------------
A0A7C9INT8      ------------------------------------------------------------
A0A238IZI1      ------------------------------------------------------------
A0A7Y2U0H6      ------------------------------------------------------------
A0A848WN80      ------------------------------------------------------------
A0A1I6ENM4      ------------------------------------------------------------
A0A2E2P4I0      ------------------------------------------------------------
A0A2U2CM86      ------------------------------------------------------------
A0A212AR83      ------------------------------------------------------------
A0A2M8J3R9      ------------------------------------------------------------
A0A1I6X762      ------------------------------------------------------------
A0A843YIS7      ------------------------------------------------------------
A0A0P1EFX8      ------------------------------------------------------------
A0A2G5KB39      ------------------------------------------------------------
A8LNM8          ------------------------------------------------------------
A0A844B423      ------------------------------------------------------------
A0A0T5NSU3      ------------------------------------------------------------
A0A5P9I718      ------------------------------------------------------------
A0A2N3CNV1      ------------------------------------------------------------
A0A257F1F4      ------------------------------------------------------------
A0A2D5J8T8      ------------------------------------------------------------
A0A2E3P9W6      ------------------------------------------------------------
A0A2G2B1P9      ------------------------------------------------------------
A0A258GCD5      ------------------------------------------------------------
A0A443INY4      ------------------------------------------------------------
A0A2D9YR88      ------------------------------------------------------------
A0A4Q3ZBK4      ------------------------------------------------------------
A0A1G9FY29      ------------------------------------------------------------
A0A6N9RUN2      ------------------------------------------------------------
A0A1W9HS52      ------------------------------------------------------------
A0A2D5LFD8      ---------------------------------------------------------MAA
A0A4D8PLT4      GRRRKHRDGWAFFFQLLRGAIHGTRSLSDNGRSSGTSRPIRPWSLKDSRILGYLQRKQKA
A0A1G3JY11      ------------------------------------------------------------
A0A3A4NIE9      ------------------------------------------------------------
A0A3A4NUI9      ------------------------------------------------------------
A0A524I3Z6      ------------------------------------------------------------
A0A524PCL7      ------------------------------------------------------------
A0A356GQV1      ------------------------------------------------------------
A0A1J5DAY8      ------------------------------------------------------------
A0A524P237      ------------------------------------------------------------
A0A4P7EP83      ------------------------------------------------------------
A0A348SRI7      ------------------------------------------------------------
A0A833GQE1      ------------------------------------------------------------
A0A661N3U1      ------------------------------------------------------------
A0A7X1T426      ------------------------------------------------------------
A0A432SAI6      ------------------------------------------------------------
A0A855HUH5      ------------------------------------------------------------
A0A6L6H5T1      ------------------------------------------------------------
A0A7V5C3K7      ------------------------------------------------------------
A0A7Y9AV38      ------------------------------------------------------------
A0A2W5J775      ------------------------------------------------------------
A0A3M3H5V6      ------------------------------------------------------------
A0A7V2YBQ6      ------------------------------------------------------------
A0A7X8Z4Y1      ------------------------------------------------------------
A0A377ZC40      ------------------------------------------------------------
A0A534XP85      ------------------------------------------------------------
A0A377LY04      ------------------------------------------------------------
A0A2X3K9R3      ------------------------------------------------------------
A0A484X141      ------------------------------------------------------------
A0A5N9VWI6      ------------------------------------------------------------
A0A5C9ABR5      ------------------------------------------------------------
A0A6D0EJQ0      ------------------------------------------------------------
A0A444R390      ------------------------------------------------------------
A0A376LLF8      ------------------------------------------------------------
A0A6L7CT21      ------------------------------------------------------------
A0A378BPJ7      ------------------------------------------------------------
A0A377ZDN3      ------------------------------------------------------------
A0A2J5PAJ7      ------------------------------------------------------------
A0A7Z9CQS8      ------------------------------------------------------------
A0A2W4RFS2      ------------------------------------------------------------
A0A1Y6DC43      ------------------------------------------------------------
A0A2S6HE06      ------------------------------------------------------------
G3J0M3          ------------------------------------------------------------
V5C6R5          ------------------------------------------------------------
A0A7V0Z1K0      ------------------------------------------------------------
A0A7Y8IFK0      ------------------------------------------------------------
A0A4Q2XLV7      ------------------------------------------------------------
A0A4Q5QYC4      ------------------------------------------------------------
A0A0U2VAW2      ------------------------------------------------------------
A0A454CTF1      ------------------------------------------------------------
A0A6B3Q2G1      ------------------------------------------------------------
A0A6N9S3L5      ------------------------------------------------------------
A0A656BWB0      ------------------------------------------------------------
A0A6D0IFH4      ------------------------------------------------------------
A0A0A0FHV8      ------------------------------------------------------------
A0A2I8SDU4      ------------------------------------------------------------
A0A2I8SU55      ------------------------------------------------------------
A0A7I6T806      ------------------------------------------------------------
A0A7I6TQE9      ------------------------------------------------------------
A0A7I6U296      ------------------------------------------------------------
S1EXJ6          ------------------------------------------------------------
A0A376UBS1      ------------------------------------------------------------
A0A4Q6G931      ------------------------------------------------------------
A0A2T0VBD8      ------------------------------------------------------------
A0A7W5DMU7      ------------------------------------------------------------
A0A378APS2      ------------------------------------------------------------
A0A443VCQ6      ------------------------------------------------------------
A0A447RKQ7      ------------------------------------------------------------
W1DSK1          ------------------------------------------------------------
A0A2N1XK22      ------------------------------------------------------------
A0A850R066      ------------------------------------------------------------
A0A1W9F5M9      ------------------------------------------------------------
A0A352MMI7      ------------------------------------------------------------
A0A4Z0LWV1      ------------------------------------------------------------
A0A376RY66      ------------------------------------------------------------
A0A377K431      ------------------------------------------------------------
A0A6D0I9G1      ------------------------------------------------------------
A0A379W6R2      ------------------------------------------------------------
A0A379TA56      ------------------------------------------------------------
A0A655C5P0      ------------------------------------------------------------
A0A3C2BN18      ------------------------------------------------------------
A0A447LR75      ------------------------------------------------------------
A0A759KJJ5      ------------------------------------------------------------
A0A376D8L7      ------------------------------------------------------------
A0A1V2FV46      ------------------------------------------------------------
A0A6N8QLT3      ------------------------------------------------------------
A0A376SB61      ------------------------------------------------------------
A0A3D1BYV9      ------------------------------------------------------------
A0A3P5DSS6      ------------------------------------------------------------
A0A483YEL5      ------------------------------------------------------------
A0A844PX38      ------------------------------------------------------------
A0A8B4SQI1      ------------------------------------------------------------
A0A483QWI8      ------------------------------------------------------------
A0A483UXD3      ------------------------------------------------------------
A0A0A8J8L3      ------------------------------------------------------------
A0A660DJ38      ------------------------------------------------------------
A0A378G3G7      ------------------------------------------------------------
A0A2X5NHJ9      ------------------------------------------------------------
A0A2J4QEC3      ------------------------------------------------------------
A0A485ADM3      ------------------------------------------------------------
A0A3D0KAC8      ------------------------------------------------------------
A0A4U9HGU4      ------------------------------------------------------------
A0A3S4JGG5      ------------------------------------------------------------
A0A377ZDH2      ------------------------------------------------------------
A0A3S4HTS8      ------------------------------------------------------------
A0A3N5MZ53      ------------------------------------------------------------
A0A534E4H4      ------------------------------------------------------------
A0A534I2B6      ------------------------------------------------------------
A0A1C2JGD0      ------------------------------------------------------------
A0A259LQ70      ------------------------------------------------------------
A0A3N5PM86      ------------------------------------------------------------
A0A2E5YSA4      ------------------------------------------------------------
A0A0N0XAV4      ------------------------------------------------------------
A0A0P9QD19      ------------------------------------------------------------
F3FHG4          ------------------------------------------------------------
F3GGI0          ------------------------------------------------------------
A0A0P9LE74      ------------------------------------------------------------
A0A3M4ZQ14      RPLSATPFSLRTDLCAALAVHRRLASSFSVRRDTINDRHEPCSFGSLPGFTGRSGNRSAD
A0A3M5YLE8      RPLSATPFSLRTDLCAALAVHRRLASSFSVRRDTINDRHEPCSFGSLPGFTGRSGNRSAD
A0A3M3RP89      RPLSATPFSLRTDLCAALAVHRRLASSFSVRRDTINDRHEPCSFGSLPGFTGRSGNRSAD
A0A0P9QIY7      RPLSAPPFSLRTDLCAALAVHRRLASSFSVRRDTINDRHEPCSFGSLPGFTGRSGNRSAD
A0A0P9VVH7      RPLSATPFSLRTDLCAALAVHRRLASSFSVRRDTINDRHEPCSFGSLPGFTGRSGNRSAD
A0A0Q0FJK6      RPLSATPFSLRTDLCAALAVHRRLASSFSVRRDTINDRHEPCSFGSLPGFTGRSGNRSAD
A0A3M3LF66      RPLSATPFSLRTDLCAALAVHRRLASSFSVRRDTINDRHEPCSFGSLPGFTGRSGNRSAD
A0A0P9WIR8      RPLSAPPFSLRTDLCAALAVHRRLASSFSVRRDTINDRHEPCSFGSLPGFTGRSGNRSAD
A0A3M3KPE5      ------------------------------------------------------------
A0A3M4C263      ------------------------------------------------------------
A0A3M5AD05      ------------------------------------------------------------
A0A0Q0D3D2      ------------------------------------------------------------
A0A0N0FS39      ------------------------------------------------------------
A0A3M6GHH2      ------------------------------------------------------------
A0A0P9R9W0      -------------------MHRRLASSFSVRSNRINDRHEPSIPGFPTGLADRSGNCSAD
A0A0Q0B9T0      -------------------MHRRLASSFSVRSNRINDRHEPSIPGFPTGLADRSGNSSAD
A0A3M6CFI7      -------------------MHRRLASSFSVRSNRINDRHEPSIPGFPTGLADRSGNSSAD
A0A0P9JXN0      -------------------MHRRLASSFSVRSNRINDRHEPSIPGFPTGLADRSGNCSAD
A0A3M6FIV7      -------------------MHRRLASSFSVRSNRINDRHEPSIPGFPTGLADRSGNCSAD
A0A3M3PLW9      ------------------------------------------------------------
A0A3M4ENY1      ------------------------------------------------------------
A0A3M5EZK7      ------------------------------------------------------------
A0A0P9SPP5      ------------------------------------------------------------
A0A658KL17      ------------------------------------------------------------
A0A3M3NNF2      ------------------------------------------------------------
A0A7Z6UK49      ------------------------------------------------------------
A0A3M4A0E8      ------------------------------------------------------------
A0A3M4PBZ2      ------------------------------------------------------------
A0A7Z6U7Q8      ------------------------------------------------------------
A0A3M6AI26      ------------------------------------------------------------
A0A0P9IWP8      ------------------------------------------------------------
A0A0P9KZ49      ------------------------------------------------------------
A0A0P9V840      ------------------------------------------------------------
A0A0Q0AIE5      ------------------------------------------------------------
A0A3M2ZQH6      ------------------------------------------------------------
A0A0N8SQG2      ------------------------------------------------------------
A0A0W8HFU1      ------------------------------------------------------------
A0A0P9VHH8      ------------------------------------------------------------
A0A0P9YV98      ------------------------------------------------------------
A0A3M3G2W8      ------------------------------------------------------------
A0A3M6C224      ------------------------------------------------------------
A0A0P9SCD7      ------------------------------------------------------------
A0A0P9T4G3      ------------------------------------------------------------
A0A0P9VKB0      ------------------------------------------------------------
A0A0Q0BM35      ------------------------------------------------------------
A0A3M3TPR7      ------------------------------------------------------------
A0A3M3U4Q3      ------------------------------------------------------------
A0A8B3FSE5      ------------------------------------------------------------
A0A3M5K254      ------------------------------------------------------------
A0A7V8M007      ------------------------------------------------------------
A0A3M5JFB0      ------------------------------------------------------------
A0A3M3TQV3      ------------------------------------------------------------
A0A3M4A376      ------------------------------------------------------------
A0A3M3EF92      ------------------------------------------------------------
A0A3M5J1E2      ------------------------------------------------------------
A0A3M5M873      ------------------------------------------------------------
A0A3M5G7H9      ------------------------------------------------------------
A0A0Q0A5T8      ------------------------------------------------------------
A0A0P9QCJ2      ------------------------------------------------------------
A0A0P9UCX7      ------------------------------------------------------------
A0A0P9Q329      ------------------------------------------------------------
A0A3M5GJ64      ------------------------------------------------------------
A0A0P9S1F1      ------------------------------------------------------------
A0A3M2XYQ3      ------------------------------------------------------------
A0A0P9XCE1      ------------------------------------------------------------
A0A3M3EFX7      ------------------------------------------------------------
A0A3M5B9D9      ------------------------------------------------------------
A0A0P9RRZ3      ------------------------------------------------------------
A0A3M2VEK7      ------------------------------------------------------------
A0A0N8R9B3      ------------------------------------------------------------
A0A0P9VA27      ------------------------------------------------------------
A0A3M4YBJ4      ------------------------------------------------------------
A0A0P9J470      ------------------------------------------------------------
A0A0Q0EVJ8      ------------------------------------------------------------
A0A3M5UI30      ------------------------------------------------------------
A0A3M5YQT8      ------------------------------------------------------------
A0A3M5F5X1      ------------------------------------------------------------
A0A3M5R8G1      ------------------------------------------------------------
A0A3M5V012      ------------------------------------------------------------
A0A3M3GA16      ------------------------------------------------------------
A0A3M3CJL0      RPLPAARVSLRTDLRAALALHRRLAPSFSVRSNRINDRHEPSFPEFPSGLPDRSGNSPAD
A0A3M3F6F5      RPLPAARVSLRTDLRAALALHRRLAPSFSVRSNRINDRHEPSFPEFPSGLPDRSGNSPAD
A0A3M3P9B7      RPLPAARVSLRTDLRAALALHRRLAPSFSVRSNRINDRHEPSFPEFPSGLPDRSGNSPAD
A0A0N8QB74      RPLPAARVSLRTDLRAALALHRRLAPSFSVRSNRINDRHEPSFPEFPSGLPDRSGNSPAD
A0A0Q0AUD0      RPLPAARVSLRTDLRAALALHRRLAPSFSVRSNRINDRHEPSFPEFPSGLPDRSGNSPAD
A0A3M5VR55      RPLPAARVSLRTDLRAALALHRRLAPSFSVRSNRINDRHEPSFPEFPSGLPDRSGNSPAD
A0A0Q0FK97      RPLPAARVSLRADLRAALALHRRLASPFSVRSNRINDRHEPSFPEFPSGLPDRSGNSPAD
A0A3M3UCT3      RPLPAARVSLRTDLRAALALHRRLAPSFSVRSNRINDRHEPSFPEFPSGLPDRSGNSPAD
A0A7Z6Y5I3      RPLPAARVSLRTDLRAALALHRRLAPSFSVRSNRINDRHEPSFPEFPSGLPDRSGNSPAD
A0A3M5KZ75      ------------------------------------------------------------
A0A3M5L3G5      ------------------------------------------------------------
A0A7Y2TRV5      ------------------------------------------------------------
A0A318DSU0      ------------------------------------------------------------
A0A538PF21      ------------------------------------------------------------
A0A1W1ZH10      ------------------------------------------------------------
A0A1W2FF24      ------------------------------------------------------------
A0A524JYQ6      ------------------------------------------------------------
A0A4Q3MA17      ------------------------------------------------------------
A0A0N0M5F7      ------------------------------------------------------------
A0A537M754      ------------------------------------------------------------
A0A1V1PDB4      ------------------------------------------------------------
A0A2M7C324      ------------------------------------------------------------
A0A4Q3HHG6      ------------------------------------------------------------
A0A3B7DTA4      ------------------------------------------------------------
A0A432ZK62      ------------------------------------------------------------
A0A1V5EEP4      ------------------------------------------------------------
A0A1V5EF48      ------------------------------------------------------------
A0A0S6X1X6      ------------------------------------------------------------
A0A537Y5L8      ------------------------------------------------------------
A0A4Q3L2X2      ------------------------------------------------------------
A0A4Q3T8J1      ------------------------------------------------------------
A0A4Q4ANM4      ------------------------------------------------------------
A0A4Q3UEC7      ------------------------------------------------------------
A0A1H5YYQ4      ------------------------------------------------------------
A0A1X4NLK2      ------------------------------------------------------------
A0A1X4NWB5      ------------------------------------------------------------
A0A1M5UQ38      ------------------------------------------------------------
A0A327YI48      ------------------------------------------------------------
A0A1B1PNL6      ------------------------------------------------------------
A0A2U8H9H9      ------------------------------------------------------------
A0A845UXY6      ------------------------------------------------------------
A0A1X6YIC0      ------------------------------------------------------------
A0A1I5E9E9      ------------------------------------------------------------
A0A1X6Z7N7      ------------------------------------------------------------
A0A2E1DQ13      ------------------------------------------------------------
A0A1H8C800      ------------------------------------------------------------
A0A2N3EZ05      ------------------------------------------------------------
A0A844ZIR7      ------------------------------------------------------------
A0A850H7C5      ------------------------------------------------------------
A0A845AYQ8      ------------------------------------------------------------
A0A0W1DLQ3      ------------------------------------------------------------
A0A246JVD8      ------------------------------------------------------------
A0A2N3BB54      ------------------------------------------------------------
A0A1H6G7A3      ------------------------------------------------------------
A0A0A7PGL6      ------------------------------------------------------------
A0A4Q2Z4L0      ------------------------------------------------------------
A0A7W0BRL7      ------------------------------------------------------------
A0A0W1GMS6      ------------------------------------------------------------
A0A0Q8RMY3      ------------------------------------------------------------
A0A1A7QC21      ------------------------------------------------------------
A0A832FJD1      ------------------------------------------------------------
A0A7C0U459      ------------------------------------------------------------
A0A7W0ITF0      ------------------------------------------------------------
A0A832C120      ------------------------------------------------------------
A0A318CT66      ------------------------------------------------------------
A0A3N5P205      ------------------------------------------------------------
A0A2G9XLE5      ------------------------------------------------------------
A0A6L3MM74      ------------------------------------------------------------
A0A7X8CDM1      ------------------------------------------------------------
A0A7C3QM04      ------------------------------------------------------------
A0A7I8MVM0      ------------------------------------------------------------
A0A7C0Y3J7      ------------------------------------------------------------
A0A7C3LF61      ------------------------------------------------------------
A0A4R1HDF2      ------------------------------------------------------------
A0A6N1DL48      ------------------------------------------------------------
A0A534HBS8      ------------------------------------------------------------
E1Y9C0          ------------------------------------------------------------
A0A1N6SH58      ------------------------------------------------------------
A0A4Q3AQN2      ------------------------------------------------------------
                                                                            

A0A1M6N1X5      ------------------------------------------------------------
A0A561M3U0      ------------------------------------------------------------
A0A2T4ZJZ6      ------------------------------------------------------------
A0A1T2KYM8      ------------------------------------------------------------
A0A2G9ZR82      ------------------------------------------------------------
A0A6J4YZ98      ------------------------------------------------------------
A0A844XH11      ------------------------------------------------------------
A0A0P1H2H0      ------------------------------------------------------------
A0A377N8F8      ------------------------------------------------------------
A0A4Q3LR91      ------------------------------------------------------------
A0A6C9IKN8      ------------------------------------------------------------
A0A4V1TR68      ------------------------------------------------------------
A0A6L3ZR06      ------------------------------------------------------------
A0A3E0WKI3      ------------------------------------------------------------
A0A1H3I2J1      ------------------------------------------------------------
A0A521LJG5      ------------------------------------------------------------
A0A1V4WHZ7      ------------------------------------------------------------
A0A1E5AJN5      ------------------------------------------------------------
A0A2N3D2J1      ------------------------------------------------------------
A0A2N2GVE1      ------------------------------------------------------------
A0A2N2INV3      ------------------------------------------------------------
A0A233IKJ2      ------------------------------------------------------------
A0A1Y5DXG5      ------------------------------------------------------------
A0A0B8P2H5      ------------------------------------------------------------
A0A380AQW6      ------------------------------------------------------------
A0A2G2GD62      ----------------MDSNITKNMEADEESFDIQQALYIIKKYNKSIAFIVVVFIIISG
A0A524P331      ------------------------------------------------------------
A0A4V1SSM5      ------------------------------------------------------------
A0A4Q3K8G7      ------------------------------------------------------------
A0A7C7W7M2      ------------------------------------------------------------
A0A1M7HC79      ------------------------------------------------------------
A0A1D3JZN6      ------------------------------------------------------------
A0A1V6ESG1      ------------------------------------------------------------
A0A850NXS7      ------------------------------------------------------------
A0A1H7YHK3      ------------------------------------------------------------
A0A3S1MCW7      ------------------------------------------------------------
A0A528AX40      ------------------------------------------------------------
A0A528MV95      ------------------------------------------------------------
A0A838IR38      ------------------------------------------------------------
A0A328C2K5      ------------------------------------------------------------
A0A5C6X8M3      ------------------------------------------------------------
A0A3D8MRR7      ------------------------------------------------------------
A0A5C6UBJ7      ------------------------------------------------------------
A0A5C6XGM3      ------------------------------------------------------------
A0A849WSS0      ------------------------------------------------------------
A0A7Y3GUU1      ------------------------------------------------------------
A0A090R136      ------------------------------------------------------------
A0A661JU93      ------------------------------------------------------------
A0A0M3GBT1      ------------------------------------------------------------
B3Q577          ------------------------------------------------------------
A0A3R9C3P5      ------------------------------------------------------------
A0A7W6FJX0      ------------------------------------------------------------
A0A2E2T3V8      ------------------------------------------------------------
A0A367UAB4      ------------------------------------------------------------
A0A1F2ZW35      ------------------------------------------------------------
A0A377V641      ------------------------------------------------------------
A0A1F2YJ88      ------------------------------------------------------------
A0A5N8AL61      ------------------------------------------------------------
A0A0J7XGZ1      ------------------------------------------------------------
I4CBA7          ------------------------------------------------------------
A3VE95          ------------------------------------------------------------
A0A1G0NL95      ------------------------------------------------------------
A0A024KA69      ------------------------------------------------------------
A0A0L1KFN4      ------------------------------------------------------------
A0A3D5UYX7      ------------------------------------------------------------
A0A524QFS4      ------------------------------------------------------------
A0A832MZU0      ------------------------------------------------------------
A0A520JSW4      ------------------------------------------------------------
A0A4Q3LTF3      ------------------------------------------------------------
A0A840SQK7      ------------------------------------------------------------
A0A7C3N3Y1      ------------------------------------------------------------
A0A537UTP9      ------------------------------------------------------------
A0A1D2RNR5      ------------------------------------------------------------
A0A4V1TQ46      ------------------------------------------------------------
A0A3A0FZC0      ------------------------------------------------------------
A0A1N7JVZ7      ------------------------------------------------------------
A0A091C4A8      ------------------------------------------------------------
A0A844YBH7      ------------------------------------------------------------
A0A4R3H6P6      ------------------------------------------------------------
A0A3S1NQ09      ------------------------------------------------------------
A0A443GJ52      ------------------------------------------------------------
A0A2W6S588      ------------------------------------------------------------
A0A483E0N4      ------------------------------------------------------------
A0A2J4YQQ6      ------------------------------------------------------------
A0A483THX4      ------------------------------------------------------------
A0A534MVS2      ------------------------------------------------------------
A0A444I5K6      ------------------------------------------------------------
A0A154VE85      ------------------------------------------------------------
A0A3C1S9Y1      ------------------------------------------------------------
A0A353EH49      ------------------------------------------------------------
A0A1Y1Q9C1      ------------------------------------------------------------
A0A3M7LJH0      ------------------------------------------------------------
A0A1E4JHX8      ------------------------------------------------------------
M2U8P2          ------------------------------------------------------------
A0A1H7KZF8      ------------------------------------------------------------
A0A6N3UC48      ------------------------------------------------------------
A0A257NG76      ------------------------------------------------------------
A0A1T4TW59      ------------------------------------------------------------
A0A1Q3MB35      ------------------------------------------------------------
A0A259LUN7      ------------------------------------------------------------
A0A2D7AVL1      ------------------------------------------------------------
A0A3B9KZE9      ------------------------------------------------------------
A0A358L616      ------------------------------------------------------------
A0A4U9HNE9      ------------------------------------------------------------
A0A7X7Z1H8      ------------------------------------------------------------
A0A7C5N053      ------------------------------------------------------------
A0A2G2CXY6      ------------------------------------------------------------
A0A3M1D4H3      ------------------------------------------------------------
A0A7C1A2A2      ------------------------------------AGAALAVLTVLLARPVFRANGSLY
A0A840RX77      ------------------------------------------------------------
A0A5C8BYM7      ------------------------------------------------------------
A0A7V2RUR3      ------------------------------------------------------------
A0A1J5ICP0      ------------------------------------------------------------
A0A379B9V4      ------------------------------------------------------------
A0A0Q6TS97      ------------------------------------------------------------
A0A0Q6UYB4      ------------------------------------------------------------
W7Q5J0          ------------------------------------------------------------
A0A654AKT6      ------------------------------------------------------------
A0A847E0Q2      ------------------------------------------------------------
A0A7W9WQN4      ------------------------------------------------------------
A0A0G9MZA5      ------------------------------------------------------------
H0T8B0          ------------------------------------------------------------
A0A7Y4X614      ------------------------------------------------------------
A0A5C7N981      ------------------------------------------------------------
A0A534TV22      ------------------------------------------------------------
A0A351CXR4      ------------------------------------------------------------
A0A2N6GLF5      ------------------------------------------------------------
A0A1W9LJP0      ------------------------------------------------------------
A0A0W1ICB0      ------------------------------------------------------------
A0A7C1C8G2      ------------------------------------------------------------
A0A832F8F3      ------------------------------------------------------------
A0A2E0UL88      ------------------------------------------------------------
A0A2N1WQN5      ------------------------------------------------------------
A0A0T2QIS1      ------------------------------------------------------------
A0A376KYN0      ------------------------------------------------------------
A0A377E5P7      ------------------------------------------------------------
A0A2X1JB05      ------------------------------------------------------------
A0A376RML0      ------------------------------------------------------------
A0A6N3QTV2      ------------------------------------------------------------
A0A0P7Y1D0      ------------------------------------------------------------
A0A7Y2FUF7      ------------------------------------------------------------
A0A7W6DRI0      ------------------------------------------------------------
A0A542J310      ------------------------------------------------------------
A0A2M7JRZ7      ------------------------------------------------------------
A0A167IR75      ------------------------------------------------------------
A0A3B8T2U6      ------------------------------------------------------------
A0A365PWR2      ------------------------------------------------------------
A0A2E9H5Z8      ------------------------------------------------------------
A0A2E2BR79      ------------------------------------------------------------
A0A6I4IKZ3      ------------------------------------------------------------
A0A7H4JZ79      ------------------------------------------------------------
A0A0Q4Q524      ------------------------------------------------------------
A0A0Q4CFJ9      ------------------------------------------------------------
A0A0Q4FE58      ------------------------------------------------------------
A0A0Q4JWC8      ------------------------------------------------------------
A0A0Q4KFL8      ------------------------------------------------------------
A0A7W8RVL5      ------------------------------------------------------------
A0A831Y0Z8      ------------------------------------------------------------
A0A522R8R0      ------------------------------------------------------------
A0A2U9NDY5      ------------------------------------------------------------
A0A0Q4IGG1      ------------------------------------------------------------
A0A352G2C2      ------------------------------------------------------------
A0A7Y3BMU7      ------------------------------------------------------------
A0A534RUJ5      ------------------------------------------------------------
V4Q8B7          ------------------------------------------------------------
A0A3M1CJM3      ------------------------------------------------------------
A0A2R7SVD4      ------------------------------------------------------------
A0A0Q8XKK5      ------------------------------------------------------------
A0A2E0Q2W0      ------------------------------------------------------------
A0A660NIR6      ------------------------------------------------------------
A0A142W0R3      ------------------------------------------------------------
A0A0S4XR18      ------------------------------------------------------------
A0A7C5CFF1      ------------------------------------------------------------
A0A7X6WZW5      ------------------------------------------------------------
A0A7X2SVT1      ------------------------------------------------------------
A0A2E0GW64      ------------------------------------------------------------
A0A1A7QJ97      ------------------------------------------------------------
A0A832UVD3      ------------------------------------------------------------
A0A7W5IBY1      ------------------------------------------------------------
A0A661LW70      ------------------------------------------------------------
W7Q8F9          ------------------------------------------------------------
A0A524PXH8      ------------------------------------------------------------
A0A4Q3P0E4      ------------------------------------------------------------
A0A3M2BE89      ------------------------------------------------------------
A0A4Q4A6K6      ------------------------------------------------------------
A0A257G674      ------------------------------------------------------------
A0A661M5M6      ------------------------------------------------------------
A0A1I1UM01      ------------------------------------------------------------
Q44573          ------------------------------------------------------------
A2W025          ------------------------------------------------------------
A0A534Z362      --------------------------------MAAADRPLFPLPDPTGAQPTPPGGYLPP
V4J283          ------------------------------------------------------------
A0A536T443      ------------------------------------------------------------
A0A0Q4UFQ5      ------------------------------------------------------------
A0A527W7E6      ------------------------------------------------------------
A0A432EMV7      ------------------------------------------------------------
A0A7Y3M8P5      ------------------------------------------------------------
A0A7C1SEU7      ------------------------------------------------------------
A0A7Y1SPC5      ------------------------------------------------------------
A0A7V6YC94      ------------------------------------------------------------
A0A534WLI3      ------------------------------------------------------------
A0A7V6CBY2      ------------------------------------------------------------
A0A7C6FBW0      ------------------------------------------------------------
A0A087LTV7      ------------------------------------------------------------
A0A7D7WSS2      ------------------------------------------------------------
A0A318KWA2      ------------------------------------------------------------
A0A522MT86      ------------------------------------------------------------
A0A4Q3I221      ------------------------------------------------------------
A0A534SAL6      -----------------------------------MTEQALTSRPADTRLSAPGGYAAAG
A0A534ZDB4      -----------------------------------MAEQALASRATDSRLTAPGGYAAAG
A0A534X3M7      --------------------------------MIARTPVPLRGASAPEQLPPGGGYLPPP
A0A534SPC6      ------------------------------------------------------------
A0A535AD60      ----------------------------MAAADRPLFPLPADPTGAQPTPPGGYLHLPPP
A0A4Q3SY08      ------------------------------------------------------------
A0A7U1E9W6      ------------------------------------------------------------
A0A4Q3LG23      ------------------------------------------------------------
A0A522EX52      ------------------------------------------------------------
A0A1H3KC95      ------------------------------------------------------------
A0A5P8Z4P3      ------------------------------------------------------------
A0A2E9HXF7      ------------------------------------------------------------
A0A0B3RZC9      ------------------------------------------------------------
A0A6F8QET1      ------------------------------------------------------------
A0A520HUH4      ------------------------------------------------------------
A0A2K8U7M6      ------------------------------------------------------------
A0A5B9DKL8      ------------------------------------------------------------
A0A238KJM1      ------------------------------------------------------------
A0A3A0FJZ4      ------------------------------------------------------------
W4HJV8          ------------------------------------------------------------
A0A0P1GDI0      ------------------------------------------------------------
A0A2R8ATV5      ------------------------------------------------------------
A0A1U7D3R6      ------------------------------------------------------------
A0A2D4UVV2      ------------------------------------------------------------
A0A0W7WHP4      ------------------------------------------------------------
A0A238J8F6      ------------------------------------------------------------
A0A238JQI6      ------------------------------------------------------------
A0A222E077      ------------------------------------------------------------
A0A239E3Y2      ------------------------------------------------------------
A0A1F9CFF0      ------------------------------------------------------------
A0A2M8B0G5      ------------------------------------------------------------
A0A363TNU9      ------------------------------------------------------------
A0A445MZQ4      ------------------------------------------------------------
A0A0M9E0E3      ------------------------------------------------------------
A0A351Z9A2      ------------------------------------------------------------
A0A6G6X2Z4      ------------------------------------------------------------
A0A0C5VQ86      ------------------------------------------------------------
A0A3S1WTQ1      ------------------------------------------------------------
A0A354EF47      ------------------------------------------------------------
A0A536T0W8      ------------------------------------------------------------
A0A2G6MSP7      ------------------------------------------------------------
A0A3N5FRH4      ------------------------------------------------------------
A0A1V4Y2C3      ------------------------------------------------------------
A0A2N2KTJ4      ------------------------------------------------------------
A0A2N2LQX0      ------------------------------------------------------------
A0A4U8YMP3      ------------------------------------------------------------
A0A1Q8QQ99      ------------------------------------------------------------
A0A7C2SIB2      ------------------------------------------------------------
A0A3D5ZY44      ------------------------------------------------------------
A0A1G5C236      ------------------------------------------------------------
A0A432HIS7      ------------------------------------------------------------
A0A401FQP5      ------------------------------------------------------------
A0A7C3Q9R6      ------------------------------------------------------------
A0A7C2AA26      ------------------------------------------------------------
A0A351Z4H9      ------------------------------------------------------------
A0A2N2KML4      ------------------------------------------------------------
E1YJF1          ------------------------------------------------------------
A0A1Q6DMW3      ------------------------------------------------------------
A0A3A6P8F8      ------------------------------------------------------------
A0A1J5EVZ6      ------------------------------------------------------------
A0A2G2DSM4      ------------------------------------------------------------
A0A1F9NI02      ------------------------------------------------------------
A0A4U1ABX4      ------------------------------------------------------------
A0A6L4AM84      ------------------------------------------------------------
A0A840UW68      ------------------------------------------------------------
A0A2G6FCC5      ------------------------------------------------------------
A0A1F9MR25      ------------------------------------------------------------
A0A2G6M7F1      ------------------------------------------------------------
A0A5Q2QDL1      ------------------------------------------------------------
A0A4Z0M4C7      ------------------------------------------------------------
A0A1V8MBH1      ------------------------------------------------------------
A0A7V9E085      ------------------------------------------------------------
A0A6J4X8D4      ------------------------------------------------------------
A0A1E7HSL6      ------------------------------------------------------------
A0A2M7JX59      ------------------------------------------------------------
A0A7V4PLT3      ------------------------------------------------------------
A0A7X7Y8R3      ------------------------------------------------------------
A0A832A361      ------------------------------------------------------------
A0A1M5GH86      ------------------------------------------------------------
A0A1W1XQZ5      ------------------------------------------------------------
A0A3D6C3I2      ------------------------------------------------------------
S0G1D4          ------------------------------------------------------------
A0A661T246      ------------------------------------------------------------
A0A850T4Q7      ------------------------------------------------------------
A0A2G6CSG7      ------------------------------------------------------------
A0A2G6NB59      ------------------------------------------------------------
A0A5K8A7T9      ------------------------------------------------------------
A0A1W9U045      ------------------------------------------------------------
A0A1F9L9G4      ------------------------------------------------------------
A0A328FD76      ------------------------------------------------------------
A0A348UX90      ------------------------------------------------------------
A0A357Z0N5      ------------------------------------------------------------
A0A0F2R2U0      ------------------------------------------------------------
A0A5K7ZK00      ------------------------------------------------------------
A0A5K7YCX8      ------------------------------------------------------------
A0A5K7Z388      ------------------------------------------------------------
A0A520CSP5      ------------------------------------------------------------
A0A1E7HFN0      ------------------------------------------------------------
A0A7J0BHG1      ------------------------------------------------------------
A0A6V8LMJ3      ------------------------------------------------------------
A0A2K8WHP8      ------------------------------------------------------------
A0A1J5N774      ------------------------------------------------------------
A0A2C8F781      ------------------------------------------------------------
A0A2E3R6G0      ------------------------------------------------------------
A0A7J0BUD3      ------------------------------------------------------------
A0A3M8EMP2      ------------------------------------------------------------
A0A2J6J6K6      ------------------------------------------------------------
A0A1F8XMK2      ------------------------------------------------------------
A0A661PSB9      ------------------------------------------------------------
A0A661QBT6      ------------------------------------------------------------
A0A6I2SLK2      ------------------------------------------------------------
A0A7Y7NC38      ------------------------------------------------------------
A0A0A8WSG4      ------------------------------------------------------------
S7TK97          ------------------------------------------------------------
S7UE93          ------------------------------------------------------------
A0A3D5BR56      ------------------------------------------------------------
A0A1I3PSR2      ------------------------------------------------------------
A0A2N2IB15      ------------------------------------------------------------
A0A7C8B5M6      ------------------------------------------------------------
A0A7V4UW39      ------------------------------------------------------------
A0A1W7QPT7      ------------------------------------------------------------
A0A6S6M1Y8      ------------------------------------------------------------
A0A6V8MCR2      ------------------------------------------------------------
A0A6V8N3X1      ------------------------------------------------------------
A0A6M4XJ81      ------------------------------------------------------------
A0A0M4D373      ------------------------------------------------------------
A0A1L3GKM9      ------------------------------------------------------------
A0A2T5R3J5      ------------------------------------------------------------
A0A1G6EKK9      ------------------------------------------------------------
A0A7C1DJX8      ------------------------------------------------------------
A0A3A4XVN3      ------------------------------------------------------------
A0A1E7JEV6      ------------------------------------------------------------
A0A2N2KDY5      ------------------------------------------------------------
A0A3N5YUD9      ------------------------------------------------------------
A0A4Q3ZDI7      ------------------------------------------------------------
A0A537PRC6      ------------------------------------------------------------
A0A7Y8L8B9      ------------------------------------------------------------
A0A5C4N0H6      ------------------------------------------------------------
A0A7V4UXV1      ------------------------------------------------------------
A0A7C3Y7G3      ------------------------------------------------------------
A0A7V5R3L0      ------------------------------------------------------------
A0A7V2SYN1      ------------------------------------------------------------
A0A6H9HII8      ------------------------------------------------------------
A0A7S6SHD5      ------------------------------------------------------------
A0A7C1UTU6      ------------------------------------------------------------
W9VVY5          ------------------------------------------------------------
A0A1E2URD3      ------------------------------------------------------------
A0A2T6MY81      ------------------------------------------------------------
A0A7Z0VN76      ------------------------------------------------------------
A0A2T6NBQ8      ------------------------------------------------------------
A0A421K431      ------------------------------------------------------------
A0A7C3Z8T7      ------------------------------------------------------------
A0A1V4QMH7      ------------------------------------------------------------
A0A496XZQ4      ------------------------------------------------------------
A0A7C3UZM2      ------------------------------------------------------------
A0A1F9BJF7      ------------------------------------------------------------
F2NDF5          ------------------------------------------------------------
A0A7Y4XWU8      ------------------------------------------------------------
A0A4V2SPR5      ------------------------------------------------------------
A0A7W8W7P8      ------------------------------------------------------------
A0A7W8WPN5      ------------------------------------------------------------
A0A519ERR1      ------------------------------------------------------------
A0A4Q3Q1M2      ------------------------------------------------------------
A0A4Q3MHR1      ------------------------------------------------------------
A0A520GDZ4      ------------------------------------------------------------
A0A372IH36      ------------------------------------------------------------
A0A540VW45      ------------------------------------------------------------
A0A1H9C241      ------------------------------------------------------------
A0A2E3FCR1      ------------------------------------------------------------
A0A4S3MG69      ------------------------------------------------------------
A0A3E0H727      ------------------------------------------------------------
A0A7X8XJJ0      ------------------------------------------------------------
A0A1I3TTC3      ------------------------------------------------------------
A0A1H3IZW6      ------------------------------------------------------------
A0A0M6YG59      ------------------------------------------------------------
A0A1H7G8B0      ------------------------------------------------------------
A0A2G2I5M1      ------------------------------------------------------------
A0A2G2M6F0      ------------------------------------------------------------
A0A352B502      ------------------------------------------------------------
A0A430DNP0      ------------------------------------------------------------
A0A410V446      ------------------------------------------------------------
A0A1B1UCM8      ------------------------------------------------------------
A0A1N6JQ20      ------------------------------------------------------------
A0A0R3KGJ5      ------------------------------------------------------------
A0A0R3N604      ------------------------------------------------------------
A0A1M5TI07      ------------------------------------------------------------
A3X191          ------------------------------------------------------------
A0A160UA87      ------------------------------------------------------------
A0A1Q5SFV5      ------------------------------------------------------------
A0A1H4RKV5      ------------------------------------------------------------
A0A7Z2Q199      ------------------------------------------------------------
A0A3A0FQ32      ------------------------------------------------------------
A0A7Y3GV54      ------------------------------------------------------------
A0A3E0WXH2      ------------------------------------------------------------
A0A1A9KEF8      ------------------------------------------------------------
A0A5E6PKN5      ------------------------------------------------------------
A0A0N9W1V6      ------------------------------------------------------------
A0A423GQ41      ------------------------------------------------------------
A0A423H7J2      ------------------------------------------------------------
A0A502HNM8      ------------------------------------------------------------
A0A4Q7H223      ------------------------------------------------------------
A0A1H4N2K9      ------------------------------------------------------------
A0A2K4KWF7      ------------------------------------------------------------
A0A1E4UZA0      ------------------------------------------------------------
A0A1H9KL56      ------------------------------------------------------------
A0A7X0BTK5      ------------------------------------------------------------
A0A2N2TRC8      ------------------------------------------------------------
A0A1V4CIZ7      ------------------------------------------------------------
A0A1M3BXA5      ------------------------------------------------------------
A0A1Y2R3U6      ------------------------------------------------------------
A0A167HVD6      ------------------------------------------------------------
A0A1V3SCT6      ------------------------------------------------------------
L0H287          ------------------------------------------------------------
A0A495VG93      ------------------------------------------------------------
A0A4R3MYM4      ------------------------------------------------------------
G2E3C0          ------------------------------------------------------------
A0A1W9J9F8      ------------------------------------------------------------
A0A2S5LFJ9      ------------------------------------------------------------
A0A2D8R8F8      ------------------------------------------------------------
A0A1G0KSD0      ------------------------------------------------------------
A0A4P6WX84      ------------------------------------------------------------
A0A1D2S760      ------------------------------------------------------------
A0A5B8RW94      ------------------------------------------------------------
A0A6I4JXQ8      ------------------------------------------------------------
A0A010SNS0      ------------------------------------------------------------
A0A0C2I782      ------------------------------------------------------------
A0A2N8BYF5      ------------------------------------------------------------
A0A558FKX2      ------------------------------------------------------------
A0A1H1DBA0      ------------------------------------------------------------
J3H699          ------------------------------------------------------------
A0A0K1QRZ4      ------------------------------------------------------------
A0A560RJW9      ------------------------------------------------------------
A0A5E7CRU7      ------------------------------------------------------------
A0A1H5J974      ------------------------------------------------------------
A0A5E7C564      ------------------------------------------------------------
A0A2W7MAV4      ------------------------------------------------------------
W6VFG3          ------------------------------------------------------------
A0A1P8ENT1      ------------------------------------------------------------
A0A2N7XRV4      ------------------------------------------------------------
A0A0Q6QPG8      ------------------------------------------------------------
A0A0F4SWA7      ------------------------------------------------------------
A0A423J219      ------------------------------------------------------------
A0A4P6G9U8      ------------------------------------------------------------
A0A4Y8JE06      ------------------------------------------------------------
A0A502I1X9      ------------------------------------------------------------
A0A502J776      ------------------------------------------------------------
A0A5B0EZF6      ------------------------------------------------------------
A0A059L434      ------------------------------------------------------------
A0A0F4UWN2      ------------------------------------------------------------
A0A5E7WEF5      ------------------------------------------------------------
A0A258TN88      ------------------------------------------------------------
A0A7Y8MN30      ------------------------------------------------------------
A0A3N5J7U8      ------------------------------------------------------------
A0A1S7S3I8      ------------------------------------------------------------
A0A655ZZQ1      ------------------------------------------------------------
A0A1S0ZAI3      ------------------------------------------------------------
A0A3C0L0A8      ------------------------------------------------------------
A0A176S762      ------------------------------------------------------------
A0A1W9WUD9      ------------------------------------------------------------
A0A1W1ZQK0      ------------------------------------------------------------
A0A7X1GRP5      ------------------------------------------------------------
A0A6I1R304      ------------------------------------------------------------
A0A1W9PMU6      ------------------------------------------------------------
A0A7Y4X3V7      ------------------------------------------------------------
A0A1G3VVY5      ------------------------------------------------------------
A0A7C3S273      ------------------------------------------------------------
A0A7C4WJ18      ------------------------------------------------------------
A0A351B422      ------------------------------------------------------------
F2NEE9          ------------------------------------------------------------
A0A7C3V565      ------------------------------------------------------------
A0A7V6A3E1      ------------------------------------------------------------
A0A318D3U4      ------------------------------------------------------------
A0A7V0JSN8      ------------------------------------------------------------
A0A7V5V784      ------------------------------------------------------------
A0A352Q5C1      ------------------------------------------------------------
A0A355TB56      ------------------------------------------------------------
A0A1F9E324      ------------------------------------------------------------
A0A435NNF5      ------------------------------------------------------------
A0A3S2AQS7      ------------------------------------------------------------
A0A527ZPD6      ------------------------------------------------------------
A0A529KRW3      ------------------------------------------------------------
A0A530ZLX0      ------------------------------------------------------------
A0A4Q3LBH4      ------------------------------------------------------------
A0A4Q3LWP3      ------------------------------------------------------------
A0A7C3JPP4      ------------------------------------------------------------
A0A534V9L7      ------------------------------------------------------------
A0A7C3JJT4      ------------------------------------------------------------
A0A524M660      ------------------------------------------------------------
A0A7C3JSX5      ------------------------------------------------------------
A0A7I8MQ67      ------------------------------------------------------------
A0A0C1TRU6      ------------------------------------------------------------
A0A2Z5SSF4      ------------------------------------------------------------
A0A7Y7TF97      ------------------------------------------------------------
A0A4Q4CIB1      ------------------------------------------------------------
A0A522ACJ9      ------------------------------------------------------------
A0A3N5Z7F8      ------------------------------------------------------------
A0A239HD34      ------------------------------------------------------------
A0A3D2M6Y9      ------------------------------------------------------------
A0A519E8D7      ------------------------------------------------------------
A0A3S1FD32      ------------------------------------------------------------
A0A434DUT4      ------------------------------------------------------------
A0A528D3U3      ------------------------------------------------------------
A0A3S3UPT3      ------------------------------------------------------------
A0A3S1E286      ------------------------------------------------------------
A0A531AC71      ------------------------------------------------------------
A0A436K268      ------------------------------------------------------------
A0A434IDQ0      ------------------------------------------------------------
A0A435IRM5      ------------------------------------------------------------
A0A3S2C404      ------------------------------------------------------------
A0A435F6C0      ------------------------------------------------------------
A0A435BMN6      ------------------------------------------------------------
A0A529XQ54      ------------------------------------------------------------
A0A530BJC1      ------------------------------------------------------------
A0A0P7ZZE4      ------------------------------------------------------------
A0A369R0Q9      ------------------------------------------------------------
A0A327LYE6      ------------------------------------------------------------
A0A5A9ZTV3      ------------------------------------------------------------
A0A258WKV0      ------------------------------------------------------------
A5G4N9          ------------------------------------------------------------
A0A812HT29      ------------------------------------------------------------
A0A444IY46      ------------------------------------------------------------
A0A6I7N627      ------------------------------------------------------------
A0A1V5DJV0      ------------------------------------------------------------
A0A520IUC4      ------------------------------------------------------------
A0A7Y7M8F4      ------------------------------------------------------------
A0A0P1FWI8      ------------------------------------------------------------
A0A6L8LHC6      ------------------------------------------------------------
A0A848ST88      ------------------------------------------------------------
A0A7U1HWF1      ------------------------------------------------------------
A0A534SH66      ------------------------------------------------------------
A0A3M0ZZ99      ------------------------------------------------------------
A0A238LBD3      ------------------------------------------------------------
A0A537NZJ1      ------------------------------------------------------------
A0A7C4R3C4      ------------------------------------------------------------
A0A0P1FRV5      ------------------------------------------------------------
A0A4Q4CVW6      ------------------------------------------------------------
A0A8B6LS25      ------------------------------------------------------------
A0A6L3ZWI0      ------------------------------------------------------------
A0A1M7BLL7      ------------------------------------------------------------
A0A0H4KZM1      ------------------------------------------------------------
A0A7V2W904      ------------------------------------------------------------
A0A1V1UJT2      ------------------------------------------------------------
A0A0L6CVX1      ------------------------------------------------------------
A0A1V0RR48      ------------------------------------------------------------
A0A0A0HJJ4      ------------------------------------------------------------
A0A5E7YA28      ------------------------------------------------------------
A0A316KRG4      ------------------------------------------------------------
A0A0J5Q9T7      ------------------------------------------------------------
A0A1I5YYQ0      ------------------------------------------------------------
A0A5P9FE62      ------------------------------------------------------------
A0A7U3CQW5      ------------------------------------------------------------
X7F6S5          ------------------------------------------------------------
A0A1G8NKI0      ------------------------------------------------------------
A0A355QPE4      ------------------------------------------------------------
A0A357RN98      ------------------------------------------------------------
A0A1I6U4V1      ------------------------------------------------------------
A0A6B2P8H8      ------------------------------------------------------------
A0A1P8USW9      ------------------------------------------------------------
A0A1G7CFZ2      ------------------------------------------------------------
A0A7G2TPW1      ------------------------------------------------------------
A0A1V6FYJ1      ------------------------------------------------------------
A0A4Q3IRI1      ------------------------------------------------------------
A0A7J5VV32      ------------------------------------------------------------
A0A1E7H876      ------------------------------------------------------------
A0A7C1C6X5      ------------------------------------------------------------
A0A7X1GMT8      ------------------------------------------------------------
Q44570          ------------------------------------------------------------
A0A509L3P8      ------------------------------------------------------------
A0A3A4S038      ------------------------------------------------------------
A0A1F9N669      ------------------------------------------------------------
A0A1F9PFA7      ------------------------------------------------------------
A0A1H2EN09      ------------------------------------------------------------
K0NP00          ------------------------------------------------------------
A0A2N6BZD5      ------------------------------------------------------------
A0A0F2NF69      ------------------------------------------------------------
A0A1F9NFD0      ------------------------------------------------------------
A0A1W9M770      ------------------------------------------------------------
A0A1W9M7R6      ------------------------------------------------------------
A0A7W0IR34      ------------------------------------------------------------
A0A7V5FUI1      ------------------------------------------------------------
A0A7T6AQC8      ------------------------------------------------------------
A0A7U4DQ89      ------------------------------------------------------------
A0A1M5YLH5      ------------------------------------------------------------
A0A4U1A4C7      ------------------------------------------------------------
A0A7C4N0I9      ------------------------------------------------------------
A0A1V4M8I1      ------------------------------------------------------------
A0A7C0XE92      ------------------------------------------------------------
A0A7U4QIX5      ------------------------------------------------------------
A0A800BQ44      ------------------------------------------------------------
A0A1E7JCL5      ------------------------------------------------------------
A0A7Z9XET3      ------------------------------------------------------------
A0A800C5N3      ------------------------------------------------------------
A0A496YAH9      ------------------------------------------------------------
A0A1V4S7E4      ------------------------------------------------------------
A0A847DGI3      ------------------------------------------------------------
A0A2N2H8D2      ------------------------------------------------------------
A0A2N2KC63      ------------------------------------------------------------
A0A3A4ZYW4      ------------------------------------------------------------
A0A800BMM4      ------------------------------------------------------------
A0A1V4MCJ4      ------------------------------------------------------------
A0A661M0W4      ------------------------------------------------------------
A0A3N5RNY4      ------------------------------------------------------------
A0A1M7Y300      ------------------------------------------------------------
A0A4U1ALN4      ------------------------------------------------------------
A0A849F908      ------------------------------------------------------------
A0A2N6BEI9      ------------------------------------------------------------
A0A0D5N3E9      ------------------------------------------------------------
A0A2N2G716      ------------------------------------------------------------
A0A1F9EUS2      ------------------------------------------------------------
A0A3N9VAW3      ------------------------------------------------------------
A0A6I1KNW9      ------------------------------------------------------------
A0A1H4B8T3      ------------------------------------------------------------
A0A1E7IQC3      ------------------------------------------------------------
A0A1M6KEN5      ------------------------------------------------------------
A0A1X0YE57      ------------------------------------------------------------
A0A2K2H9Q8      ------------------------------------------------------------
A0A1F8X5S3      ------------------------------------------------------------
A0A353QLL3      ------------------------------------------------------------
A0A847C207      ------------------------------------------------------------
A0A399I453      ------------------------------------------------------------
A0A651FBV9      ------------------------------------------------------------
A0A562VHD2      ------------------------------------------------------------
A0A7K0J0R7      ------------------------------------------------------------
A0A6I6JNB5      ------------------------------------------------------------
A0A847UFK5      ------------------------------------------------------------
A0A1G0LDK7      ------------------------------------------------------------
A0A6F9WVL7      ------------------------------------------------------------
A0A7Y7TLN9      ------------------------------------------------------------
A0A5C1MDH8      ------------------------------------------------------------
A0A7J4ZSX4      ------------------------------------------------------------
A0A5A9XE04      ------------------------------------------------------------
A0A643G9R1      ------------------------------------------------------------
A0A1G0M8Q7      ------------------------------------------------------------
A0A353MI14      ------------------------------------------------------------
A0A4S1CAW7      ------------------------------------------------------------
A0A655R819      ------------------------------------------------------------
A0A655RNN3      ------------------------------------------------------------
A0A354EI73      ------------------------------------------------------------
A0A6D0ELN7      ------------------------------------------------------------
A0A0B8PTA8      ------------------------------------------------------------
A0A0B8QF75      ------------------------------------------------------------
A0A4U9I390      ------------------------------------------------------------
A0A2X3M011      ------------------------------------------------------------
A0A2H9EHM4      ------------------------------------------------------------
A0A380B3D7      ------------------------------------------------------------
