BYKdb

Dataset for cluster orphancd of phylum proteobacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

863 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


E1Y9C0          ------------------------------------------------------------
A0A1N6SH58      ------------------------------------------------------------
A0A4Q3AQN2      ------------------------------------------------------------
A0A1W9HS52      ------------------------------------------------------------
A0A2D5LFD8      ------------------------------------------------------------
A0A0N0XAV4      ------------------------------------------------------------
A0A0P9QD19      ------------------------------------------------------------
F3FHG4          ------------------------------------------------------------
F3GGI0          ------------------------------------------------------------
A0A0P9LE74      ------------------------------------------------------------
A0A3M4ZQ14      ----------MCAAAAPCRTPGQPRAAAPGRADPGDGTAAHARPAQVRARSTWQNFLDWP
A0A3M5YLE8      ----------MCAAAAPCRTPGQPRAAAPGRADPGDGTAAHARPAQVRARSTWQNFLDWP
A0A3M3RP89      ----------MCAAAAPCRTPGQPRAAAPGRADPGDGTAAHARPAQVRARSTWQNFLDWP
A0A0P9QIY7      ----------MCAAAAPCRTPGQPRAAAPGRADPGDGTAAHARPAQVRARSTWQNFLDWP
A0A0P9VVH7      ----------MCAAAAPCRTPGQPRAAAPGRADPGDGTAAHARPAQVRARSTWQNFLDWP
A0A0Q0FJK6      ----------MCAAAAPCRTPGQPRAAAPGRADPGDGTAAHARPAQVRARSTWQNFLDWP
A0A0Q0G2J0      ----------MCAAAAPCRTPGQPRAAAPGRADPGDGTAAHARPAQVRARSTWQNFLDWP
A0A3M3LF66      ----------MCAAAAPCRTPGQPRAAAPGRADPGDGTAAHARPAQVRARSTWQNFLDWP
A0A0P9WIR8      ----------MCAAAAPCRTPGQPRAAAPGRADPGDGTAAHARPAQVRARSTWQNFLDWP
A0A3M3KPE5      ------------------------------------------------------------
A0A3M4C263      ------------------------------------------------------------
A0A3M5AD05      ------------------------------------------------------------
A0A0Q0D3D2      ------------------------------------------------------------
A0A0N0FS39      ------------------------------------------------------------
A0A3M6GHH2      ------------------------------------------------------------
A0A0P9R9W0      ------------------------------------------------------------
A0A0Q0B9T0      ------------------------------------------------------------
A0A3M6CFI7      ------------------------------------------------------------
A0A0P9JXN0      ------------------------------------------------------------
A0A3M6FIV7      ------------------------------------------------------------
A0A3M3PLW9      ------------------------------------------------------------
A0A3M4ENY1      ------------------------------------------------------------
A0A3M5EZK7      ------------------------------------------------------------
A0A0P9SPP5      ------------------------------------------------------------
A0A658KL17      ------------------------------------------------------------
A0A3M3NNF2      ------------------------------------------------------------
A0A3M4A0E8      ------------------------------------------------------------
A0A3M4PBZ2      ------------------------------------------------------------
A0A3M6AI26      ------------------------------------------------------------
A0A0P9IWP8      ------------------------------------------------------------
A0A0P9KZ49      ------------------------------------------------------------
A0A0P9V840      ------------------------------------------------------------
A0A0Q0AIE5      ------------------------------------------------------------
A0A3M2ZQH6      ------------------------------------------------------------
A0A0N8SQG2      ------------------------------------------------------------
A0A0W8HFU1      ------------------------------------------------------------
A0A3M5M873      ------------------------------------------------------------
A0A0P9VHH8      ------------------------------------------------------------
A0A0P9YV98      ------------------------------------------------------------
A0A3M3G2W8      ------------------------------------------------------------
A0A3M6C224      ------------------------------------------------------------
A0A3M5K254      ------------------------------------------------------------
A0A3M5JFB0      ------------------------------------------------------------
A0A3M3TQV3      ------------------------------------------------------------
A0A3M3EF92      ------------------------------------------------------------
A0A3M5J1E2      ------------------------------------------------------------
A0A3M5G7H9      ------------------------------------------------------------
A0A3M4A376      ------------------------------------------------------------
A0A0Q0A5T8      ------------------------------------------------------------
A0A0P9SCD7      ------------------------------------------------------------
A0A0P9T4G3      ------------------------------------------------------------
A0A0P9VKB0      ------------------------------------------------------------
A0A0Q0BM35      ------------------------------------------------------------
A0A3M3TPR7      ------------------------------------------------------------
A0A3M3U4Q3      ------------------------------------------------------------
A0A0P9UCX7      ------------------------------------------------------------
A0A0P9S1F1      ------------------------------------------------------------
A0A0P9QCJ2      ------------------------------------------------------------
A0A0P9Q329      ------------------------------------------------------------
A0A3M5GJ64      ------------------------------------------------------------
A0A0P9MPC7      ------------------------------------------------------------
A0A3M2XYQ3      ------------------------------------------------------------
A0A0P9XCE1      ------------------------------------------------------------
A0A3M3EFX7      ------------------------------------------------------------
A0A3M5B9D9      ------------------------------------------------------------
A0A0P9RRZ3      ------------------------------------------------------------
A0A3M2VEK7      ------------------------------------------------------------
A0A0N8R9B3      ------------------------------------------------------------
A0A0P9VA27      ------------------------------------------------------------
A0A3M4YBJ4      ------------------------------------------------------------
A0A0P9J470      ------------------------------------------------------------
A0A0Q0EVJ8      ------------------------------------------------------------
A0A3M5UI30      ------------------------------------------------------------
A0A3M5YQT8      ------------------------------------------------------------
A0A3M5F5X1      ------------------------------------------------------------
A0A3M5R8G1      ------------------------------------------------------------
A0A3M5V012      ------------------------------------------------------------
A0A3M3GA16      ------------------------------------------------------------
A0A3M3UCT3      ------------------------------------------------------------
A0A3M3CJL0      ------------------------------------------------------------
A0A3M3F6F5      ------------------------------------------------------------
A0A3M3P9B7      ------------------------------------------------------------
A0A0N8QB74      ------------------------------------------------------------
A0A0Q0AUD0      ------------------------------------------------------------
A0A3M5VR55      ------------------------------------------------------------
A0A0Q0FK97      ------------------------------------------------------------
A0A3M5KZ75      ------------------------------------------------------------
A0A3M5L3G5      ------------------------------------------------------------
A0A0C5VQ86      ------------------------------------------------------------
A0A1V8MBH1      ------------------------------------------------------------
A0A534QGR3      ------------------------------------------------------------
A0A0R0BVC7      ------------------------------------------------------------
A0A0W1GMS6      ------------------------------------------------------------
A0A0Q8RMY3      ------------------------------------------------------------
A0A1A7QC21      ------------------------------------------------------------
A0A1F9CFF0      ------------------------------------------------------------
A0A2M8B0G5      ------------------------------------------------------------
A0A363TNU9      ------------------------------------------------------------
A0A534HBS8      ------------------------------------------------------------
A0A0F0T3Y9      ------------------------------------------------------------
A0A379GWF0      ------------------------------------------------------------
A0A536T0W8      ------------------------------------------------------------
A0A4Q2XLV7      ------------------------------------------------------------
A0A4Q5QYC4      ------------------------------------------------------------
A0A2G9XLE5      ------------------------------------------------------------
A0A3D2M6Y9      ------------------------------------------------------------
A0A3D2YAZ2      ------------------------------------------------------------
A0A350A102      ------------------------------------------------------------
A0A350L5D2      ------------------------------------------------------------
A0A3B8SQ27      ------------------------------------------------------------
A0A656BWB0      ------------------------------------------------------------
A0A6D0IFH4      ------------------------------------------------------------
A0A3Y2RPN4      ------------------------------------------------------------
A0A0A0FHV8      ------------------------------------------------------------
A0A1X3IPU7      ------------------------------------------------------------
A0A0A0G0N2      ------------------------------------------------------------
A0A243TPR1      ------------------------------------------------------------
A0A2I8SDU4      ------------------------------------------------------------
A0A2I8SU55      ------------------------------------------------------------
S1EXJ6          ------------------------------------------------------------
A0A376UBS1      ------------------------------------------------------------
A0A4Q6G931      ------------------------------------------------------------
A0A1W9F5M9      ------------------------------------------------------------
A0A3C2BN18      ------------------------------------------------------------
A0A447LR75      ------------------------------------------------------------
A0A376D8L7      ------------------------------------------------------------
A0A1V2FV46      ------------------------------------------------------------
A0A376SB61      ------------------------------------------------------------
A0A3D1BYV9      ------------------------------------------------------------
A0A6D0I9G1      ------------------------------------------------------------
A0A352MMI7      ------------------------------------------------------------
A0A379W6R2      ------------------------------------------------------------
A0A376RY66      ------------------------------------------------------------
A0A377K431      ------------------------------------------------------------
A0A379TA56      ------------------------------------------------------------
A0A4Z0LWV1      ------------------------------------------------------------
A0A5V7HTZ1      ------------------------------------------------------------
A0A610XNI4      ------------------------------------------------------------
A0A620QD02      ------------------------------------------------------------
A0A5H3HSJ8      ------------------------------------------------------------
A0A655C5P0      ------------------------------------------------------------
A0A2T0VBD8      ------------------------------------------------------------
A0A378APS2      ------------------------------------------------------------
A0A443VCQ6      ------------------------------------------------------------
A0A447RKQ7      ------------------------------------------------------------
W1DSK1          ------------------------------------------------------------
A0A0U2VAW2      ------------------------------------------------------------
A0A454CTF1      ------------------------------------------------------------
A0A6B3Q2G1      ------------------------------------------------------------
A0A378G3G7      ------------------------------------------------------------
A0A2X5NHJ9      ------------------------------------------------------------
A0A2J4QEC3      ------------------------------------------------------------
A0A485ADM3      ------------------------------------------------------------
A0A4U9HGU4      ------------------------------------------------------------
A0A3S4JGG5      ------------------------------------------------------------
A0A377ZDH2      ------------------------------------------------------------
A0A3S4HTS8      ------------------------------------------------------------
A0A2N1XK22      ------------------------------------------------------------
A0A3D0KAC8      ------------------------------------------------------------
A0A3D2Y902      ------------------------------------------------------------
A0A655RNN3      ------------------------------------------------------------
A0A655R819      ------------------------------------------------------------
A0A655ZEY0      ------------------------------------------------------------
A0A6G6X2Z4      ------------------------------------------------------------
Q44570          ------------------------------------------------------------
A0A3N5MZ53      ------------------------------------------------------------
A0A534E4H4      ------------------------------------------------------------
A0A534I2B6      ------------------------------------------------------------
A0A1C2JGD0      ------------------------------------------------------------
A0A259LQ70      ------------------------------------------------------------
A0A4V2SPR5      ------------------------------------------------------------
A0A3N5PM86      ------------------------------------------------------------
A0A2E5YSA4      ------------------------------------------------------------
A0A519ERR1      ------------------------------------------------------------
A0A4Q3Q1M2      ------------------------------------------------------------
A0A4Q3MHR1      ------------------------------------------------------------
A0A520GDZ4      ------------------------------------------------------------
A0A318DSU0      ------------------------------------------------------------
A0A538PF21      ------------------------------------------------------------
A0A1W1ZH10      ------------------------------------------------------------
A0A1W2FF24      ------------------------------------------------------------
A0A524JYQ6      ------------------------------------------------------------
A0A4Q3MA17      ------------------------------------------------------------
A0A0N0M5F7      ------------------------------------------------------------
A0A537M754      ------------------------------------------------------------
A0A1V1PDB4      ------------------------------------------------------------
A0A2M7C324      ------------------------------------------------------------
A0A4Q3HHG6      ------------------------------------------------------------
A0A3B7DTA4      ------------------------------------------------------------
A0A432ZK62      ------------------------------------------------------------
A0A1V5EEP4      ------------------------------------------------------------
A0A1V5EF48      ------------------------------------------------------------
A0A0S6X1X6      ------------------------------------------------------------
A0A537Y5L8      ------------------------------------------------------------
A0A4Q3L2X2      ------------------------------------------------------------
A0A4Q3T8J1      ------------------------------------------------------------
A0A4Q4ANM4      ------------------------------------------------------------
A0A4Q3UEC7      ------------------------------------------------------------
A0A1H5YYQ4      ------------------------------------------------------------
A0A1X4NLK2      ------------------------------------------------------------
A0A1X4NWB5      ------------------------------------------------------------
A0A1M5UQ38      ------------------------------------------------------------
A0A327YI48      ------------------------------------------------------------
A0A1B1PNL6      ------------------------------------------------------------
A0A2U8H9H9      ------------------------------------------------------------
A0A6B2NBB8      ------------------------------------------------------------
A0A1X6YIC0      ------------------------------------------------------------
A0A1I5E9E9      ------------------------------------------------------------
A0A1X6Z7N7      ------------------------------------------------------------
A0A2E1DQ13      ------------------------------------------------------------
A0A1H8C800      ------------------------------------------------------------
A0A2N3EZ05      ------------------------------------------------------------
A0A3N5J7U8      ------------------------------------------------------------
A0A1S7S3I8      ------------------------------------------------------------
A0A519E8D7      ------------------------------------------------------------
A0A3S1NZ06      ------------------------------------------------------------
A0A3S1FD32      ------------------------------------------------------------
A0A434DUT4      ------------------------------------------------------------
A0A528D3U3      ------------------------------------------------------------
A0A3S3UPT3      ------------------------------------------------------------
A0A3S1E286      ------------------------------------------------------------
A0A531AC71      ------------------------------------------------------------
A0A436K268      ------------------------------------------------------------
A0A434IDQ0      ------------------------------------------------------------
A0A435IRM5      ------------------------------------------------------------
A0A3S2C404      ------------------------------------------------------------
A0A435F6C0      ------------------------------------------------------------
A0A435BMN6      ------------------------------------------------------------
A0A529XQ54      ------------------------------------------------------------
A0A530BJC1      ------------------------------------------------------------
A0A348SRI7      ------------------------------------------------------------
A0A354EI73      ------------------------------------------------------------
A0A4Q3IRI1      ------------------------------------------------------------
A0A4P7EP83      ------------------------------------------------------------
A0A6I1QB25      ------------------------------------------------------------
A0A655ZZQ1      ------------------------------------------------------------
A0A1S0ZAI3      ------------------------------------------------------------
A0A1W9M770      ------------------------------------------------------------
A0A1W9M7R6      ------------------------------------------------------------
A0A3A4NIE9      ------------------------------------------------------------
A0A3A4NUI9      ------------------------------------------------------------
A0A524I3Z6      ------------------------------------------------------------
A0A524PCL7      ------------------------------------------------------------
A0A356GQV1      ------------------------------------------------------------
A0A1J5DAY8      ------------------------------------------------------------
A0A524P237      ------------------------------------------------------------
A0A3C0L0A8      ------------------------------------------------------------
A0A176S762      ------------------------------------------------------------
A0A377ZC40      ------------------------------------------------------------
A0A378BPJ7      ------------------------------------------------------------
A0A2J5PAJ7      ------------------------------------------------------------
A0A377ZDN3      ------------------------------------------------------------
A0A1G3JY11      ------------------------------------------------------------
A0A661N3U1      ------------------------------------------------------------
A0A1W9WUD9      ------------------------------------------------------------
A0A1W1ZQK0      ------------------------------------------------------------
A0A4U1ALN4      ------------------------------------------------------------
A0A4U1B1A8      ------------------------------------------------------------
A0A1M7Y300      ------------------------------------------------------------
A0A4U1A967      ------------------------------------------------------------
A0A6I1R304      ------------------------------------------------------------
A0A1W9PMU6      ------------------------------------------------------------
A0A6D0ELN7      ------------------------------------------------------------
A0A3S1WTQ1      ------------------------------------------------------------
A0A440NX85      ------------------------------------------------------------
A0A530CUR9      ------------------------------------------------------------
A0A1M6N1X5      ------------------------------------------------------------
A0A561M3U0      ------------------------------------------------------------
A0A1G3VVY5      ------------------------------------------------------------
A0A2N6BZD5      ------------------------------------------------------------
A0A656PSQ6      ------------------------------------------------------------
A0A2W5J775      ------------------------------------------------------------
A0A352Q5C1      ------------------------------------------------------------
A0A435NNF5      ------------------------------------------------------------
A0A3S2AQS7      ------------------------------------------------------------
A0A436XH86      ------------------------------------------------------------
A0A527ZPD6      ------------------------------------------------------------
A0A529KRW3      ------------------------------------------------------------
A0A530ZLX0      ------------------------------------------------------------
A0A355TB56      ------------------------------------------------------------
A0A1F9E324      ------------------------------------------------------------
A0A432SAI6      ------------------------------------------------------------
A0A4Q3LBH4      ------------------------------------------------------------
A0A4Q3LWP3      ------------------------------------------------------------
A0A2N6VGL1      ------------------------------------------------------------
A0A3M3H5V6      ------------------------------------------------------------
A0A524M660      ------------------------------------------------------------
A0A0C1TRU6      ------------------------------------------------------------
A0A2Z5SSF4      ------------------------------------------------------------
A0A2T4ZJZ6      ------------------------------------------------------------
A0A327LYE6      ------------------------------------------------------------
A0A5A9ZTV3      ------------------------------------------------------------
A0A4Q4CIB1      ------------------------------------------------------------
A0A522ACJ9      ------------------------------------------------------------
A0A1T2KYM8      ------------------------------------------------------------
A0A3N5Z7F8      ------------------------------------------------------------
A0A2G9ZR82      ------------------------------------------------------------
A0A239HD34      ------------------------------------------------------------
A0A4U9I390      ------------------------------------------------------------
A0A534V9L7      ------------------------------------------------------------
A0A0P7ZZE4      ------------------------------------------------------------
A0A369R0Q9      ------------------------------------------------------------
A0A534XP85      ------------------------------------------------------------
A0A2X3M011      ------------------------------------------------------------
I2WC85          ------------------------------------------------------------
A0A400JH80      ------------------------------------------------------------
A0A2H9EHM4      ------------------------------------------------------------
A0A380B3D7      ------------------------------------------------------------
F5NSX0          ------------------------------------------------------------
A0A479JNB1      ------------------------------------------------------------
A0A5C9AF52      ------------------------------------------------------------
A0A6D0EYC7      ------------------------------------------------------------
D8EEU7          ------------------------------------------------------------
A0A0P1H2H0      ------------------------------------------------------------
A0A258WKV0      ------------------------------------------------------------
A0A377N8F8      ------------------------------------------------------------
A5G4N9          ------------------------------------------------------------
A0A3C2DSE7      ------------------------------------------------------------
A0A2X1JBG5      ------------------------------------------------------------
A0A0B8PTA8      ------------------------------------------------------------
A0A0B8QF75      ------------------------------------------------------------
A0A4Q3LR91      ------------------------------------------------------------
A0A6C9IKN8      ------------------------------------------------------------
A0A4V1TR68      ------------------------------------------------------------
A0A444IY46      ------------------------------------------------------------
A0A6I7N627      ------------------------------------------------------------
A0A660AID0      ------------------------------------------------------------
A0A3E0WKI3      ------------------------------------------------------------
A0A1H3I2J1      ------------------------------------------------------------
A0A1V5DJV0      ------------------------------------------------------------
A0A520IUC4      ------------------------------------------------------------
A0A521LJG5      ------------------------------------------------------------
A0A531IBQ7      ------------------------------------------------------------
A0A377LY04      ------------------------------------------------------------
A0A5C9ABR5      ------------------------------------------------------------
A0A5J9WU72      ------------------------------------------------------------
A0A2X3K9R3      ------------------------------------------------------------
A0A5W0ZR28      ------------------------------------------------------------
A0A622KDG2      ------------------------------------------------------------
A0A3T9EHW9      ------------------------------------------------------------
A0A484X141      ------------------------------------------------------------
A0A5N9VWI6      ------------------------------------------------------------
A0A6D0EJQ0      ------------------------------------------------------------
A0A376LLF8      ------------------------------------------------------------
A0A444R390      ------------------------------------------------------------
A0A6C9J192      ------------------------------------------------------------
A0A1V4WHZ7      ------------------------------------------------------------
A0A1E5AJN5      ---------------------------------------------------MADQQHSHS
A0A2N3D2J1      ------------------------------------------------------------
A0A2N2GVE1      ------------------------------------------------------------
A0A2N2INV3      ------------------------------------------------------------
A0A1Y5DXG5      ------------------------------------------------------------
A0A0B8P2H5      ------------------------------------------------------------
A0A483QWI8      ------------------------------------------------------------
A0A483UXD3      ------------------------------------------------------------
A0A0A8J8L3      ------------------------------------------------------------
A0A660DJ38      ------------------------------------------------------------
A0A380AQW6      ------------------------------------------------------------
A0A2G2GD62      MDSNITKNMEADEESFDIQQALYIIKKYNKSIAFIVVVFIIISGIMAYFKPSMYFSTAVV
A0A524P331      ------------------------------------------------------------
A0A4V1SSM5      ------------------------------------------------------------
A0A4Q3K8G7      ------------------------------------------------------------
A0A1M7HC79      ------------------------------------------------------------
A0A1D3JZN6      ------------------------------------------------------------
A0A1V6ESG1      ------------------------------------------------------------
A0A1H7YHK3      ------------------------------------------------------------
A0A534SH66      ------------------------------------------------------------
A0A3M0ZZ99      ------------------------------------------------------------
A0A238LBD3      ------------------------------------------------------------
A0A328C2K5      ------------------------------------------------------------
A0A5C6X8M3      ------------------------------------------------------------
A0A3D8MRR7      ------------------------------------------------------------
A0A5C6UBJ7      ------------------------------------------------------------
A0A5C6XGM3      ------------------------------------------------------------
A0A537NZJ1      ------------------------------------------------------------
A0A0P1FRV5      ------------------------------------------------------------
A0A4Q4CVW6      ------------------------------------------------------------
A0A090R136      ------------------------------------------------------------
A0A661JU93      ------------------------------------------------------------
A0A2E2T3V8      ------------------------------------------------------------
A0A367UAB4      ------------------------------------------------------------
A0A0P1FWI8      ------------------------------------------------------------
A0A377V641      ------------------------------------------------------------
A0A1F2YJ88      ------------------------------------------------------------
A0A0J7XGZ1      ------------------------------------------------------------
I4CBA7          ------------------------------------------------------------
A3VE95          ------------------------------------------------------------
A0A1G0NL95      ------------------------------------------------------------
A0A024KA69      ------------------------------------------------------------
A0A0L1KFN4      ------------------------------------------------------------
A0A3P5DSS6      ------------------------------------------------------------
A0A483YEL5      ------------------------------------------------------------
A0A658GUJ0      ------------------------------------------------------------
A0A358L616      ------------------------------------------------------------
A0A1M7BLL7      ------------------------------------------------------------
A0A0H4KZM1      ------------------------------------------------------------
A0A3D5UYX7      ------------------------------------------------------------
A0A2N1WQN5      ------------------------------------------------------------
A0A352G2C2      ------------------------------------------------------------
A0A3C0PZN1      ------------------------------------------------------------
A0A524QFS4      ---------------------------------------------MRADEEKSKIQGRDP
A0A1V1UJT2      ------------------------------------------------------------
A0A0L6CVX1      ------------------------------------------------------------
A0A1V0RR48      ------------------------------------------------------------
A0A0A0HJJ4      ------------------------------------------------------------
A0A5E7YA28      ------------------------------------------------------------
A0A520JSW4      ------------------------------------------------------------
A0A4Q3LTF3      ------------------------------------------------------------
A0A537UTP9      ------------------------------------------------------------
A0A1D2RNR5      ------------------------------------------------------------
A0A4V1TQ46      ------------------------------------------------------------
A0A3A0FZC0      ------------------------------------------------------------
A0A1N7JVZ7      ------------------------------------------------------------
A0A091C4A8      ------------------------------------------------------------
A0A4R3H6P6      ------------------------------------------------------------
A0A3S1NQ09      ------------------------------------------------------------
A0A443GJ52      ------------------------------------------------------------
A0A2W6S588      ------------------------------------------------------------
A0A483E0N4      ------------------------------------------------------------
A0A2J4YQQ6      ------------------------------------------------------------
A0A483THX4      ------------------------------------------------------------
A0A534MVS2      ------------------------------------------------------------
A0A444I5K6      ------------------------------------------------------------
A0A154VE85      -------------------------------------------------------MSALA
A0A3S1MCW7      ------------------------------------------------------------
A0A434IGN6      ------------------------------------------------------------
A0A528AX40      ------------------------------------------------------------
A0A528MV95      ------------------------------------------------------------
A0A3C1S9Y1      ------------------------------------------------------------
A0A353EH49      ------------------------------------------------------------
A0A1Y1Q9C1      ------------------------------------------------------------
A0A3M7LJH0      ------------------------------------------------------------
A0A316KRG4      ------------------------------------------------------------
A0A1E4JHX8      ------------------------------------------------------------
M2U8P2          ------------------------------------------------------------
A0A1H7KZF8      ------------------------------------------------------------
A0A0J5Q9T7      ------------------------------------------------------------
A0A257NG76      ------------------------------------------------------------
A0A1T4TW59      ------------------------------------------------------------
A0A1I5YYQ0      ------------------------------------------------------------
A0A5P9FE62      ------------------------------------------------------------
A0A1Q3MB35      ------------------------------------------------------------
A0A259LUN7      ------------------------------------------------------------
A0A2D7AVL1      ------------------------------------------------------------
A0A3B9KZE9      ------------------------------------------------------------
A0A2U0NMP8      ------------------------------------------------------------
A0A4U9HNE9      ------------------------------------------------------------
A0A2G2CXY6      ------------------------------------------------------------
A0A3M1D4H3      ------------------------------------------------------------
A0A5C8BYM7      ------------------------------------------------------------
A0A1J5ICP0      ------------------------------------------------------------
A0A0M3GBT1      ------------------------------------------------------------
B3Q577          ------------------------------------------------------------
A0A379B9V4      ------------------------------------------------------------
A0A0Q6TS97      ------------------------------------------------------------
A0A0Q6UYB4      ------------------------------------------------------------
A0A484XS37      ------------------------------------------------------------
W7Q5J0          -----------------------------------------------------------N
A0A654AKT6      ------------------------------------------------------------
A0A0G9MZA5      ------------------------------------------------------------
H0T8B0          ------------------------------------------------------------
A0A5C7N981      ------------------------------------------------------------
A0A534TV22      ------------------------------------------------------------
A0A351CXR4      ------------------------------------------------------------
A0A2N6GLF5      ------------------------------------------------------------
A0A1W9LJP0      ------------------------------------------------------------
A0A0W1ICB0      ------------------------------------------------------------
A0A2E0UL88      ------------------------------------------------------------
A0A233IKJ2      ------------------------------------------------------------
A0A2T1JE00      ------------------------------------------------------------
A0A0T2QIS1      ------------------------------------------------------------
A0A376KYN0      ------------------------------------------------------------
A0A2X1JB05      ------------------------------------------------------------
A0A376RML0      ------------------------------------------------------------
A0A377E5P7      ------------------------------------------------------------
A0A0P7Y1D0      ------------------------------------------------------------
A0A2M7JRZ7      ------------------------------------------------------------
A0A167IR75      ------------------------------------------------------------
A0A3B8T2U6      ------------------------------------------------------------
A0A365PWR2      ------------------------------------------------------------
A0A2E9H5Z8      ------------------------------------------------------------
A0A2E2BR79      ------------------------------------------------------------
A0A0Q4Q524      ------------------------------------------------------------
A0A0Q4CFJ9      ------------------------------------------------------------
A0A0Q4FE58      ------------------------------------------------------------
A0A0Q4JWC8      ------------------------------------------------------------
A0A0Q4KFL8      ------------------------------------------------------------
A0A522R8R0      ------------------------------------------------------------
A0A2U9NDY5      ------------------------------------------------------------
A0A0Q4IGG1      ------------------------------------------------------------
X7F6S5          ------------------------------------------------------------
A0A1G8NKI0      ------------------------------------------------------------
A0A355QPE4      ------------------------------------------------------------
A0A357RN98      ------------------------------------------------------------
A0A6B2MSQ7      ------------------------------------------------------------
A0A6B2P8H8      ------------------------------------------------------------
A0A1I6U4V1      ------------------------------------------------------------
A0A1G7CFZ2      ------------------------------------------------------------
A0A1P8USW9      ------------------------------------------------------------
A0A534RUJ5      ------------------------------------------------------------
A0A3M1CJM3      ------------------------------------------------------------
A0A2R7SVD4      ------------------------------------------------------------
A0A3C0PWB6      ------------------------------------------------------------
V4Q8B7          ------------------------------------------------------------
A0A0Q8XKK5      ------------------------------------------------------------
A0A2E0Q2W0      ------------------------------------------------------------
A0A660NIR6      ------------------------------------------------------------
A0A142W0R3      ------------------------------------------------------------
A0A0S4XR18      ------------------------------------------------------------
A0A2E0GW64      ------------------------------------------------------------
A0A1A7QJ97      ------------------------------------------------------------
A0A6I4IKZ3      ------------------------------------------------------------
A0A661LW70      ------------------------------------------------------------
W7Q8F9          ------------------------------------------------------------
A0A524PXH8      ------------------------------------------------------------
A0A4Q3P0E4      ------------------------------------------------------------
A0A3M2BE89      ------------------------------------------------------------
A0A4Q4A6K6      ------------------------------------------------------------
A0A257G674      ------------------------------------------------------------
A0A661M5M6      ------------------------------------------------------------
A0A1I1UM01      ------------------------------------------------------------
Q44573          ------------------------------------------------------------
A2W025          ------------------------------------------------------------
A0A534Z362      -------------------------------MAAADRPLFPLPDPTGAQPTPPGGYLPPP
V4J283          ------------------------------------------------------------
A0A536T443      ------------------------------------------------------------
A0A0Q4UFQ5      ------------------------------------------------------------
A0A527W7E6      ------------------------------------------------------------
A0A432EMV7      ------------------------------------------------------------
A0A087LTV7      ------------------------------------------------------------
A0A534WLI3      ------------------------------------------------------------
A0A318KWA2      ------------------------------------------------------------
A0A522MT86      ------------------------------------------------------------
A0A4Q3I221      ------------------------------------------------------------
A0A534SAL6      ----------------------------------MTEQALTSRPADTRLSAPGGYAAAGV
A0A534ZDB4      ----------------------------------MAEQALASRATDSRLTAPGGYAAAGV
A0A534X3M7      -------------------------------MIARTPVPLRGASAPEQLPPGGGYLPPPI
A0A534SPC6      ------------------------------------------------------------
A0A535AD60      ---------------------------MAAADRPLFPLPADPTGAQPTPPGGYLHLPPPI
A0A4Q3SY08      ------------------------------------------------------------
A0A4Q3LG23      ------------------------------------------------------------
A0A522EX52      ------------------------------------------------------------
A0A1H3KC95      ------------------------------------------------------------
A0A5P8Z4P3      ------------------------------------------------------------
A0A2E9HXF7      ------------------------------------------------------------
A0A0B3RZC9      ------------------------------------------------------------
A0A6F8QET1      ------------------------------------------------------------
A0A520HUH4      ------------------------------------------------------------
A0A2K8U7M6      ------------------------------------------------------------
A0A5B9DKL8      ------------------------------------------------------------
A0A238KJM1      ------------------------------------------------------------
A0A3A0FJZ4      ------------------------------------------------------------
W4HJV8          ------------------------------------------------------------
A0A0P1GDI0      ------------------------------------------------------------
A0A2R8ATV5      ------------------------------------------------------------
A0A1U7D3R6      ------------------------------------------------------------
A0A2D4UVV2      ------------------------------------------------------------
A0A0W7WHP4      ------------------------------------------------------------
A0A238J8F6      ------------------------------------------------------------
A0A238JQI6      ------------------------------------------------------------
A0A222E077      ------------------------------------------------------------
A0A239E3Y2      ------------------------------------------------------------
A0A1V6FYJ1      ------------------------------------------------------------
A0A445MZQ4      ------------------------------------------------------------
A0A0M9E0E3      ------------------------------------------------------------
A0A0Q6QV61      ------------------------------------------------------------
A0A2Z3IKG4      ------------------------------------------------------------
A0A2W4RFS2      ------------------------------------------------------------
A0A1Y6DC43      ------------------------------------------------------------
A0A2S6HE06      ------------------------------------------------------------
G3J0M3          ------------------------------------------------------------
V5C6R5          ------------------------------------------------------------
A0A354EF47      ------------------------------------------------------------
A0A2G6MSP7      ------------------------------------------------------------
A0A4U8YMP3      ------------------------------------------------------------
A0A1Q8QQ99      ------------------------------------------------------------
A0A3D5ZY44      ------------------------------------------------------------
A0A646J2A6      ------------------------------------------------------------
A0A1G5C236      ------------------------------------------------------------
A0A432HIS7      ------------------------------------------------------------
A0A1I3XJ27      ------------------------------------------------------------
A0A1I7DCG1      ------------------------------------------------------------
A0A3A3H6D9      ------------------------------------------------------------
A0A562CGU2      ------------------------------------------------------------
A0A0Q6VA36      ------------------------------------------------------------
A0A1B2EQN1      ------------------------------------------------------------
A0A1E7HSL6      ------------------------------------------------------------
A0A4Q3ZDI7      ------------------------------------------------------------
A0A537PRC6      ------------------------------------------------------------
A0A2M7JX59      ------------------------------------------------------------
A0A3A4XVN3      ------------------------------------------------------------
A0A1E7JEV6      ------------------------------------------------------------
A0A2N2KDY5      ------------------------------------------------------------
A0A3N5YUD9      ------------------------------------------------------------
A0A0W1DLQ3      ------------------------------------------------------------
A0A246JVD8      ------------------------------------------------------------
A0A2N3BB54      ------------------------------------------------------------
A0A1H6G7A3      ------------------------------------------------------------
A0A0A7PGL6      ------------------------------------------------------------
A0A4Q2Z4L0      ------------------------------------------------------------
A0A5C4N0H6      ------------------------------------------------------------
A0A4R1HDF2      ------------------------------------------------------------
A0A1E7HFN0      ------------------------------------------------------------
A0A1M5GH86      ------------------------------------------------------------
A0A1W1XQZ5      ------------------------------------------------------------
A0A3D6C3I2      ------------------------------------------------------------
S0G1D4          ------------------------------------------------------------
A0A661T246      ------------------------------------------------------------
A0A2G6CSG7      ------------------------------------------------------------
A0A2G6NB59      ------------------------------------------------------------
A0A5K8A7T9      ------------------------------------------------------------
A0A1W9U045      ------------------------------------------------------------
A0A1F9L9G4      ------------------------------------------------------------
A0A328FD76      ------------------------------------------------------------
A0A348UX90      ------------------------------------------------------------
A0A357Z0N5      ------------------------------------------------------------
A0A0F2R2U0      ------------------------------------------------------------
A0A5K7ZK00      ------------------------------------------------------------
A0A5K7YCX8      ------------------------------------------------------------
A0A5K7Z388      ------------------------------------------------------------
A0A352B502      ------------------------------------------------------------
A0A2K8WHP8      ------------------------------------------------------------
A0A410V446      ------------------------------------------------------------
A0A0R3KGJ5      ------------------------------------------------------------
A0A0R3N604      ------------------------------------------------------------
A0A1B1UCM8      ------------------------------------------------------------
A0A1N6JQ20      ------------------------------------------------------------
A0A1M5TI07      ------------------------------------------------------------
A3X191          ------------------------------------------------------------
A0A1H4RKV5      ------------------------------------------------------------
A0A160UA87      ------------------------------------------------------------
A0A1Q5SFV5      ------------------------------------------------------------
A0A1J5N774      ------------------------------------------------------------
A0A2C8F781      ------------------------------------------------------------
A0A2E3R6G0      ------------------------------------------------------------
A0A1F8XMK2      ------------------------------------------------------------
A0A3M8EMP2      ------------------------------------------------------------
A0A2J6J6K6      ------------------------------------------------------------
A0A661PSB9      ------------------------------------------------------------
A0A661QBT6      ------------------------------------------------------------
A0A1G6EKK9      ------------------------------------------------------------
A0A6I2SLK2      ------------------------------------------------------------
A0A0A8WSG4      ------------------------------------------------------------
S7TK97          ------------------------------------------------------------
S7UE93          ------------------------------------------------------------
A0A3D5BR56      ------------------------------------------------------------
A0A2N2IB15      ------------------------------------------------------------
A0A1I3PSR2      ------------------------------------------------------------
A0A1I4GEK4      ------------------------------------------------------------
A0A2T5R3J5      ------------------------------------------------------------
A0A1W7QPT7      ------------------------------------------------------------
A0A0M4D373      ------------------------------------------------------------
A0A1L3GKM9      ------------------------------------------------------------
A0A430DNP0      ------------------------------------------------------------
A0A3A0FQ32      ------------------------------------------------------------
A0A1E4UZA0      ------------------------------------------------------------
A0A1H9KL56      ------------------------------------------------------------
A0A1A9KEF8      ------------------------------------------------------------
A0A5E6PKN5      ------------------------------------------------------------
A0A0N9W1V6      ------------------------------------------------------------
A0A423GQ41      ------------------------------------------------------------
A0A423H7J2      ------------------------------------------------------------
A0A502HNM8      ------------------------------------------------------------
A0A4Q7H223      ------------------------------------------------------------
A0A1H4N2K9      ------------------------------------------------------------
A0A2K4KWF7      ------------------------------------------------------------
A0A3E0WXH2      ------------------------------------------------------------
A0A2N2TRC8      ------------------------------------------------------------
A0A1V4CIZ7      ------------------------------------------------------------
A0A1M3BXA5      ------------------------------------------------------------
A0A1Y2R3U6      ------------------------------------------------------------
A0A167HVD6      ------------------------------------------------------------
A0A1V3SCT6      ------------------------------------------------------------
L0H287          ------------------------------------------------------------
A0A495VG93      ------------------------------------------------------------
A0A4R3MYM4      ------------------------------------------------------------
G2E3C0          ------------------------------------------------------------
A0A4U8YLL7      ------------------------------------------------------------
A0A3N5RNY4      ------------------------------------------------------------
A0A1V4M8I1      ------------------------------------------------------------
A0A4Z0M4C7      ------------------------------------------------------------
A0A5Q2QDL1      ------------------------------------------------------------
A0A1I0R9R6      ------------------------------------------------------------
A0A443K010      ------------------------------------------------------------
A0A6I7NYG5      ------------------------------------------------------------
A0A238IZI1      ------------------------------------------------------------
A0A316GHM6      ------------------------------------------------------------
A0A520ZTR8      ------------------------------------------------------------
A0A212AR83      ------------------------------------------------------------
A0A2E2P4I0      ------------------------------------------------------------
A0A2U2CM86      ------------------------------------------------------------
A0A1X7ACC1      ------------------------------------------------------------
A0A2N3BVE7      ------------------------------------------------------------
A0A2S5JE21      ------------------------------------------------------------
A0A2R8BKZ2      ------------------------------------------------------------
A0A2S8S361      ------------------------------------------------------------
A0A238KUF6      ------------------------------------------------------------
A0A095CTW3      ------------------------------------------------------------
A0A2E3UGD6      ------------------------------------------------------------
A0A2T0RFH0      ------------------------------------------------------------
A0A285D390      ------------------------------------------------------------
A0A497VHN4      ------------------------------------------------------------
A0A318CT66      ------------------------------------------------------------
A0A3N5P205      ------------------------------------------------------------
A0A2N6BEI9      ------------------------------------------------------------
A0A0D5N3E9      ------------------------------------------------------------
A0A2N2G716      ------------------------------------------------------------
W9VVY5          ------------------------------------------------------------
A0A1E2URD3      ------------------------------------------------------------
A0A2T6MY81      ------------------------------------------------------------
A0A2T6NBQ8      ------------------------------------------------------------
A0A421K431      ------------------------------------------------------------
A0A2G2I5M1      ------------------------------------------------------------
A0A2G2M6F0      ------------------------------------------------------------
A0A1W9J9F8      ------------------------------------------------------------
A0A2S5LFJ9      ------------------------------------------------------------
A0A2D8R8F8      ------------------------------------------------------------
A0A6I4JXQ8      ------------------------------------------------------------
A0A010SNS0      ------------------------------------------------------------
A0A0C2I782      ------------------------------------------------------------
A0A2N8BYF5      ------------------------------------------------------------
A0A558FKX2      ------------------------------------------------------------
A0A1H1DBA0      ------------------------------------------------------------
J2TAD5          ------------------------------------------------------------
J3H699          ------------------------------------------------------------
A0A1H5J974      ------------------------------------------------------------
A0A0K1QRZ4      ------------------------------------------------------------
A0A560RJW9      ------------------------------------------------------------
A0A5E6TID7      ------------------------------------------------------------
A0A5E7CRU7      ------------------------------------------------------------
A0A5E7C564      ------------------------------------------------------------
A0A2W7MAV4      ------------------------------------------------------------
A0A4R3WQH5      ------------------------------------------------------------
W6VFG3          ------------------------------------------------------------
A0A1P8ENT1      ------------------------------------------------------------
A0A2N7XRV4      ------------------------------------------------------------
A0A0Q6QPG8      ------------------------------------------------------------
A0A0F4SWA7      ------------------------------------------------------------
A0A423J219      ------------------------------------------------------------
A0A4P6G9U8      ------------------------------------------------------------
A0A4Y8JE06      ------------------------------------------------------------
A0A502I1X9      ------------------------------------------------------------
A0A502J776      ------------------------------------------------------------
A0A5B0EZF6      ------------------------------------------------------------
A0A059L434      ------------------------------------------------------------
A0A0F4UWN2      ------------------------------------------------------------
A0A5E7WEF5      ------------------------------------------------------------
A0A1G0KSD0      ------------------------------------------------------------
A0A4P6WX84      ------------------------------------------------------------
A0A1D2S760      ------------------------------------------------------------
A0A5B8RW94      ------------------------------------------------------------
A0A258TN88      ------------------------------------------------------------
A0A1F9EUS2      ------------------------------------------------------------
A0A6H9HII8      ------------------------------------------------------------
A0A3N9VAW3      ------------------------------------------------------------
A0A1X0YE57      ------------------------------------------------------------
A0A2K2H9Q8      ------------------------------------------------------------
A0A6I1KNW9      ------------------------------------------------------------
A0A1H4B8T3      ------------------------------------------------------------
A0A1E7IQC3      ------------------------------------------------------------
A0A1M6KEN5      ------------------------------------------------------------
A0A353QLL3      ------------------------------------------------------------
A0A399I453      ------------------------------------------------------------
A0A651FBV9      ------------------------------------------------------------
A0A5C1MDH8      ------------------------------------------------------------
A0A5A9XE04      ------------------------------------------------------------
A0A643G9R1      ------------------------------------------------------------
A0A1G0M8Q7      ------------------------------------------------------------
A0A353MI14      ------------------------------------------------------------
A0A4S1CAW7      ------------------------------------------------------------
A0A562VHD2      ------------------------------------------------------------
A0A6I6JNB5      ------------------------------------------------------------
A0A1G0LDK7      ------------------------------------------------------------
A0A6F9WVL7      ------------------------------------------------------------
A0A2M7WWF7      ------------------------------------------------------------
A0A351Z9A2      ------------------------------------------------------------
A0A351B422      ------------------------------------------------------------
F2NEE9          ------------------------------------------------------------
B7RS54          ------------------------------------------------------------
A0A3N5FRH4      ------------------------------------------------------------
A0A1V4Y2C3      ------------------------------------------------------------
A0A2N2KTJ4      ------------------------------------------------------------
A0A2N2LQX0      ------------------------------------------------------------
A0A520CSP5      ------------------------------------------------------------
A0A1I6ENM4      ------------------------------------------------------------
A8LNM8          ------------------------------------------------------------
A0A0T5NSU3      ------------------------------------------------------------
A0A5P9I718      ------------------------------------------------------------
A0A2M8J3R9      ------------------------------------------------------------
A0A1I6X762      ------------------------------------------------------------
A0A0P1EFX8      ------------------------------------------------------------
A0A2G5KB39      ------------------------------------------------------------
A0A2N3CNV1      ------------------------------------------------------------
A0A257F1F4      ------------------------------------------------------------
A0A1G9FY29      ------------------------------------------------------------
A0A4Q3ZBK4      ------------------------------------------------------------
A0A2D5J8T8      ------------------------------------------------------------
A0A2E3P9W6      ------------------------------------------------------------
A0A2G2B1P9      ------------------------------------------------------------
A0A258GCD5      ------------------------------------------------------------
A0A2D9YR88      ------------------------------------------------------------
A0A443INY4      ------------------------------------------------------------
A0A372IH36      ------------------------------------------------------------
A0A540VW45      ------------------------------------------------------------
A0A1H9C241      ------------------------------------------------------------
A0A2E3FCR1      ------------------------------------------------------------
A0A4S3MG69      ------------------------------------------------------------
A0A3E0H727      ------------------------------------------------------------
A0A1G8QZS5      ------------------------------------------------------------
A0A1V4QMH7      ------------------------------------------------------------
A0A496XZQ4      ------------------------------------------------------------
A0A1F9BJF7      ------------------------------------------------------------
F2NDF5          ------------------------------------------------------------
A0A1I3TTC3      ------------------------------------------------------------
A0A1H3IZW6      ------------------------------------------------------------
A0A0M6YG59      ------------------------------------------------------------
A0A1H7G8B0      ------------------------------------------------------------
A0A059IPK4      ------------------------------------------------------------
A0A1H2Y469      ------------------------------------------------------------
A0A497ZQU7      ------------------------------------------------------------
A0A318D3U4      ------------------------------------------------------------
A0A401FQP5      ------------------------------------------------------------
A0A1Q6DMW3      ------------------------------------------------------------
A0A3A6P8F8      ------------------------------------------------------------
A0A2G2DSM4      ------------------------------------------------------------
A0A1F9NI02      ------------------------------------------------------------
A0A4U1ABX4      ------------------------------------------------------------
A0A351Z4H9      ------------------------------------------------------------
A0A2N2KML4      ------------------------------------------------------------
E1YJF1          ------------------------------------------------------------
A0A1J5EVZ6      ------------------------------------------------------------
A0A2G6FCC5      ------------------------------------------------------------
A0A1F9MR25      ------------------------------------------------------------
A0A2G6M7F1      ------------------------------------------------------------
A0A1E7H876      ------------------------------------------------------------
A0A509L3P8      ------------------------------------------------------------
A0A3A4S038      ------------------------------------------------------------
A0A1F9N669      ------------------------------------------------------------
A0A1F9PFA7      ------------------------------------------------------------
A0A1H2EN09      ------------------------------------------------------------
K0NP00          ------------------------------------------------------------
A0A1E7JCL5      ------------------------------------------------------------
A0A496YAH9      ------------------------------------------------------------
A0A1V4S7E4      ------------------------------------------------------------
A0A2N2H8D2      ------------------------------------------------------------
A0A2N2KC63      ------------------------------------------------------------
A0A3A4ZYW4      ------------------------------------------------------------
A0A1V4MCJ4      ------------------------------------------------------------
A0A661M0W4      ------------------------------------------------------------
A0A0F2NF69      ------------------------------------------------------------
A0A1F9NFD0      ------------------------------------------------------------
A0A1M5YLH5      ------------------------------------------------------------
A0A4U1A4C7      ------------------------------------------------------------
                                                                            

E1Y9C0          ------------------------------------------------------------
A0A1N6SH58      ------------------------------------------------------------
A0A4Q3AQN2      ------------------------------------------------------------
A0A1W9HS52      ------------------------------------------------------------
A0A2D5LFD8      ------------------------------------------------------------
A0A0N0XAV4      ------------------------------------------------------------
A0A0P9QD19      ------------------------------------------------------------
F3FHG4          ------------------------------------------------------------
F3GGI0          ------------------------------------------------------------
A0A0P9LE74      ------------------------------------------------------------
A0A3M4ZQ14      VARPARSRCSRPLSATPFSLRTDLCAALAVHRRLASSFSVRRDTINDRHEPCSFGSLPGF
A0A3M5YLE8      VARPARSRCSRPLSATPFSLRTDLCAALAVHRRLASSFSVRRDTINDRHEPCSFGSLPGF
A0A3M3RP89      VARPARSRCSRPLSATPFSLRTDLCAALAVHRRLASSFSVRRDTINDRHEPCSFGSLPGF
A0A0P9QIY7      VARPARSRCSRPLSAPPFSLRTDLCAALAVHRRLASSFSVRRDTINDRHEPCSFGSLPGF
A0A0P9VVH7      VARPARSRCSRPLSATPFSLRTDLCAALAVHRRLASSFSVRRDTINDRHEPCSFGSLPGF
A0A0Q0FJK6      VARPARSRCSRPLSATPFSLRTDLCAALAVHRRLASSFSVRRDTINDRHEPCSFGSLPGF
A0A0Q0G2J0      VARPARSRCSRPLSATPFSLRTDLCAALAVHRRLASSFSVRRDTINDRHEPCSFGSLPGF
A0A3M3LF66      VARPARSRCSRPLSATPFSLRTDLCAALAVHRRLASSFSVRRDTINDRHEPCSFGSLPGF
A0A0P9WIR8      VARPARSRCSRPLSAPPFSLRTDLCAALAVHRRLASSFSVRRDTINDRHEPCSFGSLPGF
A0A3M3KPE5      ------------------------------------------------------------
A0A3M4C263      ------------------------------------------------------------
A0A3M5AD05      ------------------------------------------------------------
A0A0Q0D3D2      ------------------------------------------------------------
A0A0N0FS39      ------------------------------------------------------------
A0A3M6GHH2      ------------------------------------------------------------
A0A0P9R9W0      -----------------------------MHRRLASSFSVRSNRINDRHEPSIPGFPTGL
A0A0Q0B9T0      -----------------------------MHRRLASSFSVRSNRINDRHEPSIPGFPTGL
A0A3M6CFI7      -----------------------------MHRRLASSFSVRSNRINDRHEPSIPGFPTGL
A0A0P9JXN0      -----------------------------MHRRLASSFSVRSNRINDRHEPSIPGFPTGL
A0A3M6FIV7      -----------------------------MHRRLASSFSVRSNRINDRHEPSIPGFPTGL
A0A3M3PLW9      ------------------------------------------------------------
A0A3M4ENY1      ------------------------------------------------------------
A0A3M5EZK7      ------------------------------------------------------------
A0A0P9SPP5      ------------------------------------------------------------
A0A658KL17      ------------------------------------------------------------
A0A3M3NNF2      ------------------------------------------------------------
A0A3M4A0E8      ------------------------------------------------------------
A0A3M4PBZ2      ------------------------------------------------------------
A0A3M6AI26      ------------------------------------------------------------
A0A0P9IWP8      ------------------------------------------------------------
A0A0P9KZ49      ------------------------------------------------------------
A0A0P9V840      ------------------------------------------------------------
A0A0Q0AIE5      ------------------------------------------------------------
A0A3M2ZQH6      ------------------------------------------------------------
A0A0N8SQG2      ------------------------------------------------------------
A0A0W8HFU1      ------------------------------------------------------------
A0A3M5M873      ------------------------------------------------------------
A0A0P9VHH8      ------------------------------------------------------------
A0A0P9YV98      ------------------------------------------------------------
A0A3M3G2W8      ------------------------------------------------------------
A0A3M6C224      ------------------------------------------------------------
A0A3M5K254      ------------------------------------------------------------
A0A3M5JFB0      ------------------------------------------------------------
A0A3M3TQV3      ------------------------------------------------------------
A0A3M3EF92      ------------------------------------------------------------
A0A3M5J1E2      ------------------------------------------------------------
A0A3M5G7H9      ------------------------------------------------------------
A0A3M4A376      ------------------------------------------------------------
A0A0Q0A5T8      ------------------------------------------------------------
A0A0P9SCD7      ------------------------------------------------------------
A0A0P9T4G3      ------------------------------------------------------------
A0A0P9VKB0      ------------------------------------------------------------
A0A0Q0BM35      ------------------------------------------------------------
A0A3M3TPR7      ------------------------------------------------------------
A0A3M3U4Q3      ------------------------------------------------------------
A0A0P9UCX7      ------------------------------------------------------------
A0A0P9S1F1      ------------------------------------------------------------
A0A0P9QCJ2      ------------------------------------------------------------
A0A0P9Q329      ------------------------------------------------------------
A0A3M5GJ64      ------------------------------------------------------------
A0A0P9MPC7      ------------------------------------------------------------
A0A3M2XYQ3      ------------------------------------------------------------
A0A0P9XCE1      ------------------------------------------------------------
A0A3M3EFX7      ------------------------------------------------------------
A0A3M5B9D9      ------------------------------------------------------------
A0A0P9RRZ3      ------------------------------------------------------------
A0A3M2VEK7      ------------------------------------------------------------
A0A0N8R9B3      ------------------------------------------------------------
A0A0P9VA27      ------------------------------------------------------------
A0A3M4YBJ4      ------------------------------------------------------------
A0A0P9J470      ------------------------------------------------------------
A0A0Q0EVJ8      ------------------------------------------------------------
A0A3M5UI30      ------------------------------------------------------------
A0A3M5YQT8      ------------------------------------------------------------
A0A3M5F5X1      ------------------------------------------------------------
A0A3M5R8G1      ------------------------------------------------------------
A0A3M5V012      ------------------------------------------------------------
A0A3M3GA16      ------------------------------------------------------------
A0A3M3UCT3      --MAGPARHHRPLPAARVSLRTDLRAALALHRRLAPSFSVRSNRINDRHEPSFPEFPSGL
A0A3M3CJL0      --MAGPARHHRPLPAARVSLRTDLRAALALHRRLAPSFSVRSNRINDRHEPSFPEFPSGL
A0A3M3F6F5      --MAGPARHHRPLPAARVSLRTDLRAALALHRRLAPSFSVRSNRINDRHEPSFPEFPSGL
A0A3M3P9B7      --MAGPARHHRPLPAARVSLRTDLRAALALHRRLAPSFSVRSNRINDRHEPSFPEFPSGL
A0A0N8QB74      --MAGPARHHRPLPAARVSLRTDLRAALALHRRLAPSFSVRSNRINDRHEPSFPEFPSGL
A0A0Q0AUD0      --MAGPARHHRPLPAARVSLRTDLRAALALHRRLAPSFSVRSNRINDRHEPSFPEFPSGL
A0A3M5VR55      --MAGPARHHRPLPAARVSLRTDLRAALALHRRLAPSFSVRSNRINDRHEPSFPEFPSGL
A0A0Q0FK97      --MAGPARHNRPLPAARVSLRADLRAALALHRRLASPFSVRSNRINDRHEPSFPEFPSGL
A0A3M5KZ75      ------------------------------------------------------------
A0A3M5L3G5      ------------------------------------------------------------
A0A0C5VQ86      ------------------------------------------------------------
A0A1V8MBH1      ------------------------------------------------------------
A0A534QGR3      ------------------------------------------------------------
A0A0R0BVC7      ------------------------------------------------------------
A0A0W1GMS6      ------------------------------------------------------------
A0A0Q8RMY3      ------------------------------------------------------------
A0A1A7QC21      ------------------------------------------------------------
A0A1F9CFF0      ------------------------------------------------------------
A0A2M8B0G5      ------------------------------------------------------------
A0A363TNU9      ------------------------------------------------------------
A0A534HBS8      ------------------------------------------------------------
A0A0F0T3Y9      ------------------------------------------------------------
A0A379GWF0      ------------------------------------------------------------
A0A536T0W8      ------------------------------------------------------------
A0A4Q2XLV7      ------------------------------------------------------------
A0A4Q5QYC4      ------------------------------------------------------------
A0A2G9XLE5      ------------------------------------------------------------
A0A3D2M6Y9      ------------------------------------------------------------
A0A3D2YAZ2      ------------------------------------------------------------
A0A350A102      ------------------------------------------------------------
A0A350L5D2      ------------------------------------------------------------
A0A3B8SQ27      ------------------------------------------------------------
A0A656BWB0      ------------------------------------------------------------
A0A6D0IFH4      ------------------------------------------------------------
A0A3Y2RPN4      ------------------------------------------------------------
A0A0A0FHV8      ------------------------------------------------------------
A0A1X3IPU7      ------------------------------------------------------------
A0A0A0G0N2      ------------------------------------------------------------
A0A243TPR1      ------------------------------------------------------------
A0A2I8SDU4      ------------------------------------------------------------
A0A2I8SU55      ------------------------------------------------------------
S1EXJ6          ------------------------------------------------------------
A0A376UBS1      ------------------------------------------------------------
A0A4Q6G931      ------------------------------------------------------------
A0A1W9F5M9      ------------------------------------------------------------
A0A3C2BN18      ------------------------------------------------------------
A0A447LR75      ------------------------------------------------------------
A0A376D8L7      ------------------------------------------------------------
A0A1V2FV46      ------------------------------------------------------------
A0A376SB61      ------------------------------------------------------------
A0A3D1BYV9      ------------------------------------------------------------
A0A6D0I9G1      ------------------------------------------------------------
A0A352MMI7      ------------------------------------------------------------
A0A379W6R2      ------------------------------------------------------------
A0A376RY66      ------------------------------------------------------------
A0A377K431      ------------------------------------------------------------
A0A379TA56      ------------------------------------------------------------
A0A4Z0LWV1      ------------------------------------------------------------
A0A5V7HTZ1      ------------------------------------------------------------
A0A610XNI4      ------------------------------------------------------------
A0A620QD02      ------------------------------------------------------------
A0A5H3HSJ8      ------------------------------------------------------------
A0A655C5P0      ------------------------------------------------------------
A0A2T0VBD8      ------------------------------------------------------------
A0A378APS2      ------------------------------------------------------------
A0A443VCQ6      ------------------------------------------------------------
A0A447RKQ7      ------------------------------------------------------------
W1DSK1          ------------------------------------------------------------
A0A0U2VAW2      ------------------------------------------------------------
A0A454CTF1      ------------------------------------------------------------
A0A6B3Q2G1      ------------------------------------------------------------
A0A378G3G7      ------------------------------------------------------------
A0A2X5NHJ9      ------------------------------------------------------------
A0A2J4QEC3      ------------------------------------------------------------
A0A485ADM3      ------------------------------------------------------------
A0A4U9HGU4      ------------------------------------------------------------
A0A3S4JGG5      ------------------------------------------------------------
A0A377ZDH2      ------------------------------------------------------------
A0A3S4HTS8      ------------------------------------------------------------
A0A2N1XK22      ------------------------------------------------------------
A0A3D0KAC8      ------------------------------------------------------------
A0A3D2Y902      ------------------------------------------------------------
A0A655RNN3      ------------------------------------------------------------
A0A655R819      ------------------------------------------------------------
A0A655ZEY0      ------------------------------------------------------------
A0A6G6X2Z4      ------------------------------------------------------------
Q44570          ------------------------------------------------------------
A0A3N5MZ53      ------------------------------------------------------------
A0A534E4H4      ------------------------------------------------------------
A0A534I2B6      ------------------------------------------------------------
A0A1C2JGD0      ------------------------------------------------------------
A0A259LQ70      ------------------------------------------------------------
A0A4V2SPR5      ------------------------------------------------------------
A0A3N5PM86      ------------------------------------------------------------
A0A2E5YSA4      ------------------------------------------------------------
A0A519ERR1      ------------------------------------------------------------
A0A4Q3Q1M2      ------------------------------------------------------------
A0A4Q3MHR1      ------------------------------------------------------------
A0A520GDZ4      ------------------------------------------------------------
A0A318DSU0      ------------------------------------------------------------
A0A538PF21      ------------------------------------------------------------
A0A1W1ZH10      ------------------------------------------------------------
A0A1W2FF24      ------------------------------------------------------------
A0A524JYQ6      ------------------------------------------------------------
A0A4Q3MA17      ------------------------------------------------------------
A0A0N0M5F7      ------------------------------------------------------------
A0A537M754      ------------------------------------------------------------
A0A1V1PDB4      ------------------------------------------------------------
A0A2M7C324      ------------------------------------------------------------
A0A4Q3HHG6      ------------------------------------------------------------
A0A3B7DTA4      ------------------------------------------------------------
A0A432ZK62      ------------------------------------------------------------
A0A1V5EEP4      ------------------------------------------------------------
A0A1V5EF48      ------------------------------------------------------------
A0A0S6X1X6      ------------------------------------------------------------
A0A537Y5L8      ------------------------------------------------------------
A0A4Q3L2X2      ------------------------------------------------------------
A0A4Q3T8J1      ------------------------------------------------------------
A0A4Q4ANM4      ------------------------------------------------------------
A0A4Q3UEC7      ------------------------------------------------------------
A0A1H5YYQ4      ------------------------------------------------------------
A0A1X4NLK2      ------------------------------------------------------------
A0A1X4NWB5      ------------------------------------------------------------
A0A1M5UQ38      ------------------------------------------------------------
A0A327YI48      ------------------------------------------------------------
A0A1B1PNL6      ------------------------------------------------------------
A0A2U8H9H9      ------------------------------------------------------------
A0A6B2NBB8      ------------------------------------------------------------
A0A1X6YIC0      ------------------------------------------------------------
A0A1I5E9E9      ------------------------------------------------------------
A0A1X6Z7N7      ------------------------------------------------------------
A0A2E1DQ13      ------------------------------------------------------------
A0A1H8C800      ------------------------------------------------------------
A0A2N3EZ05      ------------------------------------------------------------
A0A3N5J7U8      ------------------------------------------------------------
A0A1S7S3I8      ------------------------------------------------------------
A0A519E8D7      ------------------------------------------------------------
A0A3S1NZ06      ------------------------------------------------------------
A0A3S1FD32      ------------------------------------------------------------
A0A434DUT4      ------------------------------------------------------------
A0A528D3U3      ------------------------------------------------------------
A0A3S3UPT3      ------------------------------------------------------------
A0A3S1E286      ------------------------------------------------------------
A0A531AC71      ------------------------------------------------------------
A0A436K268      ------------------------------------------------------------
A0A434IDQ0      ------------------------------------------------------------
A0A435IRM5      ------------------------------------------------------------
A0A3S2C404      ------------------------------------------------------------
A0A435F6C0      ------------------------------------------------------------
A0A435BMN6      ------------------------------------------------------------
A0A529XQ54      ------------------------------------------------------------
A0A530BJC1      ------------------------------------------------------------
A0A348SRI7      ------------------------------------------------------------
A0A354EI73      ------------------------------------------------------------
A0A4Q3IRI1      ------------------------------------------------------------
A0A4P7EP83      ------------------------------------------------------------
A0A6I1QB25      ------------------------------------------------------------
A0A655ZZQ1      ------------------------------------------------------------
A0A1S0ZAI3      ------------------------------------------------------------
A0A1W9M770      ------------------------------------------------------------
A0A1W9M7R6      ------------------------------------------------------------
A0A3A4NIE9      ------------------------------------------------------------
A0A3A4NUI9      ------------------------------------------------------------
A0A524I3Z6      ------------------------------------------------------------
A0A524PCL7      ------------------------------------------------------------
A0A356GQV1      ------------------------------------------------------------
A0A1J5DAY8      ------------------------------------------------------------
A0A524P237      ------------------------------------------------------------
A0A3C0L0A8      ------------------------------------------------------------
A0A176S762      ------------------------------------------------------------
A0A377ZC40      ------------------------------------------------------------
A0A378BPJ7      ------------------------------------------------------------
A0A2J5PAJ7      ------------------------------------------------------------
A0A377ZDN3      ------------------------------------------------------------
A0A1G3JY11      ------------------------------------------------------------
A0A661N3U1      ------------------------------------------------------------
A0A1W9WUD9      ------------------------------------------------------------
A0A1W1ZQK0      ------------------------------------------------------------
A0A4U1ALN4      ------------------------------------------------------------
A0A4U1B1A8      ------------------------------------------------------------
A0A1M7Y300      ------------------------------------------------------------
A0A4U1A967      ------------------------------------------------------------
A0A6I1R304      ------------------------------------------------------------
A0A1W9PMU6      ------------------------------------------------------------
A0A6D0ELN7      ------------------------------------------------------------
A0A3S1WTQ1      ------------------------------------------------------------
A0A440NX85      ------------------------------------------------------------
A0A530CUR9      ------------------------------------------------------------
A0A1M6N1X5      ------------------------------------------------------------
A0A561M3U0      ------------------------------------------------------------
A0A1G3VVY5      ------------------------------------------------------------
A0A2N6BZD5      ------------------------------------------------------------
A0A656PSQ6      ------------------------------------------------------------
A0A2W5J775      ------------------------------------------------------------
A0A352Q5C1      ------------------------------------------------------------
A0A435NNF5      ------------------------------------------------------------
A0A3S2AQS7      ------------------------------------------------------------
A0A436XH86      ------------------------------------------------------------
A0A527ZPD6      ------------------------------------------------------------
A0A529KRW3      ------------------------------------------------------------
A0A530ZLX0      ------------------------------------------------------------
A0A355TB56      ------------------------------------------------------------
A0A1F9E324      ------------------------------------------------------------
A0A432SAI6      ------------------------------------------------------------
A0A4Q3LBH4      ------------------------------------------------------------
A0A4Q3LWP3      ------------------------------------------------------------
A0A2N6VGL1      ------------------------------------------------------------
A0A3M3H5V6      ------------------------------------------------------------
A0A524M660      ------------------------------------------------------------
A0A0C1TRU6      ------------------------------------------------------------
A0A2Z5SSF4      ------------------------------------------------------------
A0A2T4ZJZ6      ------------------------------------------------------------
A0A327LYE6      ------------------------------------------------------------
A0A5A9ZTV3      ------------------------------------------------------------
A0A4Q4CIB1      ------------------------------------------------------------
A0A522ACJ9      ------------------------------------------------------------
A0A1T2KYM8      ------------------------------------------------------------
A0A3N5Z7F8      ------------------------------------------------------------