F5NSX0          ------------------------------------------------------------
A0A7A9K1G5      ------------------------------------------------------------
A0A811C967      ------------------------------------------------------------
A0A479JNB1      ------------------------------------------------------------
A0A5C9AF52      ------------------------------------------------------------
A0A6D0EYC7      ------------------------------------------------------------
D8EEU7          ------------------------------------------------------------
A0A0R0BVC7      ------------------------------------------------------------
A0A4U8YLL7      ------------------------------------------------------------
A0A2M7WWF7      ------------------------------------------------------------
A0A534QGR3      ------------------------------------------------------------
A0A0Q6QV61      ------------------------------------------------------------
A0A2Z3IKG4      ------------------------------------------------------------
B7RS54          ------------------------------------------------------------
A0A7R7CAD2      ------------------------------------------------------------
A0A7R7CQL5      ------------------------------------------------------------
A0A1I3XJ27      ------------------------------------------------------------
A0A562CGU2      ------------------------------------------------------------
A0A7C9VCB3      ------------------------------------------------------------
A0A1I7DCG1      ------------------------------------------------------------
A0A3A3H6D9      ------------------------------------------------------------
A0A0Q6VA36      ------------------------------------------------------------
A0A1B2EQN1      ------------------------------------------------------------
A0A1G8QZS5      ------------------------------------------------------------
A0A1H2Y469      ------------------------------------------------------------
A0A497ZQU7      ------------------------------------------------------------
A0A443K010      ------------------------------------------------------------
A0A6I7NYG5      ------------------------------------------------------------
A0A1I0R9R6      ------------------------------------------------------------
A0A2N3BVE7      ------------------------------------------------------------
A0A7C2IB02      ------------------------------------------------------------
A0A6N6SI00      ------------------------------------------------------------
A0A2S5JE21      ------------------------------------------------------------
A0A2R8BKZ2      ------------------------------------------------------------
A0A2S8S361      ------------------------------------------------------------
A0A1X7ACC1      ------------------------------------------------------------
A0A238KUF6      ------------------------------------------------------------
A0A095CTW3      ------------------------------------------------------------
A0A2E3UGD6      ------------------------------------------------------------
A0A840CE00      ------------------------------------------------------------
A0A2T0RFH0      ------------------------------------------------------------
A0A285D390      ------------------------------------------------------------
A0A497VHN4      ------------------------------------------------------------
A0A6M1UAR9      ------------------------------------------------------------
A0A520ZTR8      ------------------------------------------------------------
A0A7Y2NU38      ------------------------------------------------------------
A0A849GJU0      ------------------------------------------------------------
A0A316GHM6      ------------------------------------------------------------
A0A848VYK1      ------------------------------------------------------------
A0A7C9INT8      ------------------------------------------------------------
A0A238IZI1      ------------------------------------------------------------
A0A7Y2U0H6      ------------------------------------------------------------
A0A848WN80      ------------------------------------------------------------
A0A1I6ENM4      ------------------------------------------------------------
A0A2E2P4I0      ------------------------------------------------------------
A0A2U2CM86      ------------------------------------------------------------
A0A212AR83      ------------------------------------------------------------
A0A2M8J3R9      ------------------------------------------------------------
A0A1I6X762      ------------------------------------------------------------
A0A843YIS7      ------------------------------------------------------------
A0A0P1EFX8      ------------------------------------------------------------
A0A2G5KB39      ------------------------------------------------------------
A8LNM8          ------------------------------------------------------------
A0A844B423      ------------------------------------------------------------
A0A0T5NSU3      ------------------------------------------------------------
A0A5P9I718      ------------------------------------------------------------
A0A2N3CNV1      ------------------------------------------------------------
A0A257F1F4      ------------------------------------------------------------
A0A2D5J8T8      ------------------------------------------------------------
A0A2E3P9W6      ------------------------------------------------------------
A0A2G2B1P9      ------------------------------------------------------------
A0A258GCD5      ------------------------------------------------------------
A0A443INY4      ------------------------------------------------------------
A0A2D9YR88      ------------------------------------------------------------
A0A4Q3ZBK4      ------------------------------------------------------------
A0A1G9FY29      ------------------------------------------------------------
A0A6N9RUN2      ------------------------------------------------------------
A0A1W9HS52      ------------------------------MNDRGRTSRALAHSGFDNGDYIFINPRQVV
A0A2D5LFD8      PIKLLVELLEKNMAPSKSPLDIEKKR-----DHATDQSSGNEGESLEGGASYSEFRQIIY
A0A4D8PLT4      AARPFAAIRHAHPGPDRQPARRKGRRREFFDRQRRDASRPRSARQRPSGQSSAIGRGRVL
A0A1G3JY11      ------------------------------------------------------------
A0A3A4NIE9      ------------------------------------------------------------
A0A3A4NUI9      ------------------------------------------------------------
A0A524I3Z6      ------------------------------------------------------------
A0A524PCL7      ------------------------------------------------------------
A0A356GQV1      ------------------------------------------------------------
A0A1J5DAY8      ------------------------------------------------------------
A0A524P237      ------------------------------------------------------------
A0A4P7EP83      ------------------------------------------------------------
A0A348SRI7      ------------------------------------------------------------
A0A833GQE1      ------------------------------------------------------------
A0A661N3U1      ------------------------------------------------------------
A0A7X1T426      ------------------------------------------------------------
A0A432SAI6      ------------------------------------------------------------
A0A855HUH5      ------------------------------------------------------------
A0A6L6H5T1      ------------------------------------------------------------
A0A7V5C3K7      ------------------------------------------------------------
A0A7Y9AV38      ------------------------------------------------------------
A0A2W5J775      ------------------------------------------------------------
A0A3M3H5V6      ------------------------------------------------------------
A0A7V2YBQ6      ------------------------------------------------------------
A0A7X8Z4Y1      ------------------------------------------------------------
A0A377ZC40      ------------------------------------------------------------
A0A534XP85      ------------------------------------------------------------
A0A377LY04      ------------------------------------------------------------
A0A2X3K9R3      ------------------------------------------------------------
A0A484X141      ------------------------------------------------------------
A0A5N9VWI6      ------------------------------------------------------------
A0A5C9ABR5      ------------------------------------------------------------
A0A6D0EJQ0      ------------------------------------------------------------
A0A444R390      ------------------------------------------------------------
A0A376LLF8      ------------------------------------------------------------
A0A6L7CT21      ------------------------------------------------------------
A0A378BPJ7      ------------------------------------------------------------
A0A377ZDN3      ------------------------------------------------------------
A0A2J5PAJ7      ------------------------------------------------------------
A0A7Z9CQS8      ------------------------------------------------------------
A0A2W4RFS2      ------------------------------------------------------------
A0A1Y6DC43      ------------------------------------------------------------
A0A2S6HE06      ------------------------------------------------------------
G3J0M3          ------------------------------------------------------------
V5C6R5          ------------------------------------------------------------
A0A7V0Z1K0      ------------------------------------------------------------
A0A7Y8IFK0      ------------------------------------------------------------
A0A4Q2XLV7      ------------------------------------------------------------
A0A4Q5QYC4      ------------------------------------------------------------
A0A0U2VAW2      ------------------------------------------------------------
A0A454CTF1      ------------------------------------------------------------
A0A6B3Q2G1      ------------------------------------------------------------
A0A6N9S3L5      ------------------------------------------------------------
A0A656BWB0      ------------------------------------------------------------
A0A6D0IFH4      ------------------------------------------------------------
A0A0A0FHV8      ------------------------------------------------------------
A0A2I8SDU4      ------------------------------------------------------------
A0A2I8SU55      ------------------------------------------------------------
A0A7I6T806      ------------------------------------------------------------
A0A7I6TQE9      ------------------------------------------------------------
A0A7I6U296      ------------------------------------------------------------
S1EXJ6          ------------------------------------------------------------
A0A376UBS1      ------------------------------------------------------------
A0A4Q6G931      ------------------------------------------------------------
A0A2T0VBD8      ------------------------------------------------------------
A0A7W5DMU7      ------------------------------------------------------------
A0A378APS2      ------------------------------------------------------------
A0A443VCQ6      ------------------------------------------------------------
A0A447RKQ7      ------------------------------------------------------------
W1DSK1          ------------------------------------------------------------
A0A2N1XK22      ------------------------------------------------------------
A0A850R066      ------------------------------------------------------------
A0A1W9F5M9      ------------------------------------------------------------
A0A352MMI7      ------------------------------------------------------------
A0A4Z0LWV1      ------------------------------------------------------------
A0A376RY66      ------------------------------------------------------------
A0A377K431      ------------------------------------------------------------
A0A6D0I9G1      ------------------------------------------------------------
A0A379W6R2      ------------------------------------------------------------
A0A379TA56      ------------------------------------------------------------
A0A655C5P0      ------------------------------------------------------------
A0A3C2BN18      ------------------------------------------------------------
A0A447LR75      ------------------------------------------------------------
A0A759KJJ5      ------------------------------------------------------------
A0A376D8L7      ------------------------------------------------------------
A0A1V2FV46      ------------------------------------------------------------
A0A6N8QLT3      ------------------------------------------------------------
A0A376SB61      ------------------------------------------------------------
A0A3D1BYV9      ------------------------------------------------------------
A0A3P5DSS6      ------------------------------------------------------------
A0A483YEL5      ------------------------------------------------------------
A0A844PX38      ------------------------------------------------------------
A0A8B4SQI1      ------------------------------------------------------------
A0A483QWI8      ------------------------------------------------------------
A0A483UXD3      ------------------------------------------------------------
A0A0A8J8L3      ------------------------------------------------------------
A0A660DJ38      ------------------------------------------------------------
A0A378G3G7      ------------------------------------------------------------
A0A2X5NHJ9      ------------------------------------------------------------
A0A2J4QEC3      ------------------------------------------------------------
A0A485ADM3      ------------------------------------------------------------
A0A3D0KAC8      ------------------------------------------------------------
A0A4U9HGU4      ------------------------------------------------------------
A0A3S4JGG5      ------------------------------------------------------------
A0A377ZDH2      ------------------------------------------------------------
A0A3S4HTS8      ------------------------------------------------------------
A0A3N5MZ53      ------------------------------------------------------------
A0A534E4H4      ------------------------------------------------------------
A0A534I2B6      ------------------------------------------------------------
A0A1C2JGD0      ------------------------------------------------------------
A0A259LQ70      ------------------------------------------------------------
A0A3N5PM86      ------------------------------------------------------------
A0A2E5YSA4      ------------------------------------------------------------
A0A0N0XAV4      ------------------------------------------------------------
A0A0P9QD19      ------------------------------------------------------------
F3FHG4          ------------------------------------------------------------
F3GGI0          ------------------------------------------------------------
A0A0P9LE74      ------------------------------------------------------------
A0A3M4ZQ14      VVRSQSLDSLDRRAVLPDRAGLRDSGDALLPGQCHDPDRAQKNWHRGHARGQRQADVSVP
A0A3M5YLE8      VVRSQSLDSLDRRAVLPDRAGLRDSGDALLPGQCHDPDRAQKNWHRGHARGQRQADVSVP
A0A3M3RP89      VVRSQSLDSLDRRAVLPDRAGLRDSGDALLPGQCHDPDRAQKNWHRGHARGQRQADVSVP
A0A0P9QIY7      VVRSQSLDSLDRRAVLPYRAGLRDSGDALLPGQCHDPDRAQKNRHRGHARGQRQADVSVP
A0A0P9VVH7      VVRSQSLDSLDRRAVLPDRAGLRDSGDALLPGQCHDPDRAQKNWHRGHARGQRQADVSVP
A0A0Q0FJK6      VVRSQSLDSLDRRAVLPDRAGLRDSGDALLPGQCHDPDRAQKNRHRGHARGQRQADVSVP
A0A3M3LF66      VVRSQSLDSLDRRAVLPDRAGLRDSGDALLPGQCHDPDRAQKNWHRGHARGQRQADVSVP
A0A0P9WIR8      VVRSQSLDSLDRRAVLPYRAGLRDSGDALLPGQCHDPDRAQKNRHRGHARGQRQADVSVP
A0A3M3KPE5      ------------------------------------------------------------
A0A3M4C263      ------------------------------------------------------------
A0A3M5AD05      ------------------------------------------------------------
A0A0Q0D3D2      ---------FQR------------------------------------------------
A0A0N0FS39      ------------------------------------------------------------
A0A3M6GHH2      ------------------------------------------------------------
A0A0P9R9W0      AVRPQDPDRVDRRPVFSGGSGLCHSRHAGVSGHRHDSDRAQKNRHRRHSGGQRQTTLSVA
A0A0Q0B9T0      AVRPQDPDRVDRRPVFSGGSGLCHSRHAGVSGHRHDSDRAQKNRHRRHSGGQRQTTLSVA
A0A3M6CFI7      AVRPQDPDRVDRRPVFSGGSGLCHSRHAGVSGHRHDSDRAQKNRHRRHSGGQRQTTLSVA
A0A0P9JXN0      AVRPQDPDRVDRRPVFSGGSGVCHSRHAGVSGHRHDSDRAQKNRHRRHSGGQRQTTLGVA
A0A3M6FIV7      AVRPQDPDRVDRRPVFSGGSGVCHSRHAGVSGHRHDSDRAQKNRHRRHSGGQRQTTLGVA
A0A3M3PLW9      ---------------------------------------------MPSHSRCRRXXTTEI
A0A3M4ENY1      ------------------------------------------------------------
A0A3M5EZK7      ------------------------------------------------------------
A0A0P9SPP5      -------------------------------------------------------MVSVA
A0A658KL17      -------------------------------------------------------MVSVA
A0A3M3NNF2      -------------------------------------------------------MVSVA
A0A7Z6UK49      ---------MDRQPVFSDRPGLRHSGHAGVSGHRHDSDRAPKNRHRGHPGGQRQAIVSVT
A0A3M4A0E8      ---------MDRQPVFSDRPGLRHSGHAGVSGHRHDSDRAPKNRHRGHPGGQRQAIVSVT
A0A3M4PBZ2      ---------MDRQPVFSDRPGLRHSGHAGVSGHRHDSDRAPKNRHRGHPGGQRQAIVSVT
A0A7Z6U7Q8      ---------MDRQPVFSDRPGLRHSGHAGVSGHRHDSDRAPKNRHRGHPGGQRQAIVSVT
A0A3M6AI26      ---------MDRQPVFSDRSGLCHSGHSGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A0P9IWP8      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A0P9KZ49      ---------MDRQPVFSDRSGLCHSGHSGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A0P9V840      ---------MDRQPVFSDRSGLCHSGHSGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A0Q0AIE5      ---------MDRQPVFSDRSGLCHSGHSGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A3M2ZQH6      ---------MDRQPVFSDRSGLCHSGHSGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A0N8SQG2      ---------MDRQPVFSDRSGLCHSGHSGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A0W8HFU1      ---------MDRQPVFSDRSGLCHSGHSGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A0P9VHH8      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A0P9YV98      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A3M3G2W8      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A3M6C224      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A0P9SCD7      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A0P9T4G3      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A0P9VKB0      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A0Q0BM35      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A3M3TPR7      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A3M3U4Q3      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A8B3FSE5      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A3M5K254      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A7V8M007      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A3M5JFB0      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A3M3TQV3      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A3M4A376      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A3M3EF92      ---------MDRQPVFSDRSGLCHSGHAGVSDHRHDSDRAPKNRHRGHPGGQRQAIVSVA
A0A3M5J1E2      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDSDRAPKNRHRGHPGGQRQAIVSVA
A0A3M5M873      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHSRGQRQAIVSVA
A0A3M5G7H9      ---------MDRQPVFSDLSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A0Q0A5T8      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A0P9QCJ2      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A0P9UCX7      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A0P9Q329      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A3M5GJ64      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A0P9S1F1      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHSRGQRQAIVSVA
A0A3M2XYQ3      ---------MDRRPVFSARPGLRHSGHAGVSGHRHDSDRTPKNRHRGYAGSQCQATLGVA
A0A0P9XCE1      ---------MDRRPVFSARPGLRHSGHAGVSGHRHDSDRTPKNRHRGYTGSQCQATLGVA
A0A3M3EFX7      ---------MDRRPVFSARHGLRHSGHAGVSGHRHDSDRTPKNRHRGYAGSQCQATLGVA
A0A3M5B9D9      ---------MDCRPVFSARPGLRHSGHAGVSGHRHDSDRTPKNRHRGYAGSQCQATLGVA
A0A0P9RRZ3      ---------MDSQPVFSDRPGLCHSGHAGLSGHRHDSDRAEKNRHRGYPRGQRQATLGVA
A0A3M2VEK7      ---------MDRRRVFPDRPGLCHSGHTGVSGHRHDSDRASENRHRGHARSQCQATLGVA
A0A0N8R9B3      ---------MDRRRVFSDRPGLCHSCHAGVSGHRHDSDRASENRHRGHAGSQCQATLGVA
A0A0P9VA27      ---------MDRRRVFSDRPGLCHSCHAGVSGHRHDSDRASKNRHRGHAGSQCQATLGVA
A0A3M4YBJ4      ---------MDRRRVFPDRPGLCHSGHTGVSGHRHDSDRASENRHRGHAGSQCQATLGVA
A0A0P9J470      ---------MDRRRVFSDRPGLCHSCHAGVSGHRHDSDRAPENRHRGHAGGQCQATLGVA
A0A0Q0EVJ8      ---------MDRRRVFSDRPGLCHSGHAGVSGHRHDSDRAPENRHRGHAGGQCQATLGVA
A0A3M5UI30      ---------MDRQPVFSDRSGLCHSGHSGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A3M5YQT8      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A3M5F5X1      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHSRGQRQAIVSVA
A0A3M5R8G1      ------------------------------------------------------AIVSVA
A0A3M5V012      ------------------------------------------------------AIVNVA
A0A3M3GA16      ----------------------------------------------------RKAIVSVA
A0A3M3CJL0      AVRSQDPDPVDRRRVFPDRPGLCHSGHTGVSGHRHDSDRASKNRHRGHTGSQRQATLGVA
A0A3M3F6F5      AVRSQDPDPVDRRRVFPDRPGLCHSGHTGVSGHRHDSDRASENRHRGHAGSQCQATLGVA
A0A3M3P9B7      AVRSQDPDPVDRRRVFPDRPGLCHSGHTGVSGHRHDSDRASENRHRGHAGSQCQATLGVA
A0A0N8QB74      AVRSQDPDPVDRRRVFPDRPGLCHSGHTGVSGHRHDSDRASENRHRGHAGSQCQATLGVA
A0A0Q0AUD0      AVRSQDPDPVDRRRVFPDRPGLCHSGHTGVSGHRHDSDRASENRHRGHAGSQCQATLGVA
A0A3M5VR55      AVRSQDPDPVDRRRVFPDRPGLCHSGHTGVSGHRHDSDRASENRHRGHARSQCQATLGVA
A0A0Q0FK97      AVRSQDPDPVDRRRVFPDRPGLCHSGHTGVSGHRHDSDRASENRHRGHAGSQCQATLGVA
A0A3M3UCT3      AVRSQDPDPVDRRRVFPDRPGLCHSGHTGVPGYRHDSDRASENRHRGHAGSQCQATLGVA
A0A7Z6Y5I3      AVRSQDPDPVDRRRVFPDRPGLCHSGHTGVPGYRHDSDRASENRHRGHAGSQCQATLGVA
A0A3M5KZ75      ------------------------------------------MPSHSRCRRRPXXXTTEI
A0A3M5L3G5      ------------------------------------------------------------
A0A7Y2TRV5      ------------------------------------------------------------
A0A318DSU0      ------------------------------------------------------------
A0A538PF21      ------------------------------------------------------------
A0A1W1ZH10      ------------------------------------------------------------
A0A1W2FF24      ------------------------------------------------------------
A0A524JYQ6      ----------------------QQLAELGVKLDKACQLAAEGVSSRLAMA----------
A0A4Q3MA17      ------------------------------------------------------------
A0A0N0M5F7      ------------------------------------------------------------
A0A537M754      ------------------------------------------------------------
A0A1V1PDB4      ------------------------------------------------------------
A0A2M7C324      ---------------------------------MQVADVVSGFEREYEMA----------
A0A4Q3HHG6      ------------------------------------------------------------
A0A3B7DTA4      ------------------------------------------------------------
A0A432ZK62      ---------------------------------MVACLGLDLCWFDRRLS----------
A0A1V5EEP4      ------------------------------------------------------------
A0A1V5EF48      ------------------------------------------------------------
A0A0S6X1X6      ------------------------------------------------------------
A0A537Y5L8      ------------------------------------------------------------
A0A4Q3L2X2      ------------------------------------------------------------
A0A4Q3T8J1      ------------------------------------------------------------
A0A4Q4ANM4      ---------------------------------------------QSQVR----------
A0A4Q3UEC7      ---------------------------------------------MAEVR----------
A0A1H5YYQ4      ---------MTQRPKFTRKKRAGAQSLPEIEPAVPAPQIDDTERKQAEIR----------
A0A1X4NLK2      ---------MTEQPKFQRRKRRGANT--------AAEQAQPVAVNAPDSR----------
A0A1X4NWB5      ---------MTEQPKFQRRKRREEAS--------ADVQPKRTPERNDTPT----------
A0A1M5UQ38      ---------MTEQPKFQRRKRRGAVD--------DVPTPTPKAPKKATPP----------
A0A327YI48      ---------MTDDRKFRRRNPLSAEI--------AAGEQAAKLARAEDAR----------
A0A1B1PNL6      ---------MVERRRFRRRKRSEETP--------EDPPILPLERREERLA----------
A0A2U8H9H9      ---------MVERRKFQRRKRVDETP--------EDPPIFPLERRADRLA----------
A0A845UXY6      ---------MVERRKFQRRKRVDETP--------EDPPIFPLERRADRLA----------
A0A1X6YIC0      -----------------------------------------MADRPKFRR----------
A0A1I5E9E9      ---------------------------------------MKLSRYEAYMR----------
A0A1X6Z7N7      ---------------------------------------MKLSRYEAYMR----------
A0A2E1DQ13      --------------MAGDPAMKQAPE--------AAAEDVTLSRHEAYMR----------
A0A1H8C800      ---------------------------------------MKLQRHDAYMR----------
A0A2N3EZ05      --------------------MRQAPE--------AEAEDATLSRHEAYMR----------
A0A844ZIR7      ------------------------------------------------------------
A0A850H7C5      ------------------------------------------------------------
A0A845AYQ8      ------------------------------------------------------------
A0A0W1DLQ3      ------------------------------------------------------------
A0A246JVD8      ------------------------------------------------------------
A0A2N3BB54      ------------------------------------------------------------
A0A1H6G7A3      ------------------------------------------------------------
A0A0A7PGL6      ------------------------------------------------------------
A0A4Q2Z4L0      ------------------------------------------------------------
A0A7W0BRL7      ------------------------------------------------------------
A0A0W1GMS6      ------------------------------------------------------------
A0A0Q8RMY3      ------------------------------------------------------------
A0A1A7QC21      ------------------------------------------------------------
A0A832FJD1      ------------------------------------------------------------
A0A7C0U459      ------------------------------------------------------------
A0A7W0ITF0      ------------------------------------------------------------
A0A832C120      ------------------------------------------------------------
A0A318CT66      ------------------------------------------------------------
A0A3N5P205      ------------------------------------------------------------
A0A2G9XLE5      ------------------------------------------------------------
A0A6L3MM74      ------------------------------------------------------------
A0A7X8CDM1      ------------------------------------------------------------
A0A7C3QM04      ------------------------------------------------------------
A0A7I8MVM0      ------------------------------------------------------------
A0A7C0Y3J7      ------------------------------------------------------------
A0A7C3LF61      ------------------------------------------------------------
A0A4R1HDF2      ------------------------------------------------------------
A0A6N1DL48      ------------------------------------------------------------
A0A534HBS8      ------------------------------------------------------------
E1Y9C0          ------------------------------------------------------------
A0A1N6SH58      ------------------------------------------------------------
A0A4Q3AQN2      ------------------------------------------------------------
                                                                            

A0A1M6N1X5      ------------------------------------------------------------
A0A561M3U0      ------------------------------------------------------------
A0A2T4ZJZ6      ------------------------------------------------------------
A0A1T2KYM8      ------------------------------------------------------------
A0A2G9ZR82      ------------------------------------------------------------
A0A6J4YZ98      ------------------------------------------------------------
A0A844XH11      ------------------------------------------------------------
A0A0P1H2H0      ------------------------------------------------------------
A0A377N8F8      ------------------------------------------------------------
A0A4Q3LR91      ------------------------------------------------------------
A0A6C9IKN8      ------------------------------------------------------------
A0A4V1TR68      ------------------------------------------------------------
A0A6L3ZR06      ------------------------------------------------------------
A0A3E0WKI3      ------------------------------------------------------------
A0A1H3I2J1      ------------------------------------------------------------
A0A521LJG5      ------------------------------------------------------------
A0A1V4WHZ7      ------------------------------------------------------------
A0A1E5AJN5      -------MADQQHSHSSNPGPVFLPGEASGTGNFVPSLGGSLLTDPVRLFMTAVSYSWLI
A0A2N3D2J1      ------------------------------------------------------------
A0A2N2GVE1      ----------------------------------MAEPLGPFDAAPANNNAPAQTQVDWK
A0A2N2INV3      ----------------------------------MAEPLGPFDAAPASNNAPAQTQVDWK
A0A233IKJ2      ------------------------------------------------------------
A0A1Y5DXG5      ------------------------------------------------------------
A0A0B8P2H5      ------------------------------------------------------------
A0A380AQW6      ------------------------------------------------------------
A0A2G2GD62      IMAYFKPSMYFSTAVVQISEKGRSGWNDPVLTALGLGDSQGQNIDSIMSSGYLISKMLEN
A0A524P331      ------------------------------------------------------------
A0A4V1SSM5      ------------------------------------------------------------
A0A4Q3K8G7      ------------------------------------------------------------
A0A7C7W7M2      ---------------------------MASQPELYDEIVDYRYYLELVRTVLLKYNKLIA
A0A1M7HC79      ------------------------------------------------------------
A0A1D3JZN6      ------------------------------------------------------------
A0A1V6ESG1      ------------------------------------------------------------
A0A850NXS7      ------------------------------------------------------------
A0A1H7YHK3      ------------------------------------------------------------
A0A3S1MCW7      ------------------------------------------------------------
A0A528AX40      ------------------------------------------------------------
A0A528MV95      ------------------------------------------------------------
A0A838IR38      --------------------------------MSDAFGFQEPRGSGAADDEGESLGRLIS
A0A328C2K5      --------------------------------MSDQYGFQEPRSQSAPEERGESLGALIG
A0A5C6X8M3      --------------------------------MSDQYGFQEPRPSSAPEERGESLGALIG
A0A3D8MRR7      --------------------------------MSDQYGFQEPRQSSAPEERGESLGALIG
A0A5C6UBJ7      --------------------------------MSDQYGFQEPRQSSAPEERGESLGALIG
A0A5C6XGM3      --------------------------------MSDQYGFQEPRPSSAPEERGESLGALIG
A0A849WSS0      --------------------------MSATPTRNYTGPERRRQNADVFDLKEILRFVLRH
A0A7Y3GUU1      ------------------------------------------------------------
A0A090R136      ------------------------------------------------------------
A0A661JU93      ------------------------------------------------------------
A0A0M3GBT1      ------------------------------------------------------------
B3Q577          ------------------------------------------------------------
A0A3R9C3P5      ----------------MTISTLPPDRNLPISPMRYDPRFQVETKADQFDLAAAVGLVRRR
A0A7W6FJX0      ----------------MTISTLPPDRNLPISPMRYDPRFQVETKADQFDLAAAVGLVRRR
A0A2E2T3V8      -----------------------------------------------MTISDLVGILYRR
A0A367UAB4      -----------------------------------------------MTISDLVGILYRR
A0A1F2ZW35      ---MPRQGSAGPEDASSELWGWLRLVNRHKTLIIGCGLVAVVLMALVIAQQTPMYKASSR
A0A377V641      ------------------------------------------------------------
A0A1F2YJ88      ------------------------------------------------------------
A0A5N8AL61      -------------------MYPHKAVKIQEQRVNAEPKPSSPQAPGNAYTDYGQAYTERD
A0A0J7XGZ1      ------------------------------------------------------------
I4CBA7          ------------------------------------------------------------
A3VE95          ----------------------------------------MTTFDMQAVRSGRSSERSED
A0A1G0NL95      ------------------------------------------------------------
A0A024KA69      ------------------------------------------------------------
A0A0L1KFN4      ------------------------------------------------------------
A0A3D5UYX7      ------------------------------------------------------------
A0A524QFS4      -MRADEEKSKIQGRDPATGSGSDGKESRRQQGNVPRVGPGVDAPRGYPAYHVPGYPSYAT
A0A832MZU0      ------------------------------------------------------------
A0A520JSW4      -------------------------------------MPDVFVQSSGDGDHRRNGSAAGG
A0A4Q3LTF3      ------------------------------------------------------------
A0A840SQK7      --------------------MTHFDKLSRSMIRPAPTPVQLREEELDLFSVFRLIRRRIW
A0A7C3N3Y1      ------------------------------------------------------------
A0A537UTP9      ------------------------------------------------------------
A0A1D2RNR5      ------------------------------------------------------------
A0A4V1TQ46      ------------------------------------------------------------
A0A3A0FZC0      ------------------------------------------------------------
A0A1N7JVZ7      ------------------------------------------------------------
A0A091C4A8      ------------------------------------------------------------
A0A844YBH7      --------------------------------------MAGTEHQDFDPNDPGDAAAEAP
A0A4R3H6P6      --------------------MERISPQMLGLATSEMTLFSGRAAPEATGHAGAPPLRRLL
A0A3S1NQ09      ------------------------------------------------------------
A0A443GJ52      ------------------------------------------------------------
A0A2W6S588      ---------------------------------------------------MNQEQDGSA
A0A483E0N4      ------------------------------------------------------------
A0A2J4YQQ6      ------------------------------------------------------------
A0A483THX4      ------------------------------------------------------------
A0A534MVS2      ------------------------------------------------------------
A0A444I5K6      ------------------------------------------------------------
A0A154VE85      -----------MSALAPLQPNPAARAGMAPSPADAPMPLRRGLSRNKPLFAISFLALAGL
A0A3C1S9Y1      ------------------------------------------------------------
A0A353EH49      --------------------------------------------------MMARKFERSQ
A0A1Y1Q9C1      ------------------------------------------------------------
A0A3M7LJH0      ------------------------------------------------------------
A0A1E4JHX8      ------------------------------------------------------------
M2U8P2          ------------------------------------------------MTADFAEKNATG
A0A1H7KZF8      ---------------------------------------MNAPFGRIEAAVAPPPAPLFA
A0A6N3UC48      ------------------------------------------------------------
A0A257NG76      ------------------------------------------------------------
A0A1T4TW59      ------------------------------------------------------------
A0A1Q3MB35      ------------------------------------------------------------
A0A259LUN7      ------------------------------------------------------------
A0A2D7AVL1      ------------------------------------------------------------
A0A3B9KZE9      ------------------------------------------------------------
A0A358L616      ------------------------------------------------------------
A0A4U9HNE9      ------------------------------------------------------------
A0A7X7Z1H8      ------------------------------------------------------------
A0A7C5N053      ------------------------------------------------------------
A0A2G2CXY6      ------------------------------------------------------------
A0A3M1D4H3      ------------------------------------------------------------
A0A7C1A2A2      LGDVSKKSGLGGESEQGIGVSMLFGGLLGGSGIETQIEILKSRDLVVSTIEVSGLNARVW
A0A840RX77      ------------------------------------------------------------
A0A5C8BYM7      ------------------------------------------------------------
A0A7V2RUR3      ------------------------------------------------------------
A0A1J5ICP0      ------------------------------------------------------------
A0A379B9V4      ------------------------------------------------------------
A0A0Q6TS97      ------------------------------------------------------------
A0A0Q6UYB4      ------------------------------------------------------------
W7Q5J0          ---------------NTSAEIQILQSRMVLGHAVDRLGQENIIRPVTMPIIGDYVVRQGI
A0A654AKT6      ------------------------------------------------------------
A0A847E0Q2      ------------------------------------------------------------
A0A7W9WQN4      ------------------------------------------------------------
A0A0G9MZA5      ------------------------------------------------------------
H0T8B0          ------------------------------------------------------------
A0A7Y4X614      ------------------------------------------------------------
A0A5C7N981      ------------------------------------------------------------
A0A534TV22      ------------------------------------------------------------
A0A351CXR4      ------------------------------------------------------------
A0A2N6GLF5      ------------------------------------------------------------
A0A1W9LJP0      ------------------------------------------------------------
A0A0W1ICB0      ------------------------------------------------------------
A0A7C1C8G2      ------------------------------------------------------------
A0A832F8F3      ------------------------------------------------------------
A0A2E0UL88      ------------------------------------------------------------
A0A2N1WQN5      ------------------------------------------------------------
A0A0T2QIS1      ------------------------------------------------------------
A0A376KYN0      ------------------------------------------------------------
A0A377E5P7      ------------------------------------------------------------
A0A2X1JB05      ------------------------------------------------------------
A0A376RML0      ------------------------------------------------------------
A0A6N3QTV2      ------------------------------------------------------------
A0A0P7Y1D0      ------------------------------------------------------------
A0A7Y2FUF7      ------------------------------------------------------------
A0A7W6DRI0      ------------------------------------------------------------
A0A542J310      ------------------------------------------------------------
A0A2M7JRZ7      ------------------------------------------------------------
A0A167IR75      ------------------------------------------------------------
A0A3B8T2U6      ------------------------------------------------------------
A0A365PWR2      ------------------------------------------------------------
A0A2E9H5Z8      ------------------------------------------------------------
A0A2E2BR79      ------------------------------------------------------------
A0A6I4IKZ3      ------------------------------------------------------------
A0A7H4JZ79      ------------------------------------------------------------
A0A0Q4Q524      ------------------------------------------------------------
A0A0Q4CFJ9      ------------------------------------------------------------
A0A0Q4FE58      ------------------------------------------------------------
A0A0Q4JWC8      ------------------------------------------------------------
A0A0Q4KFL8      ------------------------------------------------------------
A0A7W8RVL5      ------------------------------------------------------------
A0A831Y0Z8      ------------------------------------------------------------
A0A522R8R0      ------------------------------------------------------------
A0A2U9NDY5      ------------------------------------------------------------
A0A0Q4IGG1      ------------------------------------------------------------
A0A352G2C2      ------------------------------------------------------------
A0A7Y3BMU7      ------------------------------------------------------------
A0A534RUJ5      ------------------------------------------------------------
V4Q8B7          ------------------------------------------------------------
A0A3M1CJM3      ------------------------------------------------------------
A0A2R7SVD4      ------------------------------------------------------------
A0A0Q8XKK5      ------------------------------------------------------------
A0A2E0Q2W0      ------------------------------------------------------------
A0A660NIR6      ------------------------------------------------------------
A0A142W0R3      ------------------------------------------------------------
A0A0S4XR18      ------------------------------------------------------------
A0A7C5CFF1      ------------------------------------------------------------
A0A7X6WZW5      ------------------------------------------------------------
A0A7X2SVT1      ------------------------------------------------------------
A0A2E0GW64      ------------------------------------------------------------
A0A1A7QJ97      ------------------------------------------------------------
A0A832UVD3      ------------------------------------------------------------
A0A7W5IBY1      ------------------------------------------------------------
A0A661LW70      ------------------------------------------------------------
W7Q8F9          ------------------------------------------------------------
A0A524PXH8      ------------------------------------------------------------
A0A4Q3P0E4      ------------------------------------------------------------
A0A3M2BE89      ------------------------------------------------------------
A0A4Q4A6K6      ------------------------------------------------------------
A0A257G674      ------------------------------------------------------------
A0A661M5M6      ------------------------------------------------------------
A0A1I1UM01      ------------------------------------------------------------
Q44573          ------------------------------------------------------------
A2W025          ------------------------------------------------------------
A0A534Z362      PIIDAEFSGAPRHLREYLWVLHKYRWLAATCFGLTFGLTVFATLLTPRLYSASTRLELAR
V4J283          ------------------------------------------------------------
A0A536T443      ------------------------------------------------------------
A0A0Q4UFQ5      ------------------------------------------------------------
A0A527W7E6      ------------------------------------------------------------
A0A432EMV7      ------------------------------------------------------------
A0A7Y3M8P5      ------------------------------------------------------------
A0A7C1SEU7      ------------------------------------------------------------
A0A7Y1SPC5      ------------------------------------------------------------
A0A7V6YC94      ------------------------------------------------------------
A0A534WLI3      ------------------------------------------------------------
A0A7V6CBY2      ------------------------------------------------------------
A0A7C6FBW0      ------------------------------------------------------------
A0A087LTV7      ------------------------------------------------------------
A0A7D7WSS2      ------------------------------------------------------------
A0A318KWA2      ------------------------------------------------------------
A0A522MT86      ------------------------------------------------------------
A0A4Q3I221      ------------------------------------------------------------
A0A534SAL6      VIDAEFSEVPARHLRDYLRLLYKYRWLAATCLA--------VTLLTTRLYTASTRLQMAR
A0A534ZDB4      VIDAEFSEVPARHLRDYLRLLYKYRWLAATCLALTLGLALLVTLVTTRLYTG--------
A0A534X3M7      IFDAEFSEQP-RHLRAHLSVLHKHRWLAVTCFAVTVVSTAVLTLLTPRLYTASTRLEVAR
A0A534SPC6      ------------------------------------------------------------
A0A535AD60      IIDAEFSEAP-RHLREHLWVLHKYRWLAATCFGLTFGLTVFATLLTPRLYTASTRLELAR
A0A4Q3SY08      ------------------------------------------------------------
A0A7U1E9W6      ------------------------------------------------------------
A0A4Q3LG23      ------------------------------------------------------------
A0A522EX52      ------------------------------------------------------------
A0A1H3KC95      ------------------------------------------------------------
A0A5P8Z4P3      ------------------------------------------------------------
A0A2E9HXF7      ------------------------------------------------------------
A0A0B3RZC9      ------------------------------------------------------------
A0A6F8QET1      ------------------------------------------------------------
A0A520HUH4      ------------------------------------------------------------
A0A2K8U7M6      ------------------------------------------------------------
A0A5B9DKL8      ------------------------------------------------------------
A0A238KJM1      ------------------------------------------------------------
A0A3A0FJZ4      ------------------------------------------------------------
W4HJV8          ------------------------------------------------------------
A0A0P1GDI0      ------------------------------------------------------------
A0A2R8ATV5      ------------------------------------------------------------
A0A1U7D3R6      ------------------------------------------------------------
A0A2D4UVV2      ------------------------------------------------------------
A0A0W7WHP4      ------------------------------------------------------------
A0A238J8F6      ------------------------------------------------------------
A0A238JQI6      ------------------------------------------------------------
A0A222E077      ------------------------------------------------------------
A0A239E3Y2      ------------------------------------------------------------
A0A1F9CFF0      ------------------------------------------------------------
A0A2M8B0G5      ------------------------------------------------------------
A0A363TNU9      ------------------------------------------------------------
A0A445MZQ4      ------------------------------------------------------------
A0A0M9E0E3      ------------------------------------------------------------
A0A351Z9A2      ------------------------------------------------------------
A0A6G6X2Z4      ------------------------------------------------------------
A0A0C5VQ86      ------------------------------------------------------------
A0A3S1WTQ1      ------------------------------------------------------------
A0A354EF47      ------------------------------------------------------------
A0A536T0W8      ------------------------------------------------------------
A0A2G6MSP7      ------------------------------------------------------------
A0A3N5FRH4      ------------------------------------------------------------
A0A1V4Y2C3      ------------------------------------------------------------
A0A2N2KTJ4      ------------------------------------------------------------
A0A2N2LQX0      ------------------------------------------------------------
A0A4U8YMP3      ------------------------------------------------------------
A0A1Q8QQ99      ------------------------------------------------------------
A0A7C2SIB2      ------------------------------------------------------------
A0A3D5ZY44      ------------------------------------------------------------
A0A1G5C236      ------------------------------------------------------------
A0A432HIS7      ------------------------------------------------------------
A0A401FQP5      ------------------------------------------------------------
A0A7C3Q9R6      ------------------------------------------------------------
A0A7C2AA26      ------------------------------------------------------------
A0A351Z4H9      ------------------------------------------------------------
A0A2N2KML4      ------------------------------------------------------------
E1YJF1          ------------------------------------------------------------
A0A1Q6DMW3      ------------------------------------------------------------
A0A3A6P8F8      ------------------------------------------------------------
A0A1J5EVZ6      ------------------------------------------------------------
A0A2G2DSM4      ------------------------------------------------------------
A0A1F9NI02      ------------------------------------------------------------
A0A4U1ABX4      ------------------------------------------------------------
A0A6L4AM84      ------------------------------------------------------------
A0A840UW68      ------------------------------------------------------------
A0A2G6FCC5      ------------------------------------------------------------
A0A1F9MR25      ------------------------------------------------------------
A0A2G6M7F1      ------------------------------------------------------------
A0A5Q2QDL1      ------------------------------------------------------------
A0A4Z0M4C7      ------------------------------------------------------------
A0A1V8MBH1      ------------------------------------------------------------
A0A7V9E085      ------------------------------------------------------------
A0A6J4X8D4      ------------------------------------------------------------
A0A1E7HSL6      ------------------------------------------------------------
A0A2M7JX59      ------------------------------------------------------------
A0A7V4PLT3      ------------------------------------------------------------
A0A7X7Y8R3      ------------------------------------------------------------
A0A832A361      ------------------------------------------------------------
A0A1M5GH86      ------------------------------------------------------------
A0A1W1XQZ5      ------------------------------------------------------------
A0A3D6C3I2      ------------------------------------------------------------
S0G1D4          ------------------------------------------------------------
A0A661T246      ------------------------------------------------------------
A0A850T4Q7      ------------------------------------------------------------
A0A2G6CSG7      ------------------------------------------------------------
A0A2G6NB59      ------------------------------------------------------------
A0A5K8A7T9      ------------------------------------------------------------
A0A1W9U045      ------------------------------------------------------------
A0A1F9L9G4      ------------------------------------------------------------
A0A328FD76      ------------------------------------------------------------
A0A348UX90      ------------------------------------------------------------
A0A357Z0N5      ------------------------------------------------------------
A0A0F2R2U0      ------------------------------------------------------------
A0A5K7ZK00      ------------------------------------------------------------
A0A5K7YCX8      ------------------------------------------------------------
A0A5K7Z388      ------------------------------------------------------------
A0A520CSP5      ------------------------------------------------------------
A0A1E7HFN0      ------------------------------------------------------------
A0A7J0BHG1      ------------------------------------------------------------
A0A6V8LMJ3      ------------------------------------------------------------
A0A2K8WHP8      ------------------------------------------------------------
A0A1J5N774      ------------------------------------------------------------
A0A2C8F781      ------------------------------------------------------------
A0A2E3R6G0      ------------------------------------------------------------
A0A7J0BUD3      ------------------------------------------------------------
A0A3M8EMP2      ------------------------------------------------------------
A0A2J6J6K6      ------------------------------------------------------------
A0A1F8XMK2      ------------------------------------------------------------
A0A661PSB9      ------------------------------------------------------------
A0A661QBT6      ------------------------------------------------------------
A0A6I2SLK2      ------------------------------------------------------------
A0A7Y7NC38      ------------------------------------------------------------
A0A0A8WSG4      ------------------------------------------------------------
S7TK97          ------------------------------------------------------------
S7UE93          ------------------------------------------------------------
A0A3D5BR56      ------------------------------------------------------------
A0A1I3PSR2      ------------------------------------------------------------
A0A2N2IB15      ------------------------------------------------------------
A0A7C8B5M6      ------------------------------------------------------------
A0A7V4UW39      ------------------------------------------------------------
A0A1W7QPT7      ------------------------------------------------------------
A0A6S6M1Y8      ------------------------------------------------------------
A0A6V8MCR2      ------------------------------------------------------------
A0A6V8N3X1      ------------------------------------------------------------
A0A6M4XJ81      ------------------------------------------------------------
A0A0M4D373      ------------------------------------------------------------
A0A1L3GKM9      ------------------------------------------------------------
A0A2T5R3J5      ------------------------------------------------------------
A0A1G6EKK9      ------------------------------------------------------------
A0A7C1DJX8      ------------------------------------------------------------
A0A3A4XVN3      ------------------------------------------------------------
A0A1E7JEV6      ------------------------------------------------------------
A0A2N2KDY5      ------------------------------------------------------------
A0A3N5YUD9      ------------------------------------------------------------
A0A4Q3ZDI7      ------------------------------------------------------------
A0A537PRC6      ------------------------------------------------------------
A0A7Y8L8B9      ------------------------------------------------------------
A0A5C4N0H6      ------------------------------------------------------------
A0A7V4UXV1      ------------------------------------------------------------
A0A7C3Y7G3      ------------------------------------------------------------
A0A7V5R3L0      ------------------------------------------------------------
A0A7V2SYN1      ------------------------------------------------------------
A0A6H9HII8      ------------------------------------------------------------
A0A7S6SHD5      ------------------------------------------------------------
A0A7C1UTU6      ------------------------------------------------------------
W9VVY5          ------------------------------------------------------------
A0A1E2URD3      ------------------------------------------------------------
A0A2T6MY81      ------------------------------------------------------------
A0A7Z0VN76      ------------------------------------------------------------
A0A2T6NBQ8      ------------------------------------------------------------
A0A421K431      ------------------------------------------------------------
A0A7C3Z8T7      ------------------------------------------------------------
A0A1V4QMH7      ------------------------------------------------------------
A0A496XZQ4      ------------------------------------------------------------
A0A7C3UZM2      ------------------------------------------------------------
A0A1F9BJF7      ------------------------------------------------------------
F2NDF5          ------------------------------------------------------------
A0A7Y4XWU8      ------------------------------------------------------------
A0A4V2SPR5      ------------------------------------------------------------
A0A7W8W7P8      ------------------------------------------------------------
A0A7W8WPN5      ------------------------------------------------------------
A0A519ERR1      ------------------------------------------------------------
A0A4Q3Q1M2      ------------------------------------------------------------
A0A4Q3MHR1      ------------------------------------------------------------
A0A520GDZ4      ------------------------------------------------------------
A0A372IH36      ------------------------------------------------------------
A0A540VW45      ------------------------------------------------------------
A0A1H9C241      ------------------------------------------------------------
A0A2E3FCR1      ------------------------------------------------------------
A0A4S3MG69      ------------------------------------------------------------
A0A3E0H727      ------------------------------------------------------------
A0A7X8XJJ0      ------------------------------------------------------------
A0A1I3TTC3      ------------------------------------------------------------
A0A1H3IZW6      ------------------------------------------------------------
A0A0M6YG59      ------------------------------------------------------------
A0A1H7G8B0      ------------------------------------------------------------
A0A2G2I5M1      ------------------------------------------------------------
A0A2G2M6F0      ------------------------------------------------------------
A0A352B502      ------------------------------------------------------------
A0A430DNP0      ------------------------------------------------------------
A0A410V446      ------------------------------------------------------------
A0A1B1UCM8      ------------------------------------------------------------
A0A1N6JQ20      ------------------------------------------------------------
A0A0R3KGJ5      ------------------------------------------------------------
A0A0R3N604      ------------------------------------------------------------
A0A1M5TI07      ------------------------------------------------------------
A3X191          ------------------------------------------------------------
A0A160UA87      ------------------------------------------------------------
A0A1Q5SFV5      ------------------------------------------------------------
A0A1H4RKV5      ------------------------------------------------------------
A0A7Z2Q199      ------------------------------------------------------------
A0A3A0FQ32      ------------------------------------------------------------
A0A7Y3GV54      ------------------------------------------------------------
A0A3E0WXH2      ------------------------------------------------------------
A0A1A9KEF8      ------------------------------------------------------------
A0A5E6PKN5      ------------------------------------------------------------
A0A0N9W1V6      ------------------------------------------------------------
A0A423GQ41      ------------------------------------------------------------
A0A423H7J2      ------------------------------------------------------------
A0A502HNM8      ------------------------------------------------------------
A0A4Q7H223      ------------------------------------------------------------
A0A1H4N2K9      ------------------------------------------------------------
A0A2K4KWF7      ------------------------------------------------------------
A0A1E4UZA0      ------------------------------------------------------------
A0A1H9KL56      ------------------------------------------------------------
A0A7X0BTK5      ------------------------------------------------------------
A0A2N2TRC8      ------------------------------------------------------------
A0A1V4CIZ7      ------------------------------------------------------------
A0A1M3BXA5      ------------------------------------------------------------
A0A1Y2R3U6      ------------------------------------------------------------
A0A167HVD6      ------------------------------------------------------------
A0A1V3SCT6      ------------------------------------------------------------
L0H287          ------------------------------------------------------------
A0A495VG93      ------------------------------------------------------------
A0A4R3MYM4      ------------------------------------------------------------
G2E3C0          ------------------------------------------------------------
A0A1W9J9F8      ------------------------------------------------------------
A0A2S5LFJ9      ------------------------------------------------------------
A0A2D8R8F8      ------------------------------------------------------------
A0A1G0KSD0      ------------------------------------------------------------
A0A4P6WX84      ------------------------------------------------------------
A0A1D2S760      ------------------------------------------------------------
A0A5B8RW94      ------------------------------------------------------------
A0A6I4JXQ8      ------------------------------------------------------------
A0A010SNS0      ------------------------------------------------------------
A0A0C2I782      ------------------------------------------------------------
A0A2N8BYF5      ------------------------------------------------------------
A0A558FKX2      ------------------------------------------------------------
A0A1H1DBA0      ------------------------------------------------------------
J3H699          ------------------------------------------------------------
A0A0K1QRZ4      ------------------------------------------------------------
A0A560RJW9      ------------------------------------------------------------
A0A5E7CRU7      ------------------------------------------------------------
A0A1H5J974      ------------------------------------------------------------
A0A5E7C564      ------------------------------------------------------------
A0A2W7MAV4      ------------------------------------------------------------
W6VFG3          ------------------------------------------------------------
A0A1P8ENT1      ------------------------------------------------------------
A0A2N7XRV4      ------------------------------------------------------------
A0A0Q6QPG8      ------------------------------------------------------------
A0A0F4SWA7      ------------------------------------------------------------
A0A423J219      ------------------------------------------------------------
A0A4P6G9U8      ------------------------------------------------------------
A0A4Y8JE06      ------------------------------------------------------------
A0A502I1X9      ------------------------------------------------------------
A0A502J776      ------------------------------------------------------------
A0A5B0EZF6      ------------------------------------------------------------
A0A059L434      ------------------------------------------------------------
A0A0F4UWN2      ------------------------------------------------------------
A0A5E7WEF5      ------------------------------------------------------------
A0A258TN88      ------------------------------------------------------------
A0A7Y8MN30      ------------------------------------------------------------
A0A3N5J7U8      ------------------------------------------------------------
A0A1S7S3I8      ------------------------------------------------------------
A0A655ZZQ1      ------------------------------------------------------------
A0A1S0ZAI3      ------------------------------------------------------------
A0A3C0L0A8      ------------------------------------------------------------
A0A176S762      ------------------------------------------------------------
A0A1W9WUD9      ------------------------------------------------------------
A0A1W1ZQK0      ------------------------------------------------------------
A0A7X1GRP5      ------------------------------------------------------------
A0A6I1R304      ------------------------------------------------------------
A0A1W9PMU6      ------------------------------------------------------------
A0A7Y4X3V7      ------------------------------------------------------------
A0A1G3VVY5      ------------------------------------------------------------
A0A7C3S273      ------------------------------------------------------------
A0A7C4WJ18      ------------------------------------------------------------
A0A351B422      ------------------------------------------------------------
F2NEE9          ------------------------------------------------------------
A0A7C3V565      ------------------------------------------------------------
A0A7V6A3E1      ------------------------------------------------------------
A0A318D3U4      ------------------------------------------------------------
A0A7V0JSN8      ------------------------------------------------------------
A0A7V5V784      ------------------------------------------------------------
A0A352Q5C1      ------------------------------------------------------------
A0A355TB56      ------------------------------------------------------------
A0A1F9E324      ------------------------------------------------------------
A0A435NNF5      ------------------------------------------------------------
A0A3S2AQS7      ------------------------------------------------------------
A0A527ZPD6      ------------------------------------------------------------
A0A529KRW3      ------------------------------------------------------------
A0A530ZLX0      ------------------------------------------------------------
A0A4Q3LBH4      ------------------------------------------------------------
A0A4Q3LWP3      ------------------------------------------------------------
A0A7C3JPP4      ------------------------------------------------------------
A0A534V9L7      ------------------------------------------------------------
A0A7C3JJT4      ------------------------------------------------------------
A0A524M660      ------------------------------------------------------------
A0A7C3JSX5      ------------------------------------------------------------
A0A7I8MQ67      ------------------------------------------------------------
A0A0C1TRU6      ------------------------------------------------------------
A0A2Z5SSF4      ------------------------------------------------------------
A0A7Y7TF97      ------------------------------------------------------------
A0A4Q4CIB1      ------------------------------------------------------------
A0A522ACJ9      ------------------------------------------------------------
A0A3N5Z7F8      ------------------------------------------------------------
A0A239HD34      ------------------------------------------------------------
A0A3D2M6Y9      ------------------------------------------------------------
A0A519E8D7      ------------------------------------------------------------
A0A3S1FD32      ------------------------------------------------------------
A0A434DUT4      ------------------------------------------------------------
A0A528D3U3      ------------------------------------------------------------
A0A3S3UPT3      ------------------------------------------------------------
A0A3S1E286      ------------------------------------------------------------
A0A531AC71      ------------------------------------------------------------
A0A436K268      ------------------------------------------------------------
A0A434IDQ0      ------------------------------------------------------------
A0A435IRM5      ------------------------------------------------------------
A0A3S2C404      ------------------------------------------------------------
A0A435F6C0      ------------------------------------------------------------
A0A435BMN6      ------------------------------------------------------------
A0A529XQ54      ------------------------------------------------------------
A0A530BJC1      ------------------------------------------------------------
A0A0P7ZZE4      ------------------------------------------------------------
A0A369R0Q9      ------------------------------------------------------------
A0A327LYE6      ------------------------------------------------------------
A0A5A9ZTV3      ------------------------------------------------------------
A0A258WKV0      ------------------------------------------------------------
A5G4N9          ------------------------------------------------------------
A0A812HT29      ------------------------------------------------------------
A0A444IY46      ------------------------------------------------------------
A0A6I7N627      ------------------------------------------------------------
A0A1V5DJV0      ------------------------------------------------------------
A0A520IUC4      ------------------------------------------------------------
A0A7Y7M8F4      ------------------------------------------------------------
A0A0P1FWI8      ------------------------------------------------------------
A0A6L8LHC6      ------------------------------------------------------------
A0A848ST88      ------------------------------------------------------------
A0A7U1HWF1      ------------------------------------------------------------
A0A534SH66      ------------------------------------------------------------
A0A3M0ZZ99      ------------------------------------------------------------
A0A238LBD3      ------------------------------------------------------------
A0A537NZJ1      ------------------------------------------------------------
A0A7C4R3C4      ------------------------------------------------------------
A0A0P1FRV5      ------------------------------------------------------------
A0A4Q4CVW6      ------------------------------------------------------------
A0A8B6LS25      ------------------------------------------------------------
A0A6L3ZWI0      ------------------------------------------------------------
A0A1M7BLL7      ------------------------------------------------------------
A0A0H4KZM1      ------------------------------------------------------------
A0A7V2W904      ------------------------------------------------------------
A0A1V1UJT2      ------------------------------------------------------------
A0A0L6CVX1      ------------------------------------------------------------
A0A1V0RR48      ------------------------------------------------------------
A0A0A0HJJ4      ------------------------------------------------------------
A0A5E7YA28      ------------------------------------------------------------
A0A316KRG4      ------------------------------------------------------------
A0A0J5Q9T7      ------------------------------------------------------------
A0A1I5YYQ0      ------------------------------------------------------------
A0A5P9FE62      ------------------------------------------------------------
A0A7U3CQW5      ------------------------------------------------------------
X7F6S5          ------------------------------------------------------------
A0A1G8NKI0      ------------------------------------------------------------
A0A355QPE4      ------------------------------------------------------------
A0A357RN98      ------------------------------------------------------------
A0A1I6U4V1      ------------------------------------------------------------
A0A6B2P8H8      ------------------------------------------------------------
A0A1P8USW9      ------------------------------------------------------------
A0A1G7CFZ2      ------------------------------------------------------------
A0A7G2TPW1      ------------------------------------------------------------
A0A1V6FYJ1      ------------------------------------------------------------
A0A4Q3IRI1      ------------------------------------------------------------
A0A7J5VV32      ------------------------------------------------------------
A0A1E7H876      ------------------------------------------------------------
A0A7C1C6X5      ------------------------------------------------------------
A0A7X1GMT8      ------------------------------------------------------------
Q44570          ------------------------------------------------------------
A0A509L3P8      ------------------------------------------------------------
A0A3A4S038      ------------------------------------------------------------
A0A1F9N669      ------------------------------------------------------------
A0A1F9PFA7      ------------------------------------------------------------
A0A1H2EN09      ------------------------------------------------------------
K0NP00          ------------------------------------------------------------
A0A2N6BZD5      ------------------------------------------------------------
A0A0F2NF69      ------------------------------------------------------------
A0A1F9NFD0      ------------------------------------------------------------
A0A1W9M770      ------------------------------------------------------------
A0A1W9M7R6      ------------------------------------------------------------
A0A7W0IR34      ------------------------------------------------------------
A0A7V5FUI1      ------------------------------------------------------------
A0A7T6AQC8      ------------------------------------------------------------
A0A7U4DQ89      ------------------------------------------------------------
A0A1M5YLH5      ------------------------------------------------------------
A0A4U1A4C7      ------------------------------------------------------------
A0A7C4N0I9      ------------------------------------------------------------
A0A1V4M8I1      ------------------------------------------------------------
A0A7C0XE92      ------------------------------------------------------------
A0A7U4QIX5      ------------------------------------------------------------
A0A800BQ44      ------------------------------------------------------------
A0A1E7JCL5      ------------------------------------------------------------
A0A7Z9XET3      ------------------------------------------------------------
A0A800C5N3      ------------------------------------------------------------
A0A496YAH9      ------------------------------------------------------------
A0A1V4S7E4      ------------------------------------------------------------
A0A847DGI3      ------------------------------------------------------------
A0A2N2H8D2      ------------------------------------------------------------
A0A2N2KC63      ------------------------------------------------------------
A0A3A4ZYW4      ------------------------------------------------------------
A0A800BMM4      ------------------------------------------------------------
A0A1V4MCJ4      ------------------------------------------------------------
A0A661M0W4      ------------------------------------------------------------
A0A3N5RNY4      ------------------------------------------------------------
A0A1M7Y300      ------------------------------------------------------------
A0A4U1ALN4      ------------------------------------------------------------
A0A849F908      ------------------------------------------------------------
A0A2N6BEI9      ------------------------------------------------------------
A0A0D5N3E9      ------------------------------------------------------------
A0A2N2G716      ------------------------------------------------------------
A0A1F9EUS2      ------------------------------------------------------------
A0A3N9VAW3      ------------------------------------------------------------
A0A6I1KNW9      ------------------------------------------------------------
A0A1H4B8T3      ------------------------------------------------------------
A0A1E7IQC3      ------------------------------------------------------------
A0A1M6KEN5      ------------------------------------------------------------
A0A1X0YE57      ------------------------------------------------------------
A0A2K2H9Q8      ------------------------------------------------------------
A0A1F8X5S3      ------------------------------------------------------------
A0A353QLL3      ------------------------------------------------------------
A0A847C207      ------------------------------------------------------------
A0A399I453      ------------------------------------------------------------
A0A651FBV9      ------------------------------------------------------------
A0A562VHD2      ------------------------------------------------------------
A0A7K0J0R7      ------------------------------------------------------------
A0A6I6JNB5      ------------------------------------------------------------
A0A847UFK5      ------------------------------------------------------------
A0A1G0LDK7      ------------------------------------------------------------
A0A6F9WVL7      ------------------------------------------------------------
A0A7Y7TLN9      ------------------------------------------------------------
A0A5C1MDH8      ------------------------------------------------------------
A0A7J4ZSX4      ------------------------------------------------------------
A0A5A9XE04      ------------------------------------------------------------
A0A643G9R1      ------------------------------------------------------------
A0A1G0M8Q7      ------------------------------------------------------------
A0A353MI14      ------------------------------------------------------------
A0A4S1CAW7      ------------------------------------------------------------
A0A655R819      ------------------------------------------------------------
A0A655RNN3      ------------------------------------------------------------
A0A354EI73      ------------------------------------------------------------
A0A6D0ELN7      ------------------------------------------------------------
A0A0B8PTA8      ------------------------------------------------------------
A0A0B8QF75      ------------------------------------------------------------
A0A4U9I390      ------------------------------------------------------------
A0A2X3M011      ------------------------------------------------------------
A0A2H9EHM4      ------------------------------------------------------------
A0A380B3D7      ------------------------------------------------------------
F5NSX0          ------------------------------------------------------------
A0A7A9K1G5      ------------------------------------------------------------
A0A811C967      ------------------------------------------------------------
A0A479JNB1      ------------------------------------------------------------
A0A5C9AF52      ------------------------------------------------------------
A0A6D0EYC7      ------------------------------------------------------------
D8EEU7          ------------------------------------------------------------
A0A0R0BVC7      ------------------------------------------------------------
A0A4U8YLL7      ------------------------------------------------------------
A0A2M7WWF7      ------------------------------------------------------------
A0A534QGR3      ------------------------------------------------------------
A0A0Q6QV61      ------------------------------------------------------------
A0A2Z3IKG4      ------------------------------------------------------------
B7RS54          ------------------------------------------------------------
A0A7R7CAD2      ------------------------------------------------------------
A0A7R7CQL5      ------------------------------------------------------------
A0A1I3XJ27      ------------------------------------------------------------
A0A562CGU2      ------------------------------------------------------------
A0A7C9VCB3      ------------------------------------------------------------
A0A1I7DCG1      ------------------------------------------------------------
A0A3A3H6D9      ------------------------------------------------------------
A0A0Q6VA36      ------------------------------------------------------------
A0A1B2EQN1      ------------------------------------------------------------
A0A1G8QZS5      ------------------------------------------------------------
A0A1H2Y469      ------------------------------------------------------------
A0A497ZQU7      ------------------------------------------------------------
A0A443K010      ------------------------------------------------------------
A0A6I7NYG5      ------------------------------------------------------------
A0A1I0R9R6      ------------------------------------------------------------
A0A2N3BVE7      ------------------------------------------------------------
A0A7C2IB02      ------------------------------------------------------------
A0A6N6SI00      ------------------------------------------------------------
A0A2S5JE21      ------------------------------------------------------------
A0A2R8BKZ2      ------------------------------------------------------------
A0A2S8S361      ------------------------------------------------------------
A0A1X7ACC1      ------------------------------------------------------------
A0A238KUF6      ------------------------------------------------------------
A0A095CTW3      ------------------------------------------------------------
A0A2E3UGD6      ------------------------------------------------------------
A0A840CE00      ------------------------------------------------------------
A0A2T0RFH0      ------------------------------------------------------------
A0A285D390      ------------------------------------------------------------
A0A497VHN4      ------------------------------------------------------------
A0A6M1UAR9      ------------------------------------------------------------
A0A520ZTR8      ------------------------------------------------------------
A0A7Y2NU38      ------------------------------------------------------------
A0A849GJU0      ------------------------------------------------------------
A0A316GHM6      ------------------------------------------------------------
A0A848VYK1      ------------------------------------------------------------
A0A7C9INT8      ------------------------------------------------------------
A0A238IZI1      ------------------------------------------------------------
A0A7Y2U0H6      ------------------------------------------------------------
A0A848WN80      ------------------------------------------------------------
A0A1I6ENM4      ------------------------------------------------------------
A0A2E2P4I0      ------------------------------------------------------------
A0A2U2CM86      ------------------------------------------------------------
A0A212AR83      ------------------------------------------------------------
A0A2M8J3R9      ------------------------------------------------------------
A0A1I6X762      ------------------------------------------------------------
A0A843YIS7      ------------------------------------------------------------
A0A0P1EFX8      ------------------------------------------------------------
A0A2G5KB39      ------------------------------------------------------------
A8LNM8          ------------------------------------------------------------
A0A844B423      ------------------------------------------------------------
A0A0T5NSU3      ------------------------------------------------------------
A0A5P9I718      ------------------------------------------------------------
A0A2N3CNV1      ------------------------------------------------------------
A0A257F1F4      ------------------------------------------------------------
A0A2D5J8T8      ------------------------------------------------------------
A0A2E3P9W6      ------------------------------------------------------------
A0A2G2B1P9      ------------------------------------------------------------
A0A258GCD5      ------------------------------------------------------------
A0A443INY4      ------------------------------------------------------------
A0A2D9YR88      ------------------------------------------------------------
A0A4Q3ZBK4      ------------------------------------------------------------
A0A1G9FY29      ------------------------------------------------------------
A0A6N9RUN2      ------------------------------------------------------------
A0A1W9HS52      RVLKANKNFIIMCTLSALLLAFLHQSFLYVPIFVSESKLKVEPKSDSMSITPLLERFQQN
A0A2D5LFD8      R--RKKLIAISAIAITSAITGQLIFQRLFHPVYEGTFSLLIKDPINNSSSSNNSQSANTN
A0A4D8PLT4      R--RPQPAGGDRLRLAGRAVAAQAAAAHHHPAGTATITYVMQSLKPMYRATAMVQLDSRR
A0A1G3JY11      ------------------------------------------------------------
A0A3A4NIE9      ------------------------------------------------------------
A0A3A4NUI9      ------------------------------------------------------------
A0A524I3Z6      ------------------------------------------------------------
A0A524PCL7      ------------------------------------------------------------
A0A356GQV1      ------------------------------------------------------------
A0A1J5DAY8      ------------------------------------------------------------
A0A524P237      ------------------------------------------------------------
A0A4P7EP83      ------------------------------------------------------------
A0A348SRI7      ------------------------------------------------------------
A0A833GQE1      ------------------------------------------------------------
A0A661N3U1      ------------------------------------------------------------
A0A7X1T426      ------------------------------------------------------------
A0A432SAI6      ------------------------------------------------------------
A0A855HUH5      ------------------------------------------------------------
A0A6L6H5T1      ------------------------------------------------------------
A0A7V5C3K7      ------------------------------------------------------------
A0A7Y9AV38      ------------------------------------------------------------
A0A2W5J775      ------------------------------------------------------------
A0A3M3H5V6      ------------------------------------------------------------
A0A7V2YBQ6      ------------------------------------------------------------
A0A7X8Z4Y1      ------------------------------------------------------------
A0A377ZC40      ------------------------------------------------------------
A0A534XP85      ------------------------------------------------------------
A0A377LY04      ------------------------------------------------------------
A0A2X3K9R3      ------------------------------------------------------------
A0A484X141      ------------------------------------------------------------
A0A5N9VWI6      ------------------------------------------------------------
A0A5C9ABR5      ------------------------------------------------------------
A0A6D0EJQ0      ------------------------------------------------------------
A0A444R390      ------------------------------------------------------------
A0A376LLF8      ------------------------------------------------------------
A0A6L7CT21      ------------------------------------------------------------
A0A378BPJ7      ------------------------------------------------------------
A0A377ZDN3      ------------------------------------------------------------
A0A2J5PAJ7      ------------------------------------------------------------
A0A7Z9CQS8      ------------------------------------------------------------
A0A2W4RFS2      ------------------------------------------------------------
A0A1Y6DC43      ------------------------------------------------------------
A0A2S6HE06      ------------------------------------------------------------
G3J0M3          ------------------------------------------------------------
V5C6R5          ------------------------------------------------------------
A0A7V0Z1K0      ------------------------------------------------------------
A0A7Y8IFK0      ------------------------------------------------------------
A0A4Q2XLV7      ------------------------------------------------------------
A0A4Q5QYC4      ------------------------------------------------------------
A0A0U2VAW2      ------------------------------------------------------------
A0A454CTF1      ------------------------------------------------------------
A0A6B3Q2G1      ------------------------------------------------------------
A0A6N9S3L5      ------------------------------------------------------------
A0A656BWB0      ------------------------------------------------------------
A0A6D0IFH4      ------------------------------------------------------------
A0A0A0FHV8      ------------------------------------------------------------
A0A2I8SDU4      ------------------------------------------------------------
A0A2I8SU55      ------------------------------------------------------------
A0A7I6T806      ------------------------------------------------------------
A0A7I6TQE9      ------------------------------------------------------------
A0A7I6U296      ------------------------------------------------------------
S1EXJ6          ------------------------------------------------------------
A0A376UBS1      ------------------------------------------------------------
A0A4Q6G931      ------------------------------------------------------------
A0A2T0VBD8      ------------------------------------------------------------
A0A7W5DMU7      ------------------------------------------------------------
A0A378APS2      ------------------------------------------------------------
A0A443VCQ6      ------------------------------------------------------------
A0A447RKQ7      ------------------------------------------------------------
W1DSK1          ------------------------------------------------------------
A0A2N1XK22      ------------------------------------------------------------
A0A850R066      ------------------------------------------------------------
A0A1W9F5M9      ------------------------------------------------------------
A0A352MMI7      ------------------------------------------------------------
A0A4Z0LWV1      ------------------------------------------------------------
A0A376RY66      ------------------------------------------------------------
A0A377K431      ------------------------------------------------------------
A0A6D0I9G1      ------------------------------------------------------------
A0A379W6R2      ------------------------------------------------------------
A0A379TA56      ------------------------------------------------------------
A0A655C5P0      ------------------------------------------------------------
A0A3C2BN18      ------------------------------------------------------------
A0A447LR75      ------------------------------------------------------------
A0A759KJJ5      ------------------------------------------------------------
A0A376D8L7      ------------------------------------------------------------
A0A1V2FV46      ------------------------------------------------------------
A0A6N8QLT3      ------------------------------------------------------------
A0A376SB61      ------------------------------------------------------------
A0A3D1BYV9      ------------------------------------------------------------
A0A3P5DSS6      ------------------------------------------------------------
A0A483YEL5      ------------------------------------------------------------
A0A844PX38      ------------------------------------------------------------
A0A8B4SQI1      ------------------------------------------------------------
A0A483QWI8      ------------------------------------------------------------
A0A483UXD3      ------------------------------------------------------------
A0A0A8J8L3      ------------------------------------------------------------
A0A660DJ38      ------------------------------------------------------------
A0A378G3G7      ------------------------------------------------------------
A0A2X5NHJ9      ------------------------------------------------------------
A0A2J4QEC3      ------------------------------------------------------------
A0A485ADM3      ------------------------------------------------------------
A0A3D0KAC8      ------------------------------------------------------------
A0A4U9HGU4      ------------------------------------------------------------
A0A3S4JGG5      ------------------------------------------------------------
A0A377ZDH2      ------------------------------------------------------------
A0A3S4HTS8      ------------------------------------------------------------
A0A3N5MZ53      ------------------------------------------------------------
A0A534E4H4      ------------------------------------------------------------
A0A534I2B6      ------------------------------------------------------------
A0A1C2JGD0      ------------------------------------------------------------
A0A259LQ70      ------------------------------------------------------------
A0A3N5PM86      ------------------------------------------------------------
A0A2E5YSA4      ------------------------------------------------------------
A0A0N0XAV4      ------------------------------------------------------------
A0A0P9QD19      ------------------------------------------------------------
F3FHG4          ------------------------------------------------------------
F3GGI0          ------------------------------------------------------------
A0A0P9LE74      ------------------------------------------------------------
A0A3M4ZQ14      -------ELIKSRALLGKVVDDLKLNVLQTPDFFPVIGPYLHRTFTPGSQRTLAEPLFGL
A0A3M5YLE8      -------ELIKSRALLGKVVDDLKLNVLQTPDFFPVIGPYLHRTFTPGSQRTLAEPLFGL
A0A3M3RP89      -------ELIKSRALLGKVVDDLKLNVLQTPDFFPVIGPYLHRTFTPGSQRTLAEPLFGL
A0A0P9QIY7      -------ELIKSRALLGKVVDDLKLNVLQTPDFFPVIGPYLHRTFTPGSQRTLAEPLFGL
A0A0P9VVH7      -------ELIKSRALLGKVVDDLKLNVLQTPDFFPVIGPYLHRTFTPGSQRTLAEPLFGL
A0A0Q0FJK6      -------ELIKSRALLGKVVDDLKLNVLQTPDFFPVIGPYLHRTFTPGSQRTLAEPLFGL
A0A3M3LF66      -------ELIKSRALLGKVVDDLKLNVLQTPDFFPVIGPYLHRTFTPGSQRTLAEPLFGL
A0A0P9WIR8      -------ELIKSRALLGKVVDDLKLNVLQTPDFFPVIGPYLHRTFTPGSQRTLAEPLFGL
A0A3M3KPE5      --------MIKSRALLGKVVDDLKLNVLQTPDFFPVIGPYLHRTFTPGSQRTLAEPLFGL
A0A3M4C263      --------MIKSRALLGKVVDDLKLNVLQTPDFFPVIGPYLHRTFTPGSQRTLAEPLFGL
A0A3M5AD05      --------MIKSRALLGKVVDDLKLNVLQTPDFFPVIGPYLHRTFTPGSQRTLAEPLFGL
A0A0Q0D3D2      ----------------------------------------------------LPKPLFGL
A0A0N0FS39      ------------------------------------------------------------
A0A3M6GHH2      ------------------------------------------------------------
A0A0P9R9W0      -------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPLRDGELAEPLFGL
A0A0Q0B9T0      -------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPLRDGELAEPLFGL
A0A3M6CFI7      -------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPLRDGELAEPLFGL
A0A0P9JXN0      -------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAEPLFGL
A0A3M6FIV7      -------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAEPLFGL
A0A3M3PLW9      -------ELIKSRALLGKVVDDLKLNRLQTPDLFPVIGPYLYRTFKPARDGELAQPLFGL
A0A3M4ENY1      --------MIKSRALLGKVVDDLQLNRLQTPDLFPVIGPYLYRTFKPARDGELAQPLFGL
A0A3M5EZK7      --------MIKSRALLGKVVDDLKLNRLQTPDLFPVIGPYLYRTFKPARDGELAQPLFGL
A0A0P9SPP5      -------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAQPLFGL
A0A658KL17      -------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAQPLFGL
A0A3M3NNF2      -------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLFGL
A0A7Z6UK49      -------ELIKSRALLGKVVDDLKLSTLQTPDFFPVIGPYLYRTFKPVRDGELAQPLFGL
A0A3M4A0E8      -------ELIKSRALLGKVVDDLKLSTLQTPDFFPVIGPYLYRTFKPVRDGELAQPLFGL
A0A3M4PBZ2      -------ELIKSRALLGKVVDDLKLSTLQTPDFFPVIGPYLYRTFKPVRDGELAQPLFGL
A0A7Z6U7Q8      -------ELIKSRALLGKVVDDLKLSTLQTPDFFPVIGPYLYRTFKPVRDGELAQPLFGL
A0A3M6AI26      -------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLFGL
A0A0P9IWP8      -------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLFGL
A0A0P9KZ49      -------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLFGL
A0A0P9V840      -------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLFGL
A0A0Q0AIE5      -------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLFGL
A0A3M2ZQH6      -------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLFGL
A0A0N8SQG2      -------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLFGL
A0A0W8HFU1      -------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLFGL
A0A0P9VHH8      -------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLFGL
A0A0P9YV98      -------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLFGL
A0A3M3G2W8      -------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLFGL
A0A3M6C224      -------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLFGL
A0A0P9SCD7      -------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLFGL
A0A0P9T4G3      -------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLFGL
A0A0P9VKB0      -------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVREGELAKPLFGL
A0A0Q0BM35      -------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVREGELAKPLFGL
A0A3M3TPR7      -------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLFGL
A0A3M3U4Q3      -------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLFGL
A0A8B3FSE5      -------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLFGL
A0A3M5K254      -------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLFGL
A0A7V8M007      -------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLFGL
A0A3M5JFB0      -------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLFGL
A0A3M3TQV3      -------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLFGL
A0A3M4A376      -------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLFGL
A0A3M3EF92      -------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLFGL
A0A3M5J1E2      -------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLFGL
A0A3M5M873      -------ELIKSRALLGKVVDDLKLNTLQTPDLFPVIGPYLYRTFKPVRDGELAKPLFGL
A0A3M5G7H9      -------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLFGL
A0A0Q0A5T8      -------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLFGL
A0A0P9QCJ2      -------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLFGL
A0A0P9UCX7      -------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAQPLFGL
A0A0P9Q329      -------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAQPLFGL
A0A3M5GJ64      -------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAQPLFGL
A0A0P9S1F1      -------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAQPLFGL
A0A3M2XYQ3      -------ELIKSRALLGKVVDDLRLNRLQTPDLFPVIGPYLYRTFKPARDGELAQPLFGL
A0A0P9XCE1      -------ELIKSRALLGKVVDDLKLNRLQTPDLFPVIGPYLYRTFKPARDGELAQPLFGL
A0A3M3EFX7      -------ELIKSRALLGKVVDDLKLNRLQTPDLFPVIGPYLYRTFKPARDGELAQPLFGL
A0A3M5B9D9      -------ELIKSRALLGKVVDDLKLNRLQTPDLFPVIGPYLYRTFKPARDGELAQPLFGL
A0A0P9RRZ3      -------ELIKSRALLGKVVDDLKLSTLQTPDFFPVIGPYLYRTFKPARDGELAQPLFGL
A0A3M2VEK7      -------ELIKSRALLGKVVDDLQLNRLQTPDLFPVIGPYLYRTFKPARDGELAQPLFGL
A0A0N8R9B3      -------ELIKSRALLGKVVDDLQLNRLQTPDLFPVIGPYLYRTFKPARDGELAQPLFGL
A0A0P9VA27      -------ELIKSRALLGKVVDDLQLNRLQTPDLFPVIGPYLYRTFKPARDGELAQPLFGL
A0A3M4YBJ4      -------ELIKSRALLGKVVDDLQLNRLQTPDLFPVIGPYLYRTFKPARDGELAQPLFGL
A0A0P9J470      -------ELIKSRALLGKVVDDLQLNRLQTPDLFPVIGPYLYRTFKPARDGELAQPLFGL
A0A0Q0EVJ8      -------ELIKSRALLGKVVDDLQLNRLQTPDLFPVIGPYLYRTFKPAREGELAQPLFGL
A0A3M5UI30      -------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLFGL
A0A3M5YQT8      -------ELIKSRALLGKVVDDLKLNTLQTPDFFSVIGPYLYRTFKPVREGELSKPLFGL
A0A3M5F5X1      XXXXXXXELIKSRALLGKVVDDLKLNTLQTPDLFPVIGPYLYRTFKPVRDGELAKPLFGL
A0A3M5R8G1      -------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLFGL
A0A3M5V012      -------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLFGL
A0A3M3GA16      -------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLFGL
A0A3M3CJL0      -------ELIKSRALLGKVVDDLQLNRLQTPDLFPVIGPYLYRTFKPARDGELAQPLFGL
A0A3M3F6F5      -------ELIKSRALLGKVVDDLQLNRLQTPDLFPVIGPYLYRTFKPARDGELAQPLFGL
A0A3M3P9B7      -------ELIKSRALLGKVVDDLQLNRLQTPDLFPVIGPYLYRTFKPARDGELAQPLFGL
A0A0N8QB74      -------ELIKSRALLGKVVDDLQLNRLQTPDLFPVIGPYLYRTFKPARDGELAQPLFGL
A0A0Q0AUD0      -------ELIKSRALLGKVVDDLQLNRLQTPDLFPVIGAYLYRTFKPARDGELAQPLFGL
A0A3M5VR55      -------ELIKSRALLGKVVDDLQLNRLQTPDLFPVIGPYLYRTFKPARDGELAQPLFGL
A0A0Q0FK97      -------ELIKSRALLGKVVDDLQLNRLQTPDLFPVIGPYLYRTFKPARDGELAQPLFGL
A0A3M3UCT3      -------ELIKSRALLGKVVDDLQLNRLQTPDLFPVIGPYLYRTFKPARDGELAQPLFGL
A0A7Z6Y5I3      -------ELIKSRALLGKVVDDLQLNRLQTPDLFPVIGPYLYRTFKPARDGELAQPLFGL
A0A3M5KZ75      -------ELIKSRALLGKVVDDLQLNRLQTPDLFPVIGPYLYRTFKPAREGELAQPLFGL
A0A3M5L3G5      -------ELIKSRALLGKVVDDLQLNRLQTPDLFPVIGPYLYRTFKPAREGELAQPLFGL
A0A7Y2TRV5      ------------------------------------------------------------
A0A318DSU0      ------------------------------------------------------------
A0A538PF21      ------------------------------------------------------------
A0A1W1ZH10      ------------------------------------------------------------
A0A1W2FF24      ------------------------------------------------------------
A0A524JYQ6      ------------------------------------------------------------
A0A4Q3MA17      ------------------------------------------------------------
A0A0N0M5F7      ------------------------------------------------------------
A0A537M754      ------------------------------------------------------------
A0A1V1PDB4      ------------------------------------------------------------
A0A2M7C324      ------------------------------------------------------------
A0A4Q3HHG6      ------------------------------------------------------------
A0A3B7DTA4      ------------------------------------------------------------
A0A432ZK62      ------------------------------------------------------------
A0A1V5EEP4      ------------------------------------------------------------
A0A1V5EF48      ------------------------------------------------------------
A0A0S6X1X6      ------------------------------------------------------------
A0A537Y5L8      ------------------------------------------------------------
A0A4Q3L2X2      ------------------------------------------------------------
A0A4Q3T8J1      ------------------------------------------------------------
A0A4Q4ANM4      ------------------------------------------------------------
A0A4Q3UEC7      ------------------------------------------------------------
A0A1H5YYQ4      ------------------------------------------------------------
A0A1X4NLK2      ------------------------------------------------------------
A0A1X4NWB5      ------------------------------------------------------------
A0A1M5UQ38      ------------------------------------------------------------
A0A327YI48      ------------------------------------------------------------
A0A1B1PNL6      ------------------------------------------------------------
A0A2U8H9H9      ------------------------------------------------------------
A0A845UXY6      ------------------------------------------------------------
A0A1X6YIC0      ------------------------------------------------------------
A0A1I5E9E9      ------------------------------------------------------------
A0A1X6Z7N7      ------------------------------------------------------------
A0A2E1DQ13      ------------------------------------------------------------
A0A1H8C800      ------------------------------------------------------------
A0A2N3EZ05      ------------------------------------------------------------
A0A844ZIR7      ------------------------------------------------------------
A0A850H7C5      ------------------------------------------------------------
A0A845AYQ8      ------------------------------------------------------------
A0A0W1DLQ3      ------------------------------------------------------------
A0A246JVD8      ------------------------------------------------------------
A0A2N3BB54      ------------------------------------------------------------
A0A1H6G7A3      ------------------------------------------------------------
A0A0A7PGL6      ------------------------------------------------------------
A0A4Q2Z4L0      ------------------------------------------------------------
A0A7W0BRL7      ------------------------------------------------------------
A0A0W1GMS6      ------------------------------------------------------------
A0A0Q8RMY3      ------------------------------------------------------------
A0A1A7QC21      ------------------------------------------------------------
A0A832FJD1      ------------------------------------------------------------
A0A7C0U459      ------------------------------------------------------------
A0A7W0ITF0      ------------------------------------------------------------
A0A832C120      ------------------------------------------------------------
A0A318CT66      ------------------------------------------------------------
A0A3N5P205      ------------------------------------------------------------
A0A2G9XLE5      ------------------------------------------------------------
A0A6L3MM74      ------------------------------------------------------------
A0A7X8CDM1      ------------------------------------------------------------
A0A7C3QM04      ------------------------------------------------------------
A0A7I8MVM0      ------------------------------------------------------------
A0A7C0Y3J7      ------------------------------------------------------------
A0A7C3LF61      ------------------------------------------------------------
A0A4R1HDF2      ------------------------------------------------------------
A0A6N1DL48      ------------------------------------------------------------
A0A534HBS8      ------------------------------------------------------------
E1Y9C0          ------------------------------------------------------------
A0A1N6SH58      ------------------------------------------------------------
A0A4Q3AQN2      ------------------------------------------------------------
                                                                            

A0A1M6N1X5      ------------------------------------------------------------
A0A561M3U0      ------------------------------------------------------------
A0A2T4ZJZ6      ------------------------------------------------------------
A0A1T2KYM8      ------------------------------------------------------------
A0A2G9ZR82      ------------------------------------------------------------
A0A6J4YZ98      ------------------------------------------------------------
A0A844XH11      ------------------------------------------------------------
A0A0P1H2H0      ------------------------------------------------------------
A0A377N8F8      ------------------------------------------------------------
A0A4Q3LR91      ------------------------------------------------------------
A0A6C9IKN8      ------------------------------------------------------------
A0A4V1TR68      ------------------------------------------------------------
A0A6L3ZR06      ------------------------------------------------------------
A0A3E0WKI3      ------------------------------------------------------------
A0A1H3I2J1      ------------------------------------------------------------
A0A521LJG5      ------------------------------------------------------------
A0A1V4WHZ7      ------------------------------------------------------------
A0A1E5AJN5      IACAISGLVMGSVYASLQTKQYRASLQINIDVGRASALREFEVVGESRSFFVTAESTIAA
A0A2N3D2J1      ------------------------------------------------------------
A0A2N2GVE1      RIFHIVRNYFWIVLLTCGVGVSLAFFVTKKQTPLYRTSCSVVISSQLPSYLGSTVKSNLA
A0A2N2INV3      RIFHIVRNYFWIVLLTCGVGVSLAFFVTKKQTPLYRTSCSVVISSQLPSYLGSTVKSNLA
A0A233IKJ2      ------------------------------------------------------------
A0A1Y5DXG5      ------------------------------------------------------------
A0A0B8P2H5      ------------------------------------------------------------
A0A380AQW6      ------------------------------------------------------------
A0A2G2GD62      LELGTRYYKEKNYRLVELYKKSPLVVNVTFMEYNLLEKKLKIRAIDGETYELSYKTKIKI
A0A524P331      ---------------------------------------KTPDYTIVLTGPEKSKVANAD
A0A4V1SSM5      ------------------------------------------------------------
A0A4Q3K8G7      ------------------------------------------------------------
A0A7C7W7M2      LFCAVSVITSVIYVQSQAPAYISTVTMHIAPSNAGMFNLEQWWTSDDDKFEDTQVGILQS
A0A1M7HC79      ------------------------------------------------------------
A0A1D3JZN6      ------------------------------------------------------------
A0A1V6ESG1      ------------------------------------------------------------
A0A850NXS7      ------------------------------------------------------------
A0A1H7YHK3      ------------------------------------------------------------
A0A3S1MCW7      ------------------------------------------------------------
A0A528AX40      -----------------------------------------DIEVVSENADVRAFLTARE
A0A528MV95      -----------------------------LEVLVPSAKVFQDIEVVSESSDVRAFLTARE
A0A838IR38      RYWGLLKKFYWILIVTSILCVAAAYFWTDQQPRIYQATSKLIFHEAKPNIFGKQIERVEL
A0A328C2K5      RYWVLFRRFYWVLILTSIACVAAAYFWTDRQPRIYQATSKLIFHESRPNVFGKQFERVEL
A0A5C6X8M3      RYWALFRRFYWVLILTSIACVAAAYFWTERQPRIYQATSKLMFHESRPNVFGKQFERVEL
A0A3D8MRR7      RYWALFRRFYWVLILTSIACVAAAYFWTDRQPRIYQATSKLIFHESRPNVFGKQFERVEL
A0A5C6UBJ7      RYWALFRRFYWVLILTSIACVAAAYFWTDRQPRIYQATSKLIFHESRPNVFGKQFERVEL
A0A5C6XGM3      RYWALFRRFYWVLILTSIACVAAAYFWTERQPRIYQATSKLIFHESRPNVFGKQFERVEL
A0A849WSS0      YKMYFVLGLVSSAMVLAHHYGFPSYRARSIIYVSQGSSQIDQITNRLQGVQFAEDTHATD
A0A7Y3GUU1      ------------------------------------------------------------
A0A090R136      ------------------------------------------------------------
A0A661JU93      ------------------------------------------------------------
A0A0M3GBT1      ------------------------------------------MEDKSSSSDLLDAKSETE
B3Q577          ------------------------------------------MEDKSSSSDLLDAKSETE
A0A3R9C3P5      MIMIITIAVLLMVPAAMMISGLKPAYQGSARLIIRQPLATLLGVDDTSRNDLIDVKSETE
A0A7W6FJX0      MIMIITIAVLLMVPAAMMISGLKPAYQGSARLIIRQPLATLLGVDDTSRNDLIDVKSETE
A0A2E2T3V8      RGVFAVSFVALLMMASVAISFFSPVYKSFASVGFVREEPATTQTDFPKAVWPNAAEFVET
A0A367UAB4      RGVFAVSFVALLMMASVAISFFSPVYKSFASVGFVREEPATTQTDFPKAVWPNAAEFVET
A0A1F2ZW35      LILDTRTFKVLSTEGALSGVDTLNMGAIQSELEVIGSEFVVGRVVDKLGLANNPDFNGTK
A0A377V641      ------------------------------------------------------------
A0A1F2YJ88      ------------------------------------------------------------
A0A5N8AL61      SLVDLGSVIETVRRRKLPMAIACAIILVLTAVTYLMSDRVYMASGRVAVDRQDNDIVNVE
A0A0J7XGZ1      -------------MLPRTYTATSALLLEPREAQPVKVNDRGFVAPADDNLIDTAVQIIRS
I4CBA7          --MSTYSPHDSEAFEFSSPRHSLTGHVRTIFRKKWLFLGIVALALAGGVVVGLVRSPVYK
A3VE95          IDRVDVRGLLRAIFSRGPLIGGLAVGCALLLFVVTQFIPSTYTAYSKVMLDAREVRIMSS
A0A1G0NL95      ------------------------------------------------------------
A0A024KA69      -----------------------------------------MALAVAAGLALASAALLVM
A0A0L1KFN4      ---------------------MTPQYTAVSTIEISREADQVTNIEGVERETSVADQEFYQ
A0A3D5UYX7      ------------------------------------------------------------
A0A524QFS4      MNDSRFAELDLFDFRDLFRSLWIKKRLIMIVLAFALTSWMFYLSIATRVYRGESILELSL
A0A832MZU0      ------------------------------------------------------------
A0A520JSW4      SRELSLAVLWRIAFEWRWLILAAIGTGIVAAMLMTMLTPLQYRSVTTLELNPPEVEILAD
A0A4Q3LTF3      ------------------------------------------------------------
A0A840SQK7      LILIVGAVLTALALPAILGMERPYYGQSRLLIQQPITSALGTDPNSRPAPLDPNTEIERL
A0A7C3N3Y1      ---------------------------QTQYKILESRTLARRVIESLKLKNHPEFSIEQP
A0A537UTP9      -----------------------------------------------VDSQVEVLQSENV
A0A1D2RNR5      ------------------------------------------------------------
A0A4V1TQ46      ------------------------------------------------------------
A0A3A0FZC0      ------------------------------------------------------------
A0A1N7JVZ7      ------------------------------------------------------------
A0A091C4A8      ------------------------------------------------------------
A0A844YBH7      SSSSGAPLLPDPGLIWQVFRRNFLLFCIVVLAILGLTGAIMATLTPQYFASASVLIEPTS
A0A4R3H6P6      RAATRWRWVLLGGVAAGALAGIALTLVMPRQYASTARMEISRETARVVKIDSVERDTSIG
A0A3S1NQ09      ------------------------------------------------------------
A0A443GJ52      ------------------------------------------------------------
A0A2W6S588      TQDLAGIVSRFRRHLPIGFAIIVLMMVLAYGATKMMTPKYSASAQLSYSPQQALSRDGQP
A0A483E0N4      ------------------------------------------------------------
A0A2J4YQQ6      ------------------------------------------------------------
A0A483THX4      ------------------------------------------------------------
A0A534MVS2      ------------------------------------------------------------
A0A444I5K6      ------------------------------------------------------------
A0A154VE85      GLAIVAGLPERYRATAQLVFQDRSSGFGGSALLLDRGAIETEAAIVASRDLALRAVESLR
A0A3C1S9Y1      ------------------------------------------------------------
A0A353EH49      AGVAEPLLGFDAYAWGGEILEVAKLEVPDFLKGNALRLVVEHDSEYTLYDGDEYLLKGRV
A0A1Y1Q9C1      -------------------------------EGMQVVNFGTVSSASPDMGEQDPFFRTQY
A0A3M7LJH0      ------------------------------------------------------------
A0A1E4JHX8      ------------------------------------------------------------
M2U8P2          PLLDFGKLTVIARRRIVPMAVAAALCALAVAALYFTSEPTYSASGQIGFERGADELLPGL
A0A1H7KZF8      LDFDRLWVPVRRSLVPMAAIVFASLAAALLAFVLIRPSFRADATLRIDAAAQRIVGTEDV
A0A6N3UC48      ------------------------------------------------------------
A0A257NG76      ------------------------------------------------------------
A0A1T4TW59      ------------------------------------MHLILIKKYYQTQFEILRSSHIAE
A0A1Q3MB35      ------------------------------------------------------------
A0A259LUN7      ------------------------------------------------------------
A0A2D7AVL1      ------------------------------------------------------------
A0A3B9KZE9      ------------------------------------------------------------
A0A358L616      ------------------------------------------------------------
A0A4U9HNE9      ------------------------------------------------------------
A0A7X7Z1H8      ------------------------------------------------------------
A0A7C5N053      --------------------------------YQAEATLKFDPNPPTPLGQDVEGVVDIG
A0A2G2CXY6      ----------MGSWAARRYDPYEAGEVAEPWLGLDSFAWGGEELAIFQLEVPPGYLGKTL
A0A3M1D4H3      ------------------------------------------------------------
A0A7C1A2A2      RGADGEPPSIRYWRWRLLDGKRLSAWAPGPQALAARNAAVTDPALADVPLTIRFAAGGAY
A0A840RX77      --------------------------------------------------------MLTA
A0A5C8BYM7      ------------------------------------------------------------
A0A7V2RUR3      ----WTARAQLLLDPRQPRYADIEAVVAGLPADEATIATQIRLLQSRSFHARVMEDLGLF
A0A1J5ICP0      ----------------------------------------------------------SY
A0A379B9V4      --------MRLKKLDLTTQVEPIYPVPILGKLFASATGYSPQITISHFTPLNEAANTLIL
A0A0Q6TS97      ------------------------------------------------------------
A0A0Q6UYB4      ------------------------------------------------------------
W7Q5J0          QRPDFPIMLPYISDYVLSSGIPQPSFMQRQPYVWGGENLEVARFVLAEHRRSHVVVVERD
A0A654AKT6      ------------------------------------------------------------
A0A847E0Q2      ------------------------------------------------------------
A0A7W9WQN4      ------------------------------------------------------------
A0A0G9MZA5      ------------------------------------------------------------
H0T8B0          --------------------------------------MIGSKKDVWIRSDLTIENLLVD
A0A7Y4X614      ------------------------------------------------------------
A0A5C7N981      -----------------------------------------------------MAFIDRQ
A0A534TV22      ------------------------------------------------------------
A0A351CXR4      MLGYNSSLNNTPMYQSSLTLMVTENMPNMAMVGQGYVDPMSMLSLWSGGTLDTRIIQSRA
A0A2N6GLF5      ------------------------------------------------------------
A0A1W9LJP0      ------------------------------------------------------------
A0A0W1ICB0      --------------------MTPQYTATSRIEIAREQANVTNVEGLKRDSNAPDQEFYLT
A0A7C1C8G2      ------------------------------------------------------------
A0A832F8F3      ------------------------------------------------------------
A0A2E0UL88      ------------------------------------------------------------
A0A2N1WQN5      ------------------------------------------------------------
A0A0T2QIS1      ------------------------------------------------------------
A0A376KYN0      ------------------------------------------------------------
A0A377E5P7      ------------------------------------------------------------
A0A2X1JB05      ------------------------------------------------------------
A0A376RML0      ------------------------------------------------------------
A0A6N3QTV2      ------------------------------------------------------------
A0A0P7Y1D0      ------------------------------------------------------------
A0A7Y2FUF7      ------------------------------------------------------------
A0A7W6DRI0      ------------------------------------------------------------
A0A542J310      ------------------------------------------------------------
A0A2M7JRZ7      ------------------------------------------------------------
A0A167IR75      ------------------------------------------------------------
A0A3B8T2U6      ------------------------------------------------------------
A0A365PWR2      ------------------------------------------------------------
A0A2E9H5Z8      ------------------------------------------------------------
A0A2E2BR79      ------------------------------------------------------------
A0A6I4IKZ3      ------------------------------------------------------------
A0A7H4JZ79      ------------------------------------------------------------
A0A0Q4Q524      ------------------------------------------------------------
A0A0Q4CFJ9      ------------------------------------------------------------
A0A0Q4FE58      ------------------------------------------------------------
A0A0Q4JWC8      ------------------------------------------------------------
A0A0Q4KFL8      ------------------------------------------------------------
A0A7W8RVL5      ----------------------------------------------------------TV
A0A831Y0Z8      ------------------------------------------------------------
A0A522R8R0      ------------------------------------------------------------
A0A2U9NDY5      ------------------------------------------------------------
A0A0Q4IGG1      ------------------------------------------------------------
A0A352G2C2      ------------------------------------------------------------
A0A7Y3BMU7      ------------------------------------------------------------
A0A534RUJ5      ------------------------------------------------------------
V4Q8B7          ------------------------------------------------------------
A0A3M1CJM3      ------------------------------------------------------------
A0A2R7SVD4      ------------------------------------------------------------
A0A0Q8XKK5      ------------------------------------------------------------
A0A2E0Q2W0      ------------------------------------------------------------
A0A660NIR6      ------------------------------------------------------------
A0A142W0R3      ----------------------------------------------METDVEGAREKTIS
A0A0S4XR18      ------------------------------------------------------------
A0A7C5CFF1      ------------------------------------------------------------
A0A7X6WZW5      -----------------------SEPLLPRLFGYVFGTETIQIKQLDVPVELENQPLTLV
A0A7X2SVT1      ------------------------------------------------------TIDKRN
A0A2E0GW64      ------------------------------------------------------------
A0A1A7QJ97      ------------------------------------------------------------
A0A832UVD3      ------------------------------------------------------------
A0A7W5IBY1      ----------------------------------MGGEKIAISRFDVPTESYGENFTLVA
A0A661LW70      ------------------------------------------------------------
W7Q8F9          ------------------------------------------------------MVVERD
A0A524PXH8      ------------------------------------------------------------
A0A4Q3P0E4      ------------------------------------------------------------
A0A3M2BE89      -------------------------------------------------------LGQPL
A0A4Q4A6K6      ------------------------------------------------------------
A0A257G674      -----------------------------------------------------------D
A0A661M5M6      ------------------------------------------------------------
A0A1I1UM01      ------------------------------------------------------------
Q44573          ------------------------------------------------------------
A2W025          ---------------------------------------------------MPALEGKKL
A0A534Z362      QSPIQLRLEGNVLRLDDGDPSANGAATFLSTQVAALQSRDLAERVIRSRGLADSEAFLDP
V4J283          ------------------------------------------------------------
A0A536T443      ------------------------------------------------------------
A0A0Q4UFQ5      ------------------------------------------------------------
A0A527W7E6      ------------------------------------------------------------
A0A432EMV7      ------------------------------------------------------------
A0A7Y3M8P5      ----------------------------------------------------------VI
A0A7C1SEU7      ------------------------------------------------------------
A0A7Y1SPC5      ------------------------------------------------------------
A0A7V6YC94      ------------------------------------------------------------
A0A534WLI3      ------------------------------------------------------------
A0A7V6CBY2      ------------------------------------------------------------
A0A7C6FBW0      ---------------------------------------------------ILRSDAVAL
A0A087LTV7      ------------------------------------------------------------
A0A7D7WSS2      ------------------------------------------------------------
A0A318KWA2      --------------------------------------------------MDGETPRALG
A0A522MT86      ------------------------------------------------------------
A0A4Q3I221      ------------------------------------------------------------
A0A534SAL6      QSPIQLQLQENVLHLDESDRSVNGTSSFLATQVAALKSRDIAERVIRREGLATDEAFLHP
A0A534ZDB4      ------------------DRSVNGTSSFLATQVATLKSRDLAERVIRSERLATDEAFLHP
A0A534X3M7      QSPIQLRLEGNVLRLGESDRDANGAATFVGMQVAALRSRDLAERVIRGRGLAANDAFLDP
A0A534SPC6      ------------------------------------------------------------
A0A535AD60      QSPIQLRLEGNVLRLGDGDLSANGAATFLSTQVAALQSRDLAERVIRSRGLADSEAFLDP
A0A4Q3SY08      ------------------------------------------------------------
A0A7U1E9W6      ------------------------------------------------------------
A0A4Q3LG23      ------------------------------------------------------------
A0A522EX52      ------------------------------------------------------------
A0A1H3KC95      ------------------------------------------------------------
A0A5P8Z4P3      -----------------------------------------MTAERIFRRKNRPGARSDS
A0A2E9HXF7      ------------------------------------------------------------
A0A0B3RZC9      ------------------------------------------------------------
A0A6F8QET1      ------------------------------------------------------MGRTGD
A0A520HUH4      ------------------------------------------------------------
A0A2K8U7M6      ------------------------------------------------------------
A0A5B9DKL8      ------------------------------------------------------------
A0A238KJM1      ------------------------------------------------------------
A0A3A0FJZ4      ------------------------------------------------------------
W4HJV8          ------------------------------------------------------------
A0A0P1GDI0      ------------------------------------------------------------
A0A2R8ATV5      ------------------------------------------------------------
A0A1U7D3R6      ------------------------------------------------------------
A0A2D4UVV2      ------------------------------------------------------------
A0A0W7WHP4      ------------------------------------------------------------
A0A238J8F6      ------------------------------------------------------------
A0A238JQI6      ------------------------------------------------------------
A0A222E077      ------------------------------------------------------------
A0A239E3Y2      ------------------------------------------------------------
A0A1F9CFF0      ------------------------------------------------------------
A0A2M8B0G5      ------------------------------------------------------------
A0A363TNU9      ------------------------------------------------------------
A0A445MZQ4      ------------------------------------------------------------
A0A0M9E0E3      ------------------------------------------------------------
A0A351Z9A2      ------------------------------------------------------------
A0A6G6X2Z4      ------------------------------------------------------------
A0A0C5VQ86      ------------------------------------------------------------
A0A3S1WTQ1      ------------------------------------------------------------
A0A354EF47      ------------------------------------------------------------
A0A536T0W8      ------------------------------------------------------------
A0A2G6MSP7      ------------------------------------------------------------
A0A3N5FRH4      ------------------------------------------------------------
A0A1V4Y2C3      ------------------------------------------------------------
A0A2N2KTJ4      ------------------------------------------------------------
A0A2N2LQX0      ------------------------------------------------------------
A0A4U8YMP3      ------------------------------------------------------------
A0A1Q8QQ99      ------------------------------------------------------------
A0A7C2SIB2      ------------------------------------------------------------
A0A3D5ZY44      ------------------------------------------------------------
A0A1G5C236      ------------------------------------------------------------
A0A432HIS7      ------------------------------------------------------------
A0A401FQP5      ------------------------------------------------------------
A0A7C3Q9R6      ------------------------------------------------------------
A0A7C2AA26      ------------------------------------------------------------
A0A351Z4H9      ------------------------------------------------------------
A0A2N2KML4      ------------------------------------------------------------
E1YJF1          ------------------------------------------------------------
A0A1Q6DMW3      ------------------------------------------------------------
A0A3A6P8F8      ------------------------------------------------------------
A0A1J5EVZ6      ------------------------------------------------------------
A0A2G2DSM4      ------------------------------------------------------------
A0A1F9NI02      ------------------------------------------------------------
A0A4U1ABX4      ------------------------------------------------------------
A0A6L4AM84      ------------------------------------------------------------
A0A840UW68      ------------------------------------------------------------
A0A2G6FCC5      ------------------------------------------------------------
A0A1F9MR25      ------------------------------------------------------------
A0A2G6M7F1      ------------------------------------------------------------
A0A5Q2QDL1      ------------------------------------------------------------
A0A4Z0M4C7      ------------------------------------------------------------
A0A1V8MBH1      ------------------------------------------------------------
A0A7V9E085      ------------------------------------------------------------
A0A6J4X8D4      ------------------------------------------------------------
A0A1E7HSL6      ------------------------------------------------------------
A0A2M7JX59      ------------------------------------------------------------
A0A7V4PLT3      ------------------------------------------------------------
A0A7X7Y8R3      ------------------------------------------------------------
A0A832A361      ------------------------------------------------------------
A0A1M5GH86      ------------------------------------------------------------
A0A1W1XQZ5      ------------------------------------------------------------
A0A3D6C3I2      ------------------------------------------------------------
S0G1D4          ------------------------------------------------------------
A0A661T246      ------------------------------------------------------------
A0A850T4Q7      ------------------------------------------------------------
A0A2G6CSG7      ------------------------------------------------------------
A0A2G6NB59      ------------------------------------------------------------
A0A5K8A7T9      ------------------------------------------------------------
A0A1W9U045      ------------------------------------------------------------
A0A1F9L9G4      ------------------------------------------------------------
A0A328FD76      ------------------------------------------------------------
A0A348UX90      ------------------------------------------------------------
A0A357Z0N5      ------------------------------------------------------------
A0A0F2R2U0      ------------------------------------------------------------
A0A5K7ZK00      ------------------------------------------------------------
A0A5K7YCX8      ------------------------------------------------------------
A0A5K7Z388      ------------------------------------------------------------
A0A520CSP5      ------------------------------------------------------------
A0A1E7HFN0      ------------------------------------------------------------
A0A7J0BHG1      ------------------------------------------------------------
A0A6V8LMJ3      ------------------------------------------------------------
A0A2K8WHP8      ------------------------------------------------------------
A0A1J5N774      ------------------------------------------------------------
A0A2C8F781      ------------------------------------------------------------
A0A2E3R6G0      ------------------------------------------------------------
A0A7J0BUD3      ------------------------------------------------------------
A0A3M8EMP2      ------------------------------------------------------------
A0A2J6J6K6      ------------------------------------------------------------
A0A1F8XMK2      ------------------------------------------------------------
A0A661PSB9      ------------------------------------------------------------
A0A661QBT6      ------------------------------------------------------------
A0A6I2SLK2      ------------------------------------------------------------
A0A7Y7NC38      ------------------------------------------------------------
A0A0A8WSG4      ------------------------------------------------------------
S7TK97          ------------------------------------------------------------
S7UE93          ------------------------------------------------------------
A0A3D5BR56      ------------------------------------------------------------
A0A1I3PSR2      ------------------------------------------------------------
A0A2N2IB15      ------------------------------------------------------------
A0A7C8B5M6      ------------------------------------------------------------
A0A7V4UW39      ------------------------------------------------------------
A0A1W7QPT7      ------------------------------------------------------------
A0A6S6M1Y8      ------------------------------------------------------------
A0A6V8MCR2      ------------------------------------------------------------
A0A6V8N3X1      ------------------------------------------------------------
A0A6M4XJ81      ------------------------------------------------------------
A0A0M4D373      ------------------------------------------------------------
A0A1L3GKM9      ------------------------------------------------------------
A0A2T5R3J5      ------------------------------------------------------------
A0A1G6EKK9      ------------------------------------------------------------
A0A7C1DJX8      ------------------------------------------------------------
A0A3A4XVN3      ------------------------------------------------------------
A0A1E7JEV6      ------------------------------------------------------------
A0A2N2KDY5      ------------------------------------------------------------
A0A3N5YUD9      ------------------------------------------------------------
A0A4Q3ZDI7      ------------------------------------------------------------
A0A537PRC6      ------------------------------------------------------------
A0A7Y8L8B9      ------------------------------------------------------------
A0A5C4N0H6      ------------------------------------------------------------
A0A7V4UXV1      ------------------------------------------------------------
A0A7C3Y7G3      ------------------------------------------------------------
A0A7V5R3L0      ------------------------------------------------------------
A0A7V2SYN1      ------------------------------------------------------------
A0A6H9HII8      ------------------------------------------------------------
A0A7S6SHD5      ------------------------------------------------------------
A0A7C1UTU6      ------------------------------------------------------------
W9VVY5          ------------------------------------------------------------
A0A1E2URD3      ------------------------------------------------------------
A0A2T6MY81      ------------------------------------------------------------
A0A7Z0VN76      ------------------------------------------------------------
A0A2T6NBQ8      ------------------------------------------------------------
A0A421K431      ------------------------------------------------------------
A0A7C3Z8T7      ------------------------------------------------------------
A0A1V4QMH7      ------------------------------------------------------------
A0A496XZQ4      ------------------------------------------------------------
A0A7C3UZM2      ------------------------------------------------------------
A0A1F9BJF7      ------------------------------------------------------------
F2NDF5          ------------------------------------------------------------
A0A7Y4XWU8      ------------------------------------------------------------
A0A4V2SPR5      ------------------------------------------------------------
A0A7W8W7P8      ------------------------------------------------------------
A0A7W8WPN5      ------------------------------------------------------------
A0A519ERR1      ------------------------------------------------------------
A0A4Q3Q1M2      ------------------------------------------------------------
A0A4Q3MHR1      ------------------------------------------------------------
A0A520GDZ4      ------------------------------------------------------------
A0A372IH36      ------------------------------------------------------------
A0A540VW45      ------------------------------------------------------------
A0A1H9C241      ------------------------------------------------------------
A0A2E3FCR1      ------------------------------------------------------------
A0A4S3MG69      ------------------------------------------------------------
A0A3E0H727      ------------------------------------------------------------
A0A7X8XJJ0      ------------------------------------------------------------
A0A1I3TTC3      ------------------------------------------------------------
A0A1H3IZW6      ------------------------------------------------------------
A0A0M6YG59      ------------------------------------------------------------
A0A1H7G8B0      ------------------------------------------------------------
A0A2G2I5M1      ------------------------------------------------------------
A0A2G2M6F0      ------------------------------------------------------------
A0A352B502      ------------------------------------------------------------
A0A430DNP0      ------------------------------------------------------------
A0A410V446      ------------------------------------------------------------
A0A1B1UCM8      ------------------------------------------------------------
A0A1N6JQ20      ------------------------------------------------------------
A0A0R3KGJ5      ------------------------------------------------------------
A0A0R3N604      ------------------------------------------------------------
A0A1M5TI07      ------------------------------------------------------------
A3X191          ------------------------------------------------------------
A0A160UA87      ------------------------------------------------------------
A0A1Q5SFV5      ------------------------------------------------------------
A0A1H4RKV5      ------------------------------------------------------------
A0A7Z2Q199      ------------------------------------------------------------
A0A3A0FQ32      ------------------------------------------------------------
A0A7Y3GV54      ------------------------------------------------------------
A0A3E0WXH2      ------------------------------------------------------------
A0A1A9KEF8      ------------------------------------------------------------
A0A5E6PKN5      ------------------------------------------------------------
A0A0N9W1V6      ------------------------------------------------------------
A0A423GQ41      ------------------------------------------------------------
A0A423H7J2      ------------------------------------------------------------
A0A502HNM8      ------------------------------------------------------------
A0A4Q7H223      ------------------------------------------------------------
A0A1H4N2K9      ------------------------------------------------------------
A0A2K4KWF7      ------------------------------------------------------------
A0A1E4UZA0      ------------------------------------------------------------
A0A1H9KL56      ------------------------------------------------------------
A0A7X0BTK5      ------------------------------------------------------------
A0A2N2TRC8      ------------------------------------------------------------
A0A1V4CIZ7      ------------------------------------------------------------
A0A1M3BXA5      ------------------------------------------------------------
A0A1Y2R3U6      ------------------------------------------------------------
A0A167HVD6      ------------------------------------------------------------
A0A1V3SCT6      ------------------------------------------------------------
L0H287          ------------------------------------------------------------
A0A495VG93      ------------------------------------------------------------
A0A4R3MYM4      ------------------------------------------------------------
G2E3C0          ------------------------------------------------------------
A0A1W9J9F8      ------------------------------------------------------------
A0A2S5LFJ9      ------------------------------------------------------------
A0A2D8R8F8      ------------------------------------------------------------
A0A1G0KSD0      ------------------------------------------------------------
A0A4P6WX84      ------------------------------------------------------------
A0A1D2S760      ------------------------------------------------------------
A0A5B8RW94      ------------------------------------------------------------
A0A6I4JXQ8      ------------------------------------------------------------
A0A010SNS0      ------------------------------------------------------------
A0A0C2I782      ------------------------------------------------------------
A0A2N8BYF5      ------------------------------------------------------------
A0A558FKX2      ------------------------------------------------------------
A0A1H1DBA0      ------------------------------------------------------------
J3H699          ------------------------------------------------------------
A0A0K1QRZ4      ------------------------------------------------------------
A0A560RJW9      ------------------------------------------------------------
A0A5E7CRU7      ------------------------------------------------------------
A0A1H5J974      ------------------------------------------------------------
A0A5E7C564      ------------------------------------------------------------
A0A2W7MAV4      ------------------------------------------------------------
W6VFG3          ------------------------------------------------------------
A0A1P8ENT1      ------------------------------------------------------------
A0A2N7XRV4      ------------------------------------------------------------
A0A0Q6QPG8      ------------------------------------------------------------
A0A0F4SWA7      ------------------------------------------------------------
A0A423J219      ------------------------------------------------------------
A0A4P6G9U8      ------------------------------------------------------------
A0A4Y8JE06      ------------------------------------------------------------
A0A502I1X9      ------------------------------------------------------------
A0A502J776      ------------------------------------------------------------
A0A5B0EZF6      ------------------------------------------------------------
A0A059L434      ------------------------------------------------------------
A0A0F4UWN2      ------------------------------------------------------------
A0A5E7WEF5      ------------------------------------------------------------
A0A258TN88      ------------------------------------------------------------
A0A7Y8MN30      ------------------------------------------------------------
A0A3N5J7U8      ------------------------------------------------------------
A0A1S7S3I8      ------------------------------------------------------------
A0A655ZZQ1      ------------------------------------------------------------
A0A1S0ZAI3      ------------------------------------------------------------
A0A3C0L0A8      ------------------------------------------------------------
A0A176S762      ------------------------------------------------------------
A0A1W9WUD9      ------------------------------------------------------------
A0A1W1ZQK0      ------------------------------------------------------------
A0A7X1GRP5      ------------------------------------------------------------
A0A6I1R304      ------------------------------------------------------------
A0A1W9PMU6      ------------------------------------------------------------
A0A7Y4X3V7      ------------------------------------------------------------
A0A1G3VVY5      ------------------------------------------------------------
A0A7C3S273      ------------------------------------------------------------
A0A7C4WJ18      ------------------------------------------------------------
A0A351B422      ------------------------------------------------------------
F2NEE9          ------------------------------------------------------------
A0A7C3V565      ------------------------------------------------------------
A0A7V6A3E1      ------------------------------------------------------------
A0A318D3U4      ------------------------------------------------------------
A0A7V0JSN8      ------------------------------------------------------------
A0A7V5V784      ------------------------------------------------------------
A0A352Q5C1      ------------------------------------------------------------
A0A355TB56      ------------------------------------------------------------
A0A1F9E324      ------------------------------------------------------------
A0A435NNF5      ------------------------------------------------------------
A0A3S2AQS7      ------------------------------------------------------------
A0A527ZPD6      ------------------------------------------------------------
A0A529KRW3      ------------------------------------------------------------
A0A530ZLX0      ------------------------------------------------------------
A0A4Q3LBH4      ------------------------------------------------------------
A0A4Q3LWP3      ------------------------------------------------------------
A0A7C3JPP4      ------------------------------------------------------------
A0A534V9L7      ------------------------------------------------------------
A0A7C3JJT4      ------------------------------------------------------------
A0A524M660      ------------------------------------------------------------
A0A7C3JSX5      ------------------------------------------------------------
A0A7I8MQ67      ------------------------------------------------------------
A0A0C1TRU6      ------------------------------------------------------------
A0A2Z5SSF4      ------------------------------------------------------------
A0A7Y7TF97      ------------------------------------------------------------
A0A4Q4CIB1      ------------------------------------------------------------
A0A522ACJ9      ------------------------------------------------------------
A0A3N5Z7F8      ------------------------------------------------------------
A0A239HD34      ------------------------------------------------------------
A0A3D2M6Y9      ------------------------------------------------------------
A0A519E8D7      ------------------------------------------------------------
A0A3S1FD32      ------------------------------------------------------------
A0A434DUT4      ------------------------------------------------------------
A0A528D3U3      ------------------------------------------------------------
A0A3S3UPT3      ------------------------------------------------------------
A0A3S1E286      ------------------------------------------------------------
A0A531AC71      ------------------------------------------------------------
A0A436K268      ------------------------------------------------------------
A0A434IDQ0      ------------------------------------------------------------
A0A435IRM5      ------------------------------------------------------------
A0A3S2C404      ------------------------------------------------------------
A0A435F6C0      ------------------------------------------------------------
A0A435BMN6      ------------------------------------------------------------
A0A529XQ54      ------------------------------------------------------------
A0A530BJC1      ------------------------------------------------------------
A0A0P7ZZE4      ------------------------------------------------------------
A0A369R0Q9      ------------------------------------------------------------
A0A327LYE6      ------------------------------------------------------------
A0A5A9ZTV3      ------------------------------------------------------------
A0A258WKV0      ------------------------------------------------------------
A5G4N9          ------------------------------------------------------------
A0A812HT29      ------------------------------------------------------------
A0A444IY46      ------------------------------------------------------------
A0A6I7N627      ------------------------------------------------------------
A0A1V5DJV0      ------------------------------------------------------------
A0A520IUC4      ------------------------------------------------------------
A0A7Y7M8F4      ------------------------------------------------------------
A0A0P1FWI8      ------------------------------------------------------------
A0A6L8LHC6      ------------------------------------------------------------
A0A848ST88      ------------------------------------------------------------
A0A7U1HWF1      ------------------------------------------------------------
A0A534SH66      ------------------------------------------------------------
A0A3M0ZZ99      ------------------------------------------------------------
A0A238LBD3      ------------------------------------------------------------
A0A537NZJ1      ------------------------------------------------------------
A0A7C4R3C4      ------------------------------------------------------------
A0A0P1FRV5      ------------------------------------------------------------
A0A4Q4CVW6      ------------------------------------------------------------
A0A8B6LS25      ------------------------------------------------------------
A0A6L3ZWI0      ------------------------------------------------------------
A0A1M7BLL7      ------------------------------------------------------------
A0A0H4KZM1      ------------------------------------------------------------
A0A7V2W904      ------------------------------------------------------------
A0A1V1UJT2      ------------------------------------------------------------
A0A0L6CVX1      ------------------------------------------------------------
A0A1V0RR48      ------------------------------------------------------------