A0A2G9ZR82      ------------------------------------------------------------
A0A239HD34      ------------------------------------------------------------
A0A4U9I390      ------------------------------------------------------------
A0A534V9L7      ------------------------------------------------------------
A0A0P7ZZE4      ------------------------------------------------------------
A0A369R0Q9      ------------------------------------------------------------
A0A534XP85      ------------------------------------------------------------
A0A2X3M011      ------------------------------------------------------------
I2WC85          ------------------------------------------------------------
A0A400JH80      ------------------------------------------------------------
A0A2H9EHM4      ------------------------------------------------------------
A0A380B3D7      ------------------------------------------------------------
F5NSX0          ------------------------------------------------------------
A0A479JNB1      ------------------------------------------------------------
A0A5C9AF52      ------------------------------------------------------------
A0A6D0EYC7      ------------------------------------------------------------
D8EEU7          ------------------------------------------------------------
A0A0P1H2H0      ------------------------------------------------------------
A0A258WKV0      ------------------------------------------------------------
A0A377N8F8      ------------------------------------------------------------
A5G4N9          ------------------------------------------------------------
A0A3C2DSE7      ------------------------------------------------------------
A0A2X1JBG5      ------------------------------------------------------------
A0A0B8PTA8      ------------------------------------------------------------
A0A0B8QF75      ------------------------------------------------------------
A0A4Q3LR91      ------------------------------------------------------------
A0A6C9IKN8      ------------------------------------------------------------
A0A4V1TR68      ------------------------------------------------------------
A0A444IY46      ------------------------------------------------------------
A0A6I7N627      ------------------------------------------------------------
A0A660AID0      ------------------------------------------------------------
A0A3E0WKI3      ------------------------------------------------------------
A0A1H3I2J1      ------------------------------------------------------------
A0A1V5DJV0      ------------------------------------------------------------
A0A520IUC4      ------------------------------------------------------------
A0A521LJG5      ------------------------------------------------------------
A0A531IBQ7      ------------------------------------------------------------
A0A377LY04      ------------------------------------------------------------
A0A5C9ABR5      ------------------------------------------------------------
A0A5J9WU72      ------------------------------------------------------------
A0A2X3K9R3      ------------------------------------------------------------
A0A5W0ZR28      ------------------------------------------------------------
A0A622KDG2      ------------------------------------------------------------
A0A3T9EHW9      ------------------------------------------------------------
A0A484X141      ------------------------------------------------------------
A0A5N9VWI6      ------------------------------------------------------------
A0A6D0EJQ0      ------------------------------------------------------------
A0A376LLF8      ------------------------------------------------------------
A0A444R390      ------------------------------------------------------------
A0A6C9J192      ------------------------------------------------------------
A0A1V4WHZ7      ------------------------------------------------------------
A0A1E5AJN5      SNPGPVFLPGEASGTGNFVPSLGGSLLTDPVRLFMTAVSYSWLIIACAISGLVMGSVYAS
A0A2N3D2J1      ------------------------------------------------------------
A0A2N2GVE1      ------------------MAEPLGPFDAAPANNNAPAQTQVDWKRIFHIVRNYFWIVLLT
A0A2N2INV3      ------------------MAEPLGPFDAAPASNNAPAQTQVDWKRIFHIVRNYFWIVLLT
A0A1Y5DXG5      ------------------------------------------------------------
A0A0B8P2H5      ------------------------------------------------------------
A0A483QWI8      ------------------------------------------------------------
A0A483UXD3      ------------------------------------------------------------
A0A0A8J8L3      ------------------------------------------------------------
A0A660DJ38      ------------------------------------------------------------
A0A380AQW6      ------------------------------------------------------------
A0A2G2GD62      QISEKGRSGWNDPVLTALGLGDSQGQNIDSIMSSGYLISKMLENLELGTRYYKEKNYRLV
A0A524P331      ------------------------------------------------------------
A0A4V1SSM5      ------------------------------------------------------------
A0A4Q3K8G7      ------------------------------------------------------------
A0A1M7HC79      ------------------------------------------------------------
A0A1D3JZN6      ------------------------------------------------------------
A0A1V6ESG1      ------------------------------------------------------------
A0A1H7YHK3      ------------------------------------------------------------
A0A534SH66      ------------------------------------------------------------
A0A3M0ZZ99      ------------------------------------------------------------
A0A238LBD3      ------------------------------------------------------------
A0A328C2K5      ------------------MSDQYGFQEPRSQSAPEERGESLGALIGRYWVLFRRFYWVLI
A0A5C6X8M3      ------------------MSDQYGFQEPRPSSAPEERGESLGALIGRYWALFRRFYWVLI
A0A3D8MRR7      ------------------MSDQYGFQEPRQSSAPEERGESLGALIGRYWALFRRFYWVLI
A0A5C6UBJ7      ------------------MSDQYGFQEPRQSSAPEERGESLGALIGRYWALFRRFYWVLI
A0A5C6XGM3      ------------------MSDQYGFQEPRPSSAPEERGESLGALIGRYWALFRRFYWVLI
A0A537NZJ1      ------------------------------------------------------------
A0A0P1FRV5      ------------------------------------------------------------
A0A4Q4CVW6      ------------------------------------------------------------
A0A090R136      ------------------------------------------------------------
A0A661JU93      ------------------------------------------------------------
A0A2E2T3V8      -------------------------------MTISDLVGILYRRRGVFAVSFVALLMMAS
A0A367UAB4      -------------------------------MTISDLVGILYRRRGVFAVSFVALLMMAS
A0A0P1FWI8      ------------------------------------------------------------
A0A377V641      ------------------------------------------------------------
A0A1F2YJ88      ------------------------------------------------------------
A0A0J7XGZ1      ---------------------------------------------------------MLP
I4CBA7          ----------------------------------------------MSTYSPHDSEAFEF
A3VE95          ------------------------MTTFDMQAVRSGRSSERSEDIDRVDVRGLLRAIFSR
A0A1G0NL95      ------------------------------------------------------------
A0A024KA69      ------------------------------------------------------------
A0A0L1KFN4      ------------------------------------------------------------
A0A3P5DSS6      ------------------------------------------------------------
A0A483YEL5      ------------------------------------------------------------
A0A658GUJ0      ------------------------------------------------------------
A0A358L616      ------------------------------------------------------------
A0A1M7BLL7      ------------------------------------------------------------
A0A0H4KZM1      ------------------------------------------------------------
A0A3D5UYX7      ------------------------------------------------------------
A0A2N1WQN5      ------------------------------------------------------------
A0A352G2C2      ------------------------------------------------------------
A0A3C0PZN1      ------------------------------------------------------------
A0A524QFS4      ATGSGSDGKESRRQQGNVPRVGPGVDAPRGYPAYHVPGYPSYATMNDSRFAELDLFDFRD
A0A1V1UJT2      ------------------------------------------------------------
A0A0L6CVX1      ------------------------------------------------------------
A0A1V0RR48      ------------------------------------------------------------
A0A0A0HJJ4      ------------------------------------------------------------
A0A5E7YA28      ------------------------------------------------------------
A0A520JSW4      ---------------------MPDVFVQSSGDGDHRRNGSAAGGSRELSLAVLWRIAFEW
A0A4Q3LTF3      ------------------------------------------------------------
A0A537UTP9      ------------------------------------------------------------
A0A1D2RNR5      ------------------------------------------------------------
A0A4V1TQ46      ------------------------------------------------------------
A0A3A0FZC0      ------------------------------------------------------------
A0A1N7JVZ7      ------------------------------------------------------------
A0A091C4A8      ------------------------------------------------------------
A0A4R3H6P6      ----MERISPQMLGLATSEMTLFSGRAAPEATGHAGAPPLRRLLRAATRWRWVLLGGVAA
A0A3S1NQ09      ------------------------------------------------------------
A0A443GJ52      ------------------------------------------------------------
A0A2W6S588      -----------------------------------MNQEQDGSATQDLAGIVSRFRRHLP
A0A483E0N4      ------------------------------------------------------------
A0A2J4YQQ6      ------------------------------------------------------------
A0A483THX4      ------------------------------------------------------------
A0A534MVS2      ------------------------------------------------------------
A0A444I5K6      ------------------------------------------------------------
A0A154VE85      PLQPNPAARAGMAPSPADAPMPLRRGLSRNKPLFAISFLALAGLGLAIVAGLPERYRATA
A0A3S1MCW7      ------------------------------------------------------------
A0A434IGN6      ------------------------------------------------------------
A0A528AX40      ------------------------------------------------------------
A0A528MV95      ------------------------------------------------------------
A0A3C1S9Y1      ------------------------------------------------------------
A0A353EH49      ----------------------------------MMARKFERSQAGVAEPLLGFDAYAWG
A0A1Y1Q9C1      ------------------------------------------------------------
A0A3M7LJH0      ------------------------------------------------------------
A0A316KRG4      ------------------------------------------------------------
A0A1E4JHX8      ------------------------------------------------------------
M2U8P2          --------------------------------MTADFAEKNATGPLLDFGKLTVIARRRI
A0A1H7KZF8      -----------------------MNAPFGRIEAAVAPPPAPLFALDFDRLWVPVRRSLVP
A0A0J5Q9T7      ------------------------------------------------------------
A0A257NG76      ------------------------------------------------------------
A0A1T4TW59      ------------------------------------------------------------
A0A1I5YYQ0      ------------------------------------------------------------
A0A5P9FE62      ------------------------------------------------------------
A0A1Q3MB35      ------------------------------------------------------------
A0A259LUN7      ------------------------------------------------------------
A0A2D7AVL1      ------------------------------------------------------------
A0A3B9KZE9      ------------------------------------------------------------
A0A2U0NMP8      ------------------------------------------------------------
A0A4U9HNE9      ------------------------------------------------------------
A0A2G2CXY6      ------------------------------------------------------MGSWAA
A0A3M1D4H3      ------------------------------------------------------------
A0A5C8BYM7      ------------------------------------------------------------
A0A1J5ICP0      ------------------------------------------------------------
A0A0M3GBT1      ------------------------------------------------------------
B3Q577          ------------------------------------------------------------
A0A379B9V4      ----------------------------------------------------MRLKKLDL
A0A0Q6TS97      ------------------------------------------------------------
A0A0Q6UYB4      ------------------------------------------------------------
A0A484XS37      ------------------------------------------------------------
W7Q5J0          TSAEIQILQSRMVLGHAVDRLGQENIIRPVTMPIIGDYVVRQGIQRPDFPIMLPYISDYV
A0A654AKT6      ------------------------------------------------------------
A0A0G9MZA5      ------------------------------------------------------------
H0T8B0          ------------------------------------------------------------
A0A5C7N981      ------------------------------------------------------------
A0A534TV22      ------------------------------------------------------------
A0A351CXR4      --------------------------------------------MLGYNSSLNNTPMYQS
A0A2N6GLF5      ------------------------------------------------------------
A0A1W9LJP0      ------------------------------------------------------------
A0A0W1ICB0      ------------------------------------------------------------
A0A2E0UL88      ------------------------------------------------------------
A0A233IKJ2      ------------------------------------------------------------
A0A2T1JE00      ------------------------------------------------------------
A0A0T2QIS1      ------------------------------------------------------------
A0A376KYN0      ------------------------------------------------------------
A0A2X1JB05      ------------------------------------------------------------
A0A376RML0      ------------------------------------------------------------
A0A377E5P7      ------------------------------------------------------------
A0A0P7Y1D0      ------------------------------------------------------------
A0A2M7JRZ7      ------------------------------------------------------------
A0A167IR75      ------------------------------------------------------------
A0A3B8T2U6      ------------------------------------------------------------
A0A365PWR2      ------------------------------------------------------------
A0A2E9H5Z8      ------------------------------------------------------------
A0A2E2BR79      ------------------------------------------------------------
A0A0Q4Q524      ------------------------------------------------------------
A0A0Q4CFJ9      ------------------------------------------------------------
A0A0Q4FE58      ------------------------------------------------------------
A0A0Q4JWC8      ------------------------------------------------------------
A0A0Q4KFL8      ------------------------------------------------------------
A0A522R8R0      ------------------------------------------------------------
A0A2U9NDY5      ------------------------------------------------------------
A0A0Q4IGG1      ------------------------------------------------------------
X7F6S5          ------------------------------------------------------------
A0A1G8NKI0      ------------------------------------------------------------
A0A355QPE4      ------------------------------------------------------------
A0A357RN98      ------------------------------------------------------------
A0A6B2MSQ7      ------------------------------------------------------------
A0A6B2P8H8      ------------------------------------------------------------
A0A1I6U4V1      ------------------------------------------------------------
A0A1G7CFZ2      ------------------------------------------------------------
A0A1P8USW9      ------------------------------------------------------------
A0A534RUJ5      ------------------------------------------------------------
A0A3M1CJM3      ------------------------------------------------------------
A0A2R7SVD4      ------------------------------------------------------------
A0A3C0PWB6      ------------------------------------------------------------
V4Q8B7          ------------------------------------------------------------
A0A0Q8XKK5      ------------------------------------------------------------
A0A2E0Q2W0      ------------------------------------------------------------
A0A660NIR6      ------------------------------------------------------------
A0A142W0R3      ------------------------------------------------------------
A0A0S4XR18      ------------------------------------------------------------
A0A2E0GW64      ------------------------------------------------------------
A0A1A7QJ97      ------------------------------------------------------------
A0A6I4IKZ3      ------------------------------------------------------------
A0A661LW70      ------------------------------------------------------------
W7Q8F9          ------------------------------------------------------------
A0A524PXH8      ------------------------------------------------------------
A0A4Q3P0E4      ------------------------------------------------------------
A0A3M2BE89      ------------------------------------------------------------
A0A4Q4A6K6      ------------------------------------------------------------
A0A257G674      ------------------------------------------------------------
A0A661M5M6      ------------------------------------------------------------
A0A1I1UM01      ------------------------------------------------------------
Q44573          ------------------------------------------------------------
A2W025          ------------------------------------------------------------
A0A534Z362      IIDAEFSGAPRHLREYLWVLHKYRWLAATCFGLTFGLTVFATLLTPRLYSASTRLELARQ
V4J283          ------------------------------------------------------------
A0A536T443      ------------------------------------------------------------
A0A0Q4UFQ5      ------------------------------------------------------------
A0A527W7E6      ------------------------------------------------------------
A0A432EMV7      ------------------------------------------------------------
A0A087LTV7      ------------------------------------------------------------
A0A534WLI3      ------------------------------------------------------------
A0A318KWA2      ------------------------------------------------------------
A0A522MT86      ------------------------------------------------------------
A0A4Q3I221      ------------------------------------------------------------
A0A534SAL6      IDAEFSEVPARHLRDYLRLLYKYRWLAATCLA--------VTLLTTRLYTASTRLQMARQ
A0A534ZDB4      IDAEFSEVPARHLRDYLRLLYKYRWLAATCLALTLGLALLVTLVTTRLYTG---------
A0A534X3M7      FDAEFSEQP-RHLRAHLSVLHKHRWLAVTCFAVTVVSTAVLTLLTPRLYTASTRLEVARQ
A0A534SPC6      ------------------------------------------------------------
A0A535AD60      IDAEFSEAP-RHLREHLWVLHKYRWLAATCFGLTFGLTVFATLLTPRLYTASTRLELARQ
A0A4Q3SY08      ------------------------------------------------------------
A0A4Q3LG23      ------------------------------------------------------------
A0A522EX52      ------------------------------------------------------------
A0A1H3KC95      ------------------------------------------------------------
A0A5P8Z4P3      ------------------------------------------------------------
A0A2E9HXF7      ------------------------------------------------------------
A0A0B3RZC9      ------------------------------------------------------------
A0A6F8QET1      ------------------------------------------------------------
A0A520HUH4      ------------------------------------------------------------
A0A2K8U7M6      ------------------------------------------------------------
A0A5B9DKL8      ------------------------------------------------------------
A0A238KJM1      ------------------------------------------------------------
A0A3A0FJZ4      ------------------------------------------------------------
W4HJV8          ------------------------------------------------------------
A0A0P1GDI0      ------------------------------------------------------------
A0A2R8ATV5      ------------------------------------------------------------
A0A1U7D3R6      ------------------------------------------------------------
A0A2D4UVV2      ------------------------------------------------------------
A0A0W7WHP4      ------------------------------------------------------------
A0A238J8F6      ------------------------------------------------------------
A0A238JQI6      ------------------------------------------------------------
A0A222E077      ------------------------------------------------------------
A0A239E3Y2      ------------------------------------------------------------
A0A1V6FYJ1      ------------------------------------------------------------
A0A445MZQ4      ------------------------------------------------------------
A0A0M9E0E3      ------------------------------------------------------------
A0A0Q6QV61      ------------------------------------------------------------
A0A2Z3IKG4      ------------------------------------------------------------
A0A2W4RFS2      ------------------------------------------------------------
A0A1Y6DC43      ------------------------------------------------------------
A0A2S6HE06      ------------------------------------------------------------
G3J0M3          ------------------------------------------------------------
V5C6R5          ------------------------------------------------------------
A0A354EF47      ------------------------------------------------------------
A0A2G6MSP7      ------------------------------------------------------------
A0A4U8YMP3      ------------------------------------------------------------
A0A1Q8QQ99      ------------------------------------------------------------
A0A3D5ZY44      ------------------------------------------------------------
A0A646J2A6      ------------------------------------------------------------
A0A1G5C236      ------------------------------------------------------------
A0A432HIS7      ------------------------------------------------------------
A0A1I3XJ27      ------------------------------------------------------------
A0A1I7DCG1      ------------------------------------------------------------
A0A3A3H6D9      ------------------------------------------------------------
A0A562CGU2      ------------------------------------------------------------
A0A0Q6VA36      ------------------------------------------------------------
A0A1B2EQN1      ------------------------------------------------------------
A0A1E7HSL6      ------------------------------------------------------------
A0A4Q3ZDI7      ------------------------------------------------------------
A0A537PRC6      ------------------------------------------------------------
A0A2M7JX59      ------------------------------------------------------------
A0A3A4XVN3      ------------------------------------------------------------
A0A1E7JEV6      ------------------------------------------------------------
A0A2N2KDY5      ------------------------------------------------------------
A0A3N5YUD9      ------------------------------------------------------------
A0A0W1DLQ3      ------------------------------------------------------------
A0A246JVD8      ------------------------------------------------------------
A0A2N3BB54      ------------------------------------------------------------
A0A1H6G7A3      ------------------------------------------------------------
A0A0A7PGL6      ------------------------------------------------------------
A0A4Q2Z4L0      ------------------------------------------------------------
A0A5C4N0H6      ------------------------------------------------------------
A0A4R1HDF2      ------------------------------------------------------------
A0A1E7HFN0      ------------------------------------------------------------
A0A1M5GH86      ------------------------------------------------------------
A0A1W1XQZ5      ------------------------------------------------------------
A0A3D6C3I2      ------------------------------------------------------------
S0G1D4          ------------------------------------------------------------
A0A661T246      ------------------------------------------------------------
A0A2G6CSG7      ------------------------------------------------------------
A0A2G6NB59      ------------------------------------------------------------
A0A5K8A7T9      ------------------------------------------------------------
A0A1W9U045      ------------------------------------------------------------
A0A1F9L9G4      ------------------------------------------------------------
A0A328FD76      ------------------------------------------------------------
A0A348UX90      ------------------------------------------------------------
A0A357Z0N5      ------------------------------------------------------------
A0A0F2R2U0      ------------------------------------------------------------
A0A5K7ZK00      ------------------------------------------------------------
A0A5K7YCX8      ------------------------------------------------------------
A0A5K7Z388      ------------------------------------------------------------
A0A352B502      ------------------------------------------------------------
A0A2K8WHP8      ------------------------------------------------------------
A0A410V446      ------------------------------------------------------------
A0A0R3KGJ5      ------------------------------------------------------------
A0A0R3N604      ------------------------------------------------------------
A0A1B1UCM8      ------------------------------------------------------------
A0A1N6JQ20      ------------------------------------------------------------
A0A1M5TI07      ------------------------------------------------------------
A3X191          ------------------------------------------------------------
A0A1H4RKV5      ------------------------------------------------------------
A0A160UA87      ------------------------------------------------------------
A0A1Q5SFV5      ------------------------------------------------------------
A0A1J5N774      ------------------------------------------------------------
A0A2C8F781      ------------------------------------------------------------
A0A2E3R6G0      ------------------------------------------------------------
A0A1F8XMK2      ------------------------------------------------------------
A0A3M8EMP2      ------------------------------------------------------------
A0A2J6J6K6      ------------------------------------------------------------
A0A661PSB9      ------------------------------------------------------------
A0A661QBT6      ------------------------------------------------------------
A0A1G6EKK9      ------------------------------------------------------------
A0A6I2SLK2      ------------------------------------------------------------
A0A0A8WSG4      ------------------------------------------------------------
S7TK97          ------------------------------------------------------------
S7UE93          ------------------------------------------------------------
A0A3D5BR56      ------------------------------------------------------------
A0A2N2IB15      ------------------------------------------------------------
A0A1I3PSR2      ------------------------------------------------------------
A0A1I4GEK4      ------------------------------------------------------------
A0A2T5R3J5      ------------------------------------------------------------
A0A1W7QPT7      ------------------------------------------------------------
A0A0M4D373      ------------------------------------------------------------
A0A1L3GKM9      ------------------------------------------------------------
A0A430DNP0      ------------------------------------------------------------
A0A3A0FQ32      ------------------------------------------------------------
A0A1E4UZA0      ------------------------------------------------------------
A0A1H9KL56      ------------------------------------------------------------
A0A1A9KEF8      ------------------------------------------------------------
A0A5E6PKN5      ------------------------------------------------------------
A0A0N9W1V6      ------------------------------------------------------------
A0A423GQ41      ------------------------------------------------------------
A0A423H7J2      ------------------------------------------------------------
A0A502HNM8      ------------------------------------------------------------
A0A4Q7H223      ------------------------------------------------------------
A0A1H4N2K9      ------------------------------------------------------------
A0A2K4KWF7      ------------------------------------------------------------
A0A3E0WXH2      ------------------------------------------------------------
A0A2N2TRC8      ------------------------------------------------------------
A0A1V4CIZ7      ------------------------------------------------------------
A0A1M3BXA5      ------------------------------------------------------------
A0A1Y2R3U6      ------------------------------------------------------------
A0A167HVD6      ------------------------------------------------------------
A0A1V3SCT6      ------------------------------------------------------------
L0H287          ------------------------------------------------------------
A0A495VG93      ------------------------------------------------------------
A0A4R3MYM4      ------------------------------------------------------------
G2E3C0          ------------------------------------------------------------
A0A4U8YLL7      ------------------------------------------------------------
A0A3N5RNY4      ------------------------------------------------------------
A0A1V4M8I1      ------------------------------------------------------------
A0A4Z0M4C7      ------------------------------------------------------------
A0A5Q2QDL1      ------------------------------------------------------------
A0A1I0R9R6      ------------------------------------------------------------
A0A443K010      ------------------------------------------------------------
A0A6I7NYG5      ------------------------------------------------------------
A0A238IZI1      ------------------------------------------------------------
A0A316GHM6      ------------------------------------------------------------
A0A520ZTR8      ------------------------------------------------------------
A0A212AR83      ------------------------------------------------------------
A0A2E2P4I0      ------------------------------------------------------------
A0A2U2CM86      ------------------------------------------------------------
A0A1X7ACC1      ------------------------------------------------------------
A0A2N3BVE7      ------------------------------------------------------------
A0A2S5JE21      ------------------------------------------------------------
A0A2R8BKZ2      ------------------------------------------------------------
A0A2S8S361      ------------------------------------------------------------
A0A238KUF6      ------------------------------------------------------------
A0A095CTW3      ------------------------------------------------------------
A0A2E3UGD6      ------------------------------------------------------------
A0A2T0RFH0      ------------------------------------------------------------
A0A285D390      ------------------------------------------------------------
A0A497VHN4      ------------------------------------------------------------
A0A318CT66      ------------------------------------------------------------
A0A3N5P205      ------------------------------------------------------------
A0A2N6BEI9      ------------------------------------------------------------
A0A0D5N3E9      ------------------------------------------------------------
A0A2N2G716      ------------------------------------------------------------
W9VVY5          ------------------------------------------------------------
A0A1E2URD3      ------------------------------------------------------------
A0A2T6MY81      ------------------------------------------------------------
A0A2T6NBQ8      ------------------------------------------------------------
A0A421K431      ------------------------------------------------------------
A0A2G2I5M1      ------------------------------------------------------------
A0A2G2M6F0      ------------------------------------------------------------
A0A1W9J9F8      ------------------------------------------------------------
A0A2S5LFJ9      ------------------------------------------------------------
A0A2D8R8F8      ------------------------------------------------------------
A0A6I4JXQ8      ------------------------------------------------------------
A0A010SNS0      ------------------------------------------------------------
A0A0C2I782      ------------------------------------------------------------
A0A2N8BYF5      ------------------------------------------------------------
A0A558FKX2      ------------------------------------------------------------
A0A1H1DBA0      ------------------------------------------------------------
J2TAD5          ------------------------------------------------------------
J3H699          ------------------------------------------------------------
A0A1H5J974      ------------------------------------------------------------
A0A0K1QRZ4      ------------------------------------------------------------
A0A560RJW9      ------------------------------------------------------------
A0A5E6TID7      ------------------------------------------------------------
A0A5E7CRU7      ------------------------------------------------------------
A0A5E7C564      ------------------------------------------------------------
A0A2W7MAV4      ------------------------------------------------------------
A0A4R3WQH5      ------------------------------------------------------------
W6VFG3          ------------------------------------------------------------
A0A1P8ENT1      ------------------------------------------------------------
A0A2N7XRV4      ------------------------------------------------------------
A0A0Q6QPG8      ------------------------------------------------------------
A0A0F4SWA7      ------------------------------------------------------------
A0A423J219      ------------------------------------------------------------
A0A4P6G9U8      ------------------------------------------------------------
A0A4Y8JE06      ------------------------------------------------------------
A0A502I1X9      ------------------------------------------------------------
A0A502J776      ------------------------------------------------------------
A0A5B0EZF6      ------------------------------------------------------------
A0A059L434      ------------------------------------------------------------
A0A0F4UWN2      ------------------------------------------------------------
A0A5E7WEF5      ------------------------------------------------------------
A0A1G0KSD0      ------------------------------------------------------------
A0A4P6WX84      ------------------------------------------------------------
A0A1D2S760      ------------------------------------------------------------
A0A5B8RW94      ------------------------------------------------------------
A0A258TN88      ------------------------------------------------------------
A0A1F9EUS2      ------------------------------------------------------------
A0A6H9HII8      ------------------------------------------------------------
A0A3N9VAW3      ------------------------------------------------------------
A0A1X0YE57      ------------------------------------------------------------
A0A2K2H9Q8      ------------------------------------------------------------
A0A6I1KNW9      ------------------------------------------------------------
A0A1H4B8T3      ------------------------------------------------------------
A0A1E7IQC3      ------------------------------------------------------------
A0A1M6KEN5      ------------------------------------------------------------
A0A353QLL3      ------------------------------------------------------------
A0A399I453      ------------------------------------------------------------
A0A651FBV9      ------------------------------------------------------------
A0A5C1MDH8      ------------------------------------------------------------
A0A5A9XE04      ------------------------------------------------------------
A0A643G9R1      ------------------------------------------------------------
A0A1G0M8Q7      ------------------------------------------------------------
A0A353MI14      ------------------------------------------------------------
A0A4S1CAW7      ------------------------------------------------------------
A0A562VHD2      ------------------------------------------------------------
A0A6I6JNB5      ------------------------------------------------------------
A0A1G0LDK7      ------------------------------------------------------------
A0A6F9WVL7      ------------------------------------------------------------
A0A2M7WWF7      ------------------------------------------------------------
A0A351Z9A2      ------------------------------------------------------------
A0A351B422      ------------------------------------------------------------
F2NEE9          ------------------------------------------------------------
B7RS54          ------------------------------------------------------------
A0A3N5FRH4      ------------------------------------------------------------
A0A1V4Y2C3      ------------------------------------------------------------
A0A2N2KTJ4      ------------------------------------------------------------
A0A2N2LQX0      ------------------------------------------------------------
A0A520CSP5      ------------------------------------------------------------
A0A1I6ENM4      ------------------------------------------------------------
A8LNM8          ------------------------------------------------------------
A0A0T5NSU3      ------------------------------------------------------------
A0A5P9I718      ------------------------------------------------------------
A0A2M8J3R9      ------------------------------------------------------------
A0A1I6X762      ------------------------------------------------------------
A0A0P1EFX8      ------------------------------------------------------------
A0A2G5KB39      ------------------------------------------------------------
A0A2N3CNV1      ------------------------------------------------------------
A0A257F1F4      ------------------------------------------------------------
A0A1G9FY29      ------------------------------------------------------------
A0A4Q3ZBK4      ------------------------------------------------------------
A0A2D5J8T8      ------------------------------------------------------------
A0A2E3P9W6      ------------------------------------------------------------
A0A2G2B1P9      ------------------------------------------------------------
A0A258GCD5      ------------------------------------------------------------
A0A2D9YR88      ------------------------------------------------------------
A0A443INY4      ------------------------------------------------------------
A0A372IH36      ------------------------------------------------------------
A0A540VW45      ------------------------------------------------------------
A0A1H9C241      ------------------------------------------------------------
A0A2E3FCR1      ------------------------------------------------------------
A0A4S3MG69      ------------------------------------------------------------
A0A3E0H727      ------------------------------------------------------------
A0A1G8QZS5      ------------------------------------------------------------
A0A1V4QMH7      ------------------------------------------------------------
A0A496XZQ4      ------------------------------------------------------------
A0A1F9BJF7      ------------------------------------------------------------
F2NDF5          ------------------------------------------------------------
A0A1I3TTC3      ------------------------------------------------------------
A0A1H3IZW6      ------------------------------------------------------------
A0A0M6YG59      ------------------------------------------------------------
A0A1H7G8B0      ------------------------------------------------------------
A0A059IPK4      ------------------------------------------------------------
A0A1H2Y469      ------------------------------------------------------------
A0A497ZQU7      ------------------------------------------------------------
A0A318D3U4      ------------------------------------------------------------
A0A401FQP5      ------------------------------------------------------------
A0A1Q6DMW3      ------------------------------------------------------------
A0A3A6P8F8      ------------------------------------------------------------
A0A2G2DSM4      ------------------------------------------------------------
A0A1F9NI02      ------------------------------------------------------------
A0A4U1ABX4      ------------------------------------------------------------
A0A351Z4H9      ------------------------------------------------------------
A0A2N2KML4      ------------------------------------------------------------
E1YJF1          ------------------------------------------------------------
A0A1J5EVZ6      ------------------------------------------------------------
A0A2G6FCC5      ------------------------------------------------------------
A0A1F9MR25      ------------------------------------------------------------
A0A2G6M7F1      ------------------------------------------------------------
A0A1E7H876      ------------------------------------------------------------
A0A509L3P8      ------------------------------------------------------------
A0A3A4S038      ------------------------------------------------------------
A0A1F9N669      ------------------------------------------------------------
A0A1F9PFA7      ------------------------------------------------------------
A0A1H2EN09      ------------------------------------------------------------
K0NP00          ------------------------------------------------------------
A0A1E7JCL5      ------------------------------------------------------------
A0A496YAH9      ------------------------------------------------------------
A0A1V4S7E4      ------------------------------------------------------------
A0A2N2H8D2      ------------------------------------------------------------
A0A2N2KC63      ------------------------------------------------------------
A0A3A4ZYW4      ------------------------------------------------------------
A0A1V4MCJ4      ------------------------------------------------------------
A0A661M0W4      ------------------------------------------------------------
A0A0F2NF69      ------------------------------------------------------------
A0A1F9NFD0      ------------------------------------------------------------
A0A1M5YLH5      ------------------------------------------------------------
A0A4U1A4C7      ------------------------------------------------------------
                                                                            

E1Y9C0          ------------------------------------------------------------
A0A1N6SH58      ------------------------------------------------------------
A0A4Q3AQN2      ------------------------------------------------------------
A0A1W9HS52      ---------------------------------------------MNDRGRTSRALAHSG
A0A2D5LFD8      --------------MAAPIKLLVELLEKNMAPSKSPLDIEKKRDHATDQSSGNEGESLEG
A0A0N0XAV4      ------------------------------------------------------------
A0A0P9QD19      ------------------------------------------------------------
F3FHG4          ------------------------------------------------------------
F3GGI0          ------------------------------------------------------------
A0A0P9LE74      ------------------------------------------------------------
A0A3M4ZQ14      TGRSGNRSADVVRSQSLDSLDRRAVLPDRAGLRDSGDALLPGQCHDPDRAQKNWHRGHAR
A0A3M5YLE8      TGRSGNRSADVVRSQSLDSLDRRAVLPDRAGLRDSGDALLPGQCHDPDRAQKNWHRGHAR
A0A3M3RP89      TGRSGNRSADVVRSQSLDSLDRRAVLPDRAGLRDSGDALLPGQCHDPDRAQKNWHRGHAR
A0A0P9QIY7      TGRSGNRSADVVRSQSLDSLDRRAVLPYRAGLRDSGDALLPGQCHDPDRAQKNRHRGHAR
A0A0P9VVH7      TGRSGNRSADVVRSQSLDSLDRRAVLPDRAGLRDSGDALLPGQCHDPDRAQKNWHRGHAR
A0A0Q0FJK6      TGRSGNRSADVVRSQSLDSLDRRAVLPDRAGLRDSGDALLPGQCHDPDRAQKNRHRGHAR
A0A0Q0G2J0      TGRSGNRSADVVRSQSLDSLDRRAVLPDRAGLRDSGDALLPGQCHDPDRAQKNWHRGHAR
A0A3M3LF66      TGRSGNRSADVVRSQSLDSLDRRAVLPDRAGLRDSGDALLPGQCHDPDRAQKNWHRGHAR
A0A0P9WIR8      TGRSGNRSADVVRSQSLDSLDRRAVLPYRAGLRDSGDALLPGQCHDPDRAQKNRHRGHAR
A0A3M3KPE5      ------------------------------------------------------------
A0A3M4C263      ------------------------------------------------------------
A0A3M5AD05      ------------------------------------------------------------
A0A0Q0D3D2      -------------------FQR--------------------------------------
A0A0N0FS39      ------------------------------------------------------------
A0A3M6GHH2      ------------------------------------------------------------
A0A0P9R9W0      ADRSGNCSADAVRPQDPDRVDRRPVFSGGSGLCHSRHAGVSGHRHDSDRAQKNRHRRHSG
A0A0Q0B9T0      ADRSGNSSADAVRPQDPDRVDRRPVFSGGSGLCHSRHAGVSGHRHDSDRAQKNRHRRHSG
A0A3M6CFI7      ADRSGNSSADAVRPQDPDRVDRRPVFSGGSGLCHSRHAGVSGHRHDSDRAQKNRHRRHSG
A0A0P9JXN0      ADRSGNCSADAVRPQDPDRVDRRPVFSGGSGVCHSRHAGVSGHRHDSDRAQKNRHRRHSG
A0A3M6FIV7      ADRSGNCSADAVRPQDPDRVDRRPVFSGGSGVCHSRHAGVSGHRHDSDRAQKNRHRRHSG
A0A3M3PLW9      -------------------------------------------------------MPSHS
A0A3M4ENY1      ------------------------------------------------------------
A0A3M5EZK7      ------------------------------------------------------------
A0A0P9SPP5      ------------------------------------------------------------
A0A658KL17      ------------------------------------------------------------
A0A3M3NNF2      ------------------------------------------------------------
A0A3M4A0E8      -------------------MDRQPVFSDRPGLRHSGHAGVSGHRHDSDRAPKNRHRGHPG
A0A3M4PBZ2      -------------------MDRQPVFSDRPGLRHSGHAGVSGHRHDSDRAPKNRHRGHPG
A0A3M6AI26      -------------------MDRQPVFSDRSGLCHSGHSGVSGHRHDPDRAPKNRHRGHPG
A0A0P9IWP8      -------------------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPG
A0A0P9KZ49      -------------------MDRQPVFSDRSGLCHSGHSGVSGHRHDPDRAPKNRHRGHPG
A0A0P9V840      -------------------MDRQPVFSDRSGLCHSGHSGVSGHRHDPDRAPKNRHRGHPG
A0A0Q0AIE5      -------------------MDRQPVFSDRSGLCHSGHSGVSGHRHDPDRAPKNRHRGHPG
A0A3M2ZQH6      -------------------MDRQPVFSDRSGLCHSGHSGVSGHRHDPDRAPKNRHRGHPG
A0A0N8SQG2      -------------------MDRQPVFSDRSGLCHSGHSGVSGHRHDPDRAPKNRHRGHPG
A0A0W8HFU1      -------------------MDRQPVFSDRSGLCHSGHSGVSGHRHDPDRAPKNRHRGHPG
A0A3M5M873      -------------------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHSR
A0A0P9VHH8      -------------------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPG
A0A0P9YV98      -------------------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPG
A0A3M3G2W8      -------------------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPG
A0A3M6C224      -------------------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPG
A0A3M5K254      -------------------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPG
A0A3M5JFB0      -------------------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPG
A0A3M3TQV3      -------------------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPG
A0A3M3EF92      -------------------MDRQPVFSDRSGLCHSGHAGVSDHRHDSDRAPKNRHRGHPG
A0A3M5J1E2      -------------------MDRQPVFSDRSGLCHSGHAGVSGHRHDSDRAPKNRHRGHPG
A0A3M5G7H9      -------------------MDRQPVFSDLSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPG
A0A3M4A376      -------------------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPG
A0A0Q0A5T8      -------------------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPG
A0A0P9SCD7      -------------------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPG
A0A0P9T4G3      -------------------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPG
A0A0P9VKB0      -------------------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPG
A0A0Q0BM35      -------------------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPG
A0A3M3TPR7      -------------------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPG
A0A3M3U4Q3      -------------------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPG
A0A0P9UCX7      -------------------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPG
A0A0P9S1F1      -------------------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHSR
A0A0P9QCJ2      -------------------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPG
A0A0P9Q329      -------------------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPG
A0A3M5GJ64      -------------------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPG
A0A0P9MPC7      -------------------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPG
A0A3M2XYQ3      -------------------MDRRPVFSARPGLRHSGHAGVSGHRHDSDRTPKNRHRGYAG
A0A0P9XCE1      -------------------MDRRPVFSARPGLRHSGHAGVSGHRHDSDRTPKNRHRGYTG
A0A3M3EFX7      -------------------MDRRPVFSARHGLRHSGHAGVSGHRHDSDRTPKNRHRGYAG
A0A3M5B9D9      -------------------MDCRPVFSARPGLRHSGHAGVSGHRHDSDRTPKNRHRGYAG
A0A0P9RRZ3      -------------------MDSQPVFSDRPGLCHSGHAGLSGHRHDSDRAEKNRHRGYPR
A0A3M2VEK7      -------------------MDRRRVFPDRPGLCHSGHTGVSGHRHDSDRASENRHRGHAR
A0A0N8R9B3      -------------------MDRRRVFSDRPGLCHSCHAGVSGHRHDSDRASENRHRGHAG
A0A0P9VA27      -------------------MDRRRVFSDRPGLCHSCHAGVSGHRHDSDRASKNRHRGHAG
A0A3M4YBJ4      -------------------MDRRRVFPDRPGLCHSGHTGVSGHRHDSDRASENRHRGHAG
A0A0P9J470      -------------------MDRRRVFSDRPGLCHSCHAGVSGHRHDSDRAPENRHRGHAG
A0A0Q0EVJ8      -------------------MDRRRVFSDRPGLCHSGHAGVSGHRHDSDRAPENRHRGHAG
A0A3M5UI30      -------------------MDRQPVFSDRSGLCHSGHSGVSGHRHDPDRAPKNRHRGHPG
A0A3M5YQT8      -------------------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPG
A0A3M5F5X1      -------------------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHSR
A0A3M5R8G1      ------------------------------------------------------------
A0A3M5V012      ------------------------------------------------------------
A0A3M3GA16      ------------------------------------------------------------
A0A3M3UCT3      PDRSGNSPADAVRSQDPDPVDRRRVFPDRPGLCHSGHTGVPGYRHDSDRASENRHRGHAG
A0A3M3CJL0      PDRSGNSPADAVRSQDPDPVDRRRVFPDRPGLCHSGHTGVSGHRHDSDRASKNRHRGHTG
A0A3M3F6F5      PDRSGNSPADAVRSQDPDPVDRRRVFPDRPGLCHSGHTGVSGHRHDSDRASENRHRGHAG
A0A3M3P9B7      PDRSGNSPADAVRSQDPDPVDRRRVFPDRPGLCHSGHTGVSGHRHDSDRASENRHRGHAG
A0A0N8QB74      PDRSGNSPADAVRSQDPDPVDRRRVFPDRPGLCHSGHTGVSGHRHDSDRASENRHRGHAG
A0A0Q0AUD0      PDRSGNSPADAVRSQDPDPVDRRRVFPDRPGLCHSGHTGVSGHRHDSDRASENRHRGHAG
A0A3M5VR55      PDRSGNSPADAVRSQDPDPVDRRRVFPDRPGLCHSGHTGVSGHRHDSDRASENRHRGHAR
A0A0Q0FK97      PDRSGNSPADAVRSQDPDPVDRRRVFPDRPGLCHSGHTGVSGHRHDSDRASENRHRGHAG
A0A3M5KZ75      ----------------------------------------------------MPSHSRCR
A0A3M5L3G5      ------------------------------------------------------------
A0A0C5VQ86      ------------------------------------------------------------
A0A1V8MBH1      ------------------------------------------------------------
A0A534QGR3      ------------------------------------------------------------
A0A0R0BVC7      ------------------------------------------------------------
A0A0W1GMS6      ------------------------------------------------------------
A0A0Q8RMY3      ------------------------------------------------------------
A0A1A7QC21      ------------------------------------------------------------
A0A1F9CFF0      ------------------------------------------------------------
A0A2M8B0G5      ------------------------------------------------------------
A0A363TNU9      ------------------------------------------------------------
A0A534HBS8      ------------------------------------------------------------
A0A0F0T3Y9      ------------------------------------------------------------
A0A379GWF0      ------------------------------------------------------------
A0A536T0W8      ------------------------------------------------------------
A0A4Q2XLV7      ------------------------------------------------------------
A0A4Q5QYC4      ------------------------------------------------------------
A0A2G9XLE5      ------------------------------------------------------------
A0A3D2M6Y9      ------------------------------------------------------------
A0A3D2YAZ2      ------------------------------------------------------------
A0A350A102      ------------------------------------------------------------
A0A350L5D2      ------------------------------------------------------------
A0A3B8SQ27      ------------------------------------------------------------
A0A656BWB0      ------------------------------------------------------------
A0A6D0IFH4      ------------------------------------------------------------
A0A3Y2RPN4      ------------------------------------------------------------
A0A0A0FHV8      ------------------------------------------------------------
A0A1X3IPU7      ------------------------------------------------------------
A0A0A0G0N2      ------------------------------------------------------------
A0A243TPR1      ------------------------------------------------------------
A0A2I8SDU4      ------------------------------------------------------------
A0A2I8SU55      ------------------------------------------------------------
S1EXJ6          ------------------------------------------------------------
A0A376UBS1      ------------------------------------------------------------
A0A4Q6G931      ------------------------------------------------------------
A0A1W9F5M9      ------------------------------------------------------------
A0A3C2BN18      ------------------------------------------------------------
A0A447LR75      ------------------------------------------------------------
A0A376D8L7      ------------------------------------------------------------
A0A1V2FV46      ------------------------------------------------------------
A0A376SB61      ------------------------------------------------------------
A0A3D1BYV9      ------------------------------------------------------------
A0A6D0I9G1      ------------------------------------------------------------
A0A352MMI7      ------------------------------------------------------------
A0A379W6R2      ------------------------------------------------------------
A0A376RY66      ------------------------------------------------------------
A0A377K431      ------------------------------------------------------------
A0A379TA56      ------------------------------------------------------------
A0A4Z0LWV1      ------------------------------------------------------------
A0A5V7HTZ1      ------------------------------------------------------------
A0A610XNI4      ------------------------------------------------------------
A0A620QD02      ------------------------------------------------------------
A0A5H3HSJ8      ------------------------------------------------------------
A0A655C5P0      ------------------------------------------------------------
A0A2T0VBD8      ------------------------------------------------------------
A0A378APS2      ------------------------------------------------------------
A0A443VCQ6      ------------------------------------------------------------
A0A447RKQ7      ------------------------------------------------------------
W1DSK1          ------------------------------------------------------------
A0A0U2VAW2      ------------------------------------------------------------
A0A454CTF1      ------------------------------------------------------------
A0A6B3Q2G1      ------------------------------------------------------------
A0A378G3G7      ------------------------------------------------------------
A0A2X5NHJ9      ------------------------------------------------------------
A0A2J4QEC3      ------------------------------------------------------------
A0A485ADM3      ------------------------------------------------------------
A0A4U9HGU4      ------------------------------------------------------------
A0A3S4JGG5      ------------------------------------------------------------
A0A377ZDH2      ------------------------------------------------------------
A0A3S4HTS8      ------------------------------------------------------------
A0A2N1XK22      ------------------------------------------------------------
A0A3D0KAC8      ------------------------------------------------------------
A0A3D2Y902      ------------------------------------------------------------
A0A655RNN3      ------------------------------------------------------------
A0A655R819      ------------------------------------------------------------
A0A655ZEY0      ------------------------------------------------------------
A0A6G6X2Z4      ------------------------------------------------------------
Q44570          ------------------------------------------------------------
A0A3N5MZ53      ------------------------------------------------------------
A0A534E4H4      ------------------------------------------------------------
A0A534I2B6      ------------------------------------------------------------
A0A1C2JGD0      ------------------------------------------------------------
A0A259LQ70      ------------------------------------------------------------
A0A4V2SPR5      ------------------------------------------------------------
A0A3N5PM86      ------------------------------------------------------------
A0A2E5YSA4      ------------------------------------------------------------
A0A519ERR1      ------------------------------------------------------------
A0A4Q3Q1M2      ------------------------------------------------------------
A0A4Q3MHR1      ------------------------------------------------------------
A0A520GDZ4      ------------------------------------------------------------
A0A318DSU0      ------------------------------------------------------------
A0A538PF21      ------------------------------------------------------------
A0A1W1ZH10      ------------------------------------------------------------
A0A1W2FF24      ------------------------------------------------------------
A0A524JYQ6      ------------------------------------------------------------
A0A4Q3MA17      ------------------------------------------------------------
A0A0N0M5F7      ------------------------------------------------------------
A0A537M754      ------------------------------------------------------------
A0A1V1PDB4      ------------------------------------------------------------
A0A2M7C324      ------------------------------------------------------------
A0A4Q3HHG6      ------------------------------------------------------------
A0A3B7DTA4      ------------------------------------------------------------
A0A432ZK62      ------------------------------------------------------------
A0A1V5EEP4      ------------------------------------------------------------
A0A1V5EF48      ------------------------------------------------------------
A0A0S6X1X6      ------------------------------------------------------------
A0A537Y5L8      ------------------------------------------------------------
A0A4Q3L2X2      ------------------------------------------------------------
A0A4Q3T8J1      ------------------------------------------------------------
A0A4Q4ANM4      ------------------------------------------------------------
A0A4Q3UEC7      ------------------------------------------------------------
A0A1H5YYQ4      ------------------------------------------------------------
A0A1X4NLK2      ------------------------------------------------------------
A0A1X4NWB5      ------------------------------------------------------------
A0A1M5UQ38      ------------------------------------------------------------
A0A327YI48      ------------------------------------------------------------
A0A1B1PNL6      ------------------------------------------------------------
A0A2U8H9H9      ------------------------------------------------------------
A0A6B2NBB8      ------------------------------------------------------------
A0A1X6YIC0      ------------------------------------------------------------
A0A1I5E9E9      ------------------------------------------------------------
A0A1X6Z7N7      ------------------------------------------------------------
A0A2E1DQ13      ------------------------------------------------------------
A0A1H8C800      ------------------------------------------------------------
A0A2N3EZ05      ------------------------------------------------------------
A0A3N5J7U8      ------------------------------------------------------------
A0A1S7S3I8      ------------------------------------------------------------
A0A519E8D7      ------------------------------------------------------------
A0A3S1NZ06      ------------------------------------------------------------
A0A3S1FD32      ------------------------------------------------------------
A0A434DUT4      ------------------------------------------------------------
A0A528D3U3      ------------------------------------------------------------
A0A3S3UPT3      ------------------------------------------------------------
A0A3S1E286      ------------------------------------------------------------
A0A531AC71      ------------------------------------------------------------
A0A436K268      ------------------------------------------------------------
A0A434IDQ0      ------------------------------------------------------------
A0A435IRM5      ------------------------------------------------------------
A0A3S2C404      ------------------------------------------------------------
A0A435F6C0      ------------------------------------------------------------
A0A435BMN6      ------------------------------------------------------------
A0A529XQ54      ------------------------------------------------------------
A0A530BJC1      ------------------------------------------------------------
A0A348SRI7      ------------------------------------------------------------
A0A354EI73      ------------------------------------------------------------
A0A4Q3IRI1      ------------------------------------------------------------
A0A4P7EP83      ------------------------------------------------------------
A0A6I1QB25      ------------------------------------------------------------
A0A655ZZQ1      ------------------------------------------------------------
A0A1S0ZAI3      ------------------------------------------------------------
A0A1W9M770      ------------------------------------------------------------
A0A1W9M7R6      ------------------------------------------------------------
A0A3A4NIE9      ------------------------------------------------------------
A0A3A4NUI9      ------------------------------------------------------------
A0A524I3Z6      ------------------------------------------------------------
A0A524PCL7      ------------------------------------------------------------
A0A356GQV1      ------------------------------------------------------------
A0A1J5DAY8      ------------------------------------------------------------
A0A524P237      ------------------------------------------------------------
A0A3C0L0A8      ------------------------------------------------------------
A0A176S762      ------------------------------------------------------------
A0A377ZC40      ------------------------------------------------------------
A0A378BPJ7      ------------------------------------------------------------
A0A2J5PAJ7      ------------------------------------------------------------
A0A377ZDN3      ------------------------------------------------------------
A0A1G3JY11      ------------------------------------------------------------
A0A661N3U1      ------------------------------------------------------------
A0A1W9WUD9      ------------------------------------------------------------
A0A1W1ZQK0      ------------------------------------------------------------
A0A4U1ALN4      ------------------------------------------------------------
A0A4U1B1A8      ------------------------------------------------------------
A0A1M7Y300      ------------------------------------------------------------
A0A4U1A967      ------------------------------------------------------------
A0A6I1R304      ------------------------------------------------------------
A0A1W9PMU6      ------------------------------------------------------------
A0A6D0ELN7      ------------------------------------------------------------
A0A3S1WTQ1      ------------------------------------------------------------
A0A440NX85      ------------------------------------------------------------
A0A530CUR9      ------------------------------------------------------------
A0A1M6N1X5      ------------------------------------------------------------
A0A561M3U0      ------------------------------------------------------------
A0A1G3VVY5      ------------------------------------------------------------
A0A2N6BZD5      ------------------------------------------------------------
A0A656PSQ6      ------------------------------------------------------------
A0A2W5J775      ------------------------------------------------------------
A0A352Q5C1      ------------------------------------------------------------
A0A435NNF5      ------------------------------------------------------------
A0A3S2AQS7      ------------------------------------------------------------
A0A436XH86      ------------------------------------------------------------
A0A527ZPD6      ------------------------------------------------------------
A0A529KRW3      ------------------------------------------------------------
A0A530ZLX0      ------------------------------------------------------------
A0A355TB56      ------------------------------------------------------------
A0A1F9E324      ------------------------------------------------------------
A0A432SAI6      ------------------------------------------------------------
A0A4Q3LBH4      ------------------------------------------------------------
A0A4Q3LWP3      ------------------------------------------------------------
A0A2N6VGL1      ------------------------------------------------------------
A0A3M3H5V6      ------------------------------------------------------------
A0A524M660      ------------------------------------------------------------
A0A0C1TRU6      ------------------------------------------------------------
A0A2Z5SSF4      ------------------------------------------------------------
A0A2T4ZJZ6      ------------------------------------------------------------
A0A327LYE6      ------------------------------------------------------------
A0A5A9ZTV3      ------------------------------------------------------------
A0A4Q4CIB1      ------------------------------------------------------------
A0A522ACJ9      ------------------------------------------------------------
A0A1T2KYM8      ------------------------------------------------------------
A0A3N5Z7F8      ------------------------------------------------------------
A0A2G9ZR82      ------------------------------------------------------------
A0A239HD34      ------------------------------------------------------------
A0A4U9I390      ------------------------------------------------------------
A0A534V9L7      ------------------------------------------------------------
A0A0P7ZZE4      ------------------------------------------------------------
A0A369R0Q9      ------------------------------------------------------------
A0A534XP85      ------------------------------------------------------------
A0A2X3M011      ------------------------------------------------------------
I2WC85          ------------------------------------------------------------
A0A400JH80      ------------------------------------------------------------
A0A2H9EHM4      ------------------------------------------------------------
A0A380B3D7      ------------------------------------------------------------
F5NSX0          ------------------------------------------------------------
A0A479JNB1      ------------------------------------------------------------
A0A5C9AF52      ------------------------------------------------------------
A0A6D0EYC7      ------------------------------------------------------------
D8EEU7          ------------------------------------------------------------
A0A0P1H2H0      ------------------------------------------------------------
A0A258WKV0      ------------------------------------------------------------
A0A377N8F8      ------------------------------------------------------------
A5G4N9          ------------------------------------------------------------
A0A3C2DSE7      ------------------------------------------------------------
A0A2X1JBG5      ------------------------------------------------------------
A0A0B8PTA8      ------------------------------------------------------------
A0A0B8QF75      ------------------------------------------------------------
A0A4Q3LR91      ------------------------------------------------------------
A0A6C9IKN8      ------------------------------------------------------------
A0A4V1TR68      ------------------------------------------------------------
A0A444IY46      ------------------------------------------------------------
A0A6I7N627      ------------------------------------------------------------
A0A660AID0      ------------------------------------------------------------
A0A3E0WKI3      ------------------------------------------------------------
A0A1H3I2J1      ------------------------------------------------------------
A0A1V5DJV0      ------------------------------------------------------------
A0A520IUC4      ------------------------------------------------------------
A0A521LJG5      ------------------------------------------------------------
A0A531IBQ7      ------------------------------------------------------------
A0A377LY04      ------------------------------------------------------------
A0A5C9ABR5      ------------------------------------------------------------
A0A5J9WU72      ------------------------------------------------------------
A0A2X3K9R3      ------------------------------------------------------------
A0A5W0ZR28      ------------------------------------------------------------
A0A622KDG2      ------------------------------------------------------------
A0A3T9EHW9      ------------------------------------------------------------
A0A484X141      ------------------------------------------------------------
A0A5N9VWI6      ------------------------------------------------------------
A0A6D0EJQ0      ------------------------------------------------------------
A0A376LLF8      ------------------------------------------------------------
A0A444R390      ------------------------------------------------------------
A0A6C9J192      ------------------------------------------------------------
A0A1V4WHZ7      ------------------------------------------------------------
A0A1E5AJN5      LQTKQYRASLQINIDVGRASALREFEVVGESRSFFVTAESTIAASIRTRRLARRVVYELN
A0A2N3D2J1      ------------------------------------------------------------
A0A2N2GVE1      CGVGVSLAFFVTKKQTPLYRTSCSVVISSQLPSYLGSTVKSNLAETSEDFWYEQRYLATQ
A0A2N2INV3      CGVGVSLAFFVTKKQTPLYRTSCSVVISSQLPSYLGSTVKSNLAETSEDFWYEQRYLATQ
A0A1Y5DXG5      ------------------------------------------------------------
A0A0B8P2H5      ------------------------------------------------------------
A0A483QWI8      ------------------------------------------------------------
A0A483UXD3      ------------------------------------------------------------
A0A0A8J8L3      ------------------------------------------------------------
A0A660DJ38      ------------------------------------------------------------
A0A380AQW6      ------------------------------------------------------------
A0A2G2GD62      ELYKKSPLVVNVTFMEYNLLEKKLKIRAIDGETYELSYKTKIKINIDYFTRLLFGKQKVY
A0A524P331      -----------------------KTPDYTIVLTGPEKSKVANADGSVRMGMPTFVVKNAD
A0A4V1SSM5      ------------------------------------------------------------
A0A4Q3K8G7      ------------------------------------------------------------
A0A1M7HC79      ------------------------------------------------------------
A0A1D3JZN6      ------------------------------------------------------------
A0A1V6ESG1      ------------------------------------------------------------
A0A1H7YHK3      ------------------------------------------------------------
A0A534SH66      ------------------------------------------------------------
A0A3M0ZZ99      ------------------------------------------------------------
A0A238LBD3      ------------------------------------------------------------
A0A328C2K5      LTSIACVAAAYFWTDRQPRIYQATSKLIFHESRPNVFGKQFERVELVDPGGRWQFEQFWN
A0A5C6X8M3      LTSIACVAAAYFWTERQPRIYQATSKLMFHESRPNVFGKQFERVELVDPGGRWQFEQFWN
A0A3D8MRR7      LTSIACVAAAYFWTDRQPRIYQATSKLIFHESRPNVFGKQFERVELVDPGGRWQFEQFWN
A0A5C6UBJ7      LTSIACVAAAYFWTDRQPRIYQATSKLIFHESRPNVFGKQFERVELVDPGGRWQFEQFWN
A0A5C6XGM3      LTSIACVAAAYFWTERQPRIYQATSKLIFHESRPNVFGKQFERVELVDPGGRWQFEQFWN
A0A537NZJ1      ------------------------------------------------------------
A0A0P1FRV5      ------------------------------------------------------------
A0A4Q4CVW6      ------------------------------------------------------------
A0A090R136      ------------------------------------------------------------
A0A661JU93      ------------------------------------------------------------
A0A2E2T3V8      VAISFFSPVYKSFASVGFVREEPATTQTDFPKAVWPNAAEFVETRMEMIIGNETLSTVMS
A0A367UAB4      VAISFFSPVYKSFASVGFVREEPATTQTDFPKAVWPNAAEFVETRMEMIVGNETLSTVMS
A0A0P1FWI8      ------------------------------------------------------------
A0A377V641      ------------------------------------------------------------
A0A1F2YJ88      -----------------------------------------------------------V
A0A0J7XGZ1      RTYTATSALLLEPREAQPVKVNDRGFVAPADDNLIDTAVQIIRSPTLTLDVVRSLRLDRV
I4CBA7          SSPRHSLTGHVRTIFRKKWLFLGIVALALAGGVVVGLVRSPVYKSSAILRVELGGPSQRG
A3VE95          GPLIGGLAVGCALLLFVVTQFIPSTYTAYSKVMLDAREVRIMSSDEVVSNLSLSDPVIQS
A0A1G0NL95      ------------------------------------------------------------
A0A024KA69      ------------------------------------------------------------
A0A0L1KFN4      -----MTPQYTAVSTIEISREADQVTNIEGVERETSVADQEFYQTQYGLLRARSLAERVA
A0A3P5DSS6      ------------------------------------------------------------
A0A483YEL5      ------------------------------------------------------------
A0A658GUJ0      -------------------------------------------------VKNDHQYSISG
A0A358L616      ------------------------------------------------------------
A0A1M7BLL7      ------------------------------------------------------------
A0A0H4KZM1      ------------------------------------------------------------
A0A3D5UYX7      ------------------------------------------------------------
A0A2N1WQN5      ------------------------------------------------------------
A0A352G2C2      ------------------------------------------------------------
A0A3C0PZN1      ------------------------------------------------------------
A0A524QFS4      LFRSLWIKKRLIMIVLAFALTSWMFYLSIATRVYRGESILELSLRRPRISGQQEAVIDDA
A0A1V1UJT2      ------------------------------------------------------------
A0A0L6CVX1      ------------------------------------------------------------
A0A1V0RR48      ------------------------------------------------------------
A0A0A0HJJ4      ------------------------------------------------------------
A0A5E7YA28      ------------------------------------------------------------
A0A520JSW4      RWLILAAIGTGIVAAMLMTMLTPLQYRSVTTLELNPPEVEILADEGSKGGRQNAARSDIN
A0A4Q3LTF3      ------------------------------------------------------------
A0A537UTP9      -------------------------------VDSQVEVLQSENVALAVIKDLHLTKDPQF
A0A1D2RNR5      ------------------------------------------------------------
A0A4V1TQ46      ------------------------------------------------------------
A0A3A0FZC0      -------------------------------------------------------MLEQP
A0A1N7JVZ7      ------------------------------------------------------------
A0A091C4A8      ------------------------------------------------------------
A0A4R3H6P6      GALAGIALTLVMPRQYASTARMEISRETARVVKIDSVERDTSIGDQEFYQTQYGLLRTQV
A0A3S1NQ09      ------------------------------------------------------------
A0A443GJ52      ------------------------------------------------------------
A0A2W6S588      IGFAIIVLMMVLAYGATKMMTPKYSASAQLSYSPQQALSRDGQPAPPTQTTDAARDAAIE
A0A483E0N4      ------------------------------------------------------------
A0A2J4YQQ6      ------------------------------------------------------------
A0A483THX4      ------------------------------------------------------------
A0A534MVS2      ------------------------------------------------------------
A0A444I5K6      ------------------------------------------------HELRIVDEFQLV
A0A154VE85      QLVFQDRSSGFGGSALLLDRGAIETEAAIVASRDLALRAVESLRLIDDPAFNPALQPSAS
A0A3S1MCW7      ------------------------------------------------------------
A0A434IGN6      ------------------------------------------------------------
A0A528AX40      -------------------------DIEVVSENADVRAFLTAREKLKSRALAQRVVFQLG
A0A528MV95      -------------LEVLVPSAKVFQDIEVVSESSDVRAFLTAREKLKSRALAQRVVFQLG
A0A3C1S9Y1      ---------------------------------------------------MPGTEDNMF
A0A353EH49      GEILEVAKLEVPDFLKGNALRLVVEHDSEYTLYDGDEYLLKGRVGQDAVISLKDVKKYNR
A0A1Y1Q9C1      ---------------EGMQVVNFGTVSSASPDMGEQDPFFRTQYEQLKSRKLAAQVIDGL
A0A3M7LJH0      ------------------------------------------------------------
A0A316KRG4      ------------------------------------------------------------
A0A1E4JHX8      ------------------------------------------------------------
M2U8P2          VPMAVAAALCALAVAALYFTSEPTYSASGQIGFERGADELLPGLSERRAEITDAASVETA
A0A1H7KZF8      MAAIVFASLAAALLAFVLIRPSFRADATLRIDAAAQRIVGTEDVAGPVQVADIDRQMETT
A0A0J5Q9T7      ------------------------------------------------------------
A0A257NG76      ------------------------------------------------------------
A0A1T4TW59      --------------------MHLILIKKYYQTQFEILRSSHIAESVIDELGLANLPEFNS
A0A1I5YYQ0      ------------------------------------------------------------
A0A5P9FE62      ------------------------------------------------------------
A0A1Q3MB35      ------------------------------------------------------------
A0A259LUN7      ------------------------------------------------------------
A0A2D7AVL1      ------------------------------------------------------------
A0A3B9KZE9      ------------------------------------------------------------
A0A2U0NMP8      ----------------GLARLFNKTKNTIQVHKLFISPNMYDDNFITLTVKNDHQYSISG
A0A4U9HNE9      ------------------------------------------------------------
A0A2G2CXY6      RRYDPYEAGEVAEPWLGLDSFAWGGEELAIFQLEVPPGYLGKTLILTAQDAGTFTLHDQD
A0A3M1D4H3      ------------------------------------------------------------
A0A5C8BYM7      ------------------------------------------------------------
A0A1J5ICP0      ------------------------------------------SYVLKFDGPDSYKIIEDK
A0A0M3GBT1      --------------------------MEDKSSSSDLLDAKSETERLLSRSIAERVVRELQ
B3Q577          --------------------------MEDKSSSSDLLDAKSETERLLSRSIAERVVRELQ
A0A379B9V4      TTQVEPIYPVPILGKLFASATGYSPQITISHFTPLNEAANTLILEIGEQRDSYTLFLEKT
A0A0Q6TS97      ------------------------------------------------------------
A0A0Q6UYB4      ------------------------------------------------------------
A0A484XS37      -------------------------------------------------------MLSNN
W7Q5J0          LSSGIPQPSFMQRQPYVWGGENLEVARFVLAEHRRSHVVVVERDSEERYRVMLNEQHIGD
A0A654AKT6      ------------------------------------------------------------
A0A0G9MZA5      ------------------------------------------------------------
H0T8B0          ----------------------MIGSKKDVWIRSDLTIENLLVDDAAVETEIETTVSEKV
A0A5C7N981      -------------------------------------MAFIDRQTFDQTQYELLKSDALA
A0A534TV22      ------------------------------------------------------------
A0A351CXR4      SLTLMVTENMPNMAMVGQGYVDPMSMLSLWSGGTLDTRIIQSRAITTKAAQALNLTEKEF
A0A2N6GLF5      ------------------------------------------------MAEDVIAKLELT
A0A1W9LJP0      ------------------------------------------------------------
A0A0W1ICB0      ----MTPQYTATSRIEIAREQANVTNVEGLKRDSNAPDQEFYLTQYSLLNARSLAERVER
A0A2E0UL88      ------------------------------------------------------------
A0A233IKJ2      ------------------------------------------------------------
A0A2T1JE00      ------------------------------------------------------------
A0A0T2QIS1      ------------------------------------------------------------
A0A376KYN0      ------------------------------------------------------------
A0A2X1JB05      ------------------------------------------------------------
A0A376RML0      ------------------------------------------------------------
A0A377E5P7      ------------------------------------------------------------
A0A0P7Y1D0      ------------------------------------------------MSELDLAADPEF
A0A2M7JRZ7      ------------------------------------------------------------
A0A167IR75      ------------------------------------------------------------
A0A3B8T2U6      ------------------------------------------------------------
A0A365PWR2      ------------------------------------------------------------
A0A2E9H5Z8      ------------------------------------------------------------
A0A2E2BR79      ------------------------------------------------------------
A0A0Q4Q524      ------------------------------------------------------------
A0A0Q4CFJ9      ------------------------------------------------------------
A0A0Q4FE58      ------------------------------------------------------------
A0A0Q4JWC8      ------------------------------------------------------------
A0A0Q4KFL8      ------------------------------------------------------------
A0A522R8R0      ------------------------------------------------------------
A0A2U9NDY5      ------------------------------------------------------------
A0A0Q4IGG1      ------------------------------------------------------------
X7F6S5          ------------------------------------------------------------
A0A1G8NKI0      ------------------------------------------------------------
A0A355QPE4      ------------------------------------------------------------
A0A357RN98      ------------------------------------------------------------
A0A6B2MSQ7      ------------------------------------------------------------
A0A6B2P8H8      ------------------------------------------------------------
A0A1I6U4V1      ------------------------------------------------------------
A0A1G7CFZ2      ------------------------------------------------------------
A0A1P8USW9      ------------------------------------------------------------
A0A534RUJ5      ------------------------------------------------------------
A0A3M1CJM3      ------------------------------------------------------------
A0A2R7SVD4      ------------------------------------------------------------
A0A3C0PWB6      ------------------------------------------------------------
V4Q8B7          ------------------------------------------------------------
A0A0Q8XKK5      ------------------------------------------------------------
A0A2E0Q2W0      ------------------------------------------------------------
A0A660NIR6      -----------------------------------------------------MRSREVG
A0A142W0R3      ------------------------------METDVEGAREKTISNEIAFFNTQYSLLESR
A0A0S4XR18      ------------------------------------------------MAQNSTKPWEID
A0A2E0GW64      ------------------------------------------------------------
A0A1A7QJ97      ------------------------------------------------------------
A0A6I4IKZ3      --------------------------------------------------------TEEV
A0A661LW70      ------------------------------------------------------------
W7Q8F9          --------------------------------------MVVERDSEERYRVMLNEQHIGD
A0A524PXH8      ------------------------------------------------------------
A0A4Q3P0E4      ---------------------------------------------HYLDILLANKWLIAA
A0A3M2BE89      ---------------------------------------LGQPLTLVAQASNHYRLLDEE
A0A4Q4A6K6      ------------------------------------------------------------
A0A257G674      ----------------------------------------------------------DI
A0A661M5M6      ------------------------------------------------------------
A0A1I1UM01      ------------------------------------------------------------
Q44573          --------------------------------------------------MIHSRDVAAA
A2W025          -----------------------------------MPALEGKKLTLTAGPNGTYSLVDEN
A0A534Z362      SPIQLRLEGNVLRLDDGDPSANGAATFLSTQVAALQSRDLAERVIRSRGLADSEAFLDPG
V4J283          ------------------------------------------------------------
A0A536T443      ------------------------------------------------------------
A0A0Q4UFQ5      ------------------------------------------------------------
A0A527W7E6      ------------------------------------------------------------
A0A432EMV7      ------------------------------------------------------------
A0A087LTV7      ------------------------------------------------------------
A0A534WLI3      ------------------------------------------------------------
A0A318KWA2      -------------------------------------------------MDGETPRALGE
A0A522MT86      ------------------------------------------------------------
A0A4Q3I221      ------------------------------------------------------------
A0A534SAL6      SPIQLQLQENVLHLDESDRSVNGTSSFLATQVAALKSRDIAERVIRREGLATDEAFLHPG
A0A534ZDB4      -----------------DRSVNGTSSFLATQVATLKSRDLAERVIRSERLATDEAFLHPG
A0A534X3M7      SPIQLRLEGNVLRLGESDRDANGAATFVGMQVAALRSRDLAERVIRGRGLAANDAFLDPR
A0A534SPC6      ------------------------------------------------------------
A0A535AD60      SPIQLRLEGNVLRLGDGDLSANGAATFLSTQVAALQSRDLAERVIRSRGLADSEAFLDPG
A0A4Q3SY08      ------------------------------------------------------------
A0A4Q3LG23      ------------------------------------------------------------
A0A522EX52      ------------------------------------------------------------
A0A1H3KC95      ------------------------------------------------------------
A0A5P8Z4P3      ----------------------------------------MTAERIFRRKNRPGARSDSS
A0A2E9HXF7      ------------------------------------------------------------
A0A0B3RZC9      ------------------------------------------------------------
A0A6F8QET1      -----------------------------------------------------MGRTGDT
A0A520HUH4      ------------------------------------------------------------
A0A2K8U7M6      ------------------------------------------------------------
A0A5B9DKL8      ------------------------------------------------------------
A0A238KJM1      ------------------------------------------------------------
A0A3A0FJZ4      ------------------------------------------------------------
W4HJV8          ------------------------------------------------------------
A0A0P1GDI0      ------------------------------------------------------------
A0A2R8ATV5      ------------------------------------------------------------
A0A1U7D3R6      ------------------------------------------------------------
A0A2D4UVV2      ------------------------------------------------------------
A0A0W7WHP4      ------------------------------------------------------------
A0A238J8F6      ------------------------------------------------------------
A0A238JQI6      ------------------------------------------------------------
A0A222E077      ------------------------------------------------------------
A0A239E3Y2      ------------------------------------------------------------
A0A1V6FYJ1      ------------------------------------------------------------
A0A445MZQ4      ------------------------------------------------------------
A0A0M9E0E3      ------------------------------------------------------------
A0A0Q6QV61      ------------------------------------------------------------
A0A2Z3IKG4      ------------------------------------------------------------
A0A2W4RFS2      ------------------------------------------------------------
A0A1Y6DC43      ------------------------------------------------------------
A0A2S6HE06      ------------------------------------------------------------
G3J0M3          ------------------------------------------------------------
V5C6R5          ------------------------------------------------------------
A0A354EF47      ------------------------------------------------------------
A0A2G6MSP7      ------------------------------------------------------------
A0A4U8YMP3      ------------------------------------------------------------
A0A1Q8QQ99      ------------------------------------------------------------
A0A3D5ZY44      ------------------------------------------------------------
A0A646J2A6      ------------------------------------------------------------
A0A1G5C236      ------------------------------------------------------------
A0A432HIS7      ------------------------------------------------------------
A0A1I3XJ27      ------------------------------------------------------------
A0A1I7DCG1      ------------------------------------------------------------
A0A3A3H6D9      ------------------------------------------------------------
A0A562CGU2      ------------------------------------------------------------
A0A0Q6VA36      ------------------------------------------------------------
A0A1B2EQN1      ------------------------------------------------------------
A0A1E7HSL6      ------------------------------------------------------------
A0A4Q3ZDI7      ------------------------------------------------------------
A0A537PRC6      ------------------------------------------------------------
A0A2M7JX59      ------------------------------------------------------------
A0A3A4XVN3      ------------------------------------------------------------
A0A1E7JEV6      ------------------------------------------------------------
A0A2N2KDY5      ------------------------------------------------------------
A0A3N5YUD9      ------------------------------------------------------------
A0A0W1DLQ3      ------------------------------------------------------------
A0A246JVD8      ------------------------------------------------------------
A0A2N3BB54      ------------------------------------------------------------
A0A1H6G7A3      ------------------------------------------------------------
A0A0A7PGL6      ------------------------------------------------------------