A0A0A0HJJ4      ------------------------------------------------------------
A0A5E7YA28      ------------------------------------------------------------
A0A316KRG4      ------------------------------------------------------------
A0A0J5Q9T7      ------------------------------------------------------------
A0A1I5YYQ0      ------------------------------------------------------------
A0A5P9FE62      ------------------------------------------------------------
A0A7U3CQW5      ------------------------------------------------------------
X7F6S5          ------------------------------------------------------------
A0A1G8NKI0      ------------------------------------------------------------
A0A355QPE4      ------------------------------------------------------------
A0A357RN98      ------------------------------------------------------------
A0A1I6U4V1      ------------------------------------------------------------
A0A6B2P8H8      ------------------------------------------------------------
A0A1P8USW9      ------------------------------------------------------------
A0A1G7CFZ2      ------------------------------------------------------------
A0A7G2TPW1      ------------------------------------------------------------
A0A1V6FYJ1      ------------------------------------------------------------
A0A4Q3IRI1      ------------------------------------------------------------
A0A7J5VV32      ------------------------------------------------------------
A0A1E7H876      ------------------------------------------------------------
A0A7C1C6X5      ------------------------------------------------------------
A0A7X1GMT8      ------------------------------------------------------------
Q44570          ------------------------------------------------------------
A0A509L3P8      ------------------------------------------------------------
A0A3A4S038      ------------------------------------------------------------
A0A1F9N669      ------------------------------------------------------------
A0A1F9PFA7      ------------------------------------------------------------
A0A1H2EN09      ------------------------------------------------------------
K0NP00          ------------------------------------------------------------
A0A2N6BZD5      ------------------------------------------------------------
A0A0F2NF69      ------------------------------------------------------------
A0A1F9NFD0      ------------------------------------------------------------
A0A1W9M770      ------------------------------------------------------------
A0A1W9M7R6      ------------------------------------------------------------
A0A7W0IR34      ------------------------------------------------------------
A0A7V5FUI1      ------------------------------------------------------------
A0A7T6AQC8      ------------------------------------------------------------
A0A7U4DQ89      ------------------------------------------------------------
A0A1M5YLH5      ------------------------------------------------------------
A0A4U1A4C7      ------------------------------------------------------------
A0A7C4N0I9      ------------------------------------------------------------
A0A1V4M8I1      ------------------------------------------------------------
A0A7C0XE92      ------------------------------------------------------------
A0A7U4QIX5      ------------------------------------------------------------
A0A800BQ44      ------------------------------------------------------------
A0A1E7JCL5      ------------------------------------------------------------
A0A7Z9XET3      ------------------------------------------------------------
A0A800C5N3      ------------------------------------------------------------
A0A496YAH9      ------------------------------------------------------------
A0A1V4S7E4      ------------------------------------------------------------
A0A847DGI3      ------------------------------------------------------------
A0A2N2H8D2      ------------------------------------------------------------
A0A2N2KC63      ------------------------------------------------------------
A0A3A4ZYW4      ------------------------------------------------------------
A0A800BMM4      ------------------------------------------------------------
A0A1V4MCJ4      ------------------------------------------------------------
A0A661M0W4      ------------------------------------------------------------
A0A3N5RNY4      ------------------------------------------------------------
A0A1M7Y300      ------------------------------------------------------------
A0A4U1ALN4      ------------------------------------------------------------
A0A849F908      ------------------------------------------------------------
A0A2N6BEI9      ------------------------------------------------------------
A0A0D5N3E9      ------------------------------------------------------------
A0A2N2G716      ------------------------------------------------------------
A0A1F9EUS2      ------------------------------------------------------------
A0A3N9VAW3      ------------------------------------------------------------
A0A6I1KNW9      ------------------------------------------------------------
A0A1H4B8T3      ------------------------------------------------------------
A0A1E7IQC3      ------------------------------------------------------------
A0A1M6KEN5      ------------------------------------------------------------
A0A1X0YE57      ------------------------------------------------------------
A0A2K2H9Q8      ------------------------------------------------------------
A0A1F8X5S3      ------------------------------------------------------------
A0A353QLL3      ------------------------------------------------------------
A0A847C207      ------------------------------------------------------------
A0A399I453      ------------------------------------------------------------
A0A651FBV9      ------------------------------------------------------------
A0A562VHD2      ------------------------------------------------------------
A0A7K0J0R7      ------------------------------------------------------------
A0A6I6JNB5      ------------------------------------------------------------
A0A847UFK5      ------------------------------------------------------------
A0A1G0LDK7      ------------------------------------------------------------
A0A6F9WVL7      ------------------------------------------------------------
A0A7Y7TLN9      ------------------------------------------------------------
A0A5C1MDH8      ------------------------------------------------------------
A0A7J4ZSX4      ------------------------------------------------------------
A0A5A9XE04      ------------------------------------------------------------
A0A643G9R1      ------------------------------------------------------------
A0A1G0M8Q7      ------------------------------------------------------------
A0A353MI14      ------------------------------------------------------------
A0A4S1CAW7      ------------------------------------------------------------
A0A655R819      ------------------------------------------------------------
A0A655RNN3      ------------------------------------------------------------
A0A354EI73      ------------------------------------------------------------
A0A6D0ELN7      ------------------------------------------------------------
A0A0B8PTA8      ------------------------------------------------------------
A0A0B8QF75      ------------------------------------------------------------
A0A4U9I390      ------------------------------------------------------------
A0A2X3M011      ------------------------------------------------------------
A0A2H9EHM4      ------------------------------------------------------------
A0A380B3D7      ------------------------------------------------------------
F5NSX0          ------------------------------------------------------------
A0A7A9K1G5      ------------------------------------------------------------
A0A811C967      ------------------------------------------------------------
A0A479JNB1      ------------------------------------------------------------
A0A5C9AF52      ------------------------------------------------------------
A0A6D0EYC7      ------------------------------------------------------------
D8EEU7          ------------------------------------------------------------
A0A0R0BVC7      ------------------------------------------------------------
A0A4U8YLL7      ------------------------------------------------------------
A0A2M7WWF7      ------------------------------------------------------------
A0A534QGR3      ------------------------------------------------------------
A0A0Q6QV61      ------------------------------------------------------------
A0A2Z3IKG4      ------------------------------------------------------------
B7RS54          ------------------------------------------------------------
A0A7R7CAD2      ------------------------------------------------------------
A0A7R7CQL5      ------------------------------------------------------------
A0A1I3XJ27      ------------------------------------------------------------
A0A562CGU2      ------------------------------------------------------------
A0A7C9VCB3      ------------------------------------------------------------
A0A1I7DCG1      ------------------------------------------------------------
A0A3A3H6D9      ------------------------------------------------------------
A0A0Q6VA36      ------------------------------------------------------------
A0A1B2EQN1      ------------------------------------------------------------
A0A1G8QZS5      ------------------------------------------------------------
A0A1H2Y469      ------------------------------------------------------------
A0A497ZQU7      ------------------------------------------------------------
A0A443K010      ------------------------------------------------------------
A0A6I7NYG5      ------------------------------------------------------------
A0A1I0R9R6      ------------------------------------------------------------
A0A2N3BVE7      ------------------------------------------------------------
A0A7C2IB02      ------------------------------------------------------------
A0A6N6SI00      ------------------------------------------------------------
A0A2S5JE21      ------------------------------------------------------------
A0A2R8BKZ2      ------------------------------------------------------------
A0A2S8S361      ------------------------------------------------------------
A0A1X7ACC1      ------------------------------------------------------------
A0A238KUF6      ------------------------------------------------------------
A0A095CTW3      ------------------------------------------------------------
A0A2E3UGD6      ------------------------------------------------------------
A0A840CE00      ------------------------------------------------------------
A0A2T0RFH0      ------------------------------------------------------------
A0A285D390      ------------------------------------------------------------
A0A497VHN4      ------------------------------------------------------------
A0A6M1UAR9      ------------------------------------------------------------
A0A520ZTR8      ------------------------------------------------------------
A0A7Y2NU38      ------------------------------------------------------------
A0A849GJU0      ------------------------------------------------------------
A0A316GHM6      ------------------------------------------------------------
A0A848VYK1      ------------------------------------------------------------
A0A7C9INT8      ------------------------------------------------------------
A0A238IZI1      ------------------------------------------------------------
A0A7Y2U0H6      ------------------------------------------------------------
A0A848WN80      ------------------------------------------------------------
A0A1I6ENM4      ------------------------------------------------------------
A0A2E2P4I0      ------------------------------------------------------------
A0A2U2CM86      ------------------------------------------------------------
A0A212AR83      ------------------------------------------------------------
A0A2M8J3R9      ------------------------------------------------------------
A0A1I6X762      ------------------------------------------------------------
A0A843YIS7      ------------------------------------------------------------
A0A0P1EFX8      ------------------------------------------------------------
A0A2G5KB39      ------------------------------------------------------------
A8LNM8          ------------------------------------------------------------
A0A844B423      ------------------------------------------------------------
A0A0T5NSU3      ------------------------------------------------------------
A0A5P9I718      ------------------------------------------------------------
A0A2N3CNV1      ------------------------------------------------------------
A0A257F1F4      ------------------------------------------------------------
A0A2D5J8T8      ------------------------------------------------------------
A0A2E3P9W6      ------------------------------------------------------------
A0A2G2B1P9      ------------------------------------------------------------
A0A258GCD5      ------------------------------------------------------------
A0A443INY4      ------------------------------------------------------------
A0A2D9YR88      ------------------------------------------------------------
A0A4Q3ZBK4      ------------------------------------------------------------
A0A1G9FY29      ------------------------------------------------------------
A0A6N9RUN2      ------------------------------------------------------------
A0A1W9HS52      EQLFTRTSAVLEEVQSEPFLNLVVANYLKEGNKISFIVPAERVRGLILFIKAALKKGAKL
A0A2D5LFD8      FQNLALNSISNDLPTLISVM------------RSPLIL----------------------
A0A4D8PLT4      VELAEFKSVVSNLTPEAPAV------------RSEVSIVGSRALAERVVEKLGLINDPEF
A0A1G3JY11      ------------------------------------------------------------
A0A3A4NIE9      ------------------------------------------------------------
A0A3A4NUI9      ------------------------------------------------------------
A0A524I3Z6      ------------------------------------------------------------
A0A524PCL7      ------------------------------------------------------------
A0A356GQV1      ------------------------------------------------------------
A0A1J5DAY8      ------------------------------------------------------------
A0A524P237      ------------------------------------------------------------
A0A4P7EP83      ------------------------------------------------------------
A0A348SRI7      ------------------------------------------------------------
A0A833GQE1      ------------------------------------------------------------
A0A661N3U1      ------------------------------------------------------------
A0A7X1T426      ------------------------------------------------------------
A0A432SAI6      ------------------------------------------------------------
A0A855HUH5      ------------------------------------------------------------
A0A6L6H5T1      ------------------------------------------------------------
A0A7V5C3K7      ------------------------------------------------------------
A0A7Y9AV38      ------------------------------------------------------------
A0A2W5J775      ------------------------------------------------------------
A0A3M3H5V6      ------------------------------------------------------------
A0A7V2YBQ6      ------------------------------------------------------------
A0A7X8Z4Y1      ------------------------------------------------------------
A0A377ZC40      ------------------------------------------------------------
A0A534XP85      ------------------------------------------------------------
A0A377LY04      ------------------------------------------------------------
A0A2X3K9R3      ------------------------------------------------------------
A0A484X141      ------------------------------------------------------------
A0A5N9VWI6      ------------------------------------------------------------
A0A5C9ABR5      ------------------------------------------------------------
A0A6D0EJQ0      ------------------------------------------------------------
A0A444R390      ------------------------------------------------------------
A0A376LLF8      ------------------------------------------------------------
A0A6L7CT21      ------------------------------------------------------------
A0A378BPJ7      ------------------------------------------------------------
A0A377ZDN3      ------------------------------------------------------------
A0A2J5PAJ7      ------------------------------------------------------------
A0A7Z9CQS8      ------------------------------------------------------------
A0A2W4RFS2      ------------------------------------------------------------
A0A1Y6DC43      ------------------------------------------------------------
A0A2S6HE06      ------------------------------------------------------------
G3J0M3          ------------------------------------------------------------
V5C6R5          ------------------------------------------------------------
A0A7V0Z1K0      ------------------------------------------------------------
A0A7Y8IFK0      ------------------------------------------------------------
A0A4Q2XLV7      ------------------------------------------------------------
A0A4Q5QYC4      ------------------------------------------------------------
A0A0U2VAW2      ------------------------------------------------------------
A0A454CTF1      ------------------------------------------------------------
A0A6B3Q2G1      ------------------------------------------------------------
A0A6N9S3L5      ------------------------------------------------------------
A0A656BWB0      ------------------------------------------------------------
A0A6D0IFH4      ------------------------------------------------------------
A0A0A0FHV8      ------------------------------------------------------------
A0A2I8SDU4      ------------------------------------------------------------
A0A2I8SU55      ------------------------------------------------------------
A0A7I6T806      ------------------------------------------------------------
A0A7I6TQE9      ------------------------------------------------------------
A0A7I6U296      ------------------------------------------------------------
S1EXJ6          ------------------------------------------------------------
A0A376UBS1      ------------------------------------------------------------
A0A4Q6G931      ------------------------------------------------------------
A0A2T0VBD8      ------------------------------------------------------------
A0A7W5DMU7      ------------------------------------------------------------
A0A378APS2      ------------------------------------------------------------
A0A443VCQ6      ------------------------------------------------------------
A0A447RKQ7      ------------------------------------------------------------
W1DSK1          ------------------------------------------------------------
A0A2N1XK22      ------------------------------------------------------------
A0A850R066      ------------------------------------------------------------
A0A1W9F5M9      ------------------------------------------------------------
A0A352MMI7      ------------------------------------------------------------
A0A4Z0LWV1      ------------------------------------------------------------
A0A376RY66      ------------------------------------------------------------
A0A377K431      ------------------------------------------------------------
A0A6D0I9G1      ------------------------------------------------------------
A0A379W6R2      ------------------------------------------------------------
A0A379TA56      ------------------------------------------------------------
A0A655C5P0      ------------------------------------------------------------
A0A3C2BN18      ------------------------------------------------------------
A0A447LR75      ------------------------------------------------------------
A0A759KJJ5      ------------------------------------------------------------
A0A376D8L7      ------------------------------------------------------------
A0A1V2FV46      ------------------------------------------------------------
A0A6N8QLT3      ------------------------------------------------------------
A0A376SB61      ------------------------------------------------------------
A0A3D1BYV9      ------------------------------------------------------------
A0A3P5DSS6      ------------------------------------------------------------
A0A483YEL5      ------------------------------------------------------------
A0A844PX38      ------------------------------------------------------------
A0A8B4SQI1      ------------------------------------------------------------
A0A483QWI8      ------------------------------------------------------------
A0A483UXD3      ------------------------------------------------------------
A0A0A8J8L3      ------------------------------------------------------------
A0A660DJ38      ------------------------------------------------------------
A0A378G3G7      ------------------------------------------------------------
A0A2X5NHJ9      ------------------------------------------------------------
A0A2J4QEC3      ------------------------------------------------------------
A0A485ADM3      ------------------------------------------------------------
A0A3D0KAC8      ------------------------------------------------------------
A0A4U9HGU4      ------------------------------------------------------------
A0A3S4JGG5      ------------------------------------------------------------
A0A377ZDH2      ------------------------------------------------------------
A0A3S4HTS8      ------------------------------------------------------------
A0A3N5MZ53      ------------------------------------------------------------
A0A534E4H4      ------------------------------------------------------------
A0A534I2B6      ------------------------------------------------------------
A0A1C2JGD0      ------------------------------------------------------------
A0A259LQ70      ------------------------------------------------------------
A0A3N5PM86      ------------------------------------------------------------
A0A2E5YSA4      ------------------------------------------------------------
A0A0N0XAV4      ------------------------------------------------------------
A0A0P9QD19      ------------------------------------------------------------
F3FHG4          ------------------------------------------------------------
F3GGI0          ------------------------------------------------------------
A0A0P9LE74      ------------------------------------------------------------
A0A3M4ZQ14      NRYAWGGEKIDVFQLDVPESLLGENLTLTAGQPGQFSLYDDEHRLLLRGATNRVVEGSGV
A0A3M5YLE8      NRYAWGGEKIDVFQLDVPESLLGENLTLTAGQPGQFSLYDDEHRLLLRGATNRVVEGSGV
A0A3M3RP89      NRYAWGGEKIDVFQLDVPESLLGENLTLTAGQPGQFSLYDDEHSLLLRGATNRVVEGSGV
A0A0P9QIY7      NRYAWGGEKIDVFQLDVPESLLGENLTLTAGQPGQFSLYDDERRLLLRGATNRVVEGSGV
A0A0P9VVH7      NRYAWGGEKIDVFQLDVPESLLGENLTLTAGQPGQFSLYDDEHRLLLRGATNRVVEGSGV
A0A0Q0FJK6      NRYAWGGEKIDVFQLDVPESLLGENLTLTAGQPGQFSLYDDERRLLLRGATNRVVEGSGV
A0A3M3LF66      NRYAWGGEKIDVFQLDVPESLLGENLTLTAGQPGQFSLYDDEHRLLLRGATNRVVEGSGV
A0A0P9WIR8      NRYAWGGEKIDVFQLDVPESLLGENLTLTAGQPGQFSLYDDERRLLLRGATNRVVEGSGV
A0A3M3KPE5      NRYAWGGEKIDVFQLDVPESLLGENLTLTAGQPGQFSLYDDEHRLLLRGATNRVVEGSGV
A0A3M4C263      NRYAWGGEKIDVFQLDVPESLLGENLTLTAGQPGQFSLYDDEHRLLLRGATNRVVEGSGV
A0A3M5AD05      NRYAWGGEKIDVFQLDVPESLLGENLTLTAGQPGQFSLYDDEHRLLLRGATNRVVEGSGV
A0A0Q0D3D2      TQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVEGNGV
A0A0N0FS39      ------------------------------------------------------------
A0A3M6GHH2      ------------------------------------------------------------
A0A0P9R9W0      THYAWGGEKIDVFQLEVPEYLLGEKLTLTAGRPGQFSLYDNEHNLLLGGTTNRVVEGNGI
A0A0Q0B9T0      THYAWGGEKIDVFQLEVPEYLLGEKLTLTAGRPGQFSLYDNEHNLLLGGTTNRVVEGNGI
A0A3M6CFI7      THYAWGGEKIDVFQLEVPEYLLGEKLTLTAGRPGQFSLYDNEHNLLLGGTTNRVVEGNGI
A0A0P9JXN0      THYAWGGEKIDVFQLEVPEHLLGEKLTLTAGRPGQFSLYDNEHNLLLGGTTNRVVEGNGI
A0A3M6FIV7      THYAWGGEKIDVFQLEVPEHLLGEKLTLTAGRPGQFSLYDNEHNLLLGGTTNRVVEGNGI
A0A3M3PLW9      TQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDSEHNLLLGGAINRVVEGHGI
A0A3M4ENY1      TQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDSEHNLLLGGALNRVVEGHGI
A0A3M5EZK7      TQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDSEHNLLLGGAINRVVEGQGI
A0A0P9SPP5      TQYAWGGEKIEVFQLEVPEHLLGKKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVEGNGI
A0A658KL17      TQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVEGNGI
A0A3M3NNF2      TQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVEGNGV
A0A7Z6UK49      TQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVEGNGV
A0A3M4A0E8      TQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVEGNGV
A0A3M4PBZ2      TQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVEGNGV
A0A7Z6U7Q8      TQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGILNRVVEGNGV
A0A3M6AI26      TQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVEGNGV
A0A0P9IWP8      TQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVEGNGV
A0A0P9KZ49      TQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVEGNGV
A0A0P9V840      TQYAWGGENIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVEGNGV
A0A0Q0AIE5      TQYAWGGENIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVEGNGV
A0A3M2ZQH6      TQYAWGGENIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVEGNGV
A0A0N8SQG2      TQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVEGNGV
A0A0W8HFU1      TQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVEGNGV
A0A0P9VHH8      TQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVEGNGV
A0A0P9YV98      TQYAWGGEKIEVFQLEVPEHLLGEKLTLIAGKPGQFSLYDNEHNLLLGGTINRIVEGNGV
A0A3M3G2W8      TQYAWGGEKIEVFQLEVPEHLLGEKLTLIAGKPGQFSLYDNEHNLLLGGTINRIVEGNGV
A0A3M6C224      TQYAWGGEKIEVFQLEVPEHLLGEKLTLIAGKPGQFSLYDNEHKLLLGGTINRIVEGNGV
A0A0P9SCD7      TQYAWGGEKIEVFQLEVPEHLLGEKLTLIAGKPGQFSLYDNEHNLLLGGTINRIVEGNGV
A0A0P9T4G3      TQYAWGGEKIEVFQLEVPEHLLGEKLTLIAGKPGQFSLYDNEHNLLLGGTINRIVEGNGV
A0A0P9VKB0      TQYAWGGEKIEVFQLEVPEHLLGEKLTLIAGKPGQFSLYDNEHNLLLGGTINRIVEGNGV
A0A0Q0BM35      TQYAWGGEKIEVFQLEVPEHLLGEKLTLIAGKPGQFSLYDNEHNLLLGGTINRIVEGNGV
A0A3M3TPR7      TQYAWGGEKIEVFQLEVPEHLLGEKLTLIAGKPGQFSLYDNEHNLLLGGTINRIVEGNGV
A0A3M3U4Q3      TQYAWGGEKIEVFQLEVPEHLLGEKLTLIAGKPGQLSLYDNEHNLLLGGTINRIVEGNGV
A0A8B3FSE5      TQYAWGGEKIEVFQLEVPEHLLGEKLTLIAGKLGQFSLYDNEHNLLLGGTINRIVEGNGV
A0A3M5K254      TQYAWGGEKIEVFQLEVPEHLLGEKLTLIAGKPGQFSLYDNEHNLLLGGTINRIVEGNGV
A0A7V8M007      TQYAWGGEKIEVFQLEVPEHLLGEKLTLIAGKPGQFSLYDNEHNLLLGGTINRIVEGNGV
A0A3M5JFB0      TQYAWGGEKIEVFQLEVPEHLLGEKLTLIAGKPGQFSLYDNEHNLLLGGTINRIVEGNGV
A0A3M3TQV3      TQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVEGNGV
A0A3M4A376      TQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVEGNGV
A0A3M3EF92      TQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVEGNGV
A0A3M5J1E2      TQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVEGNGV
A0A3M5M873      TQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVEGNGV
A0A3M5G7H9      TQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVEGNGV
A0A0Q0A5T8      TQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVEGNGV
A0A0P9QCJ2      TQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVEGNGV
A0A0P9UCX7      TQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVEGNGI
A0A0P9Q329      TQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVEGNGI
A0A3M5GJ64      TQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVEGNGI
A0A0P9S1F1      TQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVEGNGI
A0A3M2XYQ3      TQYAWGGEKIEVFQLEVPENLLGEKLTLTAGKPGQFSLYDSEHNLLLGGAINRVVEGHGI
A0A0P9XCE1      TQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDSEHNLLLGGAINRVVEGHGI
A0A3M3EFX7      TQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDSEHNLLLGGAINRVVEGHGI
A0A3M5B9D9      TQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDSEHNLLLGGAINRVVEGQGI
A0A0P9RRZ3      THYAWGGEKIELFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGAVNRVVEGKGI
A0A3M2VEK7      TQYAWGGEKIEVFQLEVPEHLLGERLTLTAGKPGQFSLYDSEHNLLLGGAINRVVEGHGI
A0A0N8R9B3      TQYAWGGEKIEVFQLEVPEHLLGERLTLTAGKPGQFSLYDSEHTLLLGGAINRVVEGHGI
A0A0P9VA27      TQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDSEHTLLLGGAINRVVEGHGI
A0A3M4YBJ4      TQYAWGGEKIEVFQLEVPEHLLGEKLTLTSGKPGQFSLYDSEHNLLLGGALNRVVEGHGI
A0A0P9J470      TQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDSEHTLLLGGAINRVVEGHGI
A0A0Q0EVJ8      TQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDSEHTLLLGGAINRVVEGHGI
A0A3M5UI30      TQYAWGGENIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVEGNGV
A0A3M5YQT8      TQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVEGNGV
A0A3M5F5X1      TQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVEGNGV
A0A3M5R8G1      TQYAWGGEKIEVFQLEVPEHLLGEKLTLIAGKPGQLSLYDNEHNLLLGGTINRIVEGNGV
A0A3M5V012      TQYAWGGEKIEVFQLEVPEHLLGEKLTLIAGKPGQLSLYDNEHNLLLGGTINRIVEGNGV
A0A3M3GA16      TQYAWGGEKIEVFQLEVPEHLLGEKLTLIAGKPGQFSLYDNEHNLLLGGTINRIVEGNGV
A0A3M3CJL0      TQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDSEHNLLLGGAINRVVEGHGI
A0A3M3F6F5      TQYAWGGEKIEVFQLEVPEHLLGERLTLTAGKPGQFSLYDSEHNLLLGGAINRVVEGHGI
A0A3M3P9B7      TQYAWGGEKIEVFQLEVPEHLLGERLTLTAGKPGQFSLYDSEHNLLLGGAINRVVEGHGI
A0A0N8QB74      TQYAWGGEKIEVFQLEVPEHLLGERLTLTAGKPGQFSLYDSEHNLLLGGAINRVVEGHGI
A0A0Q0AUD0      TQYAWGGEKIEVFQLEVPEHLLGERLTLTAGKPGQFSLYDSEHNLLLGGAINRVVEGHGI
A0A3M5VR55      TQYAWGGEKIEVFQLEVPEHLLGERLTLTAGKPGQFSLYDSEHNLLLGGAINRVVEGHGI
A0A0Q0FK97      TQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDSEHNLLLGGALNRVVEGHGI
A0A3M3UCT3      TQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDSEHNLLLGGALNRVVEGHGI
A0A7Z6Y5I3      TQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDSEHNLLLGGALNRVVEGHGI
A0A3M5KZ75      TQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDSEHTLLLGGAINRVVEGHGI
A0A3M5L3G5      TQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDSEHTLLLGGAINRVVEGHGI
A0A7Y2TRV5      ------------------------------------------------------------
A0A318DSU0      ------------------------------------------------------------
A0A538PF21      ------------------------------------------------------------
A0A1W1ZH10      ------------------------------------------------------------
A0A1W2FF24      ------------------------------------------------------------
A0A524JYQ6      ------------------------------------------------------------
A0A4Q3MA17      ------------------------------------------------------------
A0A0N0M5F7      ------------------------------------------------------------
A0A537M754      ------------------------------------------------------------
A0A1V1PDB4      ------------------------------------------------------------
A0A2M7C324      ------------------------------------------------------------
A0A4Q3HHG6      ------------------------------------------------------------
A0A3B7DTA4      ------------------------------------------------------------
A0A432ZK62      ------------------------------------------------------------
A0A1V5EEP4      ------------------------------------------------------------
A0A1V5EF48      ------------------------------------------------------------
A0A0S6X1X6      ------------------------------------------------------------
A0A537Y5L8      ------------------------------------------------------------
A0A4Q3L2X2      ------------------------------------------------------------
A0A4Q3T8J1      ------------------------------------------------------------
A0A4Q4ANM4      ------------------------------------------------------------
A0A4Q3UEC7      ------------------------------------------------------------
A0A1H5YYQ4      ------------------------------------------------------------
A0A1X4NLK2      ------------------------------------------------------------
A0A1X4NWB5      ------------------------------------------------------------
A0A1M5UQ38      ------------------------------------------------------------
A0A327YI48      ------------------------------------------------------------
A0A1B1PNL6      ------------------------------------------------------------
A0A2U8H9H9      ------------------------------------------------------------
A0A845UXY6      ------------------------------------------------------------
A0A1X6YIC0      ------------------------------------------------------------
A0A1I5E9E9      ------------------------------------------------------------
A0A1X6Z7N7      ------------------------------------------------------------
A0A2E1DQ13      ------------------------------------------------------------
A0A1H8C800      ------------------------------------------------------------
A0A2N3EZ05      ------------------------------------------------------------
A0A844ZIR7      ------------------------------------------------------------
A0A850H7C5      ------------------------------------------------------------
A0A845AYQ8      ------------------------------------------------------------
A0A0W1DLQ3      ------------------------------------------------------------
A0A246JVD8      ------------------------------------------------------------
A0A2N3BB54      ------------------------------------------------------------
A0A1H6G7A3      ------------------------------------------------------------
A0A0A7PGL6      ------------------------------------------------------------
A0A4Q2Z4L0      ------------------------------------------------------------
A0A7W0BRL7      ------------------------------------------------------------
A0A0W1GMS6      ------------------------------------------------------------
A0A0Q8RMY3      ------------------------------------------------------------
A0A1A7QC21      ------------------------------------------------------------
A0A832FJD1      ------------------------------------------------------------
A0A7C0U459      ------------------------------------------------------------
A0A7W0ITF0      ------------------------------------------------------------
A0A832C120      ------------------------------------------------------------
A0A318CT66      ------------------------------------------------------------
A0A3N5P205      ------------------------------------------------------------
A0A2G9XLE5      ------------------------------------------------------------
A0A6L3MM74      ------------------------------------------------------------
A0A7X8CDM1      ------------------------------------------------------------
A0A7C3QM04      ------------------------------------------------------------
A0A7I8MVM0      ------------------------------------------------------------
A0A7C0Y3J7      ------------------------------------------------------------
A0A7C3LF61      ------------------------------------------------------------
A0A4R1HDF2      ------------------------------------------------------------
A0A6N1DL48      ------------------------------------------------------------
A0A534HBS8      ------------------------------------------------------------
E1Y9C0          ------------------------------------------------------------
A0A1N6SH58      ------------------------------------------------------------
A0A4Q3AQN2      ------------------------------------------------------------
                                                                            

A0A1M6N1X5      ------------------------------------------------------------
A0A561M3U0      ------------------------------------------------------------
A0A2T4ZJZ6      ------------------------------------------------------------
A0A1T2KYM8      ------------------------------------------------------------
A0A2G9ZR82      ------------------------------------------------------------
A0A6J4YZ98      ------------------------------------------------------------
A0A844XH11      ------------------------------------------------------------
A0A0P1H2H0      ------------------------------------------------------------
A0A377N8F8      ------------------------------------------------------------
A0A4Q3LR91      ------------------------------------------------------------
A0A6C9IKN8      ------------------------------------------------------------
A0A4V1TR68      ------------------------------------------------------------
A0A6L3ZR06      ------------------------------------------------------------
A0A3E0WKI3      ------------------------------------------------------------
A0A1H3I2J1      ------------------------------------------------------------
A0A521LJG5      ------------------------------------------------------------
A0A1V4WHZ7      ------------------------------------------------------------
A0A1E5AJN5      SIRTRRLARRVVYELNLTEKPNFYIQPVRFSLVGILKRAITGRAEQPFIPRTYDERERAA
A0A2N3D2J1      ------------------------------------------------------------
A0A2N2GVE1      ETSEDFWYEQRYLATQIEVIKSRNIALLAARRLENVDLHQLLGQPQFAHREPTEEELQRA
A0A2N2INV3      ETSEDFWYEQRYLATQIEVIKSRNIALLAARRLENAELHQLLGQPQFAHREPTEEELQRA
A0A233IKJ2      ------------------------------------------------------------
A0A1Y5DXG5      ----------------------GKVGEEVTNGTFTLTIKELVARAGTEFFVTRKDRLNTI
A0A0B8P2H5      -------------------------MARSENGEFLLFVSQLVGKQGQEYGLGKRSKLDAI
A0A380AQW6      ------------------------------------------------------------
A0A2G2GD62      NIDYFTRLLFGKQKVYIEYKGIHKFGEDVISKYFQLKVIKVRELNSLEYFFSYIDNRNMV
A0A524P331      GSVRMGMPTFVVKNADGSIAAQGKTGQRVRTQDLTLLLDEIQGKKGDLFRLQQQSFIGTV
A0A4V1SSM5      ------------------------------------------------------------
A0A4Q3K8G7      ------------------------------------------------------------
A0A7C7W7M2      NKLNRRVVQKLSLHEAGKLTPASFDAGIANSLKRWFAGLTETRVPITEPDAERISSTADE
A0A1M7HC79      ------------------------------------------------------------
A0A1D3JZN6      ------------------------------------------------------------
A0A1V6ESG1      ------------------------------------------------------------
A0A850NXS7      ------------------------------------------------------------
A0A1H7YHK3      ------------------------------------------------------------
A0A3S1MCW7      ------------------------------------------------------------
A0A528AX40      KLKSRALAQRVVFQLGLSEKPDFLFPTSGFSLSNVFYRAFGISKSPSIEEKTPEEREAIA
A0A528MV95      KLKSRALAQRVVFQLGLSEKPDFLFPTPNFSLSNIFYRAFGISKSPSIEEKTPEQREAIA
A0A838IR38      IDPGGRWQFEQFWNTQREVLRSKWFAERVVKREGLIDDPRFMPAPPEGVTRSPEDTMRIA
A0A328C2K5      VDPGGRWQFEQFWNTQKEVLGSKWFARRVVEREGLLDAPGFLPASAQQL--DEDERMKRA
A0A5C6X8M3      VDPGGRWQFEQFWNTQKEVLGSKWFAQRVIEREGLLDAPGFLPPSVQQL--DEDERMKRA
A0A3D8MRR7      VDPGGRWQFEQFWNTQKEVLGSKWFAQRVIEREGLLDAPGFLSPSVQQL--DEDERMKRA
A0A5C6UBJ7      VDPGGRWQFEQFWNTQKEVLGSKWFAQRVIEREGLLDAPGFLSPSVQQL--DEDERMKRA
A0A5C6XGM3      VDPGGRWQFEQFWNTQKEVLGSKWFAQRVIEREGLLDAPGFLPPSVQQL--DEDERMKRA
A0A849WSS0      VDKYLRYLNSEDFFRVVAERIEKSGALPLAEEEIRGPDTPWNLLRGLLSKKPVITSHERV
A0A7Y3GUU1      ------------------------------------------------------------
A0A090R136      ------------------------------------------------------------
A0A661JU93      ------------------------------------------------------------
A0A0M3GBT1      RLLSRSIAERVVRELQLNLRPEFNPALREVTFFESIRTNLRGLFDPRKPAEPVRDGIDAV
B3Q577          RLLSRSIAERVVRELQLNLRPEFNPALREVTFFESIRTNLRGLFDPRKPAEPVRDGIDAV
A0A3R9C3P5      RLLSRGITERVVRELRLNELQEFNPALRKISFIDRIRATLRGLFDAKKPTLPAGDGIEAT
A0A7W6FJX0      RLLSRGISERVVRELRLNELQEFNPALRKISFIDRIRATLRSLFDTKKPTLPAGDGIEAT
A0A2E2T3V8      RMEMIIGNETLSTVMSVLRGQGVSFSQEANVQGNFLRRIFGNDQGFIASDAKVSDEIDKD
A0A367UAB4      RMEMIVGNETLSTVMSILRGQGIIFSQEANARGNFLRRIFGNDQGFIASDAKVSDEIDKD
A0A1F2ZW35      PPGVLDSALDPIRELWSSGISSLLAPAPPPAPAQAPKPATSPSPRADRSADASDPRRQAA
A0A377V641      ------------------------------------------------------------
A0A1F2YJ88      ---------------VILTGKTNQANTLRTADGLWNISIYTQDQLNDVYLIQKQSLPSAV
A0A5N8AL61      GSQRPLTTDSPSVDTEVQVILSPNTAMAVVENLKLQDRPGFGFPEGTTPAKSLEDRKQRA
A0A0J7XGZ1      PTLTLDVVRSLRLDRVPEFGGDSKSPSAKLTPPLATGTDGHGSTGDREQIATINPAERQA
I4CBA7          SSAILRVELGGPSQRGLQGALEFFAEFSIFYETQVQSLKEMAQSGSLSTPDRRGLEDAAK
A3VE95          DEVVSNLSLSDPVIQSEVSVMTSNILIERLILEVGIERLETLYWGEVRGDRDEASRLADL
A0A1G0NL95      ------------------------------------------------------------
A0A024KA69      PVSYSATALLYFDPSPRGVLEDGRPGAGDGARVDSAVDLIASEPVLASAARALGLAGERA
A0A0L1KFN4      TQYGLLRARSLAERVAAELGLVDRPEFFEMFRFDGADDPAFEIVNGRYPAEGRAQRQREA
A0A3D5UYX7      ------------------------------------------------------------
A0A524QFS4      RRPRISGQQEAVIDDARYLSSSADQLNTQIMKLQGAGLRNLVLNKAKGTLALHGVTGDDA
A0A832MZU0      -------EINNEFFILRVIRNEGKNPFEGSIESRLYGAIDNGLDDFDSRAYIFKVYDRNT
A0A520JSW4      EGSKGGRQNAARSDINFIGTQLGLLGSRALAERVAQNLNLAADTAIVGPGGDRSLNTASA
A0A4Q3LTF3      ------------------------------------------------------------
A0A840SQK7      LARPIAVRMVQEFHLDRLEEFNPSLKPVPAFTAWVDGAKRWLKGEAEPVAPSQADIMEEV
A0A7C3N3Y1      GFFRSLGSDLWNFLSGLPGSLSSSKKDSDKEPLKTDLSNRRDLTKERLEMAPETARDTLL
A0A537UTP9      ALAVIKDLHLTKDPQFLWPKLGLFSAIKGSVLGLVDSVLRLFQSSSTSTSDPEFALTRAA
A0A1D2RNR5      ------------------------------------------------------------
A0A4V1TQ46      ------------------------------------------------------------
A0A3A0FZC0      -----------MLEQPEIKSALFDTANQGFFGQLFGGDSESKQESDKLDQLAGYKSTVRQ
A0A1N7JVZ7      -----------------------------------------------MTAERVFRRKNRP
A0A091C4A8      ----------------------MTAPAPWKLLLGLAGETDDEELDAAHLAATESVRQTLR
A0A844YBH7      EPIRTTGPNSDPNIVGVDEVDTEIALISSPLVAKRAAELYADRFASPDGDPFTADEIEAI
A0A4R3H6P6      DQEFYQTQYGLLRTQVLAERVARDLGVVDDPAFFKLFGRRDLFQDGKADPTARAKRNEVA
A0A3S1NQ09      --------------------------YVRPSSSMPGGADFSKLDPAARDALIATSRRDYA
A0A443GJ52      -----------------------VIRYFRPNPAV-GTTDVAQLDPATRDAMIASSRRDYA
A0A2W6S588      APPTQTTDAARDAAIESQLQIATSLPVAIRALQDPEVAKNPTILARAKAFDPSGKSSDAM
A0A483E0N4      --------------------INGYVGQLYENDDFSIKVDKMDAKPGSEYNIYYESRLKAI
A0A2J4YQQ6      ------------------------------------------------FTIGYLSRLKAI
A0A483THX4      ------------------------------------------ALPGTKFKISYLPRLKAI
A0A534MVS2      ------------------------------------------------------------
A0A444I5K6      ----HELRIVDEFQLVDNPFMGPKSSLFSVSTLKSFMNFRSWFADDAAVAPDPEMRRRGA
A0A154VE85      LIDDPAFNPALQPSASFAFGAWLRDHVLAPLGVAPSSGSGRASQGSAVIAPPPAVLAERA
A0A3C1S9Y1      -------MPGTEDNMFSNLREWFKEKRQSWKDQMDSLLSSDKNKGNTVPKSDDPSQDSPL
A0A353EH49      GQDAVISLKDVKKYNRYYDQQYVLAREQEFSPYLKINIEYLKARVGTEFTLEKQHVYKSA
A0A1Y1Q9C1      EQLKSRKLAAQVIDGLDLKTRLFERPAPFSVLSSFKVIIKGLIAPLLPAKIETVTEAADY
A0A3M7LJH0      ------------------------------------------------------------
A0A1E4JHX8      ---------------------------------------------MRNTPAGREKRSREA
M2U8P2          SERRAEITDAASVETAVQALRAPEIATAVARTVGPERILRAYMDPDQPIPTERQAATRRA
A0A1H7KZF8      AGPVQVADIDRQMETTLLMARSVPVAEAVMRALKLSADDTFLRQMHADPAPTPGERRQAV
A0A6N3UC48      ------------------------------------------------------------
A0A257NG76      ------------------------------------------------------------
A0A1T4TW59      SVIDELGLANLPEFNSLVGKPSARDQLLTLLRQIDGLDGFLPKPIAPSTDPNSEVAKRAV
A0A1Q3MB35      ------------------------------------------------MASAAQQRLELA
A0A259LUN7      ------------------------------------------------------------
A0A2D7AVL1      ------------------------------------------------------------
A0A3B9KZE9      ------------------------------------------------------------
A0A358L616      ------------------------------------------------------------
A0A4U9HNE9      -------------------------------------MTTLSAEPGATFSVVKLARQQAI
A0A7X7Z1H8      ---------------------------------------------------------MYT
A0A7C5N053      VGTYWNRQEYYQTQYQIIESQRVARETVARLALHHDQGFLANLPAGAEPAHPRKVDEDGA
A0A2G2CXY6      ILTAQDAGTFTLHDQDGMLLIEGNTLEQIDRDGFKIQVQALVARPGTEFLVTKHRMLNSI
A0A3M1D4H3      ------------------------------------------------------------
A0A7C1A2A2      RVLRDGRTALDGRLGEPAAGPGLRLLLTAAHPGFVPAPGAEYRLRVVRAVHLYRELLKGG
A0A840RX77      GRNGQFGLTENKQDISLTGTVGSLLKAATDNGNIELKVDLLSARPGAQFVLSSSSRLATI
A0A5C8BYM7      ------------------------------------------------------------
A0A7V2RUR3      DDPEFNPLARLPEGQVPLEPRRGVSRLLSFLPRSWLVAWGLEAEPRPMLESEAARFGREA
A0A1J5ICP0      VLKFDGPDSYKIIEDKSGALAGKGELNKPFLGPNFSILVEGDHARKGRKMKFSVLTPASA
A0A379B9V4      EIGEQRDSYTLFLEKTTEPLLTGKVGEKYDTDLIQFSLSQINAKPKQRFLINKLPELTVI
A0A0Q6TS97      ----------------------------------------------------------MA
A0A0Q6UYB4      ----------------------------------------------------------MA
W7Q5J0          SEERYRVMLNEQHIGDGHIGQLHTFLDGEMELLIDEFNAAPGAQFRLAKRNRNGDIRSLG
A0A654AKT6      -------------------MYSKIVSVLFYMFFTCVIFNPQINGATIYFYLFIPFLDPKF
A0A847E0Q2      ------------------------------------------------------------
A0A7W9WQN4      ---------------MLSGRVGTIASSGLNGRAIIAQVDRLVARPGTQFVLRRASTFDTI
A0A0G9MZA5      -------------------------------------------------MPENADIEPAL
H0T8B0          DAAVETEIETTVSEKVIATVVSRLRLDQNPEFECPDRGLFAIFSPSKTSLPPSEARIRCA
A0A7Y4X614      ---------------------------------------------------AGTEVKPEL
A0A5C7N981      TFDQTQYELLKSDALAQRVIEQLSLVAPARTASKSTGWLDIFKSADQKEDNAPAPAATGL
A0A534TV22      ------------------------------------------------------------
A0A351CXR4      ITTKAAQALNLTEKEFNLPAPATPFADLTNDISQMLLGRKLIDTPQNEQPKLAFANTRQA
A0A2N6GLF5      ----MAEDVIAKLELTKHPEFQPEENKLISFDWKTWLKSYLPQQSGGAELDEAETFYDSV
A0A1W9LJP0      --------------------MSKNWFAEPLRFWKEKLLSLRNTGKPEDKDKKDEDADAWL
A0A0W1ICB0      QYSLLNARSLAERVERRLRLARNPEFFAAHGETPEGEGLLSGLRSGPVSAADLRQRERQA
A0A7C1C8G2      ----------------------------------------------MNRKVQENITLDNN
A0A832F8F3      ------------------------------------------------------------
A0A2E0UL88      ------------------------------------------------------------
A0A2N1WQN5      ------------------------------------------------------------
A0A0T2QIS1      ----------------------------------------MDDSSAASSSEDRAGREKLA
A0A376KYN0      ------------------------------------------------------------
A0A377E5P7      ------------------------------------------------------------
A0A2X1JB05      ------------------------------------------------------------
A0A376RML0      ------------------------------------------------------------
A0A6N3QTV2      ------------------------------------------------------------
A0A0P7Y1D0      ----MSELDLAADPEFNSRLREPSGLGAVAGAVAGFLSALLPSQVADSQSGEAEQELEAV
A0A7Y2FUF7      ------------------------------------------------------------
A0A7W6DRI0      ------------------------------------------------------------
A0A542J310      ------------------------------------------------------------
A0A2M7JRZ7      ---------------------------------MTGLFTSSKKNAPSEKEISENKKDTAL
A0A167IR75      ------------------------------------------MTNERYSAEGRAERQREA
A0A3B8T2U6      ----------------------------KKLVKTAIPLFPDPQEVVLTDTEKQQNRLDFA
A0A365PWR2      --------------------------------------------------MTKEPRLAAL
A0A2E9H5Z8      ------------------------------------------------------------
A0A2E2BR79      ----------------------------------------------------------LS
A0A6I4IKZ3      ------------TEEVILTVPLNQANHVAGPHGLWKVAIFTKDQFDATYNIKSQSIPAAV
A0A7H4JZ79      ------------------------------------------------------------
A0A0Q4Q524      ------------------------------------------MVNGRYPAAGRPIRQRTA
A0A0Q4CFJ9      ------------------------------------------MVNGRYPASGRATRQRVA
A0A0Q4FE58      ------------------------------------------MVNGRYPASGREIRQRVA
A0A0Q4JWC8      ------------------------------------------MVNGRYPASGREIRQRVA
A0A0Q4KFL8      ------------------------------------------MVNGRYPASGREIRQRVA
A0A7W8RVL5      LDGGRYRLEQSDLSEPIEGRVGEKLDTKLPDGAITLQVDSLNAKPGTQFILERQSRDKTV
A0A831Y0Z8      ------------------------------------------------------------
A0A522R8R0      ------------------------------------------------------------
A0A2U9NDY5      ----------------------------MEGQGGKGQSAERQAHPGTEGGRRRKRPQTTA
A0A0Q4IGG1      ------------------------------------------MVNGQYKAAGRAERQQLA
A0A352G2C2      ------------------------------------------------------------
A0A7Y3BMU7      ------------------------------------------------------MSKEVA
A0A534RUJ5      ------------------------------------------------------------
V4Q8B7          -----------------------------------MQIAQLDARPGTEFALVRNRPQTTA
A0A3M1CJM3      ------------------------------------------------------------
A0A2R7SVD4      -----------------------------AQDGVEVLVAQLAANPGTRFEVVRNPRIVTI
A0A0Q8XKK5      -----------------------------------------------MTAVERAKREKAA
A0A2E0Q2W0      ------------------------------------------------------------
A0A660NIR6      ---------MRSREVGIRVIKALGLENNPYFNPELTPEGKEQAAEGNVKELSQEALEEQV
A0A142W0R3      NEIAFFNTQYSLLESRSLAARTVRAGNLLNDKDFLAQYDLTGGEEGTPNSAQRARMAERA
A0A0S4XR18      ----MAQNSTKPWEIDGEYKFGQAIKTPYFTFVIKATKDFGLNDTSYKIIHQSNKNSFID
A0A7C5CFF1      ------------------------------------------------------------
A0A7X6WZW5      ATEAGFDLLNRDGHRLAQGETGMPVNFNYGSGTGTLVVAALEGRPGARYTLKRHSRLATI
A0A7X2SVT1      VELEVTGPDSYTVSKDGDELFKGKVGQLESHGDISMLVSEIHADEGTSFTVTKLNNLQAI
A0A2E0GW64      ----------------------------------------------------MLSGQLKV
A0A1A7QJ97      ------------------------------------------MNNGRFPAQGRAQRQRVA
A0A832UVD3      ------------------------------------------------------------
A0A7W5IBY1      AQDGTYQLKNSAGDIVLSGRVGTIASSGLNGRAIIAQVDRLVARPGTQFVLRRASTFDTI
A0A661LW70      ------------------------------------------------------------
W7Q8F9          SEERYRVMLNEQHIGDGHIGQLHTFLDGEMELLIDEFNAAPGAQFRLAKRNRNGDIRSLG
A0A524PXH8      ------------------------------------------------------------
A0A4Q3P0E4      -HYLDILLANKWLIAAITGKVGTPLKTNTPNGPIDLLVSQLDGKPGAEFVVNRFAKLATI
A0A3M2BE89      TLVAQASNHYRLLDEEGEMLLEGQIGRVAEDHGISLYVSELIARPGTRFDLKKTGWLTAV
A0A4Q4A6K6      ------------------------------------------------------------
A0A257G674      ILKSRTLLERVAQKLRLIGNPRFYDAMGMRQPAGDLSRGELED---------------LT
A0A661M5M6      ------------------------------------------------------------
A0A1I1UM01      ------------------------------------------------------------
Q44573          ------MIHSRDVAAAVMAQLPPPAAPPHVGLRDRLCHMGLGFLCHASTPVDPQVQREHE
A2W025          TLTAGPNGTYSLVDENGTRLLAGRVGESAQGGGVTLLVQKLVARPGTQFTVVRYNDLDAI
A0A534Z362      GSRRRGLLSLSGTMLRLLRPRGLETAPAGPSEDGSAGRGSVDP---------------AL
V4J283          ----------------------------------------------------KISLVAAA
A0A536T443      ------------------------------------------------------------
A0A0Q4UFQ5      ---------------------------------------MFESGRPIQTAAARASRIKAA
A0A527W7E6      ------------------------------------IPGIQNVDAATREAMIKTATHDYA
A0A432EMV7      ------------------------------------------------------------
A0A7Y3M8P5      GSAARGFFGDSTNPIESYLFERRSFETQLEVIASEPVAKLAANKLGWIDTDASEDAWRSA
A0A7C1SEU7      ------------------------------------------------------------
A0A7Y1SPC5      ------------------------------------------------------------
A0A7V6YC94      -----------------------MRFFDGLLGGDARSPEARRG---------------RA
A0A534WLI3      ------------------------------------------------------------
A0A7V6CBY2      ------------------------------------------------------------
A0A7C6FBW0      AVIRAKGLVADPEFGGHVGLGKRLARLVGAANAAAEAPDDAIS---------------QT
A0A087LTV7      --------------MHEDAWDLRGLEGAIRRQWRVVALAVAAG---------------LA
A0A7D7WSS2      --------------MHEDAWDLRGLEGAIRRQWRVVALAVAAG---------------LA
A0A318KWA2      EARVGELARFAEGDIELRVAALEAPAEAEFTLVKHRRASAIRD---------------LG
A0A522MT86      ------------------------------------------------------------
A0A4Q3I221      ------------------------------------------------------------
A0A534SAL6      GSGRKGLLNLTGNLVNLLRPRGWDGAPAAGSGAERAVASEVDP---------------ML
A0A534ZDB4      GAERKGLLSLSGNLVNLLRPRGWDGAPAASGGAEHAMPGEVEP---------------VL
A0A534X3M7      RPRRHGLLSLGESMPRPVRPRGFETAPARSSAPEAATRTSIDP---------------AL
A0A534SPC6      ------------------------------------------------------------
A0A535AD60      GPRRRGRLSLSGTTLRLLRPRGLETAPAGPSEDGSAGRGAVDP---------------AL
A0A4Q3SY08      ------------------------------------------------------------
A0A7U1E9W6      -----------MNFSNGSPTKAA-------------------------------------
A0A4Q3LG23      -------------SVAGRLERQRVAGKLLRDNLSISPT----------------------
A0A522EX52      ------------------------------------------------------------
A0A1H3KC95      -------------MNAGPRFRRR-------------------------------------
A0A5P8Z4P3      SRDVQMSGSGETSGAEKPKVFRRHKRAETKRNAEAPDKSPAQA-----------------
A0A2E9HXF7      --------------MDSPKFRRK------RTSATAHP-----------------------
A0A0B3RZC9      -----------MNMMDSPKFRRK------RTSATGSAR----------------------
A0A6F8QET1      TRGPKGCGARGMNMMDSPKFRRK------RTSATGSAR----------------------
A0A520HUH4      ------------------------------------------------------------
A0A2K8U7M6      -MTPLGNSRLVSVAFDSPN-----------------------------------------
A0A5B9DKL8      -MQEDAWGFDSFEGLIRRQWRMIALIWVGIVAAAALALTLMPA---------------SF
A0A238KJM1      -------------MMDDRKFRRK-------------------------------------
A0A3A0FJZ4      -----------MSDAPAPGFDLRDAVLCLRRRAGWLALALALG---------------VA
W4HJV8          -----------MNMANRPKFRRR------HRPAATGWDDGARV---------------PA
A0A0P1GDI0      -------------MTERRKFRRK------NRSADAVEDEMPPI-----------------
A0A2R8ATV5      -------------MSERRKFTRK------KTQGAASSAALAPE---------------SR
A0A1U7D3R6      ------------------------------------------------------------
A0A2D4UVV2      -------------MVERRKFQRK------KRPTAETDAP---------------------
A0A0W7WHP4      -------------MTDQRKFRRK------GKRVR--------------------------
A0A238J8F6      -----------MNEMDNRKFRRK------YKSVDATAEQAAEE---------------VL
A0A238JQI6      -----------MNMMDGPKFRRK------HRSAAGKPRPAPES---------------V-
A0A222E077      -----------MNMMDSPKFRRK------RTSATAHP-----------------------
A0A239E3Y2      -----------MNMMDSPKFKRK------RTSATAPH-----------------------
A0A1F9CFF0      ------------------------------------------------------------
A0A2M8B0G5      ------------------------------------------------------------
A0A363TNU9      ------------------------------------------------------------
A0A445MZQ4      ------------------------------------------------------------
A0A0M9E0E3      ------------------------------------------------------------
A0A351Z9A2      ------------------------------------------------------------
A0A6G6X2Z4      ------------------------------------------------------------
A0A0C5VQ86      ------------------------------------------------------------
A0A3S1WTQ1      ------------------------------------------------------------
A0A354EF47      ------------------------------------------------------------
A0A536T0W8      ------------------------------------------------------------
A0A2G6MSP7      ------------------------------------------------------------
A0A3N5FRH4      ------------------------------------------------------------
A0A1V4Y2C3      ------------------------------------------------------------
A0A2N2KTJ4      ------------------------------------------------------------
A0A2N2LQX0      ------------------------------------------------------------
A0A4U8YMP3      ------------------------------------------------------------
A0A1Q8QQ99      ------------------------------------------------------------
A0A7C2SIB2      ------------------------------------------------------------
A0A3D5ZY44      ------------------------------------------------------------
A0A1G5C236      ------------------------------------------------------------
A0A432HIS7      ------------------------------------------------------------
A0A401FQP5      ------------------------------------------------------------
A0A7C3Q9R6      ------------------------------------------------------------
A0A7C2AA26      ------------------------------------------------------------
A0A351Z4H9      ------------------------------------------------------------
A0A2N2KML4      ------------------------------------------------------------
E1YJF1          ------------------------------------------------------------
A0A1Q6DMW3      ------------------------------------------------------------
A0A3A6P8F8      ------------------------------------------------------------
A0A1J5EVZ6      ------------------------------------------------------------
A0A2G2DSM4      ------------------------------------------------------------
A0A1F9NI02      ------------------------------------------------------------
A0A4U1ABX4      ------------------------------------------------------------
A0A6L4AM84      ------------------------------------------------------------
A0A840UW68      ------------------------------------------------------------
A0A2G6FCC5      ------------------------------------------------------------
A0A1F9MR25      ------------------------------------------------------------
A0A2G6M7F1      ------------------------------------------------------------
A0A5Q2QDL1      ------------------------------------------------------------
A0A4Z0M4C7      ------------------------------------------------------------
A0A1V8MBH1      ------------------------------------------------------------
A0A7V9E085      ------------------------------------------------------------
A0A6J4X8D4      ------------------------------------------------------------
A0A1E7HSL6      ------------------------------------------------------------
A0A2M7JX59      ------------------------------------------------------------
A0A7V4PLT3      ------------------------------------------------------------
A0A7X7Y8R3      ------------------------------------------------------------
A0A832A361      ------------------------------------------------------------
A0A1M5GH86      ------------------------------------------------------------
A0A1W1XQZ5      ------------------------------------------------------------
A0A3D6C3I2      ------------------------------------------------------------
S0G1D4          ------------------------------------------------------------
A0A661T246      ------------------------------------------------------------
A0A850T4Q7      ------------------------------------------------------------
A0A2G6CSG7      ------------------------------------------------------------
A0A2G6NB59      ------------------------------------------------------------
A0A5K8A7T9      ------------------------------------------------------------
A0A1W9U045      ------------------------------------------------------------
A0A1F9L9G4      ------------------------------------------------------------
A0A328FD76      ------------------------------------------------------------
A0A348UX90      ------------------------------------------------------------
A0A357Z0N5      ------------------------------------------------------------
A0A0F2R2U0      ------------------------------------------------------------
A0A5K7ZK00      ------------------------------------------------------------
A0A5K7YCX8      ------------------------------------------------------------
A0A5K7Z388      ------------------------------------------------------------
A0A520CSP5      ------------------------------------------------------------
A0A1E7HFN0      ------------------------------------------------------------
A0A7J0BHG1      ------------------------------------------------------------
A0A6V8LMJ3      ------------------------------------------------------------
A0A2K8WHP8      ------------------------------------------------------------
A0A1J5N774      ------------------------------------------------------------
A0A2C8F781      ------------------------------------------------------------
A0A2E3R6G0      ------------------------------------------------------------
A0A7J0BUD3      ------------------------------------------------------------
A0A3M8EMP2      ------------------------------------------------------------
A0A2J6J6K6      ------------------------------------------------------------
A0A1F8XMK2      ------------------------------------------------------------
A0A661PSB9      ------------------------------------------------------------
A0A661QBT6      ------------------------------------------------------------
A0A6I2SLK2      ------------------------------------------------------------
A0A7Y7NC38      ------------------------------------------------------------
A0A0A8WSG4      ------------------------------------------------------------
S7TK97          ------------------------------------------------------------
S7UE93          ------------------------------------------------------------
A0A3D5BR56      ------------------------------------------------------------
A0A1I3PSR2      ------------------------------------------------------------
A0A2N2IB15      ------------------------------------------------------------
A0A7C8B5M6      ------------------------------------------------------------
A0A7V4UW39      ------------------------------------------------------------
A0A1W7QPT7      ------------------------------------------------------------
A0A6S6M1Y8      ------------------------------------------------------------
A0A6V8MCR2      ------------------------------------------------------------
A0A6V8N3X1      ------------------------------------------------------------
A0A6M4XJ81      ------------------------------------------------------------
A0A0M4D373      ------------------------------------------------------------
A0A1L3GKM9      ------------------------------------------------------------
A0A2T5R3J5      ------------------------------------------------------------
A0A1G6EKK9      ------------------------------------------------------------
A0A7C1DJX8      ------------------------------------------------------------
A0A3A4XVN3      ------------------------------------------------------------
A0A1E7JEV6      ------------------------------------------------------------
A0A2N2KDY5      ------------------------------------------------------------
A0A3N5YUD9      ------------------------------------------------------------
A0A4Q3ZDI7      ------------------------------------------------------------
A0A537PRC6      ------------------------------------------------------------
A0A7Y8L8B9      ------------------------------------------------------------
A0A5C4N0H6      ------------------------------------------------------------
A0A7V4UXV1      ------------------------------------------------------------
A0A7C3Y7G3      ------------------------------------------------------------
A0A7V5R3L0      ------------------------------------------------------------
A0A7V2SYN1      ------------------------------------------------------------
A0A6H9HII8      ------------------------------------------------------------
A0A7S6SHD5      ------------------------------------------------------------
A0A7C1UTU6      ------------------------------------------------------------
W9VVY5          ------------------------------------------------------------
A0A1E2URD3      ------------------------------------------------------------
A0A2T6MY81      ------------------------------------------------------------
A0A7Z0VN76      ------------------------------------------------------------
A0A2T6NBQ8      ------------------------------------------------------------
A0A421K431      ------------------------------------------------------------
A0A7C3Z8T7      ------------------------------------------------------------
A0A1V4QMH7      ------------------------------------------------------------
A0A496XZQ4      ------------------------------------------------------------
A0A7C3UZM2      ------------------------------------------------------------
A0A1F9BJF7      ------------------------------------------------------------
F2NDF5          ------------------------------------------------------------
A0A7Y4XWU8      ------------------------------------------------------------
A0A4V2SPR5      ------------------------------------------------------------
A0A7W8W7P8      ------------------------------------------------------------
A0A7W8WPN5      ------------------------------------------------------------
A0A519ERR1      ------------------------------------------------------------
A0A4Q3Q1M2      ------------------------------------------------------------
A0A4Q3MHR1      ------------------------------------------------------------
A0A520GDZ4      ------------------------------------------------------------
A0A372IH36      ------------------------------------------------------------
A0A540VW45      ------------------------------------------------------------
A0A1H9C241      ------------------------------------------------------------
A0A2E3FCR1      ------------------------------------------------------------
A0A4S3MG69      ------------------------------------------------------------
A0A3E0H727      ------------------------------------------------------------
A0A7X8XJJ0      ------------------------------------------------------------
A0A1I3TTC3      ------------------------------------------------------------
A0A1H3IZW6      ------------------------------------------------------------
A0A0M6YG59      ------------------------------------------------------------
A0A1H7G8B0      ------------------------------------------------------------
A0A2G2I5M1      ------------------------------------------------------------
A0A2G2M6F0      ------------------------------------------------------------
A0A352B502      ------------------------------------------------------------
A0A430DNP0      ------------------------------------------------------------
A0A410V446      ------------------------------------------------------------
A0A1B1UCM8      ------------------------------------------------------------
A0A1N6JQ20      ------------------------------------------------------------
A0A0R3KGJ5      ------------------------------------------------------------
A0A0R3N604      ------------------------------------------------------------
A0A1M5TI07      ------------------------------------------------------------
A3X191          ------------------------------------------------------------
A0A160UA87      ------------------------------------------------------------
A0A1Q5SFV5      ------------------------------------------------------------
A0A1H4RKV5      ------------------------------------------------------------
A0A7Z2Q199      ------------------------------------------------------------
A0A3A0FQ32      ------------------------------------------------------------
A0A7Y3GV54      ------------------------------------------------------------
A0A3E0WXH2      ------------------------------------------------------------
A0A1A9KEF8      ------------------------------------------------------------
A0A5E6PKN5      ------------------------------------------------------------
A0A0N9W1V6      ------------------------------------------------------------
A0A423GQ41      ------------------------------------------------------------
A0A423H7J2      ------------------------------------------------------------
A0A502HNM8      ------------------------------------------------------------
A0A4Q7H223      ------------------------------------------------------------
A0A1H4N2K9      ------------------------------------------------------------
A0A2K4KWF7      ------------------------------------------------------------
A0A1E4UZA0      ------------------------------------------------------------
A0A1H9KL56      ------------------------------------------------------------
A0A7X0BTK5      ------------------------------------------------------------
A0A2N2TRC8      ------------------------------------------------------------
A0A1V4CIZ7      ------------------------------------------------------------
A0A1M3BXA5      ------------------------------------------------------------
A0A1Y2R3U6      ------------------------------------------------------------
A0A167HVD6      ------------------------------------------------------------
A0A1V3SCT6      ------------------------------------------------------------
L0H287          ------------------------------------------------------------
A0A495VG93      ------------------------------------------------------------
A0A4R3MYM4      ------------------------------------------------------------
G2E3C0          ------------------------------------------------------------
A0A1W9J9F8      ------------------------------------------------------------
A0A2S5LFJ9      ------------------------------------------------------------
A0A2D8R8F8      ------------------------------------------------------------
A0A1G0KSD0      ------------------------------------------------------------
A0A4P6WX84      ------------------------------------------------------------
A0A1D2S760      ------------------------------------------------------------
A0A5B8RW94      ------------------------------------------------------------
A0A6I4JXQ8      ------------------------------------------------------------
A0A010SNS0      ------------------------------------------------------------
A0A0C2I782      ------------------------------------------------------------
A0A2N8BYF5      ------------------------------------------------------------
A0A558FKX2      ------------------------------------------------------------
A0A1H1DBA0      ------------------------------------------------------------
J3H699          ------------------------------------------------------------
A0A0K1QRZ4      ------------------------------------------------------------
A0A560RJW9      ------------------------------------------------------------
A0A5E7CRU7      ------------------------------------------------------------
A0A1H5J974      ------------------------------------------------------------
A0A5E7C564      ------------------------------------------------------------
A0A2W7MAV4      ------------------------------------------------------------
W6VFG3          ------------------------------------------------------------
A0A1P8ENT1      ------------------------------------------------------------
A0A2N7XRV4      ------------------------------------------------------------
A0A0Q6QPG8      ------------------------------------------------------------
A0A0F4SWA7      ------------------------------------------------------------
A0A423J219      ------------------------------------------------------------
A0A4P6G9U8      ------------------------------------------------------------
A0A4Y8JE06      ------------------------------------------------------------
A0A502I1X9      ------------------------------------------------------------
A0A502J776      ------------------------------------------------------------
A0A5B0EZF6      ------------------------------------------------------------
A0A059L434      ------------------------------------------------------------
A0A0F4UWN2      ------------------------------------------------------------
A0A5E7WEF5      ------------------------------------------------------------
A0A258TN88      ------------------------------------------------------------
A0A7Y8MN30      ------------------------------------------------------------
A0A3N5J7U8      ------------------------------------------------------------
A0A1S7S3I8      ------------------------------------------------------------
A0A655ZZQ1      ------------------------------------------------------------
A0A1S0ZAI3      ------------------------------------------------------------
A0A3C0L0A8      ------------------------------------------------------------
A0A176S762      ------------------------------------------------------------
A0A1W9WUD9      ------------------------------------------------------------
A0A1W1ZQK0      ------------------------------------------------------------
A0A7X1GRP5      ------------------------------------------------------------
A0A6I1R304      ------------------------------------------------------------
A0A1W9PMU6      ------------------------------------------------------------
A0A7Y4X3V7      ------------------------------------------------------------
A0A1G3VVY5      ------------------------------------------------------------
A0A7C3S273      ------------------------------------------------------------
A0A7C4WJ18      ------------------------------------------------------------
A0A351B422      ------------------------------------------------------------
F2NEE9          ------------------------------------------------------------
A0A7C3V565      ------------------------------------------------------------
A0A7V6A3E1      ------------------------------------------------------------
A0A318D3U4      ------------------------------------------------------------
A0A7V0JSN8      ------------------------------------------------------------
A0A7V5V784      ------------------------------------------------------------
A0A352Q5C1      ------------------------------------------------------------
A0A355TB56      ------------------------------------------------------------
A0A1F9E324      ------------------------------------------------------------
A0A435NNF5      ------------------------------------------------------------
A0A3S2AQS7      ------------------------------------------------------------
A0A527ZPD6      ------------------------------------------------------------
A0A529KRW3      ------------------------------------------------------------
A0A530ZLX0      ------------------------------------------------------------
A0A4Q3LBH4      ------------------------------------------------------------
A0A4Q3LWP3      ------------------------------------------------------------
A0A7C3JPP4      ------------------------------------------------------------
A0A534V9L7      ------------------------------------------------------------
A0A7C3JJT4      ------------------------------------------------------------
A0A524M660      ------------------------------------------------------------
A0A7C3JSX5      ------------------------------------------------------------
A0A7I8MQ67      ------------------------------------------------------------
A0A0C1TRU6      ------------------------------------------------------------
A0A2Z5SSF4      ------------------------------------------------------------
A0A7Y7TF97      ------------------------------------------------------------
A0A4Q4CIB1      ------------------------------------------------------------
A0A522ACJ9      ------------------------------------------------------------
A0A3N5Z7F8      ------------------------------------------------------------
A0A239HD34      ------------------------------------------------------------
A0A3D2M6Y9      ------------------------------------------------------------
A0A519E8D7      ------------------------------------------------------------
A0A3S1FD32      ------------------------------------------------------------
A0A434DUT4      ------------------------------------------------------------
A0A528D3U3      ------------------------------------------------------------
A0A3S3UPT3      ------------------------------------------------------------
A0A3S1E286      ------------------------------------------------------------
A0A531AC71      ------------------------------------------------------------
A0A436K268      ------------------------------------------------------------
A0A434IDQ0      ------------------------------------------------------------
A0A435IRM5      ------------------------------------------------------------
A0A3S2C404      ------------------------------------------------------------
A0A435F6C0      ------------------------------------------------------------
A0A435BMN6      ------------------------------------------------------------
A0A529XQ54      ------------------------------------------------------------
A0A530BJC1      ------------------------------------------------------------
A0A0P7ZZE4      ------------------------------------------------------------
A0A369R0Q9      ------------------------------------------------------------
A0A327LYE6      ------------------------------------------------------------
A0A5A9ZTV3      ------------------------------------------------------------
A0A258WKV0      ------------------------------------------------------------
A5G4N9          ------------------------------------------------------------
A0A812HT29      ------------------------------------------------------------
A0A444IY46      ------------------------------------------------------------
A0A6I7N627      ------------------------------------------------------------
A0A1V5DJV0      ------------------------------------------------------------
A0A520IUC4      ------------------------------------------------------------
A0A7Y7M8F4      ------------------------------------------------------------
A0A0P1FWI8      ------------------------------------------------------------
A0A6L8LHC6      ------------------------------------------------------------
A0A848ST88      ------------------------------------------------------------
A0A7U1HWF1      ------------------------------------------------------------
A0A534SH66      ------------------------------------------------------------
A0A3M0ZZ99      ------------------------------------------------------------
A0A238LBD3      ------------------------------------------------------------
A0A537NZJ1      ------------------------------------------------------------
A0A7C4R3C4      ------------------------------------------------------------
A0A0P1FRV5      ------------------------------------------------------------
A0A4Q4CVW6      ------------------------------------------------------------
A0A8B6LS25      ------------------------------------------------------------
A0A6L3ZWI0      ------------------------------------------------------------
A0A1M7BLL7      ------------------------------------------------------------
A0A0H4KZM1      ------------------------------------------------------------
A0A7V2W904      ------------------------------------------------------------
A0A1V1UJT2      ------------------------------------------------------------
A0A0L6CVX1      ------------------------------------------------------------
A0A1V0RR48      ------------------------------------------------------------
A0A0A0HJJ4      ------------------------------------------------------------
A0A5E7YA28      ------------------------------------------------------------
A0A316KRG4      ------------------------------------------------------------
A0A0J5Q9T7      ------------------------------------------------------------
A0A1I5YYQ0      ------------------------------------------------------------
A0A5P9FE62      ------------------------------------------------------------
A0A7U3CQW5      ------------------------------------------------------------
X7F6S5          ------------------------------------------------------------
A0A1G8NKI0      ------------------------------------------------------------
A0A355QPE4      ------------------------------------------------------------
A0A357RN98      ------------------------------------------------------------
A0A1I6U4V1      ------------------------------------------------------------
A0A6B2P8H8      ------------------------------------------------------------
A0A1P8USW9      ------------------------------------------------------------
A0A1G7CFZ2      ------------------------------------------------------------
A0A7G2TPW1      ------------------------------------------------------------
A0A1V6FYJ1      ------------------------------------------------------------
A0A4Q3IRI1      ------------------------------------------------------------
A0A7J5VV32      ------------------------------------------------------------
A0A1E7H876      ------------------------------------------------------------
A0A7C1C6X5      ------------------------------------------------------------
A0A7X1GMT8      ------------------------------------------------------------
Q44570          ------------------------------------------------------------
A0A509L3P8      ------------------------------------------------------------
A0A3A4S038      ------------------------------------------------------------
A0A1F9N669      ------------------------------------------------------------
A0A1F9PFA7      ------------------------------------------------------------
A0A1H2EN09      ------------------------------------------------------------
K0NP00          ------------------------------------------------------------
A0A2N6BZD5      ------------------------------------------------------------
A0A0F2NF69      ------------------------------------------------------------
A0A1F9NFD0      ------------------------------------------------------------
A0A1W9M770      ------------------------------------------------------------
A0A1W9M7R6      ------------------------------------------------------------
A0A7W0IR34      ------------------------------------------------------------
A0A7V5FUI1      ------------------------------------------------------------
A0A7T6AQC8      ------------------------------------------------------------
A0A7U4DQ89      ------------------------------------------------------------
A0A1M5YLH5      ------------------------------------------------------------
A0A4U1A4C7      ------------------------------------------------------------
A0A7C4N0I9      ------------------------------------------------------------
A0A1V4M8I1      ------------------------------------------------------------
A0A7C0XE92      ------------------------------------------------------------
A0A7U4QIX5      ------------------------------------------------------------
A0A800BQ44      ------------------------------------------------------------
A0A1E7JCL5      ------------------------------------------------------------
A0A7Z9XET3      ------------------------------------------------------------
A0A800C5N3      ------------------------------------------------------------
A0A496YAH9      ------------------------------------------------------------
A0A1V4S7E4      ------------------------------------------------------------
A0A847DGI3      ------------------------------------------------------------
A0A2N2H8D2      ------------------------------------------------------------
A0A2N2KC63      ------------------------------------------------------------
A0A3A4ZYW4      ------------------------------------------------------------
A0A800BMM4      ------------------------------------------------------------
A0A1V4MCJ4      ------------------------------------------------------------
A0A661M0W4      ------------------------------------------------------------
A0A3N5RNY4      ------------------------------------------------------------
A0A1M7Y300      ------------------------------------------------------------
A0A4U1ALN4      ------------------------------------------------------------
A0A849F908      ------------------------------------------------------------
A0A2N6BEI9      ------------------------------------------------------------
A0A0D5N3E9      ------------------------------------------------------------
A0A2N2G716      ------------------------------------------------------------
A0A1F9EUS2      ------------------------------------------------------------
A0A3N9VAW3      ------------------------------------------------------------
A0A6I1KNW9      ------------------------------------------------------------
A0A1H4B8T3      ------------------------------------------------------------
A0A1E7IQC3      ------------------------------------------------------------
A0A1M6KEN5      ------------------------------------------------------------
A0A1X0YE57      ------------------------------------------------------------
A0A2K2H9Q8      ------------------------------------------------------------
A0A1F8X5S3      ------------------------------------------------------------
A0A353QLL3      ------------------------------------------------------------
A0A847C207      ------------------------------------------------------------
A0A399I453      ------------------------------------------------------------
A0A651FBV9      ------------------------------------------------------------
A0A562VHD2      ------------------------------------------------------------
A0A7K0J0R7      ------------------------------------------------------------
A0A6I6JNB5      ------------------------------------------------------------
A0A847UFK5      ------------------------------------------------------------
A0A1G0LDK7      ------------------------------------------------------------
A0A6F9WVL7      ------------------------------------------------------------
A0A7Y7TLN9      ------------------------------------------------------------
A0A5C1MDH8      ------------------------------------------------------------
A0A7J4ZSX4      ------------------------------------------------------------
A0A5A9XE04      ------------------------------------------------------------
A0A643G9R1      ------------------------------------------------------------
A0A1G0M8Q7      ------------------------------------------------------------
A0A353MI14      ------------------------------------------------------------
A0A4S1CAW7      ------------------------------------------------------------
A0A655R819      ------------------------------------------------------------
A0A655RNN3      ------------------------------------------------------------
A0A354EI73      ------------------------------------------------------------
A0A6D0ELN7      ------------------------------------------------------------
A0A0B8PTA8      ------------------------------------------------------------
A0A0B8QF75      ------------------------------------------------------------
A0A4U9I390      ------------------------------------------------------------
A0A2X3M011      ------------------------------------------------------------
A0A2H9EHM4      ------------------------------------------------------------
A0A380B3D7      ------------------------------------------------------------
F5NSX0          ------------------------------------------------------------
A0A7A9K1G5      ------------------------------------------------------------
A0A811C967      ------------------------------------------------------------
A0A479JNB1      ------------------------------------------------------------
A0A5C9AF52      ------------------------------------------------------------
A0A6D0EYC7      ------------------------------------------------------------
D8EEU7          ------------------------------------------------------------
A0A0R0BVC7      ------------------------------------------------------------
A0A4U8YLL7      ------------------------------------------------------------
A0A2M7WWF7      ------------------------------------------------------------
A0A534QGR3      ------------------------------------------------------------
A0A0Q6QV61      ------------------------------------------------------------
A0A2Z3IKG4      ------------------------------------------------------------
B7RS54          ------------------------------------------------------------
A0A7R7CAD2      ------------------------------------------------------------
A0A7R7CQL5      ------------------------------------------------------------
A0A1I3XJ27      ------------------------------------------------------------
A0A562CGU2      ------------------------------------------------------------
A0A7C9VCB3      ------------------------------------------------------------
A0A1I7DCG1      ------------------------------------------------------------
A0A3A3H6D9      ------------------------------------------------------------
A0A0Q6VA36      ------------------------------------------------------------
A0A1B2EQN1      ------------------------------------------------------------
A0A1G8QZS5      ------------------------------------------------------------
A0A1H2Y469      ------------------------------------------------------------
A0A497ZQU7      ------------------------------------------------------------
A0A443K010      ------------------------------------------------------------
A0A6I7NYG5      ------------------------------------------------------------
A0A1I0R9R6      ------------------------------------------------------------
A0A2N3BVE7      ------------------------------------------------------------
A0A7C2IB02      ------------------------------------------------------------
A0A6N6SI00      ------------------------------------------------------------
A0A2S5JE21      ------------------------------------------------------------
A0A2R8BKZ2      ------------------------------------------------------------
A0A2S8S361      ------------------------------------------------------------
A0A1X7ACC1      ------------------------------------------------------------
A0A238KUF6      ------------------------------------------------------------
A0A095CTW3      ------------------------------------------------------------
A0A2E3UGD6      ------------------------------------------------------------
A0A840CE00      ------------------------------------------------------------
A0A2T0RFH0      ------------------------------------------------------------
A0A285D390      ------------------------------------------------------------
A0A497VHN4      ------------------------------------------------------------
A0A6M1UAR9      ------------------------------------------------------------
A0A520ZTR8      ------------------------------------------------------------
A0A7Y2NU38      ------------------------------------------------------------
A0A849GJU0      ------------------------------------------------------------
A0A316GHM6      ------------------------------------------------------------
A0A848VYK1      ------------------------------------------------------------
A0A7C9INT8      ------------------------------------------------------------
A0A238IZI1      ------------------------------------------------------------
A0A7Y2U0H6      ------------------------------------------------------------
A0A848WN80      ------------------------------------------------------------
A0A1I6ENM4      ------------------------------------------------------------
A0A2E2P4I0      ------------------------------------------------------------
A0A2U2CM86      ------------------------------------------------------------
A0A212AR83      ------------------------------------------------------------
A0A2M8J3R9      ------------------------------------------------------------
A0A1I6X762      ------------------------------------------------------------
A0A843YIS7      ------------------------------------------------------------
A0A0P1EFX8      ------------------------------------------------------------
A0A2G5KB39      ------------------------------------------------------------
A8LNM8          ------------------------------------------------------------
A0A844B423      ------------------------------------------------------------
A0A0T5NSU3      ------------------------------------------------------------
A0A5P9I718      ------------------------------------------------------------
A0A2N3CNV1      ------------------------------------------------------------
A0A257F1F4      ------------------------------------------------------------
A0A2D5J8T8      ------------------------------------------------------------
A0A2E3P9W6      ------------------------------------------------------------
A0A2G2B1P9      ------------------------------------------------------------
A0A258GCD5      ------------------------------------------------------------
A0A443INY4      ------------------------------------------------------------
A0A2D9YR88      ------------------------------------------------------------
A0A4Q3ZBK4      ------------------------------------------------------------
A0A1G9FY29      ------------------------------------------------------------
A0A6N9RUN2      ------------------------------------------------------------
A0A1W9HS52      EDIQKHRDWIELRGYFRAAIESFANFETGIITIRIRTRHKDTSFNLAHVASEALVDRNFE
A0A2D5LFD8      SPIAESFDLSELQLAGRITITPVGEGRTGQGAGILNVKLK-------------GKDPDND
A0A4D8PLT4      NPTLKAADGADDHWLKRVTKAGVG-ALPPEGNDVLRQIVQQATALFRAEESPNAGDPNQA
A0A1G3JY11      ------------------------------------------------------------
A0A3A4NIE9      ------------------------------------------------------------
A0A3A4NUI9      ------------------------------------------------------------
A0A524I3Z6      ------------------------------------------------------------
A0A524PCL7      ------------------------------------------------------------
A0A356GQV1      ------------------------------------------------------------
A0A1J5DAY8      ------------------------------------------------------------
A0A524P237      ------------------------------------------------------------
A0A4P7EP83      ------------------------------------------------------------
A0A348SRI7      ------------------------------------------------------------
A0A833GQE1      ------------------------------------------------------------
A0A661N3U1      ------------------------------------------------------------
A0A7X1T426      ------------------------------------------------------------
A0A432SAI6      ------------------------------------------------------------
A0A855HUH5      ------------------------------------------------------------
A0A6L6H5T1      ------------------------------------------------------------
A0A7V5C3K7      ------------------------------------------------------------
A0A7Y9AV38      ------------------------------------------------------------
A0A2W5J775      ------------------------------------------------------------
A0A3M3H5V6      ------------------------------------------------------------
A0A7V2YBQ6      ------------------------------------------------------------
A0A7X8Z4Y1      ------------------------------------------------------------
A0A377ZC40      ------------------------------------------------------------
A0A534XP85      ------------------------------------------------------------
A0A377LY04      --------------------------------------------------MKIKIKSAKF
A0A2X3K9R3      ------------------------------------------------------------
A0A484X141      ------------------------------------------------------------
A0A5N9VWI6      ------------------------------------------------------------
A0A5C9ABR5      ------------------------------------------------------------
A0A6D0EJQ0      ------------------------------------------------------------
A0A444R390      ------------------------------------------------------------
A0A376LLF8      ------------------------------------------------------------
A0A6L7CT21      ------------------------------------------------------------
A0A378BPJ7      ------------------------------------------------------------
A0A377ZDN3      ------------------------------------------------------------
A0A2J5PAJ7      ------------------------------------------------------------
A0A7Z9CQS8      ------------------------------------------------------------
A0A2W4RFS2      ------------------------------------------------------------
A0A1Y6DC43      ------------------------------------------------------------
A0A2S6HE06      ------------------------------------------------------------
G3J0M3          ------------------------------------------------------------
V5C6R5          ------------------------------------------------------------
A0A7V0Z1K0      ------------------------------------------------------------
A0A7Y8IFK0      ------------------------------------------------------------
A0A4Q2XLV7      ------------------------------------------------------------
A0A4Q5QYC4      ------------------------------------------------------------
A0A0U2VAW2      ------------------------------------------------------------
A0A454CTF1      ------------------------------------------------------------
A0A6B3Q2G1      ----------NEDTFTISKISKLDAINKLASQLSISERGSQTGIVSLSIEGEYPDHNQLV
A0A6N9S3L5      ------------------------------------------------------------
A0A656BWB0      ------------------------------------------------------------
A0A6D0IFH4      ------------------------------------------------------------
A0A0A0FHV8      ------------------------------------------------------------
A0A2I8SDU4      ------------------------------------------------------------
A0A2I8SU55      ------------------------------------------------------------
A0A7I6T806      ------------------------------------------------------------
A0A7I6TQE9      ------------------------------------------------------------
A0A7I6U296      ------------------------------------------------------------
S1EXJ6          ------------------------------------------------------------
A0A376UBS1      ------------------------------------------------------------
A0A4Q6G931      ------------------------------------------------------------
A0A2T0VBD8      ------------------------------------------------------------
A0A7W5DMU7      ------------------------------------------------------------
A0A378APS2      ------------------------------------------------------------
A0A443VCQ6      ------------------------------------------------------------
A0A447RKQ7      ------------------------------------------------------------
W1DSK1          ------------------------------------------------------------
A0A2N1XK22      ------------------------------------------------------------
A0A850R066      ------------------------------------------------------------
A0A1W9F5M9      ------------------------------------------------------------
A0A352MMI7      ------------------------------------------------------------
A0A4Z0LWV1      ------------------------------------------------------------
A0A376RY66      ------------------------------------------------------------
A0A377K431      ------------------------------------------------------------
A0A6D0I9G1      ------------------------------------------------------------
A0A379W6R2      ------------------------------------------------------------
A0A379TA56      ------------------------------------------------------------
A0A655C5P0      ------------------------------------------------------------
A0A3C2BN18      ------------------------------------------------------------
A0A447LR75      ------------------------------------------------------------
A0A759KJJ5      ------------------------------------------------------------
A0A376D8L7      ------------------------------------------------------------
A0A1V2FV46      ------------------------------------------------------------
A0A6N8QLT3      ------------------------------------------------------------
A0A376SB61      ------------------------------------------------------------
A0A3D1BYV9      ------------------------------------------------------------
A0A3P5DSS6      ------------------------------------------------------------
A0A483YEL5      ------------------------------------------------------------
A0A844PX38      ------------------------------------------------------------
A0A8B4SQI1      -------------------------------------------MLTLSLTGDNPVLIERI
A0A483QWI8      -------------------------MKDLQESFTVTDQGKDTGLLVLSLTGDDPKAFEKI
A0A483UXD3      ---------------------RLKAIKDLQESFTVSDQGKDTGMLVLSLTGDDPKALEKI
A0A0A8J8L3      ---------------------------------------------------DNPILISNI
A0A660DJ38      -------------------------------------------MLGLTLTGTDPNLISKT
A0A378G3G7      ------------------------------------------------------------
A0A2X5NHJ9      ------------------------------------------------------------
A0A2J4QEC3      ------------------------------------------------------------
A0A485ADM3      ------------------------------------------------------------
A0A3D0KAC8      ------------------------------------------------------------
A0A4U9HGU4      ------------------------------------------------------------
A0A3S4JGG5      ------------------------------------------------------------
A0A377ZDH2      ------------------------------------------------------------
A0A3S4HTS8      ------------------------------------------------------------
A0A3N5MZ53      ------------------------------------------------------------
A0A534E4H4      ------------------------------------------------------------
A0A534I2B6      ------------------------------------------------------------
A0A1C2JGD0      ------------------------------------------------------------
A0A259LQ70      ------------------------------------------------------------
A0A3N5PM86      ------------------------------------------------------------
A0A2E5YSA4      ------MGSRSGCRFAREFQS---------------------------------------
A0A0N0XAV4      ------------------------------------------------------------
A0A0P9QD19      ------------------------------------------------------------
F3FHG4          ------------------------------------------------------------
F3GGI0          -------------------------------RLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A0P9LE74      ------------------------------------------------------------
A0A3M4ZQ14      TIQVAALQARPGTDFTVSRQRTFSTALSYQNRLKITEAGRDSGIIYLSIEDPDAQKANRI
A0A3M5YLE8      TIQVAALQARPGTDFTVSRQRTFSTALSYQNRLKITEAGRDSGIIYLSIEDPDAQKANRI
A0A3M3RP89      TIQVAALQARPGTDFTVSRQRTFSTALSYQNRLKITEAGRDSGIIYLSIEDPDAQKANRI
A0A0P9QIY7      TIQVAALQARPGTDFTVSRQRTFSTALSYQNRLKITEAGRDSGIIYLSIEDPDAQKANRI
A0A0P9VVH7      TIQVAALQARPGTDFTVSRQRTFSTALSYQNRLKITEAGRDSGIIYLSIEDPDAQKANRI
A0A0Q0FJK6      TIQVAALQARPGTDFTVSRQRTFSTALSYQNRLKITEAGRDSGIIYLSIEDPDAQKANRI
A0A3M3LF66      TIQVAALQARPGTDFTVSRQRTFSTALSYQNRLKITEAGRDSGIIYLSIEDPDAQKANRI
A0A0P9WIR8      TIQVAALQARPGTDFTVSRQRTFSTALSYQNRLKITEAGRDSGIIYLSIEDPDAQKANRI
A0A3M3KPE5      TIQVAALQARPGTDFTVSRQRTFSTALSYQNRLKITEAGRDSGIIYLSIEDPDAQKANRI
A0A3M4C263      TIQVAALQARPGTDFTVSRQRTFSTALSYQNRLKITEAGRDSGIIYLSIEDPDAQKANRI
A0A3M5AD05      TIQVAALQARPGTDFTVSRQRTFSTALSYQNRLKITEAGRDSGIIYLSIEDPDAQKANRI
A0A0Q0D3D2      KIQVAALRAHPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQEAQRANRI
A0A0N0FS39      ------------------------------------------------------------
A0A3M6GHH2      ------------------------------------------------------------
A0A0P9R9W0      RIQVATLLARPGTNFSLSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQNAQRANRI
A0A0Q0B9T0      RIQVATLLARPGTNFSLSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQNAQRANRI
A0A3M6CFI7      RIQVATLLARPGTNFSLSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQNAQRANRI
A0A0P9JXN0      RIQVATLLARPGTNFSLSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A3M6FIV7      RIQVATLLARPGTNFSLSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A3M3PLW9      KIQVATLQARPGTDFTVSRQRTLSTALIYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A3M4ENY1      KIQVATLQARPGTDFTVSRQRTLSTALIYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A3M5EZK7      KIQVATLQARPGTDFTVSRQRTLSTALIYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A0P9SPP5      KIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A658KL17      KIQVATLRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A3M3NNF2      KIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A7Z6UK49      KIQVAALRAHPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A3M4A0E8      KIQVAALRAHPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A3M4PBZ2      KIQVAALRAHPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A7Z6U7Q8      KIQVATLRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A3M6AI26      KIQVAALRARPGTDFSVSRQHTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A0P9IWP8      KIQVAALRAHPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQEAQRANRI
A0A0P9KZ49      KIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A0P9V840      KIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A0Q0AIE5      KIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A3M2ZQH6      KIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A0N8SQG2      KIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A0W8HFU1      KIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A0P9VHH8      KIQVAALRAHPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQEAQRANRI
A0A0P9YV98      KIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A3M3G2W8      KIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A3M6C224      KIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A0P9SCD7      KIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A0P9T4G3      KIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A0P9VKB0      KIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A0Q0BM35      KIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A3M3TPR7      KIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A3M3U4Q3      KIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A8B3FSE5      KIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A3M5K254      KIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANQI
A0A7V8M007      KIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANQI
A0A3M5JFB0      KIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANQI
A0A3M3TQV3      KIQVAALRAHPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A3M4A376      KIQVAALRAHPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A3M3EF92      KIQVAALRAHPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQNAQRANRI
A0A3M5J1E2      KIQVAALRAHPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQNAQRANRI
A0A3M5M873      KIQVAALRAHPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A3M5G7H9      KIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A0Q0A5T8      KIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A0P9QCJ2      KIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A0P9UCX7      KIQVATLRARHGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A0P9Q329      KIQVATLRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A3M5GJ64      KIQVATLRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A0P9S1F1      KIQVATLRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A3M2XYQ3      KIQVATLQARPGTDFTVSRQRTLSTALIYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A0P9XCE1      KIQVATLQARPGTDFTVSRQRTLSTALIYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A3M3EFX7      KIQVATLQARPGTDFTVSRQRTLSTALIYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A3M5B9D9      KIQVATLQARPGTDFTVSRQRTLSTALIYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A0P9RRZ3      KIQVATLQARPGTDFTVSRQRTLSTALLYQNRLKIIEAGRDSGIIYLSIEDQDAQRANRI
A0A3M2VEK7      KIQVATLQARPGTDFTVSRQRTLSTALIYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A0N8R9B3      KIQVATLQARPGTDFTVSRQRTLSTALIYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A0P9VA27      KIQVATLQARPGTDFTVSRQRTLSTALIYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A3M4YBJ4      KIQVATLQARPGTDFTVSRQRTLSTALIYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A0P9J470      KIQVATLQARPGTDFTVSRQRTLSTALIYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A0Q0EVJ8      KIQVATLQARPGTDFTVSRQRTLSTALIYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A3M5UI30      KIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A3M5YQT8      KIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANQI
A0A3M5F5X1      KIQVAALRAHPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A3M5R8G1      KIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A3M5V012      KIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A3M3GA16      KIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A3M3CJL0      KIQVATLQARPGTDFTVSRQRTLSTALIYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A3M3F6F5      KIQVATLQARPGTDFTVSRQRTLSTALIYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A3M3P9B7      KIQVATLQARPGTDFTVSRQRTLSTALIYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A0N8QB74      KIQVATLQARPGTDFTVSRQRTLSTALIYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A0Q0AUD0      KIQVATLQARPGTDFTVSRQRTLSTALIYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A3M5VR55      KIQVATLQARPGTDFTVSRQRTLSTALIYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A0Q0FK97      KIQVATLQARPGTDFTISRQRTLSTALIYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A3M3UCT3      KIQVATLQARPGTDFTVSRQRTLSTALIYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A7Z6Y5I3      KIQVATLQARPGTDFTVSRQRTLSTALIYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A3M5KZ75      KIQVATLQARPGTDFTVSRQRTLSTALIYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A3M5L3G5      KIQVATLQARPGTDFTVSRQRTLSTALIYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRI
A0A7Y2TRV5      ------------------------------------------------------------
A0A318DSU0      ------------------------------------------------------------
A0A538PF21      ------------------------------------------------------------
A0A1W1ZH10      ------------------------------------------------------------
A0A1W2FF24      ------------------------------------------------------------
A0A524JYQ6      ------------------------------------------------------------
A0A4Q3MA17      ------------------------------------------------------------
A0A0N0M5F7      ------------------------------------------------------------
A0A537M754      ------------------------------------------------------------
A0A1V1PDB4      ------------------------------------------------------------
A0A2M7C324      ------------------------------------------------------------
A0A4Q3HHG6      ------------------------------------------------------------
A0A3B7DTA4      ------------------------------------------------------------
A0A432ZK62      ------------------------------------------------------------
A0A1V5EEP4      ------------------------------------------------------------
A0A1V5EF48      ------------------------------------------------------------
A0A0S6X1X6      ------------------------------------------------------------
A0A537Y5L8      ------------------------------------------------------------
A0A4Q3L2X2      ------------------------------------------------------------
A0A4Q3T8J1      ------------------------------------------------------------
A0A4Q4ANM4      ------------------------------------------------------------
A0A4Q3UEC7      ------------------------------------------------------------
A0A1H5YYQ4      ------------------------------------------------------------
A0A1X4NLK2      ------------------------------------------------------------
A0A1X4NWB5      ------------------------------------------------------------
A0A1M5UQ38      ------------------------------------------------------------
A0A327YI48      ------------------------------------------------------------
A0A1B1PNL6      ------------------------------------------------------------
A0A2U8H9H9      ------------------------------------------------------------
A0A845UXY6      ------------------------------------------------------------
A0A1X6YIC0      ------------------------------------------------------------
A0A1I5E9E9      ------------------------------------------------------------
A0A1X6Z7N7      ------------------------------------------------------------
A0A2E1DQ13      ------------------------------------------------------------
A0A1H8C800      ------------------------------------------------------------
A0A2N3EZ05      ------------------------------------------------------------
A0A844ZIR7      ------------------------------------------------------------
A0A850H7C5      ------------------------------------------------------------
A0A845AYQ8      ------------------------------------------------------------
A0A0W1DLQ3      ------------------------------------------------------------
A0A246JVD8      ------------------------------------------------------------
A0A2N3BB54      ------------------------------------------------------------
A0A1H6G7A3      ------------------------------------------------------------
A0A0A7PGL6      ------------------------------------------------------------
A0A4Q2Z4L0      ------------------------------------------------------------
A0A7W0BRL7      ------------------------------------------------------------
A0A0W1GMS6      ------------------------------------------------------------
A0A0Q8RMY3      ------------------------------------------------------------
A0A1A7QC21      ------------------------------------------------------------
A0A832FJD1      ------------------------------------------------------------
A0A7C0U459      ------------------------------------------------------------
A0A7W0ITF0      ------------------------------------------------------------
A0A832C120      ------------------------------------------------------------
A0A318CT66      ------------------------------------------------------------
A0A3N5P205      ------------------------------------------------------------
A0A2G9XLE5      ------------------------------------------------------------
A0A6L3MM74      ------------------------------------------------------------
A0A7X8CDM1      ------------------------------------------------------------
A0A7C3QM04      ------------------------------------------------------------
A0A7I8MVM0      ------------------------------------------------------------
A0A7C0Y3J7      ------------------------------------------------------------
A0A7C3LF61      ------------------------------------------------------------
A0A4R1HDF2      ------------------------------------------------------------
A0A6N1DL48      ------------------------------------------------------------
A0A534HBS8      ------------------------------------------------------------
E1Y9C0          ------------------------------------------------------------
A0A1N6SH58      ------------------------------------------------------------
A0A4Q3AQN2      ------------------------------------------------------------
                                                                            

A0A1M6N1X5      ------------------------------------------------------------
A0A561M3U0      ------------------------------------------------------------
A0A2T4ZJZ6      ------------------------------------------------------------
A0A1T2KYM8      --------------------------------------------------QSRLVATGDY
A0A2G9ZR82      ------------------------------------------------------------
A0A6J4YZ98      ------------------------------------------------------------
A0A844XH11      ------------------------------------------------------------
A0A0P1H2H0      ----------------------------------------------------MVEQSKKV
A0A377N8F8      ------------------------------------------------------------
A0A4Q3LR91      ------------------------------------------------------------
A0A6C9IKN8      ------------------------------------------------------------
A0A4V1TR68      ------------------------------------------------------------
A0A6L3ZR06      ------------------------------------------------------------
A0A3E0WKI3      ------------------------------------------------------------
A0A1H3I2J1      -------------------------------------MGERRSFSRTPRKALSREARQQL
A0A521LJG5      ------------------------------------------------------------
A0A1V4WHZ7      ------------------------------------------------------------
A0A1E5AJN5      INRVLAGMQITTLRRSPIVRIAFVHNERSYPHVVVNQIARSFIELSVDQKAESANKIRLL
A0A2N3D2J1      -------------------------------------------TAYANARSKRLEAEQRW
A0A2N2GVE1      AGVMRGMIQVIPVPESRLVNISAVSTMPLMAKKVADAITEAFIDDNLERRLSSTKSASTW
A0A2N2INV3      AGVMRGMIQVIPVPDSRLVNISAVSTNPLMAKKVADAVTEAFIDDNLERRLSSTKSASTW
A0A233IKJ2      -------------------------------------IGNVFMDSHIEDKLQVELKANSW
A0A1Y5DXG5      LDLQSSIGASEKGKDSGIVNLSFQHESPEYSQMVLNEITEIYVRRNVDRNSAEAKKSLDF
A0A0B8P2H5      QWLNGSLSVSERGKQSGILSFGFEGENKAQIIDLLNDIANNYFLQNVDRNAAEAENSLEF
A0A380AQW6      ------------------------------------------------------------
A0A2G2GD62      GYIQNNLSTEQDAKYSSNIFVRFDDTVALRAKDIVDGITTAYIQDSVDQKKSSTERSLAF
A0A524P331      QGVMGSTNVSQVGKYTNVIQITCSDTDPVLASAMVNTLVQAYLGQTLSFRTEEASNTVKF
A0A4V1SSM5      ------------------------------------------------------------
A0A4Q3K8G7      ------------------------------------------------------------
A0A7C7W7M2      LASLTSIEKPVDREYSNLLNITVKMADPQLAALTANTIADEYIATVFENEVETARKNQQF
A0A1M7HC79      -------------------------------------MAETFLTQNVERQSAEAQQSLEF
A0A1D3JZN6      -------------------------------MRTLNEISSLYVRQNVDRTSAEAAQSLAF
A0A1V6ESG1      -----------------------------------------------------------M
A0A850NXS7      ------------------------------------------------------------
A0A1H7YHK3      --------------------------------------MEAYGRRKVDRNSAEVSSQLKF
A0A3S1MCW7      ------------------------------------------------------------
A0A528AX40      IGRILKDLTVNLVTNTSLLTISFIDQKPKYASDIANQVAQSFIDQRLDQTSETSDLARQF
A0A528MV95      IGRVLNDLTVNLVSNTSLLSITFADQNPKYASDIANQVAQSFIDQRLDQTSETSDLARQF
A0A838IR38      VGKVLGVSEVSLQRDSRVGLIRVQIDNAEMAAKISDGISQTYVEYIREFQSSGVGQLATW
A0A328C2K5      VNTLQSVAVYSLQRDSRVGLIQVRYEDPELAARIADGISETYVEYIREFQTGGLRQLANW
A0A5C6X8M3      VNILQRVAVYSLQRDSRVGLVQVRFEDPELAANIADGISETYVEYIREFQTGGLRQLANW
A0A3D8MRR7      VNTLQRVAVYSLQRDSRVGLVQVRFKDPELAASIADGISETYVEYIREFQTGGLRQLANW
A0A5C6UBJ7      VNTLQRVAVYSLQRDSRVGLVQVRFKDPELAASIADGISETYVEYIREFQTGGLRQLANW
A0A5C6XGM3      VNTLQRVAVYSLQRDSRVGLVQVRFEDPELAASIADGISETYVEYIREFQTGGLRQLANW
A0A849WSS0      VSALNRWISFEKIGADGVV-IHATTSRSALSKRVADVVSELAVDWISRNEILAVEKAVAY
A0A7Y3GUU1      ------------------------------------------------------------
A0A090R136      ---------------------------------------------------------MHF
A0A661JU93      ------------------------------------------------------------
A0A0M3GBT1      IPEFYRALGVWHEDKSDVVQVSFTTNDPQLAAAVPNRVISIYLDERKGSVRSRLDAAEKW
B3Q577          IPEFYRALGVWHEDKSDVVQVSFTTNDPQLAAAVPNRVISIYLDERKGSVRSRLDAAEKW
A0A3R9C3P5      IPEYYQALGVWHEDKSEVIQISFTASDAELAAAVPNRVVSIYLDERKDSVRGRLVSAGDW
A0A7W6FJX0      IPEYYQALGVWHEDKSEVIQISFTANDAELAAAVPNRVVSIYLDERKDSVRGRLVSAGDW
A0A2E2T3V8      VEALRRRIDVERIGNSTVIQIGVTDDDPERAYQIVSAVAESFVWLRNNELRRGMDNQLTV
A0A367UAB4      VEALRRRIDVERIGNSTVIQIGVTDDDPERAYQIVSAVAESFVWLRNNELRRGMDNQLTV
A0A1F2ZW35      IGYVSGHLNVNLVGRTFVILITAESPDGTMSARIANAVAEAYLADQIDTKNEANRRATEW
A0A377V641      ------------------------------------------MAQNISRQAAQDEKSLEF
A0A1F2YJ88      NNILANYSVAEKGKLTGILGLNYQGTDKTHITQVLNAILVSYSQQNIERRSAETAQTLKF
A0A5N8AL61      MRTVMNSLKVQREGTSYAIVIGARNPDAAIAAEIANGVMDAYVGQQRSGKAQARSQEIEM
A0A0J7XGZ1      AGRLLTHSYVRRVGVTYLVEITASSEDPDLAARIANALARRYIGLDSAKKQARNAQSAHY
I4CBA7          ALPRWSDIRITENRGSQLINVEASANDPFAAREKLRDYLEQYIRADRERLETLANSLLAK
A3VE95          TWAIRQDLNVSRESESYVFEIQFSAAEPGIAQQIANGIADTYIALQLENRRDSAVQATAW
A0A1G0NL95      -----MTTVREQGKQSGVLQLSVRADSPQAAALAANAVAGAYLQQNVSRRSREAGLTLAF
A0A024KA69      PDWLGSRVKVQRDGPTYLVSVRANAPSPIEAASYANAVANSFIHEEVAAKIDGVLADVAA
A0A0L1KFN4      AKILLDQVSIEPTRLSRLVDINFTSPDALFSAQVANAWAENFIEINLERKVQSTSYGRTA
A0A3D5UYX7      -----------------------------------------------------------E
A0A524QFS4      KQFLKGGVDINLVRRTSMVKITVDFPDPDVAAFLANTYASVALQDMLDVNKSNSKSAVEW
A0A832MZU0      QENIVISNIGVNAPSDNILEITYNDHVPARAQRIAQEIAQSYIDYDLENKTIELEQTLQF
A0A520JSW4      AGFVQGGTQVRLQPLSMIVSVSFVARDPQIAAKIVNGVADAYISTNLERRYQSSSYAREF
A0A4Q3LTF3      ------------------------------------------------------------
A0A840SQK7      IAGYYNGLVVRRSGTTDVIEIGFSSLDPQLAADIPNALVRIYLDARDSGVRGRVSEAEAW
A0A7C3N3Y1      VNRFLGKLKIEPIRNSRLVKIHFDSNDRELSPRVANELAAAYIQQNLDYRFSATEQAKDW
A0A537UTP9      VERFQSQLIITRAGLTYIISVGFRAQDAQQAAKIANAVADAYIADQLEAKYQAALRAGTW
A0A1D2RNR5      ------------------------------------------------------------
A0A4V1TQ46      ------------------------------------------------------------
A0A3A0FZC0      IKVYLSTIEIKPVRRTSLVTVEATVSDPRLAALIANRHSESYIDWVRQNRIDQQARGLTF
A0A1N7JVZ7      HARSEPEAQAQPAASRDDSADAHDSPSPKVFRRQKRSVAPGETQAEPTPEPQQPAPKPQL
A0A091C4A8      INSFLASLSIEPVRNSRLVRVHFDSPDAAFSQRVVNAVAEAYIASNLERRFDASSYAKTF
A0A844YBH7      GMRIGGITNVTRTGDVRVVDISAVSDDAAFTAAAANLVAEAYLVSQVEAKTARSDSSSEF
A0A4R3H6P6      GKILLLHVGVAPVRGSSLVDIRAVTPDPVLSQKIAKAWSENYIASNLERRFDASSYARKF
A0A3S1NQ09      ILKLQNEIRAERVGRSYVIALGYQATDPALANAITKAYADAYLADQLDASFDATERAAVW
A0A443GJ52      ILKLQNEVQAERIGRSYVISIAYQATDPVLATAVTKAYADAYLADQLDASFDATERAAVW
A0A2W6S588      AAALLSGVSAARVGTTALFSIGYSDGDPLAAARIANVVAGAYLAVQAQQKLGQGSATSNQ
A0A483E0N4      SDLQNTLSVADQGKDTGMLTISLTGEDPSIIERIVESISDNYLAQNIARQAAQDAKSLEF
A0A2J4YQQ6      TDLQENLIVADQGKDTGMLTLSLTGDNPALIERIINSITENYLAQNISRQAAQDAKSLEF
A0A483THX4      TDLQTNLVVADLGKDTGMLNVSYTGDNADLIKNIVDSITRNYLEQNISRQAAQDAKSLEF
A0A534MVS2      -------MQQINSILGQIRRLSEDRENGTLALCKGDQRVEVFYREGMIEAVSSNVDLHRL
A0A444I5K6      AETVAGNIDVERVGRSYVLDVSYTAQSPDLARDIAAAIADVYLVDKLNSKYEATRRAGQW
A0A154VE85      VDAYLDRLSVSPADNARIVAVDFTAADPDLAAAAANRTAGLYVEDRVAQRAAAARRADEW
A0A3C1S9Y1      VSAFITRIKVSPIRNSRLVDVTAEAKNPALAARMANEVVKVYIDQNMETKLAAAKDAVRW
A0A353EH49      EVLNGKLQVSESGKQSGMLTLAFTSIHQHQVADVLNQIVNSYVDQNLERSAAEARLSLEF
A0A1Y1Q9C1      TDLFSQHLYVEPIEKTHLVKVFYESPDPVLSADIVNALVNAFIKDNISSQSETDTYAKEF
A0A3M7LJH0      ---------------TGIVELSFTGENPSQIQAILDDISQNYFLQNVQRNSAEAEKSLAF
A0A1E4JHX8      ARILLENIDIVPDRLSRLVTITFTSPDPKLSARVANAWTANFIESNLERRFEATSYARKF
M2U8P2          AAFIRGGLSARREGTSFVITIASEGPDPEIAAAAVNSVIDIYVGGQVSEKSSQRQREISI
A0A1H7KZF8      LDLLDRKRSAAIIPNSRAASIAFTSPDPQLSALIANSFADHLVRRDVQQRADQSRYARAF
A0A6N3UC48      ----------------------LESPRPADAARILDEVSRLYVLQNVQRKSAEAQQSLDF
A0A257NG76      ------------GKKTGILELTMESTSQDSVLQTLNEIANIYVRQNVEQKSAEAQKTLEF
A0A1T4TW59      LKKFKSHFAIEPIRYTQLVRIHFDSANPELAAKVANAVGNAYIESNLEARLLATQTASTW
A0A1Q3MB35      TDILLDNVSINPVRGSRLVDVKFTSPSPKLSAQVADLWVSQFQQAALDRRFLSTADAREF
A0A259LUN7      ----------------------------------------------MEEKYNATRKATEW
A0A2D7AVL1      -----------------------------------------------------NSSIFSL
A0A3B9KZE9      ------------------------------------------------------------
A0A358L616      --------------------------DPELISQVLDRVMSNYLMQNVERKSAEAQKSLEF
A0A4U9HNE9      DDLRRTLSIALAGKESGIMTFKLESEDPQRAKRVLQSITENYLQQNIDRKTEEAQRMLAF
A0A7X7Z1H8      EYYGLKKLPFSITPDPEFVFMSSSHHEALAQMLYGIQERKSLMVVTGEVGVGKTTMIYTL
A0A7C5N053      ALILRARLEVKPIKDSQLAIVRVTDANPERAARIVNTLTDVYVELNISDAYESTDRAIAD
A0A2G2CXY6      LAYQEELGASEKGKDSGIISLSMQHESPAQATRILDEVSRLYVLQNVARNSAEAAQSLEF
A0A3M1D4H3      ------------------------------------------------------------
A0A7C1A2A2      GFGVSTTTGGGSTQPTLVVSLSYKGFDPYRAQRFLADLMRGYLAQNLRWSTEQAGTAYHY
A0A840RX77      EKLQNAMMISEKGKQSGIISVSLKGTDPKLTSSILNEIGREYVRQNVERKSAEAEKSLTF
A0A5C8BYM7      ---------------------------------------------------LTLDEKTNV
A0A7V2RUR3      ALAEFASRLEIRGDSSYVITLGFTAGDAEKAARIVNRIAEMFVDDQLKAKLLVTSRVGLW
A0A1J5ICP0      VEGLQGSLAVSPIKNTELVTISATAPNPSMAATKVNVIVSEYKSLAVLKDTQNAASALAF
A0A379B9V4      SALQEQLSVHEIGKQTGIINIAIQGKDKKHIQDIVSSIAESYLLQNVARNSAEASKSLEF
A0A0Q6TS97      GKILLQHVGVAPVRGSSLVDVRAVTPDPALSQRIAQAWGEDFIASNLERRFEASGYARKF
A0A0Q6UYB4      GKILLQHVGVAPVRGSSLVDVRAVTPDPALSQRIAQAWGEDFIASNLERRFEASGYARKF
W7Q5J0          GRLQIAEVGGGRGSSTGVLRLSMTGPDTQEIVRSLDAVADTFLTQNVERQSAQAEQSLVF
A0A654AKT6      VRFLTATVRHWSVPLVLAVAVSLLGSPSVAARVVSIAICIGYLMYTMGRRISYLHHWMG-
A0A847E0Q2      ---------------------------PQAAARLVNALADAYLAQNVQRRAAEADKSLQF
A0A7W9WQN4      GALQQKLVIAEKSKLSGIVGVTLDGADSQTTTEIVNAVAAAYVEQNVNRKSAQAEHTLTF
A0A0G9MZA5      AGTLLNNVSITPIINSTLVDISFSSPDPQVSARIANAWADAYIAENLDRRFGATRDARSS
H0T8B0          VSTVASNLSIVRVGRSYIEEITYTSRDPVLAGEVANAIAQAYIEDQLQSYFETSIRTNTW
A0A7Y4X614      LGAYLGGLDIRPVPRTRLVRIAFRSPDPALSAALANAHARAYIRHGAELRSEANREGLNF
A0A5C7N981      LSGLPGALSVMPVRNSQLARVHFDSPDPQMAARIANEVAVAYTKLNLERRMEATSYARTF
A0A534TV22      ------------------------------------------------------------
A0A351CXR4      SAFIQAALTVEVESHDGVLDLGFTSPNADLSADVLNVLAETYIDHKRSSKTNRVSEASEW
A0A2N6GLF5      VEYYFERLKVTPVKNSQLVRVAFEANDRQLAADVANNLANIYIVNDLEARLSMTSKASDW
A0A1W9LJP0      VNALIGRIKAEPVRNSRLVNVRVEAKDPALAAKIANAVVQAYIDQNLETKLTAAKDAVKW
A0A0W1ICB0      VELLLDNVGISPLRGSALVDVSYSSASPQLSRLIASTWVNEFVQQSMDRRLASTADARIY
A0A7C1C8G2      LGKIKNALTITPVRGTQLINISFQNPHAGLAADIVNNLMKEFLQVNAEQKLAAFHSSGVF
A0A832F8F3      -------------------------------------------MAGLTGNPSDGFGAGPL
A0A2E0UL88      ------------------------------------SYQQTEGIVSLDQESEGLINQLSN
A0A2N1WQN5      ------------------------------------------------------------
A0A0T2QIS1      VDLLLSHVTISPITRSRLVDIGYTSGSADLSATIANTWAQQFVASSLDRRFSSTADARKF
A0A376KYN0      ------------------------------------------------------------
A0A377E5P7      ----------------------MTGDDPQLITRILNSIANNYLQQNIARQAAQDSQSLEF
A0A2X1JB05      --MQETFTVSERSKESGMLELTMTGDDPQLITRILNSIANNYLQQNIARQAAQDSQSLEF
A0A376RML0      --MQETFTVSERSKESGMLELTMTGDDPQLITRILNSIANNYLQQNIARQAAQDSQSLEF
A0A6N3QTV2      --MQETFTVSERSKESGMLELTMTGDDPQLITRILNSIANNYLQQNIARQAAQDSQSLEF
A0A0P7Y1D0      TSAVLDRLSARRSGMTFMLTIAFTSENAAKAARIANAFADQYLLSQLEAKFDATERANTW
A0A7Y2FUF7      ---------------TRVITLSYSHADPKYAALVANQAAQSFIDQSVDTKSETSSLARQF
A0A7W6DRI0      ---------------------------------------MNMMDSRKFRRRRKPLKVDEP
A0A542J310      -MELRDYLRGLRRHWVAIILMTGIGVGAGFGWTLLQTPVYVASASGIVQSTGIGDVSNVS
A0A2M7JRZ7      IDQFLSKLKVEPIRNSRLVKVHFDSNYPELSAKVPNTLAVTYIQQSVESRFIATEQVKEW
A0A167IR75      ADILLTNVTINPTRLSRLVDISMTSPDPAFSAEVANSWAENFITTNLERKVQATSYGRDA
A0A3B8T2U6      IAKLQANIDIKPVFHTHVVEIEFVSEDPLLAATISDTVANVYIENYLEAKLEMTAKATTW
A0A365PWR2      LRLQNQLQIDEVEEGSGIFVLSITDADPERAVNILAEVMKAYVAQNIERAAADASSGLEF
A0A2E9H5Z8      -----------------------------------MGQSEEYILKSAEMQQFGAEERKAE
A0A2E2BR79      SRLSVSETGSGFVGNAGMLRLTLTGTDREEIRRLLDAISETFLMQNVERQSAQVDQSLAF
A0A6I4IKZ3      NALSANYSVAERGKLTGVLGLNYQGQDKEQITKVLNAILATYSAQNIERRSAESAQTLKF
A0A7H4JZ79      ----------------------------EHITKVLNAILVTYGDQNVERRSAESAQTLKF
A0A0Q4Q524      GQILRDHLDVAPTRLSRLVEIRFTSPDAAFSARIVNTWSDAFIQTNLERKVQATSYGRNL
A0A0Q4CFJ9      GEILIDHLAIVPTRLSRLVDIRFTSPNPEFSAKIVNTWSDAFIQTNLERKVQATSYGRNL
A0A0Q4FE58      GETLLKNLNIAPTRLSRLVDIRFTSPNPEFSAKIVNTWSEAFIQTNLERKVEATSYGRNL
A0A0Q4JWC8      GETLLKNLNIAPTRLSRLVDIRFTSPNPEFSAKIVNTWSEAFIQTNLERKVEATSYGRNL
A0A0Q4KFL8      GETLLKNLNIAPTRLSRLVDIRFTSPNPEFSAKIVNTWSEAFIQTNLERKVEATSYGRNL
A0A7W8RVL5      ESLQNRLTVSQKGKDSGIIGASLMGSERLLTASTLAEIGNAYVDQNLKRKAAEAEKSLAF
A0A831Y0Z8      --------------------------------------------------MSGTKQSLKW
A0A522R8R0      ------------------------------------------------------------
A0A2U9NDY5      REDQDRRKGGEAGKDAGSSDMAREEPDPQLASRVRDESSRRDGNQNSQRSAAEAAQRLDG
A0A0Q4IGG1      GKILLDNISINPTRLSSLVDISFDSPDPILSTQIVNAWSDSFIQTNLERKVQATSYGRNM
A0A352G2C2      -----------RGKQSGIVNVTLEDPNPEHAIRVLEEVASRYVDQNVARNAAEATQSLEF
A0A7Y3BMU7      AQRLQSKLSLDPIKDTRLVLLKVRDNDPERAATLANMVASSYIEKTMDDRLGSTAAAAEW
A0A534RUJ5      ------------VQRTRLVKVAFLTPDPALSARVANAHVESYIHKGLELRTQANEEAQRF
V4Q8B7          LDYQNRLKVGEAGKDSGIIYMSLEDPDPQLANQVLDEISRLYVSQNIQRSSAEAAQRLDF
A0A3M1CJM3      --------------------------------------------------------AAAW
A0A2R7SVD4      QGYQDALDISEQGKESGIIRLALASADAAEAVKILNKIAALYVDQNVRRTSAEAAQSLAF
A0A0Q8XKK5      VQILQSNIAISPIRNSALVDIKYTSGSPELAAQIANTWAQQFIEASMDRRFASTADARKF
A0A2E0Q2W0      ------------------------------------------------------------
A0A660NIR6      LMRYKAGLDISPIKNSQLVEIRFESPDPVLAAKIANQTAESYITADLDARFDMQQTASRW
A0A142W0R3      EKILLDAVSIEPVRQSSLVDVSFSTPSATLSAKLTNLWVQQFVAANLDRRFSATSDARRF
A0A0S4XR18      GFIRPNLNVAQISKQASIVKITFEDAIPQRGVDIVNNLVKVYFAQKLDYQREEVEKKLKF
A0A7C5CFF1      ------------------------------VSLQIQAVKNFRQSLKQGILSSVSLVTAGI
A0A7X6WZW5      QHLQEAMVIDEKSKPSGVLAMSLEGADPVQTAAIVNAIGSAYVKQNTERRAAEAEQSLGF
A0A7X2SVT1      RSVLSNLTVADKGKDTGVLGLEYLGEDPEQISKVLNQIVNNYLLQNVERKSAQAEKSLEF
A0A2E0GW64      SDQGDQTQKNSYLRETGVVQASFTWGKPQQAQEILNAIINTTQEKDIQKKSQQAAQALQF
A0A1A7QJ97      GEVLLDHVSIEPTRLSRLVDIRFTSPDPAFSASVANAWAENFIESNLERKLQSTSYGRDA
A0A832UVD3      -------------------KISFESYDPELSAQVANTMAEVYIASNLEARQNISSKSSSW
A0A7W5IBY1      GALQQKLVIAEKSKLSGIVGVTLDGADSQTTTEIVNAVAAAYVEQNVNRKSAQAEHTLTF
A0A661LW70      ------------------------------------------------------------
W7Q8F9          GRLQITEAAGGRGSPTGVLRLTMTGPDPQEIVRSLDAVADTFLTQNVERQSAQAEQSLAF
A0A524PXH8      --------------------MKFSSPDPRQAASIADTVTREYIDLTLDQRIQSVSQGRKF
A0A4Q3P0E4      EGLQSRLVLTEKGKQSSVINASLQDIDAIKVTEVLNAIGAQYVRQNVERKAAEAQKTLAF
A0A3M2BE89      KTLQKTLKVSEKGKKTGVFLLTLEDPDADRAVAILNAIANVYLRQNVERKSEEAQKALEF
A0A4Q4A6K6      ------------------------------------------------------------
A0A257G674      LQALEDARDVSMPRNSRLASVSFTSPQPELAARISNTLAAEFIQANLQRRFDSSAYARDF
A0A661M5M6      ---------------TRLVRIHARDVNPERARLIADAVADSYVQKTIEDRLESTDRAKDW
A0A1I1UM01      -------------------MTNRPKFRRRRRTQPEQEPAEDDLRPIPPLDTRQERLARRE
Q44573          EDAFLNNLTVTPEPRTQILDINVVDGNPERAAALANAVVTNYQRIALARQTADINRVATW
A2W025          SGFQAGIQVSEQGKQTGVVQISLEGKDPDQTAAIANALAQSYLNQHVVAKQAEATKMLDF
A0A534Z362      IDRYMRYLSVQEIRGTDLVAVRFTTPSPSLSAFLAAAHTQAYLEANEEARRADDVTAKEF
V4J283          GALSGAFTAVEYPNYSGILNVGFSAGEPEQAATILNAILDNYQRRNVERKGEEADKTLEF
A0A536T443      ------------------------------------------------MKRERLTELSSI
A0A0Q4UFQ5      GNLILARMDVEPERMSRLVEISFTSPDPELSKRVVDAWSTNFIQSTLERRYSATSYARNF
A0A527W7E6      VLMLQTGLLADRVSRSNVISIGYQATNPALATAITKAYADAYLADQLNASFDATERAAVW
A0A432EMV7      --------------KSLIAYLSYVSKDPQLSADAANAISEAFIEVGLETQLDETRQAKQW
A0A7Y3M8P5      AQQVRGALAVRHLRDTRIAVIAARDSNPKRARDIANAVAAAYIDFSQQEGQEARLRSAAW
A0A7C1SEU7      -------------------SISFTSPDRHLSQDVVNTLIEEFVRWKMDQKLEASQLAREF
A0A7Y1SPC5      ---VLSRLSVYRKGSTYVINIGFTSEDPVKAASLANAFAENYLLEQLDAKFDATSRANSW
A0A7V6YC94      IGLVMQGASVSRVDRSFILAVSFTGEDRELAAAIANALADGYIADQLDAKYEATRLAAEW
A0A534WLI3      --------SVETVPGTDLVEVRFTTPSPTLSAFLAATHAEAYVDANEEARLASNLSTRDF
A0A7V6CBY2      ---------------------------------MANTLADEYLQARLETKFRLTRQANTW
A0A7C6FBW0      LTRFKQSRTVRRKGLTYLISVSASSNSPEKAADLANELARTYIERQVSSKVEN-------
A0A087LTV7      LASAALLVMPVSYSATALLYFDPSPRGVLEDGRPGAGDGARVDSAVDLIASEPVLASAA-
A0A7D7WSS2      LASAALLVMPVSYSATALLYFDPSPRGVLEDGRPGAGDGARVDSAVDLIASEPVLASAA-
A0A318KWA2      DRLSVAEVGVGRGTSTGMLRLTLTGPDRDEIRRSLDAVAETFLTQNVRRQSAEIEQSLAF
A0A522MT86      -------------------------------AEVANAISQQYMLTAVAAKQRNDSSTLAF
A0A4Q3I221      --------AKIANAIGEAYLVDKLNSKYEATRRASGWLQDRIAELRQKALDSD-------
A0A534SAL6      LDRYMRYLSVQDVRGTDLVEVSFTTPSPTLSAFLAAAHTQAYIESNEEARRATDVTAKDF
A0A534ZDB4      LDRYMRYLSVQDVRGTDLVEVSFTTPSPALSAFLAAAHTEAYIEANEEARRATDVTAKDF
A0A534X3M7      IDRYMRYLAVEEVRGSDVVEVRFTTPDPSLSAFLAAAHTQAYLEANEEARRANDVTAQEF
A0A534SPC6      ----MRYLSVQEIRGTDLVAVRFTTPSPSLSAFLAAAHTQAYLEANEEARRADDVTAKEF
A0A535AD60      IDRYMRYLSVQEIRGTDLVAVRFTTPSPSLSAFLAAAHTQAYLEANEEARRADDVTAKEF
A0A4Q3SY08      -------------SYTSSDPRKAALIADTFAKTYVSEQLAAKASANRQASGLL-------
A0A7U1E9W6      ---------RIANAFAEIYISRQINQKINSSSTSNVLLNSQIDEMRRKVEEAE-------
A0A4Q3LG23      ---------RLSRLVDVAFTSPDPAFSAKIANAWADSFIQTNLERKVQATSYGRNLLQRQ
A0A522EX52      ---------ININDLDRKNNIGIFDISVRHEDPALATRIANEIASVTVKKNAK-------
A0A1H3KC95      ----------------------WPLHDGAEDYREAPLVLGPETRSCDRFAPQE-------
A0A5P8Z4P3      ---------PRIADRPPQDIAGETTEPGTAAAQLPPLEPSETPAPAQTSREALMALAEDL
A0A2E9HXF7      ---------PAADPASPYAAVKAASQEAARLRVEADERARAEAETQRIAKAAE-------
A0A0B3RZC9      ---------PVSEPPDPVRPLDETAREAARKRDAAAEQARSEAEARRIAEAAD-------
A0A6F8QET1      ---------PVSEPPDPVRPLDETAR-----------------------EAAD-------
A0A520HUH4      ---------PVAIAHRIETATSAVVQRLTVTQQERSYVLAIGFRARDAAKAAR-------
A0A2K8U7M6      ---------PAEAAAVAQTLAENFVNSGLERRYEASVPARAFLDERLRAAQAALADAERR
A0A5B9DKL8      TATTWLFSDPTVRTILPGESRGSAPLNDTARLESAVELIGSERTLQAVVRDLGLAVGMPG
A0A238KJM1      --------------------------------------HRSPTETVSVLKSKR-------
A0A3A0FJZ4      GGVAAHRLLPPRYVGESTLLVESSWVRDGFIDTPVASSLRSQVQTLRHRLTSDRALAGIV
W4HJV8          ---------RTTGPETSFDVQGTDAAEAGADTDTAFDPVRDGGRSTAKASGET-------
A0A0P1GDI0      ---------APLESREERLARRRAEQEAEQARLAAEEAARVEAERLEQARLEE-------
A0A2R8ATV5      PVVSEEERREQIVAEKRRRAEESRQQRVAMRQAEAEARRQAEAEARRQAEEEEARQQAAA
A0A1U7D3R6      -------------------------------------------MTAERTRSES-------
A0A2D4UVV2      ---------EPAEVTSAAPPAAAPTHRRKRRRTDAAQTPPTEAVTAERTRSES-------
A0A0W7WHP4      ---------DAAPTETDMTPVPPLEPRARRSEDTLPETGGTSARETEEAREAE-------
A0A238J8F6      RQEELRAAAAEAKAAAQKAALEAQRREVAKR--AAAERARQQAEAEQRAREEA-------
A0A238JQI6      ---------PETLPETLPESVPKNLPEIAPE--TAPEPPVPDPEAGARRTAEA-------
A0A222E077      ---------PAAAPASPYAAVKAASQEAAHLRVEADERARAEAETQRIAKAAE-------
A0A239E3Y2      ---------PAADAASPYAAVKAASQEAARL--------RAEAEAQRIAKAAE-------
A0A1F9CFF0      ------------------------------------------------------------
A0A2M8B0G5      ------------------------------------------------------------
A0A363TNU9      ------------------------------------------------------------
A0A445MZQ4      ------------------------------------------------------------
A0A0M9E0E3      ------------------------------------------------------------
A0A351Z9A2      ------------------------------------------------------------
A0A6G6X2Z4      ------------------------------------------------------------
A0A0C5VQ86      ------------------------------------------------------------
A0A3S1WTQ1      ------------------------------------------------------------
A0A354EF47      ------------------------------------------------------------
A0A536T0W8      ------------------------------------------------------------
A0A2G6MSP7      ------------------------------------------------------------
A0A3N5FRH4      ------------------------------------------------------------
A0A1V4Y2C3      ------------------------------------------------------------
A0A2N2KTJ4      ------------------------------------------------------------
A0A2N2LQX0      ------------------------------------------------------------
A0A4U8YMP3      ------------------------------------------------------------
A0A1Q8QQ99      ------------------------------------------------------------
A0A7C2SIB2      ------------------------------------------------------------
A0A3D5ZY44      ------------------------------------------------------------
A0A1G5C236      ------------------------------------------------------------
A0A432HIS7      ------------------------------------------------------------
A0A401FQP5      ------------------------------------------------------------
A0A7C3Q9R6      ------------------------------------------------------------
A0A7C2AA26      ------------------------------------------------------------
A0A351Z4H9      ------------------------------------------------------------
A0A2N2KML4      ------------------------------------------------------------
E1YJF1          ------------------------------------------------------------
A0A1Q6DMW3      ------------------------------------------------------------
A0A3A6P8F8      ------------------------------------------------------------
A0A1J5EVZ6      ------------------------------------------------------------
A0A2G2DSM4      ------------------------------------------------------------
A0A1F9NI02      ------------------------------------------------------------
A0A4U1ABX4      ------------------------------------------------------------
A0A6L4AM84      ------------------------------------------------------------
A0A840UW68      ------------------------------------------------------------
A0A2G6FCC5      ------------------------------------------------------------
A0A1F9MR25      ------------------------------------------------------------
A0A2G6M7F1      ------------------------------------------------------------
A0A5Q2QDL1      ------------------------------------------------------------
A0A4Z0M4C7      ------------------------------------------------------------
A0A1V8MBH1      ------------------------------------------------------------
A0A7V9E085      ------------------------------------------------------------
A0A6J4X8D4      ------------------------------------------------------------
A0A1E7HSL6      ------------------------------------------------------------
A0A2M7JX59      ------------------------------------------------------------
A0A7V4PLT3      ------------------------------------------------------------
A0A7X7Y8R3      ------------------------------------------------------------
A0A832A361      ------------------------------------------------------------
A0A1M5GH86      ------------------------------------------------------------
A0A1W1XQZ5      ------------------------------------------------------------
A0A3D6C3I2      ------------------------------------------------------------
S0G1D4          ------------------------------------------------------------
A0A661T246      ------------------------------------------------------------
A0A850T4Q7      ------------------------------------------------------------
A0A2G6CSG7      ------------------------------------------------------------
A0A2G6NB59      ------------------------------------------------------------
A0A5K8A7T9      ------------------------------------------------------------
A0A1W9U045      ------------------------------------------------------------
A0A1F9L9G4      ------------------------------------------------------------
A0A328FD76      ------------------------------------------------------------
A0A348UX90      ------------------------------------------------------------
A0A357Z0N5      ------------------------------------------------------------
A0A0F2R2U0      ------------------------------------------------------------
A0A5K7ZK00      ------------------------------------------------------------
A0A5K7YCX8      ------------------------------------------------------------
A0A5K7Z388      ------------------------------------------------------------
A0A520CSP5      ------------------------------------------------------------
A0A1E7HFN0      ------------------------------------------------------------
A0A7J0BHG1      ------------------------------------------------------------
A0A6V8LMJ3      ------------------------------------------------------------
A0A2K8WHP8      ------------------------------------------------------------
A0A1J5N774      ------------------------------------------------------------
A0A2C8F781      ------------------------------------------------------------
A0A2E3R6G0      ------------------------------------------------------------
A0A7J0BUD3      ------------------------------------------------------------
A0A3M8EMP2      ------------------------------------------------------------
A0A2J6J6K6      ------------------------------------------------------------
A0A1F8XMK2      ------------------------------------------------------------
A0A661PSB9      ------------------------------------------------------------
A0A661QBT6      ------------------------------------------------------------
A0A6I2SLK2      ------------------------------------------------------------
A0A7Y7NC38      ------------------------------------------------------------
A0A0A8WSG4      ------------------------------------------------------------
S7TK97          ------------------------------------------------------------
S7UE93          ------------------------------------------------------------
A0A3D5BR56      ------------------------------------------------------------
A0A1I3PSR2      ------------------------------------------------------------
A0A2N2IB15      ------------------------------------------------------------
A0A7C8B5M6      ------------------------------------------------------------
A0A7V4UW39      ------------------------------------------------------------
A0A1W7QPT7      ------------------------------------------------------------
A0A6S6M1Y8      ------------------------------------------------------------
A0A6V8MCR2      ------------------------------------------------------------
A0A6V8N3X1      ------------------------------------------------------------
A0A6M4XJ81      ------------------------------------------------------------
A0A0M4D373      ------------------------------------------------------------
A0A1L3GKM9      ------------------------------------------------------------
A0A2T5R3J5      ------------------------------------------------------------
A0A1G6EKK9      ------------------------------------------------------------
A0A7C1DJX8      ------------------------------------------------------------
A0A3A4XVN3      ------------------------------------------------------------
A0A1E7JEV6      ------------------------------------------------------------
A0A2N2KDY5      ------------------------------------------------------------
A0A3N5YUD9      ------------------------------------------------------------
A0A4Q3ZDI7      ------------------------------------------------------------
A0A537PRC6      ------------------------------------------------------------
A0A7Y8L8B9      ------------------------------------------------------------
A0A5C4N0H6      ------------------------------------------------------------
A0A7V4UXV1      ------------------------------------------------------------
A0A7C3Y7G3      ------------------------------------------------------------
A0A7V5R3L0      ------------------------------------------------------------
A0A7V2SYN1      ------------------------------------------------------------
A0A6H9HII8      ------------------------------------------------------------
A0A7S6SHD5      ------------------------------------------------------------
A0A7C1UTU6      ------------------------------------------------------------
W9VVY5          ------------------------------------------------------------
A0A1E2URD3      ------------------------------------------------------------
A0A2T6MY81      ------------------------------------------------------------
A0A7Z0VN76      ------------------------------------------------------------
A0A2T6NBQ8      ------------------------------------------------------------
A0A421K431      ------------------------------------------------------------
A0A7C3Z8T7      ------------------------------------------------------------
A0A1V4QMH7      ------------------------------------------------------------
A0A496XZQ4      ------------------------------------------------------------
A0A7C3UZM2      ------------------------------------------------------------
A0A1F9BJF7      ------------------------------------------------------------
F2NDF5          ------------------------------------------------------------
A0A7Y4XWU8      ------------------------------------------------------------
A0A4V2SPR5      ------------------------------------------------------------
A0A7W8W7P8      ------------------------------------------------------------
A0A7W8WPN5      ------------------------------------------------------------
A0A519ERR1      ------------------------------------------------------------
A0A4Q3Q1M2      ------------------------------------------------------------
A0A4Q3MHR1      ------------------------------------------------------------
A0A520GDZ4      ------------------------------------------------------------
A0A372IH36      ------------------------------------------------------------
A0A540VW45      ------------------------------------------------------------
A0A1H9C241      ------------------------------------------------------------
A0A2E3FCR1      ------------------------------------------------------------
A0A4S3MG69      ------------------------------------------------------------
A0A3E0H727      ------------------------------------------------------------
A0A7X8XJJ0      ------------------------------------------------------------
A0A1I3TTC3      ------------------------------------------------------------
A0A1H3IZW6      ------------------------------------------------------------
A0A0M6YG59      ------------------------------------------------------------
A0A1H7G8B0      ------------------------------------------------------------
A0A2G2I5M1      ------------------------------------------------------------
A0A2G2M6F0      ------------------------------------------------------------
A0A352B502      ------------------------------------------------------------
A0A430DNP0      ------------------------------------------------------------
A0A410V446      ------------------------------------------------------------
A0A1B1UCM8      ------------------------------------------------------------
A0A1N6JQ20      ------------------------------------------------------------
A0A0R3KGJ5      ------------------------------------------------------------
A0A0R3N604      ------------------------------------------------------------
A0A1M5TI07      ------------------------------------------------------------
A3X191          ------------------------------------------------------------
A0A160UA87      ------------------------------------------------------------
A0A1Q5SFV5      ------------------------------------------------------------
A0A1H4RKV5      ------------------------------------------------------------
A0A7Z2Q199      ------------------------------------------------------------
A0A3A0FQ32      ------------------------------------------------------------
A0A7Y3GV54      ------------------------------------------------------------
A0A3E0WXH2      ------------------------------------------------------------
A0A1A9KEF8      ------------------------------------------------------------
A0A5E6PKN5      ------------------------------------------------------------
A0A0N9W1V6      ------------------------------------------------------------
A0A423GQ41      ------------------------------------------------------------
A0A423H7J2      ------------------------------------------------------------
A0A502HNM8      ------------------------------------------------------------
A0A4Q7H223      ------------------------------------------------------------
A0A1H4N2K9      ------------------------------------------------------------
A0A2K4KWF7      ------------------------------------------------------------
A0A1E4UZA0      ------------------------------------------------------------
A0A1H9KL56      ------------------------------------------------------------
A0A7X0BTK5      ------------------------------------------------------------
A0A2N2TRC8      ------------------------------------------------------------
A0A1V4CIZ7      ------------------------------------------------------------
A0A1M3BXA5      ------------------------------------------------------------
A0A1Y2R3U6      ------------------------------------------------------------
A0A167HVD6      ------------------------------------------------------------
A0A1V3SCT6      ------------------------------------------------------------
L0H287          ------------------------------------------------------------
A0A495VG93      ------------------------------------------------------------
A0A4R3MYM4      ------------------------------------------------------------
G2E3C0          ------------------------------------------------------------
A0A1W9J9F8      ------------------------------------------------------------
A0A2S5LFJ9      ------------------------------------------------------------
A0A2D8R8F8      ------------------------------------------------------------
A0A1G0KSD0      ------------------------------------------------------------
A0A4P6WX84      ------------------------------------------------------------
A0A1D2S760      ------------------------------------------------------------
A0A5B8RW94      ------------------------------------------------------------
A0A6I4JXQ8      ------------------------------------------------------------
A0A010SNS0      ------------------------------------------------------------
A0A0C2I782      ------------------------------------------------------------
A0A2N8BYF5      ------------------------------------------------------------
A0A558FKX2      ------------------------------------------------------------
A0A1H1DBA0      ------------------------------------------------------------
J3H699          ------------------------------------------------------------
A0A0K1QRZ4      ------------------------------------------------------------
A0A560RJW9      ------------------------------------------------------------
A0A5E7CRU7      ------------------------------------------------------------
A0A1H5J974      ------------------------------------------------------------
A0A5E7C564      ------------------------------------------------------------
A0A2W7MAV4      ------------------------------------------------------------