A0A4Q2Z4L0      ------------------------------------------------------------
A0A5C4N0H6      ------------------------------------------------------------
A0A4R1HDF2      ------------------------------------------------------------
A0A1E7HFN0      ------------------------------------------------------------
A0A1M5GH86      ------------------------------------------------------------
A0A1W1XQZ5      ------------------------------------------------------------
A0A3D6C3I2      ------------------------------------------------------------
S0G1D4          ------------------------------------------------------------
A0A661T246      ------------------------------------------------------------
A0A2G6CSG7      ------------------------------------------------------------
A0A2G6NB59      ------------------------------------------------------------
A0A5K8A7T9      ------------------------------------------------------------
A0A1W9U045      ------------------------------------------------------------
A0A1F9L9G4      ------------------------------------------------------------
A0A328FD76      ------------------------------------------------------------
A0A348UX90      ------------------------------------------------------------
A0A357Z0N5      ------------------------------------------------------------
A0A0F2R2U0      ------------------------------------------------------------
A0A5K7ZK00      ------------------------------------------------------------
A0A5K7YCX8      ------------------------------------------------------------
A0A5K7Z388      ------------------------------------------------------------
A0A352B502      ------------------------------------------------------------
A0A2K8WHP8      ------------------------------------------------------------
A0A410V446      ------------------------------------------------------------
A0A0R3KGJ5      ------------------------------------------------------------
A0A0R3N604      ------------------------------------------------------------
A0A1B1UCM8      ------------------------------------------------------------
A0A1N6JQ20      ------------------------------------------------------------
A0A1M5TI07      ------------------------------------------------------------
A3X191          ------------------------------------------------------------
A0A1H4RKV5      ------------------------------------------------------------
A0A160UA87      ------------------------------------------------------------
A0A1Q5SFV5      ------------------------------------------------------------
A0A1J5N774      ------------------------------------------------------------
A0A2C8F781      ------------------------------------------------------------
A0A2E3R6G0      ------------------------------------------------------------
A0A1F8XMK2      ------------------------------------------------------------
A0A3M8EMP2      ------------------------------------------------------------
A0A2J6J6K6      ------------------------------------------------------------
A0A661PSB9      ------------------------------------------------------------
A0A661QBT6      ------------------------------------------------------------
A0A1G6EKK9      ------------------------------------------------------------
A0A6I2SLK2      ------------------------------------------------------------
A0A0A8WSG4      ------------------------------------------------------------
S7TK97          ------------------------------------------------------------
S7UE93          ------------------------------------------------------------
A0A3D5BR56      ------------------------------------------------------------
A0A2N2IB15      ------------------------------------------------------------
A0A1I3PSR2      ------------------------------------------------------------
A0A1I4GEK4      ------------------------------------------------------------
A0A2T5R3J5      ------------------------------------------------------------
A0A1W7QPT7      ------------------------------------------------------------
A0A0M4D373      ------------------------------------------------------------
A0A1L3GKM9      ------------------------------------------------------------
A0A430DNP0      ------------------------------------------------------------
A0A3A0FQ32      ------------------------------------------------------------
A0A1E4UZA0      ------------------------------------------------------------
A0A1H9KL56      ------------------------------------------------------------
A0A1A9KEF8      ------------------------------------------------------------
A0A5E6PKN5      ------------------------------------------------------------
A0A0N9W1V6      ------------------------------------------------------------
A0A423GQ41      ------------------------------------------------------------
A0A423H7J2      ------------------------------------------------------------
A0A502HNM8      ------------------------------------------------------------
A0A4Q7H223      ------------------------------------------------------------
A0A1H4N2K9      ------------------------------------------------------------
A0A2K4KWF7      ------------------------------------------------------------
A0A3E0WXH2      ------------------------------------------------------------
A0A2N2TRC8      ------------------------------------------------------------
A0A1V4CIZ7      ------------------------------------------------------------
A0A1M3BXA5      ------------------------------------------------------------
A0A1Y2R3U6      ------------------------------------------------------------
A0A167HVD6      ------------------------------------------------------------
A0A1V3SCT6      ------------------------------------------------------------
L0H287          ------------------------------------------------------------
A0A495VG93      ------------------------------------------------------------
A0A4R3MYM4      ------------------------------------------------------------
G2E3C0          ------------------------------------------------------------
A0A4U8YLL7      ------------------------------------------------------------
A0A3N5RNY4      ------------------------------------------------------------
A0A1V4M8I1      ------------------------------------------------------------
A0A4Z0M4C7      ------------------------------------------------------------
A0A5Q2QDL1      ------------------------------------------------------------
A0A1I0R9R6      ------------------------------------------------------------
A0A443K010      ------------------------------------------------------------
A0A6I7NYG5      ------------------------------------------------------------
A0A238IZI1      ------------------------------------------------------------
A0A316GHM6      ------------------------------------------------------------
A0A520ZTR8      ------------------------------------------------------------
A0A212AR83      ------------------------------------------------------------
A0A2E2P4I0      ------------------------------------------------------------
A0A2U2CM86      ------------------------------------------------------------
A0A1X7ACC1      ------------------------------------------------------------
A0A2N3BVE7      ------------------------------------------------------------
A0A2S5JE21      ------------------------------------------------------------
A0A2R8BKZ2      ------------------------------------------------------------
A0A2S8S361      ------------------------------------------------------------
A0A238KUF6      ------------------------------------------------------------
A0A095CTW3      ------------------------------------------------------------
A0A2E3UGD6      ------------------------------------------------------------
A0A2T0RFH0      ------------------------------------------------------------
A0A285D390      ------------------------------------------------------------
A0A497VHN4      ------------------------------------------------------------
A0A318CT66      ------------------------------------------------------------
A0A3N5P205      ------------------------------------------------------------
A0A2N6BEI9      ------------------------------------------------------------
A0A0D5N3E9      ------------------------------------------------------------
A0A2N2G716      ------------------------------------------------------------
W9VVY5          ------------------------------------------------------------
A0A1E2URD3      ------------------------------------------------------------
A0A2T6MY81      ------------------------------------------------------------
A0A2T6NBQ8      ------------------------------------------------------------
A0A421K431      ------------------------------------------------------------
A0A2G2I5M1      ------------------------------------------------------------
A0A2G2M6F0      ------------------------------------------------------------
A0A1W9J9F8      ------------------------------------------------------------
A0A2S5LFJ9      ------------------------------------------------------------
A0A2D8R8F8      ------------------------------------------------------------
A0A6I4JXQ8      ------------------------------------------------------------
A0A010SNS0      ------------------------------------------------------------
A0A0C2I782      ------------------------------------------------------------
A0A2N8BYF5      ------------------------------------------------------------
A0A558FKX2      ------------------------------------------------------------
A0A1H1DBA0      ------------------------------------------------------------
J2TAD5          ------------------------------------------------------------
J3H699          ------------------------------------------------------------
A0A1H5J974      ------------------------------------------------------------
A0A0K1QRZ4      ------------------------------------------------------------
A0A560RJW9      ------------------------------------------------------------
A0A5E6TID7      ------------------------------------------------------------
A0A5E7CRU7      ------------------------------------------------------------
A0A5E7C564      ------------------------------------------------------------
A0A2W7MAV4      ------------------------------------------------------------
A0A4R3WQH5      ------------------------------------------------------------
W6VFG3          ------------------------------------------------------------
A0A1P8ENT1      ------------------------------------------------------------
A0A2N7XRV4      ------------------------------------------------------------
A0A0Q6QPG8      ------------------------------------------------------------
A0A0F4SWA7      ------------------------------------------------------------
A0A423J219      ------------------------------------------------------------
A0A4P6G9U8      ------------------------------------------------------------
A0A4Y8JE06      ------------------------------------------------------------
A0A502I1X9      ------------------------------------------------------------
A0A502J776      ------------------------------------------------------------
A0A5B0EZF6      ------------------------------------------------------------
A0A059L434      ------------------------------------------------------------
A0A0F4UWN2      ------------------------------------------------------------
A0A5E7WEF5      ------------------------------------------------------------
A0A1G0KSD0      ------------------------------------------------------------
A0A4P6WX84      ------------------------------------------------------------
A0A1D2S760      ------------------------------------------------------------
A0A5B8RW94      ------------------------------------------------------------
A0A258TN88      ------------------------------------------------------------
A0A1F9EUS2      ------------------------------------------------------------
A0A6H9HII8      ------------------------------------------------------------
A0A3N9VAW3      ------------------------------------------------------------
A0A1X0YE57      ------------------------------------------------------------
A0A2K2H9Q8      ------------------------------------------------------------
A0A6I1KNW9      ------------------------------------------------------------
A0A1H4B8T3      ------------------------------------------------------------
A0A1E7IQC3      ------------------------------------------------------------
A0A1M6KEN5      ------------------------------------------------------------
A0A353QLL3      ------------------------------------------------------------
A0A399I453      ------------------------------------------------------------
A0A651FBV9      ------------------------------------------------------------
A0A5C1MDH8      ------------------------------------------------------------
A0A5A9XE04      ------------------------------------------------------------
A0A643G9R1      ------------------------------------------------------------
A0A1G0M8Q7      ------------------------------------------------------------
A0A353MI14      ------------------------------------------------------------
A0A4S1CAW7      ------------------------------------------------------------
A0A562VHD2      ------------------------------------------------------------
A0A6I6JNB5      ------------------------------------------------------------
A0A1G0LDK7      ------------------------------------------------------------
A0A6F9WVL7      ------------------------------------------------------------
A0A2M7WWF7      ------------------------------------------------------------
A0A351Z9A2      ------------------------------------------------------------
A0A351B422      ------------------------------------------------------------
F2NEE9          ------------------------------------------------------------
B7RS54          ------------------------------------------------------------
A0A3N5FRH4      ------------------------------------------------------------
A0A1V4Y2C3      ------------------------------------------------------------
A0A2N2KTJ4      ------------------------------------------------------------
A0A2N2LQX0      ------------------------------------------------------------
A0A520CSP5      ------------------------------------------------------------
A0A1I6ENM4      ------------------------------------------------------------
A8LNM8          ------------------------------------------------------------
A0A0T5NSU3      ------------------------------------------------------------
A0A5P9I718      ------------------------------------------------------------
A0A2M8J3R9      ------------------------------------------------------------
A0A1I6X762      ------------------------------------------------------------
A0A0P1EFX8      ------------------------------------------------------------
A0A2G5KB39      ------------------------------------------------------------
A0A2N3CNV1      ------------------------------------------------------------
A0A257F1F4      ------------------------------------------------------------
A0A1G9FY29      ------------------------------------------------------------
A0A4Q3ZBK4      ------------------------------------------------------------
A0A2D5J8T8      ------------------------------------------------------------
A0A2E3P9W6      ------------------------------------------------------------
A0A2G2B1P9      ------------------------------------------------------------
A0A258GCD5      ------------------------------------------------------------
A0A2D9YR88      ------------------------------------------------------------
A0A443INY4      ------------------------------------------------------------
A0A372IH36      ------------------------------------------------------------
A0A540VW45      ------------------------------------------------------------
A0A1H9C241      ------------------------------------------------------------
A0A2E3FCR1      ------------------------------------------------------------
A0A4S3MG69      ------------------------------------------------------------
A0A3E0H727      ------------------------------------------------------------
A0A1G8QZS5      ------------------------------------------------------------
A0A1V4QMH7      ------------------------------------------------------------
A0A496XZQ4      ------------------------------------------------------------
A0A1F9BJF7      ------------------------------------------------------------
F2NDF5          ------------------------------------------------------------
A0A1I3TTC3      ------------------------------------------------------------
A0A1H3IZW6      ------------------------------------------------------------
A0A0M6YG59      ------------------------------------------------------------
A0A1H7G8B0      ------------------------------------------------------------
A0A059IPK4      ------------------------------------------------------------
A0A1H2Y469      ------------------------------------------------------------
A0A497ZQU7      ------------------------------------------------------------
A0A318D3U4      ------------------------------------------------------------
A0A401FQP5      ------------------------------------------------------------
A0A1Q6DMW3      ------------------------------------------------------------
A0A3A6P8F8      ------------------------------------------------------------
A0A2G2DSM4      ------------------------------------------------------------
A0A1F9NI02      ------------------------------------------------------------
A0A4U1ABX4      ------------------------------------------------------------
A0A351Z4H9      ------------------------------------------------------------
A0A2N2KML4      ------------------------------------------------------------
E1YJF1          ------------------------------------------------------------
A0A1J5EVZ6      ------------------------------------------------------------
A0A2G6FCC5      ------------------------------------------------------------
A0A1F9MR25      ------------------------------------------------------------
A0A2G6M7F1      ------------------------------------------------------------
A0A1E7H876      ------------------------------------------------------------
A0A509L3P8      ------------------------------------------------------------
A0A3A4S038      ------------------------------------------------------------
A0A1F9N669      ------------------------------------------------------------
A0A1F9PFA7      ------------------------------------------------------------
A0A1H2EN09      ------------------------------------------------------------
K0NP00          ------------------------------------------------------------
A0A1E7JCL5      ------------------------------------------------------------
A0A496YAH9      ------------------------------------------------------------
A0A1V4S7E4      ------------------------------------------------------------
A0A2N2H8D2      ------------------------------------------------------------
A0A2N2KC63      ------------------------------------------------------------
A0A3A4ZYW4      ------------------------------------------------------------
A0A1V4MCJ4      ------------------------------------------------------------
A0A661M0W4      ------------------------------------------------------------
A0A0F2NF69      ------------------------------------------------------------
A0A1F9NFD0      ------------------------------------------------------------
A0A1M5YLH5      ------------------------------------------------------------
A0A4U1A4C7      ------------------------------------------------------------
                                                                            

E1Y9C0          ------------------------------------------------------------
A0A1N6SH58      ------------------------------------------------------------
A0A4Q3AQN2      ------------------------------------------------------------
A0A1W9HS52      FDNGDYIFINPRQVVRVLKANK------NFIIMCTLSALLLAFLHQSFLYVPIFVSESKL
A0A2D5LFD8      GASYSEFRQIIYRRKKLIAIS-------AIAITSAITGQLI-------------------
A0A0N0XAV4      ------------------------------------------------------------
A0A0P9QD19      ------------------------------------------------------------
F3FHG4          ------------------------------------------------------------
F3GGI0          ------------------------------------------------------------
A0A0P9LE74      ------------------------------------------------------------
A0A3M4ZQ14      G-----------QRQADVSVP-------ELIKSRALLGKVVDDLKLNVLQTPDFF-----
A0A3M5YLE8      G-----------QRQADVSVP-------ELIKSRALLGKVVDDLKLNVLQTPDFF-----
A0A3M3RP89      G-----------QRQADVSVP-------ELIKSRALLGKVVDDLKLNVLQTPDFF-----
A0A0P9QIY7      G-----------QRQADVSVP-------ELIKSRALLGKVVDDLKLNVLQTPDFF-----
A0A0P9VVH7      G-----------QRQADVSVP-------ELIKSRALLGKVVDDLKLNVLQTPDFF-----
A0A0Q0FJK6      G-----------QRQADVSVP-------ELIKSRALLGKVVDDLKLNVLQTPDFF-----
A0A0Q0G2J0      G-----------QRQADVSVP-------ELIKSRALLGKVVDDLKLNVLQTPDFF-----
A0A3M3LF66      G-----------QRQADVSVP-------ELIKSRALLGKVVDDLKLNVLQTPDFF-----
A0A0P9WIR8      G-----------QRQADVSVP-------ELIKSRALLGKVVDDLKLNVLQTPDFF-----
A0A3M3KPE5      -----------------------------MIKSRALLGKVVDDLKLNVLQTPDFF-----
A0A3M4C263      -----------------------------MIKSRALLGKVVDDLKLNVLQTPDFF-----
A0A3M5AD05      -----------------------------MIKSRALLGKVVDDLKLNVLQTPDFF-----
A0A0Q0D3D2      ------------------------------------------------------------
A0A0N0FS39      ------------------------------------------------------------
A0A3M6GHH2      ------------------------------------------------------------
A0A0P9R9W0      G-----------QRQTTLSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF-----
A0A0Q0B9T0      G-----------QRQTTLSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF-----
A0A3M6CFI7      G-----------QRQTTLSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF-----
A0A0P9JXN0      G-----------QRQTTLGVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF-----
A0A3M6FIV7      G-----------QRQTTLGVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF-----
A0A3M3PLW9      R-----------CRRXXTTEI-------ELIKSRALLGKVVDDLKLNRLQTPDLF-----
A0A3M4ENY1      -----------------------------MIKSRALLGKVVDDLQLNRLQTPDLF-----
A0A3M5EZK7      -----------------------------MIKSRALLGKVVDDLKLNRLQTPDLF-----
A0A0P9SPP5      ----------------MVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF-----
A0A658KL17      ----------------MVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF-----
A0A3M3NNF2      ----------------MVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF-----
A0A3M4A0E8      G-----------QRQAIVSVT-------ELIKSRALLGKVVDDLKLSTLQTPDFF-----
A0A3M4PBZ2      G-----------QRQAIVSVT-------ELIKSRALLGKVVDDLKLSTLQTPDFF-----
A0A3M6AI26      G-----------QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF-----
A0A0P9IWP8      G-----------QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF-----
A0A0P9KZ49      G-----------QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF-----
A0A0P9V840      G-----------QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF-----
A0A0Q0AIE5      G-----------QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF-----
A0A3M2ZQH6      G-----------QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF-----
A0A0N8SQG2      G-----------QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF-----
A0A0W8HFU1      G-----------QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF-----
A0A3M5M873      G-----------QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDLF-----
A0A0P9VHH8      G-----------QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF-----
A0A0P9YV98      G-----------QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF-----
A0A3M3G2W8      G-----------QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF-----
A0A3M6C224      G-----------QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF-----
A0A3M5K254      G-----------QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF-----
A0A3M5JFB0      G-----------QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF-----
A0A3M3TQV3      G-----------QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF-----
A0A3M3EF92      G-----------QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF-----
A0A3M5J1E2      G-----------QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF-----
A0A3M5G7H9      G-----------QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF-----
A0A3M4A376      G-----------QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF-----
A0A0Q0A5T8      G-----------QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF-----
A0A0P9SCD7      G-----------QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF-----
A0A0P9T4G3      G-----------QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF-----
A0A0P9VKB0      G-----------QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF-----
A0A0Q0BM35      G-----------QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF-----
A0A3M3TPR7      G-----------QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF-----
A0A3M3U4Q3      G-----------QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF-----
A0A0P9UCX7      G-----------QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF-----
A0A0P9S1F1      G-----------QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF-----
A0A0P9QCJ2      G-----------QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF-----
A0A0P9Q329      G-----------QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF-----
A0A3M5GJ64      G-----------QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF-----
A0A0P9MPC7      G-----------QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF-----
A0A3M2XYQ3      S-----------QCQATLGVA-------ELIKSRALLGKVVDDLRLNRLQTPDLF-----
A0A0P9XCE1      S-----------QCQATLGVA-------ELIKSRALLGKVVDDLKLNRLQTPDLF-----
A0A3M3EFX7      S-----------QCQATLGVA-------ELIKSRALLGKVVDDLKLNRLQTPDLF-----
A0A3M5B9D9      S-----------QCQATLGVA-------ELIKSRALLGKVVDDLKLNRLQTPDLF-----
A0A0P9RRZ3      G-----------QRQATLGVA-------ELIKSRALLGKVVDDLKLSTLQTPDFF-----
A0A3M2VEK7      S-----------QCQATLGVA-------ELIKSRALLGKVVDDLQLNRLQTPDLF-----
A0A0N8R9B3      S-----------QCQATLGVA-------ELIKSRALLGKVVDDLQLNRLQTPDLF-----
A0A0P9VA27      S-----------QCQATLGVA-------ELIKSRALLGKVVDDLQLNRLQTPDLF-----
A0A3M4YBJ4      S-----------QCQATLGVA-------ELIKSRALLGKVVDDLQLNRLQTPDLF-----
A0A0P9J470      G-----------QCQATLGVA-------ELIKSRALLGKVVDDLQLNRLQTPDLF-----
A0A0Q0EVJ8      G-----------QCQATLGVA-------ELIKSRALLGKVVDDLQLNRLQTPDLF-----
A0A3M5UI30      G-----------QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF-----
A0A3M5YQT8      G-----------QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF-----
A0A3M5F5X1      G-----------QRQAIVSVAXXXXXXXELIKSRALLGKVVDDLKLNTLQTPDLF-----
A0A3M5R8G1      ---------------AIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF-----
A0A3M5V012      ---------------AIVNVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF-----
A0A3M3GA16      -------------RKAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF-----
A0A3M3UCT3      S-----------QCQATLGVA-------ELIKSRALLGKVVDDLQLNRLQTPDLF-----
A0A3M3CJL0      S-----------QRQATLGVA-------ELIKSRALLGKVVDDLQLNRLQTPDLF-----
A0A3M3F6F5      S-----------QCQATLGVA-------ELIKSRALLGKVVDDLQLNRLQTPDLF-----
A0A3M3P9B7      S-----------QCQATLGVA-------ELIKSRALLGKVVDDLQLNRLQTPDLF-----
A0A0N8QB74      S-----------QCQATLGVA-------ELIKSRALLGKVVDDLQLNRLQTPDLF-----
A0A0Q0AUD0      S-----------QCQATLGVA-------ELIKSRALLGKVVDDLQLNRLQTPDLF-----
A0A3M5VR55      S-----------QCQATLGVA-------ELIKSRALLGKVVDDLQLNRLQTPDLF-----
A0A0Q0FK97      S-----------QCQATLGVA-------ELIKSRALLGKVVDDLQLNRLQTPDLF-----
A0A3M5KZ75      R-----------RPXXXTTEI-------ELIKSRALLGKVVDDLQLNRLQTPDLF-----
A0A3M5L3G5      ----------------------------ELIKSRALLGKVVDDLQLNRLQTPDLF-----
A0A0C5VQ86      ------------------------------------------------------------
A0A1V8MBH1      ------------------------------------------------------------
A0A534QGR3      ------------------------------------------------------------
A0A0R0BVC7      ------------------------------------------------------------
A0A0W1GMS6      ------------------------------------------------------------
A0A0Q8RMY3      ------------------------------------------------------------
A0A1A7QC21      ------------------------------------------------------------
A0A1F9CFF0      ------------------------------------------------------------
A0A2M8B0G5      ------------------------------------------------------------
A0A363TNU9      ------------------------------------------------------------
A0A534HBS8      ------------------------------------------------------------
A0A0F0T3Y9      ------------------------------------------------------------
A0A379GWF0      ------------------------------------------------------------
A0A536T0W8      ------------------------------------------------------------
A0A4Q2XLV7      ------------------------------------------------------------
A0A4Q5QYC4      ------------------------------------------------------------
A0A2G9XLE5      ------------------------------------------------------------
A0A3D2M6Y9      ------------------------------------------------------------
A0A3D2YAZ2      ------------------------------------------------------------
A0A350A102      ------------------------------------------------------------
A0A350L5D2      ------------------------------------------------------------
A0A3B8SQ27      ------------------------------------------------------------
A0A656BWB0      ------------------------------------------------------------
A0A6D0IFH4      ------------------------------------------------------------
A0A3Y2RPN4      ------------------------------------------------------------
A0A0A0FHV8      ------------------------------------------------------------
A0A1X3IPU7      ------------------------------------------------------------
A0A0A0G0N2      ------------------------------------------------------------
A0A243TPR1      ------------------------------------------------------------
A0A2I8SDU4      ------------------------------------------------------------
A0A2I8SU55      ------------------------------------------------------------
S1EXJ6          ------------------------------------------------------------
A0A376UBS1      ------------------------------------------------------------
A0A4Q6G931      ------------------------------------------------------------
A0A1W9F5M9      ------------------------------------------------------------
A0A3C2BN18      ------------------------------------------------------------
A0A447LR75      ------------------------------------------------------------
A0A376D8L7      ------------------------------------------------------------
A0A1V2FV46      ------------------------------------------------------------
A0A376SB61      ------------------------------------------------------------
A0A3D1BYV9      ------------------------------------------------------------
A0A6D0I9G1      ------------------------------------------------------------
A0A352MMI7      ------------------------------------------------------------
A0A379W6R2      ------------------------------------------------------------
A0A376RY66      ------------------------------------------------------------
A0A377K431      ------------------------------------------------------------
A0A379TA56      ------------------------------------------------------------
A0A4Z0LWV1      ------------------------------------------------------------
A0A5V7HTZ1      ------------------------------------------------------------
A0A610XNI4      ------------------------------------------------------------
A0A620QD02      ------------------------------------------------------------
A0A5H3HSJ8      ------------------------------------------------------------
A0A655C5P0      ------------------------------------------------------------
A0A2T0VBD8      ------------------------------------------------------------
A0A378APS2      ------------------------------------------------------------
A0A443VCQ6      ------------------------------------------------------------
A0A447RKQ7      ------------------------------------------------------------
W1DSK1          ------------------------------------------------------------
A0A0U2VAW2      ------------------------------------------------------------
A0A454CTF1      ------------------------------------------------------------
A0A6B3Q2G1      ------------------------------------------------------------
A0A378G3G7      ------------------------------------------------------------
A0A2X5NHJ9      ------------------------------------------------------------
A0A2J4QEC3      ------------------------------------------------------------
A0A485ADM3      ------------------------------------------------------------
A0A4U9HGU4      ------------------------------------------------------------
A0A3S4JGG5      ------------------------------------------------------------
A0A377ZDH2      ------------------------------------------------------------
A0A3S4HTS8      ------------------------------------------------------------
A0A2N1XK22      ------------------------------------------------------------
A0A3D0KAC8      ------------------------------------------------------------
A0A3D2Y902      ------------------------------------------------------------
A0A655RNN3      ------------------------------------------------------------
A0A655R819      ------------------------------------------------------------
A0A655ZEY0      ------------------------------------------------------------
A0A6G6X2Z4      ------------------------------------------------------------
Q44570          ------------------------------------------------------------
A0A3N5MZ53      ------------------------------------------------------------
A0A534E4H4      ------------------------------------------------------------
A0A534I2B6      ------------------------------------------------------------
A0A1C2JGD0      ------------------------------------------------------------
A0A259LQ70      ------------------------------------------------------------
A0A4V2SPR5      ------------------------------------------------------------
A0A3N5PM86      ------------------------------------------------------------
A0A2E5YSA4      ------------------------------------------------------------
A0A519ERR1      ------------------------------------------------------------
A0A4Q3Q1M2      ------------------------------------------------------------
A0A4Q3MHR1      ------------------------------------------------------------
A0A520GDZ4      ------------------------------------------------------------
A0A318DSU0      ------------------------------------------------------------
A0A538PF21      ------------------------------------------------------------
A0A1W1ZH10      ------------------------------------------------------------
A0A1W2FF24      ------------------------------------------------------------
A0A524JYQ6      ------------------------------------------------------------
A0A4Q3MA17      ------------------------------------------------------------
A0A0N0M5F7      ------------------------------------------------------------
A0A537M754      ------------------------------------------------------------
A0A1V1PDB4      ------------------------------------------------------------
A0A2M7C324      ------------------------------------------------------------
A0A4Q3HHG6      ------------------------------------------------------------
A0A3B7DTA4      ------------------------------------------------------------
A0A432ZK62      ------------------------------------------------------------
A0A1V5EEP4      ------------------------------------------------------------
A0A1V5EF48      ------------------------------------------------------------
A0A0S6X1X6      ------------------------------------------------------------
A0A537Y5L8      ------------------------------------------------------------
A0A4Q3L2X2      ------------------------------------------------------------
A0A4Q3T8J1      ------------------------------------------------------------
A0A4Q4ANM4      ------------------------------------------------------------
A0A4Q3UEC7      ------------------------------------------------------------
A0A1H5YYQ4      ------------------------------------------------------------
A0A1X4NLK2      ------------------------------------------------------------
A0A1X4NWB5      ------------------------------------------------------------
A0A1M5UQ38      ------------------------------------------------------------
A0A327YI48      ------------------------------------------------------------
A0A1B1PNL6      ------------------------------------------------------------
A0A2U8H9H9      ------------------------------------------------------------
A0A6B2NBB8      ------------------------------------------------------------
A0A1X6YIC0      ------------------------------------------------------------
A0A1I5E9E9      ------------------------------------------------------------
A0A1X6Z7N7      ------------------------------------------------------------
A0A2E1DQ13      ------------------------------------------------------------
A0A1H8C800      ------------------------------------------------------------
A0A2N3EZ05      ------------------------------------------------------------
A0A3N5J7U8      ------------------------------------------------------------
A0A1S7S3I8      ------------------------------------------------------------
A0A519E8D7      ------------------------------------------------------------
A0A3S1NZ06      ------------------------------------------------------------
A0A3S1FD32      ------------------------------------------------------------
A0A434DUT4      ------------------------------------------------------------
A0A528D3U3      ------------------------------------------------------------
A0A3S3UPT3      ------------------------------------------------------------
A0A3S1E286      ------------------------------------------------------------
A0A531AC71      ------------------------------------------------------------
A0A436K268      ------------------------------------------------------------
A0A434IDQ0      ------------------------------------------------------------
A0A435IRM5      ------------------------------------------------------------
A0A3S2C404      ------------------------------------------------------------
A0A435F6C0      ------------------------------------------------------------
A0A435BMN6      ------------------------------------------------------------
A0A529XQ54      ------------------------------------------------------------
A0A530BJC1      ------------------------------------------------------------
A0A348SRI7      ------------------------------------------------------------
A0A354EI73      ------------------------------------------------------------
A0A4Q3IRI1      ------------------------------------------------------------
A0A4P7EP83      ------------------------------------------------------------
A0A6I1QB25      ------------------------------------------------------------
A0A655ZZQ1      ------------------------------------------------------------
A0A1S0ZAI3      ------------------------------------------------------------
A0A1W9M770      ------------------------------------------------------------
A0A1W9M7R6      ------------------------------------------------------------
A0A3A4NIE9      ------------------------------------------------------------
A0A3A4NUI9      ------------------------------------------------------------
A0A524I3Z6      ------------------------------------------------------------
A0A524PCL7      ------------------------------------------------------------
A0A356GQV1      ------------------------------------------------------------
A0A1J5DAY8      ------------------------------------------------------------
A0A524P237      ------------------------------------------------------------
A0A3C0L0A8      ------------------------------------------------------------
A0A176S762      ------------------------------------------------------------
A0A377ZC40      ------------------------------------------------------------
A0A378BPJ7      ------------------------------------------------------------
A0A2J5PAJ7      ------------------------------------------------------------
A0A377ZDN3      ------------------------------------------------------------
A0A1G3JY11      ------------------------------------------------------------
A0A661N3U1      ------------------------------------------------------------
A0A1W9WUD9      ------------------------------------------------------------
A0A1W1ZQK0      ------------------------------------------------------------
A0A4U1ALN4      ------------------------------------------------------------
A0A4U1B1A8      ------------------------------------------------------------
A0A1M7Y300      ------------------------------------------------------------
A0A4U1A967      ------------------------------------------------------------
A0A6I1R304      ------------------------------------------------------------
A0A1W9PMU6      ------------------------------------------------------------
A0A6D0ELN7      ------------------------------------------------------------
A0A3S1WTQ1      ------------------------------------------------------------
A0A440NX85      ------------------------------------------------------------
A0A530CUR9      ------------------------------------------------------------
A0A1M6N1X5      ------------------------------------------------------------
A0A561M3U0      ------------------------------------------------------------
A0A1G3VVY5      ------------------------------------------------------------
A0A2N6BZD5      ------------------------------------------------------------
A0A656PSQ6      ------------------------------------------------------------
A0A2W5J775      ------------------------------------------------------------
A0A352Q5C1      ------------------------------------------------------------
A0A435NNF5      ------------------------------------------------------------
A0A3S2AQS7      ------------------------------------------------------------
A0A436XH86      ------------------------------------------------------------
A0A527ZPD6      ------------------------------------------------------------
A0A529KRW3      ------------------------------------------------------------
A0A530ZLX0      ------------------------------------------------------------
A0A355TB56      ------------------------------------------------------------
A0A1F9E324      ------------------------------------------------------------
A0A432SAI6      ------------------------------------------------------------
A0A4Q3LBH4      ------------------------------------------------------------
A0A4Q3LWP3      ------------------------------------------------------------
A0A2N6VGL1      ------------------------------------------------------------
A0A3M3H5V6      ------------------------------------------------------------
A0A524M660      ------------------------------------------------------------
A0A0C1TRU6      ------------------------------------------------------------
A0A2Z5SSF4      ------------------------------------------------------------
A0A2T4ZJZ6      ------------------------------------------------------------
A0A327LYE6      ------------------------------------------------------------
A0A5A9ZTV3      ------------------------------------------------------------
A0A4Q4CIB1      ------------------------------------------------------------
A0A522ACJ9      ------------------------------------------------------------
A0A1T2KYM8      ------------------------------------------------------------
A0A3N5Z7F8      ------------------------------------------------------------
A0A2G9ZR82      ------------------------------------------------------------
A0A239HD34      ------------------------------------------------------------
A0A4U9I390      ------------------------------------------------------------
A0A534V9L7      ------------------------------------------------------------
A0A0P7ZZE4      ------------------------------------------------------------
A0A369R0Q9      ------------------------------------------------------------
A0A534XP85      ------------------------------------------------------------
A0A2X3M011      ------------------------------------------------------------
I2WC85          ------------------------------------------------------------
A0A400JH80      ------------------------------------------------------------
A0A2H9EHM4      ------------------------------------------------------------
A0A380B3D7      ------------------------------------------------------------
F5NSX0          ------------------------------------------------------------
A0A479JNB1      ------------------------------------------------------------
A0A5C9AF52      ------------------------------------------------------------
A0A6D0EYC7      ------------------------------------------------------------
D8EEU7          ------------------------------------------------------------
A0A0P1H2H0      ------------------------------------------------------------
A0A258WKV0      ------------------------------------------------------------
A0A377N8F8      ------------------------------------------------------------
A5G4N9          ------------------------------------------------------------
A0A3C2DSE7      ------------------------------------------------------------
A0A2X1JBG5      ------------------------------------------------------------
A0A0B8PTA8      ------------------------------------------------------------
A0A0B8QF75      ------------------------------------------------------------
A0A4Q3LR91      ------------------------------------------------------------
A0A6C9IKN8      ------------------------------------------------------------
A0A4V1TR68      ------------------------------------------------------------
A0A444IY46      ------------------------------------------------------------
A0A6I7N627      ------------------------------------------------------------
A0A660AID0      ------------------------------------------------------------
A0A3E0WKI3      ------------------------------------------------------------
A0A1H3I2J1      ------------------------------------------------------------
A0A1V5DJV0      ------------------------------------------------------------
A0A520IUC4      ------------------------------------------------------------
A0A521LJG5      ------------------------------------------------------------
A0A531IBQ7      ------------------------------------------------------------
A0A377LY04      ------------------------------------------------------------
A0A5C9ABR5      ------------------------------------------------------------
A0A5J9WU72      ------------------------------------------------------------
A0A2X3K9R3      ------------------------------------------------------------
A0A5W0ZR28      ------------------------------------------------------------
A0A622KDG2      ------------------------------------------------------------
A0A3T9EHW9      ------------------------------------------------------------
A0A484X141      ------------------------------------------------------------
A0A5N9VWI6      ------------------------------------------------------------
A0A6D0EJQ0      ------------------------------------------------------------
A0A376LLF8      ------------------------------------------------------------
A0A444R390      ------------------------------------------------------------
A0A6C9J192      ------------------------------------------------------------
A0A1V4WHZ7      ------------------------------------------------------------
A0A1E5AJN5      LTEKPNFYIQPVRFSLVGILKRAITGRAEQPFIPRTYDERERAAINRVLAGMQITTLRRS
A0A2N3D2J1      ------------------------------------------------------------
A0A2N2GVE1      IEVIKSRNIALLAARRLENVDLHQLLGQPQFAHREPTEEELQRAAGVMRGMIQVIPVPES
A0A2N2INV3      IEVIKSRNIALLAARRLENAELHQLLGQPQFAHREPTEEELQRAAGVMRGMIQVIPVPDS
A0A1Y5DXG5      ------GKVGEEVTNGTFTLTIKELVARAGTEFFVTRKDRLNTILDLQSSIGASEKGKDS
A0A0B8P2H5      ---------MARSENGEFLLFVSQLVGKQGQEYGLGKRSKLDAIQWLNGSLSVSERGKQS
A0A483QWI8      -------------------------------------------MKDLQESFTVTDQGKDT
A0A483UXD3      ---------------------------------------RLKAIKDLQESFTVSDQGKDT
A0A0A8J8L3      ------------------------------------------------------------
A0A660DJ38      ------------------------------------------------------------
A0A380AQW6      ------------------------------------------------------------
A0A2G2GD62      IEYKGIHKFGEDVISKYFQLKVIKVRELNSLEYFFSYIDNRNMVGYIQNNLSTEQDAKYS
A0A524P331      GSIAAQGKTGQRVRTQDLTLLLDEIQGKKGDLFRLQQQSFIGTVQGVMGSTNVSQVGKYT
A0A4V1SSM5      ------------------------------------------------------------
A0A4Q3K8G7      ------------------------------------------------------------
A0A1M7HC79      ------------------------------------------------------------
A0A1D3JZN6      ------------------------------------------------------------
A0A1V6ESG1      ------------------------------------------------------------
A0A1H7YHK3      ------------------------------------------------------------
A0A534SH66      ------------------------------------------------------------
A0A3M0ZZ99      ------------------------------------------------------------
A0A238LBD3      ------------------------------------------------------------
A0A328C2K5      TQKEVLGSKWFARRVVEREGLLDAPGFLPASAQQLDEDERMKRAVNTLQSVAVYSLQRDS
A0A5C6X8M3      TQKEVLGSKWFAQRVIEREGLLDAPGFLPPSVQQLDEDERMKRAVNILQRVAVYSLQRDS
A0A3D8MRR7      TQKEVLGSKWFAQRVIEREGLLDAPGFLSPSVQQLDEDERMKRAVNTLQRVAVYSLQRDS
A0A5C6UBJ7      TQKEVLGSKWFAQRVIEREGLLDAPGFLSPSVQQLDEDERMKRAVNTLQRVAVYSLQRDS
A0A5C6XGM3      TQKEVLGSKWFAQRVIEREGLLDAPGFLPPSVQQLDEDERMKRAVNTLQRVAVYSLQRDS
A0A537NZJ1      ------------------------------------------------------------
A0A0P1FRV5      ------------------------------------------------------------
A0A4Q4CVW6      ------------------------------------------------------------
A0A090R136      ------------------------------------------------------------
A0A661JU93      ------------------------------------------------------------
A0A2E2T3V8      VLRGQGVSFSQEANVQGNFLRRIFGNDQGFIASDAKVSDEIDKDVEALRRRIDVERIGNS
A0A367UAB4      ILRGQGIIFSQEANARGNFLRRIFGNDQGFIASDAKVSDEIDKDVEALRRRIDVERIGNS
A0A0P1FWI8      ------------------------------------------------------------
A0A377V641      ------------------------------------------------------------
A0A1F2YJ88      ILTGKTNQANTLRTADGLWNISIYTQDQLNDVYLIQKQSLPSAVNNILANYSVAEKGKLT
A0A0J7XGZ1      PEFGGDSKSPSAKLTPPLATGTDGHGSTGDREQIATINPAERQAAGRLLTHSYVRRVGVT
I4CBA7          LQGALEFFAEFSIFYETQVQSLKEMAQSGSLSTPDRRGLEDAAKALPRWSDIRITENRGS
A3VE95          EVSVMTSNILIERLILEVGIERLETLYWGEVRGDRDEASRLADLTWAIRQDLNVSRESES
A0A1G0NL95      -------------------------------------------------MTTVREQGKQS
A0A024KA69      -----------------------MALAVAAGLALASAALLVMPVSYSATALLYFDPSPRG
A0A0L1KFN4      AELGLVDRPEFFEMFRFDGADDPAFEIVNGRYPAEGRAQRQREAAKILLDQVSIEPTRLS
A0A3P5DSS6      ------------------------------------------------------------
A0A483YEL5      ------------------------------------------------------------
A0A658GUJ0      ENIDFDGEIGRLIDKNGIRIQVDSINAEPGTRFLLTYTSRINAINYLRDSLLIADQGKDT
A0A358L616      ------------------------------------------------------------
A0A1M7BLL7      ------------------------------------------------------MPWRAT
A0A0H4KZM1      ------------------------------------------------------------
A0A3D5UYX7      ------------------------------------------------------------
A0A2N1WQN5      ------------------------------------------------------------
A0A352G2C2      -------------------------------------------------------RGKQS
A0A3C0PZN1      ------------------------------------------------------------
A0A524QFS4      RYLSSSADQLNTQIMKLQGAGLRNLVLNKAKGTLALHGVTGDDAKQFLKGGVDINLVRRT
A0A1V1UJT2      ------------------------------------------------------------
A0A0L6CVX1      ------------------------------------------------------------
A0A1V0RR48      ------------------------------------------------------------
A0A0A0HJJ4      ------------------------------------------------------------
A0A5E7YA28      ------------------------------------------------------------
A0A520JSW4      FIGTQLGLLGSRALAERVAQNLNLAADTAIVGPGGDRSLNTASAAGFVQGGTQVRLQPLS
A0A4Q3LTF3      ------------------------------------------------------------
A0A537UTP9      LWPKLGLFSAIKGSVLGLVDSVLRLFQSSSTSTSDPEFALTRAAVERFQSQLIITRAGLT
A0A1D2RNR5      ------------------------------------------------------------
A0A4V1TQ46      ------------------------------------------------------------
A0A3A0FZC0      EIKSALFDTANQGFFGQLFGGDSESKQESDKLDQLAGYKSTVRQIKVYLSTIEIKPVRRT
A0A1N7JVZ7      ------------MTAERVFRRKNRPHARSEPEAQAQPAASRDDSADAHDSPSPKVFRRQK
A0A091C4A8      ------MTAPAPWKLLLGLAGETDDEELDAAHLAATESVRQTLRINSFLASLSIEPVRNS
A0A4R3H6P6      LAERVARDLGVVDDPAFFKLFGRRDLFQDGKADPTARAKRNEVAGKILLLHVGVAPVRGS
A0A3S1NQ09      ----------YVRPSSSMPGGADFSKLDPAARDALIATSRRDYAILKLQNEIRAERVGRS
A0A443GJ52      -------VIRYFRPNPAV-GTTDVAQLDPATRDAMIASSRRDYAILKLQNEVQAERIGRS
A0A2W6S588      SQLQIATSLPVAIRALQDPEVAKNPTILARAKAFDPSGKSSDAMAAALLSGVSAARVGTT
A0A483E0N4      ----INGYVGQLYENDDFSIKVDKMDAKPGSEYNIYYESRLKAISDLQNTLSVADQGKDT
A0A2J4YQQ6      --------------------------------FTIGYLSRLKAITDLQENLIVADQGKDT
A0A483THX4      --------------------------ALPGTKFKISYLPRLKAITDLQTNLVVADLGKDT
A0A534MVS2      ------------------------------------------------------------
A0A444I5K6      DNPFMGPKSSLFSVSTLKSFMNFRSWFADDAAVAPDPEMRRRGAAETVAGNIDVERVGRS
A0A154VE85      FAFGAWLRDHVLAPLGVAPSSGSGRASQGSAVIAPPPAVLAERAVDAYLDRLSVSPADNA
A0A3S1MCW7      ------------------------------------------------------------
A0A434IGN6      ------------------------------------------------------------
A0A528AX40      LSEKPDFLFPTSGFSLSNVFYRAFGISKSPSIEEKTPEEREAIAIGRILKDLTVNLVTNT
A0A528MV95      LSEKPDFLFPTPNFSLSNIFYRAFGISKSPSIEEKTPEQREAIAIGRVLNDLTVNLVSNT
A0A3C1S9Y1      SNLREWFKEKRQSWKDQMDSLLSSDKNKGNTVPKSDDPSQDSPLVSAFITRIKVSPIRNS
A0A353EH49      YYDQQYVLAREQEFSPYLKINIEYLKARVGTEFTLEKQHVYKSAEVLNGKLQVSESGKQS
A0A1Y1Q9C1      DLKTRLFERPAPFSVLSSFKVIIKGLIAPLLPAKIETVTEAADYTDLFSQHLYVEPIEKT
A0A3M7LJH0      -----------------------------------------------------------T
A0A316KRG4      ------------------------------------------------------------
A0A1E4JHX8      -----------------------------MRNTPAGREKRSREAARILLENIDIVPDRLS
M2U8P2          VQALRAPEIATAVARTVGPERILRAYMDPDQPIPTERQAATRRAAAFIRGGLSARREGTS
A0A1H7KZF8      LLMARSVPVAEAVMRALKLSADDTFLRQMHADPAPTPGERRQAVLDLLDRKRSAAIIPNS
A0A0J5Q9T7      ------------------------------------------------------------
A0A257NG76      --------------------------------------------------------GKKT
A0A1T4TW59      LVGKPSARDQLLTLLRQIDGLDGFLPKPIAPSTDPNSEVAKRAVLKKFKSHFAIEPIRYT
A0A1I5YYQ0      ------------------------------------------------------------
A0A5P9FE62      ------------------------------------------------------------
A0A1Q3MB35      --------------------------------MASAAQQRLELATDILLDNVSINPVRGS
A0A259LUN7      ------------------------------------------------------------
A0A2D7AVL1      ------------------------------------------------------------
A0A3B9KZE9      ------------------------------------------------------------
A0A2U0NMP8      ENIDFDGEIGRLIDKNGIRIQVDSINAEPGTRFLLTYTSRINAINYLRDSLLIADQGKDT
A0A4U9HNE9      ---------------------MTTLSAEPGATFSVVKLARQQAIDDLRRTLSIALAGKES
A0A2G2CXY6      GMLLIEGNTLEQIDRDGFKIQVQALVARPGTEFLVTKHRMLNSILAYQEELGASEKGKDS
A0A3M1D4H3      ------------------------------------------------------------
A0A5C8BYM7      ------------------------------------------------------------
A0A1J5ICP0      SGALAGKGELNKPFLGPNFSILVEGDHARKGRKMKFSVLTPASAVEGLQGSLAVSPIKNT
A0A0M3GBT1      LNLRPEFNPALREVTFFESIRTNLRGLFDPRKPAEPVRDGIDAVIPEFYRALGVWHEDKS
B3Q577          LNLRPEFNPALREVTFFESIRTNLRGLFDPRKPAEPVRDGIDAVIPEFYRALGVWHEDKS
A0A379B9V4      TEPLLTGKVGEKYDTDLIQFSLSQINAKPKQRFLINKLPELTVISALQEQLSVHEIGKQT
A0A0Q6TS97      ------------------------------------------MAGKILLQHVGVAPVRGS
A0A0Q6UYB4      ------------------------------------------MAGKILLQHVGVAPVRGS
A0A484XS37      GTEIIKGKVGALESGHGISLLVSEISAEPGTVFEIAKLPRLVAINNLLDALTVEDKGKDT
W7Q5J0          GHIGQLHTFLDGEMELLIDEFNAAPGAQFRLAKRNRNGDIRSLGGRLQIAEVGGGRGSST
A0A654AKT6      ---MYSKIVSVLFYMFFTCVIFNPQINGATIYFYLFIPFLDPKFVRFLTATVRHWSVPLV
A0A0G9MZA5      ---------------------------------MPENADIEPALAGTLLNNVSITPIINS
H0T8B0          IATVVSRLRLDQNPEFECPDRGLFAIFSPSKTSLPPSEARIRCAVSTVASNLSIVRVGRS
A0A5C7N981      QRVIEQLSLVAPARTASKSTGWLDIFKSADQKEDNAPAPAATGLLSGLPGALSVMPVRNS
A0A534TV22      ------------------------------------------------------------
A0A351CXR4      NLPAPATPFADLTNDISQMLLGRKLIDTPQNEQPKLAFANTRQASAFIQAALTVEVESHD
A0A2N6GLF5      KHPEFQPEENKLISFDWKTWLKSYLPQQSGGAELDEAETFYDSVVEYYFERLKVTPVKNS
A0A1W9LJP0      ----MSKNWFAEPLRFWKEKLLSLRNTGKPEDKDKKDEDADAWLVNALIGRIKAEPVRNS
A0A0W1ICB0      RLRLARNPEFFAAHGETPEGEGLLSGLRSGPVSAADLRQRERQAVELLLDNVGISPLRGS
A0A2E0UL88      ------------------------------------------------------------
A0A233IKJ2      ------------------------------------------------------------
A0A2T1JE00      ------------------------------------------------------------
A0A0T2QIS1      ------------------------MDDSSAASSSEDRAGREKLAVDLLLSHVTISPITRS
A0A376KYN0      ------------------------------------------------------------
A0A2X1JB05      ----------------------------------------------MQETFTVSERSKES
A0A376RML0      ----------------------------------------------MQETFTVSERSKES
A0A377E5P7      ------------------------------------------------------------
A0A0P7Y1D0      NSRLREPSGLGAVAGAVAGFLSALLPSQVADSQSGEAEQELEAVTSAVLDRLSARRSGMT
A0A2M7JRZ7      -----------------MTGLFTSSKKNAPSEKEISENKKDTALIDQFLSKLKVEPIRNS
A0A167IR75      --------------------------MTNERYSAEGRAERQREAADILLTNVTINPTRLS
A0A3B8T2U6      ------------KKLVKTAIPLFPDPQEVVLTDTEKQQNRLDFAIAKLQANIDIKPVFHT
A0A365PWR2      ----------------------------------MTKEPRLAALLRLQNQLQIDEVEEGS
A0A2E9H5Z8      ------------------------------------------------------------
A0A2E2BR79      ------------------------------------------LSSRLSVSETGSGFVGNA
A0A0Q4Q524      --------------------------MVNGRYPAAGRPIRQRTAGQILRDHLDVAPTRLS
A0A0Q4CFJ9      --------------------------MVNGRYPASGRATRQRVAGEILIDHLAIVPTRLS
A0A0Q4FE58      --------------------------MVNGRYPASGREIRQRVAGETLLKNLNIAPTRLS
A0A0Q4JWC8      --------------------------MVNGRYPASGREIRQRVAGETLLKNLNIAPTRLS
A0A0Q4KFL8      --------------------------MVNGRYPASGREIRQRVAGETLLKNLNIAPTRLS
A0A522R8R0      ------------------------------------------------------------
A0A2U9NDY5      ------------MEGQGGKGQSAERQAHPGTEGGRRRKRPQTTAREDQDRRKGGEAGKDA
A0A0Q4IGG1      --------------------------MVNGQYKAAGRAERQQLAGKILLDNISINPTRLS
X7F6S5          ------------------------------------------------------------
A0A1G8NKI0      ------------------------------------------------------------
A0A355QPE4      ------------------------------------------------------------
A0A357RN98      ------------------------------------------------------------
A0A6B2MSQ7      ------------------------------------------------------------
A0A6B2P8H8      ------------------------------------------------------------
A0A1I6U4V1      ------------------------------------------------------------
A0A1G7CFZ2      ------------------------------------------------------------
A0A1P8USW9      ------------------------------------------------------------
A0A534RUJ5      --------------------------------------------------------VQRT
A0A3M1CJM3      ------------------------------------------------------------
A0A2R7SVD4      -------------AQDGVEVLVAQLAANPGTRFEVVRNPRIVTIQGYQDALDISEQGKES
A0A3C0PWB6      -------------------------------------------ALDYQDRLKVGEAGKDS
V4Q8B7          -------------------MQIAQLDARPGTEFALVRNRPQTTALDYQNRLKVGEAGKDS
A0A0Q8XKK5      -------------------------------MTAVERAKREKAAVQILQSNIAISPIRNS
A0A2E0Q2W0      ------------------------------------------------------------
A0A660NIR6      IRVIKALGLENNPYFNPELTPEGKEQAAEGNVKELSQEALEEQVLMRYKAGLDISPIKNS
A0A142W0R3      SLAARTVRAGNLLNDKDFLAQYDLTGGEEGTPNSAQRARMAERAEKILLDAVSIEPVRQS
A0A0S4XR18      GEYKFGQAIKTPYFTFVIKATKDFGLNDTSYKIIHQSNKNSFIDGFIRPNLNVAQISKQA
A0A2E0GW64      ------------------------------------MLSGQLKVSDQGDQTQKNSYLRET
A0A1A7QJ97      --------------------------MNNGRFPAQGRAQRQRVAGEVLLDHVSIEPTRLS
A0A6I4IKZ3      ILTVPLNQANHVAGPHGLWKVAIFTKDQFDATYNIKSQSIPAAVNALSANYSVAERGKLT
A0A661LW70      ---------------------------------------------------------TDF
W7Q8F9          GHIGQLHTFLDGEMELLIDEFNAAPGAQFRLAKRNRNGDIRSLGGRLQITEAAGGRGSPT
A0A524PXH8      ------------------------------------------------------------
A0A4Q3P0E4      ITGKVGTPLKTNTPNGPIDLLVSQLDGKPGAEFVVNRFAKLATIEGLQSRLVLTEKGKQS
A0A3M2BE89      GEMLLEGQIGRVAEDHGISLYVSELIARPGTRFDLKKTGWLTAVKTLQKTLKVSEKGKKT
A0A4Q4A6K6      ------------------------------------------------------------
A0A257G674      LKSRTLLERVAQKLRLIGNPRFYDAMGMRQPAGDLSRGELEDLTLQALEDARDVSMPRNS
A0A661M5M6      -----------------------------------------------------------T
A0A1I1UM01      ------------MTNRPKFRRR--------------------------------------
Q44573          VMAQLPPPAAPPHVGLRDRLCHMGLGFLCHASTPVDPQVQREHEEDAFLNNLTVTPEPRT
A2W025          GTRLLAGRVGESAQGGGVTLLVQKLVARPGTQFTVVRYNDLDAISGFQAGIQVSEQGKQT
A0A534Z362      SRRRGLLSLSGTMLRLLRPRGLETAPAGPSEDGSAGRGSVDPALIDRYMRYLSVQEIRGT
V4J283          ------------------------------------KISLVAAAGALSGAFTAVEYPNYS
A0A536T443      -----------------------------------------------------MKRERLT
A0A0Q4UFQ5      -----------------------MFESGRPIQTAAARASRIKAAGNLILARMDVEPERMS
A0A527W7E6      --------------------IPGIQNVDAATREAMIKTATHDYAVLMLQTGLLADRVSRS
A0A432EMV7      ----------------------------------------------------------KS
A0A087LTV7      -----------------------------------------------------MHEDAWD
A0A534WLI3      ----------------------------------------------------SVETVPGT
A0A318KWA2      ARVGELARFAEGDIELRVAALEAPAEAEFTLVKHRRASAIRDLGDRLSVAEVGVGRGTST
A0A522MT86      ------------------------------------------------------------
A0A4Q3I221      ------------------------------------------------------------
A0A534SAL6      SGRKGLLNLTGNLVNLLRPRGWDGAPAAGSGAERAVASEVDPMLLDRYMRYLSVQDVRGT
A0A534ZDB4      AERKGLLSLSGNLVNLLRPRGWDGAPAASGGAEHAMPGEVEPVLLDRYMRYLSVQDVRGT
A0A534X3M7      PRRHGLLSLGESMPRPVRPRGFETAPARSSAPEAATRTSIDPALIDRYMRYLAVEEVRGS
A0A534SPC6      ------------------------------------------------MRYLSVQEIRGT
A0A535AD60      PRRRGRLSLSGTTLRLLRPRGLETAPAGPSEDGSAGRGAVDPALIDRYMRYLSVQEIRGT
A0A4Q3SY08      ---------------------------------------------------------SYT
A0A4Q3LG23      ------------SVAGRLERQRVAGKLLRDNLSISPT----------------RLSRLVD
A0A522EX52      -----------------------------------------------------ININDLD
A0A1H3KC95      ------------MNAGPRFRRR--------------------------------------
A0A5P8Z4P3      RDVQMSGSGETSGAEKPKVFRRHKRAETKRNAEAPDKSPAQA-----------PRIADRP
A0A2E9HXF7      -------------MDSPKFRRK------RTSATAHP-----------------PAADPAS
A0A0B3RZC9      ----------MNMMDSPKFRRK------RTSATGSAR----------------PVSEPPD
A0A6F8QET1      RGPKGCGARGMNMMDSPKFRRK------RTSATGSAR----------------PVSEPPD
A0A520HUH4      -----------------------------------------------------PVAIAHR
A0A2K8U7M6      MTPLGNSRLVSVAFDSPN-----------------------------------PAEAAAV
A0A5B9DKL8      MQEDAWGFDSFEGLIRRQWRMIALIWVGIVAAAALALTLMPASFTATTWLFSDPTVRTIL
A0A238KJM1      ------------MMDDRKFRRK--------------------------------------
A0A3A0FJZ4      ----------MSDAPAPGFDLRDAVLCLRRRAGWLALALALGVAGGVAAHRLLPPRYVGE
W4HJV8          ----------MNMANRPKFRRR------HRPAATGWDDGARVPA---------RTTGPET
A0A0P1GDI0      ------------MTERRKFRRK------NRSADAVEDEMPPI-----------APLESRE
A0A2R8ATV5      ------------MSERRKFTRK------KTQGAASSAALAPESRPVVSEEERREQIVAEK
A0A1U7D3R6      ------------------------------------------------------------
A0A2D4UVV2      ------------MVERRKFQRK------KRPTAETDAP---------------EPAEVTS
A0A0W7WHP4      ------------MTDQRKFRRK------GKRVR--------------------DAAPTET
A0A238J8F6      ----------MNEMDNRKFRRK------YKSVDATAEQAAEEVLRQEELRAAAAEAKAAA
A0A238JQI6      ----------MNMMDGPKFRRK------HRSAAGKPRPAPESV----------PETLPET
A0A222E077      ----------MNMMDSPKFRRK------RTSATAHP-----------------PAAAPAS
A0A239E3Y2      ----------MNMMDSPKFKRK------RTSATAPH-----------------PAADAAS
A0A1V6FYJ1      ------------------------------------------------------------
A0A445MZQ4      ------------------------------------------------------------
A0A0M9E0E3      ------------------------------------------------------------
A0A0Q6QV61      ------------------------------------------------------------
A0A2Z3IKG4      ------------------------------------------------------------
A0A2W4RFS2      ------------------------------------------------------------
A0A1Y6DC43      ------------------------------------------------------------
A0A2S6HE06      ------------------------------------------------------------
G3J0M3          ------------------------------------------------------------
V5C6R5          ------------------------------------------------------------
A0A354EF47      ------------------------------------------------------------
A0A2G6MSP7      ------------------------------------------------------------
A0A4U8YMP3      ------------------------------------------------------------
A0A1Q8QQ99      ------------------------------------------------------------
A0A3D5ZY44      ------------------------------------------------------------
A0A646J2A6      ------------------------------------------------------------
A0A1G5C236      ------------------------------------------------------------
A0A432HIS7      ------------------------------------------------------------
A0A1I3XJ27      ------------------------------------------------------------
A0A1I7DCG1      ------------------------------------------------------------
A0A3A3H6D9      ------------------------------------------------------------
A0A562CGU2      ------------------------------------------------------------
A0A0Q6VA36      ------------------------------------------------------------
A0A1B2EQN1      ------------------------------------------------------------
A0A1E7HSL6      ------------------------------------------------------------
A0A4Q3ZDI7      ------------------------------------------------------------
A0A537PRC6      ------------------------------------------------------------
A0A2M7JX59      ------------------------------------------------------------
A0A3A4XVN3      ------------------------------------------------------------
A0A1E7JEV6      ------------------------------------------------------------
A0A2N2KDY5      ------------------------------------------------------------
A0A3N5YUD9      ------------------------------------------------------------
A0A0W1DLQ3      ------------------------------------------------------------
A0A246JVD8      ------------------------------------------------------------
A0A2N3BB54      ------------------------------------------------------------
A0A1H6G7A3      ------------------------------------------------------------
A0A0A7PGL6      ------------------------------------------------------------
A0A4Q2Z4L0      ------------------------------------------------------------
A0A5C4N0H6      ------------------------------------------------------------
A0A4R1HDF2      ------------------------------------------------------------
A0A1E7HFN0      ------------------------------------------------------------
A0A1M5GH86      ------------------------------------------------------------
A0A1W1XQZ5      ------------------------------------------------------------
A0A3D6C3I2      ------------------------------------------------------------
S0G1D4          ------------------------------------------------------------
A0A661T246      ------------------------------------------------------------
A0A2G6CSG7      ------------------------------------------------------------
A0A2G6NB59      ------------------------------------------------------------
A0A5K8A7T9      ------------------------------------------------------------
A0A1W9U045      ------------------------------------------------------------
A0A1F9L9G4      ------------------------------------------------------------
A0A328FD76      ------------------------------------------------------------
A0A348UX90      ------------------------------------------------------------
A0A357Z0N5      ------------------------------------------------------------
A0A0F2R2U0      ------------------------------------------------------------
A0A5K7ZK00      ------------------------------------------------------------
A0A5K7YCX8      ------------------------------------------------------------
A0A5K7Z388      ------------------------------------------------------------
A0A352B502      ------------------------------------------------------------
A0A2K8WHP8      ------------------------------------------------------------
A0A410V446      ------------------------------------------------------------
A0A0R3KGJ5      ------------------------------------------------------------
A0A0R3N604      ------------------------------------------------------------
A0A1B1UCM8      ------------------------------------------------------------
A0A1N6JQ20      ------------------------------------------------------------
A0A1M5TI07      ------------------------------------------------------------
A3X191          ------------------------------------------------------------
A0A1H4RKV5      ------------------------------------------------------------
A0A160UA87      ------------------------------------------------------------
A0A1Q5SFV5      ------------------------------------------------------------
A0A1J5N774      ------------------------------------------------------------
A0A2C8F781      ------------------------------------------------------------
A0A2E3R6G0      ------------------------------------------------------------
A0A1F8XMK2      ------------------------------------------------------------
A0A3M8EMP2      ------------------------------------------------------------
A0A2J6J6K6      ------------------------------------------------------------
A0A661PSB9      ------------------------------------------------------------
A0A661QBT6      ------------------------------------------------------------
A0A1G6EKK9      ------------------------------------------------------------
A0A6I2SLK2      ------------------------------------------------------------
A0A0A8WSG4      ------------------------------------------------------------
S7TK97          ------------------------------------------------------------
S7UE93          ------------------------------------------------------------
A0A3D5BR56      ------------------------------------------------------------
A0A2N2IB15      ------------------------------------------------------------
A0A1I3PSR2      ------------------------------------------------------------
A0A1I4GEK4      ------------------------------------------------------------
A0A2T5R3J5      ------------------------------------------------------------
A0A1W7QPT7      ------------------------------------------------------------
A0A0M4D373      ------------------------------------------------------------
A0A1L3GKM9      ------------------------------------------------------------
A0A430DNP0      ------------------------------------------------------------
A0A3A0FQ32      ------------------------------------------------------------
A0A1E4UZA0      ------------------------------------------------------------
A0A1H9KL56      ------------------------------------------------------------
A0A1A9KEF8      ------------------------------------------------------------
A0A5E6PKN5      ------------------------------------------------------------
A0A0N9W1V6      ------------------------------------------------------------
A0A423GQ41      ------------------------------------------------------------
A0A423H7J2      ------------------------------------------------------------
A0A502HNM8      ------------------------------------------------------------
A0A4Q7H223      ------------------------------------------------------------
A0A1H4N2K9      ------------------------------------------------------------
A0A2K4KWF7      ------------------------------------------------------------
A0A3E0WXH2      ------------------------------------------------------------
A0A2N2TRC8      ------------------------------------------------------------
A0A1V4CIZ7      ------------------------------------------------------------
A0A1M3BXA5      ------------------------------------------------------------
A0A1Y2R3U6      ------------------------------------------------------------
A0A167HVD6      ------------------------------------------------------------
A0A1V3SCT6      ------------------------------------------------------------
L0H287          ------------------------------------------------------------
A0A495VG93      ------------------------------------------------------------
A0A4R3MYM4      ------------------------------------------------------------
G2E3C0          ------------------------------------------------------------
A0A4U8YLL7      ------------------------------------------------------------
A0A3N5RNY4      ------------------------------------------------------------
A0A1V4M8I1      ------------------------------------------------------------
A0A4Z0M4C7      ------------------------------------------------------------
A0A5Q2QDL1      ------------------------------------------------------------
A0A1I0R9R6      ------------------------------------------------------------
A0A443K010      ------------------------------------------------------------
A0A6I7NYG5      ------------------------------------------------------------
A0A238IZI1      ------------------------------------------------------------
A0A316GHM6      ------------------------------------------------------------
A0A520ZTR8      ------------------------------------------------------------
A0A212AR83      ------------------------------------------------------------
A0A2E2P4I0      ------------------------------------------------------------
A0A2U2CM86      ------------------------------------------------------------
A0A1X7ACC1      ------------------------------------------------------------
A0A2N3BVE7      ------------------------------------------------------------
A0A2S5JE21      ------------------------------------------------------------
A0A2R8BKZ2      ------------------------------------------------------------
A0A2S8S361      ------------------------------------------------------------
A0A238KUF6      ------------------------------------------------------------
A0A095CTW3      ------------------------------------------------------------
A0A2E3UGD6      ------------------------------------------------------------
A0A2T0RFH0      ------------------------------------------------------------
A0A285D390      ------------------------------------------------------------
A0A497VHN4      ------------------------------------------------------------
A0A318CT66      ------------------------------------------------------------
A0A3N5P205      ------------------------------------------------------------
A0A2N6BEI9      ------------------------------------------------------------
A0A0D5N3E9      ------------------------------------------------------------
A0A2N2G716      ------------------------------------------------------------
W9VVY5          ------------------------------------------------------------
A0A1E2URD3      ------------------------------------------------------------
A0A2T6MY81      ------------------------------------------------------------
A0A2T6NBQ8      ------------------------------------------------------------
A0A421K431      ------------------------------------------------------------
A0A2G2I5M1      ------------------------------------------------------------
A0A2G2M6F0      ------------------------------------------------------------
A0A1W9J9F8      ------------------------------------------------------------
A0A2S5LFJ9      ------------------------------------------------------------
A0A2D8R8F8      ------------------------------------------------------------
A0A6I4JXQ8      ------------------------------------------------------------
A0A010SNS0      ------------------------------------------------------------
A0A0C2I782      ------------------------------------------------------------
A0A2N8BYF5      ------------------------------------------------------------
A0A558FKX2      ------------------------------------------------------------
A0A1H1DBA0      ------------------------------------------------------------
J2TAD5          ------------------------------------------------------------
J3H699          ------------------------------------------------------------
A0A1H5J974      ------------------------------------------------------------
A0A0K1QRZ4      ------------------------------------------------------------
A0A560RJW9      ------------------------------------------------------------
A0A5E6TID7      ------------------------------------------------------------
A0A5E7CRU7      ------------------------------------------------------------
A0A5E7C564      ------------------------------------------------------------
A0A2W7MAV4      ------------------------------------------------------------
A0A4R3WQH5      ------------------------------------------------------------
W6VFG3          ------------------------------------------------------------
A0A1P8ENT1      ------------------------------------------------------------
A0A2N7XRV4      ------------------------------------------------------------
A0A0Q6QPG8      ------------------------------------------------------------
A0A0F4SWA7      ------------------------------------------------------------
A0A423J219      ------------------------------------------------------------
A0A4P6G9U8      ------------------------------------------------------------
A0A4Y8JE06      ------------------------------------------------------------
A0A502I1X9      ------------------------------------------------------------
A0A502J776      ------------------------------------------------------------
A0A5B0EZF6      ------------------------------------------------------------
A0A059L434      ------------------------------------------------------------
A0A0F4UWN2      ------------------------------------------------------------
A0A5E7WEF5      ------------------------------------------------------------
A0A1G0KSD0      ------------------------------------------------------------
A0A4P6WX84      ------------------------------------------------------------
A0A1D2S760      ------------------------------------------------------------
A0A5B8RW94      ------------------------------------------------------------
A0A258TN88      ------------------------------------------------------------
A0A1F9EUS2      ------------------------------------------------------------
A0A6H9HII8      ------------------------------------------------------------
A0A3N9VAW3      ------------------------------------------------------------
A0A1X0YE57      ------------------------------------------------------------
A0A2K2H9Q8      ------------------------------------------------------------
A0A6I1KNW9      ------------------------------------------------------------
A0A1H4B8T3      ------------------------------------------------------------
A0A1E7IQC3      ------------------------------------------------------------
A0A1M6KEN5      ------------------------------------------------------------
A0A353QLL3      ------------------------------------------------------------
A0A399I453      ------------------------------------------------------------
A0A651FBV9      ------------------------------------------------------------
A0A5C1MDH8      ------------------------------------------------------------
A0A5A9XE04      ------------------------------------------------------------
A0A643G9R1      ------------------------------------------------------------
A0A1G0M8Q7      ------------------------------------------------------------
A0A353MI14      ------------------------------------------------------------
A0A4S1CAW7      ------------------------------------------------------------
A0A562VHD2      ------------------------------------------------------------
A0A6I6JNB5      ------------------------------------------------------------
A0A1G0LDK7      ------------------------------------------------------------
A0A6F9WVL7      ------------------------------------------------------------
A0A2M7WWF7      ------------------------------------------------------------
A0A351Z9A2      ------------------------------------------------------------
A0A351B422      ------------------------------------------------------------
F2NEE9          ------------------------------------------------------------
B7RS54          ------------------------------------------------------------
A0A3N5FRH4      ------------------------------------------------------------
A0A1V4Y2C3      ------------------------------------------------------------
A0A2N2KTJ4      ------------------------------------------------------------
A0A2N2LQX0      ------------------------------------------------------------
A0A520CSP5      ------------------------------------------------------------
A0A1I6ENM4      ------------------------------------------------------------
A8LNM8          ------------------------------------------------------------
A0A0T5NSU3      ------------------------------------------------------------
A0A5P9I718      ------------------------------------------------------------
A0A2M8J3R9      ------------------------------------------------------------
A0A1I6X762      ------------------------------------------------------------
A0A0P1EFX8      ------------------------------------------------------------
A0A2G5KB39      ------------------------------------------------------------
A0A2N3CNV1      ------------------------------------------------------------
A0A257F1F4      ------------------------------------------------------------
A0A1G9FY29      ------------------------------------------------------------
A0A4Q3ZBK4      ------------------------------------------------------------
A0A2D5J8T8      ------------------------------------------------------------
A0A2E3P9W6      ------------------------------------------------------------
A0A2G2B1P9      ------------------------------------------------------------
A0A258GCD5      ------------------------------------------------------------
A0A2D9YR88      ------------------------------------------------------------
A0A443INY4      ------------------------------------------------------------
A0A372IH36      ------------------------------------------------------------
A0A540VW45      ------------------------------------------------------------
A0A1H9C241      ------------------------------------------------------------
A0A2E3FCR1      ------------------------------------------------------------
A0A4S3MG69      ------------------------------------------------------------
A0A3E0H727      ------------------------------------------------------------
A0A1G8QZS5      ------------------------------------------------------------
A0A1V4QMH7      ------------------------------------------------------------
A0A496XZQ4      ------------------------------------------------------------
A0A1F9BJF7      ------------------------------------------------------------
F2NDF5          ------------------------------------------------------------
A0A1I3TTC3      ------------------------------------------------------------
A0A1H3IZW6      ------------------------------------------------------------
A0A0M6YG59      ------------------------------------------------------------
A0A1H7G8B0      ------------------------------------------------------------
A0A059IPK4      ------------------------------------------------------------
A0A1H2Y469      ------------------------------------------------------------
A0A497ZQU7      ------------------------------------------------------------
A0A318D3U4      ------------------------------------------------------------
A0A401FQP5      ------------------------------------------------------------
A0A1Q6DMW3      ------------------------------------------------------------
A0A3A6P8F8      ------------------------------------------------------------
A0A2G2DSM4      ------------------------------------------------------------
A0A1F9NI02      ------------------------------------------------------------
A0A4U1ABX4      ------------------------------------------------------------
A0A351Z4H9      ------------------------------------------------------------
A0A2N2KML4      ------------------------------------------------------------
E1YJF1          ------------------------------------------------------------
A0A1J5EVZ6      ------------------------------------------------------------
A0A2G6FCC5      ------------------------------------------------------------
A0A1F9MR25      ------------------------------------------------------------
A0A2G6M7F1      ------------------------------------------------------------
A0A1E7H876      ------------------------------------------------------------
A0A509L3P8      ------------------------------------------------------------
A0A3A4S038      ------------------------------------------------------------
A0A1F9N669      ------------------------------------------------------------
A0A1F9PFA7      ------------------------------------------------------------
A0A1H2EN09      ------------------------------------------------------------
K0NP00          ------------------------------------------------------------
A0A1E7JCL5      ------------------------------------------------------------
A0A496YAH9      ------------------------------------------------------------
A0A1V4S7E4      ------------------------------------------------------------
A0A2N2H8D2      ------------------------------------------------------------
A0A2N2KC63      ------------------------------------------------------------
A0A3A4ZYW4      ------------------------------------------------------------
A0A1V4MCJ4      ------------------------------------------------------------
A0A661M0W4      ------------------------------------------------------------
A0A0F2NF69      ------------------------------------------------------------
A0A1F9NFD0      ------------------------------------------------------------
A0A1M5YLH5      ------------------------------------------------------------
A0A4U1A4C7      ------------------------------------------------------------
                                                                            

E1Y9C0          ------------------------------------------------------------
A0A1N6SH58      ------------------------------------------------------------
A0A4Q3AQN2      ------------------------------------------------------------
A0A1W9HS52      KVEPKSDSMSITPLLERFQQNEQLFTRTSAVLEEVQSEPFLNLVVANYLKEGNKISFIVP
A0A2D5LFD8      -----------------------FQRLFHPVYEGTFS-----------------------
A0A0N0XAV4      ------------------------------------------------------------
A0A0P9QD19      ------------------------------------------------------------
F3FHG4          ------------------------------------------------------------
F3GGI0          ------------------------------------------------------------
A0A0P9LE74      ------------------------------------------------------------
A0A3M4ZQ14      ------------PVIGPY-----LHRTFTPGSQRTLAEPLFGLNRYAWGGEKIDVFQLDV
A0A3M5YLE8      ------------PVIGPY-----LHRTFTPGSQRTLAEPLFGLNRYAWGGEKIDVFQLDV
A0A3M3RP89      ------------PVIGPY-----LHRTFTPGSQRTLAEPLFGLNRYAWGGEKIDVFQLDV
A0A0P9QIY7      ------------PVIGPY-----LHRTFTPGSQRTLAEPLFGLNRYAWGGEKIDVFQLDV
A0A0P9VVH7      ------------PVIGPY-----LHRTFTPGSQRTLAEPLFGLNRYAWGGEKIDVFQLDV
A0A0Q0FJK6      ------------PVIGPY-----LHRTFTPGSQRTLAEPLFGLNRYAWGGEKIDVFQLDV
A0A0Q0G2J0      ------------PVIGPY-----LHRTFTPGSQRTLAEPLFGLNRYAWGGEKIDVFQLDV
A0A3M3LF66      ------------PVIGPY-----LHRTFTPGSQRTLAEPLFGLNRYAWGGEKIDVFQLDV
A0A0P9WIR8      ------------PVIGPY-----LHRTFTPGSQRTLAEPLFGLNRYAWGGEKIDVFQLDV
A0A3M3KPE5      ------------PVIGPY-----LHRTFTPGSQRTLAEPLFGLNRYAWGGEKIDVFQLDV
A0A3M4C263      ------------PVIGPY-----LHRTFTPGSQRTLAEPLFGLNRYAWGGEKIDVFQLDV
A0A3M5AD05      ------------PVIGPY-----LHRTFTPGSQRTLAEPLFGLNRYAWGGEKIDVFQLDV
A0A0Q0D3D2      -----------------------------------LPKPLFGLTQYAWGGEKIEVFQLEV
A0A0N0FS39      ------------------------------------------------------------
A0A3M6GHH2      ------------------------------------------------------------
A0A0P9R9W0      ------------PVIGPY-----LYRTFKPLRDGELAEPLFGLTHYAWGGEKIDVFQLEV
A0A0Q0B9T0      ------------PVIGPY-----LYRTFKPLRDGELAEPLFGLTHYAWGGEKIDVFQLEV
A0A3M6CFI7      ------------PVIGPY-----LYRTFKPLRDGELAEPLFGLTHYAWGGEKIDVFQLEV
A0A0P9JXN0      ------------PVIGPY-----LYRTFKPVRDGELAEPLFGLTHYAWGGEKIDVFQLEV
A0A3M6FIV7      ------------PVIGPY-----LYRTFKPVRDGELAEPLFGLTHYAWGGEKIDVFQLEV
A0A3M3PLW9      ------------PVIGPY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEV
A0A3M4ENY1      ------------PVIGPY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEV
A0A3M5EZK7      ------------PVIGPY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEV
A0A0P9SPP5      ------------PVIGPY-----LYRTFKPVRDGELAQPLFGLTQYAWGGEKIEVFQLEV
A0A658KL17      ------------PVIGPY-----LYRTFKPVRDGELAQPLFGLTQYAWGGEKIEVFQLEV
A0A3M3NNF2      ------------PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEV
A0A3M4A0E8      ------------PVIGPY-----LYRTFKPVRDGELAQPLFGLTQYAWGGEKIEVFQLEV
A0A3M4PBZ2      ------------PVIGPY-----LYRTFKPVRDGELAQPLFGLTQYAWGGEKIEVFQLEV
A0A3M6AI26      ------------PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEV
A0A0P9IWP8      ------------PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEV
A0A0P9KZ49      ------------PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEV
A0A0P9V840      ------------PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGENIEVFQLEV
A0A0Q0AIE5      ------------PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGENIEVFQLEV
A0A3M2ZQH6      ------------PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGENIEVFQLEV
A0A0N8SQG2      ------------PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEV
A0A0W8HFU1      ------------PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEV
A0A3M5M873      ------------PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEV
A0A0P9VHH8      ------------PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEV
A0A0P9YV98      ------------PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEV
A0A3M3G2W8      ------------PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEV
A0A3M6C224      ------------PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEV
A0A3M5K254      ------------PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEV
A0A3M5JFB0      ------------PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEV
A0A3M3TQV3      ------------PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEV
A0A3M3EF92      ------------PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEV
A0A3M5J1E2      ------------PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEV
A0A3M5G7H9      ------------PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEV
A0A3M4A376      ------------PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEV
A0A0Q0A5T8      ------------PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEV
A0A0P9SCD7      ------------PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEV
A0A0P9T4G3      ------------PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEV
A0A0P9VKB0      ------------PVIGPY-----LYRTFKPVREGELAKPLFGLTQYAWGGEKIEVFQLEV
A0A0Q0BM35      ------------PVIGPY-----LYRTFKPVREGELAKPLFGLTQYAWGGEKIEVFQLEV
A0A3M3TPR7      ------------PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEV
A0A3M3U4Q3      ------------PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEV
A0A0P9UCX7      ------------PVIGPY-----LYRTFKPVRDGELAQPLFGLTQYAWGGEKIEVFQLEV
A0A0P9S1F1      ------------PVIGPY-----LYRTFKPVRDGELAQPLFGLTQYAWGGEKIEVFQLEV
A0A0P9QCJ2      ------------PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEV
A0A0P9Q329      ------------PVIGPY-----LYRTFKPVRDGELAQPLFGLTQYAWGGEKIEVFQLEV
A0A3M5GJ64      ------------PVIGPY-----LYRTFKPVRDGELAQPLFGLTQYAWGGEKIEVFQLEV
A0A0P9MPC7      ------------PVIGPY-----LYRTFKPVRDGELSKPLFGLTQYAWGGEKIEVFQLEV
A0A3M2XYQ3      ------------PVIGPY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEV
A0A0P9XCE1      ------------PVIGPY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEV
A0A3M3EFX7      ------------PVIGPY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEV
A0A3M5B9D9      ------------PVIGPY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEV
A0A0P9RRZ3      ------------PVIGPY-----LYRTFKPARDGELAQPLFGLTHYAWGGEKIELFQLEV
A0A3M2VEK7      ------------PVIGPY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEV
A0A0N8R9B3      ------------PVIGPY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEV
A0A0P9VA27      ------------PVIGPY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEV
A0A3M4YBJ4      ------------PVIGPY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEV
A0A0P9J470      ------------PVIGPY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEV
A0A0Q0EVJ8      ------------PVIGPY-----LYRTFKPAREGELAQPLFGLTQYAWGGEKIEVFQLEV
A0A3M5UI30      ------------PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGENIEVFQLEV
A0A3M5YQT8      ------------SVIGPY-----LYRTFKPVREGELSKPLFGLTQYAWGGEKIEVFQLEV
A0A3M5F5X1      ------------PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEV
A0A3M5R8G1      ------------PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEV
A0A3M5V012      ------------PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEV
A0A3M3GA16      ------------PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEV
A0A3M3UCT3      ------------PVIGPY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEV
A0A3M3CJL0      ------------PVIGPY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEV
A0A3M3F6F5      ------------PVIGPY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEV
A0A3M3P9B7      ------------PVIGPY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEV
A0A0N8QB74      ------------PVIGPY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEV
A0A0Q0AUD0      ------------PVIGAY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEV
A0A3M5VR55      ------------PVIGPY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEV
A0A0Q0FK97      ------------PVIGPY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEV
A0A3M5KZ75      ------------PVIGPY-----LYRTFKPAREGELAQPLFGLTQYAWGGEKIEVFQLEV
A0A3M5L3G5      ------------PVIGPY-----LYRTFKPAREGELAQPLFGLTQYAWGGEKIEVFQLEV
A0A0C5VQ86      ------------------------------------------------------------
A0A1V8MBH1      ------------------------------------------------------------
A0A534QGR3      ------------------------------------------------------------
A0A0R0BVC7      ------------------------------------------------------------
A0A0W1GMS6      ------------------------------------------------------------
A0A0Q8RMY3      ------------------------------------------------------------
A0A1A7QC21      ------------------------------------------------------------
A0A1F9CFF0      ------------------------------------------------------------
A0A2M8B0G5      ------------------------------------------------------------
A0A363TNU9      ------------------------------------------------------------
A0A534HBS8      ------------------------------------------------------------
A0A0F0T3Y9      ------------------------------------------------------------
A0A379GWF0      ------------------------------------------------------------
A0A536T0W8      ------------------------------------------------------------
A0A4Q2XLV7      ------------------------------------------------------------
A0A4Q5QYC4      ------------------------------------------------------------
A0A2G9XLE5      ------------------------------------------------------------
A0A3D2M6Y9      ------------------------------------------------------------
A0A3D2YAZ2      ------------------------------------------------------------
A0A350A102      ------------------------------------------------------------
A0A350L5D2      ------------------------------------------------------------
A0A3B8SQ27      ------------------------------------------------------------
A0A656BWB0      ------------------------------------------------------------
A0A6D0IFH4      ------------------------------------------------------------
A0A3Y2RPN4      ------------------------------------------------------------
A0A0A0FHV8      ------------------------------------------------------------
A0A1X3IPU7      ------------------------------------------------------------
A0A0A0G0N2      ------------------------------------------------------------
A0A243TPR1      ------------------------------------------------------------
A0A2I8SDU4      ------------------------------------------------------------
A0A2I8SU55      ------------------------------------------------------------
S1EXJ6          ------------------------------------------------------------
A0A376UBS1      ------------------------------------------------------------
A0A4Q6G931      ------------------------------------------------------------
A0A1W9F5M9      ------------------------------------------------------------
A0A3C2BN18      ------------------------------------------------------------
A0A447LR75      ------------------------------------------------------------
A0A376D8L7      ------------------------------------------------------------
A0A1V2FV46      ------------------------------------------------------------
A0A376SB61      ------------------------------------------------------------
A0A3D1BYV9      ------------------------------------------------------------
A0A6D0I9G1      ------------------------------------------------------------
A0A352MMI7      ------------------------------------------------------------
A0A379W6R2      ------------------------------------------------------------
A0A376RY66      ------------------------------------------------------------
A0A377K431      ------------------------------------------------------------
A0A379TA56      ------------------------------------------------------------
A0A4Z0LWV1      ------------------------------------------------------------
A0A5V7HTZ1      ------------------------------------------------------------
A0A610XNI4      ------------------------------------------------------------
A0A620QD02      ------------------------------------------------------------
A0A5H3HSJ8      ------------------------------------------------------------
A0A655C5P0      ------------------------------------------------------------
A0A2T0VBD8      ------------------------------------------------------------
A0A378APS2      ------------------------------------------------------------
A0A443VCQ6      ------------------------------------------------------------
A0A447RKQ7      ------------------------------------------------------------
W1DSK1          ------------------------------------------------------------
A0A0U2VAW2      ------------------------------------------------------------
A0A454CTF1      ------------------------------------------------------------
A0A6B3Q2G1      ------------------------------------------------------------
A0A378G3G7      ------------------------------------------------------------
A0A2X5NHJ9      ------------------------------------------------------------
A0A2J4QEC3      ------------------------------------------------------------
A0A485ADM3      ------------------------------------------------------------
A0A4U9HGU4      ------------------------------------------------------------
A0A3S4JGG5      ------------------------------------------------------------
A0A377ZDH2      ------------------------------------------------------------
A0A3S4HTS8      ------------------------------------------------------------
A0A2N1XK22      ------------------------------------------------------------
A0A3D0KAC8      ------------------------------------------------------------
A0A3D2Y902      ------------------------------------------------------------
A0A655RNN3      ------------------------------------------------------------
A0A655R819      ------------------------------------------------------------
A0A655ZEY0      ------------------------------------------------------------
A0A6G6X2Z4      ------------------------------------------------------------
Q44570          ------------------------------------------------------------
A0A3N5MZ53      ------------------------------------------------------------
A0A534E4H4      ------------------------------------------------------------
A0A534I2B6      ------------------------------------------------------------
A0A1C2JGD0      ------------------------------------------------------------
A0A259LQ70      ------------------------------------------------------------
A0A4V2SPR5      ------------------------------------------------------------
A0A3N5PM86      ------------------------------------------------------------
A0A2E5YSA4      ------------------------------------------------------------
A0A519ERR1      ------------------------------------------------------------
A0A4Q3Q1M2      ------------------------------------------------------------
A0A4Q3MHR1      ------------------------------------------------------------
A0A520GDZ4      ------------------------------------------------------------
A0A318DSU0      ------------------------------------------------------------
A0A538PF21      ------------------------------------------------------------
A0A1W1ZH10      ------------------------------------------------------------
A0A1W2FF24      ------------------------------------------------------------
A0A524JYQ6      ------------------------------------------------------------
A0A4Q3MA17      ------------------------------------------------------------
A0A0N0M5F7      ------------------------------------------------------------
A0A537M754      ------------------------------------------------------------
A0A1V1PDB4      ------------------------------------------------------------
A0A2M7C324      ------------------------------------------------------------
A0A4Q3HHG6      ------------------------------------------------------------
A0A3B7DTA4      ------------------------------------------------------------
A0A432ZK62      ------------------------------------------------------------
A0A1V5EEP4      ------------------------------------------------------------
A0A1V5EF48      ------------------------------------------------------------
A0A0S6X1X6      ------------------------------------------------------------
A0A537Y5L8      ------------------------------------------------------------
A0A4Q3L2X2      ------------------------------------------------------------
A0A4Q3T8J1      ------------------------------------------------------------
A0A4Q4ANM4      ------------------------------------------------------------
A0A4Q3UEC7      ------------------------------------------------------------
A0A1H5YYQ4      ------------------------------------------------------------
A0A1X4NLK2      ------------------------------------------------------------
A0A1X4NWB5      ------------------------------------------------------------
A0A1M5UQ38      ------------------------------------------------------------
A0A327YI48      ------------------------------------------------------------
A0A1B1PNL6      ------------------------------------------------------------
A0A2U8H9H9      ------------------------------------------------------------
A0A6B2NBB8      ------------------------------------------------------------
A0A1X6YIC0      ------------------------------------------------------------
A0A1I5E9E9      ------------------------------------------------------------
A0A1X6Z7N7      ------------------------------------------------------------
A0A2E1DQ13      ------------------------------------------------------------
A0A1H8C800      ------------------------------------------------------------
A0A2N3EZ05      ------------------------------------------------------------
A0A3N5J7U8      ------------------------------------------------------------
A0A1S7S3I8      ------------------------------------------------------------
A0A519E8D7      ------------------------------------------------------------
A0A3S1NZ06      ------------------------------------------------------------
A0A3S1FD32      ------------------------------------------------------------
A0A434DUT4      ------------------------------------------------------------
A0A528D3U3      ------------------------------------------------------------
A0A3S3UPT3      ------------------------------------------------------------
A0A3S1E286      ------------------------------------------------------------
A0A531AC71      ------------------------------------------------------------
A0A436K268      ------------------------------------------------------------
A0A434IDQ0      ------------------------------------------------------------
A0A435IRM5      ------------------------------------------------------------
A0A3S2C404      ------------------------------------------------------------
A0A435F6C0      ------------------------------------------------------------
A0A435BMN6      ------------------------------------------------------------
A0A529XQ54      ------------------------------------------------------------
A0A530BJC1      ------------------------------------------------------------
A0A348SRI7      ------------------------------------------------------------
A0A354EI73      ------------------------------------------------------------
A0A4Q3IRI1      ------------------------------------------------------------
A0A4P7EP83      ------------------------------------------------------------
A0A6I1QB25      ------------------------------------------------------------
A0A655ZZQ1      ------------------------------------------------------------
A0A1S0ZAI3      ------------------------------------------------------------
A0A1W9M770      ------------------------------------------------------------
A0A1W9M7R6      ------------------------------------------------------------
A0A3A4NIE9      ------------------------------------------------------------
A0A3A4NUI9      ------------------------------------------------------------
A0A524I3Z6      ------------------------------------------------------------
A0A524PCL7      ------------------------------------------------------------
A0A356GQV1      ------------------------------------------------------------
A0A1J5DAY8      ------------------------------------------------------------
A0A524P237      ------------------------------------------------------------
A0A3C0L0A8      ------------------------------------------------------------
A0A176S762      ------------------------------------------------------------
A0A377ZC40      ------------------------------------------------------------
A0A378BPJ7      ------------------------------------------------------------
A0A2J5PAJ7      ------------------------------------------------------------
A0A377ZDN3      ------------------------------------------------------------
A0A1G3JY11      ------------------------------------------------------------
A0A661N3U1      ------------------------------------------------------------
A0A1W9WUD9      ------------------------------------------------------------
A0A1W1ZQK0      ------------------------------------------------------------
A0A4U1ALN4      ------------------------------------------------------------
A0A4U1B1A8      ------------------------------------------------------------
A0A1M7Y300      ------------------------------------------------------------
A0A4U1A967      ------------------------------------------------------------
A0A6I1R304      ------------------------------------------------------------
A0A1W9PMU6      ------------------------------------------------------------
A0A6D0ELN7      ------------------------------------------------------------
A0A3S1WTQ1      ------------------------------------------------------------
A0A440NX85      ------------------------------------------------------------
A0A530CUR9      ------------------------------------------------------------
A0A1M6N1X5      ------------------------------------------------------------
A0A561M3U0      ------------------------------------------------------------
A0A1G3VVY5      ------------------------------------------------------------
A0A2N6BZD5      ------------------------------------------------------------
A0A656PSQ6      ------------------------------------------------------------
A0A2W5J775      ------------------------------------------------------------
A0A352Q5C1      ------------------------------------------------------------
A0A435NNF5      ------------------------------------------------------------
A0A3S2AQS7      ------------------------------------------------------------
A0A436XH86      ------------------------------------------------------------
A0A527ZPD6      ------------------------------------------------------------
A0A529KRW3      ------------------------------------------------------------
A0A530ZLX0      ------------------------------------------------------------
A0A355TB56      ------------------------------------------------------------
A0A1F9E324      ------------------------------------------------------------
A0A432SAI6      ------------------------------------------------------------
A0A4Q3LBH4      ------------------------------------------------------------
A0A4Q3LWP3      ------------------------------------------------------------
A0A2N6VGL1      ------------------------------------------------------------
A0A3M3H5V6      ------------------------------------------------------------
A0A524M660      ------------------------------------------------------------
A0A0C1TRU6      ------------------------------------------------------------
A0A2Z5SSF4      ------------------------------------------------------------
A0A2T4ZJZ6      ------------------------------------------------------------
A0A327LYE6      ------------------------------------------------------------
A0A5A9ZTV3      ------------------------------------------------------------
A0A4Q4CIB1      ------------------------------------------------------------
A0A522ACJ9      ------------------------------------------------MDRGQDCAWIIV
A0A1T2KYM8      -----------------------------------------------QSRLVATGDYAPS
A0A3N5Z7F8      ------------------------------------------------------------
A0A2G9ZR82      ------------------------------------------------------------
A0A239HD34      ------------------------------------------------------------
A0A4U9I390      ------------------------------------------------------------
A0A534V9L7      ------------------------------------------------------------
A0A0P7ZZE4      ------------------------------------------------------------
A0A369R0Q9      ------------------------------------------------------------
A0A534XP85      ------------------------------------------------------------
A0A2X3M011      ------------------------------------------------------------
I2WC85          ------------------------------------------------------------
A0A400JH80      ------------------------------------------------------------
A0A2H9EHM4      ------------------------------------------------------------
A0A380B3D7      ------------------------------------------------------------
F5NSX0          ------------------------------------------------------------
A0A479JNB1      ------------------------------------------------------------
A0A5C9AF52      ------------------------------------------------------------
A0A6D0EYC7      ------------------------------------------------------------
D8EEU7          ------------------------------------------------------------
A0A0P1H2H0      ------------------------------------------------------------
A0A258WKV0      ------------------------------------------------------------
A0A377N8F8      ------------------------------------------------------------
A5G4N9          ------------------------------------------------------------
A0A3C2DSE7      ------------------------------------------------------------
A0A2X1JBG5      ------------------------------------------------------------
A0A0B8PTA8      ------------------------------------------------------------
A0A0B8QF75      ------------------------------------------------------------
A0A4Q3LR91      ------------------------------------------------------------
A0A6C9IKN8      ------------------------------------------------------------
A0A4V1TR68      ------------------------------------------------------------
A0A444IY46      ------------------------------------------------------------
A0A6I7N627      ------------------------------------------------------------
A0A660AID0      ------------------------------------------------------------
A0A3E0WKI3      ------------------------------------------------------------
A0A1H3I2J1      ------------------------------------------------------------
A0A1V5DJV0      ------------------------------------------------------------
A0A520IUC4      ------------------------------------------------------------
A0A521LJG5      ------------------------------------------------------------
A0A531IBQ7      ------------------------------------------------------------
A0A377LY04      ---------------------MKIKIKSAKFSTALPATTLSRTSNASRLKRRKAWPSSPD
A0A5C9ABR5      ------------------------------------------------------------
A0A5J9WU72      ------------------------------------------------------------
A0A2X3K9R3      ------------------------------------------------------------
A0A5W0ZR28      ---------------------------------------------------------LAK
A0A622KDG2      ------------------------------------------------------------
A0A3T9EHW9      ------------------------------------------------------------
A0A484X141      ------------------------------------------------------------
A0A5N9VWI6      -------------------------------------------IERKSAEASKSLAFLAK
A0A6D0EJQ0      ------------------------------------------------------------
A0A376LLF8      ------------------------------------------------------------
A0A444R390      ------------------------------------------------------------
A0A6C9J192      ------------------------------------------------------------
A0A1V4WHZ7      ------------------------------------------------------------
A0A1E5AJN5      PIVRIAFVHNERSYPHVVVNQIARSFIELSVDQKA-------------ESANKIRLLLQG
A0A2N3D2J1      -----------------------TAYANARSKRLE----------------------AEQ
A0A2N2GVE1      RLVNISAVSTMPLMAKKVADAITEAFIDDNLERRL-------------SSTKSASTWLES
A0A2N2INV3      RLVNISAVSTNPLMAKKVADAVTEAFIDDNLERRL-------------SSTKSASTWLES
A0A1Y5DXG5      GIVNLSFQHESPEYSQMVLNEITEIYVRRNVDRNS-------------AEAKKSLDFLAV
A0A0B8P2H5      GILSFGFEGENKAQIIDLLNDIANNYFLQNVDRNA-------------AEAENSLEFLQE
A0A483QWI8      GLLVLSLTGDDPKAFEKILNTISNYYLAQNIARQA-------------AQDAKSLDFLNE
A0A483UXD3      GMLVLSLTGDDPKALEKILNTISNNYLAQNIARQA-------------AQDAKSLDFLNE
A0A0A8J8L3      ---------DNPILISNILDNISQNYLSQNVARQA-------------AQDAKSLEFLNQ
A0A660DJ38      -MLGLTLTGTDPNLISKTLNSIANNYLEQNVERQA-------------AQDAKSLDFLNQ
A0A380AQW6      ------------------------------------------------------------
A0A2G2GD62      SNIFVRFDDTVALRAKDIVDGITTAYIQDSVDQKK-------------SSTERSLAFIDK
A0A524P331      NVIQITCSDTDPVLASAMVNTLVQAYLGQTLSFRT-------------EEASNTVKFVEE
A0A4V1SSM5      ------------------------------------------------------------
A0A4Q3K8G7      ------------------------------------------------------------
A0A1M7HC79      ---------------------MAETFLTQNVERQS-------------AEAQQSLEFLQE
A0A1D3JZN6      ---------------MRTLNEISSLYVRQNVDRTS-------------AEAAQSLAFLND
A0A1V6ESG1      --------------------------------------------------------MINQ
A0A1H7YHK3      ----------------------MEAYGRRKVDRNS-------------AEVSSQLKFVKD
A0A534SH66      ------------------------------------------------------------
A0A3M0ZZ99      ------------------------------------------------------------
A0A238LBD3      ------------------------------------------------------------
A0A328C2K5      RVGLIQVRYEDPELAARIADGISETYVEYIREFQT-------------GGLRQLANWFDD
A0A5C6X8M3      RVGLVQVRFEDPELAANIADGISETYVEYIREFQT-------------GGLRQLANWFDD
A0A3D8MRR7      RVGLVQVRFKDPELAASIADGISETYVEYIREFQT-------------GGLRQLANWFDD
A0A5C6UBJ7      RVGLVQVRFKDPELAASIADGISETYVEYIREFQT-------------GGLRQLANWFDD
A0A5C6XGM3      RVGLVQVRFEDPELAASIADGISETYVEYIREFQT-------------GGLRQLANWFDD
A0A537NZJ1      ------------------------------------------------------------
A0A0P1FRV5      ------------------------------------------------------------
A0A4Q4CVW6      ------------------------------------------------------------
A0A090R136      ------------------------------------------------------MHFLSD
A0A661JU93      ------------------------------------------------------------
A0A2E2T3V8      TVIQIGVTDDDPERAYQIVSAVAESFVWLRNNELR-------------RGMDNQLTVIQR
A0A367UAB4      TVIQIGVTDDDPERAYQIVSAVAESFVWLRNNELR-------------RGMDNQLTVIQR
A0A0P1FWI8      ------------------------------------------------------------
A0A377V641      --------------------------MAQNISRQA-------------AQDEKSLEFLNK
A0A1F2YJ88      GILGLNYQGTDKTHITQVLNAILVSYSQQNIERRS-------------AETAQTLKFLDE
A0A0J7XGZ1      YLVEITASSEDPDLAARIANALARRYIGLDSAKKQ-------------ARNAQSAHYVES
I4CBA7          QLINVEASANDPFAAREKLRDYLEQYIRADRERLE-------------TLANSLLAKLQN
A3VE95          YVFEIQFSAAEPGIAQQIANGIADTYIALQLENRR-------------DSAVQATAWIQE
A0A1G0NL95      GVLQLSVRADSPQAAALAANAVAGAYLQQNVSRRS-------------REAGLTLAFIAR
A0A024KA69      VLEDGRPGAGDGARVDSAVDLIASEPVLASAARALG------------LAGERAPDWLGS
A0A0L1KFN4      RLVDINFTSPDALFSAQVANAWAENFIEINLERKV-------------QSTSYGRTALQR
A0A3P5DSS6      ------------------------------------------------------------
A0A483YEL5      ---------------------ISDNYLEQNIARQA-------------AQDAKSLDFLNQ
A0A658GUJ0      GMLTISLLGSDPDLIKRVIDSISDNYLEQNIARQA-------------AQDAKSLDFLNQ
A0A358L616      ----------DPELISQVLDRVMSNYLMQNVERKS-------------AEAQKSLEFLQH
A0A1M7BLL7      SLWALSGDGA--------------------------------------------------
A0A0H4KZM1      ------------------------------MEKRW-------------TRKKRASREAGG
A0A3D5UYX7      --------------------------------------------------------ELNA
A0A2N1WQN5      ------------------------------------------------------------
A0A352G2C2      GIVNVTLEDPNPEHAIRVLEEVASRYVDQNVARNA-------------AEATQSLEFLNE
A0A3C0PZN1      --------------------------------------------------------FLNE
A0A524QFS4      SMVKITVDFPDPDVAAFLANTYASVALQDMLDVNK-------------SNSKSAVEWLES
A0A1V1UJT2      ------------------------------------------------------------
A0A0L6CVX1      ------------------------------------------------------------
A0A1V0RR48      ------------------------------------------------------------
A0A0A0HJJ4      ------------------------------------------------------------
A0A5E7YA28      ------------------------------------------------------------
A0A520JSW4      MIVSVSFVARDPQIAAKIVNGVADAYISTNLERRY-------------QSSSYAREFLQR
A0A4Q3LTF3      -----------ATLNASLSQATAERIQAEARYEQA-------------------------
A0A537UTP9      YIISVGFRAQDAQQAAKIANAVADAYIADQLEAKY-------------QAALRAGTWMQD
A0A1D2RNR5      ------------------------------------------------------------
A0A4V1TQ46      -MVTASLVQLNTAYAGALGAKLAAQ-----------------------KGWEQAAKAPLL
A0A3A0FZC0      SLVTVEATVSDPRLAALIANRHSESYIDWVRQNRI-------------DQQARGLTFLRA
A0A1N7JVZ7      RSVAPGETQAEPTPEPQQPAPKPQLVHNERPRRSAEQAFPPLASDEPAPHPETSREALLA
A0A091C4A8      RLVRVHFDSPDAAFSQRVVNAVAEAYIASNLERRF-------------DASSYAKTFLEE
A0A4R3H6P6      SLVDIRAVTPDPVLSQKIAKAWSENYIASNLERRF-------------DASSYARKFLEG
A0A3S1NQ09      YVIALGYQATDPALANAITKAYADAYLADQLDASF-------------DATERAAVWLQG
A0A443GJ52      YVISIAYQATDPVLATAVTKAYADAYLADQLDASF-------------DATERAAVWLQG
A0A2W6S588      ALFSIGYSDGDPLAAARIANVVAGAYLAVQAQQKL-------------GQGSATSNQLKG
A0A483E0N4      GMLTISLTGEDPSIIERIVESISDNYLAQNIARQA-------------AQDAKSLEFLNK
A0A2J4YQQ6      GMLTLSLTGDNPALIERIINSITENYLAQNISRQA-------------AQDAKSLEFLSK
A0A483THX4      GMLNVSYTGDNADLIKNIVDSITRNYLEQNISRQA-------------AQDAKSLEFLSQ
A0A534MVS2      ------------------------------------------------MQQINSILGQIR
A0A444I5K6      YVLDVSYTAQSPDLARDIAAAIADVYLVDKLNSKY-------------EATRRAGQWLQE
A0A154VE85      RIVAVDFTAADPDLAAAAANRTAGLYVEDRVAQRA-------------AAARRADEWLGG
A0A3S1MCW7      ------------------------------------------------------------
A0A434IGN6      ------------------------------------------------------------
A0A528AX40      SLLTISFIDQKPKYASDIANQVAQSFIDQRLDQTS-------------ETSDLARQFIQE
A0A528MV95      SLLSITFADQNPKYASDIANQVAQSFIDQRLDQTS-------------ETSDLARQFIQE
A0A3C1S9Y1      RLVDVTAEAKNPALAARMANEVVKVYIDQNMETKL-------------AAAKDAVRWLTE
A0A353EH49      GMLTLAFTSIHQHQVADVLNQIVNSYVDQNLERSA-------------AEARLSLEFLER
A0A1Y1Q9C1      HLVKVFYESPDPVLSADIVNALVNAFIKDNISSQS-------------ETDTYAKEFLEQ
A0A3M7LJH0      GIVELSFTGENPSQIQAILDDISQNYFLQNVQRNS-------------AEAEKSLAFLKG
A0A316KRG4      --------------------------------------------------MTEQPKFQRR
A0A1E4JHX8      RLVTITFTSPDPKLSARVANAWTANFIESNLERRF-------------EATSYARKFLEE
M2U8P2          FVITIASEGPDPEIAAAAVNSVIDIYVGGQVSEKS-------------SQRQREISILRE
A0A1H7KZF8      RAASIAFTSPDPQLSALIANSFADHLVRRDVQQRA-------------DQSRYARAFLES
A0A0J5Q9T7      ------------------------------------------------------------
A0A257NG76      GILELTMESTSQDSVLQTLNEIANIYVRQNVEQKS-------------AEAQKTLEFLEK
A0A1T4TW59      QLVRIHFDSANPELAAKVANAVGNAYIESNLEARL-------------LATQTASTWLTE
A0A1I5YYQ0      ---------------------------------------------------MSADRTFRR
A0A5P9FE62      ---------------------------------------------------MSADRTFRR
A0A1Q3MB35      RLVDVKFTSPSPKLSAQVADLWVSQFQQAALDRRF-------------LSTADAREFLEG
A0A259LUN7      ------------------------------MEEKY-------------NATRKATEWLQL
A0A2D7AVL1      --------------NSSIFSLDGETIVTLNKELAT-------------------------
A0A3B9KZE9      ------------------------------------------------------------
A0A2U0NMP8      GMLTISLLGSDPDLIKRVIDSISDNYLEQNIARQA-------------AQDAKSLDFLNQ
A0A4U9HNE9      GIMTFKLESEDPQRAKRVLQSITENYLQQNIDRKT-------------EEAQRMLAFLAR
A0A2G2CXY6      GIISLSMQHESPAQATRILDEVSRLYVLQNVARNS-------------AEAAQSLEFIRE
A0A3M1D4H3      ------------------------------------------------------------
A0A5C8BYM7      ------------------------------------------------LTLDEKTNVINQ
A0A1J5ICP0      ELVTISATAPNPSMAATKVNVIVSEYKSLAVLKDT-------------QNAASALAFIDE
A0A0M3GBT1      DVVQVSFTTNDPQLAAAVPNRVISIYLDERKGSVR-------------SRLDAAEKWIVQ
B3Q577          DVVQVSFTTNDPQLAAAVPNRVISIYLDERKGSVR-------------SRLDAAEKWIVQ
A0A379B9V4      GIINIAIQGKDKKHIQDIVSSIAESYLLQNVARNS-------------AEASKSLEFLNQ
A0A0Q6TS97      SLVDVRAVTPDPALSQRIAQAWGEDFIASNLERRF-------------EASGYARKFLEG
A0A0Q6UYB4      SLVDVRAVTPDPALSQRIAQAWGEDFIASNLERRF-------------EASGYARKFLEG
A0A484XS37      GVLALSLVGDDPVLVRNILNSISKNYLLQNVERKS-------------EEAAKSLDFLKD
W7Q5J0          GVLRLSMTGPDTQEIVRSLDAVADTFLTQNVERQS-------------AQAEQSLVFLEE
A0A654AKT6      LAVAVSLLGSPSVAARVVSIAICIGYLMYTMGRRISYLHHWMGINIVFAMVQFVLYYVDK
A0A0G9MZA5      TLVDISFSSPDPQVSARIANAWADAYIAENLDRRF-------------GATRDARSSLEE
H0T8B0          YIEEITYTSRDPVLAGEVANAIAQAYIEDQLQSYF-------------ETSIRTNTWLEK
A0A5C7N981      QLARVHFDSPDPQMAARIANEVAVAYTKLNLERRM-------------EATSYARTFLQE
A0A534TV22      ------------------------------------------------------------
A0A351CXR4      GVLDLGFTSPNADLSADVLNVLAETYIDHKRSSKT-------------NRVSEASEWLNA
A0A2N6GLF5      QLVRVAFEANDRQLAADVANNLANIYIVNDLEARL-------------SMTSKASDWLTQ
A0A1W9LJP0      RLVNVRVEAKDPALAAKIANAVVQAYIDQNLETKL-------------TAAKDAVKWLID
A0A0W1ICB0      ALVDVSYSSASPQLSRLIASTWVNEFVQQSMDRRL-------------ASTADARIYLEG
A0A2E0UL88      --------------------SYQQTEGIVSLDQES-------------EGLINQLSNFEA
A0A233IKJ2      ---------------------IGNVFMDSHIEDKL-------------QVELKANSWLNN
A0A2T1JE00      --------------------------------------------------ELKANSWLNN
A0A0T2QIS1      RLVDIGYTSGSADLSATIANTWAQQFVASSLDRRF-------------SSTADARKFLEG
A0A376KYN0      ------------------------------------------------------------
A0A2X1JB05      GMLELTMTGDDPQLITRILNSIANNYLQQNIARQA-------------AQDSQSLEFLQR
A0A376RML0      GMLELTMTGDDPQLITRILNSIANNYLQQNIARQA-------------AQDSQSLEFLQR
A0A377E5P7      ------MTGDDPQLITRILNSIANNYLQQNIARQA-------------AQDSQSLEFLQR
A0A0P7Y1D0      FMLTIAFTSENAAKAARIANAFADQYLLSQLEAKF-------------DATERANTWLNE
A0A2M7JRZ7      RLVKVHFDSNYPELSAKVPNTLAVTYIQQSVESRF-------------IATEQVKEWLTK
A0A167IR75      RLVDISMTSPDPAFSAEVANSWAENFITTNLERKV-------------QATSYGRDALQR
A0A3B8T2U6      HVVEIEFVSEDPLLAATISDTVANVYIENYLEAKL-------------EMTAKATTWLNT
A0A365PWR2      GIFVLSITDADPERAVNILAEVMKAYVAQNIERAA-------------ADASSGLEFLTT
A0A2E9H5Z8      -------------------MGQSEEYILKSAEMQQ-------------FGAEERKAELEN
A0A2E2BR79      GMLRLTLTGTDREEIRRLLDAISETFLMQNVERQS-------------AQVDQSLAFISE
A0A0Q4Q524      RLVEIRFTSPDAAFSARIVNTWSDAFIQTNLERKV-------------QATSYGRNLLQR
A0A0Q4CFJ9      RLVDIRFTSPNPEFSAKIVNTWSDAFIQTNLERKV-------------QATSYGRNLLQR
A0A0Q4FE58      RLVDIRFTSPNPEFSAKIVNTWSEAFIQTNLERKV-------------EATSYGRNLLQR
A0A0Q4JWC8      RLVDIRFTSPNPEFSAKIVNTWSEAFIQTNLERKV-------------EATSYGRNLLQR
A0A0Q4KFL8      RLVDIRFTSPNPEFSAKIVNTWSEAFIQTNLERKV-------------EATSYGRNLLQR
A0A522R8R0      ----------------RAAHGLNSTSGNLLSDQQL-------------SDLNKQLILAQA
A0A2U9NDY5      GSSDMAREEPDPQLASRVRDESSRRDGNQNSQRSA-------------AEAAQRLDGLRA
A0A0Q4IGG1      SLVDISFDSPDPILSTQIVNAWSDSFIQTNLERKV-------------QATSYGRNMLQR
X7F6S5          ------------------------MAAGPRFRRRK-------------GRAAPAEDDL--
A0A1G8NKI0      ----------------------MTMSERRPFRRRN-------------RPEDTPPP----
A0A355QPE4      ----------------------MTMSERRPFRRRN-------------RPEDTPAP----
A0A357RN98      ----------------------MTMSERRPFRRRN-------------RPEDTPAP----
A0A6B2MSQ7      ------------------------MVERRRFRRRK-------------RSEETPED----
A0A6B2P8H8      ------------------------MVERRRFRRRK-------------RSEETPED----
A0A1I6U4V1      ------------------------MVERRKFSRRK-------------RAEELPED----
A0A1G7CFZ2      ----------------------MTMTERRRFRRR-----------------NRPLDDLPD
A0A1P8USW9      ----------------------MNMVDRRKFRRKF-------------GRTEAPAPETQP
A0A534RUJ5      RLVKVAFLTPDPALSARVANAHVESYIHKGLELRT-------------QANEEAQRFLEE
A0A3M1CJM3      -----------------------------------------------------AAAWLAS
A0A2R7SVD4      GIIRLALASADAAEAVKILNKIAALYVDQNVRRTS-------------AEAAQSLAFLQS
A0A3C0PWB6      GIIYMSLEDPDPQLASRVLDEISRLYVSQNIQRSS-------------AEAAQRLDFLRS
V4Q8B7          GIIYMSLEDPDPQLANQVLDEISRLYVSQNIQRSS-------------AEAAQRLDFLRS
A0A0Q8XKK5      ALVDIKYTSGSPELAAQIANTWAQQFIEASMDRRF-------------ASTADARKFLES
A0A2E0Q2W0      ------------------------------------------------------------
A0A660NIR6      QLVEIRFESPDPVLAAKIANQTAESYITADLDARF-------------DMQQTASRWLND
A0A142W0R3      SLVDVSFSTPSATLSAKLTNLWVQQFVAANLDRRF-------------SATSDARRFLEQ
A0A0S4XR18      SIVKITFEDAIPQRGVDIVNNLVKVYFAQKLDYQR-------------EEVEKKLKFVND
A0A2E0GW64      GVVQASFTWGKPQQAQEILNAIINTTQEKDIQKKS-------------QQAAQALQFINS
A0A1A7QJ97      RLVDIRFTSPDPAFSASVANAWAENFIESNLERKL-------------QSTSYGRDALQR
A0A6I4IKZ3      GVLGLNYQGQDKEQITKVLNAILATYSAQNIERRS-------------AESAQTLKFLDE
A0A661LW70      SSDVENITAQKLAHLNTQVVEAESNRVEAETRYKQ-------------AMALTGTPDMLD
W7Q8F9          GVLRLTMTGPDPQEIVRSLDAVADTFLTQNVERQS-------------AQAEQSLAFLEE
A0A524PXH8      ----MKFSSPDPRQAASIADTVTREYIDLTLDQRI-------------QSVSQGRKFIAK
A0A4Q3P0E4      SVINASLQDIDAIKVTEVLNAIGAQYVRQNVERKA-------------AEAQKTLAFLDV
A0A3M2BE89      GVFLLTLEDPDADRAVAILNAIANVYLRQNVERKS-------------EEAQKALEFLQG
A0A4Q4A6K6      -------------------NNIVVSDGKLIDDQQI-------------SELNSRLVAARA
A0A257G674      RLASVSFTSPQPELAARISNTLAAEFIQANLQRRF-------------DSSAYARDFISG
A0A661M5M6      RLVRIHARDVNPERARLIADAVADSYVQKTIEDRL-------------ESTDRAKDWLER
A0A1I1UM01      -------------RRTQPEQEPAEDDLRPIPPLDT-------------RQERLARREAEA
Q44573          QILDINVVDGNPERAAALANAVVTNYQRIALARQT-------------ADINRVATWLDN
A2W025          GVVQISLEGKDPDQTAAIANALAQSYLNQHVVAKQ-------------AEATKMLDFLKG
A0A534Z362      DLVAVRFTTPSPSLSAFLAAAHTQAYLEANEEARR-------------ADDVTAKEFLGR
V4J283          GILNVGFSAGEPEQAATILNAILDNYQRRNVERKG-------------EEADKTLEFLEK
A0A536T443      ELSSILREQRDRAQANLRSAEAALTQFRVHHAVRA-------------SEGPAQGPDGRR
A0A0Q4UFQ5      RLVEISFTSPDPELSKRVVDAWSTNFIQSTLERRY-------------SATSYARNFLEE
A0A527W7E6      NVISIGYQATNPALATAITKAYADAYLADQLNASF-------------DATERAAVWLQG
A0A432EMV7      LIAYLSYVSKDPQLSADAANAISEAFIEVGLETQL-------------DETRQAKQWLLS
A0A087LTV7      LRGLEGAIRRQWRVVALAVAAGLALASAALLVMPV-------------SYSATALLYFDP
A0A534WLI3      DLVEVRFTTPSPTLSAFLAATHAEAYVDANEEARL-------------ASNLSTRDFVDR
A0A318KWA2      GMLRLTLTGPDRDEIRRSLDAVAETFLTQNVRRQS-------------AEIEQSLAFLEE
A0A522MT86      ---------------AEVANAISQQYMLTAVAAKQ-------------RNDSSTLAFINK
A0A4Q3I221      -----------AKIANAIGEAYLVDKLNSKYEATR-------------RASGWLQDRIAE
A0A534SAL6      DLVEVSFTTPSPTLSAFLAAAHTQAYIESNEEARR-------------ATDVTAKDFLGR
A0A534ZDB4      DLVEVSFTTPSPALSAFLAAAHTEAYIEANEEARR-------------ATDVTAKDFLGR
A0A534X3M7      DVVEVRFTTPDPSLSAFLAAAHTQAYLEANEEARR-------------ANDVTAQEFLGR
A0A534SPC6      DLVAVRFTTPSPSLSAFLAAAHTQAYLEANEEARR-------------ADDVTAKEFLGR
A0A535AD60      DLVAVRFTTPSPSLSAFLAAAHTQAYLEANEEARR-------------ADDVTAKEFLGR
A0A4Q3SY08      SSDPRKAALIADTFAKTYVSEQLAAKASANRQASG-------------LL-------GER
A0A4Q3LG23      VAFTSPDPAFSAKIANAWADSFIQTNLERKVQATS-------------YGRNLLQRQLGQ
A0A522EX52      RKNNIGIFDISVRHEDPALATRIANEIASVTVKKN-------------AK-------KKS
A0A1H3KC95      ------WPLHDGAEDYREAPLVLGPETRSCDRFAP-------------QE----------
A0A5P8Z4P3      PQDIAGETTEPGTAAAQLPPLEPSETPAPAQTSRE-------------ALMALAEDLTAP
A0A2E9HXF7      PYAAVKAASQEAARLRVEADERARAEAETQRIAKA-------------AE-------RAK
A0A0B3RZC9      PVRPLDETAREAARKRDAAAEQARSEAEARRIAEA-------------AD-------KAK
A0A6F8QET1      PVRPLDETAR-----------------------EA-------------AD-------NAK
A0A520HUH4      IETATSAVVQRLTVTQQERSYVLAIGFRARDAAKA-------------AR-------IAN
A0A2K8U7M6      AQTLAENFVNSGLERRYEASVPARAFLDERLRAAQ-------------AALADAERRLAA
A0A5B9DKL8      PGESRGSAPLNDTARLESAVELIGSERTLQAVVRD-------------LGLAVGMPGATA
A0A238KJM1      ----------------------HRSPTETVSVLKS-------------KR-------ESE
A0A3A0FJZ4      STLLVESSWVRDGFIDTPVASSLRSQVQTLRHRLT-------------SDRALAGIVAAL
W4HJV8          SFDVQGTDAAEAGADTDTAFDPVRDGGRSTAKASG-------------ET-------PSN
A0A0P1GDI0      ERLARRRAEQEAEQARLAAEEAARVEAERLEQARL-------------EE-------QAR
A0A2R8ATV5      RRRAEESRQQRVAMRQAEAEARRQAEAEARRQAEE-------------EEARQQAAAQAK
A0A1U7D3R6      ---------------------------MTAERTRS-------------ES-------ASD
A0A2D4UVV2      AAPPAAAPTHRRKRRRTDAAQTPPTEAVTAERTRS-------------ES-------ASD
A0A0W7WHP4      DMTPVPPLEPRARRSEDTLPETGGTSARETEEARE-------------AE-------EAR
A0A238J8F6      QKAALEAQRREVAKR--AAAERARQQAEAEQRARE-------------EA-------EKT
A0A238JQI6      LPESVPKNLPEIAPE--TAPEPPVPDPEAGARRTA-------------EA-------QAR
A0A222E077      PYAAVKAASQEAAHLRVEADERARAEAETQRIAKA-------------AE-------RAK
A0A239E3Y2      PYAAVKAASQEAARL--------RAEAEAQRIAKA-------------AE-------QAK
A0A1V6FYJ1      ------------------------------------------------------------
A0A445MZQ4      ------------------------------------------------------------
A0A0M9E0E3      ------------------------------------------------------------
A0A0Q6QV61      ------------------------------------------------------------
A0A2Z3IKG4      ------------------------------------------------------------
A0A2W4RFS2      ------------------------------------------------------------
A0A1Y6DC43      ------------------------------------------------------------
A0A2S6HE06      ------------------------------------------------------------
G3J0M3          ------------------------------------------------------------
V5C6R5          ------------------------------------------------------------
A0A354EF47      ------------------------------------------------------------
A0A2G6MSP7      ------------------------------------------------------------
A0A4U8YMP3      ------------------------------------------------------------
A0A1Q8QQ99      ------------------------------------------------------------
A0A3D5ZY44      ------------------------------------------------------------
A0A646J2A6      ------------------------------------------------------------
A0A1G5C236      ------------------------------------------------------------
A0A432HIS7      ------------------------------------------------------------
A0A1I3XJ27      ------------------------------------------------------------
A0A1I7DCG1      ------------------------------------------------------------
A0A3A3H6D9      ------------------------------------------------------------
A0A562CGU2      ------------------------------------------------------------
A0A0Q6VA36      ------------------------------------------------------------
A0A1B2EQN1      ------------------------------------------------------------
A0A1E7HSL6      ------------------------------------------------------------
A0A4Q3ZDI7      ------------------------------------------------------------
A0A537PRC6      ------------------------------------------------------------
A0A2M7JX59      ------------------------------------------------------------
A0A3A4XVN3      ------------------------------------------------------------
A0A1E7JEV6      ------------------------------------------------------------
A0A2N2KDY5      ------------------------------------------------------------
A0A3N5YUD9      ------------------------------------------------------------
A0A0W1DLQ3      ------------------------------------------------------------
A0A246JVD8      ------------------------------------------------------------
A0A2N3BB54      ------------------------------------------------------------
A0A1H6G7A3      ------------------------------------------------------------
A0A0A7PGL6      ------------------------------------------------------------
A0A4Q2Z4L0      ------------------------------------------------------------
A0A5C4N0H6      ------------------------------------------------------------
A0A4R1HDF2      ------------------------------------------------------------
A0A1E7HFN0      ------------------------------------------------------------
A0A1M5GH86      ------------------------------------------------------------
A0A1W1XQZ5      ------------------------------------------------------------
A0A3D6C3I2      ------------------------------------------------------------
S0G1D4          ------------------------------------------------------------
A0A661T246      ------------------------------------------------------------
A0A2G6CSG7      ------------------------------------------------------------
A0A2G6NB59      ------------------------------------------------------------
A0A5K8A7T9      ------------------------------------------------------------
A0A1W9U045      ------------------------------------------------------------
A0A1F9L9G4      ------------------------------------------------------------
A0A328FD76      ------------------------------------------------------------
A0A348UX90      ------------------------------------------------------------
A0A357Z0N5      ------------------------------------------------------------
A0A0F2R2U0      ------------------------------------------------------------
A0A5K7ZK00      ------------------------------------------------------------
A0A5K7YCX8      ------------------------------------------------------------
A0A5K7Z388      ------------------------------------------------------------
A0A352B502      ------------------------------------------------------------
A0A2K8WHP8      ------------------------------------------------------------
A0A410V446      ------------------------------------------------------------
A0A0R3KGJ5      ------------------------------------------------------------
A0A0R3N604      ------------------------------------------------------------
A0A1B1UCM8      ------------------------------------------------------------
A0A1N6JQ20      ------------------------------------------------------------
A0A1M5TI07      ------------------------------------------------------------
A3X191          ------------------------------------------------------------
A0A1H4RKV5      ------------------------------------------------------------
A0A160UA87      ------------------------------------------------------------
A0A1Q5SFV5      ------------------------------------------------------------
A0A1J5N774      ------------------------------------------------------------
A0A2C8F781      ------------------------------------------------------------
A0A2E3R6G0      ------------------------------------------------------------
A0A1F8XMK2      ------------------------------------------------------------
A0A3M8EMP2      ------------------------------------------------------------
A0A2J6J6K6      ------------------------------------------------------------
A0A661PSB9      ------------------------------------------------------------
A0A661QBT6      ------------------------------------------------------------
A0A1G6EKK9      ------------------------------------------------------------
A0A6I2SLK2      ------------------------------------------------------------
A0A0A8WSG4      ------------------------------------------------------------
S7TK97          ------------------------------------------------------------
S7UE93          ------------------------------------------------------------
A0A3D5BR56      ------------------------------------------------------------
A0A2N2IB15      ------------------------------------------------------------
A0A1I3PSR2      ------------------------------------------------------------
A0A1I4GEK4      ------------------------------------------------------------
A0A2T5R3J5      ------------------------------------------------------------
A0A1W7QPT7      ------------------------------------------------------------
A0A0M4D373      ------------------------------------------------------------
A0A1L3GKM9      ------------------------------------------------------------
A0A430DNP0      ------------------------------------------------------------
A0A3A0FQ32      ------------------------------------------------------------
A0A1E4UZA0      ------------------------------------------------------------
A0A1H9KL56      ------------------------------------------------------------
A0A1A9KEF8      ------------------------------------------------------------
A0A5E6PKN5      ------------------------------------------------------------
A0A0N9W1V6      ------------------------------------------------------------
A0A423GQ41      ------------------------------------------------------------
A0A423H7J2      ------------------------------------------------------------
A0A502HNM8      ------------------------------------------------------------
A0A4Q7H223      ------------------------------------------------------------
A0A1H4N2K9      ------------------------------------------------------------
A0A2K4KWF7      ------------------------------------------------------------
A0A3E0WXH2      ------------------------------------------------------------
A0A2N2TRC8      ------------------------------------------------------------
A0A1V4CIZ7      ------------------------------------------------------------
A0A1M3BXA5      ------------------------------------------------------------
A0A1Y2R3U6      ------------------------------------------------------------
A0A167HVD6      ------------------------------------------------------------
A0A1V3SCT6      ------------------------------------------------------------
L0H287          ------------------------------------------------------------
A0A495VG93      ------------------------------------------------------------
A0A4R3MYM4      ------------------------------------------------------------
G2E3C0          ------------------------------------------------------------
A0A4U8YLL7      ------------------------------------------------------------
A0A3N5RNY4      ------------------------------------------------------------
A0A1V4M8I1      ------------------------------------------------------------
A0A4Z0M4C7      ------------------------------------------------------------
A0A5Q2QDL1      ------------------------------------------------------------
A0A1I0R9R6      ------------------------------------------------------------
A0A443K010      ------------------------------------------------------------
A0A6I7NYG5      ------------------------------------------------------------
A0A238IZI1      ------------------------------------------------------------
A0A316GHM6      ------------------------------------------------------------
A0A520ZTR8      ------------------------------------------------------------
A0A212AR83      ------------------------------------------------------------
A0A2E2P4I0      ------------------------------------------------------------
A0A2U2CM86      ------------------------------------------------------------
A0A1X7ACC1      ------------------------------------------------------------
A0A2N3BVE7      ------------------------------------------------------------
A0A2S5JE21      ------------------------------------------------------------
A0A2R8BKZ2      ------------------------------------------------------------
A0A2S8S361      ------------------------------------------------------------
A0A238KUF6      ------------------------------------------------------------
A0A095CTW3      ------------------------------------------------------------
A0A2E3UGD6      ------------------------------------------------------------
A0A2T0RFH0      ------------------------------------------------------------
A0A285D390      ------------------------------------------------------------
A0A497VHN4      ------------------------------------------------------------
A0A318CT66      ------------------------------------------------------------
A0A3N5P205      ------------------------------------------------------------
A0A2N6BEI9      ------------------------------------------------------------
A0A0D5N3E9      ------------------------------------------------------------
A0A2N2G716      ------------------------------------------------------------
W9VVY5          ------------------------------------------------------------
A0A1E2URD3      ------------------------------------------------------------
A0A2T6MY81      ------------------------------------------------------------
A0A2T6NBQ8      ------------------------------------------------------------
A0A421K431      ------------------------------------------------------------
A0A2G2I5M1      ------------------------------------------------------------
A0A2G2M6F0      ------------------------------------------------------------
A0A1W9J9F8      ------------------------------------------------------------
A0A2S5LFJ9      ------------------------------------------------------------
A0A2D8R8F8      ------------------------------------------------------------
A0A6I4JXQ8      ------------------------------------------------------------
A0A010SNS0      ------------------------------------------------------------
A0A0C2I782      ------------------------------------------------------------
A0A2N8BYF5      ------------------------------------------------------------
A0A558FKX2      ------------------------------------------------------------
A0A1H1DBA0      ------------------------------------------------------------
J2TAD5          ------------------------------------------------------------
J3H699          ------------------------------------------------------------
A0A1H5J974      ------------------------------------------------------------
A0A0K1QRZ4      ------------------------------------------------------------
A0A560RJW9      ------------------------------------------------------------
A0A5E6TID7      ------------------------------------------------------------
A0A5E7CRU7      ------------------------------------------------------------
A0A5E7C564      ------------------------------------------------------------
A0A2W7MAV4      ------------------------------------------------------------
A0A4R3WQH5      ------------------------------------------------------------
W6VFG3          ------------------------------------------------------------
A0A1P8ENT1      ------------------------------------------------------------
A0A2N7XRV4      ------------------------------------------------------------
A0A0Q6QPG8      ------------------------------------------------------------
A0A0F4SWA7      ------------------------------------------------------------
A0A423J219      ------------------------------------------------------------
A0A4P6G9U8      ------------------------------------------------------------
A0A4Y8JE06      ------------------------------------------------------------
A0A502I1X9      ------------------------------------------------------------
A0A502J776      ------------------------------------------------------------
A0A5B0EZF6      ------------------------------------------------------------
A0A059L434      ------------------------------------------------------------
A0A0F4UWN2      ------------------------------------------------------------
A0A5E7WEF5      ------------------------------------------------------------
A0A1G0KSD0      ------------------------------------------------------------
A0A4P6WX84      ------------------------------------------------------------
A0A1D2S760      ------------------------------------------------------------
A0A5B8RW94      ------------------------------------------------------------
A0A258TN88      ------------------------------------------------------------
A0A1F9EUS2      ------------------------------------------------------------
A0A6H9HII8      ------------------------------------------------------------
A0A3N9VAW3      ------------------------------------------------------------
A0A1X0YE57      ------------------------------------------------------------
A0A2K2H9Q8      ------------------------------------------------------------
A0A6I1KNW9      ------------------------------------------------------------
A0A1H4B8T3      ------------------------------------------------------------
A0A1E7IQC3      ------------------------------------------------------------
A0A1M6KEN5      ------------------------------------------------------------
A0A353QLL3      ------------------------------------------------------------
A0A399I453      ------------------------------------------------------------
A0A651FBV9      ------------------------------------------------------------
A0A5C1MDH8      ------------------------------------------------------------
A0A5A9XE04      ------------------------------------------------------------
A0A643G9R1      ------------------------------------------------------------
A0A1G0M8Q7      ------------------------------------------------------------
A0A353MI14      ------------------------------------------------------------
A0A4S1CAW7      ------------------------------------------------------------
A0A562VHD2      ------------------------------------------------------------
A0A6I6JNB5      ------------------------------------------------------------
A0A1G0LDK7      ------------------------------------------------------------
A0A6F9WVL7      ------------------------------------------------------------
A0A2M7WWF7      ------------------------------------------------------------
A0A351Z9A2      ------------------------------------------------------------
A0A351B422      ------------------------------------------------------------
F2NEE9          ------------------------------------------------------------
B7RS54          ------------------------------------------------------------
A0A3N5FRH4      ------------------------------------------------------------
A0A1V4Y2C3      ------------------------------------------------------------
A0A2N2KTJ4      ------------------------------------------------------------
A0A2N2LQX0      ------------------------------------------------------------
A0A520CSP5      ------------------------------------------------------------
A0A1I6ENM4      ------------------------------------------------------------
A8LNM8          ------------------------------------------------------------
A0A0T5NSU3      ------------------------------------------------------------
A0A5P9I718      ------------------------------------------------------------
A0A2M8J3R9      ------------------------------------------------------------
A0A1I6X762      ------------------------------------------------------------
A0A0P1EFX8      ------------------------------------------------------------
A0A2G5KB39      ------------------------------------------------------------
A0A2N3CNV1      ------------------------------------------------------------
A0A257F1F4      ------------------------------------------------------------
A0A1G9FY29      ------------------------------------------------------------
A0A4Q3ZBK4      ------------------------------------------------------------
A0A2D5J8T8      ------------------------------------------------------------
A0A2E3P9W6      ------------------------------------------------------------
A0A2G2B1P9      ------------------------------------------------------------
A0A258GCD5      ------------------------------------------------------------
A0A2D9YR88      ------------------------------------------------------------
A0A443INY4      ------------------------------------------------------------
A0A372IH36      ------------------------------------------------------------
A0A540VW45      ------------------------------------------------------------
A0A1H9C241      ------------------------------------------------------------
A0A2E3FCR1      ------------------------------------------------------------
A0A4S3MG69      ------------------------------------------------------------
A0A3E0H727      ------------------------------------------------------------
A0A1G8QZS5      ------------------------------------------------------------
A0A1V4QMH7      ------------------------------------------------------------
A0A496XZQ4      ------------------------------------------------------------
A0A1F9BJF7      ------------------------------------------------------------
F2NDF5          ------------------------------------------------------------
A0A1I3TTC3      ------------------------------------------------------------
A0A1H3IZW6      ------------------------------------------------------------
A0A0M6YG59      ------------------------------------------------------------
A0A1H7G8B0      ------------------------------------------------------------
A0A059IPK4      ------------------------------------------------------------
A0A1H2Y469      ------------------------------------------------------------
A0A497ZQU7      ------------------------------------------------------------
A0A318D3U4      ------------------------------------------------------------
A0A401FQP5      ------------------------------------------------------------
A0A1Q6DMW3      ------------------------------------------------------------
A0A3A6P8F8      ------------------------------------------------------------
A0A2G2DSM4      ------------------------------------------------------------
A0A1F9NI02      ------------------------------------------------------------
A0A4U1ABX4      ------------------------------------------------------------
A0A351Z4H9      ------------------------------------------------------------
A0A2N2KML4      ------------------------------------------------------------
E1YJF1          ------------------------------------------------------------
A0A1J5EVZ6      ------------------------------------------------------------
A0A2G6FCC5      ------------------------------------------------------------
A0A1F9MR25      ------------------------------------------------------------
A0A2G6M7F1      ------------------------------------------------------------
A0A1E7H876      ------------------------------------------------------------
A0A509L3P8      ------------------------------------------------------------
A0A3A4S038      ------------------------------------------------------------
A0A1F9N669      ------------------------------------------------------------
A0A1F9PFA7      ------------------------------------------------------------
A0A1H2EN09      ------------------------------------------------------------
K0NP00          ------------------------------------------------------------
A0A1E7JCL5      ------------------------------------------------------------
A0A496YAH9      ------------------------------------------------------------
A0A1V4S7E4      ------------------------------------------------------------
A0A2N2H8D2      ------------------------------------------------------------
A0A2N2KC63      ------------------------------------------------------------
A0A3A4ZYW4      ------------------------------------------------------------
A0A1V4MCJ4      ------------------------------------------------------------
A0A661M0W4      ------------------------------------------------------------
A0A0F2NF69      ------------------------------------------------------------
A0A1F9NFD0      ------------------------------------------------------------
A0A1M5YLH5      ------------------------------------------------------------
A0A4U1A4C7      ------------------------------------------------------------
                                                                            

E1Y9C0          ------------------------------------------------------------
A0A1N6SH58      ------------------------------------------------------------
A0A4Q3AQN2      ------------------------------------------------------------
A0A1W9HS52      AERVRGLILFIKAALKKGAKLEDIQKHRDWIELRGYFRAAIESFANFETGIITIRIRTRH
A0A2D5LFD8      --LLIKDPINNSSSSNNSQSANTNFQN---LALNSISNDLPTL-ISV-MRSPLILSPIA-
A0A0N0XAV4      ------------------------------------------------------------
A0A0P9QD19      ------------------------------------------------------------
F3FHG4          ------------------------------------------------------------
F3GGI0          ------------------------------------------------------------
A0A0P9LE74      ------------------------------------------------------------
A0A3M4ZQ14      PESLLGENLTLTAGQPGQFSLYDDEHR---LLLRGATNRVVEG-SGVTIQVAALQARPG-
A0A3M5YLE8      PESLLGENLTLTAGQPGQFSLYDDEHR---LLLRGATNRVVEG-SGVTIQVAALQARPG-
A0A3M3RP89      PESLLGENLTLTAGQPGQFSLYDDEHS---LLLRGATNRVVEG-SGVTIQVAALQARPG-
A0A0P9QIY7      PESLLGENLTLTAGQPGQFSLYDDERR---LLLRGATNRVVEG-SGVTIQVAALQARPG-
A0A0P9VVH7      PESLLGENLTLTAGQPGQFSLYDDEHR---LLLRGATNRVVEG-SGVTIQVAALQARPG-
A0A0Q0FJK6      PESLLGENLTLTAGQPGQFSLYDDERR---LLLRGATNRVVEG-SGVTIQVAALQARPG-
A0A0Q0G2J0      PESLLGENLTLTAGQPGQFSLYDDEHR---LLLRGATNRVVEG-SGVTIQVAALQARPG-
A0A3M3LF66      PESLLGENLTLTAGQPGQFSLYDDEHR---LLLRGATNRVVEG-SGVTIQVAALQARPG-
A0A0P9WIR8      PESLLGENLTLTAGQPGQFSLYDDERR---LLLRGATNRVVEG-SGVTIQVAALQARPG-
A0A3M3KPE5      PESLLGENLTLTAGQPGQFSLYDDEHR---LLLRGATNRVVEG-SGVTIQVAALQARPG-
A0A3M4C263      PESLLGENLTLTAGQPGQFSLYDDEHR---LLLRGATNRVVEG-SGVTIQVAALQARPG-
A0A3M5AD05      PESLLGENLTLTAGQPGQFSLYDDEHR---LLLRGATNRVVEG-SGVTIQVAALQARPG-
A0A0Q0D3D2      PEHLLGEKLTLTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRAHPG-
A0A0N0FS39      ------------------------------------------------------------
A0A3M6GHH2      ------------------------------------------------------------
A0A0P9R9W0      PEYLLGEKLTLTAGRPGQFSLYDNEHN---LLLGGTTNRVVEG-NGIRIQVATLLARPG-
A0A0Q0B9T0      PEYLLGEKLTLTAGRPGQFSLYDNEHN---LLLGGTTNRVVEG-NGIRIQVATLLARPG-
A0A3M6CFI7      PEYLLGEKLTLTAGRPGQFSLYDNEHN---LLLGGTTNRVVEG-NGIRIQVATLLARPG-
A0A0P9JXN0      PEHLLGEKLTLTAGRPGQFSLYDNEHN---LLLGGTTNRVVEG-NGIRIQVATLLARPG-
A0A3M6FIV7      PEHLLGEKLTLTAGRPGQFSLYDNEHN---LLLGGTTNRVVEG-NGIRIQVATLLARPG-
A0A3M3PLW9      PEHLLGEKLTLTAGKPGQFSLYDSEHN---LLLGGAINRVVEG-HGIKIQVATLQARPG-
A0A3M4ENY1      PEHLLGEKLTLTAGKPGQFSLYDSEHN---LLLGGALNRVVEG-HGIKIQVATLQARPG-
A0A3M5EZK7      PEHLLGEKLTLTAGKPGQFSLYDSEHN---LLLGGAINRVVEG-QGIKIQVATLQARPG-
A0A0P9SPP5      PEHLLGKKLTLTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGIKIQVAALRARPG-
A0A658KL17      PEHLLGEKLTLTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGIKIQVATLRARPG-
A0A3M3NNF2      PEHLLGEKLTLTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-
A0A3M4A0E8      PEHLLGEKLTLTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRAHPG-
A0A3M4PBZ2      PEHLLGEKLTLTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRAHPG-
A0A3M6AI26      PEHLLGEKLTLTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-
A0A0P9IWP8      PEHLLGEKLTLTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRAHPG-
A0A0P9KZ49      PEHLLGEKLTLTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-
A0A0P9V840      PEHLLGEKLTLTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-
A0A0Q0AIE5      PEHLLGEKLTLTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-
A0A3M2ZQH6      PEHLLGEKLTLTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-
A0A0N8SQG2      PEHLLGEKLTLTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-
A0A0W8HFU1      PEHLLGEKLTLTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-
A0A3M5M873      PEHLLGEKLTLTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRAHPG-
A0A0P9VHH8      PEHLLGEKLTLTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRAHPG-
A0A0P9YV98      PEHLLGEKLTLIAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-
A0A3M3G2W8      PEHLLGEKLTLIAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-
A0A3M6C224      PEHLLGEKLTLIAGKPGQFSLYDNEHK---LLLGGTINRIVEG-NGVKIQVAALRARPG-
A0A3M5K254      PEHLLGEKLTLIAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-
A0A3M5JFB0      PEHLLGEKLTLIAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-
A0A3M3TQV3      PEHLLGEKLTLTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRAHPG-
A0A3M3EF92      PEHLLGEKLTLTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRAHPG-
A0A3M5J1E2      PEHLLGEKLTLTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRAHPG-
A0A3M5G7H9      PEHLLGEKLTLTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-
A0A3M4A376      PEHLLGEKLTLTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRAHPG-
A0A0Q0A5T8      PEHLLGEKLTLTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-
A0A0P9SCD7      PEHLLGEKLTLIAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-
A0A0P9T4G3      PEHLLGEKLTLIAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-
A0A0P9VKB0      PEHLLGEKLTLIAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-
A0A0Q0BM35      PEHLLGEKLTLIAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-
A0A3M3TPR7      PEHLLGEKLTLIAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-
A0A3M3U4Q3      PEHLLGEKLTLIAGKPGQLSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-
A0A0P9UCX7      PEHLLGEKLTLTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGIKIQVATLRARHG-
A0A0P9S1F1      PEHLLGEKLTLTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGIKIQVATLRARPG-
A0A0P9QCJ2      PEHLLGEKLTLTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-
A0A0P9Q329      PEHLLGEKLTLTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGIKIQVATLRARPG-
A0A3M5GJ64      PEHLLGEKLTLTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGIKIQVATLRARPG-
A0A0P9MPC7      PEHLLGEKLTLTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-
A0A3M2XYQ3      PENLLGEKLTLTAGKPGQFSLYDSEHN---LLLGGAINRVVEG-HGIKIQVATLQARPG-
A0A0P9XCE1      PEHLLGEKLTLTAGKPGQFSLYDSEHN---LLLGGAINRVVEG-HGIKIQVATLQARPG-
A0A3M3EFX7      PEHLLGEKLTLTAGKPGQFSLYDSEHN---LLLGGAINRVVEG-HGIKIQVATLQARPG-
A0A3M5B9D9      PEHLLGEKLTLTAGKPGQFSLYDSEHN---LLLGGAINRVVEG-QGIKIQVATLQARPG-
A0A0P9RRZ3      PEHLLGEKLTLTAGKPGQFSLYDNEHN---LLLGGAVNRVVEG-KGIKIQVATLQARPG-
A0A3M2VEK7      PEHLLGERLTLTAGKPGQFSLYDSEHN---LLLGGAINRVVEG-HGIKIQVATLQARPG-
A0A0N8R9B3      PEHLLGERLTLTAGKPGQFSLYDSEHT---LLLGGAINRVVEG-HGIKIQVATLQARPG-
A0A0P9VA27      PEHLLGEKLTLTAGKPGQFSLYDSEHT---LLLGGAINRVVEG-HGIKIQVATLQARPG-
A0A3M4YBJ4      PEHLLGEKLTLTSGKPGQFSLYDSEHN---LLLGGALNRVVEG-HGIKIQVATLQARPG-
A0A0P9J470      PEHLLGEKLTLTAGKPGQFSLYDSEHT---LLLGGAINRVVEG-HGIKIQVATLQARPG-
A0A0Q0EVJ8      PEHLLGEKLTLTAGKPGQFSLYDSEHT---LLLGGAINRVVEG-HGIKIQVATLQARPG-
A0A3M5UI30      PEHLLGEKLTLTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-
A0A3M5YQT8      PEHLLGEKLTLTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-
A0A3M5F5X1      PEHLLGEKLTLTAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRAHPG-
A0A3M5R8G1      PEHLLGEKLTLIAGKPGQLSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-
A0A3M5V012      PEHLLGEKLTLIAGKPGQLSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-
A0A3M3GA16      PEHLLGEKLTLIAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-
A0A3M3UCT3      PEHLLGEKLTLTAGKPGQFSLYDSEHN---LLLGGALNRVVEG-HGIKIQVATLQARPG-
A0A3M3CJL0      PEHLLGEKLTLTAGKPGQFSLYDSEHN---LLLGGAINRVVEG-HGIKIQVATLQARPG-
A0A3M3F6F5      PEHLLGERLTLTAGKPGQFSLYDSEHN---LLLGGAINRVVEG-HGIKIQVATLQARPG-
A0A3M3P9B7      PEHLLGERLTLTAGKPGQFSLYDSEHN---LLLGGAINRVVEG-HGIKIQVATLQARPG-
A0A0N8QB74      PEHLLGERLTLTAGKPGQFSLYDSEHN---LLLGGAINRVVEG-HGIKIQVATLQARPG-
A0A0Q0AUD0      PEHLLGERLTLTAGKPGQFSLYDSEHN---LLLGGAINRVVEG-HGIKIQVATLQARPG-
A0A3M5VR55      PEHLLGERLTLTAGKPGQFSLYDSEHN---LLLGGAINRVVEG-HGIKIQVATLQARPG-
A0A0Q0FK97      PEHLLGEKLTLTAGKPGQFSLYDSEHN---LLLGGALNRVVEG-HGIKIQVATLQARPG-
A0A3M5KZ75      PEHLLGEKLTLTAGKPGQFSLYDSEHT---LLLGGAINRVVEG-HGIKIQVATLQARPG-
A0A3M5L3G5      PEHLLGEKLTLTAGKPGQFSLYDSEHT---LLLGGAINRVVEG-HGIKIQVATLQARPG-
A0A0C5VQ86      ------------------------------------------------------------
A0A1V8MBH1      ------------------------------------------------------------
A0A534QGR3      ------------------------------------------------------------
A0A0R0BVC7      ------------------------------------------------------------
A0A0W1GMS6      ------------------------------------------------------------
A0A0Q8RMY3      ------------------------------------------------------------
A0A1A7QC21      ------------------------------------------------------------
A0A1F9CFF0      ------------------------------------------------------------
A0A2M8B0G5      ------------------------------------------------------------
A0A363TNU9      ------------------------------------------------------------
A0A534HBS8      ------------------------------------------------------------
A0A0F0T3Y9      ------------------------------------------------------------
A0A379GWF0      ------------------------------------------------------------
A0A536T0W8      ------------------------------------------------------------
A0A4Q2XLV7      ------------------------------------------------------------
A0A4Q5QYC4      ------------------------------------------------------------
A0A2G9XLE5      ------------------------------------------------------------
A0A3D2M6Y9      ------------------------------------------------------------
A0A3D2YAZ2      ------------------------------------------------------------
A0A350A102      ------------------------------------------------------------
A0A350L5D2      ------------------------------------------------------------
A0A3B8SQ27      ------------------------------------------------------------
A0A656BWB0      ------------------------------------------------------------
A0A6D0IFH4      ------------------------------------------------------------
A0A3Y2RPN4      ------------------------------------------------------------
A0A0A0FHV8      ------------------------------------------------------------
A0A1X3IPU7      ------------------------------------------------------------
A0A0A0G0N2      ------------------------------------------------------------
A0A243TPR1      ------------------------------------------------------------
A0A2I8SDU4      ------------------------------------------------------------
A0A2I8SU55      ------------------------------------------------------------
S1EXJ6          ------------------------------------------------------------
A0A376UBS1      ------------------------------------------------------------
A0A4Q6G931      ------------------------------------------------------------
A0A1W9F5M9      ------------------------------------------------------------
A0A3C2BN18      ------------------------------------------------------------
A0A447LR75      ------------------------------------------------------------
A0A376D8L7      ------------------------------------------------------------
A0A1V2FV46      ------------------------------------------------------------
A0A376SB61      ------------------------------------------------------------
A0A3D1BYV9      ------------------------------------------------------------
A0A6D0I9G1      ------------------------------------------------------------
A0A352MMI7      ------------------------------------------------------------
A0A379W6R2      ------------------------------------------------------------
A0A376RY66      ------------------------------------------------------------
A0A377K431      ------------------------------------------------------------
A0A379TA56      ------------------------------------------------------------
A0A4Z0LWV1      ------------------------------------------------------------
A0A5V7HTZ1      ------------------------------------------------------------
A0A610XNI4      ------------------------------------------------------------
A0A620QD02      ------------------------------------------------------------
A0A5H3HSJ8      ------------------------------------------------------------
A0A655C5P0      ------------------------------------------------------------
A0A2T0VBD8      ------------------------------------------------------------
A0A378APS2      ------------------------------------------------------------
A0A443VCQ6      ------------------------------------------------------------
A0A447RKQ7      ------------------------------------------------------------
W1DSK1          ------------------------------------------------------------
A0A0U2VAW2      ------------------------------------------------------------
A0A454CTF1      ------------------------------------------------------------
A0A6B3Q2G1      ------------------------------------------------------------
A0A378G3G7      ------------------------------------------------------------
A0A2X5NHJ9      ------------------------------------------------------------
A0A2J4QEC3      ------------------------------------------------------------
A0A485ADM3      ------------------------------------------------------------
A0A4U9HGU4      ------------------------------------------------------------
A0A3S4JGG5      ------------------------------------------------------------
A0A377ZDH2      ------------------------------------------------------------
A0A3S4HTS8      ------------------------------------------------------------
A0A2N1XK22      ------------------------------------------------------------
A0A3D0KAC8      ------------------------------------------------------------
A0A3D2Y902      ------------------------------------------------------------
A0A655RNN3      ------------------------------------------------------------
A0A655R819      ------------------------------------------------------------
A0A655ZEY0      ------------------------------------------------------------
A0A6G6X2Z4      ------------------------------------------------------------
Q44570          ------------------------------------------------------------
A0A3N5MZ53      ------------------------------------------------------------
A0A534E4H4      ------------------------------------------------------------
A0A534I2B6      ------------------------------------------------------------
A0A1C2JGD0      ------------------------------------------------------------
A0A259LQ70      ------------------------------------------------------------
A0A4V2SPR5      ------------------------------------------------------------
A0A3N5PM86      ------------------------------------------------------------
A0A2E5YSA4      ------------------------------------------------------------
A0A519ERR1      ------------------------------------------------------------
A0A4Q3Q1M2      ------------------------------------------------------------
A0A4Q3MHR1      ------------------------------------------------------------
A0A520GDZ4      ------------------------------------------------------------
A0A318DSU0      ------------------------------------------------------------
A0A538PF21      ------------------------------------------------------------
A0A1W1ZH10      ------------------------------------------------------------
A0A1W2FF24      ------------------------------------------------------------
A0A524JYQ6      ------------------------------------------------------------
A0A4Q3MA17      ------------------------------------------------------------
A0A0N0M5F7      ------------------------------------------------------------
A0A537M754      ------------------------------------------------------------
A0A1V1PDB4      ------------------------------------------------------------
A0A2M7C324      ------------------------------------------------------------
A0A4Q3HHG6      ------------------------------------------------------------
A0A3B7DTA4      ------------------------------------------------------------
A0A432ZK62      ------------------------------------------------------------
A0A1V5EEP4      ------------------------------------------------------------
A0A1V5EF48      ------------------------------------------------------------
A0A0S6X1X6      ------------------------------------------------------------
A0A537Y5L8      ------------------------------------------------------------
A0A4Q3L2X2      ------------------------------------------------------------
A0A4Q3T8J1      ------------------------------------------------------------
A0A4Q4ANM4      ------------------------------------------------------------
A0A4Q3UEC7      ------------------------------------------------------------
A0A1H5YYQ4      ------------------------------------------------------------
A0A1X4NLK2      ------------------------------------------------------------
A0A1X4NWB5      ------------------------------------------------------------
A0A1M5UQ38      ------------------------------------------------------------
A0A327YI48      ------------------------------------------------------------
A0A1B1PNL6      ------------------------------------------------------------
A0A2U8H9H9      ------------------------------------------------------------
A0A6B2NBB8      ------------------------------------------------------------
A0A1X6YIC0      ------------------------------------------------------------
A0A1I5E9E9      ------------------------------------------------------------
A0A1X6Z7N7      ------------------------------------------------------------
A0A2E1DQ13      ------------------------------------------------------------
A0A1H8C800      ------------------------------------------------------------
A0A2N3EZ05      ------------------------------------------------------------
A0A3N5J7U8      ------------------------------------------------------------
A0A1S7S3I8      ------------------------------------------------------------
A0A519E8D7      ------------------------------------------------------------
A0A3S1NZ06      ------------------------------------------------------------
A0A3S1FD32      ------------------------------------------------------------
A0A434DUT4      ------------------------------------------------------------
A0A528D3U3      ------------------------------------------------------------
A0A3S3UPT3      ------------------------------------------------------------
A0A3S1E286      ------------------------------------------------------------
A0A531AC71      ------------------------------------------------------------
A0A436K268      ------------------------------------------------------------
A0A434IDQ0      ------------------------------------------------------------
A0A435IRM5      ------------------------------------------------------------
A0A3S2C404      ------------------------------------------------------------
A0A435F6C0      ------------------------------------------------------------
A0A435BMN6      ------------------------------------------------------------
A0A529XQ54      ------------------------------------------------------------
A0A530BJC1      ------------------------------------------------------------
A0A348SRI7      ------------------------------------------------------------
A0A354EI73      ------------------------------------------------------------
A0A4Q3IRI1      ------------------------------------------------------------
A0A4P7EP83      ------------------------------------------------------------
A0A6I1QB25      ------------------------------------------------------------
A0A655ZZQ1      ------------------------------------------------------------
A0A1S0ZAI3      ------------------------------------------------------------
A0A1W9M770      ------------------------------------------------------------
A0A1W9M7R6      ------------------------------------------------------------
A0A3A4NIE9      ------------------------------------------------------------
A0A3A4NUI9      ------------------------------------------------------------
A0A524I3Z6      ------------------------------------------------------------
A0A524PCL7      ------------------------------------------------------------
A0A356GQV1      ------------------------------------------------------------
A0A1J5DAY8      ------------------------------------------------------------
A0A524P237      ------------------------------------------------------------
A0A3C0L0A8      ------------------------------------------------------------
A0A176S762      ------------------------------------------------------------
A0A377ZC40      ------------------------------------------------------------
A0A378BPJ7      ------------------------------------------------------------
A0A2J5PAJ7      ------------------------------------------------------------
A0A377ZDN3      ------------------------------------------------------------
A0A1G3JY11      ------------------------------------------------------------
A0A661N3U1      ------------------------------------------------------------
A0A1W9WUD9      ------------------------------------------------------------
A0A1W1ZQK0      ------------------------------------------------------------
A0A4U1ALN4      ------------------------------------------------------------
A0A4U1B1A8      ------------------------------------------------------------
A0A1M7Y300      ------------------------------------------------------------
A0A4U1A967      ------------------------------------------------------------
A0A6I1R304      ------------------------------------------------------------
A0A1W9PMU6      ------------------------------------------------------------
A0A6D0ELN7      ------------------------------------------------------------
A0A3S1WTQ1      ------------------------------------------------------------
A0A440NX85      ------------------------------------------------------------
A0A530CUR9      ------------------------------------------------------------
A0A1M6N1X5      ------------------------------------------------------------
A0A561M3U0      --------------------------------------MLKKQLEDAEVRYTLLRNKRGS
A0A1G3VVY5      ------------------------------------------------------------
A0A2N6BZD5      ------------------------------------------------------------
A0A656PSQ6      ------------------------------------------------------------
A0A2W5J775      ------------------------------------------------------------
A0A352Q5C1      ------------------------------------------------------------
A0A435NNF5      ------------------------------------------------------------
A0A3S2AQS7      ------------------------------------------------------------
A0A436XH86      ------------------------------------------------------------
A0A527ZPD6      ------------------------------------------------------------
A0A529KRW3      ------------------------------------------------------------
A0A530ZLX0      ------------------------------------------------------------
A0A355TB56      ------------------------------------------------------------
A0A1F9E324      -----------------------------------------MKLSEN-------------
A0A432SAI6      ------------------------------------------------------------
A0A4Q3LBH4      ------------------------------------------------------------
A0A4Q3LWP3      ------------------------------------------------------------
A0A2N6VGL1      ------------------------------------------------------------
A0A3M3H5V6      ------------------------------------------------------------
A0A524M660      ------------------------------------------------------------
A0A0C1TRU6      ------------------------------------------------------------
A0A2Z5SSF4      ------------------------------------------------------------
A0A2T4ZJZ6      ----------------------------------------KEQMEASIVALNEYKNQKGS
A0A327LYE6      ------------------------------------------------------------
A0A5A9ZTV3      ------------------------------------------------------------
A0A4Q4CIB1      ------------------------------------------------------------
A0A522ACJ9      MTDDKA------------------------------------------------------
A0A1T2KYM8      ILSPWR------------------------------------------------------
A0A3N5Z7F8      ------------------------------------------------------------
A0A2G9ZR82      ------------------------------------------------------------
A0A239HD34      ------------------------------------------------------------
A0A4U9I390      ------------------------------------------------------------
A0A534V9L7      ------------------------------------------------------------
A0A0P7ZZE4      ------------------------------------------------------------
A0A369R0Q9      ------------------------------------------------------------
A0A534XP85      ------------------------------------------------------------
A0A2X3M011      ------------------------------------------------------------
I2WC85          ------------------------------------------------------------
A0A400JH80      ------------------------------------------------------------
A0A2H9EHM4      ------------------------------------------------------------
A0A380B3D7      ------------------------------------------------------------
F5NSX0          ------------------------------------------------------------
A0A479JNB1      ------------------------------------------------------------
A0A5C9AF52      ------------------------------------------------------------
A0A6D0EYC7      ------------------------------------------------------------
D8EEU7          ------------------------------------------------------------
A0A0P1H2H0      ------------------------------------------MVEQSKKVLRQKRQARRA
A0A258WKV0      -----------------------------------------GKIGLSGAARNQFITEV--
A0A377N8F8      ------------------------------------------------------------
A5G4N9          ------------------------------------------------------------
A0A3C2DSE7      ------------------------------------------------------------
A0A2X1JBG5      ------------------------------------------------------------
A0A0B8PTA8      ------------------------------------------------------------
A0A0B8QF75      ------------------------------------------------------------
A0A4Q3LR91      --------------------------------------------MLAESRLHTGDVAKEQ
A0A6C9IKN8      ------------------------------------------------------------
A0A4V1TR68      ---MVQ------------------------------------------------------
A0A444IY46      ------------------------------------------------------------
A0A6I7N627      ------------------------------------------------------------
A0A660AID0      ------------------------------------------------------------
A0A3E0WKI3      ------------------------------------------------------------
A0A1H3I2J1      --MGER-----------------------------------RSFSRTPRKALSREARQQL