W6VFG3          ------------------------------------------------------------
A0A1P8ENT1      ------------------------------------------------------------
A0A2N7XRV4      ------------------------------------------------------------
A0A0Q6QPG8      ------------------------------------------------------------
A0A0F4SWA7      ------------------------------------------------------------
A0A423J219      ------------------------------------------------------------
A0A4P6G9U8      ------------------------------------------------------------
A0A4Y8JE06      ------------------------------------------------------------
A0A502I1X9      ------------------------------------------------------------
A0A502J776      ------------------------------------------------------------
A0A5B0EZF6      ------------------------------------------------------------
A0A059L434      ------------------------------------------------------------
A0A0F4UWN2      ------------------------------------------------------------
A0A5E7WEF5      ------------------------------------------------------------
A0A258TN88      ------------------------------------------------------------
A0A7Y8MN30      ------------------------------------------------------------
A0A3N5J7U8      ------------------------------------------------------------
A0A1S7S3I8      ------------------------------------------------------------
A0A655ZZQ1      ------------------------------------------------------------
A0A1S0ZAI3      ------------------------------------------------------------
A0A3C0L0A8      ------------------------------------------------------------
A0A176S762      ------------------------------------------------------------
A0A1W9WUD9      ------------------------------------------------------------
A0A1W1ZQK0      ------------------------------------------------------------
A0A7X1GRP5      ------------------------------------------------------------
A0A6I1R304      ------------------------------------------------------------
A0A1W9PMU6      ------------------------------------------------------------
A0A7Y4X3V7      ------------------------------------------------------------
A0A1G3VVY5      ------------------------------------------------------------
A0A7C3S273      ------------------------------------------------------------
A0A7C4WJ18      ------------------------------------------------------------
A0A351B422      ------------------------------------------------------------
F2NEE9          ------------------------------------------------------------
A0A7C3V565      ------------------------------------------------------------
A0A7V6A3E1      ------------------------------------------------------------
A0A318D3U4      ------------------------------------------------------------
A0A7V0JSN8      ------------------------------------------------------------
A0A7V5V784      ------------------------------------------------------------
A0A352Q5C1      ------------------------------------------------------------
A0A355TB56      ------------------------------------------------------------
A0A1F9E324      ------------------------------------------------------------
A0A435NNF5      ------------------------------------------------------------
A0A3S2AQS7      ------------------------------------------------------------
A0A527ZPD6      ------------------------------------------------------------
A0A529KRW3      ------------------------------------------------------------
A0A530ZLX0      ------------------------------------------------------------
A0A4Q3LBH4      ------------------------------------------------------------
A0A4Q3LWP3      ------------------------------------------------------------
A0A7C3JPP4      ------------------------------------------------------------
A0A534V9L7      ------------------------------------------------------------
A0A7C3JJT4      ------------------------------------------------------------
A0A524M660      ------------------------------------------------------------
A0A7C3JSX5      ------------------------------------------------------------
A0A7I8MQ67      ------------------------------------------------------------
A0A0C1TRU6      ------------------------------------------------------------
A0A2Z5SSF4      ------------------------------------------------------------
A0A7Y7TF97      ------------------------------------------------------------
A0A4Q4CIB1      ------------------------------------------------------------
A0A522ACJ9      ------------------------------------------------------------
A0A3N5Z7F8      ------------------------------------------------------------
A0A239HD34      ------------------------------------------------------------
A0A3D2M6Y9      ------------------------------------------------------------
A0A519E8D7      ------------------------------------------------------------
A0A3S1FD32      ------------------------------------------------------------
A0A434DUT4      ------------------------------------------------------------
A0A528D3U3      ------------------------------------------------------------
A0A3S3UPT3      ------------------------------------------------------------
A0A3S1E286      ------------------------------------------------------------
A0A531AC71      ------------------------------------------------------------
A0A436K268      ------------------------------------------------------------
A0A434IDQ0      ------------------------------------------------------------
A0A435IRM5      ------------------------------------------------------------
A0A3S2C404      ------------------------------------------------------------
A0A435F6C0      ------------------------------------------------------------
A0A435BMN6      ------------------------------------------------------------
A0A529XQ54      ------------------------------------------------------------
A0A530BJC1      ------------------------------------------------------------
A0A0P7ZZE4      ------------------------------------------------------------
A0A369R0Q9      ------------------------------------------------------------
A0A327LYE6      ------------------------------------------------------------
A0A5A9ZTV3      ------------------------------------------------------------
A0A258WKV0      ------------------------------------------------------------
A5G4N9          ------------------------------------------------------------
A0A812HT29      ------------------------------------------------------------
A0A444IY46      ------------------------------------------------------------
A0A6I7N627      ------------------------------------------------------------
A0A1V5DJV0      ------------------------------------------------------------
A0A520IUC4      ------------------------------------------------------------
A0A7Y7M8F4      ------------------------------------------------------------
A0A0P1FWI8      ------------------------------------------------------------
A0A6L8LHC6      ------------------------------------------------------------
A0A848ST88      ------------------------------------------------------------
A0A7U1HWF1      ------------------------------------------------------------
A0A534SH66      ------------------------------------------------------------
A0A3M0ZZ99      ------------------------------------------------------------
A0A238LBD3      ------------------------------------------------------------
A0A537NZJ1      ------------------------------------------------------------
A0A7C4R3C4      ------------------------------------------------------------
A0A0P1FRV5      ------------------------------------------------------------
A0A4Q4CVW6      ------------------------------------------------------------
A0A8B6LS25      ------------------------------------------------------------
A0A6L3ZWI0      ------------------------------------------------------------
A0A1M7BLL7      ------------------------------------------------------------
A0A0H4KZM1      ------------------------------------------------------------
A0A7V2W904      ------------------------------------------------------------
A0A1V1UJT2      ------------------------------------------------------------
A0A0L6CVX1      ------------------------------------------------------------
A0A1V0RR48      ------------------------------------------------------------
A0A0A0HJJ4      ------------------------------------------------------------
A0A5E7YA28      ------------------------------------------------------------
A0A316KRG4      ------------------------------------------------------------
A0A0J5Q9T7      ------------------------------------------------------------
A0A1I5YYQ0      ------------------------------------------------------------
A0A5P9FE62      ------------------------------------------------------------
A0A7U3CQW5      ------------------------------------------------------------
X7F6S5          ------------------------------------------------------------
A0A1G8NKI0      ------------------------------------------------------------
A0A355QPE4      ------------------------------------------------------------
A0A357RN98      ------------------------------------------------------------
A0A1I6U4V1      ------------------------------------------------------------
A0A6B2P8H8      ------------------------------------------------------------
A0A1P8USW9      ------------------------------------------------------------
A0A1G7CFZ2      ------------------------------------------------------------
A0A7G2TPW1      ------------------------------------------------------------
A0A1V6FYJ1      ------------------------------------------------------------
A0A4Q3IRI1      ------------------------------------------------------------
A0A7J5VV32      ------------------------------------------------------------
A0A1E7H876      ------------------------------------------------------------
A0A7C1C6X5      ------------------------------------------------------------
A0A7X1GMT8      ------------------------------------------------------------
Q44570          ------------------------------------------------------------
A0A509L3P8      ------------------------------------------------------------
A0A3A4S038      ------------------------------------------------------------
A0A1F9N669      ------------------------------------------------------------
A0A1F9PFA7      ------------------------------------------------------------
A0A1H2EN09      ------------------------------------------------------------
K0NP00          ------------------------------------------------------------
A0A2N6BZD5      ------------------------------------------------------------
A0A0F2NF69      ------------------------------------------------------------
A0A1F9NFD0      ------------------------------------------------------------
A0A1W9M770      ------------------------------------------------------------
A0A1W9M7R6      ------------------------------------------------------------
A0A7W0IR34      ------------------------------------------------------------
A0A7V5FUI1      ------------------------------------------------------------
A0A7T6AQC8      ------------------------------------------------------------
A0A7U4DQ89      ------------------------------------------------------------
A0A1M5YLH5      ------------------------------------------------------------
A0A4U1A4C7      ------------------------------------------------------------
A0A7C4N0I9      ------------------------------------------------------------
A0A1V4M8I1      ------------------------------------------------------------
A0A7C0XE92      ------------------------------------------------------------
A0A7U4QIX5      ------------------------------------------------------------
A0A800BQ44      ------------------------------------------------------------
A0A1E7JCL5      ------------------------------------------------------------
A0A7Z9XET3      ------------------------------------------------------------
A0A800C5N3      ------------------------------------------------------------
A0A496YAH9      ------------------------------------------------------------
A0A1V4S7E4      ------------------------------------------------------------
A0A847DGI3      ------------------------------------------------------------
A0A2N2H8D2      ------------------------------------------------------------
A0A2N2KC63      ------------------------------------------------------------
A0A3A4ZYW4      ------------------------------------------------------------
A0A800BMM4      ------------------------------------------------------------
A0A1V4MCJ4      ------------------------------------------------------------
A0A661M0W4      ------------------------------------------------------------
A0A3N5RNY4      ------------------------------------------------------------
A0A1M7Y300      ------------------------------------------------------------
A0A4U1ALN4      ------------------------------------------------------------
A0A849F908      ------------------------------------------------------------
A0A2N6BEI9      ------------------------------------------------------------
A0A0D5N3E9      ------------------------------------------------------------
A0A2N2G716      ------------------------------------------------------------
A0A1F9EUS2      ------------------------------------------------------------
A0A3N9VAW3      ------------------------------------------------------------
A0A6I1KNW9      ------------------------------------------------------------
A0A1H4B8T3      ------------------------------------------------------------
A0A1E7IQC3      ------------------------------------------------------------
A0A1M6KEN5      ------------------------------------------------------------
A0A1X0YE57      ------------------------------------------------------------
A0A2K2H9Q8      ------------------------------------------------------------
A0A1F8X5S3      ------------------------------------------------------------
A0A353QLL3      ------------------------------------------------------------
A0A847C207      ------------------------------------------------------------
A0A399I453      ------------------------------------------------------------
A0A651FBV9      ------------------------------------------------------------
A0A562VHD2      ------------------------------------------------------------
A0A7K0J0R7      ------------------------------------------------------------
A0A6I6JNB5      ------------------------------------------------------------
A0A847UFK5      ------------------------------------------------------------
A0A1G0LDK7      ------------------------------------------------------------
A0A6F9WVL7      ------------------------------------------------------------
A0A7Y7TLN9      ------------------------------------------------------------
A0A5C1MDH8      ------------------------------------------------------------
A0A7J4ZSX4      ------------------------------------------------------------
A0A5A9XE04      ------------------------------------------------------------
A0A643G9R1      ------------------------------------------------------------
A0A1G0M8Q7      ------------------------------------------------------------
A0A353MI14      ------------------------------------------------------------
A0A4S1CAW7      ------------------------------------------------------------
A0A655R819      ------------------------------------------------------------
A0A655RNN3      ------------------------------------------------------------
A0A354EI73      ------------------------------------------------------------
A0A6D0ELN7      ------------------------------------------------------------
A0A0B8PTA8      ------------------------------------------------------------
A0A0B8QF75      ------------------------------------------------------------
A0A4U9I390      ------------------------------------------------------------
A0A2X3M011      ------------------------------------------------------------
A0A2H9EHM4      ------------------------------------------------------------
A0A380B3D7      ------------------------------------------------------------
F5NSX0          ------------------------------------------------------------
A0A7A9K1G5      ------------------------------------------------------------
A0A811C967      ------------------------------------------------------------
A0A479JNB1      ------------------------------------------------------------
A0A5C9AF52      ------------------------------------------------------------
A0A6D0EYC7      ------------------------------------------------------------
D8EEU7          ------------------------------------------------------------
A0A0R0BVC7      ------------------------------------------------------------
A0A4U8YLL7      ------------------------------------------------------------
A0A2M7WWF7      ------------------------------------------------------------
A0A534QGR3      ------------------------------------------------------------
A0A0Q6QV61      ------------------------------------------------------------
A0A2Z3IKG4      ------------------------------------------------------------
B7RS54          ------------------------------------------------------------
A0A7R7CAD2      ------------------------------------------------------------
A0A7R7CQL5      ------------------------------------------------------------
A0A1I3XJ27      ------------------------------------------------------------
A0A562CGU2      ------------------------------------------------------------
A0A7C9VCB3      ------------------------------------------------------------
A0A1I7DCG1      ------------------------------------------------------------
A0A3A3H6D9      ------------------------------------------------------------
A0A0Q6VA36      ------------------------------------------------------------
A0A1B2EQN1      ------------------------------------------------------------
A0A1G8QZS5      ------------------------------------------------------------
A0A1H2Y469      ------------------------------------------------------------
A0A497ZQU7      ------------------------------------------------------------
A0A443K010      ------------------------------------------------------------
A0A6I7NYG5      ------------------------------------------------------------
A0A1I0R9R6      ------------------------------------------------------------
A0A2N3BVE7      ------------------------------------------------------------
A0A7C2IB02      ------------------------------------------------------------
A0A6N6SI00      ------------------------------------------------------------
A0A2S5JE21      ------------------------------------------------------------
A0A2R8BKZ2      ------------------------------------------------------------
A0A2S8S361      ------------------------------------------------------------
A0A1X7ACC1      ------------------------------------------------------------
A0A238KUF6      ------------------------------------------------------------
A0A095CTW3      ------------------------------------------------------------
A0A2E3UGD6      ------------------------------------------------------------
A0A840CE00      ------------------------------------------------------------
A0A2T0RFH0      ------------------------------------------------------------
A0A285D390      ------------------------------------------------------------
A0A497VHN4      ------------------------------------------------------------
A0A6M1UAR9      ------------------------------------------------------------
A0A520ZTR8      ------------------------------------------------------------
A0A7Y2NU38      ------------------------------------------------------------
A0A849GJU0      ------------------------------------------------------------
A0A316GHM6      ------------------------------------------------------------
A0A848VYK1      ------------------------------------------------------------
A0A7C9INT8      ------------------------------------------------------------
A0A238IZI1      ------------------------------------------------------------
A0A7Y2U0H6      ------------------------------------------------------------
A0A848WN80      ------------------------------------------------------------
A0A1I6ENM4      ------------------------------------------------------------
A0A2E2P4I0      ------------------------------------------------------------
A0A2U2CM86      ------------------------------------------------------------
A0A212AR83      ------------------------------------------------------------
A0A2M8J3R9      ------------------------------------------------------------
A0A1I6X762      ------------------------------------------------------------
A0A843YIS7      ------------------------------------------------------------
A0A0P1EFX8      ------------------------------------------------------------
A0A2G5KB39      ------------------------------------------------------------
A8LNM8          ------------------------------------------------------------
A0A844B423      ------------------------------------------------------------
A0A0T5NSU3      ------------------------------------------------------------
A0A5P9I718      ------------------------------------------------------------
A0A2N3CNV1      ------------------------------------------------------------
A0A257F1F4      ------------------------------------------------------------
A0A2D5J8T8      ------------------------------------------------------------
A0A2E3P9W6      ------------------------------------------------------------
A0A2G2B1P9      ------------------------------------------------------------
A0A258GCD5      ------------------------------------------------------------
A0A443INY4      ------------------------------------------------------------
A0A2D9YR88      ------------------------------------------------------------
A0A4Q3ZBK4      ------------------------------------------------------------
A0A1G9FY29      ------------------------------------------------------------
A0A6N9RUN2      ------------------------------------------------------------
A0A1W9HS52      RLKEKVYRLKDFVGRQTSERKKILEDLEQHRVELQRKHEVGNTQEYRREVYQRYGDVQSR
A0A2D5LFD8      KILLDQLADVYLEIAQRQRQQSLRDGLAF----LDQQKPALEAKSTAL------------
A0A4D8PLT4      RLLTIDTLLRRIEARNDDRSFTIIIEASS----VDPAKAAAIANAFGQAYLDYRTEMNRD
A0A1G3JY11      ------------------------------------------------------------
A0A3A4NIE9      ------------------------------------------------------------
A0A3A4NUI9      ------------------------------------------------------------
A0A524I3Z6      ------------------------------------------------------------
A0A524PCL7      ------------------------------------------------------------
A0A356GQV1      ------------------------------------------------------------
A0A1J5DAY8      ------------------------------------------------------------
A0A524P237      ------------------------------------------------------------
A0A4P7EP83      ------------------------------------------------------------
A0A348SRI7      ------------------------------------------------------------
A0A833GQE1      ------------------------------------------------------------
A0A661N3U1      ------------------------------------------------------------
A0A7X1T426      ------------------------------------------------------------
A0A432SAI6      ------------------------------------------------------------
A0A855HUH5      ------------------------------------------------------------
A0A6L6H5T1      ------------------------------------------------------------
A0A7V5C3K7      ------------------------------------------------------------
A0A7Y9AV38      ------------------------------------------------------------
A0A2W5J775      ------------------------------------------------------------
A0A3M3H5V6      ------------------------------------------------------------
A0A7V2YBQ6      ------------------------------------------------------------
A0A7X8Z4Y1      ------------------------------------------------------------
A0A377ZC40      ------------------------------------------------------------
A0A534XP85      ------------------------------------------------------------
A0A377LY04      STALPATTLSRTSNASRLKRRKAWPSSPDSSRKYAHVWDDAENKLNAF------------
A0A2X3K9R3      ------------------------------------------------------------
A0A484X141      --------------------------------------------MNAF------------
A0A5N9VWI6      ------------IERKSAEASKSLAFLAKQLPEVRSRLDVAENKLNAF------------
A0A5C9ABR5      ------------------------------------------------------------
A0A6D0EJQ0      ------------------------------------------------------------
A0A444R390      ------------------------------------------------------------
A0A376LLF8      ------------------------------------------------------------
A0A6L7CT21      ------------------------------------------------------------
A0A378BPJ7      ------------------------------------------------------------
A0A377ZDN3      ------------------------------------------------------------
A0A2J5PAJ7      ------------------------------------------------------------
A0A7Z9CQS8      ------------------------------------------------------------
A0A2W4RFS2      ------------------------------------------------------------
A0A1Y6DC43      ------------------------------------------------------------
A0A2S6HE06      ------------------------------------------------------------
G3J0M3          ------------------------------------------------------------
V5C6R5          ------------------------------------------------------------
A0A7V0Z1K0      ------------------------------------------------------------
A0A7Y8IFK0      ------------------------------------------------------------
A0A4Q2XLV7      ------------------------------------------------------------
A0A4Q5QYC4      ------------------------------------------------------------
A0A0U2VAW2      ------------------------------------------------------------
A0A454CTF1      ------------------------------------------------------------
A0A6B3Q2G1      LNDVVQNYFLQNVRRNSAEAEQSLNFLKGHLPEIKDKLTISEDTLNSF------------
A0A6N9S3L5      ------------------------------------------------------------
A0A656BWB0      ------------------------------------------------------------
A0A6D0IFH4      ------------------------------------------------------------
A0A0A0FHV8      ------------------------------------------------------------
A0A2I8SDU4      ------------------------------------------------------------
A0A2I8SU55      ------------------------------------------------------------
A0A7I6T806      ------------------------------------------------------------
A0A7I6TQE9      ------------------------------------------------------------
A0A7I6U296      ------------------------------------------------------------
S1EXJ6          ------------------------------------------------------------
A0A376UBS1      ------------------------------------------------------------
A0A4Q6G931      ------------------------------------------------------------
A0A2T0VBD8      ------------------------------------------------------------
A0A7W5DMU7      ------------------------------------------------------------
A0A378APS2      ------------------------------------------------------------
A0A443VCQ6      ------------------------------------------------------------
A0A447RKQ7      ------------------------------------------------------------
W1DSK1          ------------------------------------------------------------
A0A2N1XK22      ------------------------------------------------------------
A0A850R066      ------------------------------------------------------------
A0A1W9F5M9      ------------------------------------------------------------
A0A352MMI7      ------------------------------------------------------------
A0A4Z0LWV1      ------------------------------------------------------------
A0A376RY66      -------------------------------------MDVAENKLNAF------------
A0A377K431      ------------------------------------------------------------
A0A6D0I9G1      ------------------------------------------------------------
A0A379W6R2      ------------------------------------------------------------
A0A379TA56      ------------------------------------------------------------
A0A655C5P0      ------------------------------------------------------------
A0A3C2BN18      ------------------------------------------------------------
A0A447LR75      ------------------------------------------------------------
A0A759KJJ5      ------------------------------------------------------------
A0A376D8L7      ------------------------------------------------------------
A0A1V2FV46      ------------------------------------------------------------
A0A6N8QLT3      ------------------------------------------------------------
A0A376SB61      ------------------------------------------------------------
A0A3D1BYV9      ------------------------------------------------------------
A0A3P5DSS6      ---------------------------------MRNDLDLAEDKLNEY------------
A0A483YEL5      ---ISDNYLEQNIARQAAQDAKSLDFLNQQLPKVRTELNESEDKLNAY------------
A0A844PX38      -----------------------------------SELDIAESKLNEY------------
A0A8B4SQI1      LNSISENYLAQNIARQAAQDAKSLEFLSKQLPEVRSDLDQAEDKLNQY------------
A0A483QWI8      LNTISNYYLAQNIARQAAQDAKSLDFLNEQLPKVRADLDVAEDKLNQY------------
A0A483UXD3      LNTISNNYLAQNIARQAAQDAKSLDFLNEQLPKVRADLDVAEDKLNQY------------
A0A0A8J8L3      LDNISQNYLSQNVARQAAQDAKSLEFLNQQLPKVRAELDQAEDKLNVY------------
A0A660DJ38      LNSIANNYLEQNVERQAAQDAKSLDFLNQQLPKVRADLDIAEDKLNSY------------
A0A378G3G7      ------------------------------------------------------------
A0A2X5NHJ9      ------------------------------------------------------------
A0A2J4QEC3      ------------------------------------------------------------
A0A485ADM3      ------------------------------------------------------------
A0A3D0KAC8      --------------------------LNEQVPAVRRNLEAAQTALNKY------------
A0A4U9HGU4      ----------------------------MQLPKVRASLDGAEDKLSHY------------
A0A3S4JGG5      ------------------------------MPEVRSSLDSAEDKLNRF------------
A0A377ZDH2      ------------------------------------------------------------
A0A3S4HTS8      ------------------------------------------------------------
A0A3N5MZ53      ------------------------------------------------------------
A0A534E4H4      ------------------------------------------------------------
A0A534I2B6      ------------------------------------------------------------
A0A1C2JGD0      ------------------------------------------------------------
A0A259LQ70      ------------------------------------------------------------
A0A3N5PM86      ------------------------------------------------------------
A0A2E5YSA4      ------------------------------------------------------------
A0A0N0XAV4      ------------------------------------------------------------
A0A0P9QD19      ------------------------------------------------------------
F3FHG4          ------------------------------------------------------------
F3GGI0          LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTF------------
A0A0P9LE74      ------------------------------------------------------------
A0A3M4ZQ14      LEEVSHLYVRQNVERSSAEAAQRLEFLRSQLPAVRKQLEESEVALNNF------------
A0A3M5YLE8      LEEVSHLYVRQNVERSSAEAAQRLEFLRSQLPAVRKQLEESEVALNNF------------
A0A3M3RP89      LEEVSHLYVRQNVERSSAEAAQRLEFLRSQLPAVRKQLEESEVALNNF------------
A0A0P9QIY7      LEEVSHLYVRQNVERSSAEAAQRLEFLRSQLPAVRKQLEESEVALNNF------------
A0A0P9VVH7      LEEVSHLYVRQNVERSSAEAAQRLEFLRSQLPAVRKQLEESEVALNNF------------
A0A0Q0FJK6      LEEVSHLYVRQNVERSSAEAAQRLEFLRSQLPAVRKQLEESEVALNNF------------
A0A3M3LF66      LEEVSHLYVRQNVERSSAEAAQRLEFLRSQLPAVRKQLEESEVALNNF------------
A0A0P9WIR8      LEEVSHLYVRQNVERSSAEAAQRLEFLRSQLPAVRKQLEESEVALNNF------------
A0A3M3KPE5      LEEVSHLYVRQNVERSSAEAAQRLEFLRSQLPAVRKQLEESEVALNNF------------
A0A3M4C263      LEEVSHLYVRQNVERSSAEAAQRLEFLRSQLPAVRKQLEESEVALNNF------------
A0A3M5AD05      LEEVSHLYVRQNVERSSAEAAQRLEFLRSQLPAVRKQLEESEVALNNF------------
A0A0Q0D3D2      LDEVSHIYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTF------------
A0A0N0FS39      ------------------------------MPAVRKQLEDAETALNNF------------
A0A3M6GHH2      ------------------------------------------------------------
A0A0P9R9W0      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESEAALNTF------------
A0A0Q0B9T0      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESEAALNTF------------
A0A3M6CFI7      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESEAALNTF------------
A0A0P9JXN0      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESEAALNTF------------
A0A3M6FIV7      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESEAALNTF------------
A0A3M3PLW9      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTF------------
A0A3M4ENY1      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTF------------
A0A3M5EZK7      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTF------------
A0A0P9SPP5      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTF------------
A0A658KL17      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTF------------
A0A3M3NNF2      LDGVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTF------------
A0A7Z6UK49      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEEAETALNTF------------
A0A3M4A0E8      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTF------------
A0A3M4PBZ2      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTF------------
A0A7Z6U7Q8      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTF------------
A0A3M6AI26      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTF------------
A0A0P9IWP8      LDEVSHIYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTF------------
A0A0P9KZ49      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTF------------
A0A0P9V840      LDGVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTF------------
A0A0Q0AIE5      LDGVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTF------------
A0A3M2ZQH6      LDGVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTF------------
A0A0N8SQG2      LDGVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTF------------
A0A0W8HFU1      LDGVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTF------------
A0A0P9VHH8      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTF------------
A0A0P9YV98      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNNF------------
A0A3M3G2W8      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNNF------------
A0A3M6C224      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNNF------------
A0A0P9SCD7      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTF------------
A0A0P9T4G3      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTF------------
A0A0P9VKB0      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTF------------
A0A0Q0BM35      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTF------------
A0A3M3TPR7      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTF------------
A0A3M3U4Q3      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTF------------
A0A8B3FSE5      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTF------------
A0A3M5K254      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTF------------
A0A7V8M007      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTF------------
A0A3M5JFB0      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTF------------
A0A3M3TQV3      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEEAETALNTF------------
A0A3M4A376      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEEAETALNTF------------
A0A3M3EF92      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEEAETALNTF------------
A0A3M5J1E2      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEEAETALNTF------------
A0A3M5M873      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTF------------
A0A3M5G7H9      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTF------------
A0A0Q0A5T8      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEEAETALNTF------------
A0A0P9QCJ2      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEEAETALNTF------------
A0A0P9UCX7      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTF------------
A0A0P9Q329      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTF------------
A0A3M5GJ64      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTF------------
A0A0P9S1F1      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTF------------
A0A3M2XYQ3      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTF------------
A0A0P9XCE1      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTF------------
A0A3M3EFX7      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTF------------
A0A3M5B9D9      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTF------------
A0A0P9RRZ3      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTF------------
A0A3M2VEK7      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTF------------
A0A0N8R9B3      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTF------------
A0A0P9VA27      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTF------------
A0A3M4YBJ4      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTF------------
A0A0P9J470      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTF------------
A0A0Q0EVJ8      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTF------------
A0A3M5UI30      LDGVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTF------------
A0A3M5YQT8      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEEAETALNTF------------
A0A3M5F5X1      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTF------------
A0A3M5R8G1      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTF------------
A0A3M5V012      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTF------------
A0A3M3GA16      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTF------------
A0A3M3CJL0      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTF------------
A0A3M3F6F5      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTF------------
A0A3M3P9B7      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTF------------
A0A0N8QB74      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTF------------
A0A0Q0AUD0      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTF------------
A0A3M5VR55      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTF------------
A0A0Q0FK97      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTF------------
A0A3M3UCT3      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTF------------
A0A7Z6Y5I3      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTF------------
A0A3M5KZ75      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTF------------
A0A3M5L3G5      LDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTF------------
A0A7Y2TRV5      ------------------------------------------------------------
A0A318DSU0      ------------------------------------------------------------
A0A538PF21      ------------------------------------------------------------
A0A1W1ZH10      ------------------------------------------------------------
A0A1W2FF24      ------------------------------------------------------------
A0A524JYQ6      ------------------------------------------------------------
A0A4Q3MA17      ------------------------------------------------------------
A0A0N0M5F7      ------------------------------------------------------------
A0A537M754      ------------------------------------------------------------
A0A1V1PDB4      ------------------------------------------------------------
A0A2M7C324      ------------------------------------------------------------
A0A4Q3HHG6      ------------------------------------------------------------
A0A3B7DTA4      ------------------------------------------------------------
A0A432ZK62      ------------------------------------------------------------
A0A1V5EEP4      ------------------------------------------------------------
A0A1V5EF48      ------------------------------------------------------------
A0A0S6X1X6      ------------------------------------------------------------
A0A537Y5L8      ------------------------------------------------------------
A0A4Q3L2X2      ------------------------------------------------------------
A0A4Q3T8J1      ------------------------------------------------------------
A0A4Q4ANM4      ------------------------------------------------------------
A0A4Q3UEC7      ------------------------------------------------------------
A0A1H5YYQ4      ------------------------------------------------------------
A0A1X4NLK2      ------------------------------------------------------------
A0A1X4NWB5      ------------------------------------------------------------
A0A1M5UQ38      ------------------------------------------------------------
A0A327YI48      ------------------------------------------------------------
A0A1B1PNL6      ------------------------------------------------------------
A0A2U8H9H9      ------------------------------------------------------------
A0A845UXY6      ------------------------------------------------------------
A0A1X6YIC0      ------------------------------------------------------------
A0A1I5E9E9      ------------------------------------------------------------
A0A1X6Z7N7      ------------------------------------------------------------
A0A2E1DQ13      ------------------------------------------------------------
A0A1H8C800      ------------------------------------------------------------
A0A2N3EZ05      ------------------------------------------------------------
A0A844ZIR7      ------------------------------------------------------------
A0A850H7C5      ------------------------------------------------------------
A0A845AYQ8      ------------------------------------------------------------
A0A0W1DLQ3      ------------------------------------------------------------
A0A246JVD8      ------------------------------------------------------------
A0A2N3BB54      ------------------------------------------------------------
A0A1H6G7A3      ------------------------------------------------------------
A0A0A7PGL6      ------------------------------------------------------------
A0A4Q2Z4L0      ------------------------------------------------------------
A0A7W0BRL7      ------------------------------------------------------------
A0A0W1GMS6      ------------------------------------------------------------
A0A0Q8RMY3      ------------------------------------------------------------
A0A1A7QC21      ------------------------------------------------------------
A0A832FJD1      ------------------------------------------------------------
A0A7C0U459      ------------------------------------------------------------
A0A7W0ITF0      ------------------------------------------------------------
A0A832C120      ------------------------------------------------------------
A0A318CT66      ------------------------------------------------------------
A0A3N5P205      ------------------------------------------------------------
A0A2G9XLE5      ------------------------------------------------------------
A0A6L3MM74      ------------------------------------------------------------
A0A7X8CDM1      ------------------------------------------------------------
A0A7C3QM04      ------------------------------------------------------------
A0A7I8MVM0      ------------------------------------------------------------
A0A7C0Y3J7      ------------------------------------------------------------
A0A7C3LF61      ------------------------------------------------------------
A0A4R1HDF2      ------------------------------------------------------------
A0A6N1DL48      ------------------------------------------------------------
A0A534HBS8      ------------------------------------------------------------
E1Y9C0          ------------------------------------------------------------
A0A1N6SH58      ------------------------------------------------------------
A0A4Q3AQN2      ------------------------------------------------------------
                                                                            

A0A1M6N1X5      ------------------------------------------------------------
A0A561M3U0      ------MLK-----------------------------------KQLEDAEVRYTLLRNK
A0A2T4ZJZ6      --------K-----------------------------------EQMEASIVALNEYKNQ
A0A1T2KYM8      APSILSPWR---------------------------------------------------
A0A2G9ZR82      ------------------------------------------------------------
A0A6J4YZ98      --------------------------------------------ME--------------
A0A844XH11      ------------------------------------------------------------
A0A0P1H2H0      LRQKRQARR---------------------------------------------------
A0A377N8F8      ------------------------------------------------------------
A0A4Q3LR91      -----------------------------------------------MLAESRLHTGDVA
A0A6C9IKN8      ------------------------------------------------------------
A0A4V1TR68      ------MVQ---------------------------------------------------
A0A6L3ZR06      ------------------------------------------------------------
A0A3E0WKI3      ------------------------------------------------------------
A0A1H3I2J1      ISDMLDEEF---------------------------------------------------
A0A521LJG5      ------------------------------------------------------------
A0A1V4WHZ7      ------------------------------------------------------------
A0A1E5AJN5      LQGQADLVK-----------------------------------QQLTSAERELNDYAKS
A0A2N3D2J1      QQARGSAIF---------------------------------------------------
A0A2N2GVE1      LESQLLSLR-----------------------------------KKLDEDEKRLYEFKLK
A0A2N2INV3      LESQLLSLR-----------------------------------KKLDEDEKRLYDFKLK
A0A233IKJ2      LNNRMGDLR-----------------------------------EKLKESEVQLQTFLKS
A0A1Y5DXG5      LAVQLPEIK-----------------------------------KQLEVSEALFNDYQKN
A0A0B8P2H5      LQEKLPEIK-----------------------------------AELTANEDALNKYRQD
A0A380AQW6      ------------------------------------------------------------
A0A2G2GD62      IDKQLDNIN-----------------------------------KTLSKSEKVLQGFKQK
A0A524P331      VEEQLKGTR-----------------------------------EELDRAEQNLQTYKST
A0A4V1SSM5      ------------------------------------------------------------
A0A4Q3K8G7      ------------------------------------------------------------
A0A7C7W7M2      LSGRLTFLR-----------------------------------QEWKEAESRLQSYREA
A0A1M7HC79      LQEQSPELR-----------------------------------AQLADAEERLNQYRVA
A0A1D3JZN6      LNDQLPQVR-----------------------------------RDLEKAESALNSFQTR
A0A1V6ESG1      INQTFTDYS-----------------------------------AALSKAEQERVKAESQ
A0A850NXS7      ------------------------------------------------------------
A0A1H7YHK3      VKDQLLEVR-----------------------------------KQVEAAQAAMNAYQTK
A0A3S1MCW7      ------------------------------------------------------------
A0A528AX40      IQEQVLQVK-----------------------------------QKLQESEENLVAYAKD
A0A528MV95      IQEQVLQVK-----------------------------------QKLQKSEEDLVAYAKD
A0A838IR38      FDTYVSTKR-----------------------------------NELDVSRTELQEYQRD
A0A328C2K5      FDDYVSTKR-----------------------------------EELDQASSELQKYQRD
A0A5C6X8M3      FDDYVSTKR-----------------------------------EELDEARSELQKYQRD
A0A3D8MRR7      FDDYVSTKR-----------------------------------EELDESRSELQKYQRD
A0A5C6UBJ7      FDDYVSTKR-----------------------------------EELDESRSELQKYQRD
A0A5C6XGM3      FDDYVSTKR-----------------------------------EELDESRSELQKYQRD
A0A849WSS0      IRERIEESE-----------------------------------SNIKTLEEQMYEFKKE
A0A7Y3GUU1      ------------------------------------------------------------
A0A090R136      LSDHLPNIK-----------------------------------SQLTIAEDLLNAYRQE
A0A661JU93      ------------------------------------------------------------
A0A0M3GBT1      IVQRISEQK-----------------------------------ARADTAREAARSYQES
B3Q577          IVQRISEQK-----------------------------------ARADTAREAARSYQES
A0A3R9C3P5      LRQRVAEQQ-----------------------------------ARADTARDAARNYQES
A0A7W6FJX0      LRQRVAEQQ-----------------------------------ARADTARDAARNYQES
A0A2E2T3V8      IQRQLDEAR-----------------------------------KRLETVEQRHADWEKS
A0A367UAB4      IQRQLDEAR-----------------------------------KRLETVEQRHADWEKS
A0A1F2ZW35      LEQRLAELR-----------------------------------RNLQVAEEAVAAYRRD
A0A377V641      LNKQLPMVR-----------------------------------SDLDSAEDKLNDFRKR
A0A1F2YJ88      LDEQLPELK-----------------------------------QQLDVAEREFNKFRQQ
A0A5N8AL61      LRSRLDELR-----------------------------------DDVIAANRDVAQYRSS
A0A0J7XGZ1      VESQAAALR-----------------------------------KHAVADDATLQQYMIR
I4CBA7          LQNELRQAE-----------------------------------ERMRKSQEELVNFARE
A3VE95          IQEQVNEAR-----------------------------------ATVEAAEAALAEYRSD
A0A1G0NL95      IARQLPQVR-----------------------------------ARLETAEDALNRYRLA
A0A024KA69      LRAQVTVAG-----------------------------------EAVRAAQQALGLRSGF
A0A0L1KFN4      LQRQLAEYK-----------------------------------DRLDESQRQLVTYASN
A0A3D5UYX7      LNAQLILAR-----------------------------------ASLAEAQAKYNRARQL
A0A524QFS4      LESQMEVQR-----------------------------------GALNEMEQRILGFKRT
A0A832MZU0      LDKQIVEVK-----------------------------------QNLKNKGKKLQEYQQE
A0A520JSW4      LQRQIATTR-----------------------------------RDLERSERQLTAYAQA
A0A4Q3LTF3      ------------------------------------------------------------
A0A840SQK7      LAPQIEAQR-----------------------------------ERLESALTEVKAFRDS
A0A7C3N3Y1      LTAQIDQLK-----------------------------------AKVERADEALQAFGSK
A0A537UTP9      MQDRIKELR-----------------------------------VQATNAERAVEDFKAK
A0A1D2RNR5      ------------------------------------------------------------
A0A4V1TQ46      ------------------------------------------------------------
A0A3A0FZC0      LRAQADELR-----------------------------------EKVADLERELADYAEA
A0A1N7JVZ7      VHNERPRRSAEQAFPPLASDEPA---------------------PHPETSREALLAFAED
A0A091C4A8      LEERLEQLR-----------------------------------IQLEDSESRLVEFAQR
A0A844YBH7      INARLSELQ-----------------------------------RNAISTQAAVDQYRAS
A0A4R3H6P6      LEGRIEQLR-----------------------------------EKLEVSERDVVAYAAQ
A0A3S1NQ09      LQGRLTELR-----------------------------------QSSQAASLAVEKFRAE
A0A443GJ52      LQGRLTELR-----------------------------------ESSQAAALAVEKFRAE
A0A2W6S588      LKGQVEKLR-----------------------------------QQALEADAAVAAYRLK
A0A483E0N4      LNKQLPQVR-----------------------------------SDLDIAEDKLNQYRRK
A0A2J4YQQ6      LSKQLPQVR-----------------------------------SDLDQAEDKLNQYRRQ
A0A483THX4      LSQQLPKVR-----------------------------------SELDFAEDKLNLYRQQ
A0A534MVS2      GHYLVKEGW-----------------------------------LQSRDLDALLSESRRN
A0A444I5K6      LQERIEELR-----------------------------------QQALDTDLAVQKFRSE
A0A154VE85      LGGRLERLR-----------------------------------EEAAAAQQRLDAYRRE
A0A3C1S9Y1      LTERIEDER-----------------------------------KKVETAENALLQYKQE
A0A353EH49      LERQLPPLK-----------------------------------EQLDAAENAYNKYRVQ
A0A1Y1Q9C1      LEQEMEKAR-----------------------------------QRLTLQEAKLIEYAKQ
A0A3M7LJH0      LKGHLPTIK-----------------------------------TELDSAEDVLNRYRQA
A0A1E4JHX8      LEERLRQWR-----------------------------------ERLEESERVLVAYASD
M2U8P2          LRERIAELK-----------------------------------TDLQDAETQVANYRAR
A0A1H7KZF8      LESELANIR-----------------------------------TRLSESERRANDYARR
A0A6N3UC48      LKEQLPTVR-----------------------------------RQLEAAEQALNAYQAK
A0A257NG76      LEKQLPQLK-----------------------------------EQLEAATTALNDYRTR
A0A1T4TW59      LTERLAVLE-----------------------------------DSLEAAEFALTDFLRQ
A0A1Q3MB35      LEGRLAELR-----------------------------------GRLEDAQRQLVAYAAD
A0A259LUN7      LQLRVSALQ-----------------------------------EEVEEKERRVETFRAE
A0A2D7AVL1      DGETIVTLN-----------------------------------KELATAESERIAAYQK
A0A3B9KZE9      ------------------------------------------------------------
A0A358L616      LQHQLPQVR-----------------------------------GKLDEAEDKLNTYRRN
A0A4U9HNE9      LARQLPQIR-----------------------------------ASLNQAENRLNQFRRQ
A0A7X7Z1H8      LSQLDPETKVA---------------------------------ILFDTHVDSMSLYRYL
A0A7C5N053      LSEQQEKLE-----------------------------------RDLRASEEKLHDFKEE
A0A2G2CXY6      IREQLPVVR-----------------------------------QELERYEQALNEYQIS
A0A3M1D4H3      ----------------------------------------------IQETRARLARARAF
A0A7C1A2A2      LDGQLHKMR-----------------------------------DALEHADRRLADYKKT
A0A840RX77      LDKQLPDLK-----------------------------------RQLEQSEIKFNQFRNS
A0A5C8BYM7      INQTFVDFS-----------------------------------AALAKAEQERFKAESE
A0A7V2RUR3      LEERLAALK-----------------------------------REVEEAEAAVARYRAE
A0A1J5ICP0      IDEQIGILE-----------------------------------KSLRSSEGRLMSFKEK
A0A379B9V4      LNQQLPDVR-----------------------------------QKLSDSENRLNEFRLK
A0A0Q6TS97      LEGRIEQLR-----------------------------------EKLEMSERQVVAYAVQ
A0A0Q6UYB4      LEGRIEQLR-----------------------------------EKLEMSERQVVAYAVQ
W7Q5J0          LEEQTPELR-----------------------------------HQLTTAEERLNRYRAE
A0A654AKT6      --------------------------------------------INIVFAMVQFVLYYVD
A0A847E0Q2      LEAQLPELR-----------------------------------QQLETAEVALNEFRNR
A0A7W9WQN4      LEQQLPDLR-----------------------------------KQLDEAENRYNEFRNK
A0A0G9MZA5      LEEQLQQYR-----------------------------------QRLEEAERAVIAYATA
H0T8B0          LEKRVAELH-----------------------------------KQVQESLQAVQDFKFQ
A0A7Y4X614      LEEKLVELK-----------------------------------ERVEKAEAALNQYRRE
A0A5C7N981      LQEHLAQIK-----------------------------------VKLEDSEKNLNAFMRK
A0A534TV22      ---------------------------------------------------------MEN
A0A351CXR4      LNAQMTEIK-----------------------------------VDLKLAENALQDYRTE
A0A2N6GLF5      LTQRIEDLG-----------------------------------EKLKASEIALQSYRER
A0A1W9LJP0      LIDQMDEER-----------------------------------KKVEISENALLNYKEM
A0A0W1ICB0      LEGRLQGLR-----------------------------------DRLEKSERDLVNYAAR
A0A7C1C8G2      LDKQVNASK-----------------------------------IKLEKSEKELNAYARR
A0A832F8F3      VAGYLARIS-----------------------------------ELEAEQTELSQRYKPE
A0A2E0UL88      FEAQREQAK-----------------------------------IELQAARRVMEEYESK
A0A2N1WQN5      ------------------------------------------------------------
A0A0T2QIS1      LEGRLAELA-----------------------------------QRLEESERLAVNYAAR
A0A376KYN0      ------------------------------------------------------------
A0A377E5P7      LQRQLPEVR-----------------------------------SELDQAEEKLNVYRQQ
A0A2X1JB05      LQRQLPEVR-----------------------------------SELDQAEEKLNVYRQQ
A0A376RML0      LQRQLPEVR-----------------------------------SELDQAEEKLNVYRQQ
A0A6N3QTV2      LQRQLPEVR-----------------------------------SELDQAEEKLNVYRQQ
A0A0P7Y1D0      LNERLETLR-----------------------------------EEVRTDEQAVEMYRAE
A0A7Y2FUF7      IQEQVIDIK-----------------------------------GKLETSEKALVNYAKT
A0A7W6DRI0      IEDDLAPI------------------------------------EPLESREERLARREAE
A0A542J310      LGDSVARSR--------------------------------------------VPSYLVM
A0A2M7JRZ7      LTKQLEDLK-----------------------------------AKVERADEALQAFGSK
A0A167IR75      LQRQLTEYK-----------------------------------ERLDESQRQLVAYASD
A0A3B8T2U6      LNTSLAGLK-----------------------------------NNLIKSEQALNAFYEK
A0A365PWR2      LTTELPAMR-----------------------------------AKLEQSELALNRFQTQ
A0A2E9H5Z8      LENQIQQLL-----------------------------------------------TLRD
A0A2E2BR79      ISEQAPDLR-----------------------------------TQLSSAEDKLNEYRVK
A0A6I4IKZ3      LDEQLPDLK-----------------------------------KQLDDAERQFNKFRQQ
A0A7H4JZ79      LDEQLPDLK-----------------------------------KQLDDAERQFNKFRQQ
A0A0Q4Q524      LQRQLAQQK-----------------------------------ERLDESQRQLVAYASQ
A0A0Q4CFJ9      LQRQLAQQK-----------------------------------ERLDESQRQLVTYASQ
A0A0Q4FE58      LQRQLAQQK-----------------------------------ERLDESQRQLVGYASQ
A0A0Q4JWC8      LQRQLAQQK-----------------------------------ERLDESQRQLVGYASQ
A0A0Q4KFL8      LQRQLAQQK-----------------------------------ERLDESQRQLVGYASQ
A0A7W8RVL5      LSEQLPQLR-----------------------------------SDLERAEGRYNDMRNR
A0A831Y0Z8      MTSKAEQER-----------------------------------KKLEEAEQSLQKYMRD
A0A522R8R0      --------------------------------------------RAAHGLNSTSGNLLSD
A0A2U9NDY5      LRAQRPQVR-----------------------------------KELEKAEAALHDYQTS
A0A0Q4IGG1      LQRQLALQK-----------------------------------SRLDDSQRQLVAYASA
A0A352G2C2      LNEQVPAVR-----------------------------------KKLEAAQTALNKYQTG
A0A7Y3BMU7      LAKQLDSTR-----------------------------------TQLNDSEHALHEFKKQ
A0A534RUJ5      LEEKLVELK-----------------------------------ERVEKSEAALNRYRRD
V4Q8B7          LRSQLPQVR-----------------------------------KELEKAEAALNAYQTS
A0A3M1CJM3      LASQAAELK-----------------------------------TRMEQAEYQLYEYKRK
A0A2R7SVD4      LQSQLPQVK-----------------------------------RDLAKASDALNAYQTH
A0A0Q8XKK5      LESRLADLR-----------------------------------TRLETSERDLVNYAAE
A0A2E0Q2W0      ----MAEQR-----------------------------------ERLEXSEAALISXANE
A0A660NIR6      LNDRLNQLR-----------------------------------TDLENAEANLQAYREE
A0A142W0R3      LEQRIGSLR-----------------------------------RNLEDSERELITYAAN
A0A0S4XR18      VNDQLTITH-----------------------------------DNLSKSQLEIKDFKQS
A0A7C5CFF1      DTSSIQPLM-----------------------------------DSFIKSEETIRELKLQ
A0A7X6WZW5      LDEFLPQLR-----------------------------------RQLDDADNRYTAFRDQ
A0A7X2SVT1      LRTQLPAVR-----------------------------------SKLDEAEDKLNTFRRQ
A0A2E0GW64      INSQLPKVK-----------------------------------TDLNHSEKQLNDYRSQ
A0A1A7QJ97      LQRQLTDYK-----------------------------------QRLDESQRQLVTYASN
A0A832UVD3      LSERLSGLL-----------------------------------EKLKISESRLQDYRER
A0A7W5IBY1      LEQQLPDLR-----------------------------------KQLDEAENRYNEFRNK
A0A661LW70      ------------------------------------------------------TDFSSD
W7Q8F9          LEEQTPELR-----------------------------------SQLTAAEERLNSYRAE
A0A524PXH8      IAKQLDVTK-----------------------------------ARLEDSEQLLQQFARG
A0A4Q3P0E4      LDVQLPQYK-----------------------------------KQLEESEEVYNRYRNQ
A0A3M2BE89      LQGQLPKLK-----------------------------------AQLETSESRLNDYRLQ
A0A4Q4A6K6      ------------------------------------------------------NNIVVS
A0A257G674      ISGQLAEAR-----------------------------------AKLEKSERELNAYARQ
A0A661M5M6      LERQLATLR-----------------------------------QELDEAELALHNFKKG
A0A1I1UM01      AEAEAERQR-----------------------------------EEARQQAEEDARRQAQ
Q44573          LDNRTAALR-----------------------------------QRWLDAVQKANTFDNV
A2W025          LKGEEPRLK-----------------------------------ADLERAEAALTQYQRT
A0A534Z362      LGRQLRESR-----------------------------------DQVDRAEAALSRFAAE
V4J283          LEKQLPPLK-----------------------------------ARLEAAESAYNDYLRE
A0A536T443      LREQRDRAQ-----------------------------------ANLRSAEAALTQFRVH
A0A0Q4UFQ5      LEERLKQLR-----------------------------------IRIDESERALVNYASQ
A0A527W7E6      LQGRLTELR-----------------------------------ESSQAASLAVEKFRAE
A0A432EMV7      LLSNLDSLR-----------------------------------EKLSQSEARLREYKDK
A0A7Y3M8P5      LTEELDEIR-----------------------------------GRLRTGEEELAATTAR
A0A7C1SEU7      LTKQIYQSK-----------------------------------INLEKVEEELNRFARM
A0A7Y1SPC5      LNDRLTVLR-----------------------------------AEVRSAENAVEVYRGQ
A0A7V6YC94      LEHRIEQLR-----------------------------------QESLTADLAVQNFRAE
A0A534WLI3      VDRQLRDAR-----------------------------------AQVERAEGELDHFATD
A0A7V6CBY2      LSERIEELQ-----------------------------------ARVREAEAEIEKRRSE
A0A7C6FBW0      LLRARDVLR-----------------------------------EQMQSAQLALAMNEAD
A0A087LTV7      --------------------------------------------RALGLAGEQAPDWLGS
A0A7D7WSS2      --------------------------------------------RALGLAGEPAPDWLGS
A0A318KWA2      LEEQAPELR-----------------------------------TQLRAAEDSLNEYRAA
A0A522MT86      INKELPRLH-----------------------------------AELDKAEQALSSFQTK
A0A4Q3I221      --------------------------------------------LAVQKFRSSNGLVAAG
A0A534SAL6      LGRQLLESR-----------------------------------QQLEKAQDTLGRFAAD
A0A534ZDB4      LGRQLLESR-----------------------------------QQLEKAQDALGRFAAD
A0A534X3M7      LGRQLDESR-----------------------------------QQVERGEAALSRFAAE
A0A534SPC6      LGRQLRESR-----------------------------------DQVDRAEAALSRFAAE
A0A535AD60      LGRQLRESR-----------------------------------EHAERAEAALSRFAAE
A0A4Q3SY08      GERLQELQR-----------------------------------QAVADAAAVQQYRIQN
A0A7U1E9W6      --------------------------------------------TAVQQYKAANNLLGSD
A0A4Q3LG23      LGQAKERLDGSQRQLVNYASAEQI--------------------INLPAQSNGDGRVTSE
A0A522EX52      KKSLEASKS---LEFLHYQLPTVK--------------------QSLEVAEMKLNRYRAQ
A0A1H3KC95      ------------DPPPPSAESDDV--------------------PRPRRPRLVRKHRKAV
A0A5P8Z4P3      TAPEDDPER---EAEQETDPDTDDDAAEVQNFWGSDVDRDEANDEALDTADASTDVADSD
A0A2E9HXF7      RAKFEEKA----RRKAEFEERAQT--------------------EALRRVKAAREQRAAD
A0A0B3RZC9      KAKAREKAQEKLRRRAELEELARA--------------------EALRRVMAARARREAE
A0A6F8QET1      NAKAREKAQEKLRRRAELEELARA--------------------EALRRVMAARARREAE
A0A520HUH4      IANAVALAY---I-------------------------------DSTADFQASTATRQTE
A0A2K8U7M6      LAAYADEHR---IIDLDGQRTLLL--------------------ERLKALGRQETAAFAA
A0A5B9DKL8      ATAMEREHQ---AIRWLGERIKAQ--------------------RRGQTYLISVRASAGD
A0A238KJM1      ESEEEIQAR---LEA----------------------------------------EREAE
A0A3A0FJZ4      AALGDAPLA---ALPAAGREGALR--------------------KHLELEVVDGASPEAA
W4HJV8          PSNRESGPP---DTTSDEPDRGAL--------------------AESEAPPPASVETGVP
A0A0P1GDI0      QARQEALAR---KAEADARAKAEAEARAAAEERARIEAEAEQRRERARRAREALARQAAE
A0A2R8ATV5      QAKADLQRR---KAAAAARRRAEE--------------------RRAAEEQARQAAEAAE
A0A1U7D3R6      ASDAQEAAR---VAA--------A--------------------RRAERAREAMAQRKAE
A0A2D4UVV2      ASDAQEAAR---VAP--------A--------------------RRAERAREAMAQRKAE
A0A0W7WHP4      EARAAETQR---ATEEQAKRDAEA--------------------Q-----RAADAKRAAD
A0A238J8F6      EKTAAEAKR---LAALEAQKMAAE--------------------EARQKAFAEERAREAE
A0A238JQI6      QARAEEKAR---RKA-EFERIARE--------------------EALRRVAAARARREAE
A0A222E077      RAKFEEKAR---RKA-EFEERAQT--------------------EALRRVKAAREQRAAD
A0A239E3Y2      QAKSEEKAR---RKA-EFEERAQV--------------------EALRRVKAAREQRAAD
A0A1F9CFF0      ------------------------------------------------------------
A0A2M8B0G5      ------------------------------------------------------------
A0A363TNU9      ------------------------------------------------------------
A0A445MZQ4      ------------------------------------------------------------
A0A0M9E0E3      ------------------------------------------------------------
A0A351Z9A2      ------------------------------------------------------------
A0A6G6X2Z4      ------------------------------------------------------------
A0A0C5VQ86      ------------------------------------------------------------
A0A3S1WTQ1      ------------------------------------------------------------
A0A354EF47      ------------------------------------------------------------
A0A536T0W8      ------------------------------------------------------------
A0A2G6MSP7      ------------------------------------------------------------
A0A3N5FRH4      ------------------------------------------------------------
A0A1V4Y2C3      ------------------------------------------------------------
A0A2N2KTJ4      ------------------------------------------------------------
A0A2N2LQX0      ------------------------------------------------------------
A0A4U8YMP3      ------------------------------------------------------------
A0A1Q8QQ99      ------------------------------------------------------------
A0A7C2SIB2      ------------------------------------------------------------
A0A3D5ZY44      ------------------------------------------------------------
A0A1G5C236      ------------------------------------------------------------
A0A432HIS7      ------------------------------------------------------------
A0A401FQP5      ------------------------------------------------------------
A0A7C3Q9R6      ------------------------------------------------------------
A0A7C2AA26      ------------------------------------------------------------
A0A351Z4H9      ------------------------------------------------------------
A0A2N2KML4      ------------------------------------------------------------
E1YJF1          ------------------------------------------------------------
A0A1Q6DMW3      ------------------------------------------------------------
A0A3A6P8F8      ------------------------------------------------------------
A0A1J5EVZ6      ------------------------------------------------------------
A0A2G2DSM4      ------------------------------------------------------------
A0A1F9NI02      ------------------------------------------------------------
A0A4U1ABX4      ------------------------------------------------------------
A0A6L4AM84      ------------------------------------------------------------
A0A840UW68      ------------------------------------------------------------
A0A2G6FCC5      ------------------------------------------------------------
A0A1F9MR25      ------------------------------------------------------------
A0A2G6M7F1      ------------------------------------------------------------
A0A5Q2QDL1      ------------------------------------------------------------
A0A4Z0M4C7      ------------------------------------------------------------
A0A1V8MBH1      ------------------------------------------------------------
A0A7V9E085      ------------------------------------------------------------
A0A6J4X8D4      ------------------------------------------------------------
A0A1E7HSL6      ------------------------------------------------------------
A0A2M7JX59      ------------------------------------------------------------
A0A7V4PLT3      ------------------------------------------------------------
A0A7X7Y8R3      ------------------------------------------------------------
A0A832A361      ------------------------------------------------------------
A0A1M5GH86      ------------------------------------------------------------
A0A1W1XQZ5      ------------------------------------------------------------
A0A3D6C3I2      ------------------------------------------------------------
S0G1D4          ------------------------------------------------------------
A0A661T246      ------------------------------------------------------------
A0A850T4Q7      ------------------------------------------------------------
A0A2G6CSG7      ------------------------------------------------------------
A0A2G6NB59      ------------------------------------------------------------
A0A5K8A7T9      ------------------------------------------------------------
A0A1W9U045      ------------------------------------------------------------
A0A1F9L9G4      ------------------------------------------------------------
A0A328FD76      ------------------------------------------------------------
A0A348UX90      ------------------------------------------------------------
A0A357Z0N5      ------------------------------------------------------------
A0A0F2R2U0      ------------------------------------------------------------
A0A5K7ZK00      ------------------------------------------------------------
A0A5K7YCX8      ------------------------------------------------------------
A0A5K7Z388      ------------------------------------------------------------
A0A520CSP5      ------------------------------------------------------------
A0A1E7HFN0      ------------------------------------------------------------
A0A7J0BHG1      ------------------------------------------------------------
A0A6V8LMJ3      ------------------------------------------------------------
A0A2K8WHP8      ------------------------------------------------------------
A0A1J5N774      ------------------------------------------------------------
A0A2C8F781      ------------------------------------------------------------
A0A2E3R6G0      ------------------------------------------------------------
A0A7J0BUD3      ------------------------------------------------------------
A0A3M8EMP2      ------------------------------------------------------------
A0A2J6J6K6      ------------------------------------------------------------
A0A1F8XMK2      ------------------------------------------------------------
A0A661PSB9      ------------------------------------------------------------
A0A661QBT6      ------------------------------------------------------------
A0A6I2SLK2      ------------------------------------------------------------
A0A7Y7NC38      ------------------------------------------------------------
A0A0A8WSG4      ------------------------------------------------------------
S7TK97          ------------------------------------------------------------
S7UE93          ------------------------------------------------------------
A0A3D5BR56      ------------------------------------------------------------
A0A1I3PSR2      ------------------------------------------------------------
A0A2N2IB15      ------------------------------------------------------------
A0A7C8B5M6      ------------------------------------------------------------
A0A7V4UW39      ------------------------------------------------------------
A0A1W7QPT7      ------------------------------------------------------------
A0A6S6M1Y8      ------------------------------------------------------------
A0A6V8MCR2      ------------------------------------------------------------
A0A6V8N3X1      ------------------------------------------------------------
A0A6M4XJ81      ------------------------------------------------------------
A0A0M4D373      ------------------------------------------------------------
A0A1L3GKM9      ------------------------------------------------------------
A0A2T5R3J5      ------------------------------------------------------------
A0A1G6EKK9      ------------------------------------------------------------
A0A7C1DJX8      ------------------------------------------------------------
A0A3A4XVN3      ------------------------------------------------------------
A0A1E7JEV6      ------------------------------------------------------------
A0A2N2KDY5      ------------------------------------------------------------
A0A3N5YUD9      ------------------------------------------------------------
A0A4Q3ZDI7      ------------------------------------------------------------
A0A537PRC6      ------------------------------------------------------------
A0A7Y8L8B9      ------------------------------------------------------------
A0A5C4N0H6      ------------------------------------------------------------
A0A7V4UXV1      ------------------------------------------------------------
A0A7C3Y7G3      ------------------------------------------------------------
A0A7V5R3L0      ------------------------------------------------------------
A0A7V2SYN1      ------------------------------------------------------------
A0A6H9HII8      ------------------------------------------------------------
A0A7S6SHD5      ------------------------------------------------------------
A0A7C1UTU6      ------------------------------------------------------------
W9VVY5          ------------------------------------------------------------
A0A1E2URD3      ------------------------------------------------------------
A0A2T6MY81      ------------------------------------------------------------
A0A7Z0VN76      ------------------------------------------------------------
A0A2T6NBQ8      ------------------------------------------------------------
A0A421K431      ------------------------------------------------------------
A0A7C3Z8T7      ------------------------------------------------------------
A0A1V4QMH7      ------------------------------------------------------------
A0A496XZQ4      ------------------------------------------------------------
A0A7C3UZM2      ------------------------------------------------------------
A0A1F9BJF7      ------------------------------------------------------------
F2NDF5          ------------------------------------------------------------
A0A7Y4XWU8      ------------------------------------------------------------
A0A4V2SPR5      ------------------------------------------------------------
A0A7W8W7P8      ------------------------------------------------------------
A0A7W8WPN5      ------------------------------------------------------------
A0A519ERR1      ------------------------------------------------------------
A0A4Q3Q1M2      ------------------------------------------------------------
A0A4Q3MHR1      ------------------------------------------------------------
A0A520GDZ4      ------------------------------------------------------------
A0A372IH36      ------------------------------------------------------------
A0A540VW45      ------------------------------------------------------------
A0A1H9C241      ------------------------------------------------------------
A0A2E3FCR1      ------------------------------------------------------------
A0A4S3MG69      ------------------------------------------------------------
A0A3E0H727      ------------------------------------------------------------
A0A7X8XJJ0      ------------------------------------------------------------
A0A1I3TTC3      ------------------------------------------------------------
A0A1H3IZW6      ------------------------------------------------------------
A0A0M6YG59      ------------------------------------------------------------
A0A1H7G8B0      ------------------------------------------------------------
A0A2G2I5M1      ------------------------------------------------------------