A0A1V5DJV0      ------------------------------------------------------------
A0A520IUC4      ------------------------------------------------------------
A0A521LJG5      ------------------------------------------------------------
A0A531IBQ7      ------------------------------------------------------------
A0A377LY04      SSRKYA-----------------------------------HVWDDAENKLNAFRQDKDS
A0A5C9ABR5      ------------------------------------------------------------
A0A5J9WU72      ------------------------------------------------------------
A0A2X3K9R3      ------------------------------------------------------------
A0A5W0ZR28      QLPEVR-----------------------------------SRLDVAENKLNAFRQDKDS
A0A622KDG2      --------------------------------------------------------DKDS
A0A3T9EHW9      ------------------------------------------------------------
A0A484X141      --------------------------------------------------MNAFRQDKDS
A0A5N9VWI6      QLPEVR-----------------------------------SRLDVAENKLNAFRQDKDS
A0A6D0EJQ0      ------------------------------------------------------------
A0A376LLF8      ------------------------------------------------------------
A0A444R390      ------------------------------------------------------------
A0A6C9J192      ------------------------------------------------------------
A0A1V4WHZ7      ------------------------------------------------------------
A0A1E5AJN5      QADLVK-----------------------------------QQLTSAERELNDYAKSISF
A0A2N3D2J1      RWQQAR------------------------------------------------------
A0A2N2GVE1      QLLSLR-----------------------------------KKLDEDEKRLYEFKLKNNI
A0A2N2INV3      QLLSLR-----------------------------------KKLDEDEKRLYDFKLKNNI
A0A1Y5DXG5      QLPEIK-----------------------------------KQLEVSEALFNDYQKNQKS
A0A0B8P2H5      KLPEIK-----------------------------------AELTANEDALNKYRQDNES
A0A483QWI8      QLPKVR-----------------------------------ADLDVAEDKLNQYRRQKDS
A0A483UXD3      QLPKVR-----------------------------------ADLDVAEDKLNQYRRQKDS
A0A0A8J8L3      QLPKVR-----------------------------------AELDQAEDKLNVYRKQKDS
A0A660DJ38      QLPKVR-----------------------------------ADLDIAEDKLNSYRKEKDS
A0A380AQW6      ------------------------------------------------------------
A0A2G2GD62      QLDNIN-----------------------------------KTLSKSEKVLQGFKQKNNL
A0A524P331      QLKGTR-----------------------------------EELDRAEQNLQTYKSTSGM
A0A4V1SSM5      ------------------------------------------------------------
A0A4Q3K8G7      ------------------------------------------------------------
A0A1M7HC79      QSPELR-----------------------------------AQLADAEERLNQYRVAMDS
A0A1D3JZN6      QLPQVR-----------------------------------RDLEKAESALNSFQTRSKS
A0A1V6ESG1      TFTDYS-----------------------------------AALSKAEQERVKAESQYRE
A0A1H7YHK3      QLLEVR-----------------------------------KQVEAAQAAMNAYQTKAKS
A0A534SH66      ------------------------------------------------------------
A0A3M0ZZ99      ------------------------------------------------------------
A0A238LBD3      ------------------------------------------------------------
A0A328C2K5      YVSTKR-----------------------------------EELDQASSELQKYQRDNNI
A0A5C6X8M3      YVSTKR-----------------------------------EELDEARSELQKYQRDNNI
A0A3D8MRR7      YVSTKR-----------------------------------EELDESRSELQKYQRDNNI
A0A5C6UBJ7      YVSTKR-----------------------------------EELDESRSELQKYQRDNNI
A0A5C6XGM3      YVSTKR-----------------------------------EELDESRSELQKYQRDNNI
A0A537NZJ1      ------------------------------------------------------------
A0A0P1FRV5      ------------------------------------------------------------
A0A4Q4CVW6      -----------------------------------------SQ-----------------
A0A090R136      HLPNIK-----------------------------------SQLTIAEDLLNAYRQENES
A0A661JU93      ------------------------------------------------------------
A0A2E2T3V8      QLDEAR-----------------------------------KRLETVEQRHADWEKSSGN
A0A367UAB4      QLDEAR-----------------------------------KRLETVEQRHADWEKSSGN
A0A0P1FWI8      ------------------------------------------------------------
A0A377V641      QLPMVR-----------------------------------SDLDSAEDKLNDFRKRNDS
A0A1F2YJ88      QLPELK-----------------------------------QQLDVAEREFNKFRQQYNT
A0A0J7XGZ1      QAAALR-----------------------------------KHAVADDATLQQYMIRNNL
I4CBA7          ELRQAE-----------------------------------ERMRKSQEELVNFAREHGM
A3VE95          QVNEAR-----------------------------------ATVEAAEAALAEYRSDALT
A0A1G0NL95      QLPQVR-----------------------------------ARLETAEDALNRYRLASSS
A0A024KA69      RVKVQR---------------------------------------DGPTYLVSVRANA--
A0A0L1KFN4      QLAEYK-----------------------------------DRLDESQRQLVTYASNQEI
A0A3P5DSS6      ----MR-----------------------------------NDLDLAEDKLNEYRRKSDS
A0A483YEL5      QLPKVR-----------------------------------TELNESEDKLNAYRRQKDS
A0A658GUJ0      QLPKVR-----------------------------------TELNESEDKLNAYRRQKDS
A0A358L616      QLPQVR-----------------------------------GKLDEAEDKLNTYRRNNES
A0A1M7BLL7      -----------------------------------------MKLSRYEAHMRRRAARRDA
A0A0H4KZM1      PAPKPA------------------------------------------------------
A0A3D5UYX7      QLILAR-----------------------------------ASLAEAQAKYNRARQLRAQ
A0A2N1WQN5      ------------------------------------------------------------
A0A352G2C2      QVPAVR-----------------------------------KKLEAAQTALNKYQTGSGS
A0A3C0PZN1      QVPAVR-----------------------------------RNLEAAQTALNKYQTGSRS
A0A524QFS4      QMEVQR-----------------------------------GALNEMEQRILGFKRTHPL
A0A1V1UJT2      -----------------------------------------MNLSRHDAYMRRREARRAA
A0A0L6CVX1      ------------------------------------------------------------
A0A1V0RR48      ------------------------------------------------------------
A0A0A0HJJ4      -----------------------------------------MTLKRHEEYMRRRAARRAE
A0A5E7YA28      -----------------------------------------MSLTRHEEYMRRRAARRAA
A0A520JSW4      QIATTR-----------------------------------RDLERSERQLTAYAQAQRL
A0A4Q3LTF3      -----------------------------------------GRAGASTEAL---------
A0A537UTP9      RIKELR-----------------------------------VQATNAERAVEDFKAKNNI
A0A1D2RNR5      ------------------------------------------------------------
A0A4V1TQ46      SIPEVQ------------------------------------------------------
A0A3A0FZC0      QADELR-----------------------------------EKVADLERELADYAEANSI
A0A1N7JVZ7      FAEDLAFPDLTVEDDAPPARSEKPTPEAAPAAWDDTKMEGHAEADEEKPSVPPTASEPDA
A0A091C4A8      RLEQLR-----------------------------------IQLEDSESRLVEFAQRERI
A0A4R3H6P6      RIEQLR-----------------------------------EKLEVSERDVVAYAAQQGI
A0A3S1NQ09      RLTELR-----------------------------------QSSQAASLAVEKFRAEHGL
A0A443GJ52      RLTELR-----------------------------------ESSQAAALAVEKFRAEHGL
A0A2W6S588      QVEKLR-----------------------------------QQALEADAAVAAYRLKHNI
A0A483E0N4      QLPQVR-----------------------------------SDLDIAEDKLNQYRRKNDS
A0A2J4YQQ6      QLPQVR-----------------------------------SDLDQAEDKLNQYRRQSDS
A0A483THX4      QLPKVR-----------------------------------SELDFAEDKLNLYRQQNDS
A0A534MVS2      RLSEDRENGT-------------------------------LALCKGDQRVEVFYREGMI
A0A444I5K6      RIEELR-----------------------------------QQALDTDLAVQKFRSEHGL
A0A154VE85      RLERLR-----------------------------------EEAAAAQQRLDAYRRETGM
A0A3S1MCW7      ------------------------------------------------------------
A0A434IGN6      ------------------------------------------------------------
A0A528AX40      QVLQVK-----------------------------------QKLQESEENLVAYAKDVGI
A0A528MV95      QVLQVK-----------------------------------QKLQKSEEDLVAYAKDVGI
A0A3C1S9Y1      RIEDER-----------------------------------KKVETAENALLQYKQEQGI
A0A353EH49      QLPPLK-----------------------------------EQLDAAENAYNKYRVQHGS
A0A1Y1Q9C1      EMEKAR-----------------------------------QRLTLQEAKLIEYAKQNNI
A0A3M7LJH0      HLPTIK-----------------------------------TELDSAEDVLNRYRQANDS
A0A316KRG4      KRRGAD-----------------------------------APVDTPDHRPSNAQKP---
A0A1E4JHX8      RLRQWR-----------------------------------ERLEESERVLVAYASDEKI
M2U8P2          RIAELK-----------------------------------TDLQDAETQVANYRARTNL
A0A1H7KZF8      ELANIR-----------------------------------TRLSESERRANDYARRAAI
A0A0J5Q9T7      ------------------------------------------------------------
A0A257NG76      QLPQLK-----------------------------------EQLEAATTALNDYRTRHGS
A0A1T4TW59      RLAVLE-----------------------------------DSLEAAEFALTDFLRQEGL
A0A1I5YYQ0      KNRPVR-----------------------------------AREEDDMRPVAPLERPKDR
A0A5P9FE62      KNRPVR-----------------------------------AREEDDMRPVAPLERPKDR
A0A1Q3MB35      RLAELR-----------------------------------GRLEDAQRQLVAYAADKQI
A0A259LUN7      RVSALQ-----------------------------------EEVEEKERRVETFRAETGL
A0A2D7AVL1      -----------------------------------------AESERIAAYQKYIEAENSP
A0A3B9KZE9      ------------------------------------------------------------
A0A2U0NMP8      QLPKVR-----------------------------------TELNESEDKLNAYRRQKDS
A0A4U9HNE9      QLPQIR-----------------------------------ASLNQAENRLNQFRRQNDS
A0A2G2CXY6      QLPVVR-----------------------------------QELERYEQALNEYQISTQS
A0A3M1D4H3      -IQETR-----------------------------------ARLARARAFQGRESVDQVA
A0A5C8BYM7      TFVDFS-----------------------------------AALAKAEQERFKAESEYEA
A0A1J5ICP0      QIGILE-----------------------------------KSLRSSEGRLMSFKEKEKL
A0A0M3GBT1      RISEQK-----------------------------------ARADTAREAARSYQESMDV
B3Q577          RISEQK-----------------------------------ARADTAREAARSYQESMDV
A0A379B9V4      QLPDVR-----------------------------------QKLSDSENRLNEFRLKNES
A0A0Q6TS97      RIEQLR-----------------------------------EKLEMSERQVVAYAVQQGI
A0A0Q6UYB4      RIEQLR-----------------------------------EKLEMSERQVVAYAVQQGI
A0A484XS37      QLPEVR-----------------------------------SFLDSAEDKLNRFRQANDS
W7Q5J0          QTPELR-----------------------------------HQLTTAEERLNRYRAELDS
A0A654AKT6      GLAWQL-----------------------------------GPTQLAETIWGPYATRTYT
A0A0G9MZA5      QLQQYR-----------------------------------QRLEEAERAVIAYATAQGL
H0T8B0          RVAELH-----------------------------------KQVQESLQAVQDFKFQNAI
A0A5C7N981      HLAQIK-----------------------------------VKLEDSEKNLNAFMRKEGI
A0A534TV22      ------------------------------------------------------MENKST
A0A351CXR4      QMTEIK-----------------------------------VDLKLAENALQDYRTEQGE
A0A2N6GLF5      RIEDLG-----------------------------------EKLKASEIALQSYREREKL
A0A1W9LJP0      QMDEER-----------------------------------KKVEISENALLNYKEMQGI
A0A0W1ICB0      RLQGLR-----------------------------------DRLEKSERDLVNYAARQGI
A0A2E0UL88      QREQAK-----------------------------------IELQAARRVMEEYESKVAS
A0A233IKJ2      RMGDLR-----------------------------------EKLKESEVQLQTFLKSEGL
A0A2T1JE00      RMGDLR-----------------------------------EKLKESEVQLQTFLKSEGL
A0A0T2QIS1      RLAELA-----------------------------------QRLEESERLAVNYAARNDI
A0A376KYN0      ------------------------------------------------------------
A0A2X1JB05      QLPEVR-----------------------------------SELDQAEEKLNVYRQQRDS
A0A376RML0      QLPEVR-----------------------------------SELDQAEEKLNVYRQQRDS
A0A377E5P7      QLPEVR-----------------------------------SELDQAEEKLNVYRQQRDS
A0A0P7Y1D0      RLETLR-----------------------------------EEVRTDEQAVEMYRAENGL
A0A2M7JRZ7      QLEDLK-----------------------------------AKVERADEALQAFGSKHDI
A0A167IR75      QLTEYK-----------------------------------ERLDESQRQLVAYASDQEI
A0A3B8T2U6      SLAGLK-----------------------------------NNLIKSEQALNAFYEKEKL
A0A365PWR2      ELPAMR-----------------------------------AKLEQSELALNRFQTQAGS
A0A2E9H5Z8      QIQ--------------------------------------QLLTLRDDELIDFAEGLKL
A0A2E2BR79      QAPDLR-----------------------------------TQLSSAEDKLNEYRVKMDS
A0A0Q4Q524      QLAQQK-----------------------------------ERLDESQRQLVAYASQERI
A0A0Q4CFJ9      QLAQQK-----------------------------------ERLDESQRQLVTYASQERI
A0A0Q4FE58      QLAQQK-----------------------------------ERLDESQRQLVGYASQERI
A0A0Q4JWC8      QLAQQK-----------------------------------ERLDESQRQLVGYASQERI
A0A0Q4KFL8      QLAQQK-----------------------------------ERLDESQRQLVGYASQERI
A0A522R8R0      DTANAR-----------------------------------ARYFQFKAIVDSGPDNAVR
A0A2U9NDY5      QRPQVR-----------------------------------KELEKAEAALHDYQTSAKA
A0A0Q4IGG1      QLALQK-----------------------------------SRLDDSQRQLVAYASAQQI
X7F6S5          ---RPV-----------------------------------PPLASREERLARRAEDMSA
A0A1G8NKI0      ---APT-----------------------------------PRPDPQAEALAKAQ----A
A0A355QPE4      ---APA-----------------------------------PRPDPQAEALAKAQAEAEA
A0A357RN98      ---APA-----------------------------------PRPDPQAEALAKAQAEAEA
A0A6B2MSQ7      ---PPI-----------------------------------LPLERREERLARRRADRDA
A0A6B2P8H8      ---PPI-----------------------------------LPLERREERLARRRADRDA
A0A1I6U4V1      ---PPI-----------------------------------LPLERREERLARRRADREA
A0A1G7CFZ2      EDISPV-----------------------------------EPLATRAERLARRETKTSA
A0A1P8USW9      ED-PPI-----------------------------------EPLESRETRLARRKAETEA
A0A534RUJ5      KLVELK-----------------------------------ERVEKSEAALNRYRRDKGI
A0A3M1CJM3      QAAELK-----------------------------------TRMEQAEYQLYEYKRKQHI
A0A2R7SVD4      QLPQVK-----------------------------------RDLAKASDALNAYQTHGKT
A0A3C0PWB6      QLPQVR-----------------------------------KELEKAEAALHDYQTSSKS
V4Q8B7          QLPQVR-----------------------------------KELEKAEAALNAYQTSSKS
A0A0Q8XKK5      RLADLR-----------------------------------TRLETSERDLVNYAAEKGI
A0A2E0Q2W0      -MAEQR-----------------------------------ERLEXSEAALISXANEXGI
A0A660NIR6      RLNQLR-----------------------------------TDLENAEANLQAYREEIGL
A0A142W0R3      RIGSLR-----------------------------------RNLEDSERELITYAANNDI
A0A0S4XR18      QLTITH-----------------------------------DNLSKSQLEIKDFKQSNTV
A0A2E0GW64      QLPKVK-----------------------------------TDLNHSEKQLNDYRSQSNI
A0A1A7QJ97      QLTDYK-----------------------------------QRLDESQRQLVTYASNQEI
A0A6I4IKZ3      QLPDLK-----------------------------------KQLDDAERQFNKFRQQYNT
A0A661LW70      SIPEVL------------------------------------------------------
W7Q8F9          QTPELR-----------------------------------SQLTAAEERLNSYRAELDS
A0A524PXH8      QLDVTK-----------------------------------ARLEDSEQLLQQFARGRNI
A0A4Q3P0E4      QLPQYK-----------------------------------KQLEESEEVYNRYRNQKGT
A0A3M2BE89      QLPKLK-----------------------------------AQLETSESRLNDYRLQRGS
A0A4Q4A6K6      LTSDSL-----------------------------------ARLNRFDEVINAIAPDSLS
A0A257G674      QLAEAR-----------------------------------AKLEKSERELNAYARQAGL
A0A661M5M6      QLATLR-----------------------------------QELDEAELALHNFKKGHNV
A0A1I1UM01      EAERQR-----------------------------------EEARQQAEEDARRQAQEDR
Q44573          RTAALRQRWLDAV----------------------------QKANTFDNVHGLTNTSEGS
A2W025          EEPRLK-----------------------------------ADLERAEAALTQYQRTSGS
A0A534Z362      QLRESR-----------------------------------DQVDRAEAALSRFAAEHPN
V4J283          QLPPLK-----------------------------------ARLEAAESAYNDYLREHGT
A0A536T443      ITADPTYASYVDLQVAI------------------------EALARDRAAITQVVARARD
A0A0Q4UFQ5      RLKQLR-----------------------------------IRIDESERALVNYASQQNI
A0A527W7E6      RLTELR-----------------------------------ESSQAASLAVEKFRAEHGL
A0A432EMV7      NLDSLR-----------------------------------EKLSQSEARLREYKDKEGL
A0A087LTV7      SPRGVL-----------------------------------EDGRPGAGDGARVDSAVDL
A0A534WLI3      QLRDAR-----------------------------------AQVERAEGELDHFATDHPS
A0A318KWA2      QAPELR-----------------------------------TQLRAAEDSLNEYRAAQHS
A0A522MT86      ELPRLH-----------------------------------AELDKAEQALSSFQTKAQS
A0A4Q3I221      LRQKALDSDLAVQKFRSSNGLVAAGSVLVAD----------QQLSELNSALIVAQSDTAK
A0A534SAL6      QLLESR-----------------------------------QQLEKAQDTLGRFAADHPN
A0A534ZDB4      QLLESR-----------------------------------QQLEKAQDALGRFAADHPN
A0A534X3M7      QLDESR-----------------------------------QQVERGEAALSRFAAEHPN
A0A534SPC6      QLRESR-----------------------------------DQVDRAEAALSRFAAEHPN
A0A535AD60      QLRESR-----------------------------------EHAERAEAALSRFAAEHPN
A0A4Q3SY08      LQELQR---QAVADAAAVQQYRIQNDLLSTSGATLTEQEISTYNQRVAEARVEAAADQAR
A0A4Q3LG23      AKERLDGSQRQLVNYASAEQI--------------------INLPAQSNGDGRVTSERSI
A0A522EX52      LEASKS---LEFLHYQLPTVK--------------------QSLEVAEMKLNRYRAQSGK
A0A1H3KC95      ---------DPPPPSAESDDV--------------------PRPRRPRLVRKHRKAVPSA
A0A5P8Z4P3      EDDPER---EAEQETDPDTDDDAAEVQNFWGSDVDRDEANDEALDTADASTDVADSDVAE
A0A2E9HXF7      FEEKA----RRKAEFEERAQT--------------------EALRRVKAAREQRAADAMK
A0A0B3RZC9      AREKAQEKLRRRAELEELARA--------------------EALRRVMAARARREAEARK
A0A6F8QET1      AREKAQEKLRRRAELEELARA--------------------EALRRVMAARARREAEAHE
A0A520HUH4      AVALAY---I-------------------------------DSTADFQASTATRQTETGQ
A0A2K8U7M6      YADEHR---IIDLDGQRTLLL--------------------ERLKALGRQETAAFAAQLA
A0A5B9DKL8      MEREHQ---AIRWLGERIKAQ--------------------RRGQTYLISVRASAGDPLM
A0A238KJM1      EEIQAR---LEA----------------------------------------EREAELRR
A0A3A0FJZ4      GDAPLA---ALPAAGREGALR--------------------KHLELEVVDGASPEAAVVR
W4HJV8          RESGPP---DTTSDEPDRGAL--------------------AESEAPPPASVETGVPAGR
A0A0P1GDI0      QEALAR---KAEADARAKAEAEARAAAEERARIEAEAEQRRERARRAREALARQAAEKQR
A0A2R8ATV5      ADLQRR---KAAAAARRRAEE--------------------RRAAEEQARQAAEAAEERA
A0A1U7D3R6      AQEAAR---VAA--------A--------------------RRAERAREAMAQRKAEEAR
A0A2D4UVV2      AQEAAR---VAP--------A--------------------RRAERAREAMAQRKAEEAR
A0A0W7WHP4      AAETQR---ATEEQAKRDAEA--------------------Q-----RAADAKRAADAKR
A0A238J8F6      AAEAKR---LAALEAQKMAAE--------------------EARQKAFAEERAREAERVK
A0A238JQI6      AEEKAR---RKA-EFERIARE--------------------EALRRVAAARARREAEARQ
A0A222E077      FEEKAR---RKA-EFEERAQT--------------------EALRRVKAAREQRAADAMK
A0A239E3Y2      SEEKAR---RKA-EFEERAQV--------------------EALRRVKAAREQRAADALK
A0A1V6FYJ1      ------------------------------------------------------------
A0A445MZQ4      ------------------------------------------------------------
A0A0M9E0E3      ------------------------------------------------------------
A0A0Q6QV61      ------------------------------------------------------------
A0A2Z3IKG4      ------------------------------------------------------------
A0A2W4RFS2      ------------------------------------------------------------
A0A1Y6DC43      ------------------------------------------------------------
A0A2S6HE06      ------------------------------------------------------------
G3J0M3          ------------------------------------------------------------
V5C6R5          ------------------------------------------------------------
A0A354EF47      ------------------------------------------------------------
A0A2G6MSP7      ------------------------------------------------------------
A0A4U8YMP3      ------------------------------------------------------------
A0A1Q8QQ99      ------------------------------------------------------------
A0A3D5ZY44      ------------------------------------------------------------
A0A646J2A6      ------------------------------------------------------------
A0A1G5C236      ------------------------------------------------------------
A0A432HIS7      ------------------------------------------------------------
A0A1I3XJ27      ------------------------------------------------------------
A0A1I7DCG1      ------------------------------------------------------------
A0A3A3H6D9      ------------------------------------------------------------
A0A562CGU2      ------------------------------------------------------------
A0A0Q6VA36      ------------------------------------------------------------
A0A1B2EQN1      ------------------------------------------------------------
A0A1E7HSL6      ------------------------------------------------------------
A0A4Q3ZDI7      ------------------------------------------------------------
A0A537PRC6      ------------------------------------------------------------
A0A2M7JX59      ------------------------------------------------------------
A0A3A4XVN3      ------------------------------------------------------------
A0A1E7JEV6      ------------------------------------------------------------
A0A2N2KDY5      ------------------------------------------------------------
A0A3N5YUD9      ------------------------------------------------------------
A0A0W1DLQ3      ------------------------------------------------------------
A0A246JVD8      ------------------------------------------------------------
A0A2N3BB54      ------------------------------------------------------------
A0A1H6G7A3      ------------------------------------------------------------
A0A0A7PGL6      ------------------------------------------------------------
A0A4Q2Z4L0      ------------------------------------------------------------
A0A5C4N0H6      ------------------------------------------------------------
A0A4R1HDF2      ------------------------------------------------------------
A0A1E7HFN0      ------------------------------------------------------------
A0A1M5GH86      ------------------------------------------------------------
A0A1W1XQZ5      ------------------------------------------------------------
A0A3D6C3I2      ------------------------------------------------------------
S0G1D4          ------------------------------------------------------------
A0A661T246      ------------------------------------------------------------
A0A2G6CSG7      ------------------------------------------------------------
A0A2G6NB59      ------------------------------------------------------------
A0A5K8A7T9      ------------------------------------------------------------
A0A1W9U045      ------------------------------------------------------------
A0A1F9L9G4      ------------------------------------------------------------
A0A328FD76      ------------------------------------------------------------
A0A348UX90      ------------------------------------------------------------
A0A357Z0N5      ------------------------------------------------------------
A0A0F2R2U0      ------------------------------------------------------------
A0A5K7ZK00      ------------------------------------------------------------
A0A5K7YCX8      ------------------------------------------------------------
A0A5K7Z388      ------------------------------------------------------------
A0A352B502      ------------------------------------------------------------
A0A2K8WHP8      ------------------------------------------------------------
A0A410V446      ------------------------------------------------------------
A0A0R3KGJ5      ------------------------------------------------------------
A0A0R3N604      ------------------------------------------------------------
A0A1B1UCM8      ------------------------------------------------------------
A0A1N6JQ20      ------------------------------------------------------------
A0A1M5TI07      ------------------------------------------------------------
A3X191          ------------------------------------------------------------
A0A1H4RKV5      ------------------------------------------------------------
A0A160UA87      ------------------------------------------------------------
A0A1Q5SFV5      ------------------------------------------------------------
A0A1J5N774      ------------------------------------------------------------
A0A2C8F781      ------------------------------------------------------------
A0A2E3R6G0      ------------------------------------------------------------
A0A1F8XMK2      ------------------------------------------------------------
A0A3M8EMP2      ------------------------------------------------------------
A0A2J6J6K6      ------------------------------------------------------------
A0A661PSB9      ------------------------------------------------------------
A0A661QBT6      ------------------------------------------------------------
A0A1G6EKK9      ------------------------------------------------------------
A0A6I2SLK2      ------------------------------------------------------------
A0A0A8WSG4      ------------------------------------------------------------
S7TK97          ------------------------------------------------------------
S7UE93          ------------------------------------------------------------
A0A3D5BR56      ------------------------------------------------------------
A0A2N2IB15      ------------------------------------------------------------
A0A1I3PSR2      ------------------------------------------------------------
A0A1I4GEK4      ------------------------------------------------------------
A0A2T5R3J5      ------------------------------------------------------------
A0A1W7QPT7      ------------------------------------------------------------
A0A0M4D373      ------------------------------------------------------------
A0A1L3GKM9      ------------------------------------------------------------
A0A430DNP0      ------------------------------------------------------------
A0A3A0FQ32      ------------------------------------------------------------
A0A1E4UZA0      ------------------------------------------------------------
A0A1H9KL56      ------------------------------------------------------------
A0A1A9KEF8      ------------------------------------------------------------
A0A5E6PKN5      ------------------------------------------------------------
A0A0N9W1V6      ------------------------------------------------------------
A0A423GQ41      ------------------------------------------------------------
A0A423H7J2      ------------------------------------------------------------
A0A502HNM8      ------------------------------------------------------------
A0A4Q7H223      ------------------------------------------------------------
A0A1H4N2K9      ------------------------------------------------------------
A0A2K4KWF7      ------------------------------------------------------------
A0A3E0WXH2      ------------------------------------------------------------
A0A2N2TRC8      ------------------------------------------------------------
A0A1V4CIZ7      ------------------------------------------------------------
A0A1M3BXA5      ------------------------------------------------------------
A0A1Y2R3U6      ------------------------------------------------------------
A0A167HVD6      ------------------------------------------------------------
A0A1V3SCT6      ------------------------------------------------------------
L0H287          ------------------------------------------------------------
A0A495VG93      ------------------------------------------------------------
A0A4R3MYM4      ------------------------------------------------------------
G2E3C0          ------------------------------------------------------------
A0A4U8YLL7      ------------------------------------------------------------
A0A3N5RNY4      ------------------------------------------------------------
A0A1V4M8I1      ------------------------------------------------------------
A0A4Z0M4C7      ------------------------------------------------------------
A0A5Q2QDL1      ------------------------------------------------------------
A0A1I0R9R6      ------------------------------------------------------------
A0A443K010      ------------------------------------------------------------
A0A6I7NYG5      ------------------------------------------------------------
A0A238IZI1      ------------------------------------------------------------
A0A316GHM6      ------------------------------------------------------------
A0A520ZTR8      ------------------------------------------------------------
A0A212AR83      ------------------------------------------------------------
A0A2E2P4I0      ------------------------------------------------------------
A0A2U2CM86      ------------------------------------------------------------
A0A1X7ACC1      ------------------------------------------------------------
A0A2N3BVE7      ------------------------------------------------------------
A0A2S5JE21      ------------------------------------------------------------
A0A2R8BKZ2      ------------------------------------------------------------
A0A2S8S361      ------------------------------------------------------------
A0A238KUF6      ------------------------------------------------------------
A0A095CTW3      ------------------------------------------------------------
A0A2E3UGD6      ------------------------------------------------------------
A0A2T0RFH0      ------------------------------------------------------------
A0A285D390      ------------------------------------------------------------
A0A497VHN4      ------------------------------------------------------------
A0A318CT66      ------------------------------------------------------------
A0A3N5P205      ------------------------------------------------------------
A0A2N6BEI9      ------------------------------------------------------------
A0A0D5N3E9      ------------------------------------------------------------
A0A2N2G716      ------------------------------------------------------------
W9VVY5          ------------------------------------------------------------
A0A1E2URD3      ------------------------------------------------------------
A0A2T6MY81      ------------------------------------------------------------
A0A2T6NBQ8      ------------------------------------------------------------
A0A421K431      ------------------------------------------------------------
A0A2G2I5M1      ------------------------------------------------------------
A0A2G2M6F0      ------------------------------------------------------------
A0A1W9J9F8      ------------------------------------------------------------
A0A2S5LFJ9      ------------------------------------------------------------
A0A2D8R8F8      ------------------------------------------------------------
A0A6I4JXQ8      ------------------------------------------------------------
A0A010SNS0      ------------------------------------------------------------
A0A0C2I782      ------------------------------------------------------------
A0A2N8BYF5      ------------------------------------------------------------
A0A558FKX2      ------------------------------------------------------------
A0A1H1DBA0      ------------------------------------------------------------
J2TAD5          ------------------------------------------------------------
J3H699          ------------------------------------------------------------
A0A1H5J974      ------------------------------------------------------------
A0A0K1QRZ4      ------------------------------------------------------------
A0A560RJW9      ------------------------------------------------------------
A0A5E6TID7      ------------------------------------------------------------
A0A5E7CRU7      ------------------------------------------------------------
A0A5E7C564      ------------------------------------------------------------
A0A2W7MAV4      ------------------------------------------------------------
A0A4R3WQH5      ------------------------------------------------------------
W6VFG3          ------------------------------------------------------------
A0A1P8ENT1      ------------------------------------------------------------
A0A2N7XRV4      ------------------------------------------------------------
A0A0Q6QPG8      ------------------------------------------------------------
A0A0F4SWA7      ------------------------------------------------------------
A0A423J219      ------------------------------------------------------------
A0A4P6G9U8      ------------------------------------------------------------
A0A4Y8JE06      ------------------------------------------------------------
A0A502I1X9      ------------------------------------------------------------
A0A502J776      ------------------------------------------------------------
A0A5B0EZF6      ------------------------------------------------------------
A0A059L434      ------------------------------------------------------------
A0A0F4UWN2      ------------------------------------------------------------
A0A5E7WEF5      ------------------------------------------------------------
A0A1G0KSD0      ------------------------------------------------------------
A0A4P6WX84      ------------------------------------------------------------
A0A1D2S760      ------------------------------------------------------------
A0A5B8RW94      ------------------------------------------------------------
A0A258TN88      ------------------------------------------------------------
A0A1F9EUS2      ------------------------------------------------------------
A0A6H9HII8      ------------------------------------------------------------
A0A3N9VAW3      ------------------------------------------------------------
A0A1X0YE57      ------------------------------------------------------------
A0A2K2H9Q8      ------------------------------------------------------------
A0A6I1KNW9      ------------------------------------------------------------
A0A1H4B8T3      ------------------------------------------------------------
A0A1E7IQC3      ------------------------------------------------------------
A0A1M6KEN5      ------------------------------------------------------------
A0A353QLL3      ------------------------------------------------------------
A0A399I453      ------------------------------------------------------------
A0A651FBV9      ------------------------------------------------------------
A0A5C1MDH8      ------------------------------------------------------------
A0A5A9XE04      ------------------------------------------------------------
A0A643G9R1      ------------------------------------------------------------
A0A1G0M8Q7      ------------------------------------------------------------
A0A353MI14      ------------------------------------------------------------
A0A4S1CAW7      ------------------------------------------------------------
A0A562VHD2      ------------------------------------------------------------
A0A6I6JNB5      ------------------------------------------------------------
A0A1G0LDK7      ------------------------------------------------------------
A0A6F9WVL7      ------------------------------------------------------------
A0A2M7WWF7      ------------------------------------------------------------
A0A351Z9A2      ------------------------------------------------------------
A0A351B422      ------------------------------------------------------------
F2NEE9          ------------------------------------------------------------
B7RS54          ------------------------------------------------------------
A0A3N5FRH4      ------------------------------------------------------------
A0A1V4Y2C3      ------------------------------------------------------------
A0A2N2KTJ4      ------------------------------------------------------------
A0A2N2LQX0      ------------------------------------------------------------
A0A520CSP5      ------------------------------------------------------------
A0A1I6ENM4      ------------------------------------------------------------
A8LNM8          ------------------------------------------------------------
A0A0T5NSU3      ------------------------------------------------------------
A0A5P9I718      ------------------------------------------------------------
A0A2M8J3R9      ------------------------------------------------------------
A0A1I6X762      ------------------------------------------------------------
A0A0P1EFX8      ------------------------------------------------------------
A0A2G5KB39      ------------------------------------------------------------
A0A2N3CNV1      ------------------------------------------------------------
A0A257F1F4      ------------------------------------------------------------
A0A1G9FY29      ------------------------------------------------------------
A0A4Q3ZBK4      ------------------------------------------------------------
A0A2D5J8T8      ------------------------------------------------------------
A0A2E3P9W6      ------------------------------------------------------------
A0A2G2B1P9      ------------------------------------------------------------
A0A258GCD5      ------------------------------------------------------------
A0A2D9YR88      ------------------------------------------------------------
A0A443INY4      ------------------------------------------------------------
A0A372IH36      ------------------------------------------------------------
A0A540VW45      ------------------------------------------------------------
A0A1H9C241      ------------------------------------------------------------
A0A2E3FCR1      ------------------------------------------------------------
A0A4S3MG69      ------------------------------------------------------------
A0A3E0H727      ------------------------------------------------------------
A0A1G8QZS5      ------------------------------------------------------------
A0A1V4QMH7      ------------------------------------------------------------
A0A496XZQ4      ------------------------------------------------------------
A0A1F9BJF7      ------------------------------------------------------------
F2NDF5          ------------------------------------------------------------
A0A1I3TTC3      ------------------------------------------------------------
A0A1H3IZW6      ------------------------------------------------------------
A0A0M6YG59      ------------------------------------------------------------
A0A1H7G8B0      ------------------------------------------------------------
A0A059IPK4      ------------------------------------------------------------
A0A1H2Y469      ------------------------------------------------------------
A0A497ZQU7      ------------------------------------------------------------
A0A318D3U4      ------------------------------------------------------------
A0A401FQP5      ------------------------------------------------------------
A0A1Q6DMW3      ------------------------------------------------------------
A0A3A6P8F8      ------------------------------------------------------------
A0A2G2DSM4      ------------------------------------------------------------
A0A1F9NI02      ------------------------------------------------------------
A0A4U1ABX4      ------------------------------------------------------------
A0A351Z4H9      ------------------------------------------------------------
A0A2N2KML4      ------------------------------------------------------------
E1YJF1          ------------------------------------------------------------
A0A1J5EVZ6      ------------------------------------------------------------
A0A2G6FCC5      ------------------------------------------------------------
A0A1F9MR25      ------------------------------------------------------------
A0A2G6M7F1      ------------------------------------------------------------
A0A1E7H876      ------------------------------------------------------------
A0A509L3P8      ------------------------------------------------------------
A0A3A4S038      ------------------------------------------------------------
A0A1F9N669      ------------------------------------------------------------
A0A1F9PFA7      ------------------------------------------------------------
A0A1H2EN09      ------------------------------------------------------------
K0NP00          ------------------------------------------------------------
A0A1E7JCL5      ------------------------------------------------------------
A0A496YAH9      ------------------------------------------------------------
A0A1V4S7E4      ------------------------------------------------------------
A0A2N2H8D2      ------------------------------------------------------------
A0A2N2KC63      ------------------------------------------------------------
A0A3A4ZYW4      ------------------------------------------------------------
A0A1V4MCJ4      ------------------------------------------------------------
A0A661M0W4      ------------------------------------------------------------
A0A0F2NF69      ------------------------------------------------------------
A0A1F9NFD0      ------------------------------------------------------------
A0A1M5YLH5      ------------------------------------------------------------
A0A4U1A4C7      ------------------------------------------------------------
                                                                            

E1Y9C0          ------------------------------------------------------------
A0A1N6SH58      ------------------------------------------------------------
A0A4Q3AQN2      ------------------------------------------------------------
A0A1W9HS52      KDTSFNLAHVASEALVDRNFERLKEKVYRLKDFVGRQTSERKKILEDLEQHRVELQRKHE
A0A2D5LFD8      ESFDLSELQLAGRITI--TPVGEGR--------TGQGAGILNVKLKGKDPDNDK--ILLD
A0A0N0XAV4      ------------------------------------------------------------
A0A0P9QD19      ------------------------------------------------------------
F3FHG4          ------------------------------------------------------------
F3GGI0          -------------------RLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A0P9LE74      ------------------------------------------------------------
A0A3M4ZQ14      TDFTVSRQRTFSTALSYQNRLKITE--------AGRDSGIIYLSIEDPDAQKAN--RILE
A0A3M5YLE8      TDFTVSRQRTFSTALSYQNRLKITE--------AGRDSGIIYLSIEDPDAQKAN--RILE
A0A3M3RP89      TDFTVSRQRTFSTALSYQNRLKITE--------AGRDSGIIYLSIEDPDAQKAN--RILE
A0A0P9QIY7      TDFTVSRQRTFSTALSYQNRLKITE--------AGRDSGIIYLSIEDPDAQKAN--RILE
A0A0P9VVH7      TDFTVSRQRTFSTALSYQNRLKITE--------AGRDSGIIYLSIEDPDAQKAN--RILE
A0A0Q0FJK6      TDFTVSRQRTFSTALSYQNRLKITE--------AGRDSGIIYLSIEDPDAQKAN--RILE
A0A0Q0G2J0      TDFTVSRQRTFSTALSYQNRLKITE--------AGRDSGIIYLSIEDPDAQKAN--RILE
A0A3M3LF66      TDFTVSRQRTFSTALSYQNRLKITE--------AGRDSGIIYLSIEDPDAQKAN--RILE
A0A0P9WIR8      TDFTVSRQRTFSTALSYQNRLKITE--------AGRDSGIIYLSIEDPDAQKAN--RILE
A0A3M3KPE5      TDFTVSRQRTFSTALSYQNRLKITE--------AGRDSGIIYLSIEDPDAQKAN--RILE
A0A3M4C263      TDFTVSRQRTFSTALSYQNRLKITE--------AGRDSGIIYLSIEDPDAQKAN--RILE
A0A3M5AD05      TDFTVSRQRTFSTALSYQNRLKITE--------AGRDSGIIYLSIEDPDAQKAN--RILE
A0A0Q0D3D2      TDFSVSRQRTLSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQEAQRAN--RILD
A0A0N0FS39      ------------------------------------------------------------
A0A3M6GHH2      ------------------------------------------------------------
A0A0P9R9W0      TNFSLSRQRTLSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQNAQRAN--RILD
A0A0Q0B9T0      TNFSLSRQRTLSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQNAQRAN--RILD
A0A3M6CFI7      TNFSLSRQRTLSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQNAQRAN--RILD
A0A0P9JXN0      TNFSLSRQRTLSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A3M6FIV7      TNFSLSRQRTLSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A3M3PLW9      TDFTVSRQRTLSTALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A3M4ENY1      TDFTVSRQRTLSTALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A3M5EZK7      TDFTVSRQRTLSTALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A0P9SPP5      TDFSVSRQRTLSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A658KL17      TDFSVSRQRTLSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A3M3NNF2      TDFSVSRQRTLSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A3M4A0E8      TDFSVSRQRTLSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A3M4PBZ2      TDFSVSRQRTLSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A3M6AI26      TDFSVSRQHTLSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A0P9IWP8      TDFSVSRQRTLSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQEAQRAN--RILD
A0A0P9KZ49      TDFSVSRQRTLSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A0P9V840      TDFSVSRQRTLSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A0Q0AIE5      TDFSVSRQRTLSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A3M2ZQH6      TDFSVSRQRTLSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A0N8SQG2      TDFSVSRQRTLSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A0W8HFU1      TDFSVSRQRTLSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A3M5M873      TDFSVSRQRTLSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A0P9VHH8      TDFSVSRQRTLSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQEAQRAN--RILD
A0A0P9YV98      TDFSVSRQRTLSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A3M3G2W8      TDFSVSRQRTLSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A3M6C224      TDFSVSRQRTLSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A3M5K254      TDFSVSRQRTLSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--QILD
A0A3M5JFB0      TDFSVSRQRTLSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--QILD
A0A3M3TQV3      TDFSVSRQRTLSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A3M3EF92      TDFSVSRQRTLSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQNAQRAN--RILD
A0A3M5J1E2      TDFSVSRQRTLSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQNAQRAN--RILD
A0A3M5G7H9      TDFSVSRQRTLSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A3M4A376      TDFSVSRQRTLSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A0Q0A5T8      TDFSVSRQRTLSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A0P9SCD7      TDFSVSRQRTLSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A0P9T4G3      TDFSVSRQRTLSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A0P9VKB0      TDFSVSRQRTLSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A0Q0BM35      TDFSVSRQRTLSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A3M3TPR7      TDFSVSRQRTLSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A3M3U4Q3      TDFSVSRQRTLSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A0P9UCX7      TDFSVSRQRTLSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A0P9S1F1      TDFSVSRQRTLSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A0P9QCJ2      TDFSVSRQRTLSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A0P9Q329      TDFSVSRQRTLSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A3M5GJ64      TDFSVSRQRTLSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A0P9MPC7      TDFSVSRQRTLSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A3M2XYQ3      TDFTVSRQRTLSTALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A0P9XCE1      TDFTVSRQRTLSTALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A3M3EFX7      TDFTVSRQRTLSTALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A3M5B9D9      TDFTVSRQRTLSTALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A0P9RRZ3      TDFTVSRQRTLSTALLYQNRLKIIE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A3M2VEK7      TDFTVSRQRTLSTALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A0N8R9B3      TDFTVSRQRTLSTALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A0P9VA27      TDFTVSRQRTLSTALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A3M4YBJ4      TDFTVSRQRTLSTALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A0P9J470      TDFTVSRQRTLSTALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A0Q0EVJ8      TDFTVSRQRTLSTALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A3M5UI30      TDFSVSRQRTLSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A3M5YQT8      TDFSVSRQRTLSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--QILD
A0A3M5F5X1      TDFSVSRQRTLSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A3M5R8G1      TDFSVSRQRTLSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A3M5V012      TDFSVSRQRTLSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A3M3GA16      TDFSVSRQRTLSTALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A3M3UCT3      TDFTVSRQRTLSTALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A3M3CJL0      TDFTVSRQRTLSTALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A3M3F6F5      TDFTVSRQRTLSTALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A3M3P9B7      TDFTVSRQRTLSTALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A0N8QB74      TDFTVSRQRTLSTALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A0Q0AUD0      TDFTVSRQRTLSTALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A3M5VR55      TDFTVSRQRTLSTALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A0Q0FK97      TDFTISRQRTLSTALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A3M5KZ75      TDFTVSRQRTLSTALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A3M5L3G5      TDFTVSRQRTLSTALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILD
A0A0C5VQ86      ------------------------------------------------------------
A0A1V8MBH1      ------------------------------------------------------------
A0A534QGR3      ------------------------------------------------------------
A0A0R0BVC7      ------------------------------------------------------------
A0A0W1GMS6      ------------------------------------------------------------
A0A0Q8RMY3      ------------------------------------------------------------
A0A1A7QC21      ------------------------------------------------------------
A0A1F9CFF0      ------------------------------------------------------------
A0A2M8B0G5      ------------------------------------------------------------
A0A363TNU9      ------------------------------------------------------------
A0A534HBS8      ------------------------------------------------------------
A0A0F0T3Y9      ------------------------------------------------------------
A0A379GWF0      ------------------------------------------------------------
A0A536T0W8      ------------------------------------------------------------
A0A4Q2XLV7      ------------------------------------------------------------
A0A4Q5QYC4      ------------------------------------------------------------
A0A2G9XLE5      ------------------------------------------------------------
A0A3D2M6Y9      ------------------------------------------------------------
A0A3D2YAZ2      ------------------------------------------------------------
A0A350A102      ------------------------------------------------------------
A0A350L5D2      ------------------------------------------------------------
A0A3B8SQ27      ------------------------------------------------------------
A0A656BWB0      ------------------------------------------------------------
A0A6D0IFH4      ------------------------------------------------------------
A0A3Y2RPN4      ------------------------------------------------------------
A0A0A0FHV8      ------------------------------------------------------------
A0A1X3IPU7      ------------------------------------------------------------
A0A0A0G0N2      ------------------------------------------------------------
A0A243TPR1      ------------------------------------------------------------
A0A2I8SDU4      ------------------------------------------------------------
A0A2I8SU55      ------------------------------------------------------------
S1EXJ6          ------------------------------------------------------------
A0A376UBS1      ------------------------------------------------------------
A0A4Q6G931      ------------------------------------------------------------
A0A1W9F5M9      ------------------------------------------------------------
A0A3C2BN18      ------------------------------------------------------------
A0A447LR75      ------------------------------------------------------------
A0A376D8L7      ------------------------------------------------------------
A0A1V2FV46      ------------------------------------------------------------
A0A376SB61      ------------------------------------------------------------
A0A3D1BYV9      ------------------------------------------------------------
A0A6D0I9G1      ------------------------------------------------------------
A0A352MMI7      ------------------------------------------------------------
A0A379W6R2      ------------------------------------------------------------
A0A376RY66      ------------------------------------------------------------
A0A377K431      ------------------------------------------------------------
A0A379TA56      ------------------------------------------------------------
A0A4Z0LWV1      ------------------------------------------------------------
A0A5V7HTZ1      ------------------------------------------------------------
A0A610XNI4      ------------------------------------------------------------
A0A620QD02      ------------------------------------------------------------
A0A5H3HSJ8      ------------------------------------------------------------
A0A655C5P0      ------------------------------------------------------------
A0A2T0VBD8      ------------------------------------------------------------
A0A378APS2      ------------------------------------------------------------
A0A443VCQ6      ------------------------------------------------------------
A0A447RKQ7      ------------------------------------------------------------
W1DSK1          ------------------------------------------------------------
A0A0U2VAW2      ------------------------------------------------------------
A0A454CTF1      ------------------------------------------------------------
A0A6B3Q2G1      NEDTFTISKISKLDAINKLASQLSI--------SERGSQTGIVSLSIEGEYPDHNQLVLN
A0A378G3G7      ------------------------------------------------------------
A0A2X5NHJ9      ------------------------------------------------------------
A0A2J4QEC3      ------------------------------------------------------------
A0A485ADM3      ------------------------------------------------------------
A0A4U9HGU4      ------------------------------------------------------------
A0A3S4JGG5      ------------------------------------------------------------
A0A377ZDH2      ------------------------------------------------------------
A0A3S4HTS8      ------------------------------------------------------------
A0A2N1XK22      ------------------------------------------------------------
A0A3D0KAC8      ------------------------------------------------------------
A0A3D2Y902      ------------------------------------------------------------
A0A655RNN3      ------------------------------------------------------------
A0A655R819      ------------------------------------------------------------
A0A655ZEY0      ------------------------------------------------------------
A0A6G6X2Z4      ------------------------------------------------------------
Q44570          ------------------------------------------------------------
A0A3N5MZ53      ------------------------------------------------------------
A0A534E4H4      ------------------------------------------------------------
A0A534I2B6      ------------------------------------------------------------
A0A1C2JGD0      ------------------------------------------------------------
A0A259LQ70      ------------------------------------------------------------
A0A4V2SPR5      ------------------------------------------------------------
A0A3N5PM86      ------------------------------------------------------------
A0A2E5YSA4      ------------------------------------------------------------
A0A519ERR1      ------------------------------------------------------------
A0A4Q3Q1M2      ------------------------------------------------------------
A0A4Q3MHR1      ------------------------------------------------------------
A0A520GDZ4      ------------------------------------------------------------
A0A318DSU0      ------------------------------------------------------------
A0A538PF21      ------------------------------------------------------------
A0A1W1ZH10      ------------------------------------------------------------
A0A1W2FF24      ------------------------------------------------------------
A0A524JYQ6      ------------------------------------------------------------
A0A4Q3MA17      ------------------------------------------------------------
A0A0N0M5F7      ------------------------------------------------------------
A0A537M754      ------------------------------------------------------------
A0A1V1PDB4      ------------------------------------------------------------
A0A2M7C324      ------------------------------------------------------------
A0A4Q3HHG6      ------------------------------------------------------------
A0A3B7DTA4      ------------------------------------------------------------
A0A432ZK62      ------------------------------------------------------------
A0A1V5EEP4      ------------------------------------------------------------
A0A1V5EF48      ------------------------------------------------------------
A0A0S6X1X6      ------------------------------------------------------------
A0A537Y5L8      ------------------------------------------------------------
A0A4Q3L2X2      ------------------------------------------------------------
A0A4Q3T8J1      ------------------------------------------------------------
A0A4Q4ANM4      ------------------------------------------------------------
A0A4Q3UEC7      ------------------------------------------------------------
A0A1H5YYQ4      ------------------------------------------------------------
A0A1X4NLK2      ------------------------------------------------------------
A0A1X4NWB5      ------------------------------------------------------------
A0A1M5UQ38      ------------------------------------------------------------
A0A327YI48      ------------------------------------------------------------
A0A1B1PNL6      ------------------------------------------------------------
A0A2U8H9H9      ------------------------------------------------------------
A0A6B2NBB8      ------------------------------------------------------------
A0A1X6YIC0      ------------------------------------------------------------
A0A1I5E9E9      ------------------------------------------------------------
A0A1X6Z7N7      ------------------------------------------------------------
A0A2E1DQ13      ------------------------------------------------------------
A0A1H8C800      ------------------------------------------------------------
A0A2N3EZ05      ------------------------------------------------------------
A0A3N5J7U8      ------------------------------------------------------------
A0A1S7S3I8      ------------------------------------------------------------
A0A519E8D7      ------------------------------------------------------------
A0A3S1NZ06      --------------------------AEHGLSASSDGQLMSAKQLADLNAQLIVAQADTA
A0A3S1FD32      ------------------------------------------------------------
A0A434DUT4      ------------------------------------------------------------
A0A528D3U3      ------------------------------------------------------------
A0A3S3UPT3      ------------------------------------------------------------
A0A3S1E286      ------------------------------------------------------------
A0A531AC71      ------------------------------------------------------------
A0A436K268      ------------------------------------------------------------
A0A434IDQ0      ------------------------------------------------------------
A0A435IRM5      ------------------------------------------------------------
A0A3S2C404      ------------------------------------------------------------
A0A435F6C0      ------------------------------------------------------------
A0A435BMN6      ------------------------------------------------------------
A0A529XQ54      ------------------------------------------------------------
A0A530BJC1      ------------------------------------------------------------
A0A348SRI7      ------------------------------------------------------------
A0A354EI73      ------------------------------------------------------------
A0A4Q3IRI1      ------------------------------------------------------------
A0A4P7EP83      ------------------------------------------------------------
A0A6I1QB25      ------------------------------------------------------------
A0A655ZZQ1      ------------------------------------------------------------
A0A1S0ZAI3      ------------------------------------------------------------
A0A1W9M770      ------------------------------------------------------------
A0A1W9M7R6      ------------------------------------------------------------
A0A3A4NIE9      ------------------------------------------------------------
A0A3A4NUI9      ------------------------------------------------------------
A0A524I3Z6      ------------------------------------------------------------
A0A524PCL7      ------------------------------------------------------------
A0A356GQV1      ------------------------------------------------------------
A0A1J5DAY8      ------------------------------------------------------------
A0A524P237      ------------------------------------------------------------
A0A3C0L0A8      ------------------------------------------------------------
A0A176S762      ------------------------------------------------------------
A0A377ZC40      ------------------------------------------------------------
A0A378BPJ7      ------------------------------------------------------------
A0A2J5PAJ7      ------------------------------------------------------------
A0A377ZDN3      ------------------------------------------------------------
A0A1G3JY11      ------------------------------------------------------------
A0A661N3U1      ------------------------------------------------------------
A0A1W9WUD9      ------------------------------------------------------------
A0A1W1ZQK0      ------------------------------------------------------------
A0A4U1ALN4      ------------------------------------------------------------
A0A4U1B1A8      ------------------------------------------------------------
A0A1M7Y300      ------------------------------------------------------------
A0A4U1A967      ------------------------------------------------------------
A0A6I1R304      ------------------------------------------------------------
A0A1W9PMU6      ------------------------------------------------------------
A0A6D0ELN7      ------------------------------------------------------------
A0A3S1WTQ1      ------------------------------------------------------------
A0A440NX85      ------------------------------------------------------------
A0A530CUR9      ------------------------------------------------------------
A0A1M6N1X5      ------------------------------------------------------------
A0A561M3U0      VDLTEEAKI---------------------------------------------------
A0A1G3VVY5      ------------------------------------------------------------
A0A2N6BZD5      ------------------------------------------------------------
A0A656PSQ6      ------------------------------------------------------------
A0A2W5J775      ------------------------------------------------------------
A0A352Q5C1      ------------------------------------------------------------
A0A435NNF5      ------------------------------------------------------------
A0A3S2AQS7      ------------------------------------------------------------
A0A436XH86      ------------------------------------------------------------
A0A527ZPD6      ------------------------------------------------------------
A0A529KRW3      ------------------------------------------------------------
A0A530ZLX0      ------------------------------------------------------------
A0A355TB56      ------------------------------------------------------------
A0A1F9E324      ------------------------------------------------------------
A0A432SAI6      ------------------------------------------------------------
A0A4Q3LBH4      ------------------------------------------------------------
A0A4Q3LWP3      ------------------------------------------------------------
A0A2N6VGL1      ------------------------------------------------------------
A0A3M3H5V6      ------------------------------------------------------------
A0A524M660      ------------------------------------------------------------
A0A0C1TRU6      ------------------------------------------------------------
A0A2Z5SSF4      ------------------------------------------------------------
A0A2T4ZJZ6      VNLDIETQN---------------------------------------------------
A0A327LYE6      ------------------------------------------------------------
A0A5A9ZTV3      ------------------------------------------------------------
A0A4Q4CIB1      ------------------------------------------------------------
A0A522ACJ9      ------------------------------------------------------------
A0A1T2KYM8      ------------------------------------------------------------
A0A3N5Z7F8      ------------------------------------------------------------
A0A2G9ZR82      ------------------------------------------------------------
A0A239HD34      ------------------------------------------------------------
A0A4U9I390      ------------------------------------------------------------
A0A534V9L7      ------------------------------------------------------------
A0A0P7ZZE4      ------------------------------------------------------------
A0A369R0Q9      ------------------------------------------------------------
A0A534XP85      ------------------------------------------------------------
A0A2X3M011      ------------------------------------------------------------
I2WC85          ------------------------------------------------------------
A0A400JH80      ------------------------------------------------------TRILNS
A0A2H9EHM4      ------------------------------------------------------------
A0A380B3D7      ------------------------------------------------------------
F5NSX0          ------------------------------------------------------------
A0A479JNB1      ------------------------------------------------------------
A0A5C9AF52      ------------------------------------------------------------
A0A6D0EYC7      ------------------------------------------------------------
D8EEU7          ------------------------------------------------------------
A0A0P1H2H0      ARAARAAEG---------------------------------------------------
A0A258WKV0      ------------------------------------------------------------
A0A377N8F8      ------------------------------------------------------------
A5G4N9          ------------------------------------------------------------
A0A3C2DSE7      ------------------------------------------------------------
A0A2X1JBG5      ------------------------------------------------------------
A0A0B8PTA8      ------------------------------------------------------------
A0A0B8QF75      ------------------------------------------------------------
A0A4Q3LR91      L-----------------------------------------------------------
A0A6C9IKN8      ------------------------------------------------------------
A0A4V1TR68      ------------------------------------------------------------
A0A444IY46      ------------------------------------------------------------
A0A6I7N627      ------------------------------------------------------------
A0A660AID0      ------------------------------------------------------------
A0A3E0WKI3      ------------------------------------------------------------
A0A1H3I2J1      ISDMLDEE----------------------------------------------------
A0A1V5DJV0      ------------------------------------------------------------
A0A520IUC4      ------------------------------------------------------------
A0A521LJG5      ------------------------------------------------------------
A0A531IBQ7      ------------------------------------------------------------
A0A377LY04      VDLPLEAKS---------------------------------------------------
A0A5C9ABR5      ------------------------------------------------------------
A0A5J9WU72      ------------------------------------------------------------
A0A2X3K9R3      MDLPLEAKA---------------------------------------------------
A0A5W0ZR28      VDLPLEAKA---------------------------------------------------
A0A622KDG2      VDLPLEAKA---------------------------------------------------
A0A3T9EHW9      ------------------------------------------------------------
A0A484X141      VDLPLEAKA---------------------------------------------------
A0A5N9VWI6      VDLPLEAKA---------------------------------------------------
A0A6D0EJQ0      ------------------------------------------------------------
A0A376LLF8      ------------------------------------------------------------
A0A444R390      ------------------------------------------------------------
A0A6C9J192      ------------------------------------------------------------
A0A1V4WHZ7      ------------------------------------------------------------
A0A1E5AJN5      TDLEEQPAILASRLSAVNDALNAAVQDRLELGLIVQQIT------------EGKAPSLSA
A0A2N3D2J1      ---------------------------------------------------GSAIFSLPD
A0A2N2GVE1      LAVSLEARI-----QSTTGLILSRSNSVETLDGMARELRAKIQQVRRMRTTDPTLDPSAD
A0A2N2INV3      LAVSLEARI-----QSTTGLILSRSNAVETLDGMARELRAKIQQVRRMRTTDPTLDPSAD
A0A1Y5DXG5      VNISLETQG---------------------------------------------------
A0A0B8P2H5      VDLGLEAQS---------------------------------------------------
A0A483QWI8      VDLSLEAKS---------------------------------------------------
A0A483UXD3      VDLSLEAKS---------------------------------------------------
A0A0A8J8L3      VDLSMEAKT---------------------------------------------------
A0A660DJ38      VDLSMEAKS---------------------------------------------------
A0A380AQW6      ------------------------------------------------------------
A0A2G2GD62      LSLDIKAAMVSKNVEKIGTEISSLSSEESILENLKEYIDENDDLTGLTVQSLET------
A0A524P331      IKLDAEAEELVRKLSGIEKERAAVAMQRNQVEFALAALKKARRRGGVYSPAAFR------
A0A4V1SSM5      ------------------------------------------------------------
A0A4Q3K8G7      ------------------------------------------------------------
A0A1M7HC79      VDLSSESQA---------------------------------------------------
A0A1D3JZN6      IDISLEAKA---------------------------------------------------
A0A1V6ESG1      MERSPENSAQVL------------------------------------------------
A0A1H7YHK3      VDITMQTKG---------------------------------------------------
A0A534SH66      ------------------------------------------------------------
A0A3M0ZZ99      ------------------------------------------------------------
A0A238LBD3      ------------------------------------------------------------
A0A328C2K5      LSHSFEDRR-----EMAAEGLASVSEQHREVQARLFAEEALLNQLENMESSGEDLRALGD
A0A5C6X8M3      LSHTFEDRR-----EMAAEGLAAVSTQLREVQARLFAEEALLNQLETMESRGDDLRALGD
A0A3D8MRR7      LSHTFEDRR-----EMAAEGLAAVSTQLRDVQARLFAEEALLNQLETMESRGDDLRALGD
A0A5C6UBJ7      LSHTFEDRR-----EMAAEGLAAVSTQLRDVQARLFAEEALLNQLETMESRGDDLRALGD
A0A5C6XGM3      LSHTFEDRR-----EMAAEGLAAVSTQLREVQARLFAEEALLNQLETMESRGDDLRALGD
A0A537NZJ1      ------------------------------------------------------------
A0A0P1FRV5      ------------------------------------------------------------
A0A4Q4CVW6      ------------------------------------------------------------
A0A090R136      IDLGLEAKS---------------------------------------------------
A0A661JU93      ------------------------------------------------------------
A0A2E2T3V8      IADRERELILERIYDLNAELDTAFQEREAARMLFEKRQAVKSSEELLALPDIA-------
A0A367UAB4      IADRERELILERIYDLNAELDTAFQEKEAARMLFEKRQAVKSSEELLALPDIA-------
A0A0P1FWI8      ------------------------------------------------------------
A0A377V641      VDLSLEAKS---------------------------------------------------
A0A1F2YJ88      VDVTKESEL---------------------------------------------------
A0A0J7XGZ1      MSAEGATMA--------EQEVSELNRQIADAQAQLAEQRGKLGAAQAQIARGGGGADIGS
I4CBA7          VLLDDEPELESSLLETAGKTFLDIRNERLNLETLTLHKQMILPKYI--------------
A3VE95          REGGTYETSTQQLGNLSSQLVVARSERVTAEAQYEQLRNLLENQGLDALAKAV-------
A0A1G0NL95      ADLEIETQG---------------------------------------------------
A0A024KA69      ------------------------------------------------------------
A0A0L1KFN4      INLPSQSVGDGSTTQERSIVVDNLAALNAALNEATADRIAAEARFRQAGGSGSSAEAL--
A0A3P5DSS6      VDLSLEAKS---------------------------------------------------
A0A483YEL5      VDLSLEAKS---------------------------------------------------
A0A658GUJ0      VDLSLEAKS---------------------------------------------------
A0A358L616      VDMSLEAKS---------------------------------------------------
A0A1M7BLL7      LENPHSHSP---------------------------------------------------
A0A0H4KZM1      ------------------------------------------------------------
A0A3D5UYX7      ---------------------------------------------------GGSVESVAD
A0A2N1WQN5      ------------------------------------------------------------
A0A352G2C2      VDITAETQS---------------------------------------------------
A0A3C0PZN1      VDITAETQS---------------------------------------------------
A0A524QFS4      ETLEARRDA---------------------------------------------------
A0A1V1UJT2      EEAGEMPEPVYEESC---------------------------------------------
A0A0L6CVX1      ------------------------------------------------------------
A0A1V0RR48      ------------------------------------------------------------
A0A0A0HJJ4      MEA----------EA---------------------------------------------
A0A5E7YA28      LEA----------EA---------------------------------------------
A0A520JSW4      ISTSSSDEGGDTNSLTGSSLVALNTALATTQARRIAAEQRYREAALGGATTE--------
A0A4Q3LTF3      ------------------------------------------------------------
A0A537UTP9      VAASGRLMNEQQLSELNTSLIQARALTAETKAKLDRIDEILRTGVEVPDATVTDSL----
A0A1D2RNR5      ------------------------------------------------------------
A0A4V1TQ46      ------------------------------------------------------------
A0A3A0FZC0      VAVNKDENITAQKMSQLNRLLTDATAKRIEAENLYKEAEAALSNPSAGF-----------
A0A1N7JVZ7      PNSSGPGADTRSDAATAPDAPLVLQDTQRADAPEPAPK----------------------
A0A091C4A8      VDAIDGSSLSTQSLSELNSTLAAAQDQRIRAEARWKHAE------------SASGMGLSA
A0A4R3H6P6      INLPSPIDPNTGGAAGGGGRSLLTDDLIALNSALEVATAERIVAESRLNE-AKRPDASSI
A0A3S1NQ09      AANSDGQLMSDKQLSDLNAQLIVAQADTARASARYQQYKAIVDSGSENA--FKDAAISSD
A0A443GJ52      AVN-DGQLISDKKLGDLNGQLIEAQADTARASARYQQYKSIVESGSDNA--FRDAAISAD
A0A2W6S588      LTDPNATLPDNELSNIGVQLSDARGA----------------AAQAETRSAASGSTVISG
A0A483E0N4      VDLSLEAKS---------------------------------------------------
A0A2J4YQQ6      VDLSLEAKS---------------------------------------------------
A0A483THX4      VDLSLEAKS---------------------------------------------------
A0A534MVS2      EAVSSNVDLHRLGHYLVKEGWLQS------------------------------------
A0A444I5K6      VEAGSGTLISDQQLSEINTQLINAQAETAKAEARYARVKSIIDAKQTDAIVTDVL-----
A0A154VE85      LEIGGGSIYRDQLTQVNAQLVAARGSRTEAEARAAQARRLIGQGSNTGTNTGGGLETAAA
A0A3S1MCW7      -----------------------------------------------------------P
A0A434IGN6      -----------------NTALATAIQERLDAGRMVDQID------------KGRGASLGP
A0A528AX40      TITGDDKSLIGSNIEALNTALATAIQERLDAGRMVDQID------------KGRGSSLGP
A0A528MV95      TITGDEKSLIGSNIETLNTALATAIQERLDAGRMVDQID------------KGRGSSLGP
A0A3C1S9Y1      ITGFSNDAEKITAEKLAKLNNQVVEFESKRVETETRYQQALALEKT-----PDLLDSIPE
A0A353EH49      IDLGAETTG---------------------------------------------------
A0A1Y1Q9C1      LEVNNSQSSQERKLDELYSALGEAERARIQAESQMIQGRKRTNAHAVL------------
A0A3M7LJH0      IDLSLEAKS---------------------------------------------------
A0A316KRG4      ------------------------------------------------------------
A0A1E4JHX8      INLPAAGATRDGPTVERSIVADDLASLNAELSAAKGEMVRAHSRVTEVGANGAVEEAL--
M2U8P2          VDIKDDSTAAQQILSQLGAELAQAEAEQAVAE-------------------SRAASPAAA
A0A1H7KZF8      IAVPARKNQRTDATLTSDTLDRVNQQLSDAAQRRIRAQADWRAVA------ARPPLSIPE
A0A0J5Q9T7      ------------------------------------------------------------
A0A257NG76      IDLDLETQS---------------------------------------------------
A0A1T4TW59      IELDDIDELAGTELTNLTIRVSEAKERRVAAEAIYSLLQSSGSSAASLLSVPEIS-----
A0A1I5YYQ0      VPQDAAPPAALE------------------------------------------------
A0A5P9FE62      VPQDAAPPASVE------------------------------------------------
A0A1Q3MB35      ITLANGQDESGRTDTAETLVSNDLKVLNGALADATRARITAESTVRQTSSASEGSL----
A0A259LUN7      LEAQGTTLT--------EQQIAYLTSQRSELQIELDRARARYEAMRRQIDSGAGVEGVSE
A0A2D7AVL1      ITLDVL------------------------------------------------------
A0A3B9KZE9      ------------------------------------------------------------
A0A2U0NMP8      VDLSLEAKS---------------------------------------------------
A0A4U9HNE9      VDLSLEAKS---------------------------------------------------
A0A2G2CXY6      VDITIETQA---------------------------------------------------
A0A3M1D4H3      ATTSA-------------------------------------------------------
A0A5C8BYM7      VRRTPDTARQVL------------------------------------------------
A0A1J5ICP0      VSLSDDARATLQQLMNFDTELKQAEGLRKQAEFIAENIMQSDGMPDKSIVALGAST----
A0A0M3GBT1      ISKEDAQDERLKSLIELTGREGKIEETRVEVKAVISTLEAADSASVAVQNIA--------
B3Q577          ISKEDAQDERLKSLIELTGREGKIEETRVEVKAVISTLEAADSASVAVQNIA--------
A0A379B9V4      VDLSLEAKA---------------------------------------------------
A0A0Q6TS97      INLPSSVDASTSGAAVGGRSLLTDDLIALNSALEVATAERIVAESRLNE--IKRPDASSI
A0A0Q6UYB4      INLPSSVDASTSGAAVGGRSLLTDDLIALNSALEVATAERIVAESRLNE--IKRPDASSI
A0A484XS37      VDLSLEAKS---------------------------------------------------
W7Q5J0          VDLSSEAQA---------------------------------------------------
A0A654AKT6      NFFEIFYFARVSGFSREAGFFSSLLVASLIAYLLTEK-----------------------
A0A0G9MZA5      VSIDVPREDGDSAGTASQTLVATELAAFNSALQQATTQRIAAEAALAARSGANAGSTE--
H0T8B0          ILGSQGRLASEVELDKLAKELAKSRAETIQAQAKLEQITHVLVQRSKSQDFDVSSPAVPD
A0A5C7N981      VRPDDKQQSPDAQVLGEFTSALAKSQGERIRAETLYQQAKAGDVATLQA--VV-------
A0A534TV22      LSLSQVI-----------------------------------------------------
A0A351CXR4      TTTRSLESS---------------------------------------------------
A0A2N6GLF5      IEVGGVSTLTAQQLQDLGGQLVMAEQRRATAESSLRQINALKGQPVERL--ASIPAVL--
A0A1W9LJP0      ITNFSNDAENITAEKLAKLNAQVVESESQRVEAETRYRQALAAQNSPDM--LDSISQVL-
A0A0W1ICB0      VRLSEIQGEDGRTRTTQTLASSDLEQLNRLLVQATAERAEAESKLSAAR--APGATQLGL
A0A2E0UL88      IEPTLSTKITETADPMIQQLAREKAQVDLEIQKAEFGRDNALAARPELE--EY-------
A0A233IKJ2      VDIQGVESLASQELEELTSQLNKTRDRRVAAETLYLVAQTYSRQDSDLS--ALASIPEIS
A0A2T1JE00      VDIQGVESLASQELEELTSQLNKTRDRRVAAETLYLVAQTYSRQDSDLS--ALASIPEIS
A0A0T2QIS1      VLLGRTITPDGRTLVDRTLTSSDLEALNTALAQATAE-----RVAAESR--ARTAGPSEL
A0A376KYN0      ------------------------------------------------------------
A0A2X1JB05      VDLNLEAKA---------------------------------------------------
A0A376RML0      VDLNLEAKA---------------------------------------------------
A0A377E5P7      VDLNLEAKA---------------------------------------------------
A0A0P7Y1D0      LDTGGSTLTEQQISDLNAQLAIQRAELSAAESSLRN------VQTQLER--GASLDTIGE
A0A2M7JRZ7      ISLEEKENVTMQRLTELNEVLTKAESERMAKE----------ALYRQTK--DKHFDALPS
A0A167IR75      VNLPSEGGNDGTNTQERPIVVDNLASLNAALNEATADRIA--AEARFRR--AGGGGSSAE
A0A3B8T2U6      VNIDGVIGLASEELQRYTALFVDAQNNLARVRSIFEQVNGQESKQDLAS--LQEVQ----
A0A365PWR2      VDISLEIEG---------------------------------------------------
A0A2E9H5Z8      ------------------------------------------------------------
A0A2E2BR79      VDLDSESQS---------------------------------------------------
A0A0Q4Q524      INLPAQQNGDGTTSERSIVADDLASLNTALSQATAERIAAEARYREGGR--AGASSEAL-
A0A0Q4CFJ9      INLPAQSNADGSTAERSIVADDLASLNTALSQATAERIAAESRYREGSR--AGASSEAL-
A0A0Q4FE58      INLPAQSNADGSTSERSIVADDLASLNTALSQATAERIAVEARYREGGR--AGASSEAL-
A0A0Q4JWC8      INLPAQSNADGSTSERSIVADDLASLNTALSQATAERIAVEARYREGGR--AGASSEAL-
A0A0Q4KFL8      INLPAQSNADGSTSERSIVADDLASLNTALSQATAERIAVEARYREGGR--AGASSEAL-
A0A522R8R0      NATIPVNKDSGTGT----------------------------------------------
A0A2U9NDY5      VDSSSETKG---------------------------------------------------
A0A0Q4IGG1      INLPAQGAGSGGSTTVERSIVADDLAALNATLSQATAERIQAQARAQQS--GRAGASTEA
X7F6S5          T-----------------------------------------------------------
A0A1G8NKI0      QAEAQR------------------------------------------------------
A0A355QPE4      QAEVQR------------------------------------------------------
A0A357RN98      QAEAQR------------------------------------------------------
A0A6B2MSQ7      E-----------------------------------------------------------
A0A6B2P8H8      E-----------------------------------------------------------
A0A1I6U4V1      E-----------------------------------------------------------
A0A1G7CFZ2      AQAT--------------------------------------------------------
A0A1P8USW9      AAAAEE------------------------------------------------------
A0A534RUJ5      ISLDDKENIVVARLTDLNARLTDAEAERIGLE----------AQMRSVS--QTDYDSLPA
A0A3M1CJM3      LSVSLEDRQNIISQRLQDLNQTLNKVQAERIALEARRQKILDIKEHRLA--LDAVDKVI-
A0A2R7SVD4      VNISLETQS---------------------------------------------------
A0A3C0PWB6      VDISIETKG---------------------------------------------------
V4Q8B7          VDISIETKG---------------------------------------------------
A0A0Q8XKK5      TALGTSKSADGRTEVERTLVSSDLEALNAALASATADRLAAESRSVRQR--GASPQAL--
A0A2E0Q2W0      VVLQRGASGDSEGGGQQTLVETRLSQLNEALA----------EATARRI--EAEGASRAA
A0A660NIR6      VATPTSALGGNERQLDNSSDRLIAARVERQRLEQVYHQVQRGSRNRYEV--PEVF-----
A0A142W0R3      ITLETRSDPGTGRTIGDRTLVAADVEKISTALSVARDARIAAESQLSSS--VSSTDLS--
A0A0S4XR18      ATIPNSASTLLNAMVDIDTQLQQANMKLSVLEGLIRQMKTGNGINFVSI--DVLGA----
A0A2E0GW64      LDISAESKM---------------------------------------------------
A0A1A7QJ97      INLPATSEGAQERPIVADNLAALNSALSEAIADRIA------AESRFRQ--AGSAGSTAA
A0A6I4IKZ3      VDVTKESEL---------------------------------------------------
A0A661LW70      ------------------------------------------------------------
W7Q8F9          VDLSSEAQA---------------------------------------------------
A0A524PXH8      YALEQEELVIHEKLADLNARLTEAESQRITVE----------SLYQQSQ--GASRDSLPI
A0A4Q3P0E4      VAFDEEAKL---------------------------------------------------
A0A3M2BE89      VDVGLEAEA---------------------------------------------------
A0A4Q4A6K6      LAGIDTPGSEVL------------------------------------------------
A0A257G674      IRDRNPSNTIDKGSTSGSVTTASLLQVNTAANQAQATRIAAQQRWNLVS--RSDPLNSPD
A0A661M5M6      LSVSMEDRQNLVASDVQTTHAKLTEIRNRRIELEARLKRLNASLGEAPK--QIDPAVVA-
A0A1I1UM01      LRAEEEARRQAEQDR---------------------------------------------
Q44573          TSTPLIERQIADTSANLSQAEGRLAAAQARAD----------ALQDAAA--RGDARAAVA
A2W025          INASDEAKVYLEGSVQ--------------------------------------------
A0A534Z362      VAINEEQKTVAQRIADVSSLLSKAEGARLALH----------SRYEFLT--RPHGDALAY
V4J283          IDITRETEN---------------------------------------------------
A0A536T443      GGVPVDELTMIGAVQ---------------------------------------------
A0A0Q4UFQ5      VNIPGSTDSNGQTTGERSLVVDDLANLNRELAQATAE-----RVAAESR--LNSGGATKE
A0A527W7E6      SANSDGQLLSDKQLADLNAQLIVAQADTARASARYQQYKAIVDSGSETA--FNDSAIAAD
A0A432EMV7      VDSESFAAQTSDKLGELTSELVKAKAKRAEAEVLFKQ-----VKAAEKR--GDDYGSLAA
A0A087LTV7      IASEPVLASAARALGLAGEQAPDWLGSRVKVQ----R-----EGPTYLV--SV-------
A0A534WLI3      VAVNQEQRLVAQRTAELSDLLTKAEADRVGLE----S-----RNEFLSH--AD-SEPLAY
A0A318KWA2      VDLTSEAQA---------------------------------------------------
A0A522MT86      MQPTSEAQAYLQGGID--------------------------------------------
A0A4Q3I221      AEARLQRIAQIIASGQGDAIVTDVL-----------------------------------
A0A534SAL6      VAINQEQKTVAQRIGEVSSLLTKVEGTRLNLE----S-----RYQFLTT--PG-SDPLAF
A0A534ZDB4      VAINEEQKTVAQRIGEVSSLLTKVEGTRLNLE----T-----RYEFLTT--PG-SEALAY
A0A534X3M7      VAVNEEQKTVAQRITDVSSLLTRAEGTRVELQ----T-----QNDSLAK--KQYGDLLAF
A0A534SPC6      VAINEEQKTVAQRIADVSSLLSKAEGARLALH----S-----RYEFLTR--PH-GDALAY
A0A535AD60      VAINEEQKTVAQRISDVSSLLSKAEGTRLALH----S-----RYEFLTR--PD-GDALAY
A0A4Q3SY08      LNTARQQLATG-------------------------S-----TGEDVGE--AL-------
A0A4Q3LG23      VADDLATINSALSQAIADRIQAEARFRQVGAA----G-----ASTEALR--NS-------
A0A522EX52      LDIKL------------------------------------------QT--EN-------
A0A1H3KC95      PEERH-------------------------------------DVPSTPR--AT-------
A0A5P8Z4P3      MDQDFAPGGHPPKSAQPATVEASDMSEPLADE----P-----NARDAES--LP-------
A0A2E9HXF7      AREDA-------------------------------------ERQESAR--QH-------
A0A0B3RZC9      AAERA-------------------------------------EAEAALQ--AE-------
A0A6F8QET1      AAERA-------------------------------------EAEAALQ--AE-------
A0A520HUH4      TALLRLSREAEAAAASVARYRADSGIVQGGGV----G-----TINDQQV--GP-------
A0A2K8U7M6      AQTEA-------------------------------R-----QAGTDAA--AT-------
A0A5B9DKL8      AARLANGVANA-------------------FL----R-----IEVEGKV--DD-------
A0A238KJM1      IALERIAARKE----------------------------------------RE-------
A0A3A0FJZ4      IAFRSPDRALA-----------------LGVV----R-----ASAEQLI--AE-------
W4HJV8          VNATSLSSDSD-------------------------S-----DSDSDSD--SD-------
A0A0P1GDI0      LAEEQAKAEAEEKARLAAEAEAQAEAARLAKL----A-----EERAAEA--KR-------
A0A2R8ATV5      QAKAAALARQK-------------------------A-----EAIKRAK--AE-------
A0A1U7D3R6      LAEEQ---RQA-------------------------A-----AQREAER--LR-------
A0A2D4UVV2      LAEEQ---RQA-------------------------A-----AQREAER--LR-------
A0A0W7WHP4      AAEEQ----------------------------------------------AR-------
A0A238J8F6      AAEQAEKDRQR-------------------------V-----EAE------KR-------
A0A238JQI6      KAEAEAAEKAR-------------------------T-----EAEDAAR--KA-------
A0A222E077      AREDA-------------------------------------ERQESAR--QH-------
A0A239E3Y2      ASEDA-------------------------------------ERQERER--QH-------
A0A1V6FYJ1      ------------------------------------------------------------
A0A445MZQ4      ------------------------------------------------------------
A0A0M9E0E3      ------------------------------------------------------------
A0A0Q6QV61      ------------------------------------------------------------
A0A2Z3IKG4      ------------------------------------------------------------
A0A2W4RFS2      ------------------------------------------------------------
A0A1Y6DC43      ------------------------------------------------------------
A0A2S6HE06      ------------------------------------------------------------
G3J0M3          ------------------------------------------------------------
V5C6R5          ------------------------------------------------------------
A0A354EF47      ------------------------------------------------------------
A0A2G6MSP7      ------------------------------------------------------------
A0A4U8YMP3      ------------------------------------------------------------
A0A1Q8QQ99      ------------------------------------------------------------
A0A3D5ZY44      ------------------------------------------------------------
A0A646J2A6      ------------------------------------------------------------
A0A1G5C236      ------------------------------------------------------------
A0A432HIS7      ------------------------------------------------------------
A0A1I3XJ27      ------------------------------------------------------------
A0A1I7DCG1      ------------------------------------------------------------
A0A3A3H6D9      ------------------------------------------------------------
A0A562CGU2      ------------------------------------------------------------
A0A0Q6VA36      ------------------------------------------------------------
A0A1B2EQN1      ------------------------------------------------------------
A0A1E7HSL6      ------------------------------------------------------------
A0A4Q3ZDI7      ------------------------------------------------------------
A0A537PRC6      ------------------------------------------------------------
A0A2M7JX59      ------------------------------------------------------------
A0A3A4XVN3      ------------------------------------------------------------
A0A1E7JEV6      ------------------------------------------------------------
A0A2N2KDY5      ------------------------------------------------------------
A0A3N5YUD9      ------------------------------------------------------------
A0A0W1DLQ3      ------------------------------------------------------------
A0A246JVD8      ------------------------------------------------------------
A0A2N3BB54      ------------------------------------------------------------
A0A1H6G7A3      ------------------------------------------------------------
A0A0A7PGL6      ------------------------------------------------------------
A0A4Q2Z4L0      ------------------------------------------------------------
A0A5C4N0H6      ------------------------------------------------------------
A0A4R1HDF2      ------------------------------------------------------------
A0A1E7HFN0      ------------------------------------------------------------
A0A1M5GH86      ------------------------------------------------------------
A0A1W1XQZ5      ------------------------------------------------------------
A0A3D6C3I2      ------------------------------------------------------------
S0G1D4          ------------------------------------------------------------
A0A661T246      ------------------------------------------------------------
A0A2G6CSG7      ------------------------------------------------------------
A0A2G6NB59      ------------------------------------------------------------
A0A5K8A7T9      ------------------------------------------------------------
A0A1W9U045      ------------------------------------------------------------
A0A1F9L9G4      ------------------------------------------------------------
A0A328FD76      ------------------------------------------------------------
A0A348UX90      ------------------------------------------------------------
A0A357Z0N5      ------------------------------------------------------------
A0A0F2R2U0      ------------------------------------------------------------
A0A5K7ZK00      ------------------------------------------------------------
A0A5K7YCX8      ------------------------------------------------------------
A0A5K7Z388      ------------------------------------------------------------
A0A352B502      ------------------------------------------------------------
A0A2K8WHP8      ------------------------------------------------------------
A0A410V446      ------------------------------------------------------------
A0A0R3KGJ5      ------------------------------------------------------------
A0A0R3N604      ------------------------------------------------------------
A0A1B1UCM8      ------------------------------------------------------------
A0A1N6JQ20      ------------------------------------------------------------
A0A1M5TI07      ------------------------------------------------------------
A3X191          ------------------------------------------------------------
A0A1H4RKV5      ------------------------------------------------------------
A0A160UA87      ------------------------------------------------------------
A0A1Q5SFV5      ------------------------------------------------------------