A0A2G2M6F0      ------------------------------------------------------------
A0A352B502      ------------------------------------------------------------
A0A430DNP0      ------------------------------------------------------------
A0A410V446      ------------------------------------------------------------
A0A1B1UCM8      ------------------------------------------------------------
A0A1N6JQ20      ------------------------------------------------------------
A0A0R3KGJ5      ------------------------------------------------------------
A0A0R3N604      ------------------------------------------------------------
A0A1M5TI07      ------------------------------------------------------------
A3X191          ------------------------------------------------------------
A0A160UA87      ------------------------------------------------------------
A0A1Q5SFV5      ------------------------------------------------------------
A0A1H4RKV5      ------------------------------------------------------------
A0A7Z2Q199      ------------------------------------------------------------
A0A3A0FQ32      ------------------------------------------------------------
A0A7Y3GV54      ------------------------------------------------------------
A0A3E0WXH2      ------------------------------------------------------------
A0A1A9KEF8      ------------------------------------------------------------
A0A5E6PKN5      ------------------------------------------------------------
A0A0N9W1V6      ------------------------------------------------------------
A0A423GQ41      ------------------------------------------------------------
A0A423H7J2      ------------------------------------------------------------
A0A502HNM8      ------------------------------------------------------------
A0A4Q7H223      ------------------------------------------------------------
A0A1H4N2K9      ------------------------------------------------------------
A0A2K4KWF7      ------------------------------------------------------------
A0A1E4UZA0      ------------------------------------------------------------
A0A1H9KL56      ------------------------------------------------------------
A0A7X0BTK5      ------------------------------------------------------------
A0A2N2TRC8      ------------------------------------------------------------
A0A1V4CIZ7      ------------------------------------------------------------
A0A1M3BXA5      ------------------------------------------------------------
A0A1Y2R3U6      ------------------------------------------------------------
A0A167HVD6      ------------------------------------------------------------
A0A1V3SCT6      ------------------------------------------------------------
L0H287          ------------------------------------------------------------
A0A495VG93      ------------------------------------------------------------
A0A4R3MYM4      ------------------------------------------------------------
G2E3C0          ------------------------------------------------------------
A0A1W9J9F8      ------------------------------------------------------------
A0A2S5LFJ9      ------------------------------------------------------------
A0A2D8R8F8      ------------------------------------------------------------
A0A1G0KSD0      ------------------------------------------------------------
A0A4P6WX84      ------------------------------------------------------------
A0A1D2S760      ------------------------------------------------------------
A0A5B8RW94      ------------------------------------------------------------
A0A6I4JXQ8      ------------------------------------------------------------
A0A010SNS0      ------------------------------------------------------------
A0A0C2I782      ------------------------------------------------------------
A0A2N8BYF5      ------------------------------------------------------------
A0A558FKX2      ------------------------------------------------------------
A0A1H1DBA0      ------------------------------------------------------------
J3H699          ------------------------------------------------------------
A0A0K1QRZ4      ------------------------------------------------------------
A0A560RJW9      ------------------------------------------------------------
A0A5E7CRU7      ------------------------------------------------------------
A0A1H5J974      ------------------------------------------------------------
A0A5E7C564      ------------------------------------------------------------
A0A2W7MAV4      ------------------------------------------------------------
W6VFG3          ------------------------------------------------------------
A0A1P8ENT1      ------------------------------------------------------------
A0A2N7XRV4      ------------------------------------------------------------
A0A0Q6QPG8      ------------------------------------------------------------
A0A0F4SWA7      ------------------------------------------------------------
A0A423J219      ------------------------------------------------------------
A0A4P6G9U8      ------------------------------------------------------------
A0A4Y8JE06      ------------------------------------------------------------
A0A502I1X9      ------------------------------------------------------------
A0A502J776      ------------------------------------------------------------
A0A5B0EZF6      ------------------------------------------------------------
A0A059L434      ------------------------------------------------------------
A0A0F4UWN2      ------------------------------------------------------------
A0A5E7WEF5      ------------------------------------------------------------
A0A258TN88      ------------------------------------------------------------
A0A7Y8MN30      ------------------------------------------------------------
A0A3N5J7U8      ------------------------------------------------------------
A0A1S7S3I8      ------------------------------------------------------------
A0A655ZZQ1      ------------------------------------------------------------
A0A1S0ZAI3      ------------------------------------------------------------
A0A3C0L0A8      ------------------------------------------------------------
A0A176S762      ------------------------------------------------------------
A0A1W9WUD9      ------------------------------------------------------------
A0A1W1ZQK0      ------------------------------------------------------------
A0A7X1GRP5      ------------------------------------------------------------
A0A6I1R304      ------------------------------------------------------------
A0A1W9PMU6      ------------------------------------------------------------
A0A7Y4X3V7      ------------------------------------------------------------
A0A1G3VVY5      ------------------------------------------------------------
A0A7C3S273      ------------------------------------------------------------
A0A7C4WJ18      ------------------------------------------------------------
A0A351B422      ------------------------------------------------------------
F2NEE9          ------------------------------------------------------------
A0A7C3V565      ------------------------------------------------------------
A0A7V6A3E1      ------------------------------------------------------------
A0A318D3U4      ------------------------------------------------------------
A0A7V0JSN8      ------------------------------------------------------------
A0A7V5V784      ------------------------------------------------------------
A0A352Q5C1      ------------------------------------------------------------
A0A355TB56      ------------------------------------------------------------
A0A1F9E324      ------------------------------------------------------------
A0A435NNF5      ------------------------------------------------------------
A0A3S2AQS7      ------------------------------------------------------------
A0A527ZPD6      ------------------------------------------------------------
A0A529KRW3      ------------------------------------------------------------
A0A530ZLX0      ------------------------------------------------------------
A0A4Q3LBH4      ------------------------------------------------------------
A0A4Q3LWP3      ------------------------------------------------------------
A0A7C3JPP4      ------------------------------------------------------------
A0A534V9L7      ------------------------------------------------------------
A0A7C3JJT4      ------------------------------------------------------------
A0A524M660      ------------------------------------------------------------
A0A7C3JSX5      ------------------------------------------------------------
A0A7I8MQ67      ------------------------------------------------------------
A0A0C1TRU6      ------------------------------------------------------------
A0A2Z5SSF4      ------------------------------------------------------------
A0A7Y7TF97      ------------------------------------------------------------
A0A4Q4CIB1      ------------------------------------------------------------
A0A522ACJ9      ------------------------------------------------------------
A0A3N5Z7F8      ------------------------------------------------------------
A0A239HD34      ------------------------------------------------------------
A0A3D2M6Y9      ------------------------------------------------------------
A0A519E8D7      ------------------------------------------------------------
A0A3S1FD32      ------------------------------------------------------------
A0A434DUT4      ------------------------------------------------------------
A0A528D3U3      ------------------------------------------------------------
A0A3S3UPT3      ------------------------------------------------------------
A0A3S1E286      ------------------------------------------------------------
A0A531AC71      ------------------------------------------------------------
A0A436K268      ------------------------------------------------------------
A0A434IDQ0      ------------------------------------------------------------
A0A435IRM5      ------------------------------------------------------------
A0A3S2C404      ------------------------------------------------------------
A0A435F6C0      ------------------------------------------------------------
A0A435BMN6      ------------------------------------------------------------
A0A529XQ54      ------------------------------------------------------------
A0A530BJC1      ------------------------------------------------------------
A0A0P7ZZE4      ------------------------------------------------------------
A0A369R0Q9      ------------------------------------------------------------
A0A327LYE6      ------------------------------------------------------------
A0A5A9ZTV3      ------------------------------------------------------------
A0A258WKV0      ------------------------------------------------------------
A5G4N9          ------------------------------------------------------------
A0A812HT29      ------------------------------------------------------------
A0A444IY46      ------------------------------------------------------------
A0A6I7N627      ------------------------------------------------------------
A0A1V5DJV0      ------------------------------------------------------------
A0A520IUC4      ------------------------------------------------------------
A0A7Y7M8F4      ------------------------------------------------------------
A0A0P1FWI8      ------------------------------------------------------------
A0A6L8LHC6      ------------------------------------------------------------
A0A848ST88      ------------------------------------------------------------
A0A7U1HWF1      ------------------------------------------------------------
A0A534SH66      ------------------------------------------------------------
A0A3M0ZZ99      ------------------------------------------------------------
A0A238LBD3      ------------------------------------------------------------
A0A537NZJ1      ------------------------------------------------------------
A0A7C4R3C4      ------------------------------------------------------------
A0A0P1FRV5      ------------------------------------------------------------
A0A4Q4CVW6      ------------------------------------------------------------
A0A8B6LS25      ------------------------------------------------------------
A0A6L3ZWI0      ------------------------------------------------------------
A0A1M7BLL7      ------------------------------------------------------------
A0A0H4KZM1      ------------------------------------------------------------
A0A7V2W904      ------------------------------------------------------------
A0A1V1UJT2      ------------------------------------------------------------
A0A0L6CVX1      ------------------------------------------------------------
A0A1V0RR48      ------------------------------------------------------------
A0A0A0HJJ4      ------------------------------------------------------------
A0A5E7YA28      ------------------------------------------------------------
A0A316KRG4      ------------------------------------------------------------
A0A0J5Q9T7      ------------------------------------------------------------
A0A1I5YYQ0      ------------------------------------------------------------
A0A5P9FE62      ------------------------------------------------------------
A0A7U3CQW5      ------------------------------------------------------------
X7F6S5          ------------------------------------------------------------
A0A1G8NKI0      ------------------------------------------------------------
A0A355QPE4      ------------------------------------------------------------
A0A357RN98      ------------------------------------------------------------
A0A1I6U4V1      ------------------------------------------------------------
A0A6B2P8H8      ------------------------------------------------------------
A0A1P8USW9      ------------------------------------------------------------
A0A1G7CFZ2      ------------------------------------------------------------
A0A7G2TPW1      ------------------------------------------------------------
A0A1V6FYJ1      ------------------------------------------------------------
A0A4Q3IRI1      ------------------------------------------------------------
A0A7J5VV32      ------------------------------------------------------------
A0A1E7H876      ------------------------------------------------------------
A0A7C1C6X5      ------------------------------------------------------------
A0A7X1GMT8      ------------------------------------------------------------
Q44570          ------------------------------------------------------------
A0A509L3P8      ------------------------------------------------------------
A0A3A4S038      ------------------------------------------------------------
A0A1F9N669      ------------------------------------------------------------
A0A1F9PFA7      ------------------------------------------------------------
A0A1H2EN09      ------------------------------------------------------------
K0NP00          ------------------------------------------------------------
A0A2N6BZD5      ------------------------------------------------------------
A0A0F2NF69      ------------------------------------------------------------
A0A1F9NFD0      ------------------------------------------------------------
A0A1W9M770      ------------------------------------------------------------
A0A1W9M7R6      ------------------------------------------------------------
A0A7W0IR34      ------------------------------------------------------------
A0A7V5FUI1      ------------------------------------------------------------
A0A7T6AQC8      ------------------------------------------------------------
A0A7U4DQ89      ------------------------------------------------------------
A0A1M5YLH5      ------------------------------------------------------------
A0A4U1A4C7      ------------------------------------------------------------
A0A7C4N0I9      ------------------------------------------------------------
A0A1V4M8I1      ------------------------------------------------------------
A0A7C0XE92      ------------------------------------------------------------
A0A7U4QIX5      ------------------------------------------------------------
A0A800BQ44      ------------------------------------------------------------
A0A1E7JCL5      ------------------------------------------------------------
A0A7Z9XET3      ------------------------------------------------------------
A0A800C5N3      ------------------------------------------------------------
A0A496YAH9      ------------------------------------------------------------
A0A1V4S7E4      ------------------------------------------------------------
A0A847DGI3      ------------------------------------------------------------
A0A2N2H8D2      ------------------------------------------------------------
A0A2N2KC63      ------------------------------------------------------------
A0A3A4ZYW4      ------------------------------------------------------------
A0A800BMM4      ------------------------------------------------------------
A0A1V4MCJ4      ------------------------------------------------------------
A0A661M0W4      ------------------------------------------------------------
A0A3N5RNY4      ------------------------------------------------------------
A0A1M7Y300      ------------------------------------------------------------
A0A4U1ALN4      ------------------------------------------------------------
A0A849F908      ------------------------------------------------------------
A0A2N6BEI9      ------------------------------------------------------------
A0A0D5N3E9      ------------------------------------------------------------
A0A2N2G716      ------------------------------------------------------------
A0A1F9EUS2      ------------------------------------------------------------
A0A3N9VAW3      ------------------------------------------------------------
A0A6I1KNW9      ------------------------------------------------------------
A0A1H4B8T3      ------------------------------------------------------------
A0A1E7IQC3      ------------------------------------------------------------
A0A1M6KEN5      ------------------------------------------------------------
A0A1X0YE57      ------------------------------------------------------------
A0A2K2H9Q8      ------------------------------------------------------------
A0A1F8X5S3      ------------------------------------------------------------
A0A353QLL3      ------------------------------------------------------------
A0A847C207      ------------------------------------------------------------
A0A399I453      ------------------------------------------------------------
A0A651FBV9      ------------------------------------------------------------
A0A562VHD2      ------------------------------------------------------------
A0A7K0J0R7      ------------------------------------------------------------
A0A6I6JNB5      ------------------------------------------------------------
A0A847UFK5      ------------------------------------------------------------
A0A1G0LDK7      ------------------------------------------------------------
A0A6F9WVL7      ------------------------------------------------------------
A0A7Y7TLN9      ------------------------------------------------------------
A0A5C1MDH8      ------------------------------------------------------------
A0A7J4ZSX4      ------------------------------------------------------------
A0A5A9XE04      ------------------------------------------------------------
A0A643G9R1      ------------------------------------------------------------
A0A1G0M8Q7      ------------------------------------------------------------
A0A353MI14      ------------------------------------------------------------
A0A4S1CAW7      ------------------------------------------------------------
A0A655R819      ------------------------------------------------------------
A0A655RNN3      ------------------------------------------------------------
A0A354EI73      ------------------------------------------------------------
A0A6D0ELN7      ------------------------------------------------------------
A0A0B8PTA8      ------------------------------------------------------------
A0A0B8QF75      ------------------------------------------------------------
A0A4U9I390      ------------------------------------------------------------
A0A2X3M011      ------------------------------------------------------------
A0A2H9EHM4      ------------------------------------------------------------
A0A380B3D7      ------------------------------------------------------------
F5NSX0          ------------------------------------------------------------
A0A7A9K1G5      ------------------------------------------------------------
A0A811C967      ------------------------------------------------------------
A0A479JNB1      ------------------------------------------------------------
A0A5C9AF52      ------------------------------------------------------------
A0A6D0EYC7      ------------------------------------------------------------
D8EEU7          ------------------------------------------------------------
A0A0R0BVC7      ------------------------------------------------------------
A0A4U8YLL7      ------------------------------------------------------------
A0A2M7WWF7      ------------------------------------------------------------
A0A534QGR3      ------------------------------------------------------------
A0A0Q6QV61      ------------------------------------------------------------
A0A2Z3IKG4      ------------------------------------------------------------
B7RS54          ------------------------------------------------------------
A0A7R7CAD2      ------------------------------------------------------------
A0A7R7CQL5      ------------------------------------------------------------
A0A1I3XJ27      ------------------------------------------------------------
A0A562CGU2      ------------------------------------------------------------
A0A7C9VCB3      ------------------------------------------------------------
A0A1I7DCG1      ------------------------------------------------------------
A0A3A3H6D9      ------------------------------------------------------------
A0A0Q6VA36      ------------------------------------------------------------
A0A1B2EQN1      ------------------------------------------------------------
A0A1G8QZS5      ------------------------------------------------------------
A0A1H2Y469      ------------------------------------------------------------
A0A497ZQU7      ------------------------------------------------------------
A0A443K010      ------------------------------------------------------------
A0A6I7NYG5      ------------------------------------------------------------
A0A1I0R9R6      ------------------------------------------------------------
A0A2N3BVE7      ------------------------------------------------------------
A0A7C2IB02      ------------------------------------------------------------
A0A6N6SI00      ------------------------------------------------------------
A0A2S5JE21      ------------------------------------------------------------
A0A2R8BKZ2      ------------------------------------------------------------
A0A2S8S361      ------------------------------------------------------------
A0A1X7ACC1      ------------------------------------------------------------
A0A238KUF6      ------------------------------------------------------------
A0A095CTW3      ------------------------------------------------------------
A0A2E3UGD6      ------------------------------------------------------------
A0A840CE00      ------------------------------------------------------------
A0A2T0RFH0      ------------------------------------------------------------
A0A285D390      ------------------------------------------------------------
A0A497VHN4      ------------------------------------------------------------
A0A6M1UAR9      ------------------------------------------------------------
A0A520ZTR8      ------------------------------------------------------------
A0A7Y2NU38      ------------------------------------------------------------
A0A849GJU0      ------------------------------------------------------------
A0A316GHM6      ------------------------------------------------------------
A0A848VYK1      ------------------------------------------------------------
A0A7C9INT8      ------------------------------------------------------------
A0A238IZI1      ------------------------------------------------------------
A0A7Y2U0H6      ------------------------------------------------------------
A0A848WN80      ------------------------------------------------------------
A0A1I6ENM4      ------------------------------------------------------------
A0A2E2P4I0      ------------------------------------------------------------
A0A2U2CM86      ------------------------------------------------------------
A0A212AR83      ------------------------------------------------------------
A0A2M8J3R9      ------------------------------------------------------------
A0A1I6X762      ------------------------------------------------------------
A0A843YIS7      ------------------------------------------------------------
A0A0P1EFX8      ------------------------------------------------------------
A0A2G5KB39      ------------------------------------------------------------
A8LNM8          ------------------------------------------------------------
A0A844B423      ------------------------------------------------------------
A0A0T5NSU3      ------------------------------------------------------------
A0A5P9I718      ------------------------------------------------------------
A0A2N3CNV1      ------------------------------------------------------------
A0A257F1F4      ------------------------------------------------------------
A0A2D5J8T8      ------------------------------------------------------------
A0A2E3P9W6      ------------------------------------------------------------
A0A2G2B1P9      ------------------------------------------------------------
A0A258GCD5      ------------------------------------------------------------
A0A443INY4      ------------------------------------------------------------
A0A2D9YR88      ------------------------------------------------------------
A0A4Q3ZBK4      ------------------------------------------------------------
A0A1G9FY29      ------------------------------------------------------------
A0A6N9RUN2      ------------------------------------------------------------
A0A1W9HS52      LTEIERAVEINRHMEKHTESELKKIKENIVNPQLSSSELFLSQNQHRMELLQ--------
A0A2D5LFD8      LTELENFRKQNLLID--ASTEALKIEANLSS--TEQSLLSLQNTRRNLEQVRKQVAAGNL
A0A4D8PLT4      LTERVNQWLGGRLIE--AREAVRGAEEAIRSFRKENSLLELPPDGRNMVQQQMNELATQL
A0A1G3JY11      ------------------------------------------------------------
A0A3A4NIE9      ------------------------------------------------------------
A0A3A4NUI9      ------------------------------------------------------------
A0A524I3Z6      ------------------------------------------------------------
A0A524PCL7      ------------------------------------------------------------
A0A356GQV1      ------------------------------------------------------------
A0A1J5DAY8      ------------------------------------------------------------
A0A524P237      ------------------------------------------------------------
A0A4P7EP83      ------------------------------------------------------------
A0A348SRI7      ------------------------------------------------------------
A0A833GQE1      ------------------------------------------------------------
A0A661N3U1      ------------------------------------------------------------
A0A7X1T426      ------------------------------------------------------------
A0A432SAI6      ------------------------------------------------------------
A0A855HUH5      ------------------------------------------------------------
A0A6L6H5T1      ------------------------------------------------------------
A0A7V5C3K7      ------------------------------------------------------------
A0A7Y9AV38      ------------------------------------------------------------
A0A2W5J775      ------------------------------------------------------------
A0A3M3H5V6      ------------------------------------------------------------
A0A7V2YBQ6      ------------------------------------------------------------
A0A7X8Z4Y1      ------------------------------------------------------------
A0A377ZC40      ------------------------------------------------------------
A0A534XP85      ------------------------------------------------------------
A0A377LY04      ------------------------------------------------------------
A0A2X3K9R3      ------------------------------------------------------------
A0A484X141      ------------------------------------------------------------
A0A5N9VWI6      ------------------------------------------------------------
A0A5C9ABR5      ------------------------------------------------------------
A0A6D0EJQ0      ------------------------------------------------------------
A0A444R390      ------------------------------------------------------------
A0A376LLF8      ------------------------------------------------------------
A0A6L7CT21      ------------------------------------------------------------
A0A378BPJ7      ------------------------------------------------------------
A0A377ZDN3      ------------------------------------------------------------
A0A2J5PAJ7      ------------------------------------------------------------
A0A7Z9CQS8      ------------------------------------------------------------
A0A2W4RFS2      ------------------------------------------------------------
A0A1Y6DC43      ------------------------------------------------------------
A0A2S6HE06      ------------------------------------------------------------
G3J0M3          ------------------------------------------------------------
V5C6R5          ------------------------------------------------------------
A0A7V0Z1K0      ------------------------------------------------------------
A0A7Y8IFK0      ------------------------------------------------------------
A0A4Q2XLV7      ------------------------------------------------------------
A0A4Q5QYC4      ------------------------------------------------------------
A0A0U2VAW2      ------------------------------------------------------------
A0A454CTF1      ------------------------------------------------------------
A0A6B3Q2G1      ------------------------------------------------------------
A0A6N9S3L5      ------------------------------------------------------------
A0A656BWB0      ------------------------------------------------------------
A0A6D0IFH4      ------------------------------------------------------------
A0A0A0FHV8      ------------------------------------------------------------
A0A2I8SDU4      ------------------------------------------------------------
A0A2I8SU55      ------------------------------------------------------------
A0A7I6T806      ------------------------------------------------------------
A0A7I6TQE9      ------------------------------------------------------------
A0A7I6U296      ------------------------------------------------------------
S1EXJ6          ------------------------------------------------------------
A0A376UBS1      ------------------------------------------------------------
A0A4Q6G931      ------------------------------------------------------------
A0A2T0VBD8      ------------------------------------------------------------
A0A7W5DMU7      ------------------------------------------------------------
A0A378APS2      ------------------------------------------------------------
A0A443VCQ6      ------------------------------------------------------------
A0A447RKQ7      ------------------------------------------------------------
W1DSK1          ------------------------------------------------------------
A0A2N1XK22      ------------------------------------------------------------
A0A850R066      ------------------------------------------------------------
A0A1W9F5M9      ------------------------------------------------------------
A0A352MMI7      ------------------------------------------------------------
A0A4Z0LWV1      ------------------------------------------------------------
A0A376RY66      ------------------------------------------------------------
A0A377K431      ------------------------------------------------------------
A0A6D0I9G1      ------------------------------------------------------------
A0A379W6R2      ------------------------------------------------------------
A0A379TA56      ------------------------------------------------------------
A0A655C5P0      ------------------------------------------------------------
A0A3C2BN18      ------------------------------------------------------------
A0A447LR75      ------------------------------------------------------------
A0A759KJJ5      ------------------------------------------------------------
A0A376D8L7      ------------------------------------------------------------
A0A1V2FV46      ------------------------------------------------------------
A0A6N8QLT3      ------------------------------------------------------------
A0A376SB61      ------------------------------------------------------------
A0A3D1BYV9      ------------------------------------------------------------
A0A3P5DSS6      ------------------------------------------------------------
A0A483YEL5      ------------------------------------------------------------
A0A844PX38      ------------------------------------------------------------
A0A8B4SQI1      ------------------------------------------------------------
A0A483QWI8      ------------------------------------------------------------
A0A483UXD3      ------------------------------------------------------------
A0A0A8J8L3      ------------------------------------------------------------
A0A660DJ38      ------------------------------------------------------------
A0A378G3G7      ------------------------------------------------------------
A0A2X5NHJ9      ------------------------------------------------------------
A0A2J4QEC3      ------------------------------------------------------------
A0A485ADM3      ------------------------------------------------------------
A0A3D0KAC8      ------------------------------------------------------------
A0A4U9HGU4      ------------------------------------------------------------
A0A3S4JGG5      ------------------------------------------------------------
A0A377ZDH2      ------------------------------------------------------------
A0A3S4HTS8      ------------------------------------------------------------
A0A3N5MZ53      ------------------------------------------------------------
A0A534E4H4      ------------------------------------------------------------
A0A534I2B6      ------------------------------------------------------------
A0A1C2JGD0      ------------------------------------------------------------
A0A259LQ70      ------------------------------------------------------------
A0A3N5PM86      ------------------------------------------------------------
A0A2E5YSA4      ------------------------------------------------------------
A0A0N0XAV4      ------------------------------------------------------------
A0A0P9QD19      ------------------------------------------------------------
F3FHG4          ------------------------------------------------------------
F3GGI0          ------------------------------------------------------------
A0A0P9LE74      ------------------------------------------------------------
A0A3M4ZQ14      ------------------------------------------------------------
A0A3M5YLE8      ------------------------------------------------------------
A0A3M3RP89      ------------------------------------------------------------
A0A0P9QIY7      ------------------------------------------------------------
A0A0P9VVH7      ------------------------------------------------------------
A0A0Q0FJK6      ------------------------------------------------------------
A0A3M3LF66      ------------------------------------------------------------
A0A0P9WIR8      ------------------------------------------------------------
A0A3M3KPE5      ------------------------------------------------------------
A0A3M4C263      ------------------------------------------------------------
A0A3M5AD05      ------------------------------------------------------------
A0A0Q0D3D2      ------------------------------------------------------------
A0A0N0FS39      ------------------------------------------------------------
A0A3M6GHH2      ------------------------------------------------------------
A0A0P9R9W0      ------------------------------------------------------------
A0A0Q0B9T0      ------------------------------------------------------------
A0A3M6CFI7      ------------------------------------------------------------
A0A0P9JXN0      ------------------------------------------------------------
A0A3M6FIV7      ------------------------------------------------------------
A0A3M3PLW9      ------------------------------------------------------------
A0A3M4ENY1      ------------------------------------------------------------
A0A3M5EZK7      ------------------------------------------------------------
A0A0P9SPP5      ------------------------------------------------------------
A0A658KL17      ------------------------------------------------------------
A0A3M3NNF2      ------------------------------------------------------------
A0A7Z6UK49      ------------------------------------------------------------
A0A3M4A0E8      ------------------------------------------------------------
A0A3M4PBZ2      ------------------------------------------------------------
A0A7Z6U7Q8      ------------------------------------------------------------
A0A3M6AI26      ------------------------------------------------------------
A0A0P9IWP8      ------------------------------------------------------------
A0A0P9KZ49      ------------------------------------------------------------
A0A0P9V840      ------------------------------------------------------------
A0A0Q0AIE5      ------------------------------------------------------------
A0A3M2ZQH6      ------------------------------------------------------------
A0A0N8SQG2      ------------------------------------------------------------
A0A0W8HFU1      ------------------------------------------------------------
A0A0P9VHH8      ------------------------------------------------------------
A0A0P9YV98      ------------------------------------------------------------
A0A3M3G2W8      ------------------------------------------------------------
A0A3M6C224      ------------------------------------------------------------
A0A0P9SCD7      ------------------------------------------------------------
A0A0P9T4G3      ------------------------------------------------------------
A0A0P9VKB0      ------------------------------------------------------------
A0A0Q0BM35      ------------------------------------------------------------
A0A3M3TPR7      ------------------------------------------------------------
A0A3M3U4Q3      ------------------------------------------------------------
A0A8B3FSE5      ------------------------------------------------------------
A0A3M5K254      ------------------------------------------------------------
A0A7V8M007      ------------------------------------------------------------
A0A3M5JFB0      ------------------------------------------------------------
A0A3M3TQV3      ------------------------------------------------------------
A0A3M4A376      ------------------------------------------------------------
A0A3M3EF92      ------------------------------------------------------------
A0A3M5J1E2      ------------------------------------------------------------
A0A3M5M873      ------------------------------------------------------------
A0A3M5G7H9      ------------------------------------------------------------
A0A0Q0A5T8      ------------------------------------------------------------
A0A0P9QCJ2      ------------------------------------------------------------
A0A0P9UCX7      ------------------------------------------------------------
A0A0P9Q329      ------------------------------------------------------------
A0A3M5GJ64      ------------------------------------------------------------
A0A0P9S1F1      ------------------------------------------------------------
A0A3M2XYQ3      ------------------------------------------------------------
A0A0P9XCE1      ------------------------------------------------------------
A0A3M3EFX7      ------------------------------------------------------------
A0A3M5B9D9      ------------------------------------------------------------
A0A0P9RRZ3      ------------------------------------------------------------
A0A3M2VEK7      ------------------------------------------------------------
A0A0N8R9B3      ------------------------------------------------------------
A0A0P9VA27      ------------------------------------------------------------
A0A3M4YBJ4      ------------------------------------------------------------
A0A0P9J470      ------------------------------------------------------------
A0A0Q0EVJ8      ------------------------------------------------------------
A0A3M5UI30      ------------------------------------------------------------
A0A3M5YQT8      ------------------------------------------------------------
A0A3M5F5X1      ------------------------------------------------------------
A0A3M5R8G1      ------------------------------------------------------------
A0A3M5V012      ------------------------------------------------------------
A0A3M3GA16      ------------------------------------------------------------
A0A3M3CJL0      ------------------------------------------------------------
A0A3M3F6F5      ------------------------------------------------------------
A0A3M3P9B7      ------------------------------------------------------------
A0A0N8QB74      ------------------------------------------------------------
A0A0Q0AUD0      ------------------------------------------------------------
A0A3M5VR55      ------------------------------------------------------------
A0A0Q0FK97      ------------------------------------------------------------
A0A3M3UCT3      ------------------------------------------------------------
A0A7Z6Y5I3      ------------------------------------------------------------
A0A3M5KZ75      ------------------------------------------------------------
A0A3M5L3G5      ------------------------------------------------------------
A0A7Y2TRV5      ------------------------------------------------------------
A0A318DSU0      ------------------------------------------------------------
A0A538PF21      ------------------------------------------------------------
A0A1W1ZH10      ------------------------------------------------------------
A0A1W2FF24      ------------------------------------------------------------
A0A524JYQ6      ------------------------------------------------------------
A0A4Q3MA17      ------------------------------------------------------------
A0A0N0M5F7      ------------------------------------------------------------
A0A537M754      ------------------------------------------------------------
A0A1V1PDB4      ------------------------------------------------------------
A0A2M7C324      ------------------------------------------------------------
A0A4Q3HHG6      ------------------------------------------------------------
A0A3B7DTA4      ------------------------------------------------------------
A0A432ZK62      ------------------------------------------------------------
A0A1V5EEP4      ------------------------------------------------------------
A0A1V5EF48      ------------------------------------------------------------
A0A0S6X1X6      ------------------------------------------------------------
A0A537Y5L8      ------------------------------------------------------------
A0A4Q3L2X2      ------------------------------------------------------------
A0A4Q3T8J1      ------------------------------------------------------------
A0A4Q4ANM4      ------------------------------------------------------------
A0A4Q3UEC7      ------------------------------------------------------------
A0A1H5YYQ4      ------------------------------------------------------------
A0A1X4NLK2      ------------------------------------------------------------
A0A1X4NWB5      ------------------------------------------------------------
A0A1M5UQ38      ------------------------------------------------------------
A0A327YI48      ------------------------------------------------------------
A0A1B1PNL6      ------------------------------------------------------------
A0A2U8H9H9      ------------------------------------------------------------
A0A845UXY6      ------------------------------------------------------------
A0A1X6YIC0      ------------------------------------------------------------
A0A1I5E9E9      ------------------------------------------------------------
A0A1X6Z7N7      ------------------------------------------------------------
A0A2E1DQ13      ------------------------------------------------------------
A0A1H8C800      ------------------------------------------------------------
A0A2N3EZ05      ------------------------------------------------------------
A0A844ZIR7      ------------------------------------------------------------
A0A850H7C5      ------------------------------------------------------------
A0A845AYQ8      ------------------------------------------------------------
A0A0W1DLQ3      ------------------------------------------------------------
A0A246JVD8      ------------------------------------------------------------
A0A2N3BB54      ------------------------------------------------------------
A0A1H6G7A3      ------------------------------------------------------------
A0A0A7PGL6      ------------------------------------------------------------
A0A4Q2Z4L0      ------------------------------------------------------------
A0A7W0BRL7      ------------------------------------------------------------
A0A0W1GMS6      ------------------------------------------------------------
A0A0Q8RMY3      ------------------------------------------------------------
A0A1A7QC21      ------------------------------------------------------------
A0A832FJD1      ------------------------------------------------------------
A0A7C0U459      ------------------------------------------------------------
A0A7W0ITF0      ------------------------------------------------------------
A0A832C120      ------------------------------------------------------------
A0A318CT66      ------------------------------------------------------------
A0A3N5P205      ------------------------------------------------------------
A0A2G9XLE5      ------------------------------------------------------------
A0A6L3MM74      ------------------------------------------------------------
A0A7X8CDM1      ------------------------------------------------------------
A0A7C3QM04      ------------------------------------------------------------
A0A7I8MVM0      ------------------------------------------------------------
A0A7C0Y3J7      ------------------------------------------------------------
A0A7C3LF61      ------------------------------------------------------------
A0A4R1HDF2      ------------------------------------------------------------
A0A6N1DL48      ------------------------------------------------------------
A0A534HBS8      ------------------------------------------------------------
E1Y9C0          ------------------------------------------------------------
A0A1N6SH58      ------------------------------------------------------------
A0A4Q3AQN2      ------------------------------------------------------------
                                                                            

A0A1M6N1X5      ------------------------------------------------------------
A0A561M3U0      RGSVDLTE----------------------------------------------------
A0A2T4ZJZ6      KGSVNLDI----------------------------------------------------
A0A1T2KYM8      ------------------------------------------------------------
A0A2G9ZR82      ------------------------------------------------------------
A0A6J4YZ98      ------------------------------------------------------------
A0A844XH11      ------------------------------------------------------------
A0A0P1H2H0      ------------------------------------------------------------
A0A377N8F8      ------------------------------------------------------------
A0A4Q3LR91      KEQLD-------------------------------------------------------
A0A6C9IKN8      ------------------------------------------------------------
A0A4V1TR68      ------------------------------------------------------------
A0A6L3ZR06      ------------------------------------------------------------
A0A3E0WKI3      ------------------------------------------------------------
A0A1H3I2J1      ------------------------------------------------------------
A0A521LJG5      ------------------------------------------------------------
A0A1V4WHZ7      ------------------------------------------------------------
A0A1E5AJN5      ISFTDLEE------------------------------QPAILASRLSAVNDALNAAVQD
A0A2N3D2J1      ------------------------------------------------------------
A0A2N2GVE1      NNILAVSL------------------------------------EARIQSTTGLILSRSN
A0A2N2INV3      NNILAVSL------------------------------------EARIQSTTGLILSRSN
A0A233IKJ2      EGLVDIQG------------------------------VESLASQELEELTSQLNKTRDR
A0A1Y5DXG5      QKSVNISL----------------------------------------------------
A0A0B8P2H5      NESVDLGL----------------------------------------------------
A0A380AQW6      ------------------------------------------------------------
A0A2G2GD62      NNLLSLDI------------------------------KAAMVSKNVEKIGTEISSLSSE
A0A524P331      SGMIKLDA------------------------------EAEELVRKLSGIEKERAAVAMQ
A0A4V1SSM5      ------------------------------------------------------------
A0A4Q3K8G7      ------------------------------------------------------------
A0A7C7W7M2      ENIVTRSS------------------------------GENEVDEELSSLSNRYFSAREN
A0A1M7HC79      MDSVDLSS----------------------------------------------------
A0A1D3JZN6      SKSIDISL----------------------------------------------------
A0A1V6ESG1      YREMERSP----------------------------------------------------
A0A850NXS7      ------------------------------------------------------------
A0A1H7YHK3      AKSVDITM----------------------------------------------------
A0A3S1MCW7      ------------------------------------------------------------
A0A528AX40      VGITITGD------------------------------DKSLIGSNIEALNTALATAIQE
A0A528MV95      VGITITGD------------------------------EKSLIGSNIETLNTALATAIQE
A0A838IR38      NNILSLSF----------------------------EERQLLNNTELQAVSGQLREVRAT
A0A328C2K5      NNILSHSF----------------------------EDRREMAAEGLASVSEQHREVQAR
A0A5C6X8M3      NNILSHTF----------------------------EDRREMAAEGLAAVSTQLREVQAR
A0A3D8MRR7      NNILSHTF----------------------------EDRREMAAEGLAAVSTQLRDVQAR
A0A5C6UBJ7      NNILSHTF----------------------------EDRREMAAEGLAAVSTQLRDVQAR
A0A5C6XGM3      NNILSHTF----------------------------EDRREMAAEGLAAVSTQLREVQAR
A0A849WSS0      RRLVTLDS----------------------------------------------------
A0A7Y3GUU1      ------------------------------------------------------------
A0A090R136      NESIDLGL----------------------------------------------------
A0A661JU93      ------------------------------------------------------------
A0A0M3GBT1      MDVISKED------------------------------AQDERLKSLIELTGREGKIEET
B3Q577          MDVISKED------------------------------AQDERLKSLIELTGREGKIEET
A0A3R9C3P5      MDIVSKED------------------------------AQDERIKSLLELTGREGKIEES
A0A7W6FJX0      MEIVSKED------------------------------AQDERIKSLLELTGREGKIEES
A0A2E2T3V8      SGNIADRE-------------------------------RELILERIYDLNAELDTAFQE
A0A367UAB4      SGNIADRE-------------------------------RELILERIYDLNAELDTAFQE
A0A1F2ZW35      KGLAGSPE-------------------------------GAISTQTLSELNTRYTAARGR
A0A377V641      NDSVDLSL----------------------------------------------------
A0A1F2YJ88      YNTVDVTK----------------------------------------------------
A0A5N8AL61      ANLVSSGD-------------------------------DVAGQQALAGLNSQYATARAE
A0A0J7XGZ1      NNLMSAEG-------------------------------ATMAEQEVSELNRQIADAQAQ
I4CBA7          HGMVLLDD------------------------------EPELESSLLETAGKTFLDIRNE
A3VE95          ALTREGGT-------------------------------YETSTQQLGNLSSQLVVARSE
A0A1G0NL95      SSSADLEI----------------------------------------------------
A0A024KA69      EERQALAS----------------------------------------------------
A0A0L1KFN4      QEIINLPS--------------------QSVGDGSTTQERSIVVDNLAALNAALNEATAD
A0A3D5UYX7      RAQGGSVE----------------------------------------------------
A0A524QFS4      HPLETLEA----------------------------------------------------
A0A832MZU0      NSAVTMID------------------------------SPATIVNLVEEKKEVVDQIAMQ
A0A520JSW4      QRLISTSS------------------------SDEGGDTNSLTGSSLVALNTALATTQAR
A0A4Q3LTF3      -----------------------------------------------ATLNASLSQATAE
A0A840SQK7      SGLVSDDA------------------------RSDAARTISVLTARQAELSTESADAAAA
A0A7C3N3Y1      HDILSLEE------------------------------KENITMQRLADLNEALAKAEAD
A0A537UTP9      NNIVAASG-------------------------------RLMNEQQLSELNTSLIQARAL
A0A1D2RNR5      ------------------------------------------------------------
A0A4V1TQ46      -----------------------------------------MVTASLVQLNTAYAGALGA
A0A3A0FZC0      NSIVAVNK------------------------------DENITAQKMSQLNRLLTDATAK
A0A1N7JVZ7      LAFPDLTVEDDAPPARSEKPTPEAAPAAWDDTKMEGHAEADEEKPSVPPTASEPDAPNSS
A0A091C4A8      ERIVDAID------------------------------GSSLSTQSLSELNSTLAAAQDQ
A0A844YBH7      RGLSSSNS-------------------------------GTNAEQEVSNLNTELAQARAD
A0A4R3H6P6      QGIINLPS-----------------PIDPNTGGAAGGGGRSLLTDDLIALNSALEVATAE
A0A3S1NQ09      HGLAANSD------------------------------GQLMSDKQLSDLNAQLIVAQAD
A0A443GJ52      HGLAVN-D------------------------------GQLISDKKLGDLNGQLIEAQAD
A0A2W6S588      HNILTDPN-------------------------------ATLPDNELSNIGVQLSDARGA
A0A483E0N4      NDSVDLSL----------------------------------------------------
A0A2J4YQQ6      SDSVDLSL----------------------------------------------------
A0A483THX4      NDSVDLSL----------------------------------------------------
A0A534MVS2      NMLLGEAA-------------------------------------IWKKFLESAEVAEAV
A0A444I5K6      HGLVEAGS------------------------------GTLISDQQLSEINTQLINAQAE
A0A154VE85      TGMLEIGG-------------------------------GSIYRDQLTQVNAQLVAARGS
A0A3C1S9Y1      QGIITGFS----------------------------NDAEKITAEKLAKLNNQVVEFESK
A0A353EH49      HGSIDLGA----------------------------------------------------
A0A1Y1Q9C1      NNILEVNN------------------------------SQSSQERKLDELYSALGEAERA
A0A3M7LJH0      NDSIDLSL----------------------------------------------------
A0A1E4JHX8      EKIINLPA--------------------AGATRDGPTVERSIVADDLASLNAELSAAKGE
M2U8P2          TNLVDIKD------------------------------DSTAAQQILSQLGAELAQAEAE
A0A1H7KZF8      AAIIAVPA------------------------RKNQRTDATLTSDTLDRVNQQLSDAAQR
A0A6N3UC48      AGSVDITL----------------------------------------------------
A0A257NG76      HGSIDLDL----------------------------------------------------
A0A1T4TW59      EGLIELDD------------------------------IDELAGTELTNLTIRVSEAKER
A0A1Q3MB35      KQIITLAN--------------------GQDESGRTDTAETLVSNDLKVLNGALADATRA
A0A259LUN7      TGLLEAQG-------------------------------TTLTEQQIAYLTSQRSELQIE
A0A2D7AVL1      YIEAENSP----------------------------------------------------
A0A3B9KZE9      ------------------------------------------------------------
A0A358L616      NESVDMSL----------------------------------------------------
A0A4U9HNE9      NDSVDLSL----------------------------------------------------
A0A7X7Z1H8      FADFGIEE-------------------KGGERAENVLILRKYLEKRLDNGKKTILIIDEG
A0A7C5N053      HDILSVAL----------------------------DDKSSMLLSEMQAYNDALAKVRAE
A0A2G2CXY6      TQSVDITI----------------------------------------------------
A0A3M1D4H3      QGRESVDQ----------------------------------------------------
A0A7C1A2A2      SGVIAVSA------------------------------DAKAMIGQLAEYQTQRGAAELR
A0A840RX77      SGTIDLDE----------------------------------------------------
A0A5C8BYM7      YEAVRRTP----------------------------------------------------
A0A7V2RUR3      HNLVAPSG-----------------------------AGPTLSDQELAELNKELIVARAQ
A0A1J5ICP0      EKLVSLSD------------------------------DARATLQQLMNFDTELKQAEGL
A0A379B9V4      NESVDLSL----------------------------------------------------
A0A0Q6TS97      QGIINLPS------------------SVDASTSGAAVGGRSLLTDDLIALNSALEVATAE
A0A0Q6UYB4      QGIINLPS------------------SVDASTSGAAVGGRSLLTDDLIALNSALEVATAE
W7Q5J0          LDSVDLSS----------------------------------------------------
A0A654AKT6      KGLAWQLG-------------------------------PTQLAETIWGPYATRTYTNFF
A0A847E0Q2      HQTIDIPG----------------------------------------------------
A0A7W9WQN4      NGTVDLTE----------------------------------------------------
A0A0G9MZA5      QGLVSIDV-------------------PREDGDSAGTASQTLVATELAAFNSALQQATTQ
H0T8B0          NAIILGSQ------------------------------GRLASEVELDKLAKELAKSRAE
A0A7Y4X614      KGIISLDD------------------------------KENIIVNRLVDLNTRLTEAEAE
A0A5C7N981      EGIVRPDD-----------------------------KQQSPDAQVLGEFTSALAKSQGE
A0A534TV22      KSTLSLSQ----------------------------------------------------
A0A351CXR4      QGETTTRS----------------------------------------------------
A0A2N6GLF5      EKLIEVGG------------------------------VSTLTAQQLQDLGGQLVMAEQR
A0A1W9LJP0      QGIITNFS----------------------------NDAENITAEKLAKLNAQVVESESQ
A0A0W1ICB0      QGIVRLSE--------------------IQGEDGRTRTTQTLASSDLEQLNRLLVQATAE
A0A7C1C8G2      TGIISLNS------------------------------KLNLIMGQLEAVNEALAQAVTA
A0A832F8F3      FPRLVEIA----------------------------------------------------
A0A2E0UL88      VASIEPTL-----------------------------------STKITETADPMIQQLAR
A0A2N1WQN5      ------------------------------------------------------------
A0A0T2QIS1      NDIVLLGR--------------------TITPDGRTLVDRTLTSSDLEALNTALAQATAE
A0A376KYN0      ------------------------------------------------------------
A0A377E5P7      RDSVDLNL----------------------------------------------------
A0A2X1JB05      RDSVDLNL----------------------------------------------------
A0A376RML0      RDSVDLNL----------------------------------------------------
A0A6N3QTV2      RDSVDLNL----------------------------------------------------
A0A0P7Y1D0      NGLLDTGG---------------------------STLTEQQISDLNAQLAIQRAELSAA
A0A7Y2FUF7      AGITVTGN------------------------------DGSLISQNISQINAALSKAIDD
A0A7W6DRI0      ADEAEQGA----------------------------------------------------
A0A542J310      AGWTDVAE----------------------------------------------------
A0A2M7JRZ7      HDIISLEE------------------------------KENVTMQRLTELNEVLTKAESE
A0A167IR75      QEIVNLPS--------------------EGGNDGTNTQERPIVVDNLASLNAALNEATAD
A0A3B8T2U6      EKLVNIDG------------------------------VIGLASEELQRYTALFVDAQNN
A0A365PWR2      AGSVDISL----------------------------------------------------
A0A2E9H5Z8      DELIDFAE----------------------------------------------------
A0A2E2BR79      MDSVDLDS----------------------------------------------------
A0A6I4IKZ3      YNTVDVTK----------------------------------------------------
A0A7H4JZ79      YNTVDVTK----------------------------------------------------
A0A0Q4Q524      ERIINLPA---------------------QQNGDGTTSERSIVADDLASLNTALSQATAE
A0A0Q4CFJ9      ERIINLPA---------------------QSNADGSTAERSIVADDLASLNTALSQATAE
A0A0Q4FE58      ERIINLPA---------------------QSNADGSTSERSIVADDLASLNTALSQATAE
A0A0Q4JWC8      ERIINLPA---------------------QSNADGSTSERSIVADDLASLNTALSQATAE
A0A0Q4KFL8      ERIINLPA---------------------QSNADGSTSERSIVADDLASLNTALSQATAE
A0A7W8RVL5      MGVFNLSE----------------------------------------------------
A0A831Y0Z8      NNLVTLEN------------------------------RLAVYPEKLSQFSTDLSRAESE
A0A522R8R0      QQLSDLNK-----------------------------------QLILAQADTANARARYF
A0A2U9NDY5      AKAVDSSS----------------------------------------------------
A0A0Q4IGG1      QQIINLPA-------------------QGAGSGGSTTVERSIVADDLAALNATLSQATAE
A0A352G2C2      SGSVDITA----------------------------------------------------
A0A7Y3BMU7      HNVLSVSV----------------------------ENRQNLLAEEIREYNERLTDIRAR
A0A534RUJ5      KGIISLDD------------------------------KENIVVARLTDLNARLTDAEAE
V4Q8B7          SKSVDISI----------------------------------------------------
A0A3M1CJM3      QHILSVSL----------------------------EDRQNIISQRLQDLNQTLNKVQAE
A0A2R7SVD4      GKTVNISL----------------------------------------------------
A0A0Q8XKK5      KGITALGT--------------------SKSADGRTEVERTLVSSDLEALNAALASATAD
A0A2E0Q2W0      XGIVVLQR--------------------GASGDSEGGGQQTLVETRLSQLNEALAEATAR
A0A660NIR6      IGLVATPT-----------------------------SALGGNERQLDNSSDRLIAARVE
A0A142W0R3      NDIITLET-------------------RSDPGTGRTIGDRTLVAADVEKISTALSVARDA
A0A0S4XR18      NTVATIPN------------------------------SASTLLNAMVDIDTQLQQANMK
A0A7C5CFF1      QNNIEKSV----------------------------------------------------
A0A7X6WZW5      HGTFDLGT----------------------------------------------------
A0A7X2SVT1      NESVDLSL----------------------------------------------------
A0A2E0GW64      SNILDISA----------------------------------------------------
A0A1A7QJ97      QEIINLPA------------------------TSEGAQERPIVADNLAALNSALSEAIAD
A0A832UVD3      HHLVDVQG------------------------------VNSIASKQLNELTTSLMQAQRE
A0A7W5IBY1      NGTVDLTE----------------------------------------------------
A0A661LW70      VENITAQK----------------------------------LAHLNTQVVEAESNRVEA
W7Q8F9          LDSVDLSS----------------------------------------------------
A0A524PXH8      RNIYALEQ------------------------------EELVIHEKLADLNARLTEAESQ
A0A4Q3P0E4      KGTVAFDE----------------------------------------------------
A0A3M2BE89      RGSVDVGL----------------------------------------------------
A0A4Q4A6K6      DGKLIDDQ------------------------------QISELNSRLVAARALTSDSLAR
A0A257G674      AGLIRDRN--------------------PSNTIDKGSTSGSVTTASLLQVNTAANQAQAT
A0A661M5M6      HNVLSVSM----------------------------EDRQNLVASDVQTTHAKLTEIRNR
A0A1I1UM01      EDRLRAEE----------------------------------EARRQAEQDRQRAEAEAQ
Q44573          HGLTNTSE-----------------------GSTSTPLIERQIADTSANLSQAEGRLAAA
A2W025          SGSINASD----------------------------------------------------
A0A534Z362      HPNVAINE------------------------------EQKTVAQRIADVSSLLSKAEGA
V4J283          HGTIDITR----------------------------------------------------
A0A536T443      HAVRASEG--------------------PAQGPDGRRITADPTYASYVDLQVAIEALARD
A0A0Q4UFQ5      QNIVNIPG--------------------STDSNGQTTGERSLVVDDLANLNRELAQATAE
A0A527W7E6      HGLSANSD--------------------------GQLLSDKQLADLNAQLIVAQADTARA
A0A432EMV7      EGLVDSES--------------------------FAAQTSDKLGELTSELVKAKAKRAEA
A0A7Y3M8P5      GQASSRTD----------------------------------------------------
A0A7C1SEU7      SGIVSLDT------------------------------KLNSVYSQLGELNTALARAEAE
A0A7Y1SPC5      SGLLSAQG---------------------------SSLTEQQISDLNAQLIIQTADYNET
A0A7V6YC94      NNLVAVDG---------------------------QLVSEQQVAAINAELVKASSDTASA
A0A534WLI3      HPSVAVNQ------------------------------EQRLVAQRTAELSDLLTKAEAD
A0A7V6CBY2      LGLLEGNG---------------------------VTLASQQLVELNTQLVMARTARAEA
A0A7C6FBW0      YDRFIAAH-----------------------------------LETISDTGNAELTALRN
A0A087LTV7      RVKVQREG---------------------------PTYLVSVRANAPSPIEAASYANAVA
A0A7D7WSS2      RVKVQREG---------------------------PTYLVSVRANAPSPIEAASYANAVA
A0A318KWA2      QHSVDLTS------------------------------EAQAAIEQFVALDSQLNELEFR
A0A522MT86      AQSMQPTS------------------------------EAQAYLQGGIDFDRRIADLQIQ
A0A4Q3I221      SVLVADQQ----------------------------------LSELNSALIVAQSDTAKA
A0A534SAL6      HPNVAINQ------------------------------EQKTVAQRIGEVSSLLTKVEGT
A0A534ZDB4      HPNVAINE------------------------------EQKTVAQRIGEVSSLLTKVEGT
A0A534X3M7      HPNVAVNE------------------------------EQKTVAQRITDVSSLLTRAEGT
A0A534SPC6      HPNVAINE------------------------------EQKTVAQRIADVSSLLSKAEGA
A0A535AD60      HPNVAINE------------------------------EQKTVAQRISDVSSLLSKAEGT
A0A4Q3SY08      DLLSTSGA---------------------------TLTEQEISTYNQRVAEARVEAAADQ
A0A7U1E9W6      QGTLTQQE---------------------------------ISSMNTQLASARSAEAEAE
A0A4Q3LG23      RSIVADDLATINSALSQAIADRIQAEARFRQVGAAGASTEALRNSAINNLRQRRAELAAE
A0A522EX52      SGKLDIKL---------------------------------QTENFLRQLAELDKKLAEL
A0A1H3KC95      PSAPEERH----------------------------DVPSTPRATEPTVANTGDASAPPD
A0A5P8Z4P3      VAEMDQDFAPGGHPPKSAQPATVEASDMSEPLADEPNARDAESLPPQAIAPAHHPERPLR
A0A2E9HXF7      AMKAREDA----------------------------ERQESARQHREAEEARSRQEAAAK
A0A0B3RZC9      ARKAAERA----------------------------EAEAALQAEKEAEERRIQAERA--
A0A6F8QET1      AHEAAERA----------------------------EAEAALQAEKQAEERRIEAERA--
A0A520HUH4      TGQTALLRLSREAEAAAASVARYRADSGIVQGGGVGTINDQQVGPISQQLASAKAEAAAL
A0A2K8U7M6      QLAAQTEA---------------------------RQAGTDAAATDSPVIQRLQARKAEL
A0A5B9DKL8      PLMAARLANGVANA-------------------FLRIEVEGKVDDILAEQAALRDR-VIA
A0A238KJM1      LRRIALERIAARKE-----------------------------REAEKQIATERAQAEAE
A0A3A0FJZ4      VVRIAFRSPDRALA-----------------LGVVRASAEQLIAEREAERASQAQATEAL
W4HJV8          AGRVNATSLSSDSD---------------------SDSDSDSDSDSDSDSDSPEEDRSPE
A0A0P1GDI0      KQRLAEEQAKAEAEEKARLAAEAEAQAEAARLAKLAEERAAEAKRKQAELAAQRKA-EAE
A0A2R8ATV5      ERAQAKAAALARQK---------------------AEAIKRAKAEEAEEQARLKAE-AAK
A0A1U7D3R6      EARLAEEQ---RQA---------------------AAQREAERLRLEQTRAAEEAE-AAR
A0A2D4UVV2      EARLAEEQ---RQA---------------------AAQREAERLRLEQTRAAEEAE-AAR
A0A0W7WHP4      AKRAAEEQ-----------------------------------ARREAEEQARREA-AEH
A0A238J8F6      RVKAAEQAEKDRQR---------------------VEAE----KRRQAEIEAQRQA-ELA
A0A238JQI6      ARQKAEAEAAEKAR---------------------TEAEDAARKAEEARLAEERRK-AED
A0A222E077      AMKAREDA----------------------------ERQESARQHREAEEARSRQEAAAK
A0A239E3Y2      ALKASEDA----------------------------ERQERERQHREAEEARTRQE-ATK
A0A1F9CFF0      ------------------------------------------------------------
A0A2M8B0G5      ------------------------------------------------------------
A0A363TNU9      ------------------------------------------------------------
A0A445MZQ4      ------------------------------------------------------------
A0A0M9E0E3      ------------------------------------------------------------
A0A351Z9A2      ------------------------------------------------------------
A0A6G6X2Z4      ------------------------------------------------------------
A0A0C5VQ86      ------------------------------------------------------------
A0A3S1WTQ1      ------------------------------------------------------------
A0A354EF47      ------------------------------------------------------------
A0A536T0W8      ------------------------------------------------------------
A0A2G6MSP7      ------------------------------------------------------------
A0A3N5FRH4      ------------------------------------------------------------
A0A1V4Y2C3      ------------------------------------------------------------
A0A2N2KTJ4      ------------------------------------------------------------
A0A2N2LQX0      ------------------------------------------------------------
A0A4U8YMP3      ------------------------------------------------------------
A0A1Q8QQ99      ------------------------------------------------------------
A0A7C2SIB2      ------------------------------------------------------------
A0A3D5ZY44      ------------------------------------------------------------
A0A1G5C236      ------------------------------------------------------------
A0A432HIS7      ------------------------------------------------------------
A0A401FQP5      ------------------------------------------------------------
A0A7C3Q9R6      ------------------------------------------------------------
A0A7C2AA26      ------------------------------------------------------------
A0A351Z4H9      ------------------------------------------------------------
A0A2N2KML4      ------------------------------------------------------------
E1YJF1          ------------------------------------------------------------
A0A1Q6DMW3      ------------------------------------------------------------
A0A3A6P8F8      ------------------------------------------------------------
A0A1J5EVZ6      ------------------------------------------------------------
A0A2G2DSM4      ------------------------------------------------------------
A0A1F9NI02      ------------------------------------------------------------
A0A4U1ABX4      ------------------------------------------------------------
A0A6L4AM84      ------------------------------------------------------------
A0A840UW68      ------------------------------------------------------------
A0A2G6FCC5      ------------------------------------------------------------
A0A1F9MR25      ------------------------------------------------------------
A0A2G6M7F1      ------------------------------------------------------------
A0A5Q2QDL1      ------------------------------------------------------------
A0A4Z0M4C7      ------------------------------------------------------------
A0A1V8MBH1      ------------------------------------------------------------
A0A7V9E085      ------------------------------------------------------------
A0A6J4X8D4      ------------------------------------------------------------
A0A1E7HSL6      ------------------------------------------------------------
A0A2M7JX59      ------------------------------------------------------------
A0A7V4PLT3      ------------------------------------------------------------
A0A7X7Y8R3      ------------------------------------------------------------
A0A832A361      ------------------------------------------------------------
A0A1M5GH86      ------------------------------------------------------------
A0A1W1XQZ5      ------------------------------------------------------------
A0A3D6C3I2      ------------------------------------------------------------
S0G1D4          ------------------------------------------------------------
A0A661T246      ------------------------------------------------------------
A0A850T4Q7      ------------------------------------------------------------
A0A2G6CSG7      ------------------------------------------------------------
A0A2G6NB59      ------------------------------------------------------------
A0A5K8A7T9      ------------------------------------------------------------
A0A1W9U045      ------------------------------------------------------------
A0A1F9L9G4      ------------------------------------------------------------
A0A328FD76      ------------------------------------------------------------
A0A348UX90      ------------------------------------------------------------
A0A357Z0N5      ------------------------------------------------------------
A0A0F2R2U0      ------------------------------------------------------------
A0A5K7ZK00      ------------------------------------------------------------
A0A5K7YCX8      ------------------------------------------------------------
A0A5K7Z388      ------------------------------------------------------------
A0A520CSP5      ------------------------------------------------------------
A0A1E7HFN0      ------------------------------------------------------------
A0A7J0BHG1      ------------------------------------------------------------
A0A6V8LMJ3      ------------------------------------------------------------
A0A2K8WHP8      ------------------------------------------------------------
A0A1J5N774      ------------------------------------------------------------
A0A2C8F781      ------------------------------------------------------------
A0A2E3R6G0      ------------------------------------------------------------
A0A7J0BUD3      ------------------------------------------------------------
A0A3M8EMP2      ------------------------------------------------------------
A0A2J6J6K6      ------------------------------------------------------------
A0A1F8XMK2      ------------------------------------------------------------
A0A661PSB9      ------------------------------------------------------------
A0A661QBT6      ------------------------------------------------------------
A0A6I2SLK2      ------------------------------------------------------------
A0A7Y7NC38      ------------------------------------------------------------
A0A0A8WSG4      ------------------------------------------------------------
S7TK97          ------------------------------------------------------------
S7UE93          ------------------------------------------------------------
A0A3D5BR56      ------------------------------------------------------------
A0A1I3PSR2      ------------------------------------------------------------
A0A2N2IB15      ------------------------------------------------------------
A0A7C8B5M6      ------------------------------------------------------------
A0A7V4UW39      ------------------------------------------------------------
A0A1W7QPT7      ------------------------------------------------------------
A0A6S6M1Y8      ------------------------------------------------------------
A0A6V8MCR2      ------------------------------------------------------------
A0A6V8N3X1      ------------------------------------------------------------
A0A6M4XJ81      ------------------------------------------------------------
A0A0M4D373      ------------------------------------------------------------
A0A1L3GKM9      ------------------------------------------------------------
A0A2T5R3J5      ------------------------------------------------------------