A0A1J5N774      ------------------------------------------------------------
A0A2C8F781      ------------------------------------------------------------
A0A2E3R6G0      ------------------------------------------------------------
A0A1F8XMK2      ------------------------------------------------------------
A0A3M8EMP2      ------------------------------------------------------------
A0A2J6J6K6      ------------------------------------------------------------
A0A661PSB9      ------------------------------------------------------------
A0A661QBT6      ------------------------------------------------------------
A0A1G6EKK9      ------------------------------------------------------------
A0A6I2SLK2      ------------------------------------------------------------
A0A0A8WSG4      ------------------------------------------------------------
S7TK97          ------------------------------------------------------------
S7UE93          ------------------------------------------------------------
A0A3D5BR56      ------------------------------------------------------------
A0A2N2IB15      ------------------------------------------------------------
A0A1I3PSR2      ------------------------------------------------------------
A0A1I4GEK4      ------------------------------------------------------------
A0A2T5R3J5      ------------------------------------------------------------
A0A1W7QPT7      ------------------------------------------------------------
A0A0M4D373      ------------------------------------------------------------
A0A1L3GKM9      ------------------------------------------------------------
A0A430DNP0      ------------------------------------------------------------
A0A3A0FQ32      ------------------------------------------------------------
A0A1E4UZA0      ------------------------------------------------------------
A0A1H9KL56      ------------------------------------------------------------
A0A1A9KEF8      ------------------------------------------------------------
A0A5E6PKN5      ------------------------------------------------------------
A0A0N9W1V6      ------------------------------------------------------------
A0A423GQ41      ------------------------------------------------------------
A0A423H7J2      ------------------------------------------------------------
A0A502HNM8      ------------------------------------------------------------
A0A4Q7H223      ------------------------------------------------------------
A0A1H4N2K9      ------------------------------------------------------------
A0A2K4KWF7      ------------------------------------------------------------
A0A3E0WXH2      ------------------------------------------------------------
A0A2N2TRC8      ------------------------------------------------------------
A0A1V4CIZ7      ------------------------------------------------------------
A0A1M3BXA5      ------------------------------------------------------------
A0A1Y2R3U6      ------------------------------------------------------------
A0A167HVD6      ------------------------------------------------------------
A0A1V3SCT6      ------------------------------------------------------------
L0H287          ------------------------------------------------------------
A0A495VG93      ------------------------------------------------------------
A0A4R3MYM4      ------------------------------------------------------------
G2E3C0          ------------------------------------------------------------
A0A4U8YLL7      ------------------------------------------------------------
A0A3N5RNY4      ------------------------------------------------------------
A0A1V4M8I1      ------------------------------------------------------------
A0A4Z0M4C7      ------------------------------------------------------------
A0A5Q2QDL1      ------------------------------------------------------------
A0A1I0R9R6      ------------------------------------------------------------
A0A443K010      ------------------------------------------------------------
A0A6I7NYG5      ------------------------------------------------------------
A0A238IZI1      ------------------------------------------------------------
A0A316GHM6      ------------------------------------------------------------
A0A520ZTR8      ------------------------------------------------------------
A0A212AR83      ------------------------------------------------------------
A0A2E2P4I0      ------------------------------------------------------------
A0A2U2CM86      ------------------------------------------------------------
A0A1X7ACC1      ------------------------------------------------------------
A0A2N3BVE7      ------------------------------------------------------------
A0A2S5JE21      ------------------------------------------------------------
A0A2R8BKZ2      ------------------------------------------------------------
A0A2S8S361      ------------------------------------------------------------
A0A238KUF6      ------------------------------------------------------------
A0A095CTW3      ------------------------------------------------------------
A0A2E3UGD6      ------------------------------------------------------------
A0A2T0RFH0      ------------------------------------------------------------
A0A285D390      ------------------------------------------------------------
A0A497VHN4      ------------------------------------------------------------
A0A318CT66      ------------------------------------------------------------
A0A3N5P205      ------------------------------------------------------------
A0A2N6BEI9      ------------------------------------------------------------
A0A0D5N3E9      ------------------------------------------------------------
A0A2N2G716      ------------------------------------------------------------
W9VVY5          ------------------------------------------------------------
A0A1E2URD3      ------------------------------------------------------------
A0A2T6MY81      ------------------------------------------------------------
A0A2T6NBQ8      ------------------------------------------------------------
A0A421K431      ------------------------------------------------------------
A0A2G2I5M1      ------------------------------------------------------------
A0A2G2M6F0      ------------------------------------------------------------
A0A1W9J9F8      ------------------------------------------------------------
A0A2S5LFJ9      ------------------------------------------------------------
A0A2D8R8F8      ------------------------------------------------------------
A0A6I4JXQ8      ------------------------------------------------------------
A0A010SNS0      ------------------------------------------------------------
A0A0C2I782      ------------------------------------------------------------
A0A2N8BYF5      ------------------------------------------------------------
A0A558FKX2      ------------------------------------------------------------
A0A1H1DBA0      ------------------------------------------------------------
J2TAD5          ------------------------------------------------------------
J3H699          ------------------------------------------------------------
A0A1H5J974      ------------------------------------------------------------
A0A0K1QRZ4      ------------------------------------------------------------
A0A560RJW9      ------------------------------------------------------------
A0A5E6TID7      ------------------------------------------------------------
A0A5E7CRU7      ------------------------------------------------------------
A0A5E7C564      ------------------------------------------------------------
A0A2W7MAV4      ------------------------------------------------------------
A0A4R3WQH5      ------------------------------------------------------------
W6VFG3          ------------------------------------------------------------
A0A1P8ENT1      ------------------------------------------------------------
A0A2N7XRV4      ------------------------------------------------------------
A0A0Q6QPG8      ------------------------------------------------------------
A0A0F4SWA7      ------------------------------------------------------------
A0A423J219      ------------------------------------------------------------
A0A4P6G9U8      ------------------------------------------------------------
A0A4Y8JE06      ------------------------------------------------------------
A0A502I1X9      ------------------------------------------------------------
A0A502J776      ------------------------------------------------------------
A0A5B0EZF6      ------------------------------------------------------------
A0A059L434      ------------------------------------------------------------
A0A0F4UWN2      ------------------------------------------------------------
A0A5E7WEF5      ------------------------------------------------------------
A0A1G0KSD0      ------------------------------------------------------------
A0A4P6WX84      ------------------------------------------------------------
A0A1D2S760      ------------------------------------------------------------
A0A5B8RW94      ------------------------------------------------------------
A0A258TN88      ------------------------------------------------------------
A0A1F9EUS2      ------------------------------------------------------------
A0A6H9HII8      ------------------------------------------------------------
A0A3N9VAW3      ------------------------------------------------------------
A0A1X0YE57      ------------------------------------------------------------
A0A2K2H9Q8      ------------------------------------------------------------
A0A6I1KNW9      ------------------------------------------------------------
A0A1H4B8T3      ------------------------------------------------------------
A0A1E7IQC3      ------------------------------------------------------------
A0A1M6KEN5      ------------------------------------------------------------
A0A353QLL3      ------------------------------------------------------------
A0A399I453      ------------------------------------------------------------
A0A651FBV9      ------------------------------------------------------------
A0A5C1MDH8      ------------------------------------------------------------
A0A5A9XE04      ------------------------------------------------------------
A0A643G9R1      ------------------------------------------------------------
A0A1G0M8Q7      ------------------------------------------------------------
A0A353MI14      ------------------------------------------------------------
A0A4S1CAW7      ------------------------------------------------------------
A0A562VHD2      ------------------------------------------------------------
A0A6I6JNB5      ------------------------------------------------------------
A0A1G0LDK7      ------------------------------------------------------------
A0A6F9WVL7      ------------------------------------------------------------
A0A2M7WWF7      ------------------------------------------------------------
A0A351Z9A2      ------------------------------------------------------------
A0A351B422      ------------------------------------------------------------
F2NEE9          ------------------------------------------------------------
B7RS54          ------------------------------------------------------------
A0A3N5FRH4      ------------------------------------------------------------
A0A1V4Y2C3      ------------------------------------------------------------
A0A2N2KTJ4      ------------------------------------------------------------
A0A2N2LQX0      ------------------------------------------------------------
A0A520CSP5      ------------------------------------------------------------
A0A1I6ENM4      ------------------------------------------------------------
A8LNM8          ------------------------------------------------------------
A0A0T5NSU3      ------------------------------------------------------------
A0A5P9I718      ------------------------------------------------------------
A0A2M8J3R9      ------------------------------------------------------------
A0A1I6X762      ------------------------------------------------------------
A0A0P1EFX8      ------------------------------------------------------------
A0A2G5KB39      ------------------------------------------------------------
A0A2N3CNV1      ------------------------------------------------------------
A0A257F1F4      ------------------------------------------------------------
A0A1G9FY29      ------------------------------------------------------------
A0A4Q3ZBK4      ------------------------------------------------------------
A0A2D5J8T8      ------------------------------------------------------------
A0A2E3P9W6      ------------------------------------------------------------
A0A2G2B1P9      ------------------------------------------------------------
A0A258GCD5      ------------------------------------------------------------
A0A2D9YR88      ------------------------------------------------------------
A0A443INY4      ------------------------------------------------------------
A0A372IH36      ------------------------------------------------------------
A0A540VW45      ------------------------------------------------------------
A0A1H9C241      ------------------------------------------------------------
A0A2E3FCR1      ------------------------------------------------------------
A0A4S3MG69      ------------------------------------------------------------
A0A3E0H727      ------------------------------------------------------------
A0A1G8QZS5      ------------------------------------------------------------
A0A1V4QMH7      ------------------------------------------------------------
A0A496XZQ4      ------------------------------------------------------------
A0A1F9BJF7      ------------------------------------------------------------
F2NDF5          ------------------------------------------------------------
A0A1I3TTC3      ------------------------------------------------------------
A0A1H3IZW6      ------------------------------------------------------------
A0A0M6YG59      ------------------------------------------------------------
A0A1H7G8B0      ------------------------------------------------------------
A0A059IPK4      ------------------------------------------------------------
A0A1H2Y469      ------------------------------------------------------------
A0A497ZQU7      ------------------------------------------------------------
A0A318D3U4      ------------------------------------------------------------
A0A401FQP5      ------------------------------------------------------------
A0A1Q6DMW3      ------------------------------------------------------------
A0A3A6P8F8      ------------------------------------------------------------
A0A2G2DSM4      ------------------------------------------------------------
A0A1F9NI02      ------------------------------------------------------------
A0A4U1ABX4      ------------------------------------------------------------
A0A351Z4H9      ------------------------------------------------------------
A0A2N2KML4      ------------------------------------------------------------
E1YJF1          ------------------------------------------------------------
A0A1J5EVZ6      ------------------------------------------------------------
A0A2G6FCC5      ------------------------------------------------------------
A0A1F9MR25      ------------------------------------------------------------
A0A2G6M7F1      ------------------------------------------------------------
A0A1E7H876      ------------------------------------------------------------
A0A509L3P8      ------------------------------------------------------------
A0A3A4S038      ------------------------------------------------------------
A0A1F9N669      ------------------------------------------------------------
A0A1F9PFA7      ------------------------------------------------------------
A0A1H2EN09      ------------------------------------------------------------
K0NP00          ------------------------------------------------------------
A0A1E7JCL5      ------------------------------------------------------------
A0A496YAH9      ------------------------------------------------------------
A0A1V4S7E4      ------------------------------------------------------------
A0A2N2H8D2      ------------------------------------------------------------
A0A2N2KC63      ------------------------------------------------------------
A0A3A4ZYW4      ------------------------------------------------------------
A0A1V4MCJ4      ------------------------------------------------------------
A0A661M0W4      ------------------------------------------------------------
A0A0F2NF69      ------------------------------------------------------------
A0A1F9NFD0      ------------------------------------------------------------
A0A1M5YLH5      ------------------------------------------------------------
A0A4U1A4C7      ------------------------------------------------------------
                                                                            

E1Y9C0          ------------------------------------------------------------
A0A1N6SH58      ------------------------------------------------------------
A0A4Q3AQN2      ------------------------------------------------------------
A0A1W9HS52      VGNTQEYRREVYQRYGDVQSRLTEIERAVEINRHMEKHTESELKKIKENIVNPQLSSSEL
A0A2D5LFD8      QLADVYLEIAQRQRQQSLRDGLAFLDQQKPALEAKSTALLTELENFRKQNLLIDAS----
A0A0N0XAV4      ------------------------------------------------------------
A0A0P9QD19      ------------------------------------------------------------
F3FHG4          ------------------------------------------------------------
F3GGI0          EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS----
A0A0P9LE74      -------------------------------------------------VRGAD------
A0A3M4ZQ14      EVSHLYVRQNVERSSAEAAQRLEFLRSQLPAVRKQLEESEVALNNFQTSAKSVDLS----
A0A3M5YLE8      EVSHLYVRQNVERSSAEAAQRLEFLRSQLPAVRKQLEESEVALNNFQTSAKSVDLS----
A0A3M3RP89      EVSHLYVRQNVERSSAEAAQRLEFLRSQLPAVRKQLEESEVALNNFQTSAKSVDLS----
A0A0P9QIY7      EVSHLYVRQNVERSSAEAAQRLEFLRSQLPAVRKQLEESEVALNNFQTSAKSVDLS----
A0A0P9VVH7      EVSHLYVRQNVERSSAEAAQRLEFLRSQLPAVRKQLEESEVALNNFQTSAKSVDLS----
A0A0Q0FJK6      EVSHLYVRQNVERSSAEAAQRLEFLRSQLPAVRKQLEESEVALNNFQTSAKSVDLS----
A0A0Q0G2J0      EVSHLYVRQNVERSSAEAAQRLEFLRSQLPAVRKQLEESEVALNNFQTSAKSVDLS----
A0A3M3LF66      EVSHLYVRQNVERSSAEAAQRLEFLRSQLPAVRKQLEESEVALNNFQTSAKSVDLS----
A0A0P9WIR8      EVSHLYVRQNVERSSAEAAQRLEFLRSQLPAVRKQLEESEVALNNFQTSAKSVDLS----
A0A3M3KPE5      EVSHLYVRQNVERSSAEAAQRLEFLRSQLPAVRKQLEESEVALNNFQTSAKSVDLS----
A0A3M4C263      EVSHLYVRQNVERSSAEAAQRLEFLRSQLPAVRKQLEESEVALNNFQTSAKSVDLS----
A0A3M5AD05      EVSHLYVRQNVERSSAEAAQRLEFLRSQLPAVRKQLEESEVALNNFQTSAKSVDLS----
A0A0Q0D3D2      EVSHIYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS----
A0A0N0FS39      ----------------------------MPAVRKQLEDAETALNNFQTSARSVDLS----
A0A3M6GHH2      ----------------------------------------------------MDLS----
A0A0P9R9W0      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESEAALNTFQTSARSVDLS----
A0A0Q0B9T0      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESEAALNTFQTSARSVDLS----
A0A3M6CFI7      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESEAALNTFQTSARSVDLS----
A0A0P9JXN0      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESEAALNTFQTSARSVDLS----
A0A3M6FIV7      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESEAALNTFQTSARSVDLS----
A0A3M3PLW9      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS----
A0A3M4ENY1      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS----
A0A3M5EZK7      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS----
A0A0P9SPP5      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS----
A0A658KL17      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS----
A0A3M3NNF2      GVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS----
A0A3M4A0E8      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS----
A0A3M4PBZ2      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS----
A0A3M6AI26      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS----
A0A0P9IWP8      EVSHIYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS----
A0A0P9KZ49      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS----
A0A0P9V840      GVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS----
A0A0Q0AIE5      GVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS----
A0A3M2ZQH6      GVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS----
A0A0N8SQG2      GVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS----
A0A0W8HFU1      GVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS----
A0A3M5M873      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS----
A0A0P9VHH8      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS----
A0A0P9YV98      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNNFQTSARSVDLS----
A0A3M3G2W8      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNNFQTSARSVDLS----
A0A3M6C224      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNNFQTSARSVDLS----
A0A3M5K254      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS----
A0A3M5JFB0      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS----
A0A3M3TQV3      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEEAETALNTFQTSARSVDLS----
A0A3M3EF92      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEEAETALNTFQTSARSVDLS----
A0A3M5J1E2      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEEAETALNTFQTSARSVDLS----
A0A3M5G7H9      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS----
A0A3M4A376      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEEAETALNTFQTSARSVDLS----
A0A0Q0A5T8      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEEAETALNTFQTSARSVDLS----
A0A0P9SCD7      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS----
A0A0P9T4G3      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS----
A0A0P9VKB0      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS----
A0A0Q0BM35      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS----
A0A3M3TPR7      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS----
A0A3M3U4Q3      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS----
A0A0P9UCX7      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS----
A0A0P9S1F1      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS----
A0A0P9QCJ2      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEEAETALNTFQTSARSVDLS----
A0A0P9Q329      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS----
A0A3M5GJ64      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS----
A0A0P9MPC7      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS----
A0A3M2XYQ3      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS----
A0A0P9XCE1      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS----
A0A3M3EFX7      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS----
A0A3M5B9D9      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS----
A0A0P9RRZ3      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS----
A0A3M2VEK7      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS----
A0A0N8R9B3      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS----
A0A0P9VA27      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS----
A0A3M4YBJ4      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS----
A0A0P9J470      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS----
A0A0Q0EVJ8      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS----
A0A3M5UI30      GVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS----
A0A3M5YQT8      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEEAETALNTFQTSARSVDLS----
A0A3M5F5X1      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS----
A0A3M5R8G1      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS----
A0A3M5V012      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS----
A0A3M3GA16      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS----
A0A3M3UCT3      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS----
A0A3M3CJL0      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS----
A0A3M3F6F5      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS----
A0A3M3P9B7      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS----
A0A0N8QB74      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS----
A0A0Q0AUD0      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS----
A0A3M5VR55      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS----
A0A0Q0FK97      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS----
A0A3M5KZ75      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS----
A0A3M5L3G5      EVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS----
A0A0C5VQ86      ------------------------------------------------------------
A0A1V8MBH1      ------------------------------------------------------------
A0A534QGR3      ------------------------------------------------------------
A0A0R0BVC7      ------------------------------------------------------------
A0A0W1GMS6      ------------------------------------------------------------
A0A0Q8RMY3      ------------------------------------------------------------
A0A1A7QC21      ------------------------------------------------------------
A0A1F9CFF0      ------------------------------------------------------------
A0A2M8B0G5      ------------------------------------------------------------
A0A363TNU9      ------------------------------------------------------------
A0A534HBS8      ------------------------------------------------------------
A0A0F0T3Y9      ------------------------------------------------------------
A0A379GWF0      ------------------------------------------------------------
A0A536T0W8      ------------------------------------------------------------
A0A4Q2XLV7      ------------------------------------------------------------
A0A4Q5QYC4      ------------------------------------------------------------
A0A2G9XLE5      ------------------------------------------------------------
A0A3D2M6Y9      ------------------------------------------------------------
A0A3D2YAZ2      ------------------------------------------------------------
A0A350A102      ------------------------------------------------------------
A0A350L5D2      ------------------------------------------------------------
A0A3B8SQ27      ------------------------------------------------------------
A0A656BWB0      ------------------------------------------------------------
A0A6D0IFH4      ------------------------------------------------------------
A0A3Y2RPN4      ------------------------------------------------------------
A0A0A0FHV8      ------------------------------------------------------------
A0A1X3IPU7      ------------------------------------------------------------
A0A0A0G0N2      ------------------------------------------------------------
A0A243TPR1      ------------------------------------------------------------
A0A2I8SDU4      ------------------------------------------------------------
A0A2I8SU55      ------------------------------------------------------------
S1EXJ6          ------------------------------------------------------------
A0A376UBS1      ------------------------------------------------------------
A0A4Q6G931      ------------------------------------------------------------
A0A1W9F5M9      ------------------------------------------------------------
A0A3C2BN18      ------------------------------------------------------------
A0A447LR75      ------------------------------------------------------------
A0A376D8L7      ------------------------------------------------------------
A0A1V2FV46      ------------------------------------------------------------
A0A376SB61      ------------------------------------------------------------
A0A3D1BYV9      ------------------------------------------------------------
A0A6D0I9G1      ------------------------------------------------------------
A0A352MMI7      ------------------------------------------------------------
A0A379W6R2      ------------------------------------------------------------
A0A376RY66      -----------------------------------MDVAENKLNAFRQDKDSVDLP----
A0A377K431      ------------------------------------------------------------
A0A379TA56      ------------------------------------------------------------
A0A4Z0LWV1      ------------------------------------------------------------
A0A5V7HTZ1      -----------------------------PEVRSRLDVAENKLNAFRQDKDSVDLP----
A0A610XNI4      -----------------------------PEVRSRLDVAENKLNAFRQDKDSVDLP----
A0A620QD02      -----------------------------------------KLNAFRQDKDSVDLP----
A0A5H3HSJ8      ------------------------------------------------------------
A0A655C5P0      ------------------------------------------------------------
A0A2T0VBD8      ------------------------------------------------------------
A0A378APS2      ------------------------------------------------------------
A0A443VCQ6      ------------------------------------------------------------
A0A447RKQ7      ------------------------------------------------------------
W1DSK1          ------------------------------------------------------------
A0A0U2VAW2      ------------------------------------------------------------
A0A454CTF1      ------------------------------------------------------------
A0A6B3Q2G1      DVVQNYFLQNVRRNSAEAEQSLNFLKGHLPEIKDKLTISEDTLNSFRQENESIDLN----
A0A378G3G7      ------------------------------------------------------------
A0A2X5NHJ9      ------------------------------------------------------------
A0A2J4QEC3      ------------------------------------------------------------
A0A485ADM3      ------------------------------------------------------------
A0A4U9HGU4      --------------------------MQLPKVRASLDGAEDKLSHYRQQKDSVDLT----
A0A3S4JGG5      ----------------------------MPEVRSSLDSAEDKLNRFRQANDSVDLS----
A0A377ZDH2      ------------------------------------------------------------
A0A3S4HTS8      ------------------------------------------------------------
A0A2N1XK22      ------------------------------------------------------------
A0A3D0KAC8      ------------------------LNEQVPAVRRNLEAAQTALNKYQTGSRSVDIT----
A0A3D2Y902      ------------------------------------------------------------
A0A655RNN3      ------------------------------------------------------------
A0A655R819      ------------------------------------------------------------
A0A655ZEY0      ------------------------------------------------------------
A0A6G6X2Z4      ------------------------------------------------------------
Q44570          ------------------------------------------------------------
A0A3N5MZ53      ------------------------------------------------------------
A0A534E4H4      ------------------------------------------------------------
A0A534I2B6      ------------------------------------------------------------
A0A1C2JGD0      ------------------------------------------------------------
A0A259LQ70      ------------------------------------------------------------
A0A4V2SPR5      ------------------------------------------------------------
A0A3N5PM86      ------------------------------------------------------------
A0A2E5YSA4      ------------------------------------------------------------
A0A519ERR1      ------------------------------------------------------------
A0A4Q3Q1M2      ------------------------------------------------------------
A0A4Q3MHR1      ------------------------------------------------------------
A0A520GDZ4      ------------------------------------------------------------
A0A318DSU0      ------------------------------------------------------------
A0A538PF21      ------------------------------------------------------------
A0A1W1ZH10      ------------------------------------------------------------
A0A1W2FF24      ------------------------------------------------------------
A0A524JYQ6      ------------------------------------------------------------
A0A4Q3MA17      ------------------------------------------------------------
A0A0N0M5F7      ------------------------------------------------------------
A0A537M754      ------------------------------------------------------------
A0A1V1PDB4      ------------------------------------------------------------
A0A2M7C324      ------------------------------------------------------------
A0A4Q3HHG6      ------------------------------------------------------------
A0A3B7DTA4      ------------------------------------------------------------
A0A432ZK62      ------------------------------------------------------------
A0A1V5EEP4      ------------------------------------------------------------
A0A1V5EF48      ------------------------------------------------------------
A0A0S6X1X6      ------------------------------------------------------------
A0A537Y5L8      ------------------------------------------------------------
A0A4Q3L2X2      ------------------------------------------------------------
A0A4Q3T8J1      ------------------------------------------------------------
A0A4Q4ANM4      ------------------------------------------------------------
A0A4Q3UEC7      ------------------------------------------------------------
A0A1H5YYQ4      ------------------------------------------------------------
A0A1X4NLK2      ------------------------------------------------------------
A0A1X4NWB5      ------------------------------------------------------------
A0A1M5UQ38      ------------------------------------------------------------
A0A327YI48      ------------------------------------------------------------
A0A1B1PNL6      ------------------------------------------------------------
A0A2U8H9H9      ------------------------------------------------------------
A0A6B2NBB8      ------------------------------------------------------------
A0A1X6YIC0      ------------------------------------------------------------
A0A1I5E9E9      ------------------------------------------------------------
A0A1X6Z7N7      ------------------------------------------------------------
A0A2E1DQ13      ------------------------------------------------------------
A0A1H8C800      ------------------------------------------------------------
A0A2N3EZ05      ------------------------------------------------------------
A0A3N5J7U8      ------------------------------------------------------------
A0A1S7S3I8      ------------------------------------------------------------
A0A519E8D7      ------------------------------------------------------------
A0A3S1NZ06      RASARYQQYKSIVDSGSENAFKDAAISSDQPSSSVIAALKTRYLTVAKRQQDVEANFGPQ
A0A3S1FD32      ------------------------------------------------------------
A0A434DUT4      ------------------------------------------------------------
A0A528D3U3      ------------------------------------------------------------
A0A3S3UPT3      ------------------------------------------------------------
A0A3S1E286      ------------------------------------------------------------
A0A531AC71      ------------------------------------------------------------
A0A436K268      ------------------------------------------------------------
A0A434IDQ0      ------------------------------------------------------------
A0A435IRM5      ------------------------------------------------------------
A0A3S2C404      ------------------------------------------------------------
A0A435F6C0      ------------------------------------------------------------
A0A435BMN6      ------------------------------------------------------------
A0A529XQ54      ------------------------------------------------------------
A0A530BJC1      ------------------------------------------------------------
A0A348SRI7      ------------------------------------------------------------
A0A354EI73      ------------------------------------------------------------
A0A4Q3IRI1      ------------------------------------------------------------
A0A4P7EP83      ------------------------------------------------------------
A0A6I1QB25      ------------------------------------------------------------
A0A655ZZQ1      ------------------------------------------------------------
A0A1S0ZAI3      --------------------------------MPTLEIAHKKLEQA--------------
A0A1W9M770      ------------------------------------------------------------
A0A1W9M7R6      ------------------------------------------------------------
A0A3A4NIE9      ---------------MGGDDPMKIPFLDTLLKENTKRPEHESGPLFSTGEED--------
A0A3A4NUI9      -----------------------MIQFPFFKRNGRPHVKRGPYDIFAVGKED--------
A0A524I3Z6      -----------------------MTRFPFYRKNDALPASHHSVDLFSVGKED--------
A0A524PCL7      -----------------------MIKFPFFRRNGHLPAGRRPFDLFAIAKED--------
A0A356GQV1      ------------------------------------------------------------
A0A1J5DAY8      -----------------------MKIFTMGGGRPGTESPSGRIGILNLRSID--------
A0A524P237      -----------------------MLL------PKEADMPSDRKAVFDPRDID--------
A0A3C0L0A8      ------------------------------------------------------------
A0A176S762      ------------------------------------------------------------
A0A377ZC40      ------------------------------------------------------------
A0A378BPJ7      ------------------------------------------------------------
A0A2J5PAJ7      ------------------------------------------------------------
A0A377ZDN3      ------------------------------------------------------------
A0A1G3JY11      ------------------------------------------------------------
A0A661N3U1      ------------------------------------------------------MDRRTR
A0A1W9WUD9      ------------------------------------------------------------
A0A1W1ZQK0      ----------------------------MGKFFTALQKSKTPI-----------------
A0A4U1ALN4      ----------------------------MGKTSKALKKSGYSLEVPLQSTTDTQTERLVR
A0A4U1B1A8      ----------------------------MGNIADALKKAG--VDL-------GAKDDDIQ
A0A1M7Y300      ----------------------------MGNIADALKKAG--VELPDHAPVEVRRDDEVV
A0A4U1A967      ----------------------------MGNIADALEKAG--VELIDKG---VASEGENF
A0A6I1R304      --------------------MSRVFDALAKASEEKKHQVKSALRVVEPELRD--------
A0A1W9PMU6      ----------------------------MKNLLASCQPRSVSLPTLRENPKR--------
A0A6D0ELN7      ------------------------------------------------------------
A0A3S1WTQ1      ------------------------------------------------------IGGKLG
A0A440NX85      ------------------------------------------------------------
A0A530CUR9      ------------------------------------------------------------
A0A1M6N1X5      ------------------------------------------------------------
A0A561M3U0      --ALQQTADAKTRMLELQQKRDELSSR-FTGSHPEVIALNAQIATLRAQESV--------
A0A1G3VVY5      -------------MGKMFDALQKAEKERYRESERVSYKGVPKDNVFDRQEAQ--------
A0A2N6BZD5      ------------------------------------------------------MARSIR
A0A656PSQ6      ------------------------------------------------------------
A0A2W5J775      ------------------------------------------------------------
A0A352Q5C1      ------------------------------------------------------------
A0A435NNF5      ------------------------------------------------------------
A0A3S2AQS7      ------------------------------------------------------------
A0A436XH86      ------------------------------------------------------------
A0A527ZPD6      ------------------------------------------------------------
A0A529KRW3      ------------------------------------------------------------
A0A530ZLX0      ------------------------------------------------------------
A0A355TB56      ------------------------------------------------------------
A0A1F9E324      ----------------------------YKSEYPEMKRLRNQMETIQKRLTL--EGNRII
A0A432SAI6      ------------------------------------------------------------
A0A4Q3LBH4      ------VQLLLERRADIQGQYQQQLAT-RQEDYPTVAAAKAQLRELDRQIGS--LAGNIR
A0A4Q3LWP3      ----MNRQWLLVLRS--------QLSI-HREDFPAVVEITAQMRELARQINL--IGGNIR
A0A2N6VGL1      ------------------------------------------------------------
A0A3M3H5V6      ------------------------------------------------------------
A0A524M660      ------------------------------------------------------------
A0A0C1TRU6      ------------------------------------------------------------
A0A2Z5SSF4      ------------------------------------------------------------
A0A2T4ZJZ6      --TLTGVVEMKTQITLLQQKRDELRQK-FTESHPNVIAVDKQIARLQSQLQS--HNQMIK
A0A327LYE6      --MPDISTDMASTDDDDVARPPGPEDAASTQTSPEPPRARDQEDQGATSPDA--------
A0A5A9ZTV3      --MPDISTDMASTDDDDVARPPGPEDAASTQTSPEPPRARDQEDQGATSPDA--------
A0A4Q4CIB1      ------------------------------------------------------------
A0A522ACJ9      -------------RFDLVGRVAARLAHGTSGVEPDSNSPSSPPDQIAAHRAT--------
A0A1T2KYM8      -----AAKEAKREELDSELEIAQLAKR-YGPKHPKMIAAKAAHQARISRMKK--EVDIVL
A0A3N5Z7F8      ------------------------------------------------------------
A0A2G9ZR82      -------THLKNEYAKLYAKYEEMSTT-FHDAYPPVNALKSNMASISEQIKT--EENKIF
A0A239HD34      -----------------------------------MDRLHAAIEKARAEREK--------
A0A4U9I390      --------MPPCRHSEWLSNKTSLGGKSFLRYYIRHKTT---------------------
A0A534V9L7      ----------------------------MHQGALPMSRVFEALNKASNEKKRDGQTAPTS
A0A0P7ZZE4      ----------------------------MERLKAALDKARETRAATAASAPA--TAARAN
A0A369R0Q9      ----------------------------MERLKAALDKARETRAATAAPAPA--SGARPE
A0A534XP85      ------------------------------------------------------------
A0A2X3M011      ------------------------------------------------------------
I2WC85          ------------------------------------------------------------
A0A400JH80      IANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSELDQAEEKLNVYRQQRDSVDLNLEAKA
A0A2H9EHM4      ------------------------------------------------------------
A0A380B3D7      ------------------------------------------------------------
F5NSX0          ------------------------------------------------------------
A0A479JNB1      ------------------------------------------------------------
A0A5C9AF52      ------------------------------------------------------------
A0A6D0EYC7      ------------------------------------------------------------
D8EEU7          ------------------------------------------------------------
A0A0P1H2H0      --TQANVMADVEAPAPVKDDAPQATGF-LGLSGRSADDIAQEDRALRAAFPQ--------
A0A258WKV0      ----------------------------FRLRSIEASSAVDTLVEQDKRVRY--------
A0A377N8F8      -------MAVTTQLNGLRFEEAELSKR-YTSAHPIYRALDEKRKTLLANKAA--LELKIN
A5G4N9          ----------------------------MEAMEPHTEVLEPPMDVLEPHMEV--------
A0A3C2DSE7      ----------QADRAHARSRVEELSRR-YGDRYPAMQSARSDLNAATASLRQ--QVEQVV
A0A2X1JBG5      ------MVGLEKQLNELTFREAELQQL-YTRQHPAYIALLEKRQTLLNTKNA--INKSIK
A0A0B8PTA8      ------------------------------------------------------------
A0A0B8QF75      ------------------------------------------------------------
A0A4Q3LR91      --DNGASSTLRARRAELSGDYARMMQQ-FDAGYPPAKALQAQIRALDASLRS--EDNRVS
A0A6C9IKN8      ----PIVIDLNNSLAAMKQTIIRSVDNLIVGLNIKLKNNREHEEQTQKRIEAVPAQQKYV
A0A4V1TR68      ----------------------------FAPDYPPAKALREQRKQIDASIER--EQARVT
A0A444IY46      ------------------------------------------------------------
A0A6I7N627      ------------------------------------------------------------
A0A660AID0      ---------------------------------PAYKSLLDKRQTLLQEKER--LNKQVQ
A0A3E0WKI3      --MLNQVVEVEQRLAEMDLERSQLRMS-YASQHPNIIALDEQMERLRERRRE--FDSRIR
A0A1H3I2J1      --FGTSTVEVTEIGEPARAAPAPVARDTLADSFDALDALDAQPLALEDELRS--------
A0A1V5DJV0      --------------------------------------MMQQLPVAERELAQ--------
A0A520IUC4      ------VQALRAERAKLEADYRERLAT-FKPDFPDMVALRNRIQEIDISLRR--ETGEVS
A0A521LJG5      ----------RIQDVELTRKGAELASQ-LGDNHPKIQAVRSELNAVRARFIT--ETQRIT
A0A531IBQ7      ---------------------------------------------VSKQIFD--QLNQLT
A0A377LY04      --VLDSMVNIDAQLNELTFKEAEISKL-YTKRHPAYRTLLEKRRTLEEEKAK--LNDRVT
A0A5C9ABR5      ------------------------------------------------------------
A0A5J9WU72      ------------------------------------------------------------
A0A2X3K9R3      --VLDSMVNIDAQLNELTFKEAEISKL-FTKAHPAYRTLLEKRQALEDEKSK--LNGRVT
A0A5W0ZR28      --VLDSMVNIDAQLNELTFKEAEISKL-FTKAHPAYRTLLEKRKALEDEKAK--LNGRVT
A0A622KDG2      --VLDSMVNIDAQLNELTFKEAEISKL-FTKAHPAYRTLLEKRKALEDEKAK--LNGRVT
A0A3T9EHW9      ------------------------------KVHPAYRTLLEKRQALEDEKAK--LNGRVT
A0A484X141      --VLDSMVNIDAQLNELTFKEAEISKL-YTKVHPAYRTLLEKRQALEDEKAK--LNGRVT
A0A5N9VWI6      --VLDSMVNIDAQLNELTFKEAEISKL-YTKVHPAYRTLLEKRQALEDEKAK--LNGRVT
A0A6D0EJQ0      ------------------------------------------------------------
A0A376LLF8      ------------------------------------------------------------
A0A444R390      ------------------------------------------------------------
A0A6C9J192      ------------------------------------------------------------
A0A1V4WHZ7      ------------------------------------------------------MVNAIK
A0A1E5AJN5      VLESQAIEGLKQRLATLRADYQDKLSI-YKPDFPEMVRLAGQIEDTQNQLAK--EISIIS
A0A2N3D2J1      VLNNGTIQQLTQRRAQLQAEYQEKGRL-FRSDYPVMVQLAAQIAEVNRQIDR--EAGNVR
A0A2N2GVE1      FLNKPAIVSLRSRYHSAQEKLKEVQVE-VMERHEEVIRQERILDVVRGQLTS--ELALSE
A0A2N2INV3      FLNKPTIVSLRSRYHAAQEKLKEVQVE-VMERHEEVIRQERILDVVRGQLTS--ELALSE
A0A1Y5DXG5      --VLEQIVELDTKLQELDLERLAMSRK-FKRNHPNYQGIVEQISAVQKQRDA--LAQKIA
A0A0B8P2H5      --TLKVMVELEAQLNELTFKESELAQR-FTKQHPAYVAVLEKRKTLEAQKRR--LEGQIK
A0A483QWI8      --VLEQIVNVDNQLNELTFRESEISQL-YTKEHPTYKALIEKRETLKEERAK--LNKKVT
A0A483UXD3      --VLEQIVNVDNQLNELTFRESEISQL-YTKEHPTYKALIEKRETLKEERAK--LNKKVT
A0A0A8J8L3      --VLDQIVNVDNQLNELTFREAEVSQL-YTKEHPTYKALMEKQQTLQTEKIK--LNKKVS
A0A660DJ38      --VLDQIVNVDNQLNELTFREAEISQL-YTKEHPTYKALIEKRQTLQQEKTK--LNKRVS
A0A380AQW6      --MLDTQVQLEGQLNELTFKEAEISKL-YTRVHPAYRALLEKRATLEAEKAR--LGKQVQ
A0A2G2GD62      --TATNLNELIINYQTALTNRRSMLVS-VTEFHPEVIKLNEEVFNLRKNIQA-----TVV
A0A524P331      --DDPLIGTMASKLTELEMQRRALVAE-NTERHPQVKAVQGQIDQLQGKIQSTFETARLN
A0A4V1SSM5      ------------------HDQTQILER-YGPRYPDAIRVTQQLEQIDRQIAD--ESRRIV
A0A4Q3K8G7      -------------------------------------RARDELAKVDGEIQA--EIRRVM
A0A1M7HC79      --TIQQFIALEQQLNELEFQEAEMAQR-FTPRHPNYKTLQRKKRQLQQERAE--LNERVN
A0A1D3JZN6      --VLDQVVALDTGISELKLQQAEMDRK-FTRQHPAYRALLAKLDELTGKQAQ--LTKRIE
A0A1V6ESG1      --ENKTVQTIKEQKAKLEAEYLVNLGT-YKPDFPKMLQTKAQIAELDLRIKA--EIAAVL
A0A1H7YHK3      --LLEQQVAVETSIQQLHMQQAEMDRS-FTREHPAYRALMKQIGELESRKAG--FNKQVG
A0A534SH66      ------------------------------------------------------------
A0A3M0ZZ99      ----------------------------MEALRGELAAIEGREAEVTAELRRALQQGNLS
A0A238LBD3      --MNAKYSRRTGRPRLDASERARLLAEIAKLGAPATTELDAQSAALRAALSE--SVEPPA
A0A328C2K5      LVDSPALKRGLDRESELLERRAELTTR-YLDEYPEVRAVDEQLAVVRQSIDE--EIGRIR
A0A5C6X8M3      LVDNPALKRGLDRESELLERRAELKTR-YLDAHPEVRAVDEQLEVVRRSIED--EIGRIR
A0A3D8MRR7      LVDNPALKRGLDRESELLERRAELKTR-YLDAHPEVRAVDEQLEVVRRSIEE--EIGRIR
A0A5C6UBJ7      LVDNPALKRGLDRESELLERRAELKTR-YLDAHPEVRAVDEQLEVVRRSIEE--EIGRIR
A0A5C6XGM3      LVDNPALKRGLDRESELLERRAELKTR-YLDAHPEVRAVDEQLEVVRRSIED--EIGRIR
A0A537NZJ1      -----------------MTRPASVRMR---------------------------------
A0A0P1FRV5      --MVEQSKRFRRGMRQRPAKAPE-----EAPVDPPVEASVEVPAEVTDAAPV--QRRGLL
A0A4Q4CVW6      ------------------------------------------------------EIGKVG
A0A090R136      --TLDMMVKIESQLNELTFKESEISQR-FTKEHPAYIALLDKKSVLISERKK--INKQVQ
A0A661JU93      ------MRSLKEKLTSLEIQKAMLLEK-YTELHPEVVAVNREIAKTKEELNR--AVANAL
A0A2E2T3V8      --KDDQVRDLQVKYEVLQQNYAELEQR-YQPAHPSMVRITGEIWSVQQTLAK--ALERSA
A0A367UAB4      --KDDQVRDLQVKYEVLQQNYAELEQR-YQPAHPSMVRISGEIWSVQQTLAK--ALERSA
A0A0P1FWI8      --MVEQNKRYRRKTRQQPPKSPGF----LGPKNLSEADIEAEEKALREAFLW--------
A0A377V641      --VLDQIVNVDNQLNELTFRESEISQL-YTKEHPTYKALMEKRKTLQDERGK--LNKRVA
A0A1F2YJ88      --FLTQSVTLETQKAQLEQQVAEAGAK-YTAEHPVMQQMNAQLGAINKKIGE--------
A0A0J7XGZ1      ALASDTIRQLRQQEAQASARLAQLDAR-YGALHPDVVQARDELADVRAQLGA--ELGRIV
I4CBA7          --DNEFLSTLKKNSAALKADYVSAASV-LGSGHFQHSLAQGKLYAMEKAISE-VEQSEIA
A3VE95          --TSPLLERLNQDKLALERQDAQWGAS-FGPDHPQRVRIANEIAGVEAEMQT--EAERII
A0A1G0NL95      --RLTRLLEVDKQITELRQKRDETAQQ-FAPGHPRMLALAQQEARLQTAARS--LNDWVK
A0A024KA69      --PSPIEAASYANAVANSFIHEEVAAK-IDGVLADVAALRAQVTVAGEAVRAAQQALGLR
A0A0L1KFN4      --SNYAINNLRQKRAELESEYRELMVR-FEPGYPQAQSLQSRIDELSRAIER--EEARVS
A0A3P5DSS6      --VLDQIVNVDNQLNELTFRESEISQL-YTKEHPTYKALMEKRKTLQDEKAK--LNKRVS
A0A483YEL5      --VLDQIVNVDNQLNELTFKESEISQL-YTQEHPTYKALMEKRKILQDERAK--LNKRVS
A0A658GUJ0      --VLDQIVNVDNQLNELTFKESEISQL-YTQEHPTYKALMEKRKILQDERAK--LNKRVS
A0A358L616      --ALDSSVSVQSQLNELTFREAEVSQL-FTKDHPTYRALLEKRKTLEDEQKK--LNHKIG
A0A1M7BLL7      --DQEDILSPEADEATQEADEAPFALS------PEMIAPPLDEKPLVAEADG--------
A0A0H4KZM1      --LTGPIHLAPERETPLEPEEL------TPPETPTTADVRSEAERTSEAAPS--PEAKPR
A0A3D5UYX7      VLASGTISGLRQKQAELAREKANLSAK-YGPRHPAIVNIEAQQSDIGSQISA--EVSRII
A0A2N1WQN5      ------------------------------------------------------------
A0A352G2C2      --VLDRIVDLEKQISEQNLKRTEMERR-FTRQHPNFQALMNQINQLQMQKEE--LEKQIG
A0A3C0PZN1      --VLDRIVDLEKQISEQNLKRTEMERR-FTRQHPNFQALMNQINQLQMQKDQ--LEKQID
A0A524QFS4      --IRQSLAAHSKDLTESNAERDRLLSL-YTDQHPEVITQDQLILAARRQYEEAIENAESL
A0A1V1UJT2      --GESAIEEIADEFALPLDPGMRADPEEALAVTPESQDVPEPEPEPEPEPEP--EPEPEP
A0A0L6CVX1      ------------------------------------------------------------
A0A1V0RR48      ------------------------------------------------------------
A0A0A0HJJ4      --DDEVPQVVDTPEPEAPAQDEIAQEETALAAPPESLELSEPEPEPEPEPEP--EPEPEP
A0A5E7YA28      --EENAAHFPEMPVAEP------TEEEAPLALSPESLNIPEPEPEPEPEPEP--EPEPEP
A0A520JSW4      --SSVNAAPLRAQIAALDAEYQQKLQG-FRPDYPEMIALKARIDALRTSVIR--ETHTAN
A0A4Q3LTF3      --RNVAINNLRQRRAELAAEYQRLMIQ-FEPGYPAAKAIQSQIDQLDRSIGR--EEGRVS
A0A537UTP9      --KSEVINKLRSQYLDFSRQAAELSAK-YGARHLAVVDLRARMQEIRKVIID--ELNRIA
A0A1D2RNR5      ------------------------------------------MDELKARINA--EVQSVL
A0A4V1TQ46      --SDPSYQGLSQQRARAVAQYEQDAKH-WTPDYPEMVQQTAQIRGLDRQINA--VANRVK
A0A3A0FZC0      --DDPSTQHMRGELAKLEAEYQQLSAK-FTSSYPRMVQLKAQISGLKQSIEG--QRRQVV
A0A1N7JVZ7      --EADPVTPPVAQKPDQTPETHPLPPQAIAPTREPEKPLPTAMPPADTTRDAQELDEADE
A0A091C4A8      VLGSEIVQALQERRADLQAQYQDKLSI-FKPAFPEMQQLQAQIDELDRQIQT--EVGNIK
A0A4R3H6P6      ALGNDAIASMRQRRADAAAEYAKLMVQ-FRPDYPQAQALASQVQALDVSIAQ--EENRVR
A0A3S1NQ09      QPSSSVISALKTRYLTVAKRLQDVEAN-FGPEHPQAVALSKEKADISTQIFG--ELKQLT
A0A443GJ52      QPSNSVISTLKTRYLTVAKRQQDVEAN-FGAEHPQAVALAKEKADISAQIFG--ELKQLT
A0A2W6S588      GVDTTALSTLREQRAEASRDLAGLTSR-YGDRNPQVIDARQKVADLDTAIGR--EMASMS
A0A483E0N4      --VLDQIVNVDNQLNELTFRESEISQL-YTKEHPTYKALMEKRKTLQEEKAK--LNKKVS
A0A2J4YQQ6      --VLDQIVNVDNQLNELTFRESEISQL-YTKEHPTYKALMEKRKTLQDERGK--LNKRVS
A0A483THX4      --VLDQIVNVDNQLNELTFRESEISQL-YTKEHPTYKALMEKRKTLQDEKAK--LNKRVS
A0A534MVS2      --RDLDALLSESRRNNMLLGEAAIWKKFLESAEVAEAVRLQAMDLLKHVVENDFSIDVFT
A0A444I5K6      --DSSISNDLRKKYLEASKLETEIEAR-LGPDHVQAVRLRAEMEEYKRLMFD--ELNRIA
A0A154VE85      VLNADLVRELRLQEAALQRRIAELRVE-YRDDHPRLQEALSESEGLRRTIAG--EVEKIG
A0A3S1MCW7      VLESAGLQKLSDKLADLTSQYQQKLGI-LKPGFPEMQQLQSQIKELQRLYNN--GVLTIT
A0A434IGN6      VLESEGLQKITDKLADLTSQYQQKLGI-LKPGFPEMQQLQAQIKELQRLYNN--GVLTIT
A0A528AX40      VLESEGLQKITEKLADLTSQYQQKLGI-LKPGFPEMQQLQAQIKELQRLYNN--GVLTIT
A0A528MV95      VLESEGLQKITEKLSDLTSQYQQKLGI-LKPGFPEMQQLQAQIKELQRLYDN--GVLTIT
A0A3C1S9Y1      VLSNDIIKEIKKMEVNLYNKMSELSKK-YGSNHPQMVAIQSELAELHQRKAT--EGKRIV
A0A353EH49      --LLTEMSHLGAAILELEQERKELRNL-YKPEHSVIKALDEKIQLLKIEQRKLEIDADVL
A0A1Y1Q9C1      --NSPVVESLKQNLATLEAEYREKLKL-FKPAFPDMVSLQGRIDEVRGQLNR--EMSSLR
A0A3M7LJH0      --TLEVMVKLEAQLNELTFKESEVSQR-FTTDHPAYKSLLDKRQVLLGEKER--LNQQVQ
A0A316KRG4      --DFAGDRASKPEPAAPAPRKSKIKAIKKHPAPKAAAPVSAKRISADSDSRP--EPARDH
A0A1E4JHX8      --TNNAITGIRQKRAEVAAEYARLLSQ-FEPEYPEVKALATQLSQLDRSIAS--EENRIR
M2U8P2          IQSSSLLRELRAREAALSAERADLAGR-YGERHPSLANIDRQLSDLNERISE--EIARER
A0A1H7KZF8      VIGNAAVQSLVSQSTDVQARLNAAAAR-HGPEHPEVRQLTAQATALHRELTR--LADGIK
A0A0J5Q9T7      --MAERRKFHRRHGPTQDATGTQPAED-LAPISPLETRAERQARRTAERIRANAAQSIVE
A0A257NG76      --VLKGVVEIQTQITLLQQKRDELRQK-FTESHPSVVAIDKQISRLQGQMNS--NDKKIE
A0A1T4TW59      --NHPQVRDVKSAEIDAERKVSELAKR-YGPKHDKMIQARAQLDAVRARSRAVIRELGIG
A0A1I5YYQ0      --SGEARDKPRTFRRKNPPRRTPEAQRPAGPPEARPDPADKEPDVPRKTLTE--PPVRLE
A0A5P9FE62      --SGEARDKPRTFRRKNPPRRTPEAQRPAGAPEARPDPADKEPDVPRKTLTK--PPVRLE
A0A1Q3MB35      --NNQALNLMRDRRAQYASELASSLAV-FEPEYPQVQALQSQLSELDRNIAR--EEARVR
A0A259LUN7      VINSALINQLKSQRAEILRRVAELETR-VGDRHPDLISARNEVADIDRQMMA--EMNRIA
A0A2D7AVL1      --DSPDLKKLREQRFQLDTEYQNKLEI-YRPEYSEMTELKRRIELTDREIEA--ERTRIV
A0A3B9KZE9      --------------------YQNKLEI-YRPEYSEMTELKRRIELTDREIEA--ERTRIV
A0A2U0NMP8      --VLDQIVNVDNQLNELTFKESEISQL-YTQEHPTYKALMEKRKILQDERAK--LNKRVS
A0A4U9HNE9      --VLDTQVQLEAQLNELTFRESEISKL-YTRAHPAYRALLEKRATLQQEKAR--LGKQVQ
A0A2G2CXY6      --ILDQIVELDTMISELNLRRAEMERR-FTREHPNYQAMLQQMQQLERQKAA--LEARVG
A0A3M1D4H3      --ANKLVARLQDDLTNLRQKRANELTD-KTPEHPDIQNLDKLIAETEAQLAEALAAQHAL
A0A5C8BYM7      --ESKTIQDYKAQRSKLDLEYEQSAKV-YKEDFPKMQQLKAQMNDLDAKIQS--EVASIL
A0A1J5ICP0      --KSERLNALAQKLSELQSRMITLKIN-YKEKHPLVVEAVEQIKETKKGIMA--ELSSII
A0A0M3GBT1      --LPDDITSKQRDLHAQEDDLARLLEL-YDGNAEAVVDLRGKIEKSRADLSF--ATKQYL
B3Q577          --LPDDITSKQRDLHAQEDDLARLLEL-YDGNAEAVVDLRGKIEKSRADLSF--ATKQYL
A0A379B9V4      --TLDTIIQIEADLSELSIQESEISRK-FTLKHPSYVALIDKRNVLNAEKER--LNKQLE
A0A0Q6TS97      ALGNDAIASMRQRRADAAAEYAKLMVQ-FRPDYPQAKALASQIQALDAAIGQ--EEGRVR
A0A0Q6UYB4      ALGNDAIASMRQRRADAAAEYAKLMVQ-FRPDYPQAKALASQIQALDAAIGQ--EEGRVR
A0A484XS37      --VLDTVVGVEAQLNELTLKEAEISKL-YTKEHPAYRALMEKRATLQQEKDK--LNKRVS
W7Q5J0          --AVQRYIDIERRINELEFQEAELAQR-YTTSHPSYQTLLRQKRHLQAEKTQ--LNNRVN
A0A654AKT6      --VNKKVVALYAVGLFISFSKSSLILFIFLALFPLRHKLRLIHPLVILTAFI--GVVGLI
A0A0G9MZA5      --ASATADALRARRAELQVELAELRSR-FSPSYPPVQALQVQIDELERAIRE--EQAGAQ
H0T8B0          ALNSPVINGLRDDFLKDKSKEAELSAR-YGTDHQAAVQLRERMAARQQAIWD--EIGRLA
A0A5C7N981      --DNKLIAEYKARLSKLEGDYQEGLTT-YKPGYPKMQQMESQIKELQAKISQ--ETKGAI
A0A534TV22      --NQGLVPQLRSTLLSLEAEKVKSSTV-FKPDHPRMIELNQQITEARRSLNA--EISSVV
A0A351CXR4      --TENRLVQLSEALQLAKEDYARLAQR-YGPRHPKMIEAESEIQRTQASLKM--GGGQAV
A0A2N6GLF5      --SDSLVSSLREAEAEAQRKVSSFSKR-YGPKHPKMIEAQADLTEARLNVQR--QIESVI
A0A1W9LJP0      --NNPLVQDIKKMEVELYNRMSELSKK-YGAKHPQITAITSELATLQERKMG--EAKRVV
A0A0W1ICB0      --SNQSLSTLRQRRAEANAAYQELLVQ-FEPEYPQAQAAREKVAALDRAISA--EETRVR
A0A2E0UL88      --SQKSLKDLRARSKELEMRINKLASD---------AMESGDLTTSPLQLSR--DLRRSI
A0A233IKJ2      --NHPTIRDVKLAEVQAERKVSELSKR-YGDKHPKLKAAQAELASVKRNLNS--ELKQLL
A0A2T1JE00      --NHPTIRDVKLAEVQAERKVSELSKR-YGDKHPKLKAAQAELASVKRNLNF--ELKQLL
A0A0T2QIS1      SITNPTIVALRDRRAQAAADYAKLMVQ-FEPGYPAAQALQEQIASLDSAIAR--EDARIV
A0A376KYN0      -------MNVDNQLNELTFREAEISQL-YKKDHPTYRALLEKRQTLEQERKR--LNKRVS
A0A2X1JB05      --VLEQIVNVDNQLNELTFREAEISQL-YKKDHPTYRALLEKRQTLEQERKR--LNKRVS
A0A376RML0      --VLEQIVNVDNQLNELTFREAEISQL-YKKDHPTYRALLEKRQTLEQERKR--LNKRVS
A0A377E5P7      --VLEQIVNVDNQLNELTFREAEISQL-YKKDHPTYRALLEKRQTLEQERKR--LNKRVS
A0A0P7Y1D0      VLRSETIRALRAQQTDTSRRRSDLTSR-YGPRHPEILAVEREAADLEEQVNR--EIQRIV
A0A2M7JRZ7      ILENKLVMDLKQAYIQLEAQYMKLSET-FKPEYPEMVRLKNQMQSIQRRMDV--ETNKII
A0A167IR75      ALSNNAINNLRQRRAELNAEYQDLMIR-FEPGYPQARAIQSQIEALDQAIAR--EESRVS
A0A3B8T2U6      --NHPTVQNVKKQQLNAQSRVSELAKV-YGPRHPKMIAANAELESIDDSLAR--QVRALV
A0A365PWR2      --YLNQLVALDSKISALRLQQTELASR-FTSEHPAYQTLVNQIESLTLEQQS--LARKIG
A0A2E9H5Z8      --PGSQVPFLRSRIQESQLNMEAMQASGLGRKHPSMEMALIAQNKMQENLET--AVTVLR
A0A2E2BR79      --VIAQLIDVEKKLSEVEFQEAEMAQR-FTRNHPAYQALMRQKSFLRNERDR--LNARVE
A0A0Q4Q524      --RNQAINTLRQRRAEFAAEYQKLLIQ-FEPEYPAVKALKSQIDQLDRSIAN--EERRVS
A0A0Q4CFJ9      --RNQAINSLRQRRAEYAAEYQKLLTQ-FEPEYPAAKALKSQIDQLDRSITN--EERRVS
A0A0Q4FE58      --RNQAINALRQRRAEYAADYQKLLTQ-FEPEYPAARALKSQIDQLDRSISN--EERRVS
A0A0Q4JWC8      --RNQAINALRQRRAEYAADYQKLLTQ-FEPEYPAARALKSQIDQLDRSISN--EERRVS
A0A0Q4KFL8      --RNQAINALRQRRAEYAADYQKLLTQ-FEPEYPAARALKSQIDQLDRSISN--EERRVS
A0A522R8R0      --NTNIINDLRVRYLDVTRREQQIESQ-FGKDHPQAVALRHQQEELAGQIYQ--ELKQLT
A0A2U9NDY5      --VRDQSVQRETQLAERARKRVEDDRR-YTREHPTYRTLMTQMNELQAQKAQ--LLKKVD
A0A0Q4IGG1      L-RNQAINTLRQRRAELAADYQRLMVQ-FEPGYPAARAIQTQIDQLDRSISR--EESRVT
X7F6S5          --ESRSAAAEEARARDGQA---------------------AEAERARHAAEA--EAETER
A0A1G8NKI0      --EAEADAEDQRRRAE------------------------AAGDQARRQAEA--AAQA--
A0A355QPE4      --EAEAAAEDQRRRAE------------------------AAGDQARRQAEA--AAQA--
A0A357RN98      --EAEAAAEDQRRRAE------------------------AAGDQARRQAEA--AAQA--
A0A6B2MSQ7      --EARAAAQDRARRQA------------------------EEAERLQVARER--AAQE--
A0A6B2P8H8      --EARAAAQDRARRQA------------------------EEAERLQVARER--AAQE--
A0A1I6U4V1      --EARAAEQRRAEQQR------------------------LEDQRLE---------ER--
A0A1G7CFZ2      -------------RRAEAERV-------------------AEAARLQQQVEK--EARR--
A0A1P8USW9      --AARKAQEDDARRKAEAKRKAEDARR-AAERLEAVQRQRAEAARRKREAEE--QARK--
A0A534RUJ5      VVNNTLIQALKEQLTTLQGQYAQLSTQ-FKPAYPRLAQLKAQVVDTEQRVQK--EIQRVV
A0A3M1CJM3      --SNPLIQQLKANYVKLKEEHTELSTK-YLPDHPKMKVVENKLKLLQRSINR--EIDNVL
A0A2R7SVD4      --VLGQSVALETRISELKMQQAEMDRK-FTSQHPAYRALMSQIGELTQQQKS--LAGKVQ
A0A3C0PWB6      --VLDQIVQLETQLSELTLKRVDYDRL-YTREHPTYRTLMSQMNELQAQKAQ--LLKKVD
V4Q8B7          --VLDQIVALETQISELSLKRVEYDRL-YTREHPTYRTLITQMNELQAQKAQ--LLKKVD
A0A0Q8XKK5      --TNPAISSLRQRRAEVASELAKLSVQ-FEPGYPASRALAEQLQSLDSAISR--EEARVD
A0A2E0Q2W0      SVANAGAATIRSRIAXVEATLARLRTT-LGPENSQVEASEAELRSLRSALSK--ESGITG
A0A660NIR6      --NNPAVVAARAAEANAEKRMAEVAGS-MGASHPAYKQAQSELELARSSLRK--QSEAVI
A0A142W0R3      --SNAAVSALRQRRAELMADLARLRKI-FGEEYPEIVAKKEQLAALNQSVST--ETQRSR
A0A0S4XR18      --PNSSINNIITALQQKNAARTALLAE-YTPKHPDVIEISEEISALEVSLRG--SIKSLY
A0A2E0GW64      --MLTQLVKSQNDLEALKLEKTQLQQG-FTEKHPIVIAINEKIHKQQAALSA--LESEAK
A0A1A7QJ97      ALGNTAINNLRQRRAELAADYQQLMVR-FEPGYPAAQAIQQQIDALDSAITR--EESRVS
A0A6I4IKZ3      --YLTQSITLETKKAELEQKQAEMAAK-YTAEHPAMREINGQLAAINKQIGE--LNSTLK
A0A661LW70      --NNELIRQIKSMEIGLYKRMSELSKK-YGQKHPRMVAIESELNTLQKRRTQ--EVSRVI
W7Q8F9          --AVQRYIDIERRINELEFQEAEMAQR-YTHSHPSYRTLLRQKRHLQNEKSQ--LNDRVN
A0A524PXH8      IVNSPLLKSLVEQLAQAEGERAELADR-FTSEFPKLRALDARLSQARGRVMH--EEGRLV
A0A4Q3P0E4      --VLGTAVDRQTKLLDAQQRRRELEAL-FTPNHPLMQTLDAQIAALSRDIGD--VQGRIK
A0A3M2BE89      --LLDQSAKLEQQISELKLKKLELRRR-FTDNHPVIQSLEDKLGRLQTEQQT--LEQRIK
A0A4Q4A6K6      --LSPIINNLRQQYLDYSRRESELSLK-VGKNHIAVINLRNRMRDIRTSIMD--EVRRLA
A0A257G674      VLANPAISQLLSERARVQSELQKQRAN-HLEDYPAVAQLRAQVGVIDNQLQS--VARSIR
A0A661M5M6      --DDPTLGDLVTELRNKEQEHEALAVK-YGGEHPTMKTLAHELEALAKQVTK--EKAAII
A0A1I1UM01      --QRAEAEAQRQAEAERLRVEAETRRR-AEEVRLREETEARQQAEEDRQRAR--ARADQV
Q44573          LSQEPILVATANALMQLQSTRQEEAAT-YGPQHPRLRALDQQIATTRASLEA--ETQAAL
A2W025          --YEQQIAAQRLQLASLAQRFTDSHPM-VIAAKQQLAELQGEKDKFSNRFRS--LPATEV
A0A534Z362      FLDRPGIQKLHLALLDLRAQRAGLGQR-LGPKHPQILELGRQQAEIEQQLGA--EVAQEV
V4J283          --VLTSIMEIENELFTLQQERETLRSR-FKPTHPKIRSLDGLMATLTGKLRT--LEQQTE
A0A536T443      --RSSALSAALKELADRQAELRVLRFR-YADTHPPVRRLAQQVDTLARFVIP--ELGGAL
A0A0Q4UFQ5      QLDNTANSTLRTKRAELAADYARMLQQ-FDPAYPPAKALQAQIRSIDAALRG--EGSRVD
A0A527W7E6      QPSSSVIIGLKTRYLAIAKRLQDVENN-FGKDHPQAVALAKEKADVSAQIFG--QLKQIT
A0A432EMV7      VLNNTLIQALKQEQSQLQRKVSELSGR-YLDKHPKMIAAKADLEEAISRVEL--ETAKVV
A0A087LTV7      --RANAPSPIEAASYANAVANSFIHEE-VAAKIDGVLADVAALRARVTVAGE--AVRAAQ
A0A534WLI3      LLDRPAIAKLHGTLLDLETQEAPLTHR-LGPNHPQMLELRRQQAAVQRQLAT--EVAGEI
A0A318KWA2      --AIEQFVALDSQLNELEFREAELAQR-YTPNHPAYQSLLRQKRHLEAERAA--LNARVD
A0A522MT86      --FDRRIADLQIQRTQLLDRYTPDSRW-VRNIDEQLGQLRAQKAEFDSRFAA--MPSSER
A0A4Q3I221      --DSSISNELRQKYLDASKREAQISDR-LGVNHIQAIRLRSEMTEYNRLMFE--EVNRIA
A0A534SAL6      FLDRPGVQKLHLALLDLRAQRAGLGQR-LGQSHPQMLELARNEAELERQLDA--EVAAET
A0A534ZDB4      FLDRPGVQKLHLALLDMRAQRAGLAQR-LGQNHPQMLELARNEAELERQLGA--EVAEET
A0A534X3M7      FLDRPGIQKLHLALLELRAQRAGLEGR-LGPKHPQTLELRRQQAEIEDQLRA--EVTQEV
A0A534SPC6      FLDRPGIQKLHLALLDLRAQRAGLGQR-LGPKHPQILELGRQQAEIEQQLGA--EVAQEV
A0A535AD60      FLGRPGIQKLHLAILDLRAQRAGLGQR-LGPRHPQILELRRQEDEIEHQLRA--EVGQEV
A0A4Q3SY08      --DSGVIQSLRGQRVAVSAKVADMQGR-YGARHPEILKAQRELADIDAQIQG--EVTRVI
A0A4Q3LG23      --AINNLRQRRAELAAEYQRLMVQFKP-EYPAAEAIQSQIGQLDRSIAREEG--RVSSSL
A0A522EX52      --FLRQLAELDKKLAELRISKIDMLQR-YTEEHPAFIALSRQIQEIKEDKKN--L-----
A0A1H3KC95      --EPTVANTGDASAPPDTGPSREAFDA-QLPKAAGKAEAHPTPPDMEPAPAA--SPASGA
A0A5P8Z4P3      --PQAIAPAHHPERPLRKSAEPVSRPV-TADDELDDIEDIEAAPSVSTASPD--TVAAPP
A0A2E9HXF7      --REAEEARSRQEAAAKAAQDAEDHRQ---------QVEKRAAEEAARREKA--KRDAEA
A0A0B3RZC9      --KEAEERRIQAERA-----------------------------DEERAAEA--RRKAAE
A0A6F8QET1      --KQAEERRIEAERA-----------------------------DEERAAEA--RRKAAE
A0A520HUH4      --ISQQLASAKAEAAALRSNVAAAERQ-IAAGGSDAVSAVLSAPVITDLRRQ--RTEAER
A0A2K8U7M6      --DSPVIQRLQARKAELSADYQQQLKV-FKPGYPKMQQLRRALAELERQLRQ--EATAIG
A0A5B9DKL8      --ILAEQAALRDR-VIAAGVAVDRTQG-ILDATAEPGYEARQEAQAAQAQYQ--MLLGRL
A0A238KJM1      --AEKQIATERAQAEAEARKAEDDTKR-LTAEQARLTEEKQVAEAAAA------------
A0A3A0FJZ4      --REAERASQAQATEALLASQLRDLQA-ELASQARELDEIELARSGAALGAS--GDGGEV
W4HJV8          --SDSDSDSPEEDRSPEQATALAASDP-SVPTPSAAPENAAPAHDATVPAPN--LAYATP
A0A0P1GDI0      --KQAELAAQRKA-EAEAAERAEKQRK-QAEADRRAQEKAKEAQRQAERAAA--QRQAEE
A0A2R8ATV5      --EAEEQARLKAE-AAKRAQAEEAARL-QAEAKARAAEDARKQHEAEQAARE--EAEAQA
A0A1U7D3R6      --LEQTRAAEEAE-AARRAEDAERARL---------ADEARRQQEAEHRAQE--QREAEA
A0A2D4UVV2      --LEQTRAAEEAE-AARRAEDAERARL---------ADEARRQQEAEHRAQE--QREAEA
A0A0W7WHP4      --REAEEQARREA-AEHARREEQAQRE---------AQAQRAAEEQAHREAE--EQ----
A0A238J8F6      --RQAEIEAQRQA-ELAAREKAEAVRR---------AEEARQIAEAEEARQK--AEAEEA
A0A238JQI6      --EEARLAEERRK-AEDAARKAEEARL---------AEERRKVEDAARKAEE--ARLAEE
A0A222E077      --REAEEARSRQEAAAKAAQDAEDHRQ---------QVEKRAAEEAARREKA--KR----
A0A239E3Y2      --REAEEARTRQE-ATKAAQDAAEIRQ---------QAEKRAAKEAARRARA--ERDAED
A0A1V6FYJ1      -----------------------------------------------------MHILKAL
A0A445MZQ4      ----------------------------------------------------MGKLSDAL
A0A0M9E0E3      --------------------------------------------LGTALAFTFEILDNTL
A0A0Q6QV61      ------------------------------------------------------------
A0A2Z3IKG4      ----------------------------------------------------MERIQSTL
A0A2W4RFS2      ------------------------------------------------------------
A0A1Y6DC43      ------------------------------------------------------------
A0A2S6HE06      ------------------------------------------------------------
G3J0M3          ------------------------------------------------------------
V5C6R5          ------------------------------------------------------------
A0A354EF47      --------------------------------------------------MAVGKVSRAL
A0A2G6MSP7      -----------------------------------------------------MVLNLLI
A0A4U8YMP3      ---------------------------------------------------MMGHFSKAL
A0A1Q8QQ99      ----------------------------------------------------MGRIEEAL
A0A3D5ZY44      -----------------------------------------------MAGAGTIVLLEVF
A0A646J2A6      ------------------------------------------------------------
A0A1G5C236      ----------------------------------------------------MGHFSKAL
A0A432HIS7      ----------------------------------------------------MGKIYDAL
A0A1I3XJ27      -----------------------------------MSGSEASAQKTPEGPGVLDRIQTAM
A0A1I7DCG1      ----------------------------------------------------MEHIHAAL
A0A3A3H6D9      ----------------------------------------------------MEHIHAAL
A0A562CGU2      ----------------------------------------------------MEHIRTAL
A0A0Q6VA36      -------------------------------------------------------MEQTV
A0A1B2EQN1      ----------------------------------------------------MEQIHDVL
A0A1E7HSL6      ----------------------------------------------------MGKISSAI
A0A4Q3ZDI7      ------------------------------------------------AALAGMLIGAAL
A0A537PRC6      ----------------------------------------MTPRERDARPRTVRAYPIAA
A0A2M7JX59      ----------------------------------------MRSALCPMRGFVMSRVFRAL
A0A3A4XVN3      -----------------------------------------------------MRMKIEK
A0A1E7JEV6      -----------------------------------------------------MYLRKSV
A0A2N2KDY5      -----------------------------------------------------MNLKNYF
A0A3N5YUD9      -----------------------------------------------------MSLKQAL
A0A0W1DLQ3      ----------------------------------------------------MADADPTT
A0A246JVD8      ----------------------------------------------------MADAELTT
A0A2N3BB54      ----------------------------------------------------MAEADPPP
A0A1H6G7A3      ----------------------------------------------------MADADMPL
A0A0A7PGL6      ----------------------------------------------------MADADLPL
A0A4Q2Z4L0      ----------------------------------------------------MADADLPL
A0A5C4N0H6      --------------------------------------------------MEADIVRKPK
A0A4R1HDF2      --------------------------------------------------MSMDYIKDAV
A0A1E7HFN0      ----------------------------------------------------MSMIKKAL
A0A1M5GH86      ----------------------------------------------------MGKIYEAL
A0A1W1XQZ5      ----------------------------------------------------MGKIYEAL
A0A3D6C3I2      ------------------------------------------------------------
S0G1D4          ----------------------------------------------------MGKLFDAL
A0A661T246      ----------------------------------------------------MGKIFDAL
A0A2G6CSG7      ----------------------------------------------------MGKIHDAL
A0A2G6NB59      ----------------------------------------------------MGKIHDAL
A0A5K8A7T9      ----------------------------------------------------MGKIHEAL
A0A1W9U045      ----------------------------------------------------MGKIFDAL
A0A1F9L9G4      ----------------------------------------------------MGKIFEAL
A0A328FD76      ----------------------------------------------------MGKIFRAL
A0A348UX90      ----------------------------------------------------MGKIFKAL
A0A357Z0N5      ----------------------------------------------------MGKIFKAL
A0A0F2R2U0      ----------------------------------------------------MGKIFDAL
A0A5K7ZK00      ----------------------------------------------------MGKIHEAL
A0A5K7YCX8      ----------------------------------------------------MGKIHDAL
A0A5K7Z388      ----------------------------------------------------MGKIHDAL
A0A352B502      ----------------------------------------------------MSKIEEAL
A0A2K8WHP8      ----------------------------------------------------MPPLSLTP
A0A410V446      ----------------------------------------------------MDSIKHAV
A0A0R3KGJ5      ----------------------------------------------------MDSIKQAV
A0A0R3N604      ----------------------------------------------------MDSIKQAV
A0A1B1UCM8      ----------------------------------------------------MDSIKQAV
A0A1N6JQ20      ----------------------------------------------------MDSIKQAV
A0A1M5TI07      ----------------------------------------------------MDSIKQAI
A3X191          ----------------------------------------------------MDSIRQAV
A0A1H4RKV5      ----------------------------------------------------MDSIKQAV
A0A160UA87      ----------------------------------------------------MDSIKQAV
A0A1Q5SFV5      ----------------------------------------------------MESIKQAV
A0A1J5N774      ----------------------------------------------------MSRIEEAL
A0A2C8F781      ----------------------------------------------------MSRIEEAL
A0A2E3R6G0      ----------------------------------------------------MSRIEEAL
A0A1F8XMK2      ----------------------------------------------------MSRIEEAI
A0A3M8EMP2      ----------------------------------------------------MSRIEEIL
A0A2J6J6K6      ----------------------------------------------------MSRIEQAL
A0A661PSB9      ----------------------------------------------------MSRIEQAL
A0A661QBT6      ----------------------------------------------------MSRIEQAL
A0A1G6EKK9      ----------------------------------------------------MSRIEQAL
A0A6I2SLK2      ----------------------------------------------------MSRIEKAL
A0A0A8WSG4      ----------------------------------------------------MSRIEKAL
S7TK97          ----------------------------------------------------MSRIEEAL
S7UE93          ----------------------------------------------------MSRIEEAL
A0A3D5BR56      ----------------------------------------------------MSRIEDAM
A0A2N2IB15      ----------------------------------------------------MSRIEDAL
A0A1I3PSR2      ----------------------------------------------------MSRIEEAL
A0A1I4GEK4      ----------------------------------------------------MSRIEEAL
A0A2T5R3J5      ----------------------------------------------------MSRIEKAL
A0A1W7QPT7      ----------------------------------------------------MSRIEEAM
A0A0M4D373      ----------------------------------------------------MSRIEKAL
A0A1L3GKM9      ----------------------------------------------------MSRIEKAI
A0A430DNP0      ----------------------------------------------------MAEPPLAP
A0A3A0FQ32      ----------------------------------------------------MGKVYEAL
A0A1E4UZA0      ----------------------------------------------------MERIKQAI
A0A1H9KL56      ----------------------------------------------------MERIKQAI
A0A1A9KEF8      ----------------------------------------------------MDRNTPAH
A0A5E6PKN5      ----------------------------------------------------MDIIKPDA
A0A0N9W1V6      ------------------------------------------------------------
A0A423GQ41      ------------------------------------------------------------
A0A423H7J2      ------------------------------------------------------------
A0A502HNM8      ----------------------------------------------------MEIIKPAS
A0A4Q7H223      ----------------------------------------------------MEIIKPAG
A0A1H4N2K9      ----------------------------------------------------MEIIKPAG
A0A2K4KWF7      ----------------------------------------------------MEIIKPTG
A0A3E0WXH2      ----------------------------------------------------MERIKQAL
A0A2N2TRC8      ----------------------------------------------------MERIKLAI
A0A1V4CIZ7      ---------------------------------------------------------MPV
A0A1M3BXA5      ----------------------------------------------------MERIKQAL
A0A1Y2R3U6      ----------------------------------------------------MERIKEAV
A0A167HVD6      ----------------------------------------------------MERIKLAI
A0A1V3SCT6      ----------------------------------------------------MERIKLAI
L0H287          ----------------------------------------------------MHRLRKAG
A0A495VG93      ----------------------------------------------------MERIKQAI
A0A4R3MYM4      ----------------------------------------------------MERLKKAM
G2E3C0          ----------------------------------------------------MERLKKAM
A0A4U8YLL7      ----------------------------------------------------MGIFRKAV
A0A3N5RNY4      ----------------------------------------------------MNSTEQVS
A0A1V4M8I1      ----------------------------------------------------MGKIADAL
A0A4Z0M4C7      ----------------------------------------------------MEHGQGAG
A0A5Q2QDL1      ----------------------------------------------------MSRLYDAV
A0A1I0R9R6      ----------------------------------------------------MEKLQAAI
A0A443K010      ----------------------------------------------------MEKLQIAI
A0A6I7NYG5      ----------------------------------------------------MEKIQQAI
A0A238IZI1      ----------------------------------------------------MEKLQAAL
A0A316GHM6      ----------------------------------------------------MEKLQAAL
A0A520ZTR8      ----------------------------------------------------MEKLQAAL
A0A212AR83      ----------------------------------------------------MERLQAAI
A0A2E2P4I0      ----------------------------------------------------MDRLQQAI
A0A2U2CM86      ----------------------------------------------------MDRLQMAL
A0A1X7ACC1      ----------------------------------------------------MDRLQQAI
A0A2N3BVE7      ----------------------------------------------------MEKLEAAL
A0A2S5JE21      ----------------------------------------------------MEKLEAAL
A0A2R8BKZ2      ----------------------------------------------------MEKLEAAL
A0A2S8S361      ----------------------------------------------------MEKLEAAL
A0A238KUF6      ----------------------------------------------------MERLQAAI
A0A095CTW3      ------------------------------------------------------------
A0A2E3UGD6      ----------------------------------------------------MEKLQAAL
A0A2T0RFH0      ----------------------------------------------------MEKLQAAL
A0A285D390      ----------------------------------------------------MEKLQKAL
A0A497VHN4      ----------------------------------------------------MEKLQKAL
A0A318CT66      ----------------------------------------------------MSKLEKAM
A0A3N5P205      ----------------------------------------------------MSRLEKAL
A0A2N6BEI9      ----------------------------------------------------MSRLEKAV
A0A0D5N3E9      ----------------------------------------------------MSRIEQAL
A0A2N2G716      ----------------------------------------------------MSRRTQTQ
W9VVY5          ----------------------------------------------------MDRARAER
A0A1E2URD3      ----------------------------------------------------MEKIKDAL
A0A2T6MY81      ----------------------------------------------------MEKLKKAL
A0A2T6NBQ8      ----------------------------------------------------MEKIKQAL
A0A421K431      ----------------------------------------------------MEKIKQAL
A0A2G2I5M1      ----------------------------------------------------MDRIQKAL
A0A2G2M6F0      ----------------------------------------------------MDRIQKAL
A0A1W9J9F8      -----------------------------------------------MEKIKDALAKAKI
A0A2S5LFJ9      -----------------------------------------------MEKIKDALAKAKI
A0A2D8R8F8      ----------------------------------------------------MEKFDNII
A0A6I4JXQ8      ----------------------------------------------------MEIIKPDT
A0A010SNS0      ----------------------------------------------------MEIIKPDT
A0A0C2I782      ----------------------------------------------------MEIIKPDT
A0A2N8BYF5      ----------------------------------------------------MEIIKPDT
A0A558FKX2      ----------------------------------------------------MEIIKPDT
A0A1H1DBA0      ----------------------------------------------------MEIIKPAS
J2TAD5          ----------------------------------------------------MEINKPDT
J3H699          ----------------------------------------------------MEFNKTDT
A0A1H5J974      ----------------------------------------------------MEIIKPDT
A0A0K1QRZ4      ----------------------------------------------------MEIIKPDT
A0A560RJW9      ----------------------------------------------------MEIIKPDT
A0A5E6TID7      ----------------------------------------------------MEIIKPDT
A0A5E7CRU7      ----------------------------------------------------MEIIKPDT
A0A5E7C564      ----------------------------------------------------MEIIKPDT
A0A2W7MAV4      ----------------------------------------------------MEMFNPDT
A0A4R3WQH5      ----------------------------------------------------MEMFNPDT
W6VFG3          ----------------------------------------------------MEMFNPDT
A0A1P8ENT1      ----------------------------------------------------MEIINSDT
A0A2N7XRV4      ----------------------------------------------------MEIINSDT
A0A0Q6QPG8      ----------------------------------------------------MEIFNPDT
A0A0F4SWA7      ----------------------------------------------------MEISNPDT
A0A423J219      ----------------------------------------------------MEIINSDT
A0A4P6G9U8      ----------------------------------------------------MEIINLDT
A0A4Y8JE06      ----------------------------------------------------MEIINLDT
A0A502I1X9      ----------------------------------------------------MEIINPDT
A0A502J776      ----------------------------------------------------MEIINPDT
A0A5B0EZF6      ----------------------------------------------------MEIINLDT
A0A059L434      ----------------------------------------------------MEMFNPDT
A0A0F4UWN2      ----------------------------------------------------MEMFNPDT
A0A5E7WEF5      ----------------------------------------------------MEMFNPDT
A0A1G0KSD0      ----------------------------------------------------MERIKEAI
A0A4P6WX84      ----------------------------------------------------MERIKLAI
A0A1D2S760      ----------------------------------------------------MERIKQAL
A0A5B8RW94      ----------------------------------------------------MERIKQAL
A0A258TN88      ----------------------------------------------------MERIKQAV
A0A1F9EUS2      ----------------------------------------------------MSRIYRAL
A0A6H9HII8      ----------------------------------------------------MERIRKAL
A0A3N9VAW3      ----------------------------------------------------MSRIEEAL
A0A1X0YE57      ----------------------------------------------------MSRIDRAI
A0A2K2H9Q8      ----------------------------------------------------MSRIDRAI
A0A6I1KNW9      ----------------------------------------------------MSRIEDIL
A0A1H4B8T3      ----------------------------------------------------MSRIEEAL
A0A1E7IQC3      ----------------------------------------------------MSRIQDAL
A0A1M6KEN5      ----------------------------------------------------MSRIEEAL
A0A353QLL3      ----------------------------------------------------MSRIDQAI
A0A399I453      ----------------------------------------------------MSRIEKAL
A0A651FBV9      ----------------------------------------------------MSRIEEAL
A0A5C1MDH8      ----------------------------------------------------MSRIEKAM
A0A5A9XE04      ----------------------------------------------------MSRIEKAM
A0A643G9R1      ----------------------------------------------------MSRIEKAM
A0A1G0M8Q7      ----------------------------------------------------MSRIEMAM
A0A353MI14      ----------------------------------------------------MSRIEMAM
A0A4S1CAW7      ----------------------------------------------------MSRIEMAM
A0A562VHD2      ----------------------------------------------------MSRIERAL
A0A6I6JNB5      ----------------------------------------------------MSRIEEAL
A0A1G0LDK7      ----------------------------------------------------MSRIEEAL
A0A6F9WVL7      ----------------------------------------------------MSRIEEAL
A0A2M7WWF7      ---------------------------------------------------MVPRLKESA
A0A351Z9A2      ----------------------------------------------------MPVIAAQK
A0A351B422      ----------------------------------------------------MSFIDKAL
F2NEE9          ----------------------------------------------------MSFIDKAL
B7RS54          -----------------------------------------------MVPEAGHKGAPTM
A0A3N5FRH4      ----------------------------------------------------MGKMYEAL
A0A1V4Y2C3      ----------------------------------------------------MGKMYEAL
A0A2N2KTJ4      ----------------------------------------------------MGKMFDVL
A0A2N2LQX0      ----------------------------------------------------MGKMFDVL
A0A520CSP5      -------------------------------------PKIPVKPQKPLIVALGGVLGLLA
A0A1I6ENM4      ----------------------------------------------------MEKLQKAL
A8LNM8          ----------------------------------------------------MEKLQAAL
A0A0T5NSU3      ------------------------------------------------------------
A0A5P9I718      ----------------------------------------------------MERLQAAI
A0A2M8J3R9      ----------------------------------------------------MDRLQQAI
A0A1I6X762      ---------------------------------------------------MTDRLQQAI
A0A0P1EFX8      ----------------------------------------------------MEKLQKAI
A0A2G5KB39      ----------------------------------------------------MERLQAAI
A0A2N3CNV1      ----------------------------------------------------MERLQEAL
A0A257F1F4      ----------------------------------------------------MDRLSEAI
A0A1G9FY29      ----------------------------------------------------MDRLQTAI
A0A4Q3ZBK4      ----------------------------------------------------MDRLQQAI
A0A2D5J8T8      ----------------------------------------------------MERLQTAI
A0A2E3P9W6      ----------------------------------------------------MERLQDAI
A0A2G2B1P9      ----------------------------------------------------MERLEAAL
A0A258GCD5      ----------------------------------------------------MEKLEAAL
A0A2D9YR88      ----------------------------------------------------MERLQAAI
A0A443INY4      ----------------------------------------------------MEKLQIAI
A0A372IH36      ------------------------------------------------MSSNSRDTGPDG
A0A540VW45      ---------------------------------------------------------MEL
A0A1H9C241      ----------------------------------------------MAEHVVRRRGQKRL
A0A2E3FCR1      ----------------------------------------------MVNYVLRRNRRKEI
A0A4S3MG69      ----------------------------------------------MVKYVLRRN-RTET
A0A3E0H727      ----------------------------------------------------MVALQEVL
A0A1G8QZS5      ----------------------------------------------------MERIQAAL
A0A1V4QMH7      ----------------------------------------------------MGFIDKAL
A0A496XZQ4      ----------------------------------------------------MGFIDKAL
A0A1F9BJF7      ----------------------------------------------------MSFIDKAL
F2NDF5          ----------------------------------------------------MSFIEKAV
A0A1I3TTC3      ----------------------------------------------------MDRLHAAI
A0A1H3IZW6      ----------------------------------------------------MDRIQAAI
A0A0M6YG59      ----------------------------------------------------MDRIQAAI
A0A1H7G8B0      ----------------------------------------------------MDRLQAAI
A0A059IPK4      ----------------------------------------------------MERLEAAM
A0A1H2Y469      ----------------------------------------------------MERIQAAI
A0A497ZQU7      ----------------------------------------------------MERIQTAI
A0A318D3U4      ----------------------------------------------------MGKIADAL
A0A401FQP5      --------------------------------------MTPTLPKVSQQLYCRGQRVKLF
A0A1Q6DMW3      ----------------------------------------------------MGKVFDAL
A0A3A6P8F8      ----------------------------------------------------MGKVAEAL
A0A2G2DSM4      ----------------------------------------------------MGKFSTTL
A0A1F9NI02      -----------------------------------------------------MKISEAL
A0A4U1ABX4      ----------------------------------------------------MAKISEVL
A0A351Z4H9      ------------------------------MGXKGVPKDNVFDRQEAQPEQYQESERATY
A0A2N2KML4      ----------------------------------------------------MGKMYDAL
E1YJF1          ----------------------------------------MNKKQEYIGWIFMGKMFEAL
A0A1J5EVZ6      ----------------------------------------------------MGKIHTAL
A0A2G6FCC5      ------------------------------------------------MGETVGKVLRAL
A0A1F9MR25      ----------------------------------------------------MGKFFNVL
A0A2G6M7F1      ----------------------------------------------------MGKVYKIL
A0A1E7H876      ---------------------------------------------------MSGQPAAEP
A0A509L3P8      ----------------------------------------------------MGKIYDAL
A0A3A4S038      ----------------------------------------------------MGKVFDAL
A0A1F9N669      ----------------------------------------------------MGKMFEAL
A0A1F9PFA7      ----------------------------------------------------MGKMFEAL
A0A1H2EN09      ----------------------------------------------------MGKIYNAF
K0NP00          ----------------------------------------------------MGKIYSAF
A0A1E7JCL5      ----------------------------------------------------MGKFFEAL
A0A496YAH9      --------------------------MTKDDVERSRCAFFEAAMNLRKKGRGMGKIAEAL
A0A1V4S7E4      ----------------------------------------------------MGKIFNAL
A0A2N2H8D2      ----------------------------------------------------MGKISEAL
A0A2N2KC63      ----------------------------------------------------MGKISEAL
A0A3A4ZYW4      ----------------------------------------------------MGKISEAL
A0A1V4MCJ4      ----------------------------------------------------MGKISDAL
A0A661M0W4      ----------------------------------------------------MGKISDAL
A0A0F2NF69      ----------------------------------------------------MESFNEQH
A0A1F9NFD0      ----------------------------------------------------MESFTEQH
A0A1M5YLH5      ----------------------------------------------------MGKLADVL
A0A4U1A4C7      ----------------------------------------------------MGKFSKTL
                                                                            

E1Y9C0          ------------------------------------------------------------
A0A1N6SH58      ------------------------------------------------------------
A0A4Q3AQN2      ------------------------------------------------------------
A0A1W9HS52      FLSQNQHRMELLQYQKALLENDTSPDSKTRKDEIQSELDTVAQNLQKAIQEADQSGNLTF
A0A2D5LFD8      ------------------TEALKIEANLSSTEQSLLSLQNTRRNLEQVRKQVAAGNLNSF
A0A0N0XAV4      ------------------------------------------------------------
A0A0P9QD19      -----------------------------------------------MYTR---------
F3FHG4          -------------------------------------MKLKRVELERLYTR---------
F3GGI0          ------------------IETKGVLDQVVSLDSMLSELKLKRVELERLYTR---------
A0A0P9LE74      --------------------------------------------------T---------
A0A3M4ZQ14      ------------------IETKGVLDQVVSLDATLSELKLKRVELERLYTR---------
A0A3M5YLE8      ------------------IETKGVLDQVVSLDATLSELKLKRVELERLYTR---------
A0A3M3RP89      ------------------IETKGVLDQVVSLDATLSELKLKRVELERLYTR---------
A0A0P9QIY7      ------------------IETKGVLDQVVSLDATLSELKLKRVELERLYTR---------
A0A0P9VVH7      ------------------IETKGVLDQVVSLDATLSELKLKRVELERLYTR---------
A0A0Q0FJK6      ------------------IETKGVLDQVVSLDATLSELKLKRVELERLYTR---------
A0A0Q0G2J0      ------------------IETKGVLDQVVSLDATLSELKLKRVELERLYTR---------
A0A3M3LF66      ------------------IETKGVLDQVVSLDATLSELKLKRVELERLYTR---------
A0A0P9WIR8      ------------------IETKGVLDQVVSLDATLSELKLKRVELERLYTR---------
A0A3M3KPE5      ------------------IETKGVLDQVVSLDATLSELKLKRVELERLYTR---------
A0A3M4C263      ------------------IETKGVLDQVVSLDATLSELKLKRVELERLYTR---------
A0A3M5AD05      ------------------IETKGVLDQVVSLDATLSELKLKRVELERLYTR---------
A0A0Q0D3D2      ------------------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR---------
A0A0N0FS39      ------------------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR---------
A0A3M6GHH2      ------------------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR---------
A0A0P9R9W0      ------------------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR---------
A0A0Q0B9T0      ------------------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR---------
A0A3M6CFI7      ------------------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR---------
A0A0P9JXN0      ------------------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR---------
A0A3M6FIV7      ------------------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR---------
A0A3M3PLW9      ------------------IETKGVLDQVVSLDSMLSELKLKRVELERLYTR---------
A0A3M4ENY1      ------------------IETKGVLDQVVSLDSMLSELKLKRVELERLYTR---------
A0A3M5EZK7      ------------------IETKGVLDQVVSLDSMLSELKLKRVELERLYTR---------
A0A0P9SPP5      ------------------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR---------
A0A658KL17      ------------------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR---------
A0A3M3NNF2      ------------------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR---------
A0A3M4A0E8      ------------------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR---------
A0A3M4PBZ2      ------------------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR---------
A0A3M6AI26      ------------------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR---------
A0A0P9IWP8      ------------------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR---------
A0A0P9KZ49      ------------------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR---------
A0A0P9V840      ------------------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR---------
A0A0Q0AIE5      ------------------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR---------
A0A3M2ZQH6      ------------------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR---------
A0A0N8SQG2      ------------------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR---------
A0A0W8HFU1      ------------------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR---------
A0A3M5M873      ------------------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR---------
A0A0P9VHH8      ------------------IETKGVLDQVVSLDSMLSELKLRRLELERLYTR---------
A0A0P9YV98      ------------------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR---------
A0A3M3G2W8      ------------------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR---------
A0A3M6C224      ------------------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR---------
A0A3M5K254      ------------------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR---------
A0A3M5JFB0      ------------------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR---------
A0A3M3TQV3      ------------------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR---------
A0A3M3EF92      ------------------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR---------
A0A3M5J1E2      ------------------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR---------
A0A3M5G7H9      ------------------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR---------
A0A3M4A376      ------------------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR---------
A0A0Q0A5T8      ------------------IETKGVLDQVVSLDSMLSELKLKRVELERLYTR---------
A0A0P9SCD7      ------------------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR---------
A0A0P9T4G3      ------------------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR---------
A0A0P9VKB0      ------------------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR---------
A0A0Q0BM35      ------------------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR---------
A0A3M3TPR7      ------------------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR---------
A0A3M3U4Q3      ------------------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR---------
A0A0P9UCX7      ------------------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR---------
A0A0P9S1F1      ------------------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR---------
A0A0P9QCJ2      ------------------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR---------
A0A0P9Q329      ------------------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR---------
A0A3M5GJ64      ------------------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR---------
A0A0P9MPC7      ------------------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR---------
A0A3M2XYQ3      ------------------IETKGVLDQVVSLDSMLSELKLKRVELERLYTR---------