A0A1G6EKK9      ------------------------------------------------------------
A0A7C1DJX8      ------------------------------------------------------------
A0A3A4XVN3      ------------------------------------------------------------
A0A1E7JEV6      ------------------------------------------------------------
A0A2N2KDY5      ------------------------------------------------------------
A0A3N5YUD9      ------------------------------------------------------------
A0A4Q3ZDI7      ------------------------------------------------------------
A0A537PRC6      ------------------------------------------------------------
A0A7Y8L8B9      ------------------------------------------------------------
A0A5C4N0H6      ------------------------------------------------------------
A0A7V4UXV1      ------------------------------------------------------------
A0A7C3Y7G3      ------------------------------------------------------------
A0A7V5R3L0      ------------------------------------------------------------
A0A7V2SYN1      ------------------------------------------------------------
A0A6H9HII8      ------------------------------------------------------------
A0A7S6SHD5      ------------------------------------------------------------
A0A7C1UTU6      ------------------------------------------------------------
W9VVY5          ------------------------------------------------------------
A0A1E2URD3      ------------------------------------------------------------
A0A2T6MY81      ------------------------------------------------------------
A0A7Z0VN76      ------------------------------------------------------------
A0A2T6NBQ8      ------------------------------------------------------------
A0A421K431      ------------------------------------------------------------
A0A7C3Z8T7      ------------------------------------------------------------
A0A1V4QMH7      ------------------------------------------------------------
A0A496XZQ4      ------------------------------------------------------------
A0A7C3UZM2      ------------------------------------------------------------
A0A1F9BJF7      ------------------------------------------------------------
F2NDF5          ------------------------------------------------------------
A0A7Y4XWU8      ------------------------------------------------------------
A0A4V2SPR5      ------------------------------------------------------------
A0A7W8W7P8      ------------------------------------------------------------
A0A7W8WPN5      ------------------------------------------------------------
A0A519ERR1      ------------------------------------------------------------
A0A4Q3Q1M2      ------------------------------------------------------------
A0A4Q3MHR1      ------------------------------------------------------------
A0A520GDZ4      ------------------------------------------------------------
A0A372IH36      ------------------------------------------------------------
A0A540VW45      ------------------------------------------------------------
A0A1H9C241      ------------------------------------------------------------
A0A2E3FCR1      ------------------------------------------------------------
A0A4S3MG69      ------------------------------------------------------------
A0A3E0H727      ------------------------------------------------------------
A0A7X8XJJ0      ------------------------------------------------------------
A0A1I3TTC3      ------------------------------------------------------------
A0A1H3IZW6      ------------------------------------------------------------
A0A0M6YG59      ------------------------------------------------------------
A0A1H7G8B0      ------------------------------------------------------------
A0A2G2I5M1      ------------------------------------------------------------
A0A2G2M6F0      ------------------------------------------------------------
A0A352B502      ------------------------------------------------------------
A0A430DNP0      ------------------------------------------------------------
A0A410V446      ------------------------------------------------------------
A0A1B1UCM8      ------------------------------------------------------------
A0A1N6JQ20      ------------------------------------------------------------
A0A0R3KGJ5      ------------------------------------------------------------
A0A0R3N604      ------------------------------------------------------------
A0A1M5TI07      ------------------------------------------------------------
A3X191          ------------------------------------------------------------
A0A160UA87      ------------------------------------------------------------
A0A1Q5SFV5      ------------------------------------------------------------
A0A1H4RKV5      ------------------------------------------------------------
A0A7Z2Q199      ------------------------------------------------------------
A0A3A0FQ32      ------------------------------------------------------------
A0A7Y3GV54      ------------------------------------------------------------
A0A3E0WXH2      ------------------------------------------------------------
A0A1A9KEF8      ------------------------------------------------------------
A0A5E6PKN5      ------------------------------------------------------------
A0A0N9W1V6      ------------------------------------------------------------
A0A423GQ41      ------------------------------------------------------------
A0A423H7J2      ------------------------------------------------------------
A0A502HNM8      ------------------------------------------------------------
A0A4Q7H223      ------------------------------------------------------------
A0A1H4N2K9      ------------------------------------------------------------
A0A2K4KWF7      ------------------------------------------------------------
A0A1E4UZA0      ------------------------------------------------------------
A0A1H9KL56      ------------------------------------------------------------
A0A7X0BTK5      ------------------------------------------------------------
A0A2N2TRC8      ------------------------------------------------------------
A0A1V4CIZ7      ------------------------------------------------------------
A0A1M3BXA5      ------------------------------------------------------------
A0A1Y2R3U6      ------------------------------------------------------------
A0A167HVD6      ------------------------------------------------------------
A0A1V3SCT6      ------------------------------------------------------------
L0H287          ------------------------------------------------------------
A0A495VG93      ------------------------------------------------------------
A0A4R3MYM4      ------------------------------------------------------------
G2E3C0          ------------------------------------------------------------
A0A1W9J9F8      ------------------------------------------------------------
A0A2S5LFJ9      ------------------------------------------------------------
A0A2D8R8F8      ------------------------------------------------------------
A0A1G0KSD0      ------------------------------------------------------------
A0A4P6WX84      ------------------------------------------------------------
A0A1D2S760      ------------------------------------------------------------
A0A5B8RW94      ------------------------------------------------------------
A0A6I4JXQ8      ------------------------------------------------------------
A0A010SNS0      ------------------------------------------------------------
A0A0C2I782      ------------------------------------------------------------
A0A2N8BYF5      ------------------------------------------------------------
A0A558FKX2      ------------------------------------------------------------
A0A1H1DBA0      ------------------------------------------------------------
J3H699          ------------------------------------------------------------
A0A0K1QRZ4      ------------------------------------------------------------
A0A560RJW9      ------------------------------------------------------------
A0A5E7CRU7      ------------------------------------------------------------
A0A1H5J974      ------------------------------------------------------------
A0A5E7C564      ------------------------------------------------------------
A0A2W7MAV4      ------------------------------------------------------------
W6VFG3          ------------------------------------------------------------
A0A1P8ENT1      ------------------------------------------------------------
A0A2N7XRV4      ------------------------------------------------------------
A0A0Q6QPG8      ------------------------------------------------------------
A0A0F4SWA7      ------------------------------------------------------------
A0A423J219      ------------------------------------------------------------
A0A4P6G9U8      ------------------------------------------------------------
A0A4Y8JE06      ------------------------------------------------------------
A0A502I1X9      ------------------------------------------------------------
A0A502J776      ------------------------------------------------------------
A0A5B0EZF6      ------------------------------------------------------------
A0A059L434      ------------------------------------------------------------
A0A0F4UWN2      ------------------------------------------------------------
A0A5E7WEF5      ------------------------------------------------------------
A0A258TN88      ------------------------------------------------------------
A0A7Y8MN30      ------------------------------------------------------------
A0A3N5J7U8      ------------------------------------------------------------
A0A1S7S3I8      ------------------------------------------------------------
A0A655ZZQ1      ------------------------------------------------------------
A0A1S0ZAI3      ------------------------------------------------------------
A0A3C0L0A8      ------------------------------------------------------------
A0A176S762      ------------------------------------------------------------
A0A1W9WUD9      ------------------------------------------------------------
A0A1W1ZQK0      ------------------------------------------------------------
A0A7X1GRP5      ------------------------------------------------------------
A0A6I1R304      ------------------------------------------------------------
A0A1W9PMU6      ------------------------------------------------------------
A0A7Y4X3V7      ------------------------------------------------------------
A0A1G3VVY5      ------------------------------------------------------------
A0A7C3S273      ------------------------------------------------------------
A0A7C4WJ18      ------------------------------------------------------------
A0A351B422      ------------------------------------------------------------
F2NEE9          ------------------------------------------------------------
A0A7C3V565      ------------------------------------------------------------
A0A7V6A3E1      ------------------------------------------------------------
A0A318D3U4      ------------------------------------------------------------
A0A7V0JSN8      ------------------------------------------------------------
A0A7V5V784      ------------------------------------------------------------
A0A352Q5C1      ------------------------------------------------------------
A0A355TB56      ------------------------------------------------------------
A0A1F9E324      -----------------------------------MKLSENYKSEYPEMKRLRNQMETIQ
A0A435NNF5      ------------------------------------------------------------
A0A3S2AQS7      ------------------------------------------------------------
A0A527ZPD6      ------------------------------------------------------------
A0A529KRW3      ------------------------------------------------------------
A0A530ZLX0      ------------------------------------------------------------
A0A4Q3LBH4      --------------------VQLLLERRADIQGQYQQQLATRQEDYPTVAAAKAQLRELD
A0A4Q3LWP3      ------------------MNRQWLLVLRS--------QLSIHREDFPAVVEITAQMRELA
A0A7C3JPP4      ------------------------------------------------------------
A0A534V9L7      ------------------------------------------------------------
A0A7C3JJT4      ------------------------------------------------------------
A0A524M660      ------------------------------------------------------------
A0A7C3JSX5      ------------------------------------------------------------
A0A7I8MQ67      ------------------------------------------------------------
A0A0C1TRU6      ------------------------------------------------------------
A0A2Z5SSF4      ------------------------------------------------------------
A0A7Y7TF97      -----------------------------------METDPGRHRAAAGGNRPVPFLCHGS
A0A4Q4CIB1      ------------------------------------------------------------
A0A522ACJ9      ------------------------------------------------------------
A0A3N5Z7F8      ------------------------------------------------------------
A0A239HD34      ------------------------------------------------------------
A0A3D2M6Y9      ------------------------------------------------------------
A0A519E8D7      ------------------------------------------------------------
A0A3S1FD32      ---------AAQGKSSVDNQTQVKLRELDQQATALTTLYQTFLGRYEEAAQQQSFPVGKI
A0A434DUT4      ------NVALAAGKSSIDNQTQVQLRELEQKATALSTLYQTFLGRYEEASQQQSFPVGKI
A0A528D3U3      ------------------------------------------------------------
A0A3S3UPT3      ------------------------------------------------------------
A0A3S1E286      ------------------------------------------------------------
A0A531AC71      ------------------------------------------------------------
A0A436K268      ------------------------------------------------------------
A0A434IDQ0      ------------------------------------------------------------
A0A435IRM5      ------------------------------------------------------------
A0A3S2C404      ------------------------------------------------------------
A0A435F6C0      ------------------------------------------------------------
A0A435BMN6      ------------------------------------------------------------
A0A529XQ54      ------------------------------------------------------------
A0A530BJC1      ------------------------------------------------------------
A0A0P7ZZE4      ------------------------------------------------------------
A0A369R0Q9      ------------------------------------------------------------
A0A327LYE6      ------------------------------------------------------MPDIST
A0A5A9ZTV3      ------------------------------------------------------MPDIST
A0A258WKV0      ------------------------GKIGLSGAARNQFITEVFRLRSIEASSAVDTLVEQD
A5G4N9          --------------------------------------MEAMEPHTEVLEPPMDVLEPHM
A0A812HT29      ------------------------------------------------------MLGSQK
A0A444IY46      --------------------------------------------------MEVQAQDQKQ
A0A6I7N627      -------------------------------------------------------IDQRE
A0A1V5DJV0      ------------------------------------------------MMQQLPVAEREL
A0A520IUC4      --------------------VQALRAERAKLEADYRERLATFKPDFPDMVALRNRIQEID
A0A7Y7M8F4      --------------------------VTGRIAASVTKDLSGAEARVAALSRAVANLQRQV
A0A0P1FWI8      -----------------------MVEQNKRYRRK----TRQQPPKSPGF---LGPKNLSE
A0A6L8LHC6      -----------------------MVEQSRKFRRK----QRPQQDEARGFPRPPRPPRLSE
A0A848ST88      ------------------------LTQRFLRQRRGAIQYDILEQEVDTNAELVEALSRRA
A0A7U1HWF1      ------------------------------------------------------------
A0A534SH66      ------------------------METGHALHASLLKQQMETAVNSELAASNVRVIERAE
A0A3M0ZZ99      ---------------------------MEALRGELAAIEGREAEVTAELRRALQQGNLSA
A0A238LBD3      --------------------------MNAKYSRRTGRPRLDASERARLLAEIAKLGAPAT
A0A537NZJ1      --------------------MTRPASVRMRMKRR--------------------------
A0A7C4R3C4      ------------MGKISEALSRFTEESRNRPKEQEPPPLAPEAALEASDFAALAGYDPLS
A0A0P1FRV5      -----------------------MVEQSKRFRRG----MRQRPAKAPEEAPVDPPVEASV
A0A4Q4CVW6      --------------------------------------SQEIGKVGEALRSELAVLDRNG
A0A8B6LS25      ------MERDVKVNTDLYSSLLNNAMQLRLVKEG----KVGNVRVLDEAILPEAPIKPQR
A0A6L3ZWI0      ------------------------------------------------------------
A0A1M7BLL7      ------MPWRATSLWALSGDGAMKLSRYEAHMRRRAARRDALENPHSHSPDQEDILSPEA
A0A0H4KZM1      --------------------------MEKRWTRK------KRASREAGGPAPKPALTGPI
A0A7V2W904      --------------------------------------VRAKERSLEAELARVKRAATSY
A0A1V1UJT2      ----------------------MNLSRHDAYMRR----REARRAAEEAGEMPEPVYEESC
A0A0L6CVX1      ------------------------------------------------------------
A0A1V0RR48      ------------------------------------------------------------
A0A0A0HJJ4      ----------------------MTLKRHEEYMRR----RAARRAEMEA----------EA
A0A5E7YA28      ----------------------MSLTRHEEYMRR----RAARRAALEA----------EA
A0A316KRG4      ------------------------MTEQPKFQRR----KRRGADAPVDTPDHRPSNAQKP
A0A0J5Q9T7      ------------------------MAERRKFHRRHGPTQDATGTQPAEDLAPISPLETRA
A0A1I5YYQ0      ------------------------MSADRTFRRK----NRPVRAREEDDMRPVAPLERPK
A0A5P9FE62      ------------------------MSADRTFRRK----NRPVRAREEDDMRPVAPLERPK
A0A7U3CQW5      ----------------------MNMMDRPRFRRK--HQTATGRKASDESAAPVPPLESRA
X7F6S5          ------------------------MAAGPRFRRR-----KGRAAPAEDDLRPVPPLASRE
A0A1G8NKI0      ----------------------MTMSERRPFRRR----NRPEDTPPP---APTPRPDPQA
A0A355QPE4      ----------------------MTMSERRPFRRR----NRPEDTPAP---APAPRPDPQA
A0A357RN98      ----------------------MTMSERRPFRRR----NRPEDTPAP---APAPRPDPQA
A0A1I6U4V1      ------------------------MVERRKFSRR----KRAEELPED---PPILPLERRE
A0A6B2P8H8      ------------------------MVERRRFRRR----KRSEETPED---PPILPLERRE
A0A1P8USW9      ----------------------MNMVDRRKFRRKFGRTEAPAPETQPED-PPIEPLESRE
A0A1G7CFZ2      ----------------------MTMTERRRFRRR----NRPLDDLPDEDISPVEPLATRA
A0A7G2TPW1      ------------------------MTERRRFRRR----NRPLDDLPDENISPVEPLGTRA
A0A1V6FYJ1      ------------------------------------------------------------
A0A4Q3IRI1      ------------------------------------------------------------
A0A7J5VV32      ------------------------------------------------------------
A0A1E7H876      ------------------------------------------------------------
A0A7C1C6X5      ------------------------------------------------------------
A0A7X1GMT8      ------------------------------------------------------------
Q44570          ------------------------------------------------------------
A0A509L3P8      ------------------------------------------------------------
A0A3A4S038      ------------------------------------------------------------
A0A1F9N669      ------------------------------------------------------------
A0A1F9PFA7      ------------------------------------------------------------
A0A1H2EN09      ------------------------------------------------------------
K0NP00          ------------------------------------------------------------
A0A2N6BZD5      ------------------------------------------------------------
A0A0F2NF69      ------------------------------------------------------------
A0A1F9NFD0      ------------------------------------------------------------
A0A1W9M770      ------------------------------------------------------------
A0A1W9M7R6      ------------------------------------------------------------
A0A7W0IR34      ------------------------------------------------------------
A0A7V5FUI1      ------------------------------------------------------------
A0A7T6AQC8      ------------------------------------------------------------
A0A7U4DQ89      ------------------------------------------------------------
A0A1M5YLH5      ------------------------------------------------------------
A0A4U1A4C7      ------------------------------------------------------------
A0A7C4N0I9      ------------------------------------------------------------
A0A1V4M8I1      ------------------------------------------------------------
A0A7C0XE92      ------------------------------------------------------------
A0A7U4QIX5      ------------------------------------------------------------
A0A800BQ44      ------------------------------------------------------------
A0A1E7JCL5      ------------------------------------------------------------
A0A7Z9XET3      ------------------------------------------------------------
A0A800C5N3      ------------------------------------------------------------
A0A496YAH9      ------------------------------------------------------------
A0A1V4S7E4      ------------------------------------------------------------
A0A847DGI3      ------------------------------------------------------------
A0A2N2H8D2      ------------------------------------------------------------
A0A2N2KC63      ------------------------------------------------------------
A0A3A4ZYW4      ------------------------------------------------------------
A0A800BMM4      ------------------------------------------------------------
A0A1V4MCJ4      ------------------------------------------------------------
A0A661M0W4      ------------------------------------------------------------
A0A3N5RNY4      ------------------------------------------------------------
A0A1M7Y300      ------------------------------------------------------------
A0A4U1ALN4      ------------------------------------------------------------
A0A849F908      ------------------------------------------------------------
A0A2N6BEI9      ------------------------------------------------------------
A0A0D5N3E9      ------------------------------------------------------------
A0A2N2G716      ------------------------------------------------------------
A0A1F9EUS2      ------------------------------------------------------------
A0A3N9VAW3      ------------------------------------------------------------
A0A6I1KNW9      ------------------------------------------------------------
A0A1H4B8T3      ------------------------------------------------------------
A0A1E7IQC3      ------------------------------------------------------------
A0A1M6KEN5      ------------------------------------------------------------
A0A1X0YE57      ------------------------------------------------------------
A0A2K2H9Q8      ------------------------------------------------------------
A0A1F8X5S3      ------------------------------------------------------------
A0A353QLL3      ------------------------------------------------------------
A0A847C207      ------------------------------------------------------------
A0A399I453      ------------------------------------------------------------
A0A651FBV9      ------------------------------------------------------------
A0A562VHD2      ------------------------------------------------------------
A0A7K0J0R7      ------------------------------------------------------------
A0A6I6JNB5      ------------------------------------------------------------
A0A847UFK5      ------------------------------------------------------------
A0A1G0LDK7      ------------------------------------------------------------
A0A6F9WVL7      ------------------------------------------------------------
A0A7Y7TLN9      ------------------------------------------------------------
A0A5C1MDH8      ------------------------------------------------------------
A0A7J4ZSX4      ------------------------------------------------------------
A0A5A9XE04      ------------------------------------------------------------
A0A643G9R1      ------------------------------------------------------------
A0A1G0M8Q7      ------------------------------------------------------------
A0A353MI14      ------------------------------------------------------------
A0A4S1CAW7      ------------------------------------------------------------
A0A655R819      ------------------------------------------------------------
A0A655RNN3      ------------------------------------------------------------
A0A354EI73      ------------------------------------------------------------
A0A6D0ELN7      ------------------------------------------------------------
A0A0B8PTA8      ------------------------------------------------------------
A0A0B8QF75      ------------------------------------------------------------
A0A4U9I390      ------------------------------------------------------------
A0A2X3M011      ------------------------------------------------------------
A0A2H9EHM4      ------------------------------------------------------------
A0A380B3D7      ------------------------------------------------------------
F5NSX0          ------------------------------------------------------------
A0A7A9K1G5      ---------------------------NIARQAAQDSQSLEFLQRQLPEVRSELDQAEEK
A0A811C967      -------------------------------------------------MRSELDQAEEK
A0A479JNB1      ------------------------------------------------------------
A0A5C9AF52      ------------------------------------------------------------
A0A6D0EYC7      ------------------------------------------------------------
D8EEU7          ------------------------------------------------------------
A0A0R0BVC7      ------------------------------------------------------------
A0A4U8YLL7      ------------------------------------------------------------
A0A2M7WWF7      ------------------------------------------------------------
A0A534QGR3      ------------------------------------------------------------
A0A0Q6QV61      ------------------------------------------------------------
A0A2Z3IKG4      ------------------------------------------------------------
B7RS54          ------------------------------------------------------------
A0A7R7CAD2      ------------------------------------------------------------
A0A7R7CQL5      ------------------------------------------------------------
A0A1I3XJ27      ------------------------------------------------------------
A0A562CGU2      ------------------------------------------------------------
A0A7C9VCB3      ------------------------------------------------------------
A0A1I7DCG1      ------------------------------------------------------------
A0A3A3H6D9      ------------------------------------------------------------
A0A0Q6VA36      ------------------------------------------------------------
A0A1B2EQN1      ------------------------------------------------------------
A0A1G8QZS5      ------------------------------------------------------------
A0A1H2Y469      ------------------------------------------------------------
A0A497ZQU7      ------------------------------------------------------------
A0A443K010      ------------------------------------------------------------
A0A6I7NYG5      ------------------------------------------------------------
A0A1I0R9R6      ------------------------------------------------------------
A0A2N3BVE7      ------------------------------------------------------------
A0A7C2IB02      ------------------------------------------------------------
A0A6N6SI00      ------------------------------------------------------------
A0A2S5JE21      ------------------------------------------------------------
A0A2R8BKZ2      ------------------------------------------------------------
A0A2S8S361      ------------------------------------------------------------
A0A1X7ACC1      ------------------------------------------------------------
A0A238KUF6      ------------------------------------------------------------
A0A095CTW3      ------------------------------------------------------------
A0A2E3UGD6      ------------------------------------------------------------
A0A840CE00      ------------------------------------------------------------
A0A2T0RFH0      ------------------------------------------------------------
A0A285D390      ------------------------------------------------------------
A0A497VHN4      ------------------------------------------------------------
A0A6M1UAR9      ------------------------------------------------------------
A0A520ZTR8      ------------------------------------------------------------
A0A7Y2NU38      ------------------------------------------------------------
A0A849GJU0      ------------------------------------------------------------
A0A316GHM6      ------------------------------------------------------------
A0A848VYK1      ------------------------------------------------------------
A0A7C9INT8      ------------------------------------------------------------
A0A238IZI1      ------------------------------------------------------------
A0A7Y2U0H6      ------------------------------------------------------------
A0A848WN80      ------------------------------------------------------------
A0A1I6ENM4      ------------------------------------------------------------
A0A2E2P4I0      ------------------------------------------------------------
A0A2U2CM86      ------------------------------------------------------------
A0A212AR83      ------------------------------------------------------------
A0A2M8J3R9      ------------------------------------------------------------
A0A1I6X762      ------------------------------------------------------------
A0A843YIS7      ------------------------------------------------------------
A0A0P1EFX8      ------------------------------------------------------------
A0A2G5KB39      ------------------------------------------------------------
A8LNM8          ------------------------------------------------------------
A0A844B423      ------------------------------------------------------------
A0A0T5NSU3      ------------------------------------------------------------
A0A5P9I718      ------------------------------------------------------------
A0A2N3CNV1      ------------------------------------------------------------
A0A257F1F4      ------------------------------------------------------------
A0A2D5J8T8      ------------------------------------------------------------
A0A2E3P9W6      ------------------------------------------------------------
A0A2G2B1P9      ------------------------------------------------------------
A0A258GCD5      ------------------------------------------------------------
A0A443INY4      ------------------------------------------------------------
A0A2D9YR88      ------------------------------------------------------------
A0A4Q3ZBK4      ------------------------------------------------------------
A0A1G9FY29      ------------------------------------------------------------
A0A6N9RUN2      ------------------------------------------------------------
A0A1W9HS52      ----YQKALLENDTSPDSKTRKDEIQSELDTV-AQNLQKAIQEADQSGNLTFVSPQEYYK
A0A2D5LFD8      NSFDFQGSIISGGGASTSGTTETAGSSLSGSIGISGIDSXLEEELTTLKEALYEARSIYQ
A0A4D8PLT4      TAAQAQKAAAEARVRQAREQTAANNAAAIPEVLASPLIQKLREAEAMLERRLAELQQVYG
A0A1G3JY11      ------------------------------------------------------------
A0A3A4NIE9      ------------------------------------------------------------
A0A3A4NUI9      ------------------------------------------------------------
A0A524I3Z6      ------------------------------------------------------------
A0A524PCL7      ------------------------------------------------------------
A0A356GQV1      ------------------------------------------------------------
A0A1J5DAY8      ------------------------------------------------------------
A0A524P237      ------------------------------------------------------------
A0A4P7EP83      ------------------------------------------------------------
A0A348SRI7      ------------------------------------------------------------
A0A833GQE1      ------------------------------------------------------------
A0A661N3U1      ------------------------------------------------------------
A0A7X1T426      ------------------------------------------------------------
A0A432SAI6      ------------------------------------------------------------
A0A855HUH5      ------------------------------------------------------------
A0A6L6H5T1      ------------------------------------------------------------
A0A7V5C3K7      ------------------------------------------------------------
A0A7Y9AV38      ------------------------------------------------------------
A0A2W5J775      ------------------------------------------------------------
A0A3M3H5V6      ------------------------------------------------------------
A0A7V2YBQ6      ------------------------------------------------------------
A0A7X8Z4Y1      ------------------------------------------------------------
A0A377ZC40      ------------------------------------------------------------
A0A534XP85      ------------------------------------------------------------
A0A377LY04      ------------------RQDKDSVDLPLEAKSVLDSMVNIDAQLNELTFKEAEISKLYT
A0A2X3K9R3      ------------------------MDLPLEAKAVLDSMVNIDAQLNELTFKEAEISKLFT
A0A484X141      ------------------RQDKDSVDLPLEAKAVLDSMVNIDAQLNELTFKEAEISKLYT
A0A5N9VWI6      ------------------RQDKDSVDLPLEAKAVLDSMVNIDAQLNELTFKEAEISKLYT
A0A5C9ABR5      ------------------------------------------------------------
A0A6D0EJQ0      ------------------------------------------------------------
A0A444R390      ------------------------------------------------------------
A0A376LLF8      ------------------------------------------------------------
A0A6L7CT21      ------------------------------------------------------------
A0A378BPJ7      ------------------------------------------------------------
A0A377ZDN3      ------------------------------------------------------------
A0A2J5PAJ7      ------------------------------------------------------------
A0A7Z9CQS8      ------------------------------------------------------------
A0A2W4RFS2      ------------------------------------------------------------
A0A1Y6DC43      ------------------------------------------------------------
A0A2S6HE06      ------------------------------------------------------------
G3J0M3          ------------------------------------------------------------
V5C6R5          ------------------------------------------------------------
A0A7V0Z1K0      ------------------------------------------------------------
A0A7Y8IFK0      ------------------------------------------------------------
A0A4Q2XLV7      ------------------------------------------------------------
A0A4Q5QYC4      ------------------------------------------------------------
A0A0U2VAW2      -------------------------------------------MLTDWHY----------
A0A454CTF1      ------------------------------------MMVALEAQLNELTFKESEISQKFT
A0A6B3Q2G1      ------------------RQENESIDLNLEAQSTLKVMVALEAQLNELTFKESEISQKFT
A0A6N9S3L5      ------------------------------------------------------------
A0A656BWB0      ------------------------------------------------------------
A0A6D0IFH4      ------------------------------------------------------------
A0A0A0FHV8      ------------------------------------------------------------
A0A2I8SDU4      ------------------------------------------------------------
A0A2I8SU55      ------------------------------------------------------------
A0A7I6T806      ------------------------------------------------------------
A0A7I6TQE9      ------------------------------------------------------------
A0A7I6U296      ------------------------------------------------------------
S1EXJ6          ------------------------------------------------------------
A0A376UBS1      ------------------------------------------------------------
A0A4Q6G931      ------------------------------------------------------------
A0A2T0VBD8      ------------------------------------------------------------
A0A7W5DMU7      ------------------------------------------------------------
A0A378APS2      ------------------------------------------------------------
A0A443VCQ6      ------------------------------------------------------------
A0A447RKQ7      ------------------------------------------------------------
W1DSK1          ------------------------------------------------------------
A0A2N1XK22      ------------------------------------------------------------
A0A850R066      ------------------------------------------------------------
A0A1W9F5M9      ------------------------------------------------------------
A0A352MMI7      -------------------------------------------------FKEAEISKLYT
A0A4Z0LWV1      -------------------------------------RVHLDAPLNDLTVNEAEISKLFT
A0A376RY66      ------------------RQDKDSVDLPLEAKAVLDSMVNIDAQLNELTFKEAEISKLYT
A0A377K431      -------------------------------------MVNIDAQLNELTFKEAEISKLYT
A0A6D0I9G1      ------------------------------------------------------------
A0A379W6R2      ------------------------------------------------------------
A0A379TA56      ------------------------------------------------------------
A0A655C5P0      ------------------------------------------------------------
A0A3C2BN18      ------------------------------------------------------------
A0A447LR75      ------------------------------------------------------------
A0A759KJJ5      ------------------------------------------------------------
A0A376D8L7      ------------------------------------------------------------
A0A1V2FV46      ------------------------------------------------------------
A0A6N8QLT3      ------------------------------------------------------------
A0A376SB61      ------------------------------------------------------------
A0A3D1BYV9      ------------------------------------------------------------
A0A3P5DSS6      ------------------RRKSDSVDLSLEAKSVLDQIVNVDNQLNELTFRESEISQLYT
A0A483YEL5      ------------------RRQKDSVDLSLEAKSVLDQIVNVDNQLNELTFKESEISQLYT
A0A844PX38      ------------------RRQSDSVDLSLEAKSVLDQIVNVDNQLNELTFRESEISQLYT
A0A8B4SQI1      ------------------RRKSDSVDLSLEAKAVLDQIVNVDNQLNELTFRESEISQLYT
A0A483QWI8      ------------------RRQKDSVDLSLEAKSVLEQIVNVDNQLNELTFRESEISQLYT
A0A483UXD3      ------------------RRQKDSVDLSLEAKSVLEQIVNVDNQLNELTFRESEISQLYT
A0A0A8J8L3      ------------------RKQKDSVDLSMEAKTVLDQIVNVDNQLNELTFREAEVSQLYT
A0A660DJ38      ------------------RKEKDSVDLSMEAKSVLDQIVNVDNQLNELTFREAEISQLYT
A0A378G3G7      ----------------------------MEAKSLLDTMVQLDAQINQLTFSEAEVSKLYT
A0A2X5NHJ9      --------------------------------------MNVDNQLNQLTFREAEVSQLFT
A0A2J4QEC3      ------------------------------------------------------------
A0A485ADM3      ------------------------------------------------------------
A0A3D0KAC8      ------------------QTGSRSVDITAETQSVLDRIVDLEKQISEQNLKRTEMERRFT
A0A4U9HGU4      ------------------RQQKDSVDLTMEAKSILDSIVAVEGQLNELTFKEADISKLYT
A0A3S4JGG5      ------------------RQANDSVDLSLEAKSVLDTIVGVEAQLNELTFKEAEISKLYT
A0A377ZDH2      ------------------------------------------------------------
A0A3S4HTS8      ------------------------------------------------------------
A0A3N5MZ53      ------------------------------------------------------------
A0A534E4H4      ------------------------------------------------------------
A0A534I2B6      ------------------------------------MIAAQNELAQATENLNNQARSVIE
A0A1C2JGD0      ------------------------------------------------------------
A0A259LQ70      ------------------------------------------------------------
A0A3N5PM86      -----------------------MVRLSAAMKGINEKIAQ-------------EVKKILQ
A0A2E5YSA4      ------------------------------------------------------------
A0A0N0XAV4      ------------------------------------------------------------
A0A0P9QD19      ---------------------------------------------------------MYT
F3FHG4          -----------------------------------------------MKLKRVELERLYT
F3GGI0          ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLKRVELERLYT
A0A0P9LE74      ---------------------VRGAD----------------------------------
A0A3M4ZQ14      ------------------QTSAKSVDLSIETKGVLDQVVSLDATLSELKLKRVELERLYT
A0A3M5YLE8      ------------------QTSAKSVDLSIETKGVLDQVVSLDATLSELKLKRVELERLYT
A0A3M3RP89      ------------------QTSAKSVDLSIETKGVLDQVVSLDATLSELKLKRVELERLYT
A0A0P9QIY7      ------------------QTSAKSVDLSIETKGVLDQVVSLDATLSELKLKRVELERLYT
A0A0P9VVH7      ------------------QTSAKSVDLSIETKGVLDQVVSLDATLSELKLKRVELERLYT
A0A0Q0FJK6      ------------------QTSAKSVDLSIETKGVLDQVVSLDATLSELKLKRVELERLYT
A0A3M3LF66      ------------------QTSAKSVDLSIETKGVLDQVVSLDATLSELKLKRVELERLYT
A0A0P9WIR8      ------------------QTSAKSVDLSIETKGVLDQVVSLDATLSELKLKRVELERLYT
A0A3M3KPE5      ------------------QTSAKSVDLSIETKGVLDQVVSLDATLSELKLKRVELERLYT
A0A3M4C263      ------------------QTSAKSVDLSIETKGVLDQVVSLDATLSELKLKRVELERLYT
A0A3M5AD05      ------------------QTSAKSVDLSIETKGVLDQVVSLDATLSELKLKRVELERLYT
A0A0Q0D3D2      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYT
A0A0N0FS39      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYT
A0A3M6GHH2      ------------------------MDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYT
A0A0P9R9W0      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYT
A0A0Q0B9T0      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYT
A0A3M6CFI7      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYT
A0A0P9JXN0      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYT
A0A3M6FIV7      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYT
A0A3M3PLW9      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLKRVELERLYT
A0A3M4ENY1      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLKRVELERLYT
A0A3M5EZK7      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLKRVELERLYT
A0A0P9SPP5      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYT
A0A658KL17      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYT
A0A3M3NNF2      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYT
A0A7Z6UK49      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYT
A0A3M4A0E8      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYT
A0A3M4PBZ2      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYT
A0A7Z6U7Q8      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYT
A0A3M6AI26      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYT
A0A0P9IWP8      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYT
A0A0P9KZ49      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYT
A0A0P9V840      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYT
A0A0Q0AIE5      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYT
A0A3M2ZQH6      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYT
A0A0N8SQG2      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYT
A0A0W8HFU1      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYT
A0A0P9VHH8      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRLELERLYT
A0A0P9YV98      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYT
A0A3M3G2W8      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYT
A0A3M6C224      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYT
A0A0P9SCD7      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYT
A0A0P9T4G3      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYT
A0A0P9VKB0      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYT
A0A0Q0BM35      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYT
A0A3M3TPR7      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYT
A0A3M3U4Q3      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYT
A0A8B3FSE5      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYT
A0A3M5K254      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYT
A0A7V8M007      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYT
A0A3M5JFB0      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYT
A0A3M3TQV3      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYT
A0A3M4A376      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYT
A0A3M3EF92      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYT
A0A3M5J1E2      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYT
A0A3M5M873      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYT
A0A3M5G7H9      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYT
A0A0Q0A5T8      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLKRVELERLYT
A0A0P9QCJ2      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYT
A0A0P9UCX7      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYT
A0A0P9Q329      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYT
A0A3M5GJ64      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYT
A0A0P9S1F1      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYT
A0A3M2XYQ3      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLKRVELERLYT
A0A0P9XCE1      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLKRVELERLYT
A0A3M3EFX7      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLKRVELERLYT
A0A3M5B9D9      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLKRVELERLYT
A0A0P9RRZ3      ------------------QTSARSVDLSIETKGVLDQVVSLESMLSELKLKRVELERLYT
A0A3M2VEK7      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLKRVELERLYT
A0A0N8R9B3      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLKRVELERLYT
A0A0P9VA27      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLKRVELERLYT
A0A3M4YBJ4      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLKRVELERLYT
A0A0P9J470      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLKRVELERLYT
A0A0Q0EVJ8      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLKRVELERLYT
A0A3M5UI30      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYT
A0A3M5YQT8      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYT
A0A3M5F5X1      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYT
A0A3M5R8G1      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYT
A0A3M5V012      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYT
A0A3M3GA16      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYT
A0A3M3CJL0      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLKRVELERLYT
A0A3M3F6F5      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLKRVELERLYT
A0A3M3P9B7      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLKRVELERLYT
A0A0N8QB74      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLKRVELERLYT
A0A0Q0AUD0      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLKRVELERLYT
A0A3M5VR55      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLKRVELERLYT
A0A0Q0FK97      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLKRVELERLYT
A0A3M3UCT3      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLKRVELERLYT
A0A7Z6Y5I3      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLKRVELERLYT
A0A3M5KZ75      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLKRVELERLYT
A0A3M5L3G5      ------------------QTSARSVDLSIETKGVLDQVVSLDSMLSELKLKRVELERLYT
A0A7Y2TRV5      ------------------------------------------------------------
A0A318DSU0      ------------------------------------------------------------
A0A538PF21      ------------------------------------------------------------
A0A1W1ZH10      ------------------------------------------------------------
A0A1W2FF24      ------------------------------------------------------------
A0A524JYQ6      ------------------------------------------------------------
A0A4Q3MA17      ------------------------------------------------------------
A0A0N0M5F7      ------------------------------------------------------------
A0A537M754      ------------------------------------------------------------
A0A1V1PDB4      ------------------------------------------------------------
A0A2M7C324      ------------------------------------------------------------
A0A4Q3HHG6      ------------------------------------------------------------
A0A3B7DTA4      ------------------------------------------------------------
A0A432ZK62      ------------------------------------------------------------
A0A1V5EEP4      ------------------------------------------------------------
A0A1V5EF48      ------------------------------------------------------------
A0A0S6X1X6      ------------------------------------------------------------
A0A537Y5L8      ------------------------------------------------------------
A0A4Q3L2X2      ------------------------------------------------------------
A0A4Q3T8J1      ------------------------------------------------------------
A0A4Q4ANM4      ------------------------------------------------------------
A0A4Q3UEC7      ------------------------------------------------------------
A0A1H5YYQ4      ------------------------------------------------------------
A0A1X4NLK2      ------------------------------------------------------------
A0A1X4NWB5      ------------------------------------------------------------
A0A1M5UQ38      ------------------------------------------------------------
A0A327YI48      ------------------------------------------------------------
A0A1B1PNL6      ------------------------------------------------------------
A0A2U8H9H9      ------------------------------------------------------------
A0A845UXY6      ------------------------------------------------------------
A0A1X6YIC0      ------------------------------------------------------------
A0A1I5E9E9      ------------------------------------------------------------
A0A1X6Z7N7      ------------------------------------------------------------
A0A2E1DQ13      ------------------------------------------------------------
A0A1H8C800      ------------------------------------------------------------
A0A2N3EZ05      ------------------------------------------------------------
A0A844ZIR7      ------------------------------------------------------------
A0A850H7C5      ------------------------------------------------------------
A0A845AYQ8      ------------------------------------------------------------
A0A0W1DLQ3      ------------------------------------------------------------
A0A246JVD8      ------------------------------------------------------------
A0A2N3BB54      ------------------------------------------------------------
A0A1H6G7A3      ------------------------------------------------------------
A0A0A7PGL6      ------------------------------------------------------------
A0A4Q2Z4L0      ------------------------------------------------------------
A0A7W0BRL7      ------------------------------------------------------------
A0A0W1GMS6      ------------------------------------------------------------
A0A0Q8RMY3      ------------------------------------------------------------
A0A1A7QC21      ------------------------------------------------------------
A0A832FJD1      ------------------------------------------------------------
A0A7C0U459      ------------------------------------------------------------
A0A7W0ITF0      ------------------------------------------------------------
A0A832C120      ------------------------------------------------------------
A0A318CT66      ------------------------------------------------------------
A0A3N5P205      ------------------------------------------------------------
A0A2G9XLE5      ------------------------------------------------------------
A0A6L3MM74      ------------------------------------------------------------
A0A7X8CDM1      ------------------------------------------------------------
A0A7C3QM04      ------------------------------------------------------------
A0A7I8MVM0      ------------------------------------------------------------
A0A7C0Y3J7      ------------------------------------------------------------
A0A7C3LF61      ------------------------------------------------------------
A0A4R1HDF2      ------------------------------------------------------------
A0A6N1DL48      ------------------------------------------------------------
A0A534HBS8      ------------------------------------------------------------
E1Y9C0          ------------------------------------------------------------
A0A1N6SH58      ------------------------------------------------------------
A0A4Q3AQN2      ------------------------------------------------------------
                                                                            

A0A1M6N1X5      ------------------------------------------------------------
A0A561M3U0      --------------------------------EAKIA-----------------------
A0A2T4ZJZ6      --------------------------------ETQNT-----------------------
A0A1T2KYM8      ------------------------------------------------------------
A0A2G9ZR82      ------------------------------------------------------------
A0A6J4YZ98      ------------------------------------------------------------
A0A844XH11      ------------------------------------------------------------
A0A0P1H2H0      ------------------------------------------------------------
A0A377N8F8      ------------------------------------------------------------
A0A4Q3LR91      ------------------------------------------------------------
A0A6C9IKN8      ------------------------------------------------------------
A0A4V1TR68      ------------------------------------------------------------
A0A6L3ZR06      ----------------------------------LVQ-----------------------
A0A3E0WKI3      ------------------------------------------------------------
A0A1H3I2J1      ------------------------------------------------------------
A0A521LJG5      ------------------------------------------------------------
A0A1V4WHZ7      ------------------------------------------------------------
A0A1E5AJN5      RLELGLIVQQITEGKAP-------------SLSAVLE-----------------------
A0A2N3D2J1      ------------------------------SLPDVLN-----------------------
A0A2N2GVE1      SVETLDGMARELRAKIQQVRRMRTTDPTLDPSADFLN-----------------------
A0A2N2INV3      AVETLDGMARELRAKIQQVRRMRTTDPTLDPSADFLN-----------------------
A0A233IKJ2      RVAAETLYLVAQTYSRQDSDLSALA-----SIPEISN-----------------------
A0A1Y5DXG5      --------------------------------ETQGV-----------------------
A0A0B8P2H5      --------------------------------EAQST-----------------------
A0A380AQW6      ------------------------------------------------------------
A0A2G2GD62      ESILENLKEYIDEN---------DDLTGLTVQSLETT-----------------------
A0A524P331      RNQVEFALAALKKA---------RRRGGVYSPAAFRD-----------------------
A0A4V1SSM5      ------------------------------------------------------------
A0A4Q3K8G7      ------------------------------------------------------------
A0A7C7W7M2      RLRQENLYQQLKDIRPGNRSAE--------KLQAISS-----------------------
A0A1M7HC79      --------------------------------ESQAT-----------------------
A0A1D3JZN6      --------------------------------EAKAV-----------------------
A0A1V6ESG1      -----------------------------ENSAQVLE-----------------------
A0A850NXS7      ------------------------------------------------------------
A0A1H7YHK3      --------------------------------QTKGL-----------------------
A0A3S1MCW7      --------------------PVLE------------------------------------
A0A528AX40      RLDAGRMVDQIDKGRGSSLGPVLE------------------------------------
A0A528MV95      RLDAGRMVDQIDKGRGSSLGPVLE------------------------------------
A0A838IR38      MFAEAALLNQIVTMEKGGADLR--------ALADLVA-----------------------
A0A328C2K5      LFAEEALLNQLENMESSGEDLR--------ALGDLVD-----------------------
A0A5C6X8M3      LFAEEALLNQLETMESRGDDLR--------ALGDLVD-----------------------
A0A3D8MRR7      LFAEEALLNQLETMESRGDDLR--------ALGDLVD-----------------------
A0A5C6UBJ7      LFAEEALLNQLETMESRGDDLR--------ALGDLVD-----------------------
A0A5C6XGM3      LFAEEALLNQLETMESRGDDLR--------ALGDLVD-----------------------
A0A849WSS0      ------------------------------------------------------------
A0A7Y3GUU1      ------------------------------------------------------------
A0A090R136      --------------------------------EAKST-----------------------
A0A661JU93      ------------------------------------------------------------
A0A0M3GBT1      RVEVKAVISTLEAADSASV-----------AVQNIAL-----------------------
B3Q577          RVEVKAVISTLEAADSASV-----------AVQNIAL-----------------------
A0A3R9C3P5      RVEVKATISTLEGADNASA-----------AAQNIAV-----------------------
A0A7W6FJX0      RVEVKATISTLEAADNASA-----------ATQNIAM-----------------------
A0A2E2T3V8      REAARMLFEKRQAV---------KSSEELLALPDIAK-----------------------
A0A367UAB4      KEAARMLFEKRQAV---------KSSEELLALPDIAK-----------------------
A0A1F2ZW35      RIEKEGRLVALSKASLNPGELA--------NIPEVAG-----------------------
A0A377V641      --------------------------------EAKSV-----------------------
A0A1F2YJ88      --------------------------------ESELF-----------------------
A0A5N8AL61      SAAANARASASRRG----------------SVTDITN-----------------------
A0A0J7XGZ1      LAEQRGKLGAAQAQIARGGGGA--------DIGSALA-----------------------
I4CBA7          RLNLETLTLHKQM-----------------ILPKYID-----------------------
A3VE95          RVTAEAQYEQLRNL---------LENQGLDALAKAVT-----------------------
A0A1G0NL95      --------------------------------ETQGR-----------------------
A0A024KA69      ------------------------------------------------------------
A0A0L1KFN4      RIAAEARFRQAGGSG---------------SSAEALS-----------------------
A0A3D5UYX7      ------------------------------SVADVLA-----------------------
A0A524QFS4      --------------------------------RRDAI-----------------------
A0A832MZU0      IQEIKNFRTSFESGGVFSTVSLVGVGIDTSSIQSLMEDYRANDEMIRELRYQQNDITKSV
A0A520JSW4      RIAAEQRYREAAL-----------------GGATTES-----------------------
A0A4Q3LTF3      RIQAEARYEQAGRAG---------------ASTEALR-----------------------
A0A840SQK7      LASLQARRGTP-------------------EAAQAVD-----------------------
A0A7C3N3Y1      RMAKEALYRQTFNRKID-------------SLPMVFE-----------------------
A0A537UTP9      TAETKAKLDRIDEILRTGVEVPDA------TVTDSLK-----------------------
A0A1D2RNR5      ------------------------------------------------------------
A0A4V1TQ46      KLAAQKGWEQAAKAPLL-------------SIPEVQS-----------------------
A0A3A0FZC0      RIEAENLYKEAEAALS--------------NPSAGFD-----------------------
A0A1N7JVZ7      GPGADTRSDAATAP----------------DAPLVLQ-----------------------
A0A091C4A8      RIRAEARWKHAESASGM-------------GLSAVLG-----------------------
A0A844YBH7      LAEKRGRYNSAREQLTRGSGGA--------DVGAALG-----------------------
A0A4R3H6P6      RIVAESRLNEAKRPD---------------ASSIALG-----------------------
A0A3S1NQ09      TARASARYQQYKAIVDSGSE---NAFKDAAISSDQPS-----------------------
A0A443GJ52      TARASARYQQYKSIVESGSD---NAFRDAAISADQPS-----------------------
A0A2W6S588      AAQAETRSAASGST----------------VISGGVD-----------------------
A0A483E0N4      --------------------------------EAKSV-----------------------
A0A2J4YQQ6      --------------------------------EAKSV-----------------------
A0A483THX4      --------------------------------EAKSV-----------------------
A0A534MVS2      RLQAMDLLKHVVENDFSIDVFTSGLHSFHVPAKINFS-----------------------
A0A444I5K6      TAKAEARYARVKSIIDAKQTDA--------IVTDVLD-----------------------
A0A154VE85      RTEAEARAAQARRLIGQGSNTGTNTGGGLETAAAVLN-----------------------
A0A3C1S9Y1      RVETETRYQQALAL-------E-KTPDLLDSIPEVLS-----------------------
A0A353EH49      --------------------------------ETTGL-----------------------
A0A1Y1Q9C1      RIQAESQMIQGRKRT---------------NAHAVLN-----------------------
A0A3M7LJH0      --------------------------------EAKST-----------------------
A0A1E4JHX8      MVRAHSRVTEVGANG---------------AVEEALT-----------------------
M2U8P2          QAVAESRAAS--------------------PAAAIQS-----------------------
A0A1H7KZF8      RIRAQADWRAVAARPPL-------------SIPEVIG-----------------------
A0A6N3UC48      --------------------------------ETQAV-----------------------
A0A257NG76      --------------------------------ETQSV-----------------------
A0A1T4TW59      RVAAEAIYSLLQSS-------G-SSAASLLSVPEISN-----------------------
A0A1Q3MB35      RITAESTVRQTSS-----------------ASEGSLN-----------------------
A0A259LUN7      LDRARARYEAMRRQ-------I-DSGAGVEGVSEVIN-----------------------
A0A2D7AVL1      ------------------------------ITLDVLD-----------------------
A0A3B9KZE9      ------------------------------------------------------------
A0A358L616      --------------------------------EAKSA-----------------------
A0A4U9HNE9      --------------------------------EAKSV-----------------------
A0A7X7Z1H8      HNMSEEIFNEIVFLTNLETRTN-KLLQIILVGQPELK-----------------------
A0A7C5N053      IQEAAARHSQLSKVSADVSKLP-A--------SELLK-----------------------
A0A2G2CXY6      --------------------------------ETQAI-----------------------
A0A3M1D4H3      -----------------------------VAATTSAA-----------------------
A0A7C1A2A2      LYNLRQIARSLDERHPNIDP----------YLLSTVD-----------------------
A0A840RX77      --------------------------------ESKML-----------------------
A0A5C8BYM7      -----------------------------DTARQVLE-----------------------
A0A7V2RUR3      LAEKRAKLDLVRRL-------Q-QTGGRLDSVPEVAA-----------------------
A0A1J5ICP0      RKQAEFIAENIMQSDGMPDKSI-V------ALGASTK-----------------------
A0A379B9V4      --------------------------------EAKAT-----------------------
A0A0Q6TS97      RIVAESRLNEIKRPD---------------ASSIALG-----------------------
A0A0Q6UYB4      RIVAESRLNEIKRPD---------------ASSIALG-----------------------
W7Q5J0          --------------------------------EAQAA-----------------------
A0A654AKT6      EIFYFARVSGFSREAGFFSSLL-VASLIAYLLTEKVN-----------------------
A0A847E0Q2      --------------------------------EITAL-----------------------
A0A7W9WQN4      --------------------------------ESRLL-----------------------
A0A0G9MZA5      RIAAEAALAARSGA----------------NAGSTEA-----------------------
H0T8B0          TIQAQAKLEQITHVLVQRSKSQ-DFDVSSPAVPDALN-----------------------
A0A7Y4X614      RIGLEAQVQTLKQG-------G-R------SLPMLAE-----------------------
A0A5C7N981      RIRAETLYQQAKAG------DV-A------TLQAVVD-----------------------
A0A534TV22      ----------------------------------VIN-----------------------
A0A351CXR4      --------------------------------LESST-----------------------
A0A2N6GLF5      RATAESSLRQINALKGQPVERL-A------SIPAVLS-----------------------
A0A1W9LJP0      RVEAETRYRQALAA-QNSPDML-D------SISQVLN-----------------------
A0A0W1ICB0      RAEAESKLSAARAP---------G------ATQLGLS-----------------------
A0A7C1C8G2      RISKESLYLQTKKN------GG-E------NLPQVLN-----------------------
A0A832F8F3      ------------------------------SSIEGLQ-----------------------
A0A2E0UL88      EKAQVDLEIQKAEFGRDNALAA-R------PELEEYS-----------------------
A0A2N1WQN5      ------------------------------------------------------------
A0A0T2QIS1      RVAAESRARTAGPS------------------ELSIT-----------------------
A0A376KYN0      ------------------------------------------------------------
A0A377E5P7      --------------------------------EAKAV-----------------------
A0A2X1JB05      --------------------------------EAKAV-----------------------
A0A376RML0      --------------------------------EAKAV-----------------------
A0A6N3QTV2      --------------------------------EAKAV-----------------------
A0A0P7Y1D0      ESSLRNVQTQLERG-----ASL-D------TIGEVLR-----------------------
A0A7Y2FUF7      RLVAERYLLQVRDG------EA-S------ALPQVFA-----------------------
A0A7W6DRI0      --------------------------------DEQTH-----------------------
A0A542J310      ---------------------G-V------IADLGLE-----------------------
A0A2M7JRZ7      RMAKEALYRQTKDK------HF-D------ALPSILE-----------------------
A0A167IR75      RIAAEARFRRAGGG---------G------SSAEALS-----------------------
A0A3B8T2U6      LARVRSIFEQVNGQ--ESKQDL-A------SLQEVQN-----------------------
A0A365PWR2      --------------------------------EIEGY-----------------------
A0A2E9H5Z8      --------------------------------GLKLP-----------------------
A0A2E2BR79      --------------------------------ESQSV-----------------------
A0A6I4IKZ3      --------------------------------ESELY-----------------------
A0A7H4JZ79      --------------------------------ESELY-----------------------
A0A0Q4Q524      RIAAEARYREGGRA---------G------ASSEALR-----------------------
A0A0Q4CFJ9      RIAAESRYREGSRA---------G------ASSEALR-----------------------
A0A0Q4FE58      RIAVEARYREGGRA---------G------ASSEALR-----------------------
A0A0Q4JWC8      RIAVEARYREGGRA---------G------ASSEALR-----------------------
A0A0Q4KFL8      RIAVEARYREGGRA---------G------ASSEALR-----------------------
A0A7W8RVL5      --------------------------------QGKAY-----------------------
A0A831Y0Z8      RKQIKDQWEQIVQFQDSPEN-L-E------SIPLFAK-----------------------
A0A522R8R0      QFKAIVDSGPDNAVRNATIPVN-K------DSGTGTN-----------------------
A0A2U9NDY5      --------------------------------ETKGV-----------------------
A0A0Q4IGG1      RIQAQARAQQSGRA---------G------ASTEALR-----------------------
A0A352G2C2      --------------------------------ETQSV-----------------------
A0A7Y3BMU7      RIELEARLGRLKAA--RSQPEA-V------QDTDGGE-----------------------
A0A534RUJ5      RIGLEAQMRSVSQT------DY-D------SLPAVVN-----------------------
V4Q8B7          --------------------------------ETKGV-----------------------
A0A3M1CJM3      RIALEARRQKILDIKEHRLA-L-D------AVDKVIS-----------------------
A0A2R7SVD4      --------------------------------ETQSV-----------------------
A0A0Q8XKK5      RLAAESRSVRQRGA-----------------SPQALT-----------------------
A0A2E0Q2W0      RIEAEGASRAASVA----------------------------------------------
A0A660NIR6      RQRLEQVYHQVQRGSRNRYE-----------VPEVFN-----------------------
A0A142W0R3      RIAAESQLSSSVSS------------------TDLSS-----------------------
A0A0S4XR18      LSVLEGLIRQMKTGNGINFVSI-D------VLGA--P-----------------------
A0A7C5CFF1      -----------------------------------TS-----------------------
A0A7X6WZW5      --------------------------------EGRLS-----------------------
A0A7X2SVT1      --------------------------------EAKSA-----------------------
A0A2E0GW64      --------------------------------ESKMM-----------------------
A0A1A7QJ97      RIAAESRFRQAGSA---------G------STAAALG-----------------------
A0A832UVD3      RNEKRQLYEMVDRANKSMSA-L-L------AIPAILN-----------------------
A0A7W5IBY1      --------------------------------ESRLL-----------------------
A0A661LW70      ETRYKQAMALTGTP-----DML-D------SIPEVLN-----------------------
W7Q8F9          --------------------------------EAQAA-----------------------
A0A524PXH8      RITVESLYQQSQGA------SR-D------SLPIIVN-----------------------
A0A4Q3P0E4      --------------------------------EAKLV-----------------------
A0A3M2BE89      --------------------------------EAEAL-----------------------
A0A4Q4A6K6      LNRFDEVINAIAPDSLSLAGID-T------PGSEVLL-----------------------
A0A257G674      RIAAQQRWNLVSRS------DP-L------NSPDVLA-----------------------
A0A661M5M6      RIELEARLKRLNASLGEAPK-Q-I------DPAVVAD-----------------------
A0A1I1UM01      RQAEAERLRVEAET----------------------------------------------
Q44573          QARADALQDAAARG------DA-R------AAVALSQ-----------------------
A2W025          --------------------------------EAKVY-----------------------
A0A534Z362      RLALHSRYEFLTRP------HG-D------ALAYFLD-----------------------
V4J283          --------------------------------ETENV-----------------------
A0A536T443      RAAITQVVARARDGGVPVDE-L-T------MIGAVQR-----------------------
A0A0Q4UFQ5      RVAAESRLNS-----------G-G------ATKEQLD-----------------------
A0A527W7E6      SARYQQYKAIVDSGSETAFNDS-A------IAADQPS-----------------------
A0A432EMV7      EVLFKQVKAAEKRG-----DDY-G------SLAAVLN-----------------------
A0A7Y3M8P5      ------------------------------------A-----------------------
A0A7C1SEU7      MIGKRAIYNQAIKD-----G-P-A------SLPRVLS-----------------------
A0A7Y1SPC5      VARLESVKAKVARG-----DAA-D------TIGEVLA-----------------------
A0A7V6YC94      KARLDQINEIIASG-----SPD-A------LVADALD-----------------------
A0A534WLI3      RVGLESRNEFLSHA-----D-S-E------PLAYLLD-----------------------
A0A7V6CBY2      EARLQQVQRLTRTP-----GGM-D------STIEVLE-----------------------
A0A7C6FBW0      RLQQLEKERQAMQR-----RGD-A------APNLAPD-----------------------
A0A087LTV7      NSFIHEEVAAKIDG-----VLA-D------VAALRAR-----------------------
A0A7D7WSS2      NSFIHEEVAAKIDG-----VLA-D------VAALRAQ-----------------------
A0A318KWA2      EAELAQRYTP--------------------------N-----------------------
A0A522MT86      RTQLLDRYTP--------------------------D-----------------------
A0A4Q3I221      EARLQRIAQIIASG-----QGD-A------IVTDVLD-----------------------
A0A534SAL6      RLNLESRYQFLTTP-----G-S-D------PLAFFLD-----------------------
A0A534ZDB4      RLNLETRYEFLTTP-----G-S-E------ALAYFLD-----------------------
A0A534X3M7      RVELQTQNDSLAKK-----QYG-D------LLAFFLD-----------------------
A0A534SPC6      RLALHSRYEFLTRP-----H-G-D------ALAYFLD-----------------------
A0A535AD60      RLALHSRYEFLTRP-----D-G-D------ALAYFLG-----------------------
A0A4Q3SY08      ARLNTARQQLATGS-----T-G-E------DVGEALD-----------------------
A0A7U1E9W6      ARLRAAQRQLKSGS-----N-G-E------DVGAALG-----------------------
A0A4Q3LG23      YQRLMVQFKPEYPA-----A-E-A------IQSQIGQ-----------------------
A0A522EX52      RISKIDMLQRYTEE-----H-P-A------FIALSRQ-----------------------
A0A1H3KC95      TGPSREAFDAQLPK-----A-A-G------KAEAHPT-----------------------
A0A5P8Z4P3      KSAEPVSRPVTADD-----E-L-D------DIEDIEA-----------------------
A0A2E9HXF7      AAQDAEDHRQ---------------------QVEKRA-----------------------
A0A0B3RZC9      ------------------------------------------------------------
A0A6F8QET1      ------------------------------------------------------------
A0A520HUH4      RSNVAAAERQIAAG-----G-S-D------AVSAVLS-----------------------
A0A2K8U7M6      SADYQQQLKVFKPG-----Y-P-K------MQQLRRA-----------------------
A0A5B9DKL8      AGVAVDRTQGILDA-----T-A-E------PGYEARQ-----------------------
A0A238KJM1      ARKAEDDTKRLTAE-----Q-A-R------LTEEKQV-----------------------
A0A3A0FJZ4      LASQLRDLQAELAS-----Q-A-R------ELDEIEL-----------------------
W4HJV8          QATALAASDPSVPT-----P-S-A------APENAAP-----------------------
A0A0P1GDI0      AAERAEKQRKQAEA-----D-R-R------AQEKAKE-----------------------
A0A2R8ATV5      RAQAEEAARLQAEA-----K-A-R------AAEDARK-----------------------
A0A1U7D3R6      RAEDAERARL---------------------ADEARR-----------------------
A0A2D4UVV2      RAEDAERARL---------------------ADEARR-----------------------
A0A0W7WHP4      ARREEQAQRE---------------------AQAQRA-----------------------
A0A238J8F6      AREKAEAVRR---------------------AEEARQ-----------------------
A0A238JQI6      AARKAEEARL---------------------AEERRK-----------------------
A0A222E077      AAQDAEDHRQ---------------------QVEKRA-----------------------
A0A239E3Y2      AAQDAAEIRQ---------------------QAEKRA-----------------------
A0A1F9CFF0      ------------------------------------------------------------
A0A2M8B0G5      ------------------------------------------------------------
A0A363TNU9      ------------------------------------------------------------
A0A445MZQ4      ------------------------------------------------------------
A0A0M9E0E3      ------------------------------------------------------------
A0A351Z9A2      ------------------------------------------------------------
A0A6G6X2Z4      ------------------------------------------------------------
A0A0C5VQ86      ------------------------------------------------------------
A0A3S1WTQ1      ------------------------------------------------------------
A0A354EF47      ------------------------------------------------------------
A0A536T0W8      ------------------------------------------------------------
A0A2G6MSP7      ------------------------------------------------------------
A0A3N5FRH4      ------------------------------------------------------------
A0A1V4Y2C3      ------------------------------------------------------------
A0A2N2KTJ4      ------------------------------------------------------------
A0A2N2LQX0      ------------------------------------------------------------
A0A4U8YMP3      ------------------------------------------------------------
A0A1Q8QQ99      ------------------------------------------------------------
A0A7C2SIB2      ------------------------------------------------------------
A0A3D5ZY44      ------------------------------------------------------------
A0A1G5C236      ------------------------------------------------------------
A0A432HIS7      ------------------------------------------------------------
A0A401FQP5      ------------------------------------------------------------
A0A7C3Q9R6      ------------------------------------------------------------
A0A7C2AA26      ------------------------------------------------------------
A0A351Z4H9      --------------------------------------------------MGXKGVPKDN
A0A2N2KML4      ------------------------------------------------------------
E1YJF1          ------------------------------------------------------------
A0A1Q6DMW3      ------------------------------------------------------------
A0A3A6P8F8      ------------------------------------------------------------
A0A1J5EVZ6      ------------------------------------------------------------
A0A2G2DSM4      ------------------------------------------------------------
A0A1F9NI02      ------------------------------------------------------------
A0A4U1ABX4      ------------------------------------------------------------
A0A6L4AM84      ------------------------------------------------------------
A0A840UW68      ------------------------------------------------------------
A0A2G6FCC5      ------------------------------------------------------------
A0A1F9MR25      ------------------------------------------------------------
A0A2G6M7F1      ------------------------------------------------------------
A0A5Q2QDL1      ------------------------------------------------------------
A0A4Z0M4C7      ------------------------------------------------------------
A0A1V8MBH1      ------------------------------------------------------------
A0A7V9E085      ------------------------------------------------------------
A0A6J4X8D4      ------------------------------------------------------------
A0A1E7HSL6      ------------------------------------------------------------
A0A2M7JX59      ------------------------------------------------------------
A0A7V4PLT3      ------------------------------------------------------------
A0A7X7Y8R3      ------------------------------------------------------------
A0A832A361      ------------------------------------------------------------
A0A1M5GH86      ------------------------------------------------------------
A0A1W1XQZ5      ------------------------------------------------------------
A0A3D6C3I2      ------------------------------------------------------------
S0G1D4        &