A0A0P9XCE1      ------------------IETKGVLDQVVSLDSMLSELKLKRVELERLYTR---------
A0A3M3EFX7      ------------------IETKGVLDQVVSLDSMLSELKLKRVELERLYTR---------
A0A3M5B9D9      ------------------IETKGVLDQVVSLDSMLSELKLKRVELERLYTR---------
A0A0P9RRZ3      ------------------IETKGVLDQVVSLESMLSELKLKRVELERLYTR---------
A0A3M2VEK7      ------------------IETKGVLDQVVSLDSMLSELKLKRVELERLYTR---------
A0A0N8R9B3      ------------------IETKGVLDQVVSLDSMLSELKLKRVELERLYTR---------
A0A0P9VA27      ------------------IETKGVLDQVVSLDSMLSELKLKRVELERLYTR---------
A0A3M4YBJ4      ------------------IETKGVLDQVVSLDSMLSELKLKRVELERLYTR---------
A0A0P9J470      ------------------IETKGVLDQVVSLDSMLSELKLKRVELERLYTR---------
A0A0Q0EVJ8      ------------------IETKGVLDQVVSLDSMLSELKLKRVELERLYTR---------
A0A3M5UI30      ------------------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR---------
A0A3M5YQT8      ------------------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR---------
A0A3M5F5X1      ------------------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR---------
A0A3M5R8G1      ------------------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR---------
A0A3M5V012      ------------------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR---------
A0A3M3GA16      ------------------IETKGVLDQVVSLDSMLSELKLRRVELERLYTR---------
A0A3M3UCT3      ------------------IETKGVLDQVVSLDSMLSELKLKRVELERLYTR---------
A0A3M3CJL0      ------------------IETKGVLDQVVSLDSMLSELKLKRVELERLYTR---------
A0A3M3F6F5      ------------------IETKGVLDQVVSLDSMLSELKLKRVELERLYTR---------
A0A3M3P9B7      ------------------IETKGVLDQVVSLDSMLSELKLKRVELERLYTR---------
A0A0N8QB74      ------------------IETKGVLDQVVSLDSMLSELKLKRVELERLYTR---------
A0A0Q0AUD0      ------------------IETKGVLDQVVSLDSMLSELKLKRVELERLYTR---------
A0A3M5VR55      ------------------IETKGVLDQVVSLDSMLSELKLKRVELERLYTR---------
A0A0Q0FK97      ------------------IETKGVLDQVVSLDSMLSELKLKRVELERLYTR---------
A0A3M5KZ75      ------------------IETKGVLDQVVSLDSMLSELKLKRVELERLYTR---------
A0A3M5L3G5      ------------------IETKGVLDQVVSLDSMLSELKLKRVELERLYTR---------
A0A0C5VQ86      ------------------------------------------------------------
A0A1V8MBH1      ------------------------------------------------------------
A0A534QGR3      ------------------------------------------------------------
A0A0R0BVC7      ------------------------------------------------------------
A0A0W1GMS6      ------------------------------------------------------------
A0A0Q8RMY3      ------------------------------------------------------------
A0A1A7QC21      ------------------------------------------------------------
A0A1F9CFF0      ------------------------------------------------------------
A0A2M8B0G5      ------------------------------------------------------------
A0A363TNU9      ------------------------------------------------------------
A0A534HBS8      ------------------------------------------------------------
A0A0F0T3Y9      ------------------------------------------------------------
A0A379GWF0      ------------------------------------------------------------
A0A536T0W8      ------------------------------------------------------------
A0A4Q2XLV7      ------------------------------------------------------------
A0A4Q5QYC4      ------------------------------------------------------------
A0A2G9XLE5      ------------------------------------------------------------
A0A3D2M6Y9      ------------------------------------------------------------
A0A3D2YAZ2      ------------------------------------------------------------
A0A350A102      ------------------------------------------------------------
A0A350L5D2      ------------------------------------------------------------
A0A3B8SQ27      ------------------------------------------------------------
A0A656BWB0      ------------------------------------------------------------
A0A6D0IFH4      ------------------------------------------------------------
A0A3Y2RPN4      ------------------------------------------------------------
A0A0A0FHV8      ------------------------------------------------------------
A0A1X3IPU7      ------------------------------------------------------------
A0A0A0G0N2      ------------------------------------------------------------
A0A243TPR1      ------------------------------------------------------------
A0A2I8SDU4      ------------------------------------------------------------
A0A2I8SU55      ------------------------------------------------------------
S1EXJ6          ------------------------------------------------------------
A0A376UBS1      ------------------------------------------------------------
A0A4Q6G931      ------------------------------------------------------------
A0A1W9F5M9      ------------------------------------------------------------
A0A3C2BN18      ------------------------------------------------------------
A0A447LR75      ------------------------------------------------------------
A0A376D8L7      ------------------------------------------------------------
A0A1V2FV46      ------------------------------------------------------------
A0A376SB61      ------------------------------------------------------------
A0A3D1BYV9      ------------------------------------------------------------
A0A6D0I9G1      ------------------------------------------------------------
A0A352MMI7      ---------------------------------------FKEAEISKLYTK---------
A0A379W6R2      ------------------------------------------------------------
A0A376RY66      ------------------LEAKAVLDSMVNIDAQLNELTFKEAEISKLYTK---------
A0A377K431      ---------------------------MVNIDAQLNELTFKEAEISKLYTK---------
A0A379TA56      ------------------------------------------------------------
A0A4Z0LWV1      ---------------------------RVHLDAPLNDLTVNEAEISKLFTK---------
A0A5V7HTZ1      ------------------LEAKAVLDSMVNIDAQLNELTFKEAEISKLFTK---------
A0A610XNI4      ------------------LEAKAVLDSMVNIDAQLNELTFKEAEISKLFTK---------
A0A620QD02      ------------------LEAKAVLDSMVNIDAQLNELTFKEAEISKLFTK---------
A0A5H3HSJ8      ------------------------------------------------------------
A0A655C5P0      ------------------------------------------------------------
A0A2T0VBD8      ------------------------------------------------------------
A0A378APS2      ------------------------------------------------------------
A0A443VCQ6      ------------------------------------------------------------
A0A447RKQ7      ------------------------------------------------------------
W1DSK1          ------------------------------------------------------------
A0A0U2VAW2      ---------------------------------MLTDWHY--------------------
A0A454CTF1      --------------------------MMVALEAQLNELTFKESEISQKFTQ---------
A0A6B3Q2G1      ------------------LEAQSTLKVMVALEAQLNELTFKESEISQKFTQ---------
A0A378G3G7      ------------------MEAKSLLDTMVQLDAQINQLTFSEAEVSKLYTK---------
A0A2X5NHJ9      ----------------------------MNVDNQLNQLTFREAEVSQLFTK---------
A0A2J4QEC3      ------------------------------------------------------------
A0A485ADM3      ------------------------------------------------------------
A0A4U9HGU4      ------------------MEAKSILDSIVAVEGQLNELTFKEADISKLYTK---------
A0A3S4JGG5      ------------------LEAKSVLDTIVGVEAQLNELTFKEAEISKLYTK---------
A0A377ZDH2      ------------------------------------------------------------
A0A3S4HTS8      ------------------------------------------------------------
A0A2N1XK22      ------------------------------------------------------------
A0A3D0KAC8      ------------------AETQSVLDRIVDLEKQISEQNLKRTEMERRFTR---------
A0A3D2Y902      ------------------------------------------------------------
A0A655RNN3      ------------------------------------------------------------
A0A655R819      ------------------------------------------------------------
A0A655ZEY0      ----MKSASAQLEAVRKNLRAELRQLLNGINNELQAAKQSERSLQTEFNQR---------
A0A6G6X2Z4      ------------------------------------------------------------
Q44570          ------------------------------------------------------------
A0A3N5MZ53      ------------------------------------------------------------
A0A534E4H4      ------------------------------------------------------------
A0A534I2B6      ----MIAAQNELAQATENLNNQARSVIEGIRKRYEAAKSEEAAIVAALNRA---------
A0A1C2JGD0      ------------------------------------------------------------
A0A259LQ70      ------------------------------------------------------------
A0A4V2SPR5      ------------------------------------------------------------
A0A3N5PM86      ----MVRLSAAMKGINEKIAQEVKKILQSVETEYRVALAEEKSIREAMEEK---------
A0A2E5YSA4      ------------------------------------------------------------
A0A519ERR1      ------------------------------------------------------------
A0A4Q3Q1M2      ------------------------------------------------------------
A0A4Q3MHR1      ------------------------------------------------------------
A0A520GDZ4      ------------------------------------------------------------
A0A318DSU0      -------------------------------------MSQIGQLQAQKGDI---------
A0A538PF21      ------------------------------------------------------------
A0A1W1ZH10      ------------------------------------------------------------
A0A1W2FF24      ------------------------------------------------------------
A0A524JYQ6      ---------QQLAELGVKLDKACQLAAEGVSSRLAMAQSKEDAIRREFSEQ---------
A0A4Q3MA17      ------------------------------------------------------------
A0A0N0M5F7      -------------------------------------------MQGEVERL---------
A0A537M754      -------------------------------------------MNG----I---------
A0A1V1PDB4      ------------------------------------------------------------
A0A2M7C324      --------------------MQVADVVSGFEREYEMARANESALAGSVAEA---------
A0A4Q3HHG6      ------------------------------------------------------------
A0A3B7DTA4      ------------------------------------------------------------
A0A432ZK62      --------------------------MVACLGLDLCWFDRRLSLRLVIKQI---------
A0A1V5EEP4      ------------------------------------------------------------
A0A1V5EF48      ------------------------------------------------------------
A0A0S6X1X6      ------------------------------------------------------------
A0A537Y5L8      ------------------------------------------------------------
A0A4Q3L2X2      ------------------------------------------------------------
A0A4Q3T8J1      ------------------------------------------------------------
A0A4Q4ANM4      ------------------------------------------------------------
A0A4Q3UEC7      ------------------------------------------------------------
A0A1H5YYQ4      ------------------------------------------------------------
A0A1X4NLK2      ----------------MTEQPKFQRRKRRGANTAAEQAQPVAVNAPDSRVA---------
A0A1X4NWB5      ----------------MTEQPKFQRRKRREEASADVQPKRTPERNDTPTLD---------
A0A1M5UQ38      ------------------------------------------------------------
A0A327YI48      ------------------------------------------------------------
A0A1B1PNL6      ----------------MVERRRFRRRKRSEETPEDPPILP--------------------
A0A2U8H9H9      ----------------MVERRKFQRRKRVDETPEDPPIFP--------------------
A0A6B2NBB8      ----------------MVERRKFQRRKRVDETPEDPPIFP--------------------
A0A1X6YIC0      ------------------------------------------------------------
A0A1I5E9E9      --------------------------------------MK--------------------
A0A1X6Z7N7      --------------------------------------MK--------------------
A0A2E1DQ13      ---------------------MAGDPAMKQAPEAAAEDVT--------------------
A0A1H8C800      --------------------------------------MK--------------------
A0A2N3EZ05      ---------------------------MRQAPEAEAEDAT--------------------
A0A3N5J7U8      ------------------------------------------------------------
A0A1S7S3I8      ------------------------------------------------------------
A0A519E8D7      ------------------------------------------------------------
A0A3S1NZ06      HPQAVALAKEKADISAQIFGELKQLTESYRNEYEVALARETALRANVAAAQ---------
A0A3S1FD32      ------------------------------------------------AAQ---------
A0A434DUT4      ---------------------------------------------NVALAA---------
A0A528D3U3      ------------------------------------------------------------
A0A3S3UPT3      ------------------------------------------------------------
A0A3S1E286      ------------------------------------------------------------
A0A531AC71      ------------------------------------------------------------
A0A436K268      ------------------------------------------------------------
A0A434IDQ0      ------------------------------------------------------------
A0A435IRM5      ------------------------------------------------------------
A0A3S2C404      ------------------------------------------------------------
A0A435F6C0      ------------------------------------------------------------
A0A435BMN6      ------------------------------------------------------------
A0A529XQ54      ------------------------------------------------------------
A0A530BJC1      ------------------------------------------------------------
A0A348SRI7      ------------------------------------------------------------
A0A354EI73      ------------------------------------------------------------
A0A4Q3IRI1      ------------------------------------------------------------
A0A4P7EP83      ------------------------------------------------------------
A0A6I1QB25      ------------------------------------------------------------
A0A655ZZQ1      ------------------------------------------------------------
A0A1S0ZAI3      ------------------------------------------------------------
A0A1W9M770      ------------------------------------------------------------
A0A1W9M7R6      ------------------------------------------------------------
A0A3A4NIE9      ------------------------------------------------------------
A0A3A4NUI9      ------------------------------------------------------------
A0A524I3Z6      ------------------------------------------------------------
A0A524PCL7      ------------------------------------------------------------
A0A356GQV1      ------------------------------------------------------------
A0A1J5DAY8      ------------------------------------------------------------
A0A524P237      ------------------------------------------------------------
A0A3C0L0A8      ------------------------------------------------------------
A0A176S762      ------------------------------------------------------------
A0A377ZC40      ------------------------------------------------------------
A0A378BPJ7      ------------------------------------------------------------
A0A2J5PAJ7      ------------------------------------------------------------
A0A377ZDN3      ------------------------------------------------------------
A0A1G3JY11      ------------------------------------------------------------
A0A661N3U1      DV----------------------------------------------------------
A0A1W9WUD9      ------------------------------------------------------------
A0A1W1ZQK0      ------------------------------------------------------------
A0A4U1ALN4      SA------------------------------------------DNAATGG---------
A0A4U1B1A8      EP------------------------------------------TEKQEVA---------
A0A1M7Y300      AA------------------------------------------EEPSSYQ---------
A0A4U1A967      RV------------------------------------------DNERETR---------
A0A6I1R304      ------------------------------------------------------------
A0A1W9PMU6      ------------------------------------------------------------
A0A6D0ELN7      ------------------------------------------------------------
A0A3S1WTQ1      KEEKPGETQVDAKTTQSLSSAEKR------------------------------------
A0A440NX85      ------------------------------------------------------------
A0A530CUR9      ------------------------------------------------------------
A0A1M6N1X5      ------------------------------------------------------------
A0A561M3U0      -------------------------------------------------FA---------
A0A1G3VVY5      ------------------------------------------------------------
A0A2N6BZD5      VG----------------------------------------------------------
A0A656PSQ6      ------------------------------------------------------------
A0A2W5J775      ------------------------------------------------------------
A0A352Q5C1      ------------------------------------------------------------
A0A435NNF5      ------------------------------------------------------------
A0A3S2AQS7      -------------------------------------NKETDLKSKLAEME---------
A0A436XH86      ------------------------------------------------------------
A0A527ZPD6      ------------------------------------------------------------
A0A529KRW3      ------------------------------------------------------------
A0A530ZLX0      ------------------------------------------------------------
A0A355TB56      ------------------------------------------------------------
A0A1F9E324      AG------------------IRSE--------YESGLRKESLLRAAFEEQK---------
A0A432SAI6      ------------------------------------------------------------
A0A4Q3LBH4      SG------------------IRNA--------YQISNAREQQLANEIDKLK---------
A0A4Q3LWP3      SG------------------IKNQ--------YDVARARSEQLRREIDTLK---------
A0A2N6VGL1      ------------------------------------------------------------
A0A3M3H5V6      ------------------------------------------------------------
A0A524M660      ------------------------------------------------------------
A0A0C1TRU6      ------------------------------------------------------------
A0A2Z5SSF4      ------------------------------------------------------------
A0A2T4ZJZ6      TL------------------PATQ------------------------------------
A0A327LYE6      ------------------------------------------------------------
A0A5A9ZTV3      ------------------------------------------------------------
A0A4Q4CIB1      ------------------------------------------------------------
A0A522ACJ9      ------------------------------------------------------------
A0A1T2KYM8      NN------------------IDKE--------FERAQWLEKKLQKQFDDLK---------
A0A3N5Z7F8      ------------------------------------------------------------
A0A2G9ZR82      QS------------------IASD--------YKTALKKLEALKERVELQK---------
A0A239HD34      ------------------------------------------------------------
A0A4U9I390      ------------------------------------------------------------
A0A534V9L7      TE----------------------------------------------------------
A0A0P7ZZE4      PA----------------------------------------------------------
A0A369R0Q9      PA----------------------------------------------------------
A0A534XP85      ------------------------------------------------------------
A0A2X3M011      ------------------------------------------------------------
I2WC85          ------------------------------------------------------------
A0A400JH80      VLEQIVNVDNQLNELTFREAEISQLYKKDHPTYRALLEKRQTLEQERKRLN---------
A0A2H9EHM4      ------------------------------------------------------------
A0A380B3D7      ------------------------------------------------------------
F5NSX0          ------------------------------------------------------------
A0A479JNB1      ------------------------------------------------------------
A0A5C9AF52      ------------------------------------------------------------
A0A6D0EYC7      ------------------------------------------------------------
D8EEU7          ------------------------MYKKDHPTYRALLEKRQTLEQERKRLN---------
A0A0P1H2H0      ------------------------------------------------------------
A0A258WKV0      ------------------------------------------------------------
A0A377N8F8      AM------------------PKTQ------------------------------------
A5G4N9          ------------------------------------------------------------
A0A3C2DSE7      AS------------------IERS--------YQLAVANENSLRASFNDNK---------
A0A2X1JBG5      RL------------------PKTQ------------------------------------
A0A0B8PTA8      ------------------------------------------------------------
A0A0B8QF75      ------------------------------------------------------------
A0A4Q3LR91      NV------------------LSQN--------YQASLRREQQLQSQVKQLT---------
A0A6C9IKN8      LT----------------------------------------------------------
A0A4V1TR68      GA------------------LTEN--------YTAAVSRERALRERVSALK---------
A0A444IY46      --------------------MEVQ----------------------AQDQK---------
A0A6I7N627      ----------------------------------------------IDQRE---------
A0A660AID0      KL------------------PKTQ------------------------------------
A0A3E0WKI3      EL------------------PQSQ------------------------------------
A0A1H3I2J1      --------------------PERD-------------------ETEHDTQD---------
A0A1V5DJV0      ------------------------------------------------------------
A0A520IUC4      SS------------------LRSA--------YLAALGREAELRGQVSALR---------
A0A521LJG5      LA------------------VRAE--------LDAAKSEEDELKELLDKAS---------
A0A531IBQ7      ES------------------YRND--------YEVALQRETALRQNVAAAA---------
A0A377LY04      AM------------------PKTQ------------------------------------
A0A5C9ABR5      ------------------------------------------------------------
A0A5J9WU72      ------------------------------------------------------------
A0A2X3K9R3      AM------------------PKTQ------------------------------------
A0A5W0ZR28      AM------------------PKTQ------------------------------------
A0A622KDG2      AM------------------PKTQ------------------------------------
A0A3T9EHW9      AM------------------PKTQ------------------------------------
A0A484X141      AM------------------PKTQ------------------------------------
A0A5N9VWI6      AM------------------PKTQ------------------------------------
A0A6D0EJQ0      ------------------------------------------------------------
A0A376LLF8      ------------------------------------------------------------
A0A444R390      ------------------------------------------------------------
A0A6C9J192      ------------------------------------------------------------
A0A1V4WHZ7      ND------------------------------YAIARAKENSARSAVEGQK---------
A0A1E5AJN5      DS------------------FVLR--------LAQAQQREETLRQELALVT---------
A0A2N3D2J1      SA------------------IRTE--------FEVARDQEGALQQEVSALK---------
A0A2N2GVE1      DA------------------LVAE--------YQLKERNLQESRALMLQAQ---------
A0A2N2INV3      DA------------------LVAE--------YQLKERNLTESRALMLQAQ---------
A0A1Y5DXG5      NL------------------PETQ------------------------------------
A0A0B8P2H5      QL------------------PKTQ------------------------------------
A0A483QWI8      AM------------------PKTQ------------------------------------
A0A483UXD3      AM------------------PKTQ------------------------------------
A0A0A8J8L3      AM------------------PSTQ------------------------------------
A0A660DJ38      GM------------------PSTQ------------------------------------
A0A380AQW6      SL------------------PKTQ------------------------------------
A0A2G2GD62      LG------------------------------IKTIKTRKEYLRRELKVRQ---------
A0A524P331      LT-----------------------------------KQEASINEQIAEYE---------
A0A4V1SSM5      SG------------------LQAN--------AQAASARAGSLRGELSRLR---------
A0A4Q3K8G7      SN------------------LEAR--------VQVAGQRASAASGIASASR---------
A0A1M7HC79      QL------------------PAEQ------------------------------------
A0A1D3JZN6      GL------------------PSTQ------------------------------------
A0A1V6ESG1      AS------------------VKSQ--------YDAAKRQEDLVRMRLQETR---------
A0A1H7YHK3      EL------------------PDTQ------------------------------------
A0A534SH66      ------------------------------------------------------------
A0A3M0ZZ99      AE----------------------------------------------------------
A0A238LBD3      DE----------------------------------------------------------
A0A328C2K5      SA------------------VANR--------AAVTRRNTESLQDEIERHK---------
A0A5C6X8M3      TA------------------VANR--------AAVTRRNAANLQEEIERHK---------
A0A3D8MRR7      TA------------------VANR--------AAVTRRNTANLQEEIERHK---------
A0A5C6UBJ7      TA------------------VANR--------AAVTRRNTANLQEEIERHK---------
A0A5C6XGM3      TA------------------VANR--------AAVTRRNAANLQEEIERHK---------
A0A537NZJ1      ------------------------------------------------------------
A0A0P1FRV5      SG----------------------------------------------------------
A0A4Q4CVW6      EA------------------LRSE--------LAVLDRNGESLEARYVTLR---------
A0A090R136      DL------------------PKTQ------------------------------------
A0A661JU93      KSGPSAGDPIFQNLIAGIIESETK--------IQSTEGRINALEQLIKKYE---------
A0A2E2T3V8      RQ------------------IDFG--------NANAQARYELVLKQLVRWK---------
A0A367UAB4      RQ------------------IDFG--------NANAQARYELVLKQLVRWK---------
A0A0P1FWI8      --------------------FDPD------------------------------------
A0A377V641      TM------------------PETQ------------------------------------
A0A1F2YJ88      -------------------------------------------------LN---------
A0A0J7XGZ1      SG------------------LRAD--------VQIAESRLASLLDSRAQAK---------
I4CBA7          SS------------------------------LEAAKKRESAALQAYELAK---------
A3VE95          EL------------------RRNE--------VEVARLREQSLADGIQQLE---------
A0A1G0NL95      KL------------------PETQ------------------------------------
A0A024KA69      SG------------------FEER------------------------------------
A0A0L1KFN4      AS------------------VQAE--------YQQALAREEALQQRVSALK---------
A0A3P5DSS6      AM------------------PETQ------------------------------------
A0A483YEL5      TM------------------PETQ------------------------------------
A0A658GUJ0      TM------------------PETQ------------------------------------
A0A358L616      QM------------------PQTQ------------------------------------
A0A1M7BLL7      ------------------------------------------------------------
A0A0H4KZM1      AP----------------------------------------------------------
A0A3D5UYX7      ES------------------LANN--------VSVAKTRVSALRDNLNQIK---------
A0A2N1WQN5      ------------------------------------------------------------
A0A352G2C2      TL------------------PSTQ------------------------------------
A0A3C0PZN1      TL------------------PSTQ------------------------------------
A0A524QFS4      EKSIA--------------EARTE------------------------------------
A0A1V1UJT2      EPEPE--------------PEP--------------------------------------
A0A0L6CVX1      ------------------------------------------------------------
A0A1V0RR48      ------------------------------------------------------------
A0A0A0HJJ4      EP----------------------------------------------------------
A0A5E7YA28      EPEPE--------------PEPEP------------------------------------
A0A520JSW4      TDRLG--------------TLRQD--------FQAARAEEDRLRAQVAGLS---------
A0A4Q3LTF3      NS------------------LQAD--------YREALERERALQAKVNQLK---------
A0A537UTP9      QT------------------YRSD--------YEIAKAREESISKSLTEIV---------
A0A1D2RNR5      AS------------------VRNQ--------ALMAKRQENLIRTRLQQTR---------
A0A4V1TQ46      GA------------------IQQR--------YLVAAAQERALSENLDQFK---------
A0A3A0FZC0      TG------------------LKAK--------MLAAQQEEKNLHEELEQQK---------
A0A1N7JVZ7      IAAIE--------------ATPSISARAPEDAGDRARTEPDPLMAQHPEPE---------
A0A091C4A8      AA------------------IRGE--------YESALAQEQMLRAQIDALK---------
A0A4R3H6P6      VS------------------LRQA--------YESSVMRERSLLARVQDLK---------
A0A3S1NQ09      ES------------------YRNE--------YEVAQARETALRANVAAAQ---------
A0A443GJ52      ES------------------YRNE--------YEVALARETALRANVALAA---------
A0A2W6S588      RS------------------ARAE--------SAAAAARSASLQASLAQAQ---------
A0A483E0N4      TM------------------PETQ--------QEILR-----------------------
A0A2J4YQQ6      SM------------------PETQ--------QEILR-----------------------
A0A483THX4      SM------------------PETQ--------QEILR-----------------------
A0A534MVS2      SGLHS--------------FHVPAKINFSHLLLELFRSDATPFQPDPAQWL---------
A0A444I5K6      ES------------------YQSE--------LQVAKSRENSLRDSVTQAT---------
A0A154VE85      IG------------------LANE--------VEVARARERALQQEVDRLQ---------
A0A3S1MCW7      DS------------------LRQK--------YQEAQNKEADLKSKLAEME---------
A0A434IGN6      DS------------------LRQK--------YQEAQNKEADLRSKLAEME---------
A0A528AX40      DS------------------LRQK--------YQEAQSKEADLRSKLAEME---------
A0A528MV95      DS------------------LRQK--------YQEAQNKEADLKSKLAEME---------
A0A3C1S9Y1      SS------------------LRNE--------YRMAVAKEDSLKKSFEEQK---------
A0A353EH49      PN------------------VQKD------------------------------------
A0A1Y1Q9C1      QS------------------LQTEDATIRQADYISARKLEDDLRAEVESYK---------
A0A3M7LJH0      KL------------------PKTQ--------REILR-----------------------
A0A316KRG4      DT----------------------------------------------------------
A0A1E4JHX8      TS------------------LQQS--------YQASVARVGDLEGRVSNLK---------
M2U8P2          DA------------------ARRE--------AQTASRRTASIRSSLNDAQ---------
A0A1H7KZF8      AG------------------LHTP--------LDSATRDEAELASRFARLQ---------
A0A0J5Q9T7      EQTQR--------------RADAQ--------AKAQAPRAAAAAQAVLRAE---------
A0A257NG76      VL------------------PETQ--------QVILR-----------------------
A0A1T4TW59      IG------------------IQKE--------LDNAIKQEAALVADLENKK---------
A0A1I5YYQ0      PEMRQ--------------DAPTD--------AAPEETPPPMAEAQEPAAL---------
A0A5P9FE62      PEMRQ--------------DAPTD--------AAPEETPPSMAEAQEPAAL---------
A0A1Q3MB35      QA------------------AQTT--------YQEALARENSLNREVAALK---------
A0A259LUN7      AN------------------LESE--------LRVAESQINSIQGQIGQSS---------
A0A2D7AVL1      DA------------------LETS--------FRAAEAKEASLRERIGELK---------
A0A3B9KZE9      DA------------------LETS--------FRAAEAKEASLRERIGELK---------
A0A2U0NMP8      TM------------------PETQ--------QEVLR-----------------------
A0A4U9HNE9      NL------------------PKTQ--------QEVLR-----------------------
A0A2G2CXY6      DL------------------PSTQ--------QELLR-----------------------
A0A3M1D4H3      DPTVE--------------QYEAQ--------LAGLVKKGAEIDASIQRTT---------
A0A5C8BYM7      AS------------------VSNT--------LEMTKRQEALLRSRLETTR---------
A0A1J5ICP0      AS---------------------------------LKVNERSIKGNISSYE---------
A0A0M3GBT1      QT------------------MRAK--------LAALDHEAAAVQSILDVAH---------
B3Q577          QT------------------MRAK--------LAALDHEAAAVQSILDVAH---------
A0A379B9V4      KL------------------PNTQ--------KEMIR-----------------------
A0A0Q6TS97      VS------------------LQQA--------YDSSQTRERALTARVEGLK---------
A0A0Q6UYB4      VS------------------LQQA--------YDSSQTRERALTARVEGLK---------
A0A484XS37      VM------------------PKTQ--------QVILR-----------------------
W7Q5J0          EL------------------PTAQ--------QEVLR-----------------------
A0A654AKT6      AV-----------------------------------------------YL---------
A0A0G9MZA5      SGSQS--------------RLRAN--------YNEALAAEQRLQAQVNRLQ---------
H0T8B0          EG------------------YKSQ--------VQIAKAHEDELNKKLDEVF---------
A0A5C7N981      GG------------------LKAN--------YEAALAQEQLIAAKLKESK---------
A0A534TV22      RG------------------IQES--------YGAARAKEAALEAEAQKQQ---------
A0A351CXR4      SD------------------REKE--------FELAR-----------------------
A0A2N6GLF5      KG------------------VEKE--------YQVARENEQSIKRSLGSAK---------
A0A1W9LJP0      SS------------------LRNE--------YNLALAREQSLKQALNRQK---------
A0A0W1ICB0      GA------------------YSAD--------YNAAVQRETDLRARVDRLL---------
A0A2E0UL88      VT------------------QQIE--------IEALKAKIISLDETIQDFS---------
A0A233IKJ2      NG------------------INNE--------LQAAKQAESSLHRELEKRK---------
A0A2T1JE00      NG------------------INNE--------LQAAKQAESSLHRELEKRK---------
A0A0T2QIS1      NS------------------RTAE--------FRNVATRESDLRRRVADLK---------
A0A376KYN0      AM------------------PSTQ--------QEVLR-----------------------
A0A2X1JB05      AM------------------PSTQ--------QEVLR-----------------------
A0A376RML0      AM------------------PSTQ--------QEVLR-----------------------
A0A377E5P7      AM------------------PSTQ--------QEVLR-----------------------
A0A0P7Y1D0      AG------------------LETE--------VNVARQRVGSLQSTLSGVR---------
A0A2M7JRZ7      AG------------------IKND--------YESNLRRESLIRQAFEQQK---------
A0A167IR75      GS------------------VRAE--------YQQAEAREQALRQRVNALT---------
A0A3B8T2U6      DG------------------IYQE--------YQAAESKVNSLKVEVESAK---------
A0A365PWR2      TL------------------PETQ--------QELVR-----------------------
A0A2E9H5Z8      DL------------------LKTQ--------LRLVNGQLVKIKERVEERR---------
A0A2E2BR79      KM------------------PAAQ--------QEVVR-----------------------
A0A0Q4Q524      GS------------------LETD--------YRGAVERERALQARVEQLK---------
A0A0Q4CFJ9      GS------------------IETD--------YRGAVERERALQARVEQLK---------
A0A0Q4FE58      GS------------------LETE--------YRGAVERERALKARVEQLK---------
A0A0Q4JWC8      GS------------------LETE--------YRGAVERERALKARVEQLK---------
A0A0Q4KFL8      GS------------------LETE--------YRGAVERERALKARVEQLK---------
A0A522R8R0      ES------------------YRNE--------YEVAKAREDSLRTNVDQMT---------
A0A2U9NDY5      AL------------------PMTQ--------QELLR-----------------------
A0A0Q4IGG1      GS------------------IQAE--------YREALQREGALQARVNQLK---------
X7F6S5          LR------------------IERD--------AERARIARELAEAREAERA---------
A0A1G8NKI0      -Q------------------ADAE--------AEEQQRQAEAAARTRAQAA---------
A0A355QPE4      -Q------------------ADAE--------AEEQRRQAEAAARTRAKAA---------
A0A357RN98      -Q------------------ADAE--------AEEQRRQAEAAARTRAKAA---------
A0A6B2MSQ7      -Q------------------AERE--------QAEMEAARRELASLRTPAA---------
A0A6B2P8H8      -Q------------------AERE--------QAEMEAARRELASLRTPAA---------
A0A1I6U4V1      -R------------------LEEH--------RAEMDTARRQLAAARPRAA---------
A0A1G7CFZ2      -Q------------------REAE--------RRRTEARQAEAAARMAQTT---------
A0A1P8USW9      -Q------------------AEDA--------AREAELRAQQEAAREAESA---------
A0A534RUJ5      EG------------------VKTS--------YLDAEAKEKELRAKMEEQK---------
A0A3M1CJM3      ES------------------LEAE--------YQVKLDSEKRLRRELERVK---------
A0A2R7SVD4      DL------------------PATQ--------QELLN-----------------------
A0A3C0PWB6      AL------------------PMTQ--------QELLR-----------------------
V4Q8B7          AL------------------PMTQ--------QELLR-----------------------
A0A0Q8XKK5      SS------------------RSTE--------YREAQMREEGLRRQVETLR---------
A0A2E0Q2W0      AA------------------SDAQ--------LRGARQVEAELQARFDRAK---------
A0A660NIR6      SS------------------ISKA--------YEVARETERALEQEVASSK---------
A0A142W0R3      AL------------------NQES--------YASALKREKELQAELDRLT---------
A0A0S4XR18      NS------------------VQKQ--------KNDLETTKKSYEYSLGGMP---------
A0A2E0GW64      KL------------------PHSD--------QKALS-----------------------
A0A1A7QJ97      GS------------------VQAE--------YRQAVQRESALEMRVNSLK---------
A0A6I4IKZ3      QL------------------PDVQ--------RQYLQ-----------------------
A0A661LW70      NS------------------LKNE--------YKVALAKENALRAALAKQK---------
W7Q8F9          EL------------------PAAQ--------QEVLR-----------------------
A0A524PXH8      AS------------------IETE--------YRGAVDREMMLRDQLDRQR---------
A0A4Q3P0E4      SL------------------PAVQ--------QDAVR-----------------------
A0A3M2BE89      AL------------------PSTE--------QEVLR-----------------------
A0A4Q4A6K6      ET------------------SRSD--------HEIAKQKQKQIEDQLASAV---------
A0A257G674      AS------------------VKQQ--------FDAAVETEQNLKQQVAELK---------
A0A661M5M6      AS------------------AEHD--------VQQIKTVEEGLRSAAGDAH---------
A0A1I1UM01      AH------------------GDAG--------PDGADEQRTD------------------
Q44573          ST------------------IRED--------QISARAEVQRLNENLDLLR---------
A2W025          KA------------------VQ--------------------------------------
A0A534Z362      AA------------------VRSR--------DEAAQLREEELRRKLAHLG---------
V4J283          AL------------------PEVQ--------QTVLR-----------------------
A0A536T443      IA--------------------------------GLAAREHALQQRIDSIA---------
A0A0Q4UFQ5      AV------------------LRAT--------YQASLSREQQLTSQVNKLT---------
A0A527W7E6      ES------------------YRND--------FEVAQTREQALRDKISTAA---------
A0A432EMV7      DG------------------IKRD--------YEAARAQEKEIKRFIREQK---------
A0A087LTV7      QA------------------LALR--------SGFE------------------------
A0A534WLI3      EA------------------VRAR--------YDAARLREAGLRRKLAQQE---------
A0A318KWA2      DL------------------PEAQ--------QEVVR-----------------------
A0A522MT86      KN------------------VD--------------------------------------
A0A4Q3I221      ES------------------YKSD--------LNVAKAREKSLTDSVAQAT---------
A0A534SAL6      AS------------------VRAR--------YDAARLREEALRHKTAHLE---------
A0A534ZDB4      TS------------------VRAR--------YDAARLREEALRHKMAHLE---------
A0A534X3M7      EA------------------IRAR--------YDAARLHEEDLRRKLARLG---------
A0A534SPC6      AA------------------VRSR--------DEAAQLREEELRRKLAHLG---------
A0A535AD60      AS------------------VRSR--------NDAAQLREEELRRKLAHLG---------
A0A4Q3SY08      SN------------------LEAK--------AEVSRQRLASISGSLSTAR---------
A0A4Q3LG23      EA------------------DYRE--------AAERERGLQRKVDALKTGY---------
A0A522EX52      ------------------------------------------------------------
A0A1H3KC95      RR------------------VRLA--------ALPKAELARVLRRVRGQGP---------
A0A5P8Z4P3      TK------------------VEDL--------RADTPEQSPTPPQRSYIRM---------
A0A2E9HXF7      RA------------------ASAL--------RAAETERIAD------------------
A0A0B3RZC9      EK------------------AEAE--------RLAEEEKRAE------------------
A0A6F8QET1      EK------------------AEAE--------RLAEEQKRAE------------------
A0A520HUH4      QR------------------AQLA--------ARYGEKFPALVQSKQQIEA---------
A0A2K8U7M6      SA------------------ARAA--------AAARAHQEARLAERGDEVR---------
A0A5B9DKL8      KQ------------------VETE--------AFLQVPSTRIVVEATAPLY---------
A0A238KJM1      ------------------------------------------------------------
A0A3A0FJZ4      HT------------------LRSS--------ALASIQELQSQLSRAEAVY---------
W4HJV8          DA------------------LASE--------TSEEALPATDLRDAKPDAR---------
A0A0P1GDI0      AA------------------RHKA--------KAAAEQQARMQAEAAQRAE---------
A0A2R8ATV5      RA------------------KALA--------DE-----------RAKIEA---------
A0A1U7D3R6      RA------------------AE--------------------------------------
A0A2D4UVV2      RA------------------AE--------------------------------------
A0A0W7WHP4      ---------------------------------------------REARAR---------
A0A238J8F6      RK------------------KADA--------EKKRLAEEQAALRAEKEAR---------
A0A238JQI6      RR------------------KAED---------------------AARKAQ---------
A0A222E077      ------------------------------------------------------------
A0A239E3Y2      R--------------------------------------------AASALR---------
A0A1V6FYJ1      EKQDHE------------------------------------------------------
A0A445MZQ4      DRHQSE-----------------RAVKTLMFRPETDHGLGTV------------------
A0A0M9E0E3      KNPEDI-----------------REYLKIP------------------------------
A0A0Q6QV61      ------------------------------------------------------------
A0A2Z3IKG4      EKLERE-----------------IALVAYR------------------------------
A0A2W4RFS2      ------------------------------------------------------------
A0A1Y6DC43      ------------------------------------------------------------
A0A2S6HE06      ------------------------------------------------------------
G3J0M3          ------------------------------------------------------------
V5C6R5          ------------------------------------------------------------
A0A354EF47      NKAESG-----------------FTPDDSP------------------------------
A0A2G6MSP7      GLALGL-----------------VSGIGAA------------------------------
A0A4U8YMP3      EKRGLE-----------------RSDKPEV------------------------------
A0A1Q8QQ99      EKAVRR-----------------IVPDTPP------------------------------
A0A3D5ZY44      DNGVRT-----------------EADVERE------------------------------
A0A646J2A6      ------------------------------------------------------------
A0A1G5C236      EKRDSE-----------------RGDKPVV------------------------------
A0A432HIS7      EKSQQY-----------------TPNKSSS------------------------------
A0A1I3XJ27      QKAREE-----------------HSPVRLP------------------------------
A0A1I7DCG1      QKAKQQ-----------------RGSDPAN------------------------------
A0A3A3H6D9      QKAKQQ-----------------RGSDPAN------------------------------
A0A562CGU2      QKAREQ-----------------QGRPWVE------------------------------
A0A0Q6VA36      VSAQNP-----------------AAHRDGD------------------------------
A0A1B2EQN1      LNSENE-----------------TSVTFAE------------------------------
A0A1E7HSL6      EKSNRE-----------------NWSTSIN------------------------------
A0A4Q3ZDI7      GGLREF-----------------QERFFRT------------------------------
A0A537PRC6      KSASTY-----------------RAVIFWT------------------------------
A0A2M7JX59      EKAEEE-----------------KKQKEKE------------------------------
A0A3A4XVN3      AVDKMK-----------------MQWRKAD------------------------------
A0A1E7JEV6      EKVKKM-----------------PNIAKQS------------------------------
A0A2N2KDY5      PRTKKV-------------------EPREA------------------------------
A0A3N5YUD9      EKAKKM-----------------RSETPAH------------------------------
A0A0W1DLQ3      LNSRDT-----------------LRLADLPVFTP--------------------------
A0A246JVD8      AINPEF-----------------VTLASLTEFTP--------------------------
A0A2N3BB54      SNDIKM-----------------LTLDALPVFTP--------------------------
A0A1H6G7A3      SRDQQL-----------------LTLSALASFAP--------------------------
A0A0A7PGL6      SRDQKL-----------------LTLSGLASFTP--------------------------
A0A4Q2Z4L0      SRDHKL-----------------LTLSSLAAFTP--------------------------
A0A5C4N0H6      QPLKPQ-----------------VGPTAPI------------------------------
A0A4R1HDF2      AMLDRA-----------------HPSYGLV------------------------------
A0A1E7HFN0      QRARKD-----------------RHE----------------------------------
A0A1M5GH86      ERAKKS-----------------PKRETGP------------------------------
A0A1W1XQZ5      ERAKRS-----------------PKQDVPS------------------------------
A0A3D6C3I2      ------------------------------------------------------------
S0G1D4          EKARQD-----------------HRVQEDE----------VPV-----------------
A0A661T246      EKSKVT-----------------NKKTHGT----------VVTAKAENQAY---------
A0A2G6CSG7      EKAERS-----------------KELKVVP----------DIK-----------------
A0A2G6NB59      EKAERS-----------------KELKVVP----------DIK-----------------
A0A5K8A7T9      EKSGRV-----------------KELNRLA----------SVE-----------------
A0A1W9U045      EKA-NK-----------------ENNVSAS----------TEK-----------------
A0A1F9L9G4      EKS-KH-----------------IRSSDTV----------ENQ-----------------
A0A328FD76      EKAGNK-----------------LTPGEKS----------ASS-----------------
A0A348UX90      EKAGNN-----------------VTPEKES----------ELR-----------------
A0A357Z0N5      EKAGNN-----------------VTAEKES----------ELR-----------------
A0A0F2R2U0      EKSNTQ-----------------AAKSVPL----------PHV-----------------
A0A5K7ZK00      EKSGRA-----------------KDMKVAA----------TLS-----------------
A0A5K7YCX8      EKSGRS-----------------KGLKVAP----------AV------------------
A0A5K7Z388      EKSGRV-----------------NDLKVVT----------AV------------------
A0A352B502      EKATRE-----------------RQGGGHE------------------------------
A0A2K8WHP8      EQRSHP-----------------APAPGPA------------------------------
A0A410V446      ELARSA-----------------EQGARIV------------------------------
A0A0R3KGJ5      ELARAA-----------------D-VHHPG------------------------------
A0A0R3N604      ELARAA-----------------E-VHRPG------------------------------
A0A1B1UCM8      ELARAA-----------------EVVHRPG------------------------------
A0A1N6JQ20      ELARAT-----------------ENMPRQG------------------------------
A0A1M5TI07      DLARAT-----------------EGGARRA------------------------------
A3X191          ERARAA-----------------ESTLRND------------------------------
A0A1H4RKV5      ELARAA-----------------ESAPRND------------------------------
A0A160UA87      ELARSG-----------------DRLAHQE------------------------------
A0A1Q5SFV5      ELARSG-----------------DSLAQQE------------------------------
A0A1J5N774      KKATQL-----------------RGR--------------EEQ-----------------
A0A2C8F781      KKASQM-----------------RNS--------------TR------------------
A0A2E3R6G0      KKASQM-----------------RNS--------------TR------------------
A0A1F8XMK2      EKALRM-----------------RES---G----------AAV-----------------
A0A3M8EMP2      EKATRL-----------------REK--------------GPA-----------------
A0A2J6J6K6      EKSSKL-----------------RER----------------------------------
A0A661PSB9      KKVSRD-----------------RLE--TS----------RVM-----------------
A0A661QBT6      KKVSRD-----------------RLE--TS----------RVM-----------------
A0A1G6EKK9      EKAAKM-----------------RLG---V----------TEN-----------------
A0A6I2SLK2      EKASQL-----------------RTK----------------------------------
A0A0A8WSG4      EKASQL-----------------RQR----------------------------------
S7TK97          SKAAGM-----------------KPA---V----------DGP-----------------
S7UE93          AKAANL-----------------NTN---S----------GPG-----------------
A0A3D5BR56      AKAAGL-----------------HSS---S----------SKG-----------------
A0A2N2IB15      AKAAGM-----------------QAG---F----------YSK-----------------
A0A1I3PSR2      AKAAGM-----------------QSG---L----------HSK-----------------
A0A1I4GEK4      AKAAGM-----------------QSG---L----------HSK-----------------
A0A2T5R3J5      EKAVQM-----------------RQE---K----------APE-----------------
A0A1W7QPT7      EKAARM-----------------RQGMDQS----------PPA-----------------
A0A0M4D373      EKASLL-----------------REN---Q----------ALE-----------------
A0A1L3GKM9      EKANQL-----------------RQG---A----------PAD-----------------
A0A430DNP0      SSPKLA-----------------LNLVVAL----ALGLILAGA-----------------
A0A3A0FQ32      QRAEAE-----------------RGRRGAG-------AVPGVT-----------------
A0A1E4UZA0      EKAKK-------------------QASSGF------------------------------
A0A1H9KL56      EKAKK-------------------QASSGF------------------------------
A0A1A9KEF8      DDSQQQ-----------------SPPAPSH------------------------------
A0A5E6PKN5      DKAEQ-------------------PTASKA------------------------------
A0A0N9W1V6      ------------------------MTMPKA------------------------------
A0A423GQ41      ------------------------MTIPKA------------------------------
A0A423H7J2      ------------------------MTIPKA------------------------------
A0A502HNM8      DENEP-------------------TTSSSL------------------------------
A0A4Q7H223      DKAEQ-------------------PATSSL------------------------------
A0A1H4N2K9      DKAEQ-------------------PASSSL------------------------------
A0A2K4KWF7      DKAEQ-------------------PASSSL------------------------------
A0A3E0WXH2      EKAKSQ-----------------AAGSTTG---------WSGV-----------------
A0A2N2TRC8      EKAKTG-----------------GQSALAV-------AIEPVG-----------------
A0A1V4CIZ7      DQETTA-----------------RDGDTPD------------------------------
A0A1M3BXA5      EKARQQ-----------------SVGAAPA---APAHPQTAPV-----------------
A0A1Y2R3U6      EKAKSQ-----------------RVGLQPPLHVAAVRTAAKP------------------
A0A167HVD6      KKAKDG-----------------EADSKKS-DSRLLRGGRAPD-----------------
A0A1V3SCT6      EKAKAA-----------------EADSARP-DVPLLRKVSDSE-----------------
L0H287          KRPLAE-----------------PADGAGA---TRVASLAELP-----------------
A0A495VG93      DRARAE-----------------R----GN---A--PTPPVKP-----------------
A0A4R3MYM4      ELARAQ-----------------RESIVGP---S--PGAPG-------------------
G2E3C0          ERARAE-----------------RQASLAG---S--AGRPERQ-----------------
A0A4U8YLL7      PRKGAG------------------------------------------------------
A0A3N5RNY4      VKRIKI-----------------D------------------------------------
A0A1V4M8I1      KKAGKE-----------------Q------------------------------------
A0A4Z0M4C7      EAAAGQ-----------------S------------------------------------
A0A5Q2QDL1      QKSKGN-----------------L------------------------------------
A0A1I0R9R6      EKARRQ-----------------RDGKPRA----------RRSQERSSKPP---------
A0A443K010      EKARAS-----------------RLAQR------------GVTSHEDSAPE---------
A0A6I7NYG5      ERARQQ-----------------RDGHT------------------ATVVG---------
A0A238IZI1      AKARAQ-----------------RDGEP------------ISRGGRPELSA---------
A0A316GHM6      ARAREK-----------------REGGT------------DRPLRTTDVTA---------
A0A520ZTR8      ARAREK-----------------REDGD------------GGRATRPELSA---------
A0A212AR83      EKARAQ-----------------REETR------------PDTPPPPAFAA---------
A0A2E2P4I0      SKARKE-----------------REASGDV----------ATSPAQSPRGV---------
A0A2U2CM86      EKARAK-----------------REQAG------------APGPETRPFGD---------
A0A1X7ACC1      QKARVE-----------------RASRQ------------QEPPDRTAPEP---------
A0A2N3BVE7      NKAREM-----------------RQTAL------------GAPQGPGGRPA---------
A0A2S5JE21      AKARQM-----------------RQQAM------------GTRRPVTPGEA---------
A0A2R8BKZ2      AKAREM-----------------RKSAL------------GPPDGTGDRVA---------
A0A2S8S361      AKAREM-----------------RKSAV------------GGGDVVRSRTV---------
A0A238KUF6      KQAREM-----------------REGTA------------GRR--VRAAQG---------
A0A095CTW3      ------------------------------------------------------------
A0A2E3UGD6      EQARRQ-----------------RTESA------------SER--GPAKAA---------
A0A2T0RFH0      AKAREK-----------------RESLG------------VDT--TRGVKS---------
A0A285D390      QKARES-----------------REGQA------------LDA--RPAVTA---------
A0A497VHN4      GKARKQ-----------------RGDVT------------SDASGRKASDT---------
A0A318CT66      ERAKQA-----------------R------------------------------------
A0A3N5P205      KRAKQD-----------------R------------------------------------
A0A2N6BEI9      EEALKR-----------------K-----------------------GGVS---------
A0A0D5N3E9      EKAAML-----------------R------------------------------------
A0A2N2G716      KVAAVD-----------------D------------------------------------
W9VVY5          QAALSG-----------------S--------------------------A---------
A0A1E2URD3      DKAKKI-----------------Q--------------------------S---------
A0A2T6MY81      DRARDQ-----------------K--------------------------N---------
A0A2T6NBQ8      ERARDA-----------------K--------------------------T---------
A0A421K431      DRARDN-----------------R--------------------------I---------
A0A2G2I5M1      DKAKAK-----------------H--------------------SEQAIID---------
A0A2G2M6F0      DKAKAR-----------------H--------------------SEQAAVG---------
A0A1W9J9F8      ENTESK-----------------S---Q------------FKAETKASSTL---------
A0A2S5LFJ9      ENTESK-----------------S---Q------------FKAETKASSTL---------
A0A2D8R8F8      TRLREQ-----------------Q------------------------------------
A0A6I4JXQ8      GNSGQQ-----------------P------------------------------------
A0A010SNS0      ENSEQQ-----------------P------------------------------------
A0A0C2I782      EDSEQQ-----------------P------------------------------------
A0A2N8BYF5      ENSEQQ-----------------P------------------------------------
A0A558FKX2      ENSEQQ-----------------P------------------------------------
A0A1H1DBA0      DKGEPQ-----------------A------------------------------------
J2TAD5          EGDVQQ-----------------S------------------------------------
J3H699          EDDEKQ-----------------S------------------------------------
A0A1H5J974      ENTEPK-----------------N------------------------------------
A0A0K1QRZ4      ENTEPK-----------------N------------------------------------
A0A560RJW9      ENTEPK-----------------N------------------------------------
A0A5E6TID7      ENTEPK-----------------N------------------------------------
A0A5E7CRU7      ENTEPK-----------------N------------------------------------
A0A5E7C564      EKSEPQ-----------------T------------------------------------
A0A2W7MAV4      EKTEQQ-----------------T------------------------------------
A0A4R3WQH5      EKTEQQ-----------------T------------------------------------
W6VFG3          EKTEQQ-----------------T------------------------------------
A0A1P8ENT1      EKAEQQ-----------------T------------------------------------
A0A2N7XRV4      EKAEQQ-----------------T------------------------------------
A0A0Q6QPG8      ENAEQQ-----------------T------------------------------------
A0A0F4SWA7      ENAEQQ-----------------T------------------------------------
A0A423J219      EKAEQQ-----------------T------------------------------------
A0A4P6G9U8      EKAEQQ-----------------T------------------------------------
A0A4Y8JE06      EKAEQQ-----------------T------------------------------------
A0A502I1X9      EKAEQQ-----------------T------------------------------------
A0A502J776      EKAEQQ-----------------T------------------------------------
A0A5B0EZF6      EKAEQQ-----------------T------------------------------------
A0A059L434      EKAEQQ-----------------T------------------------------------
A0A0F4UWN2      EKAEQQ-----------------T------------------------------------
A0A5E7WEF5      EKAEQQ-----------------T------------------------------------
A0A1G0KSD0      ERAKRE-----------------R-VSV------------PPPPQDAKADA---------
A0A4P6WX84      EKAKAS-----------------RTDLL------------SPNSSSSHHPG---------
A0A1D2S760      EKARQQ-----------------S----------------AGAAPHPAHPS---------
A0A5B8RW94      EKARAQ-----------------A----------------GSNTQHV--QP---------
A0A258TN88      EKARRL-----------------Q------------------------QGA---------
A0A1F9EUS2      EKAEEE-----------------K-------------------RQKVREEP---------
A0A6H9HII8      EQAGRE-----------------R-------------------SQNLATEP---------
A0A3N9VAW3      EKAAQL-----------------R-------------------NNKRGFDV---------
A0A1X0YE57      EIAADI-----------------Q-------------------ARRVPESA---------
A0A2K2H9Q8      EIAADI-----------------Q-------------------ARRVPESA---------
A0A6I1KNW9      EKATRL-----------------R-------------------NGDALPEG---------
A0A1H4B8T3      KKVSSQ-----------------R-------------------TR----VN---------
A0A1E7IQC3      NKAASR-----------------R-------------------KSPV--ES---------
A0A1M6KEN5      KKAASQ-----------------R-------------------STPSGEEE---------
A0A353QLL3      EKAARL-----------------R-------------------EQ---------------
A0A399I453      EKAAQL-----------------R-------------------NTTTTVVE---------
A0A651FBV9      EKAARL-----------------R-------------------GDHGNTGP---------
A0A5C1MDH8      ERAAQL-----------------R-------------------EGGGVAPA---------
A0A5A9XE04      EKAAQL-----------------R-------------------DG---------------
A0A643G9R1      EKAAQL-----------------R-------------------DG---------------
A0A1G0M8Q7      EKAARL-----------------R-------------------EEGKGAQP---------
A0A353MI14      EKAARL-----------------R-------------------EEGKGAQP---------
A0A4S1CAW7      EKAARL-----------------R-------------------EEGAPREA---------
A0A562VHD2      EKASQM-----------------R-------------------GSGGVAPS---------
A0A6I6JNB5      KKATKR-----------------R-------------------GEEAVSTR---------
A0A1G0LDK7      EKAEKL-----------------R-------------------SAMFPVS----------
A0A6F9WVL7      EKAAKL-----------------R-------------------NGVTLVAV---------
A0A2M7WWF7      DSDDAP------------------------------------------------------
A0A351Z9A2      GNPGNP------------------------------------------------------
A0A351B422      ERAQAA-----------------RQKDKPK----------VEEDIKAPWAE---------
F2NEE9          ERAQAA-----------------RQKDKPK----------VEEDIKAPWAE---------
B7RS54          QEINTV------------------------------------------------------
A0A3N5FRH4      QKAEKE-----------------RIPEQKR----------E--PVKAVF-----------
A0A1V4Y2C3      QKVERE-----------------KFGEPTD----------K--TLKTTP-----------
A0A2N2KTJ4      QKLERE-----------------KTADQKK----------EEPAIVSDP-----------
A0A2N2LQX0      QKLERE-----------------KNIDQKK----------EQPAIVTDP-----------
A0A520CSP5      GVALAI-----------------VRSLFMG----------GIRNPQEIEAH---------
A0A1I6ENM4      SKARQD-----------------RAAQGAA----------PRRAAPDTPAA---------
A8LNM8          DKARER-----------------REGSVPP----------SGLSSQRPSQR---------
A0A0T5NSU3      -------------------------------------------------MP---------
A0A5P9I718      EKARAQ-----------------RDKTETG----------APRFRKKPAAP---------
A0A2M8J3R9      SKARTQ-----------------REDVETG----------AYRDPGAARTA---------
A0A1I6X762      KKARSE-----------------RESRVGA----------S-RPQMPQSVS---------
A0A0P1EFX8      EKARSQ-----------------RRKRAPA----------QLAVAADKAIQ---------
A0A2G5KB39      NKARAQ-----------------RKT----------------GVAATEHVQ---------
A0A2N3CNV1      ARAREQ-----------------RRHSERA----------TPGQADAATPE---------
A0A257F1F4      SKARAA-----------------RGDSPAQ----------AQSLP-AVTTK---------
A0A1G9FY29      EKAREQ-----------------RAEVLKQ----------RPTNG-PLTDV---------
A0A4Q3ZBK4      EKAREQ-----------------RAAALRG----------NPTAG-PLAED---------
A0A2D5J8T8      QKARMQ-----------------RAGSGPE----------QYAPA-HAPSA---------
A0A2E3P9W6      HKARAQ-----------------RSGSAR--------------PA-HRPSG---------
A0A2G2B1P9      EKARQD-----------------RQTA----------------QI-AAVAD---------
A0A258GCD5      AKAREM-----------------RKAA----------------LG-APETV---------
A0A2D9YR88      ERAREQ-----------------R-DT----------------RG-ATARP---------
A0A443INY4      EKARAS-----------------RLAQ----------------RG-LTIDV---------
A0A372IH36      GLSDRD-----------------RQRRALE----------RRLREALMQPA---------
A0A540VW45      GSKQTS-----------------RVDVVDT----------PGNDSPPENPS---------
A0A1H9C241      GREDKT-----------------K---LLE----------RVARYSDEIEK---------
A0A2E3FCR1      EQEKPT-----------------ERPVLME----------RVAQQAAQTDA---------
A0A4S3MG69      EQPKEA-----------------KSAPLLE----------RVARHAAEAEA---------
A0A3E0H727      LNLDNP-----------------LYRAYVS----------HPSQWLASIAG---------
A0A1G8QZS5      KKAREE-----------------RSQPKSS----------EPPEQVQTHER---------
A0A1V4QMH7      EKAKTV-----------------KPTTEES----------QIHPVPKVTPV---------
A0A496XZQ4      EKAKTV-----------------KPTTEES----------QIHPVPKVTPV---------
A0A1F9BJF7      EKAKAL-----------------HKKEDKR----------VISSRPEKVPA---------
F2NDF5          ELAKSS-----------------RRQEEGS----------HRSELEKLLEQ---------
A0A1I3TTC3      AQARKA-----------------REAVLAG----------AGPAMEAEAHA---------
A0A1H3IZW6      ARARTA-----------------REAVLAG----------HTAPGPQPAAQ---------
A0A0M6YG59      ARARTE-----------------RDALLAG----------H-------RPE---------
A0A1H7G8B0      AQARAA-----------------RQAVLST----------Q-------AGV---------
A0A059IPK4      AKARAA-----------------RK---AT----------KDGEAPDHRPR---------
A0A1H2Y469      QKARES-----------------RQDQDEP----------EKAKGGTSPAL---------
A0A497ZQU7      QKAREA-----------------RRVSDAD----------KKEQTSAPTPV---------
A0A318D3U4      DKARRE---------PARKMDQLRPSGETG----------SREQKQARVQH---------
A0A401FQP5      RRKQKS-----------------DKRPIPR----------KHGGFTFDSDP---------
A0A1Q6DMW3      SKSGAD-----------------NKPVE---------------RKSPASVK---------
A0A3A6P8F8      SKAGAD-----------------IKRVTEG----------IDGNNQGNTAL---------
A0A2G2DSM4      AKGEQQ-----------------DSTTQKN----------DSDWLSPENVE---------
A0A1F9NI02      EKAGYG-----------------EDLEKRA----------EE---GPEKEF---------
A0A4U1ABX4      KKAQYD-----------------QDFERQV----------AERKIQQLKQY---------
A0A351Z4H9      KDAPKD-----------------NIFDKQK----------VQPSKPAPKD----------
A0A2N2KML4      QKVERE-----------------KF-TEQR----------DEAPKTSSED----------
E1YJF1          QKAEDE-----------------NVRTPQA----------ETVEPSLDND----------
A0A1J5EVZ6      SKAGAE-----------------EPTTRQM----------EETPAPPLPMP---------
A0A2G6FCC5      SKAAES-----------------DKSQMLS----------DESTLQGLDKE---------
A0A1F9MR25      AKAKKN-----------------EAIEQEI----------SQSRAAEGREV---------
A0A2G6M7F1      NRAEQNRNFQGKEKAEATSSGDHQAADAVT----------SKLLASSGRKV---------
A0A1E7H876      VRKKTI-----------------KH-----------------------------------
A0A509L3P8      EKAQKE-----------------KTPSIET----------GKGPAAHFHDS---------
A0A3A4S038      EKSNQK-----------------I----------------SIEPLASDERK---------
A0A1F9N669      EKSKNV-----------------IADNVGQ----------TKRSLSGDDQI---------
A0A1F9PFA7      EKSKNV-----------------IADNVGQ----------TKRSLSGDDQI---------
A0A1H2EN09      KKKESE-----------------VFDSV------------------MDDGT---------
K0NP00          EKKRSE-----------------ERGLI------------------TDLET---------
A0A1E7JCL5      RKSETT-----------------KR---------------------QTSAR---------
A0A496YAH9      EKHKKE-----------------KV---------------------IETEK---------
A0A1V4S7E4      ERHKKE-----------------SS---------------------IMTEY---------
A0A2N2H8D2      ERHNKE-----------------NS---------------------VKKST---------
A0A2N2KC63      ERHNKE-----------------NS---------------------VKKST---------
A0A3A4ZYW4      ERHNKE-----------------NS---------------------VKKSG---------
A0A1V4MCJ4      DKYQSE-----------------KK---------------------EYFYR---------
A0A661M0W4      ERRRKE-----------------TA---------------------LKSEK---------
A0A0F2NF69      ------------------------------------------------------------
A0A1F9NFD0      ------------------------------------------------------------
A0A1M5YLH5      EKAGYG-----------------TE---------------------GTEKQ---------
A0A4U1A4C7      EKANQH-----------------KN---------------------VQNNA---------
                                                                            

E1Y9C0          ------------------------------------------------------------
A0A1N6SH58      ------------------------------------------------------------
A0A4Q3AQN2      ------------------------------------------------------------
A0A1W9HS52      VS-------------------------------------------------PQEYYKNL-
A0A2D5LFD8      DFQGSIISGGGASTSGTTETAGSSLSGSIGISGIDSXLEEELTTLKEALYEARSIYQPG-
A0A0N0XAV4      ------------------------------------------------------------
A0A0P9QD19      ---------------------------------------------------EHPTYRSL-
F3FHG4          ---------------------------------------------------EHPTYRSL-
F3GGI0          ---------------------------------------------------EHPTYRSL-
A0A0P9LE74      ---------------------------------------------------EHPTYRSL-
A0A3M4ZQ14      ---------------------------------------------------EHPTYRGL-
A0A3M5YLE8      ---------------------------------------------------EHPTYRGL-
A0A3M3RP89      ---------------------------------------------------EHPTYRGL-
A0A0P9QIY7      ---------------------------------------------------EHPTYRGL-
A0A0P9VVH7      ---------------------------------------------------EHPTYRGL-
A0A0Q0FJK6      ---------------------------------------------------EHPTYRGL-
A0A0Q0G2J0      ---------------------------------------------------EHPTYRGL-
A0A3M3LF66      ---------------------------------------------------EHPTYRGL-
A0A0P9WIR8      ---------------------------------------------------EHPTYRSL-
A0A3M3KPE5      ---------------------------------------------------EHPTYRSL-
A0A3M4C263      ---------------------------------------------------EHPTYRSL-
A0A3M5AD05      ---------------------------------------------------EHPTYRSL-
A0A0Q0D3D2      ---------------------------------------------------EHPTYRSL-
A0A0N0FS39      ---------------------------------------------------EHPTYRSL-
A0A3M6GHH2      ---------------------------------------------------EHPTYRSL-
A0A0P9R9W0      ---------------------------------------------------EHPTYRSL-
A0A0Q0B9T0      ---------------------------------------------------EHPTYRSL-
A0A3M6CFI7      ---------------------------------------------------EHPTYRSL-
A0A0P9JXN0      ---------------------------------------------------EHPTYRSL-
A0A3M6FIV7      ---------------------------------------------------EHPTYRSL-
A0A3M3PLW9      ---------------------------------------------------EHPTYRSL-
A0A3M4ENY1      ---------------------------------------------------EHPTYRSL-
A0A3M5EZK7      ---------------------------------------------------EHPTYRSL-
A0A0P9SPP5      ---------------------------------------------------EHPTYRSL-
A0A658KL17      ---------------------------------------------------EHPTYRSL-
A0A3M3NNF2      ---------------------------------------------------EHPTYRSL-
A0A3M4A0E8      ---------------------------------------------------EHPTYRSL-
A0A3M4PBZ2      ---------------------------------------------------EHPTYRSL-
A0A3M6AI26      ---------------------------------------------------EHPTYRSL-
A0A0P9IWP8      ---------------------------------------------------EHPTYRSL-
A0A0P9KZ49      ---------------------------------------------------EHPTYRSL-
A0A0P9V840      ---------------------------------------------------EHPTYRSL-
A0A0Q0AIE5      ---------------------------------------------------EHPTYRSL-
A0A3M2ZQH6      ---------------------------------------------------EHPTYRSL-
A0A0N8SQG2      ---------------------------------------------------EHPTYRSL-
A0A0W8HFU1      ---------------------------------------------------EHPTYRSL-
A0A3M5M873      ---------------------------------------------------EHPTYRSL-
A0A0P9VHH8      ---------------------------------------------------EHPTYRSL-
A0A0P9YV98      ---------------------------------------------------EHPTYRSL-
A0A3M3G2W8      ---------------------------------------------------EHPTYRSL-
A0A3M6C224      ---------------------------------------------------EHPTYRSL-
A0A3M5K254      ---------------------------------------------------EHPTYRSL-
A0A3M5JFB0      ---------------------------------------------------EHPTYRSL-
A0A3M3TQV3      ---------------------------------------------------EHPTYRSL-
A0A3M3EF92      ---------------------------------------------------EHPTYRSL-
A0A3M5J1E2      ---------------------------------------------------EHPTYRSL-
A0A3M5G7H9      ---------------------------------------------------EHPTYRSL-
A0A3M4A376      ---------------------------------------------------EHPTYRSL-
A0A0Q0A5T8      ---------------------------------------------------EHPTYRSL-
A0A0P9SCD7      ---------------------------------------------------EHPTYRSL-
A0A0P9T4G3      ---------------------------------------------------EHPTYRSL-
A0A0P9VKB0      ---------------------------------------------------EHPTYRSL-
A0A0Q0BM35      ---------------------------------------------------EHPTYRSL-
A0A3M3TPR7      ---------------------------------------------------EHPTYRSL-
A0A3M3U4Q3      ---------------------------------------------------EHPTYRSL-
A0A0P9UCX7      ---------------------------------------------------EHPTYRSL-
A0A0P9S1F1      ---------------------------------------------------EHPTYRSL-
A0A0P9QCJ2      ---------------------------------------------------EHPTYRSL-
A0A0P9Q329      ---------------------------------------------------EHPTYRSL-
A0A3M5GJ64      ---------------------------------------------------EHPTYRSL-
A0A0P9MPC7      ---------------------------------------------------EHPTYRSL-
A0A3M2XYQ3      ---------------------------------------------------EHPTYRSL-
A0A0P9XCE1      ---------------------------------------------------EHPTYRSL-
A0A3M3EFX7      ---------------------------------------------------EHPTYRSL-
A0A3M5B9D9      ---------------------------------------------------EHPTYRSL-
A0A0P9RRZ3      ---------------------------------------------------EHPTYRSL-
A0A3M2VEK7      ---------------------------------------------------EHPTYRSL-
A0A0N8R9B3      ---------------------------------------------------EHPTYRSL-
A0A0P9VA27      ---------------------------------------------------EHPTYRSL-
A0A3M4YBJ4      ---------------------------------------------------EHPTYRSL-
A0A0P9J470      ---------------------------------------------------EHPTYRSL-
A0A0Q0EVJ8      ---------------------------------------------------EHPTYRSL-
A0A3M5UI30      ---------------------------------------------------EHPTYRSL-
A0A3M5YQT8      ---------------------------------------------------EHPTYRSLM
A0A3M5F5X1      ---------------------------------------------------EHPTYRSL-
A0A3M5R8G1      ---------------------------------------------------EHPTYRSL-
A0A3M5V012      ---------------------------------------------------EHPTYRSL-
A0A3M3GA16      ---------------------------------------------------EHPTYRSL-
A0A3M3UCT3      ---------------------------------------------------EHPTYRSL-
A0A3M3CJL0      ---------------------------------------------------EHPTYRSL-
A0A3M3F6F5      ---------------------------------------------------EHPTYRSL-
A0A3M3P9B7      ---------------------------------------------------EHPTYRSL-
A0A0N8QB74      ---------------------------------------------------EHPTYRSL-
A0A0Q0AUD0      ---------------------------------------------------EHPTYRSL-
A0A3M5VR55      ---------------------------------------------------EHPTYRSL-
A0A0Q0FK97      ---------------------------------------------------EHPTYRSL-
A0A3M5KZ75      ---------------------------------------------------EHPTYRSL-
A0A3M5L3G5      ---------------------------------------------------EHPTYRSL-
A0A0C5VQ86      ------------------------------------------------------------
A0A1V8MBH1      ------------------------------------------------------------
A0A534QGR3      ------------------------------------------------------------
A0A0R0BVC7      ------------------------------------------------------------
A0A0W1GMS6      ------------------------------------------------------------
A0A0Q8RMY3      ------------------------------------------------------------
A0A1A7QC21      ------------------------------------------------------------
A0A1F9CFF0      ------------------------------------------------------------
A0A2M8B0G5      ------------------------------------------------------------
A0A363TNU9      ------------------------------------------------------------
A0A534HBS8      ------------------------------------------------------------
A0A0F0T3Y9      ------------------------------------------------------------
A0A379GWF0      ------------------------------------------------------------
A0A536T0W8      ------------------------------------------------------------
A0A4Q2XLV7      ------------------------------------------------------------
A0A4Q5QYC4      ------------------------------------------------------------
A0A2G9XLE5      ------------------------------------------------------------
A0A3D2M6Y9      ------------------------------------------------------------
A0A3D2YAZ2      ------------------------------------------------------------
A0A350A102      ------------------------------------------------------------
A0A350L5D2      ------------------------------------------------------------
A0A3B8SQ27      ------------------------------------------------------------
A0A656BWB0      ------------------------------------------------------------
A0A6D0IFH4      ------------------------------------------------------------
A0A3Y2RPN4      ------------------------------------------------------------
A0A0A0FHV8      ------------------------------------------------------------
A0A1X3IPU7      ------------------------------------------------------------
A0A0A0G0N2      ------------------------------------------------------------
A0A243TPR1      ------------------------------------------------------------
A0A2I8SDU4      ------------------------------------------------------------
A0A2I8SU55      ------------------------------------------------------------
S1EXJ6          ------------------------------------------------------------
A0A376UBS1      ------------------------------------------------------------
A0A4Q6G931      ------------------------------------------------------------
A0A1W9F5M9      ------------------------------------------------------------
A0A3C2BN18      ------------------------------------------------------------
A0A447LR75      ------------------------------------------------------------
A0A376D8L7      ------------------------------------------------------------
A0A1V2FV46      ------------------------------------------------------------
A0A376SB61      ------------------------------------------------------------
A0A3D1BYV9      ------------------------------------------------------------
A0A6D0I9G1      ------------------------------------------------------------
A0A352MMI7      ---------------------------------------------------AHPAYRTL-
A0A379W6R2      ------------------------------------------------------------
A0A376RY66      ---------------------------------------------------VHPAYRTL-
A0A377K431      ---------------------------------------------------VHPAYRTL-
A0A379TA56      ------------------------------------------------------------
A0A4Z0LWV1      ---------------------------------------------------AHPAYRTL-
A0A5V7HTZ1      ---------------------------------------------------AHPAYRTL-
A0A610XNI4      ---------------------------------------------------AHPAYRTL-
A0A620QD02      ---------------------------------------------------AHPAYRTL-
A0A5H3HSJ8      ------------------------------------------------------------
A0A655C5P0      ------------------------------------------------------------
A0A2T0VBD8      ------------------------------------------------------------
A0A378APS2      ------------------------------------------------------------
A0A443VCQ6      ------------------------------------------------------------
A0A447RKQ7      ------------------------------------------------------------
W1DSK1          ------------------------------------------------------------
A0A0U2VAW2      -----------------------------------------------------PTYQGL-
A0A454CTF1      ---------------------------------------------------DHPAYKSL-
A0A6B3Q2G1      ---------------------------------------------------DHPAYKSL-
A0A378G3G7      ---------------------------------------------------EHPTYRAL-
A0A2X5NHJ9      ---------------------------------------------------DHPTYKAL-
A0A2J4QEC3      ------------------------------------------------------------
A0A485ADM3      ------------------------------------------------------------
A0A4U9HGU4      ---------------------------------------------------EHPAYRSL-
A0A3S4JGG5      ---------------------------------------------------EHPAYRAL-
A0A377ZDH2      ------------------------------------------------------------
A0A3S4HTS8      ------------------------------------------------------------
A0A2N1XK22      ------------------------------------------------------------
A0A3D0KAC8      ---------------------------------------------------QHPNFQAL-
A0A3D2Y902      ------------------------------------------------------------
A0A655RNN3      ------------------------------------------------------------
A0A655R819      ------------------------------------------------------------
A0A655ZEY0      ------------------------------------------------------------
A0A6G6X2Z4      ------------------------------------------------------------
Q44570          ------------------------------------------------------------
A0A3N5MZ53      ------------------------------------------------------------
A0A534E4H4      ------------------------------------------------------------
A0A534I2B6      ------------------------------------------------------------
A0A1C2JGD0      ------------------------------------------------------------
A0A259LQ70      ------------------------------------------------------------
A0A4V2SPR5      ------------------------------------------------------------
A0A3N5PM86      ------------------------------------------------------------
A0A2E5YSA4      ------------------------------------------------------------
A0A519ERR1      ------------------------------------------------------------
A0A4Q3Q1M2      ------------------------------------------------------------
A0A4Q3MHR1      ------------------------------------------------------------
A0A520GDZ4      ------------------------------------------------------------
A0A318DSU0      ------------------------------------------------------------
A0A538PF21      ------------------------------------------------------------
A0A1W1ZH10      ------------------------------------------------------------
A0A1W2FF24      ------------------------------------------------------------
A0A524JYQ6      ------------------------------------------------------------
A0A4Q3MA17      ------------------------------------------------------------
A0A0N0M5F7      ------------------------------------------------------------
A0A537M754      ------------------------------------------------------------
A0A1V1PDB4      ------------------------------------------------------------
A0A2M7C324      ------------------------------------------------------------
A0A4Q3HHG6      ------------------------------------------------------------
A0A3B7DTA4      ------------------------------------------------------------
A0A432ZK62      ------------------------------------------------------------
A0A1V5EEP4      ------------------------------------------------------------
A0A1V5EF48      ------------------------------------------------------------
A0A0S6X1X6      ------------------------------------------------------------
A0A537Y5L8      ------------------------------------------------------------
A0A4Q3L2X2      ------------------------------------------------------------
A0A4Q3T8J1      ------------------------------------------------------------
A0A4Q4ANM4      ------------------------------------------------------------
A0A4Q3UEC7      ------------------------------------------------------------
A0A1H5YYQ4      ------------------------------------------------------------
A0A1X4NLK2      ------------------------------------------------------------
A0A1X4NWB5      ------------------------------------------------------------
A0A1M5UQ38      ------------------------------------------------------------
A0A327YI48      ------------------------------------------------------------
A0A1B1PNL6      ------------------------------------------------------------
A0A2U8H9H9      ------------------------------------------------------------
A0A6B2NBB8      ------------------------------------------------------------
A0A1X6YIC0      ------------------------------------------------------------
A0A1I5E9E9      ------------------------------------------------------------
A0A1X6Z7N7      ------------------------------------------------------------
A0A2E1DQ13      ------------------------------------------------------------
A0A1H8C800      ------------------------------------------------------------
A0A2N3EZ05      ------------------------------------------------------------
A0A3N5J7U8      ------------------------------------------------------------
A0A1S7S3I8      ------------------------------------------------------------
A0A519E8D7      ------------------------------------------------------------
A0A3S1NZ06      ------------------------------------------------------------
A0A3S1FD32      ------------------------------------------------------------
A0A434DUT4      ------------------------------------------------------------
A0A528D3U3      ------------------------------------------------------------
A0A3S3UPT3      ------------------------------------------------------------
A0A3S1E286      ------------------------------------------------------------
A0A531AC71      ------------------------------------------------------------
A0A436K268      ------------------------------------------------------------
A0A434IDQ0      ------------------------------------------------------------
A0A435IRM5      ------------------------------------------------------------
A0A3S2C404      ------------------------------------------------------------
A0A435F6C0      ------------------------------------------------------------
A0A435BMN6      ------------------------------------------------------------
A0A529XQ54      ------------------------------------------------------------
A0A530BJC1      ------------------------------------------------------------
A0A348SRI7      ------------------------------------------------------------
A0A354EI73      ------------------------------------------------------------
A0A4Q3IRI1      ------------------------------------------------------------
A0A4P7EP83      ------------------------------------------------------------
A0A6I1QB25      ------------------------------------------------------------
A0A655ZZQ1      ------------------------------------------------------------
A0A1S0ZAI3      ------------------------------------------------------------
A0A1W9M770      ------------------------------------------------------------
A0A1W9M7R6      ------------------------------------------------------------
A0A3A4NIE9      ------------------------------------------------------------
A0A3A4NUI9      ------------------------------------------------------------
A0A524I3Z6      ------------------------------------------------------------
A0A524PCL7      ------------------------------------------------------------
A0A356GQV1      ------------------------------------------------------------
A0A1J5DAY8      ------------------------------------------------------------
A0A524P237      ------------------------------------------------------------
A0A3C0L0A8      ------------------------------------------------------------
A0A176S762      ------------------------------------------------------------
A0A377ZC40      ------------------------------------------------------------
A0A378BPJ7      ------------------------------------------------------------
A0A2J5PAJ7      ------------------------------------------------------------
A0A377ZDN3      ------------------------------------------------------------
A0A1G3JY11      ------------------------------------------------------------
A0A661N3U1      ------------------------------------------------------------
A0A1W9WUD9      ------------------------------------------------------------
A0A1W1ZQK0      ------------------------------------------------------------
A0A4U1ALN4      ------------------------------------------------------------
A0A4U1B1A8      ------------------------------------------------------------
A0A1M7Y300      ------------------------------------------------------------
A0A4U1A967      ------------------------------------------------------------
A0A6I1R304      ------------------------------------------------------------
A0A1W9PMU6      ------------------------------------------------------------
A0A6D0ELN7      ------------------------------------------------------------
A0A3S1WTQ1      ------------------------------------------------------------
A0A440NX85      ------------------------------------------------------------
A0A530CUR9      ------------------------------------------------------------
A0A1M6N1X5      ------------------------------------------------------------
A0A561M3U0      ------------------------------------------------------------
A0A1G3VVY5      ------------------------------------------------------------
A0A2N6BZD5      ------------------------------------------------------------
A0A656PSQ6      ------------------------------------------------------------
A0A2W5J775      ------------------------------------------------------------
A0A352Q5C1      ------------------------------------------------------------
A0A435NNF5      ------------------------------------------------------------
A0A3S2AQS7      ------------------------------------------------------------
A0A436XH86      ------------------------------------------------------------
A0A527ZPD6      ------------------------------------------------------------
A0A529KRW3      ------------------------------------------------------------
A0A530ZLX0      ------------------------------------------------------------
A0A355TB56      ------------------------------------------------------------
A0A1F9E324      ------------------------------------------------------------
A0A432SAI6      ------------------------------------------------------------
A0A4Q3LBH4      ------------------------------------------------------------
A0A4Q3LWP3      ------------------------------------------------------------
A0A2N6VGL1      ------------------------------------------------------------
A0A3M3H5V6      ------------------------------------------------------------
A0A524M660      ------------------------------------------------------------
A0A0C1TRU6      ------------------------------------------------------------
A0A2Z5SSF4      ------------------------------------------------------------
A0A2T4ZJZ6      ------------------------------------------------------------
A0A327LYE6      ------------------------------------------------------------
A0A5A9ZTV3      ------------------------------------------------------------
A0A4Q4CIB1      ------------------------------------------------------------
A0A522ACJ9      ------------------------------------------------------------
A0A1T2KYM8      ------------------------------------------------------------
A0A3N5Z7F8      ------------------------------------------------------------
A0A2G9ZR82      ------------------------------------------------------------
A0A239HD34      ------------------------------------------------------------
A0A4U9I390      ------------------------------------------------------------
A0A534V9L7      ------------------------------------------------------------
A0A0P7ZZE4      ------------------------------------------------------------
A0A369R0Q9      ------------------------------------------------------------
A0A534XP85      ------------------------------------------------------------
A0A2X3M011      ------------------------------------------------------------
I2WC85          ------------------------------------------------------------
A0A400JH80      ------------------------------------------------------------
A0A2H9EHM4      ------------------------------------------------------------
A0A380B3D7      ------------------------------------------------------------
F5NSX0          ------------------------------------------------------------
A0A479JNB1      ------------------------------------------------------------
A0A5C9AF52      ------------------------------------------------------------
A0A6D0EYC7      ------------------------------------------------------------
D8EEU7          ------------------------------------------------------------
A0A0P1H2H0      ------------------------------------------------------------
A0A258WKV0      ------------------------------------------------------------
A0A377N8F8      ------------------------------------------------------------
A5G4N9          ------------------------------------------------------------
A0A3C2DSE7      ------------------------------------------------------------
A0A2X1JBG5      ------------------------------------------------------------
A0A0B8PTA8      ------------------------------------------------------------
A0A0B8QF75      ------------------------------------------------------------
A0A4Q3LR91      ------------------------------------------------------------
A0A6C9IKN8      ------------------------------------------------------------
A0A4V1TR68      ------------------------------------------------------------
A0A444IY46      ------------------------------------------------------------
A0A6I7N627      ------------------------------------------------------------
A0A660AID0      ------------------------------------------------------------
A0A3E0WKI3      ------------------------------------------------------------
A0A1H3I2J1      ------------------------------------------------------------
A0A1V5DJV0      ------------------------------------------------------------
A0A520IUC4      ------------------------------------------------------------
A0A521LJG5      ------------------------------------------------------------
A0A531IBQ7      ------------------------------------------------------------
A0A377LY04      ------------------------------------------------------------
A0A5C9ABR5      ------------------------------------------------------------
A0A5J9WU72      ------------------------------------------------------------
A0A2X3K9R3      ------------------------------------------------------------
A0A5W0ZR28      ------------------------------------------------------------
A0A622KDG2      ------------------------------------------------------------
A0A3T9EHW9      ------------------------------------------------------------
A0A484X141      ------------------------------------------------------------
A0A5N9VWI6      ------------------------------------------------------------
A0A6D0EJQ0      ------------------------------------------------------------
A0A376LLF8      ------------------------------------------------------------
A0A444R390      ------------------------------------------------------------
A0A6C9J192      ------------------------------------------------------------
A0A1V4WHZ7      ------------------------------------------------------------
A0A1E5AJN5      ------------------------------------------------------------
A0A2N3D2J1      ------------------------------------------------------------
A0A2N2GVE1      ------------------------------------------------------------
A0A2N2INV3      ------------------------------------------------------------
A0A1Y5DXG5      ------------------------------------------------------------
A0A0B8P2H5      ------------------------------------------------------------
A0A483QWI8      ------------------------------------------------------------
A0A483UXD3      ------------------------------------------------------------
A0A0A8J8L3      ------------------------------------------------------------
A0A660DJ38      ------------------------------------------------------------
A0A380AQW6      ------------------------------------------------------------
A0A2G2GD62      ------------------------------------------------------------
A0A524P331      ------------------------------------------------------------
A0A4V1SSM5      ------------------------------------------------------------
A0A4Q3K8G7      ------------------------------------------------------------
A0A1M7HC79      ------------------------------------------------------------
A0A1D3JZN6      ------------------------------------------------------------
A0A1V6ESG1      ------------------------------------------------------------
A0A1H7YHK3      ------------------------------------------------------------
A0A534SH66      ------------------------------------------------------------
A0A3M0ZZ99      ------------------------------------------------------------
A0A238LBD3      ------------------------------------------------------------
A0A328C2K5      ------------------------------------------------------------
A0A5C6X8M3      ------------------------------------------------------------
A0A3D8MRR7      ------------------------------------------------------------
A0A5C6UBJ7      ------------------------------------------------------------
A0A5C6XGM3      ------------------------------------------------------------
A0A537NZJ1      ------------------------------------------------------------
A0A0P1FRV5      ------------------------------------------------------------
A0A4Q4CVW6      ------------------------------------------------------------
A0A090R136      ------------------------------------------------------------
A0A661JU93      ------------------------------------------------------------
A0A2E2T3V8      ------------------------------------------------------------
A0A367UAB4      ------------------------------------------------------------
A0A0P1FWI8      ------------------------------------------------------------
A0A377V641      ------------------------------------------------------------
A0A1F2YJ88      ------------------------------------------------------------
A0A0J7XGZ1      ------------------------------------------------------------
I4CBA7          ------------------------------------------------------------
A3VE95          ------------------------------------------------------------
A0A1G0NL95      ------------------------------------------------------------
A0A024KA69      ------------------------------------------------------------
A0A0L1KFN4      ------------------------------------------------------------
A0A3P5DSS6      ------------------------------------------------------------
A0A483YEL5      ------------------------------------------------------------
A0A658GUJ0      ------------------------------------------------------------
A0A358L616      ------------------------------------------------------------
A0A1M7BLL7      ------------------------------------------------------------
A0A0H4KZM1      ------------------------------------------------------------
A0A3D5UYX7      ------------------------------------------------------------
A0A2N1WQN5      ------------------------------------------------------------
A0A352G2C2      ------------------------------------------------------------
A0A3C0PZN1      ------------------------------------------------------------
A0A524QFS4      ------------------------------------------------------------
A0A1V1UJT2      ------------------------------------------------------------
A0A0L6CVX1      ------------------------------------------------------------
A0A1V0RR48      ------------------------------------------------------------
A0A0A0HJJ4      ------------------------------------------------------------
A0A5E7YA28      ------------------------------------------------------------
A0A520JSW4      ------------------------------------------------------------
A0A4Q3LTF3      ------------------------------------------------------------
A0A537UTP9      ------------------------------------------------------------
A0A1D2RNR5      ------------------------------------------------------------
A0A4V1TQ46      ------------------------------------------------------------
A0A3A0FZC0      ------------------------------------------------------------
A0A1N7JVZ7      ------------------------------------------------------------
A0A091C4A8      ------------------------------------------------------------
A0A4R3H6P6      ------------------------------------------------------------
A0A3S1NQ09      ------------------------------------------------------------
A0A443GJ52      ------------------------------------------------------------
A0A2W6S588      ------------------------------------------------------------
A0A483E0N4      ------------------------------------------------------------
A0A2J4YQQ6      ------------------------------------------------------------
A0A483THX4      ------------------------------------------------------------
A0A534MVS2      ------------------------------------------------------------
A0A444I5K6      ------------------------------------------------------------
A0A154VE85      ------------------------------------------------------------
A0A3S1MCW7      ------------------------------------------------------------
A0A434IGN6      ------------------------------------------------------------
A0A528AX40      ------------------------------------------------------------
A0A528MV95      ------------------------------------------------------------
A0A3C1S9Y1      ------------------------------------------------------------
A0A353EH49      ------------------------------------------------------------
A0A1Y1Q9C1      ------------------------------------------------------------
A0A3M7LJH0      ------------------------------------------------------------
A0A316KRG4      ------------------------------------------------------------
A0A1E4JHX8      ------------------------------------------------------------
M2U8P2          ------------------------------------------------------------
A0A1H7KZF8      ------------------------------------------------------------
A0A0J5Q9T7      ------------------------------------------------------------
A0A257NG76      ------------------------------------------------------------
A0A1T4TW59      ------------------------------------------------------------
A0A1I5YYQ0      ------------------------------------------------------------
A0A5P9FE62      ------------------------------------------------------------
A0A1Q3MB35      ------------------------------------------------------------
A0A259LUN7      ------------------------------------------------------------
A0A2D7AVL1      ------------------------------------------------------------
A0A3B9KZE9      ------------------------------------------------------------
A0A2U0NMP8      ------------------------------------------------------------
A0A4U9HNE9      ------------------------------------------------------------
A0A2G2CXY6      ------------------------------------------------------------
A0A3M1D4H3      ------------------------------------------------------------
A0A5C8BYM7      ------------------------------------------------------------
A0A1J5ICP0      ------------------------------------------------------------
A0A0M3GBT1      ------------------------------------------------------------
B3Q577          ------------------------------------------------------------
A0A379B9V4      ------------------------------------------------------------
A0A0Q6TS97      ------------------------------------------------------------
A0A0Q6UYB4      ------------------------------------------------------------
A0A484XS37      ------------------------------------------------------------
W7Q5J0          ------------------------------------------------------------
A0A654AKT6      ------------------------------------------------------------
A0A0G9MZA5      ------------------------------------------------------------
H0T8B0          ------------------------------------------------------------
A0A5C7N981      ------------------------------------------------------------
A0A534TV22      ------------------------------------------------------------
A0A351CXR4      ------------------------------------------------------------
A0A2N6GLF5      ------------------------------------------------------------
A0A1W9LJP0      ------------------------------------------------------------
A0A0W1ICB0      ------------------------------------------------------------
A0A2E0UL88      ------------------------------------------------------------
A0A233IKJ2      ------------------------------------------------------------
A0A2T1JE00      ------------------------------------------------------------
A0A0T2QIS1      ------------------------------------------------------------
A0A376KYN0      ------------------------------------------------------------
A0A2X1JB05      ------------------------------------------------------------
A0A376RML0      ------------------------------------------------------------
A0A377E5P7      ------------------------------------------------------------
A0A0P7Y1D0      ------------------------------------------------------------
A0A2M7JRZ7      ------------------------------------------------------------
A0A167IR75      ------------------------------------------------------------
A0A3B8T2U6      ------------------------------------------------------------
A0A365PWR2      ------------------------------------------------------------
A0A2E9H5Z8      ------------------------------------------------------------
A0A2E2BR79      ------------------------------------------------------------
A0A0Q4Q524      ------------------------------------------------------------
A0A0Q4CFJ9      ------------------------------------------------------------
A0A0Q4FE58      ------------------------------------------------------------
A0A0Q4JWC8      ------------------------------------------------------------
A0A0Q4KFL8      ------------------------------------------------------------
A0A522R8R0      ------------------------------------------------------------
A0A2U9NDY5      ------------------------------------------------------------
A0A0Q4IGG1      ------------------------------------------------------------
X7F6S5          ------------------------------------------------------------
A0A1G8NKI0      ------------------------------------------------------------
A0A355QPE4      ------------------------------------------------------------
A0A357RN98      ------------------------------------------------------------
A0A6B2MSQ7      ------------------------------------------------------------
A0A6B2P8H8      ------------------------------------------------------------
A0A1I6U4V1      ------------------------------------------------------------
A0A1G7CFZ2      ------------------------------------------------------------
A0A1P8USW9      ------------------------------------------------------------
A0A534RUJ5      ------------------------------------------------------------
A0A3M1CJM3      ------------------------------------------------------------
A0A2R7SVD4      ------------------------------------------------------------
A0A3C0PWB6      ------------------------------------------------------------
V4Q8B7          ------------------------------------------------------------
A0A0Q8XKK5      ------------------------------------------------------------
A0A2E0Q2W0      ------------------------------------------------------------
A0A660NIR6      ------------------------------------------------------------
A0A142W0R3      ------------------------------------------------------------
A0A0S4XR18      ------------------------------------------------------------
A0A2E0GW64      ------------------------------------------------------------
A0A1A7QJ97      ------------------------------------------------------------
A0A6I4IKZ3      ------------------------------------------------------------
A0A661LW70      ------------------------------------------------------------
W7Q8F9          ------------------------------------------------------------
A0A524PXH8      ------------------------------------------------------------
A0A4Q3P0E4      ------------------------------------------------------------
A0A3M2BE89      ------------------------------------------------------------
A0A4Q4A6K6      ------------------------------------------------------------
A0A257G674      ------------------------------------------------------------
A0A661M5M6      ------------------------------------------------------------
A0A1I1UM01      ------------------------------------------------------------
Q44573          ------------------------------------------------------------
A2W025          ------------------------------------------------------------
A0A534Z362      ------------------------------------------------------------
V4J283          ------------------------------------------------------------
A0A536T443      ------------------------------------------------------------
A0A0Q4UFQ5      ------------------------------------------------------------
A0A527W7E6      ------------------------------------------------------------
A0A432EMV7      ------------------------------------------------------------
A0A087LTV7      ------------------------------------------------------------
A0A534WLI3      ------------------------------------------------------------
A0A318KWA2      ------------------------------------------------------------
A0A522MT86      ------------------------------------------------------------
A0A4Q3I221      ------------------------------------------------------------
A0A534SAL6      ------------------------------------------------------------
A0A534ZDB4      ------------------------------------------------------------
A0A534X3M7      ------------------------------------------------------------
A0A534SPC6      ------------------------------------------------------------
A0A535AD60      ------------------------------------------------------------
A0A4Q3SY08      ------------------------------------------------------------
A0A4Q3LG23      ------------------------------------------------------------
A0A522EX52      ------------------------------------------------------------
A0A1H3KC95      ------------------------------------------------------------
A0A5P8Z4P3      ------------------------------------------------------------
A0A2E9HXF7      ------------------------------------------------------------
A0A0B3RZC9      ------------------------------------------------------------
A0A6F8QET1      ------------------------------------------------------------
A0A520HUH4      ------------------------------------------------------------
A0A2K8U7M6      ------------------------------------------------------------
A0A5B9DKL8      ------------------------------------------------------------
A0A238KJM1      ------------------------------------------------------------
A0A3A0FJZ4      ------------------------------------------------------------
W4HJV8          ------------------------------------------------------------
A0A0P1GDI0      ------------------------------------------------------------
A0A2R8ATV5      ------------------------------------------------------------
A0A1U7D3R6      ------------------------------------------------------------
A0A2D4UVV2      ------------------------------------------------------------
A0A0W7WHP4      ------------------------------------------------------------
A0A238J8F6      ------------------------------------------------------------
A0A238JQI6      ------------------------------------------------------------
A0A222E077      ------------------------------------------------------------
A0A239E3Y2      ------------------------------------------------------------
A0A1V6FYJ1      ------------------------------------------------------------
A0A445MZQ4      ------------------------------------------------------------
A0A0M9E0E3      ------------------------------------------------------------
A0A0Q6QV61      ------------------------------------------------------------
A0A2Z3IKG4      ------------------------------------------------------------
A0A2W4RFS2      ------------------------------------------------------------
A0A1Y6DC43      ------------------------------------------------------------
A0A2S6HE06      ------------------------------------------------------------
G3J0M3          ------------------------------------------------------------
V5C6R5          ------------------------------------------------------------
A0A354EF47      ------------------------------------------------------------
A0A2G6MSP7      ------------------------------------------------------------
A0A4U8YMP3      ------------------------------------------------------------
A0A1Q8QQ99      ------------------------------------------------------------
A0A3D5ZY44      ------------------------------------------------------------
A0A646J2A6      ------------------------------------------------------------
A0A1G5C236      ------------------------------------------------------------
A0A432HIS7      ------------------------------------------------------------
A0A1I3XJ27      ------------------------------------------------------------
A0A1I7DCG1      ------------------------------------------------------------
A0A3A3H6D9      ------------------------------------------------------------
A0A562CGU2      ------------------------------------------------------------
A0A0Q6VA36      ------------------------------------------------------------
A0A1B2EQN1      ------------------------------------------------------------
A0A1E7HSL6      ------------------------------------------------------------
A0A4Q3ZDI7      ------------------------------------------------------------
A0A537PRC6      ------------------------------------------------------------
A0A2M7JX59      ------------------------------------------------------------
A0A3A4XVN3      ------------------------------------------------------------
A0A1E7JEV6      ------------------------------------------------------------
A0A2N2KDY5      ------------------------------------------------------------
A0A3N5YUD9      ------------------------------------------------------------
A0A0W1DLQ3      ------------------------------------------------------------
A0A246JVD8      ------------------------------------------------------------
A0A2N3BB54      ------------------------------------------------------------
A0A1H6G7A3      ------------------------------------------------------------
A0A0A7PGL6      ------------------------------------------------------------
A0A4Q2Z4L0      ------------------------------------------------------------
A0A5C4N0H6      ------------------------------------------------------------
A0A4R1HDF2      ------------------------------------------------------------
A0A1E7HFN0      ------------------------------------------------------------
A0A1M5GH86      ------------------------------------------------------------
A0A1W1XQZ5      ------------------------------------------------------------
A0A3D6C3I2      ------------------------------------------------------------
S0G1D4          ------------------------------------------------------------
A0A661T246      ------------------------------------------------------------
A0A2G6CSG7      ------------------------------------------------------------
A0A2G6NB59      ------------------------------------------------------------
A0A5K8A7T9      ------------------------------------------------------------
A0A1W9U045      ------------------------------------------------------------
A0A1F9L9G4      ------------------------------------------------------------
A0A328FD76      ------------------------------------------------------------
A0A348UX90      ------------------------------------------------------------
A0A357Z0N5      ------------------------------------------------------------
A0A0F2R2U0      ------------------------------------------------------------
A0A5K7ZK00      ------------------------------------------------------------
A0A5K7YCX8      ------------------------------------------------------------
A0A5K7Z388      ------------------------------------------------------------
A0A352B502      ------------------------------------------------------------
A0A2K8WHP8      ------------------------------------------------------------
A0A410V446      ------------------------------------------------------------
A0A0R3KGJ5      ------------------------------------------------------------
A0A0R3N604      ------------------------------------------------------------
A0A1B1UCM8      ------------------------------------------------------------
A0A1N6JQ20      ------------------------------------------------------------
A0A1M5TI07      ------------------------------------------------------------
A3X191          ------------------------------------------------------------
A0A1H4RKV5      ------------------------------------------------------------
A0A160UA87      ------------------------------------------------------------
A0A1Q5SFV5      ------------------------------------------------------------
A0A1J5N774      ------------------------------------------------------------
A0A2C8F781      ------------------------------------------------------------
A0A2E3R6G0      ------------------------------------------------------------
A0A1F8XMK2      ------------------------------------------------------------
A0A3M8EMP2      ------------------------------------------------------------
A0A2J6J6K6      ------------------------------------------------------------
A0A661PSB9      ------------------------------------------------------------
A0A661QBT6      ------------------------------------------------------------
A0A1G6EKK9      ------------------------------------------------------------
A0A6I2SLK2      ------------------------------------------------------------
A0A0A8WSG4      ------------------------------------------------------------
S7TK97          ------------------------------------------------------------
S7UE93          ------------------------------------------------------------
A0A3D5BR56      ------------------------------------------------------------
A0A2N2IB15      ------------------------------------------------------------
A0A1I3PSR2      ------------------------------------------------------------
A0A1I4GEK4      ------------------------------------------------------------
A0A2T5R3J5      ------------------------------------------------------------
A0A1W7QPT7      ------------------------------------------------------------
A0A0M4D373      ------------------------------------------------------------
A0A1L3GKM9      ------------------------------------------------------------
A0A430DNP0      ------------------------------------------------------------
A0A3A0FQ32      ------------------------------------------------------------
A0A1E4UZA0      ------------------------------------------------------------
A0A1H9KL56      ------------------------------------------------------------
A0A1A9KEF8      ------------------------------------------------------------
A0A5E6PKN5      ------------------------------------------------------------
A0A0N9W1V6      ------------------------------------------------------------
A0A423GQ41      ------------------------------------------------------------
A0A423H7J2      ------------------------------------------------------------
A0A502HNM8      ------------------------------------------------------------
A0A4Q7H223      ------------------------------------------------------------
A0A1H4N2K9      ------------------------------------------------------------
A0A2K4KWF7      ------------------------------------------------------------
A0A3E0WXH2      ------------------------------------------------------------
A0A2N2TRC8      ------------------------------------------------------------
A0A1V4CIZ7      ------------------------------------------------------------
A0A1M3BXA5      ------------------------------------------------------------
A0A1Y2R3U6      ------------------------------------------------------------
A0A167HVD6      ------------------------------------------------------------
A0A1V3SCT6      ------------------------------------------------------------
L0H287          ------------------------------------------------------------
A0A495VG93      ------------------------------------------------------------
A0A4R3MYM4      ------------------------------------------------------------
G2E3C0          ------------------------------------------------------------
A0A4U8YLL7      ------------------------------------------------------------
A0A3N5RNY4      ------------------------------------------------------------
A0A1V4M8I1      ------------------------------------------------------------
A0A4Z0M4C7      ------------------------------------------------------------
A0A5Q2QDL1      ------------------------------------------------------------
A0A1I0R9R6      ------------------------------------------------------------
A0A443K010      ------------------------------------------------------------
A0A6I7NYG5      ------------------------------------------------------------
A0A238IZI1      ------------------------------------------------------------
A0A316GHM6      ------------------------------------------------------------
A0A520ZTR8      ------------------------------------------------------------
A0A212AR83      ------------------------------------------------------------
A0A2E2P4I0      ------------------------------------------------------------
A0A2U2CM86      ------------------------------------------------------------
A0A1X7ACC1      ------------------------------------------------------------
A0A2N3BVE7      ------------------------------------------------------------
A0A2S5JE21      ------------------------------------------------------------
A0A2R8BKZ2      ------------------------------------------------------------
A0A2S8S361      ------------------------------------------------------------
A0A238KUF6      ------------------------------------------------------------
A0A095CTW3      ------------------------------------------------------------
A0A2E3UGD6      ------------------------------------------------------------
A0A2T0RFH0      ------------------------------------------------------------
A0A285D390      ------------------------------------------------------------
A0A497VHN4      ------------------------------------------------------------
A0A318CT66      ------------------------------------------------------------
A0A3N5P205      ------------------------------------------------------------
A0A2N6BEI9      ------------------------------------------------------------
A0A0D5N3E9      ------------------------------------------------------------
A0A2N2G716      ------------------------------------------------------------
W9VVY5          ------------------------------------------------------------
A0A1E2URD3      ------------------------------------------------------------
A0A2T6MY81      ------------------------------------------------------------
A0A2T6NBQ8      ------------------------------------------------------------
A0A421K431      ------------------------------------------------------------
A0A2G2I5M1      ------------------------------------------------------------
A0A2G2M6F0      ------------------------------------------------------------
A0A1W9J9F8      ------------------------------------------------------------
A0A2S5LFJ9      ------------------------------------------------------------
A0A2D8R8F8      ------------------------------------------------------------
A0A6I4JXQ8      ------------------------------------------------------------
A0A010SNS0      ------------------------------------------------------------
A0A0C2I782      ------------------------------------------------------------
A0A2N8BYF5      ------------------------------------------------------------
A0A558FKX2      ------------------------------------------------------------
A0A1H1DBA0      ------------------------------------------------------------
J2TAD5          ------------------------------------------------------------
J3H699          ------------------------------------------------------------
A0A1H5J974      ------------------------------------------------------------
A0A0K1QRZ4      ------------------------------------------------------------
A0A560RJW9      ------------------------------------------------------------
A0A5E6TID7      ------------------------------------------------------------
A0A5E7CRU7      ------------------------------------------------------------
A0A5E7C564      ------------------------------------------------------------
A0A2W7MAV4      ------------------------------------------------------------
A0A4R3WQH5      ------------------------------------------------------------
W6VFG3          ------------------------------------------------------------
A0A1P8ENT1      ------------------------------------------------------------
A0A2N7XRV4      ------------------------------------------------------------
A0A0Q6QPG8      ------------------------------------------------------------
A0A0F4SWA7      ------------------------------------------------------------
A0A423J219      ------------------------------------------------------------
A0A4P6G9U8      ------------------------------------------------------------
A0A4Y8JE06      ------------------------------------------------------------
A0A502I1X9      ------------------------------------------------------------
A0A502J776      ------------------------------------------------------------
A0A5B0EZF6      ------------------------------------------------------------
A0A059L434      ------------------------------------------------------------
A0A0F4UWN2      ------------------------------------------------------------
A0A5E7WEF5      ------------------------------------------------------------
A0A1G0KSD0      ------------------------------------------------------------
A0A4P6WX84      ------------------------------------------------------------
A0A1D2S760      ------------------------------------------------------------
A0A5B8RW94      ------------------------------------------------------------
A0A258TN88      ------------------------------------------------------------
A0A1F9EUS2      ------------------------------------------------------------
A0A6H9HII8      ------------------------------------------------------------
A0A3N9VAW3      ------------------------------------------------------------
A0A1X0YE57      ------------------------------------------------------------
A0A2K2H9Q8      ------------------------------------------------------------
A0A6I1KNW9      ------------------------------------------------------------
A0A1H4B8T3      ------------------------------------------------------------
A0A1E7IQC3      ------------------------------------------------------------
A0A1M6KEN5      ------------------------------------------------------------
A0A353QLL3      ------------------------------------------------------------
A0A399I453      ------------------------------------------------------------
A0A651FBV9      ------------------------------------------------------------
A0A5C1MDH8      ------------------------------------------------------------
A0A5A9XE04      ------------------------------------------------------------
A0A643G9R1      ------------------------------------------------------------
A0A1G0M8Q7      ------------------------------------------------------------
A0A353MI14      ------------------------------------------------------------
A0A4S1CAW7      ------------------------------------------------------------
A0A562VHD2      ------------------------------------------------------------
A0A6I6JNB5      ------------------------------------------------------------
A0A1G0LDK7      ------------------------------------------------------------
A0A6F9WVL7      ------------------------------------------------------------
A0A2M7WWF7      ------------------------------------------------------------
A0A351Z9A2      ------------------------------------------------------------
A0A351B422      ------------------------------------------------------------
F2NEE9          ------------------------------------------------------------
B7RS54          ------------------------------------------------------------
A0A3N5FRH4      ------------------------------------------------------------
A0A1V4Y2C3      ------------------------------------------------------------
A0A2N2KTJ4      ------------------------------------------------------------
A0A2N2LQX0      ------------------------------------------------------------
A0A520CSP5      ------------------------------------------------------------
A0A1I6ENM4      ------------------------------------------------------------
A8LNM8          ------------------------------------------------------------
A0A0T5NSU3      ------------------------------------------------------------
A0A5P9I718      ------------------------------------------------------------
A0A2M8J3R9      ------------------------------------------------------------
A0A1I6X762      ------------------------------------------------------------
A0A0P1EFX8      ------------------------------------------------------------
A0A2G5KB39      ------------------------------------------------------------
A0A2N3CNV1      ------------------------------------------------------------
A0A257F1F4      ------------------------------------------------------------
A0A1G9FY29      ------------------------------------------------------------
A0A4Q3ZBK4      ------------------------------------------------------------
A0A2D5J8T8      ------------------------------------------------------------
A0A2E3P9W6      ------------------------------------------------------------
A0A2G2B1P9      ------------------------------------------------------------
A0A258GCD5      ------------------------------------------------------------
A0A2D9YR88      ------------------------------------------------------------
A0A443INY4      ------------------------------------------------------------
A0A372IH36      ------------------------------------------------------------
A0A540VW45      ------------------------------------------------------------
A0A1H9C241      ------------------------------------------------------------
A0A2E3FCR1      ------------------------------------------------------------
A0A4S3MG69      ------------------------------------------------------------
A0A3E0H727      ------------------------------------------------------------
A0A1G8QZS5      ------------------------------------------------------------
A0A1V4QMH7      ------------------------------------------------------------
A0A496XZQ4      ------------------------------------------------------------
A0A1F9BJF7      ------------------------------------------------------------
F2NDF5          ------------------------------------------------------------
A0A1I3TTC3      ------------------------------------------------------------
A0A1H3IZW6      ------------------------------------------------------------
A0A0M6YG59      ------------------------------------------------------------
A0A1H7G8B0      ------------------------------------------------------------
A0A059IPK4      ------------------------------------------------------------
A0A1H2Y469      ------------------------------------------------------------
A0A497ZQU7      ------------------------------------------------------------
A0A318D3U4      ------------------------------------------------------------
A0A401FQP5      ------------------------------------------------------------
A0A1Q6DMW3      ------------------------------------------------------------
A0A3A6P8F8      ------------------------------------------------------------
A0A2G2DSM4      ------------------------------------------------------------
A0A1F9NI02      ------------------------------------------------------------
A0A4U1ABX4      ------------------------------------------------------------
A0A351Z4H9      ------------------------------------------------------------
A0A2N2KML4      ------------------------------------------------------------
E1YJF1          ------------------------------------------------------------
A0A1J5EVZ6      ------------------------------------------------------------
A0A2G6FCC5      ------------------------------------------------------------
A0A1F9MR25      ------------------------------------------------------------
A0A2G6M7F1      ------------------------------------------------------------
A0A1E7H876      ------------------------------------------------------------
A0A509L3P8      ------------------------------------------------------------
A0A3A4S038      ------------------------------------------------------------
A0A1F9N669      ------------------------------------------------------------
A0A1F9PFA7      ------------------------------------------------------------
A0A1H2EN09      ------------------------------------------------------------
K0NP00          ------------------------------------------------------------
A0A1E7JCL5      ------------------------------------------------------------
A0A496YAH9      ------------------------------------------------------------
A0A1V4S7E4      ------------------------------------------------------------
A0A2N2H8D2      ------------------------------------------------------------
A0A2N2KC63      ------------------------------------------------------------
A0A3A4ZYW4      ------------------------------------------------------------
A0A1V4MCJ4      ------------------------------------------------------------
A0A661M0W4      ------------------------------------------------------------
A0A0F2NF69      ------------------------------------------------------------
A0A1F9NFD0      ------------------------------------------------------------
A0A1M5YLH5      ------------------------------------------------------------
A0A4U1A4C7      ------------------------------------------------------------
                                                                            

E1Y9C0          ------------------------------------------------------------
A0A1N6SH58      ------------------------------------------------------------
A0A4Q3AQN2      ------------------------------------------------------------
A0A1W9HS52      --ENTLVKLKEESRKLETEKSTLNARLKADKSEISKIPHILQEFEALQRQISVSSDLYLG
A0A2D5LFD8      --SFAMKSLEQKKAAL--------------EPLLLASQLRALDTALQVNSNQINSTKLEL
A0A0N0XAV4      -----MNQLEEQKKAL--------------LKKIEALPMTQQELLRLTRDMQVTSQTYSL
A0A0P9QD19      --MSQMNQLEQQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
F3FHG4          --MSQMNQLEQQRQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
F3GGI0          --MSQMNQLEQQRQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A0P9LE74      --MSQMNQLEEQKKAL--------------LKKIEALPMTQQELLRLTRDMQVTSQTYSL
A0A3M4ZQ14      --MSQINQLEQQRQAL--------------LKKIEALPMTQQELLRLTRDMQVTSQTYTL
A0A3M5YLE8      --MSQINQLEQQRQAL--------------LKKIEALPMTQQELLRLTRDMQVTSQTYTL
A0A3M3RP89      --MSQINQLEQQRQAL--------------LKKIEALPMTQQELLRLTRDMQVTSQTYTL
A0A0P9QIY7      --MSQINQLEQQRQAL--------------LKKIEALPMTQQELLRLTRDMQVTSQTYTL
A0A0P9VVH7      --MSQINQLEQQRQAL--------------LKKIEALPMTQQELLRLTRDMQVTSQTYTL
A0A0Q0FJK6      --MSQINQLEQQRQAL--------------LKKIEALPMTQQELLRLTRDMQVTSQTYTL
A0A0Q0G2J0      --MSQINQLEQQRQAL--------------LKKIEALPMTQQELLRLTRDMQVTSQTYTL
A0A3M3LF66      --MSQINQLEQQRQAL--------------LKKIEALPMTQQELLRLTRDMQVTSQTYTL
A0A0P9WIR8      --MSQINQLEQQRQAL--------------LKKIEALPMTQQELLRLTRDMQVTSQTYTL
A0A3M3KPE5      --MSQINQLEQQRQAL--------------LKKIEALPMTQQELLRLTRDMQVTSQTYTL
A0A3M4C263      --MSQINQLEQQRQAL--------------LKKIEALPMTQQELLRLTRDMQVTSQTYTL
A0A3M5AD05      --MSQINQLEQQRQAL--------------LKKIEALPMTQQELLRLTRDMQVTSQTYTL
A0A0Q0D3D2      --MSQMNQLEQQKQGL--------------LKKIDALPMTQQEL---------------L
A0A0N0FS39      --MSQMNQLEQQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A3M6GHH2      --MSQMNQLEQQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A0P9R9W0      --MSQMNQLEQQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A0Q0B9T0      --MSQMNQLEQQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A3M6CFI7      --MSQMNQLEQQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A0P9JXN0      --MSQMNQLEQQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A3M6FIV7      --MSQMNQLEQQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A3M3PLW9      --MSQMNQLEQQRQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A3M4ENY1      --MSQMSQLEQQRQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A3M5EZK7      --MSQMNQLEQQRQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A0P9SPP5      --MSQMNQLEQQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A658KL17      --MSQMNQLEQQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A3M3NNF2      --MSQMNQLEQQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A3M4A0E8      --MSQMNQLEQQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A3M4PBZ2      --MSQMNQLEQQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A3M6AI26      --MSQMNQLEQQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A0P9IWP8      --MSQMNQLEQQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A0P9KZ49      --MSQMNQLEQQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A0P9V840      --MSQMNQLEQQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A0Q0AIE5      --MSQMNQLEQQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A3M2ZQH6      --MSQMNQLEQQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A0N8SQG2      --MSQMNQLEQQKQGL--------------LKKIDALPMTQQELLRMTRDMQVISQTYTL
A0A0W8HFU1      --MSQMNQLEQQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A3M5M873      --MSQMNQLEQQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A0P9VHH8      --MSQMNQLEQQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A0P9YV98      --MSQMNQLEQQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A3M3G2W8      --MSQMNQLEQQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A3M6C224      --MSQMNQLEQQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A3M5K254      --MSQMNQLEQQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A3M5JFB0      --MSQMNQLEQQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A3M3TQV3      --MSQMNQLEQQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A3M3EF92      --MSQMNQLEQQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A3M5J1E2      --MSQMNQLEQQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A3M5G7H9      --MSQMNQLEQQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A3M4A376      --MSQMNQLEQQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A0Q0A5T8      --MSQMNQLEQQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A0P9SCD7      --MSQMNQLEQQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A0P9T4G3      --MSQMNQLEQQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A0P9VKB0      --MSQMNQLEQQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A0Q0BM35      --MSQMNQLEQQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A3M3TPR7      --MSQMNQLEQQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A3M3U4Q3      --MSQMNQLEQQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A0P9UCX7      --MSQMNQLEQQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A0P9S1F1      --MSQMNQLEQQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A0P9QCJ2      --MSQLNQLEQQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A0P9Q329      --MSQMNQLEQQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A3M5GJ64      --MSQMNQLEQQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A0P9MPC7      --MSQMNQLEQQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A3M2XYQ3      --MSQMNQLEQQRQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A0P9XCE1      --MSQMNQLEQQRQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A3M3EFX7      --MSQMNQLEQQRQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A3M5B9D9      --MSQMNQLEQQRQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A0P9RRZ3      --MSQMNQLEQQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A3M2VEK7      --MSQMNQLEQQRQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A0N8R9B3      --MSQMNQLEQQRLGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A0P9VA27      --MSQMSQLEQQRQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A3M4YBJ4      --MSQMSQLEQQRQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A0P9J470      --MSQINQLEQQRQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A0Q0EVJ8      --MSQINQLEQQRQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A3M5UI30      -----MNQLEQQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A3M5YQT8      SQMSQMNQLEQQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A3M5F5X1      --MSQMNQLEQQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A3M5R8G1      --MSQMNQLEQQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A3M5V012      --MSQMNQLEQQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A3M3GA16      --MSQMNQLEQQKQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A3M3UCT3      --MSQMNQLEQQRQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A3M3CJL0      --MSQMNQLEQQRKGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A3M3F6F5      --MSQMSQLEQQRQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A3M3P9B7      --MSQMSQLEQQRQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A0N8QB74      --MSQMNQLEQQRQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A0Q0AUD0      --MSQMNQLEQQRQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A3M5VR55      --MSQMNQLEQQRLGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A0Q0FK97      --MSQMNQLEQQRLGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A3M5KZ75      --MSQINQLEQQRQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A3M5L3G5      --MSQINQLEQQRQGL--------------LKKIDALPMTQQELLRLTRDMQVISQTYTL
A0A0C5VQ86      ------------------------------------------------------------
A0A1V8MBH1      ------------------------------------------------------------
A0A534QGR3      ------------------------------------------------------------
A0A0R0BVC7      ------------------------------------------------------------
A0A0W1GMS6      ------------------------------------------------------------
A0A0Q8RMY3      ------------------------------------------------------------
A0A1A7QC21      ------------------------------------------------------------
A0A1F9CFF0      ------------------------------------------------------------
A0A2M8B0G5      ------------------------------------------------------------
A0A363TNU9      ------------------------------------------------------------
A0A534HBS8      ------------------------------------------------------------
A0A0F0T3Y9      ------------------------------------------------------------
A0A379GWF0      ------------------------------------------------------------
A0A536T0W8      ------------------------------------------------------------
A0A4Q2XLV7      ------------------------------------------------------------
A0A4Q5QYC4      ------------------------------------------------------------
A0A2G9XLE5      ------------------------------------------------------------
A0A3D2M6Y9      ------------------------------------------------------------
A0A3D2YAZ2      ------------------------------------------------------------
A0A350A102      ------------------------------------------------------------
A0A350L5D2      ------------------------------------------------------------
A0A3B8SQ27      ------------------------------------------------------------
A0A656BWB0      ------------------------------------------------------------
A0A6D0IFH4      ------------------------------------------------------------
A0A3Y2RPN4      ------------------------------------------------------------
A0A0A0FHV8      ------------------------------------------------------------
A0A1X3IPU7      ------------------------------------------------------------
A0A0A0G0N2      ------------------------------------------------------------
A0A243TPR1      ------------------------------------------------------------
A0A2I8SDU4      ------------------------------------------------------------
A0A2I8SU55      ------------------------------------------------------------
S1EXJ6          ------------------------------------------------------------
A0A376UBS1      ------------------------------------------------------------
A0A4Q6G931      ------------------------------------------------------------
A0A1W9F5M9      ------------------------------------------------------------
A0A3C2BN18      ------------------------------------------------------------
A0A447LR75      ------------------------------------------------------------
A0A376D8L7      ------------------------------------------------------------
A0A1V2FV46      ------------------------------------------------------------
A0A376SB61      ------------------------------------------------------------
A0A3D1BYV9      ------------------------------------------------------------
A0A6D0I9G1      --------------------------------------------------VESGQQVYMQ
A0A352MMI7      --LEKRRALEDEKDRL--------------SGRVSAMPKTQQEIVRLTRDVESGQQVYMQ
A0A379W6R2      ------------------------------------------------------------
A0A376RY66      --LEKRQALEDEKAKL--------------NGRVTAMPKTQQEIVRLTRDVESGQQVYMQ
A0A377K431      --LEKRQALEDEKAKL--------------NGRVTAMPKPSRKLCVLTRDVESGQQVYMQ
A0A379TA56      ------------------------------------MPKTQQEIVRLTRDVESGQQVYMQ
A0A4Z0LWV1      --LEKRKALEDEKAKL--------------NGRVTAMPKTQQEIVRLTRDVESGQQVYMQ
A0A5V7HTZ1      --LEKRKALEDEKAKL--------------NGRVTAMPKTQQEIVRLTRDVESGQQVYMQ
A0A610XNI4      --LEKRKALEDEKAKL--------------NGRVTAMPKTQQEIVRLTRDVESGQQVYMQ
A0A620QD02      --LEKRKALEDEKAKL--------------NGRVTAMPKTQQEIVRLTRDVESGQQVYMQ
A0A5H3HSJ8      --LEKRKALEDEKAKL--------------NGRVTAMPKTQQEIVRLTRDVESGQQVYMQ
A0A655C5P0      ------------------------------------MPKTQQEIVRLTRDVESGQQVYMQ
A0A2T0VBD8      ------------------------------------------------------------
A0A378APS2      ------------------------------------------------------------
A0A443VCQ6      ------------------------------------------------------------
A0A447RKQ7      ------------------------------------------------------------
W1DSK1          ------------------------------------------------------------
A0A0U2VAW2      --VEQIAAVKEQRKAL--------------VGEVGNLPETQQELLRLKRDVEVSNQIYTL
A0A454CTF1      --LDKRQTLLQEKARL--------------NRQVQKLPKTQREVLRMTRDVEVNQQIYIQ
A0A6B3Q2G1      --LDKRQTLLQEKERL--------------NKQVQKLPKTQREVLRMTRDVEVNQQIYIQ
A0A378G3G7      --LEKRKTLEEEKNNL--------------KKKINNLPETQQEVLRLTRDVQVGQDVYLQ
A0A2X5NHJ9      --LEKRKVLQQEKAKL--------------NQQVSGMPATQQEVLRLSRNVESGQAVYMQ
A0A2J4QEC3      -------------------------------------------------------AVYMQ
A0A485ADM3      --MEKRKTLQDEKAKL--------------NKRVSAMPETQQEILRLSRDVESGRAVYMQ
A0A4U9HGU4      --LEKRKTLEEERDRL--------------NKRVNAMPETQQEVVRLSRDVDSGKEVYMQ
A0A3S4JGG5      --MEKRATLQQEKDKL--------------NKRVSGMPKTQQEILRLTRDVQAGQEIYMQ
A0A377ZDH2      ------------------------------------------------------------
A0A3S4HTS8      ------------------------------------------------------------
A0A2N1XK22      ------------------------------------------------------------
A0A3D0KAC8      --MNQINQLQMQKDQL--------------EKQIDTLPSTQQELLRLTRDVEVSSETYSM
A0A3D2Y902      ---------------------------------------TQQELLRLTRDVEVSSETYSM
A0A655RNN3      ------------------------------------------------------------
A0A655R819      ------------------------------------------------------------
A0A655ZEY0      ------------------------------KSEFQTLTVKNAKYSELKREVQTNRELFDL
A0A6G6X2Z4      ---------------------------------------------------------MSK
Q44570          ------------------------------------------------------------
A0A3N5MZ53      ------------------------------------------------------------
A0A534E4H4      -----------------------------------------------------DRQLYDL
A0A534I2B6      ------------------------------GQQYQQVGRKEAKLESLQRAVDTNRQLYDL
A0A1C2JGD0      ----------------------------------------------------------MF
A0A259LQ70      ------------------------------------------------------------
A0A4V2SPR5      ------------------------------------------------------------
A0A3N5PM86      ------------------------------KREALYLNEKQIGYNSLKRDTDTSRSLYES
A0A2E5YSA4      ---------------------------------MGSRSGCRFAREFQSGDEIESMGEIAE
A0A519ERR1      ------------------------------------------------RDVRVNNELYKS
A0A4Q3Q1M2      ------------------------------------------------------------
A0A4Q3MHR1      ------------------------------------------------------------
A0A520GDZ4      ------------------------------------------------------------
A0A318DSU0      ------------------------------DKQVGDLPDTQQELLRLTRDVEVTNATYTS
A0A538PF21      ------------------------------------------------------------
A0A1W1ZH10      -------------------------------------------------------TQYQT
A0A1W2FF24      -------------------------------------------------------TQYQT
A0A524JYQ6      ------------------------------QKKAFELDRKLLTYEELLRNVEADQALYNS
A0A4Q3MA17      ---------------------------------VTTLPNVEQDMVRLTRDVKVNSESYAT
A0A0N0M5F7      ------------------------------RNATLSEQDRSIRYTILRREVRTNRELYDG
A0A537M754      ------------------------------KGQLLNLREKSIAYTILQREVDTNRSLYDA
A0A1V1PDB4      ----------------------------------MELNQKSIQYGVLQREAESARHMYEL
A0A2M7C324      ------------------------------KQSIQGSNRKEYELSALERDVKTNQELYDV
A0A4Q3HHG6      ------------------------------------------------------------
A0A3B7DTA4      ---------------------------------------------MLKRVAETNRSSYDA
A0A432ZK62      ------------------------------NAQVSTLLETQQEVLRLARDVEVSQEIYVQ
A0A1V5EEP4      -----------------------------------------------------MGKLYKA
A0A1V5EF48      -----------------------------------------------------MGKLYKA
A0A0S6X1X6      ----------------------------------MDEQNSGVQYNLLKRVADTNRSLYDT
A0A537Y5L8      ----------------------------------------------LDSNAQTYRALHDA
A0A4Q3L2X2      -----------------------------------------------QQEVDTNRALYDG
A0A4Q3T8J1      ------------------------------------------------------RTLYEG
A0A4Q4ANM4      --------------------------------------QSQVRLRELETASNTYRGIYET
A0A4Q3UEC7      --------------------------------------MAEVRLRELERQAESAKTLYEN
A0A1H5YYQ4      ----------------------------------MTQRPKFTRKKRAGAQSLPEIEPAVP
A0A1X4NLK2      ------------------------------ELEALLAEKEALLQRQAELEAERLQEVARK
A0A1X4NWB5      ------------------------------EIDALIAEKEALLRQRAELEALRKKEAARD
A0A1M5UQ38      -----------------------------------MTEQPKFQRRKRRGAVDDVPTPTPK
A0A327YI48      -----------------------------------MTDDRKFRRRNPLSAEIAAGEQAAK
A0A1B1PNL6      ----------------------------------LERREERLARRRADRDAEEARAAAQV
A0A2U8H9H9      ----------------------------------LERRADRLARREAEREAEDART----
A0A6B2NBB8      ----------------------------------LERRADRLARREAEREAEDART----
A0A1X6YIC0      ----------------------------------MADRPKFRRRRGRTPERTEDDD----
A0A1I5E9E9      ----------------------------------LSRYEAYMRRRAARRDALENA-----
A0A1X6Z7N7      ----------------------------------LSRYEAYMRRRAARRDALESP-----
A0A2E1DQ13      ----------------------------------LSRHEAYMRRRAARQAEAPET-----
A0A1H8C800      ----------------------------------LQRHDAYMRRREARHTAEEAGD----
A0A2N3EZ05      ----------------------------------LSRHEAYMRRRAARLEAEAAA-----
A0A3N5J7U8      -------------------------------------------MSESRDPAGSGQMFDIE
A0A1S7S3I8      ------------------------------------------------------------
A0A519E8D7      ------------------------------------------------------------
A0A3S1NZ06      ------------------------------GKSSIDNQSQVQLRDLDQKATALTTLYQTF
A0A3S1FD32      ------------------------------GKSSVDNQTQVKLRELDQQATALTTLYQTF
A0A434DUT4      ------------------------------GKSSIDNQTQVQLRELEQKATALSTLYQTF
A0A528D3U3      ------------------------------------------------------------
A0A3S3UPT3      ------------------------------------------------------------
A0A3S1E286      ------------------------------------------------------------
A0A531AC71      ------------------------------------------------------------
A0A436K268      ------------------------------------------------------------
A0A434IDQ0      ------------------------------------------------------------
A0A435IRM5      ------------------------------------------------------------
A0A3S2C404      ------------------------------------------------------------
A0A435F6C0      ------------------------------------------------------------
A0A435BMN6      ------------------------------------------------------------
A0A529XQ54      ------------------------------------------------------------
A0A530BJC1      ------------------------------------------------------------
A0A348SRI7      ------------------------------------------------------------
A0A354EI73      ------------------------------------------------------------
A0A4Q3IRI1      ------------------------------------------------------------
A0A4P7EP83      ------------------------------------------------------------
A0A6I1QB25      ------------------------------------------------------------
A0A655ZZQ1      -----------------------------------------MVRKQRGKLDAKAYFDEKL
A0A1S0ZAI3      ------------------------------------------------------------
A0A1W9M770      -------------------------------------------------------MFGSK
A0A1W9M7R6      ------------------------------------------------------------
A0A3A4NIE9      ------------------------------------------------------------
A0A3A4NUI9      ------------------------------------------------------------
A0A524I3Z6      ------------------------------------------------------------
A0A524PCL7      ------------------------------------------------------------
A0A356GQV1      ------------------------------------------------------------
A0A1J5DAY8      ------------------------------------------------------------
A0A524P237      ------------------------------------------------------------
A0A3C0L0A8      ------------------------------------------------------------
A0A176S762      ------------------------------------------------------------
A0A377ZC40      ------------------------------------------------------------
A0A378BPJ7      ----------------------------------------------------------MQ
A0A2J5PAJ7      ------------------------------------------------------------
A0A377ZDN3      ------------------------------------------------------------
A0A1G3JY11      ------------------------------------------------------------
A0A661N3U1      ------------------------------------------------------------
A0A1W9WUD9      ------------------------------------------------------------
A0A1W1ZQK0      ------------------------------------------------------------
A0A4U1ALN4      ------------------------------NEEKPFLVREPQRTEIYSPQ----------
A0A4U1B1A8      ------------------------------VSESEKLDAVVPIREMVRELPTTDSPRDVE
A0A1M7Y300      ------------------------------ESTYTVTNKRAPAVDASQPL----------
A0A4U1A967      ------------------------------NDNHNFSDDSNSPSDHLTNL----------
A0A6I1R304      ----------------------------------------------SAHTKMEFSLSEVL
A0A1W9PMU6      ------------------------------------------------------------
A0A6D0ELN7      ------------------------------------------------------------
A0A3S1WTQ1      ------------------------------------------------------------
A0A440NX85      ------------------------------------------------------------
A0A530CUR9      ------------------------------------------------------------
A0A1M6N1X5      ------------------------------------------------------------
A0A561M3U0      ------------------------------QQIERLPDVQQDAVRLMLDVKVNTDLYAAL
A0A1G3VVY5      ------------------------------------------------------------
A0A2N6BZD5      ----------------------------------------KVFKALNKGASTDEADLPWD
A0A656PSQ6      ------------------------------------------------------------
A0A2W5J775      ------------------------------------------------------------
A0A352Q5C1      ------------------------------------------------------------
A0A435NNF5      ------------------------------------------------------------
A0A3S2AQS7      ------------------------------RQQVVFNDKNIKYTILKREVDSNRSQYDSL
A0A436XH86      ------------------------------------------------------------
A0A527ZPD6      ------------------------------------------------------------
A0A529KRW3      ------------------------------------------------------------
A0A530ZLX0      ------------------------------------------------------SQYDSL
A0A355TB56      ------------------------------------------------------------
A0A1F9E324      ------------------------------GKAVEMKQKAIQYNILKRESDTNKELYRGL
A0A432SAI6      ------------------------------------------------------------
A0A4Q3LBH4      ------------------------------NSTLSEQNQGIELSILRREADTNRQQYEAL
A0A4Q3LWP3      ------------------------------SDTLSEQNQGIELSILRREADTNRQQYEAL
A0A2N6VGL1      ------------------------------------------------------------
A0A3M3H5V6      ---------------------------------------------------PGKNSRATL
A0A524M660      ------------------------------------------------------------
A0A0C1TRU6      ------------------------------------------------------------
A0A2Z5SSF4      ------------------------------------------------------------
A0A2T4ZJZ6      ----------------------------------------QVILELSGDVKVSTNLYSTL
A0A327LYE6      ------------------------------------------------------------
A0A5A9ZTV3      ------------------------------------------------------------
A0A4Q4CIB1      ------------------------------------------------------------
A0A522ACJ9      ------------------------------------------------------------
A0A1T2KYM8      ------------------------------LQAQAIDSKQSEYRALERNLEADQKLYDTF
A0A3N5Z7F8      ---------------------------------------------------------NAL
A0A2G9ZR82      ------------------------------KLAMELNERATQYKIMEREVETNKQIYNSL
A0A239HD34      ------------------------------------------------------------
A0A4U9I390      ------------------------------------------------------------
A0A534V9L7      ----------------------------------------MNVTAYAPAPEKELDLRELT
A0A0P7ZZE4      ------------------------------------------------------------
A0A369R0Q9      ------------------------------------------------------------
A0A534XP85      ------------------------------------------------------------
A0A2X3M011      ------------------------------------------------------------
I2WC85          ------------------------------------------------------------
A0A400JH80      ------------------------------KRVSAMPSTQQEVLRLSRDVEAGRAVYLQL
A0A2H9EHM4      ------------------------------------------------------------
A0A380B3D7      ------------------------------------------------------------
F5NSX0          ------------------------------------------------------------
A0A479JNB1      ------------------------------------------------------------
A0A5C9AF52      ------------------------------------------------------------
A0A6D0EYC7      -----------------------------------MPSTQQEVLRLSRDVEAGRAVYLQL
D8EEU7          ------------------------------KRVSAMPSTQQEVLRLSRDVEAGRAVYLQL
A0A0P1H2H0      ------------------------------------------------------------
A0A258WKV0      -------------------------------------------NMLDREATALRAQLSSL
A0A377N8F8      ----------------------------------------QNILRLTRDVQTAQEMHSLL
A5G4N9          ------------------------------------------------------------
A0A3C2DSE7      ------------------------------EQIQDISRKEFKVRDLQREVEANRALYDTF
A0A2X1JBG5      ----------------------------------------QEILRLTRDVQVDQEIFVQL
A0A0B8PTA8      ---------------------------------------------MTRDVEVNQQIYLQL
A0A0B8QF75      ---------------------------------------------------MNQQIYLQL
A0A4Q3LR91      ------------------------------GRVLDFRRRNIQYDILQREVDTNRQLYDAL
A0A6C9IKN8      ---------------------------------------------VERQQKIKEELYLYL
A0A4V1TR68      ------------------------------SGVLDFRQRSIQYNILQRDVDTNRQLYDAL
A0A444IY46      ------------------------------QKAIELNDKASQYRILLRETETNKSIYETL
A0A6I7N627      ------------------------------EQLMTLNERSVQYNILRREYETSRELYDAV
A0A660AID0      ----------------------------------------REVLRMTRDVEVNQQIYIQL
A0A3E0WKI3      ----------------------------------------QELLRLRREAEVNSALYTAM
A0A1H3I2J1      ------------------------------HQPELQDEDDAAFDALLAEFEASDDHDDDD
A0A1V5DJV0      ---------------------------------------------LMRHTKVNSELYTFL
A0A520IUC4      ------------------------------SNVLDLRGRGIGYTILQREVETNRTLYDAL
A0A521LJG5      ------------------------------VVSGTASQYEAELKQLEREAQSNRTLYEGF
A0A531IBQ7      ------------------------------GKSSIDNQSQVKLRELDQQATALSTLYQTF
A0A377LY04      ----------------------------------------QEIVRLTRDVESGQQVYMQL
A0A5C9ABR5      ------------------------------------------------------------
A0A5J9WU72      ------------------------------------------IVRLTRDVESGQQVYMQL
A0A2X3K9R3      ----------------------------------------QEIVRLTRDVESGQQVYMQL
A0A5W0ZR28      ----------------------------------------QEIVRLTRDVESGQQVYMQL
A0A622KDG2      ----------------------------------------QEIVRLTRDVESGQQVYMQL
A0A3T9EHW9      ----------------------------------------QEIVRLTRDVESGQQVYMQL
A0A484X141      ----------------------------------------QEIVRLTRDVESGQQVYMQL
A0A5N9VWI6      ----------------------------------------QEIVRLTRDVESGQQVYMQL
A0A6D0EJQ0      ------------------------------------------------------------
A0A376LLF8      ------------------------------------------------------------
A0A444R390      ------------------------------------------------------------
A0A6C9J192      ------------------------------------------------------------
A0A1V4WHZ7      ------------------------------AEAQKLSEHSIQYGVFLREVEKNRELYENL
A0A1E5AJN5      ------------------------------ASSREYREKSVEFIILRREVDSKRSQFEAL
A0A2N3D2J1      ------------------------------STTLDEQRRSIQYNILRREADTNRTLYDAL
A0A2N2GVE1      ------------------------------EEALALAALDIEHSKLLRERNETAKLYELV
A0A2N2INV3      ------------------------------EEALALAALDIEHSKLLRERNETAKLYELV
A0A1Y5DXG5      ----------------------------------------QKLLGLTRDVEVGNEIYMML
A0A0B8P2H5      ----------------------------------------REVLRLTRDVEVNQQIYLQL
A0A483QWI8      ----------------------------------------QEILRLSRDVDSGQAVYMQL
A0A483UXD3      ----------------------------------------QEILRLSRDVDSGQAVYMQL
A0A0A8J8L3      ----------------------------------------QEVLRLSRDVESGRAVYLQL
A0A660DJ38      ----------------------------------------QEVLRLSRDVESGRAVYLQL
A0A380AQW6      ----------------------------------------QEILRLTRDVQVDQQVYMQL
A0A2G2GD62      ------------------------------ASLTKLPEQERELGELTRNSSVNQEIYSFL
A0A524P331      ------------------------------AKLGKLPEAERTQARLMRHSKVNADIYTFL
A0A4V1SSM5      ------------------------------GEQAGNTRASAVASSLKRQAEARSSVYTQT
A0A4Q3K8G7      ------------------------------GELAANTSASVELNELERRADALRTNYNAL
A0A1M7HC79      ----------------------------------------QEVVRLTRDVEVTQAIYVNV
A0A1D3JZN6      ----------------------------------------QELLSLTRDVQVGTEIYTQL
A0A1V6ESG1      ------------------------------KEVIQTQDKGVDLSLLKRELDTNRQIYDNL
A0A1H7YHK3      ----------------------------------------QELLRLTRDLQVSNELYTAL
A0A534SH66      -------------------------------------------------METGHALHASL
A0A3M0ZZ99      --------------------------------------ALARFYELRQEAEIARSQYAAL
A0A238LBD3      ------------------------------------------------------------
A0A328C2K5      ------------------------------AEIAELNQIGFRYTEMRDSTETLRLHYESV
A0A5C6X8M3      ------------------------------AEIAELNQIGFRYTEMRDSTETLRQHYETV
A0A3D8MRR7      ------------------------------AEIAELNQIGFRYTEMRDSTETLRQHYETV
A0A5C6UBJ7      ------------------------------AEIAELNQIGFRYTEMRDSTETLRQHYETV
A0A5C6XGM3      ------------------------------AEIAELNQIGFRYTEMRDSTETLRQHYETV
A0A537NZJ1      ---------------------------------------------MKRRCNCASSSARLT
A0A0P1FRV5      --------------------------------------SGRSAEEIAREDRALRSAFPFL
A0A4Q4CVW6      ------------------------------QQTERANSDDVEARALAREAEAERNLLQAL
A0A090R136      ----------------------------------------REVLRLTRDVEVNQQIYIQL
A0A661JU93      ------------------------------AQMKLLPQKEVQLAELTRNVEANRAVYSML
A0A2E2T3V8      ------------------------------KELVKKHEALAGQGVLERDVEEAKRTVELL
A0A367UAB4      ------------------------------KELVKKHEALAGQGVLERDVEEAKRTVELL
A0A0P1FWI8      ------------------------------------------------------------
A0A377V641      ----------------------------------------QEILRLSRDVESGRAVYMQL
A0A1F2YJ88      ------------------------------STLKELPDLQRRYLQLYREVEVKQQLYTAL
A0A0J7XGZ1      ------------------------------GSLVQNGSAQVGRLELERRAEASRAIYSAY
I4CBA7          ------------------------------EAAIRAGSNATRLSILKRAAAADAQVYLTL
A3VE95          ------------------------------DRLAGMSANSIGRTQLEREAAAARENYEAL
A0A1G0NL95      ----------------------------------------RNILRLSREVQVNTQLYTSL
A0A024KA69      -----------------------------------------------QALASAQSHYRML
A0A0L1KFN4      ------------------------------GDYLDLRRRSIQYNIFQQEVDTNRALYDGL
A0A3P5DSS6      ----------------------------------------QEILRLSRDVESGRAVYMQL
A0A483YEL5      ----------------------------------------QEVLRLSRDVESGRAVYMQL
A0A658GUJ0      ----------------------------------------QEVLRLSRDVESGRAVYMQL
A0A358L616      ----------------------------------------QEILRLTRDVQAGQEIYMQL
A0A1M7BLL7      -------------------------------------------QLPEPEPEPDVEDAPNV
A0A0H4KZM1      ------------------------------------------------------------
A0A3D5UYX7      ------------------------------GETGADNQALIQLRELEREADATRAVYEAF
A0A2N1WQN5      ------------------------------------------------------------
A0A352G2C2      ----------------------------------------QELLRLTRDVEVSSETYSML
A0A3C0PZN1      ----------------------------------------QELLRLTRDVEVSSETYSML
A0A524QFS4      ------------------------------------------LTGLDREREALEVAYKGM
A0A1V1UJT2      ------------------------------------------------------------
A0A0L6CVX1      ------------------------------------------------------------
A0A1V0RR48      ------------------------------------------------------------
A0A0A0HJJ4      ------------------------------------------------------------
A0A5E7YA28      ------------------------------------------------------------
A0A520JSW4      ------------------------------GAVLEQRGRLIQYNILHRDVDTNRTLYDAL
A0A4Q3LTF3      ------------------------------SSYLDLRRRSIQYNIYQQEVDTNRALYDGL
A0A537UTP9      ------------------------------SVSQTTNQAQIVLRDLESRAQTYRQLHDNF
A0A1D2RNR5      ------------------------------AEIMAAQDRSVDFNLLKREVDTNRELYNGL
A0A4V1TQ46      ------------------------------TQTLSEQERAVQYNILHRELDTNRALYDAL
A0A3A0FZC0      ------------------------------SQAFELSKRQVQFNVLNRELTSSRELLQNV
A0A1N7JVZ7      ------------------------------TSPEAERIAVEAEPSPHVGGEESSDIENLF
A0A091C4A8      ------------------------------DEVLDLRNRSIEYNILRREVDTNRQQYDAL
A0A4R3H6P6      ------------------------------GGLTDLRRRSIQYNIYQREADTNRELYNAL
A0A3S1NQ09      ------------------------------GKSSVDNQTQVKLRELDQQATALTTLYQTF
A0A443GJ52      ------------------------------GKSSIDNQSQVKLRELEQKATALSTLYQTF
A0A2W6S588      ------------------------------SKLAGAVNASVQLAELQRRADNAHTLYTNL
A0A483E0N4      ---------------------------------------------LSRDVESGRAVYMQL
A0A2J4YQQ6      ---------------------------------------------LSRDVESGRAVYMQL
A0A483THX4      ---------------------------------------------LSRDVESGRAVYMQL
A0A534MVS2      ------------------------------RIASDTNLSQMPWYPQELSVLNELRRLSTF
A0A444I5K6      ------------------------------GVAATAGETQVELRELERTRDTYKNLYQSF
A0A154VE85      ------------------------------VLVDDRNDALLSLRALEGDLRSRTQLYEVM
A0A3S1MCW7      ------------------------------MQQDIFNDKNIKYTILKREVDSNRSQYDSL
A0A434IGN6      ------------------------------KQQVIFNDKNIKYTILKREVDSNRSQYDNL
A0A528AX40      ------------------------------KQQVIFNDKNIQYTILKREVDSNRSQYDNL
A0A528MV95      ------------------------------TQQVIFNDKNIKYTILKREVDSNRSQYDNL
A0A3C1S9Y1      ------------------------------GESLNMNKKAIQYGVLYRQAESSKHMYELL
A0A353EH49      ------------------------------------------ILRLKRDVEMNTILYSKL
A0A1Y1Q9C1      ------------------------------GELVDLRDRSIEYNALKREVETSRNLYDGL
A0A3M7LJH0      ---------------------------------------------MTRDVQVNQQIYIQL
A0A316KRG4      ------------------------------------------------------------
A0A1E4JHX8      ------------------------------SSFLDLRRRSIQYNIYQREADTNRQLYDAL
M2U8P2          ------------------------------SELLEGNNASVRLAELERNAEAARALYESF
A0A1H7KZF8      ------------------------------TSRLSEQDNNVALAILQREADTNRNQYDAL
A0A0J5Q9T7      ------------------------------ETQASERLKREATERAEAERVTRDEAVRVK
A0A257NG76      ---------------------------------------------LARDVKVNTELYTAL
A0A1T4TW59      ------------------------------GDYQNITGKRAQYDALKRDVDSNRQLYEMF
A0A1I5YYQ0      ------------------------------MRADEPKDGPATAPAMAPPAERTATPVTPS
A0A5P9FE62      ------------------------------TRADELNDGPATAPAMAPPAERTATPVTRS
A0A1Q3MB35      ------------------------------RRMLDERRDSIQYAIYQREVDTTRELYQGL
A0A259LUN7      ------------------------------SQLRGNNINLVRLRELERDAETSRVMLEEF
A0A2D7AVL1      ------------------------------TKLIELRTQSVXYGILERQVETNRSQYDAL
A0A3B9KZE9      ------------------------------TKLIELRTQSVQYGILERQVETNRSQYDAL
A0A2U0NMP8      ---------------------------------------------LSRDVESGRAVYMQL
A0A4U9HNE9      ---------------------------------------------LTRDVQVDQQVYMQL
A0A2G2CXY6      ---------------------------------------------LKRDVAVTTEIYTAL
A0A3M1D4H3      ------------------------------EQFSTYPDKMRHMSQLELAAEAAENVYKSL
A0A5C8BYM7      ------------------------------RQIVQGQDQSVDYNLLKREVDTNRELYNGL
A0A1J5ICP0      ------------------------------KRINALPAAEKRLAELTRGAEVQQSAYSSL
A0A0M3GBT1      ------------------------------EKRARDALVQTELTRLQRISDKEQTALEKL
B3Q577          ------------------------------EKRARDALVQTELTRLQRISDKEQTALEKL
A0A379B9V4      ---------------------------------------------FTRDLEVNQHIYIQL
A0A0Q6TS97      ------------------------------DGLADLRRRSIQYNIYQRDADTNRELYNAL
A0A0Q6UYB4      ------------------------------DGLADLRRRSIQYNIYQRDADTNRELYNAL
A0A484XS37      ---------------------------------------------LTRDVQAAQEIYMQL
W7Q5J0          ---------------------------------------------LTRDVEVTQAIYVNV
A0A654AKT6      ------------------------------GNHAFFGSTTFAHRLGGYPFLLDARLEDLL
A0A0G9MZA5      ------------------------------ANYTDQRQDSVEYNILQREVDTNREIYAGL
H0T8B0          ------------------------------QQSAATRQLQAKLRELESTAKVYQSNYATF
A0A5C7N981      ------------------------------QTVLGSQDNNFQYNLFKREVDTNRELYDSL
A0A534TV22      ------------------------------KAALDLKEIGVAYAVYEEEVKVNRALYEGV
A0A351CXR4      ---------------------------------------------LEKDVENARTLHDMF
A0A2N6GLF5      ------------------------------GEMQQINRKSQELRVLEREVEANRQLYSQF
A0A1W9LJP0      ------------------------------TESLDMNKKAIRYGVLQRDAESSRNMYELL
A0A0W1ICB0      ------------------------------GRLDTENRSSIQYNIYQREVDTNRELYDGL
A0A2E0UL88      ------------------------------KKFEDIPEQSIEFARLERERLSNEKLFMIL
A0A233IKJ2      ------------------------------SEFQSLSVKNARYSELKREVQTNRELFDLF
A0A2T1JE00      ------------------------------SEFQSLSVKNARYSELKREVQTNRELFDLF
A0A0T2QIS1      ------------------------------AQLNTQQRASIQYNIYQREADTNRQLYDSL
A0A376KYN0      ---------------------------------------------LSRDVEAGRAVYLQL
A0A2X1JB05      ---------------------------------------------LSRDVEAGRAVYLQL
A0A376RML0      ---------------------------------------------LSRDVEAGRAVYLQL
A0A377E5P7      ---------------------------------------------LSRDVEAGRAVYLQL
A0A0P7Y1D0      ------------------------------DELVTNNRALVQLRELEREAEASRTLFESF
A0A2M7JRZ7      ------------------------------AKVMEMKEQGIQYNILKREADTNKELYKGL
A0A167IR75      ------------------------------DEYLDVRRRSIQYNIYQQEVDTNRALYDGL
A0A3B8T2U6      ------------------------------QNYRKLSNLENQHLALQREVEINNQLYSSF
A0A365PWR2      ---------------------------------------------LSRDVKVNNEIYLLM
A0A2E9H5Z8      ------------------------------FDAVDKALQSQDYVEAKQDYETAKAMLSQM
A0A2E2BR79      ---------------------------------------------LTRDVEVTQAIYVNL
A0A0Q4Q524      ------------------------------SSYLDLRRRSIQYNIYQQEVDTNRALYEGL
A0A0Q4CFJ9      ------------------------------SSYLDLRRRSIQYNIFQQEVDTNRALYEGL
A0A0Q4FE58      ------------------------------GSYLDLRRRSIQYNIFQQEVDTNRALYEGL
A0A0Q4JWC8      ------------------------------GSYLDLRRRSIQYNIFQQEVDTNRALYEGL
A0A0Q4KFL8      ------------------------------GSYLDLRRRSIQYNIFQQEVDTNRALYEGL
A0A522R8R0      ------------------------------GQNTKNSQAMVHLRELEQKADALSSLYQAF
A0A2U9NDY5      ---------------------------------------------RKRDMEVTTQTYTLL
A0A0Q4IGG1      ------------------------------SSYLDNRRRSIQYNIYQQEVDTNRALYDGL
X7F6S5          ------------------------------RAAEAERPLLLRAAEPAREP----------
A0A1G8NKI0      ------------------------------AEARAAREAENARAQVEADA----------
A0A355QPE4      ------------------------------AEARAAREAENARAQVEADA----------
A0A357RN98      ------------------------------AEARAAREAENARAQVEADA----------
A0A6B2MSQ7      ------------------------------APAAAAAAEQLAPAQPVPPA----------
A0A6B2P8H8      ------------------------------APAAAAAAEQLAPAQPVPPA----------
A0A1I6U4V1      ------------------------------AAVAAPVNASAAPAHPAPET----------
A0A1G7CFZ2      ------------------------------RQTGAEHRVETGRVSTEPARPEARRG----
A0A1P8USW9      ------------------------------RAAEKARQEDETRRAAIAERREERRKARED
A0A534RUJ5      ------------------------------AITLSLKDDSVQYAILDREADTNRQLYDSV
A0A3M1CJM3      ------------------------------AEAQELNKKEIEYNRLKRVADNYAALYQHI
A0A2R7SVD4      ---------------------------------------------LTRDVEVASQIYTQL
A0A3C0PWB6      ---------------------------------------------LKRDMEVTTQTYTLL
V4Q8B7          ---------------------------------------------LQRDMEVTTQTYTLL
A0A0Q8XKK5      ------------------------------LQLGKQSRDSIQYNIYQREADTNRQLYDGL
A0A2E0Q2W0      ------------------------------AEYLAQQNQGVQYGILDREVNTNRQLYDAL
A0A660NIR6      ------------------------------GNIQEINRKEGKLNVLQREVATNQQIYQTF
A0A142W0R3      ------------------------------GKYRDQQRRSIEYAILQREVDTNRQLYDGL
A0A0S4XR18      ------------------------------SSELGLMN-------LSRNFEVNQKMYSYL
A0A2E0GW64      ---------------------------------------------LMREVKVKETLYSNL
A0A1A7QJ97      ------------------------------DEYLDLRRRSIQYNIFEQEVDTNQALYDGL
A0A6I4IKZ3      ---------------------------------------------LYREVEVKTQLYTAL
A0A661LW70      ------------------------------KETLELNQKAIQYGVLRREAESARYMYELL
W7Q8F9          ---------------------------------------------LTRDVEVTQAIYINV
A0A524PXH8      ------------------------------AIVSAYEEKAIDFKIMRREVDTNRDIYESL
A0A4Q3P0E4      ---------------------------------------------MQRDVTVNTGLYQSL
A0A3M2BE89      ---------------------------------------------LMRDVKVQTELYTLL
A0A4Q4A6K6      ------------------------------SRSRGSNSAELTMRELETSAKSYRSLYESF
A0A257G674      ------------------------------GSSLEEQDRLVQYNLLAREADTSRTVYEGL
A0A661M5M6      ------------------------------SAGLNLNLREIEYRRLNHDRDSKAKLYEIV
A0A1I1UM01      ------------------------------------------------------------
Q44573          ------------------------------QKAGGQSAPQAEYRTLDQEAQSARAVYETF
A2W025          ---------------------------------------------LQRDAKVAEDIYVLL
A0A534Z362      ------------------------------ATAVELRDLGARYQLLKNDVETGHALHASL
V4J283          ---------------------------------------------LSRDVEVNSSLYSRL
A0A536T443      ------------------------------GDLRGAPPVALEEVRLSRDQANATELFSNL
A0A0Q4UFQ5      ------------------------------GRVLDFRRRSIQYNILQREVDTNRQLYDAL
A0A527W7E6      ------------------------------GKSSIDNQSQVKLKELEQQAQALTTLYQTF
A0A432EMV7      ------------------------------SEMRAFSGKSSDLTELEREVQANKDLYDAF
A0A087LTV7      ---------------------------------------------ERQALASAQSHYRML
A0A534WLI3      ------------------------------RTAVALRELGSRYDLLKSDADSARALRESL
A0A318KWA2      ---------------------------------------------RTRDVEVTQAIYVNV
A0A522MT86      ---------------------------------------------LTRDAKVAEQVYLGM
A0A4Q3I221      ------------------------------GISATASETQVQLRELEREADTYKNMYQTF
A0A534SAL6      ------------------------------EVAIDLHALGARYDLLKNDVDTAHALHDSL
A0A534ZDB4      ------------------------------EVAIDLHALGARYDLLKNDVDSAHALHDSL
A0A534X3M7      ------------------------------ATAIQLRDLGARYQLLKNNVEGAHALHASL
A0A534SPC6      ------------------------------ATAVELRDLGARYQLLKNDVETGHALHASL
A0A535AD60      ------------------------------ATAVELRDLGARYQLLKSDEENAYALHASL
A0A4Q3SY08      ------------------------------GTLTD-------------------------
A0A4Q3LG23      ------------------------------LDLRR-------------------------
A0A522EX52      ------------------------------------------------------------
A0A1H3KC95      ------------------------------AIAAPPQEERPEYPPRASPTPGERPSAAGA
A0A5P8Z4P3      ------------------------------PAQAA----------QPPEHKEDVPSQDTD
A0A2E9HXF7      ------------------------------------------------------------
A0A0B3RZC9      ------------------------------------------------------------
A0A6F8QET1      ------------------------------------------------------------
A0A520HUH4      ------------------------------LDQQIRLEQTRIIEGLRSEARSASAKATDL
A0A2K8U7M6      ------------------------------AQLRDLQVFGGGYRVLEREVADHQERHDAL
A0A5B9DKL8      ------------------------------AAAPR------------------SNLALAL
A0A238KJM1      ------------------------------------------------------------
A0A3A0FJZ4      ------------------------------TRRHP---SVKQLRAELARRRAQLVAPAAT
W4HJV8          ------------------------------TAETSGHTPTSATETNIPHATPDAPAETSE
A0A0P1GDI0      ------------------------------EARRAAHQADIDLARESERVRREKAERLAA
A0A2R8ATV5      ------------------------------EAKAA----------EQTRQSQVARARTLK
A0A1U7D3R6      ------------------------------------------------------------
A0A2D4UVV2      ------------------------------------------------------------
A0A0W7WHP4      ------------------------------SAAAV----------EALRRAEA-------
A0A238J8F6      ------------------------------QRAEA----------EKRAQEREAARKAEE
A0A238JQI6      ------------------------------EARQA----------EERRKAEDAARKAQE
A0A222E077      ------------------------------------------------------------
A0A239E3Y2      ------------------------------DAEMA----------KAKRLADEHQRAAEA
A0A1V6FYJ1      ------------------------------------------------------------
A0A445MZQ4      ------------------------------------------------------------
A0A0M9E0E3      ------------------------------------------------------------
A0A0Q6QV61      -----------------------------------------------------MRSREEE
A0A2Z3IKG4      ------------------------------------------------DNGMPPLPPSQA
A0A2W4RFS2      --------------------------------------------------MSQETDQQPL
A0A1Y6DC43      --------------------------------------------------MHEITRIQPL
A0A2S6HE06      --------------------------------------------------MIRNTDKYPL
G3J0M3          --------------------------------------------------MIKNTDKYPL
V5C6R5          --------------------------------------------------MVDSSESDSL
A0A354EF47      -----------------------------------------LLTSDNEDAVSVSVTAEPI
A0A2G6MSP7      -------------------------------------------FIAEFFDNTIKNPDEMA
A0A4U8YMP3      ------------------------------------------------STAEAPVPEVPE
A0A1Q8QQ99      --------------------------------------------------------PPLR
A0A3D5ZY44      --------------------------------------------------------LGVA
A0A646J2A6      ------------------------------------------------------------
A0A1G5C236      ------------------------------------------------STPDKVKNEVPA
A0A432HIS7      --------------------------------------------------IDRAHLEAVE
A0A1I3XJ27      --------------------------------------------------ERSIPSVHSV
A0A1I7DCG1      -----------------------------------------------D--QTATTVARMG
A0A3A3H6D9      -----------------------------------------------D--QTTTTVARMG
A0A562CGU2      -----------------------------------------------EVLPPPLHAHQIE
A0A0Q6VA36      --------------------------------------------------RMPVSRSQEL
A0A1B2EQN1      --------------------------------------------------SRASSFPPD-
A0A1E7HSL6      -------------------------------------------------------KKSET
A0A4Q3ZDI7      ---------------------------------------GHQVSETLGLEFLGSVPLVTS
A0A537PRC6      ---------------------------------------RELVSPIIIAEACGEVSRSYP
A0A2M7JX59      --------------------------------------------KPSLKVFEEKTVLKKE
A0A3A4XVN3      ----------------------------------------KTEPAVQKKNFRYDSSIKQW
A0A1E7JEV6      ----------------------------------------NLSENL------PEREEAGW
A0A2N2KDY5      ----------------------------------------NASKNFMPLIMPADKEKIGW
A0A3N5YUD9      ----------------------------------------SGPPEVQTAVSDSPQRPAEW
A0A0W1DLQ3      ------------------------------------------------------------
A0A246JVD8      ------------------------------------------------------------
A0A2N3BB54      ------------------------------------------------------------
A0A1H6G7A3      ------------------------------------------------------------
A0A0A7PGL6      ------------------------------------------------------------
A0A4Q2Z4L0      ------------------------------------------------------------
A0A5C4N0H6      ---------------------------------------------------PQPQHAIDT
A0A4R1HDF2      -----------------------------------------------------DSKPEMT
A0A1E7HFN0      -----------------------------------------EGHRIPVEQAASEMPGLAE
A0A1M5GH86      ------------------------------------------------------------
A0A1W1XQZ5      ------------------------------------------------------------
A0A3D6C3I2      ---------------------------------------------------------MD-
S0G1D4          -----------------------------------------HTVKTGEIPANDRQILPK-
A0A661T246      ------------------------------VNMPVTSNKDMNATDVSYKRVEKVAKLKKQ
A0A2G6CSG7      -----------------------------------------PAPALRKPAASTVEVIPPA
A0A2G6NB59      -----------------------------------------PAPALRKPAASTVEVIPPA
A0A5K8A7T9      -----------------------------------------ERVHPAREPGNEIKIVAP-
A0A1W9U045      -----------------------------------------ASRFKVYDRKVMEKEASG-
A0A1F9L9G4      -----------------------------------------ENPFSGDDQRQMDTIKES-
A0A328FD76      -----------------------------------------DDTAMVSDDSDTQVSELS-
A0A348UX90      -----------------------------------------DNTALVCDDPDNQVYKQS-
A0A357Z0N5      -----------------------------------------DNTALVCDNPDSQVYKQS-
A0A0F2R2U0      -----------------------------------------RTDIVNGKGADRIVPISN-
A0A5K7ZK00      -----------------------------------------QPHPARQANSEIEIKVVP-
A0A5K7YCX8      -----------------------------------------RSTPVDDQAGGNSIKVIT-
A0A5K7Z388      -----------------------------------------DSEPAEAQAVKKEAKVMK-
A0A352B502      -----------------------------------------------AGGVPQRSSVREA
A0A2K8WHP8      ---------------------------------------------PAPAPAPRPEARRPQ
A0A410V446      -----------------------------------------------QPHSVGPQ-----
A0A0R3KGJ5      -----------------------------------------------TLSGPPLAADGSL
A0A0R3N604      -----------------------------------------------ALSGSALAAEGPL
A0A1B1UCM8      -----------------------------------------------VLSGSALAANGPL
A0A1N6JQ20      -----------------------------------------------ERAPGLSAGVRP-
A0A1M5TI07      -------------------------------------------------AVSVPDPARP-
A3X191          -----------------------------------------------ASGLADLAGMTR-
A0A1H4RKV5      -----------------------------------------------TGLAGAFGISRQ-
A0A160UA87      -------------------------------------------------FIGGSKPIAT-
A0A1Q5SFV5      -------------------------------------------------LIGGSKPIAR-
A0A1J5N774      -----------------------------------------RQDRAIPTGPHGGESANDL
A0A2C8F781      --------------------------------------------RTETFDPPSEEAINR-
A0A2E3R6G0      --------------------------------------------RTETFDPPSEEAINR-
A0A1F8XMK2      -----------------------------------------KERAPLDPKHSPVVPEYDD
A0A3M8EMP2      -----------------------------------------PGTESSASAPLKVDLASRP
A0A2J6J6K6      --------------------------------------------QGEVHPPLPVAPVLGT
A0A661PSB9      -----------------------------------------VDVPDKKVSPGSSINSKGL
A0A661QBT6      -----------------------------------------VDVPDKKVSPGSSNNSKGL
A0A1G6EKK9      -----------------------------------------QVGYVSAARLKPTPPQTSP
A0A6I2SLK2      ------------------------------------------SPRQQTTSMVKTIESAIE
A0A0A8WSG4      --------------------------------------------MPDVQPEPVEFPPSTS
S7TK97          -----------------------------------------RPSQAKSVAASKCCPMPET
S7UE93          -----------------------------------------LERSGRHGRKVGRSPLVEP
A0A3D5BR56      -----------------------------------------GGKKKKRAKGSDRHPLKHG
A0A2N2IB15      -----------------------------------------GNMAA--GPGIVRVPMGES
A0A1I3PSR2      -----------------------------------------GNRAE--VSGIARAPMGEP
A0A1I4GEK4      -----------------------------------------GNRAG--VSGIARAPMGEP
A0A2T5R3J5      -----------------------------------------RAPEKRE------------
A0A1W7QPT7      -----------------------------------------SARQPMESPVLPPLPPRVP
A0A0M4D373      -----------------------------------------KASLRREYQERPPVPLEAG
A0A1L3GKM9      -----------------------------------------ISPVKVT-----PLPAAAS
A0A430DNP0      -----------------------------------------AVLVREQFDDAVRAPDEVE
A0A3A0FQ32      -----------------------------------------APAAQPIARAPGGAPAGRL
A0A1E4UZA0      -------------------------------------------IAKPQASSAVAQPLAEL
A0A1H9KL56      -------------------------------------------IAKPQASSAVAQPLAEL
A0A1A9KEF8      -------------------------------------------AVSPAVRP------DVP
A0A5E6PKN5      -------------------------------------------MTP-TGQP-------GL
A0A0N9W1V6      -------------------------------------------MTV-TGQS------AGL
A0A423GQ41      -------------------------------------------MTV-TGQS------ASL
A0A423H7J2      -------------------------------------------MTV-TGQS------ASL
A0A502HNM8      -------------------------------------------VTTSNGDS------ATL
A0A4Q7H223      -------------------------------------------VTTSTGHS------ATL
A0A1H4N2K9      -------------------------------------------VTTSTGQS------ATL
A0A2K4KWF7      -------------------------------------------VTTSTGHS------ATL
A0A3E0WXH2      -----------------------------------------SPGAFVAAESKASADTGDV
A0A2N2TRC8      -----------------------------------------ESNQVSETAAAPEVPHLSP
A0A1V4CIZ7      ----------------------------------------------------------DL
A0A1M3BXA5      -----------------------------------------AATAPAAVAQQADALASGV
A0A1Y2R3U6      -----------------------------------------------ASEVVQESLPGTD
A0A167HVD6      -----------------------------------------------PSTAGRKAESGDL
A0A1V3SCT6      -----------------------------------------TPAGESSSAIRREASPGDA
L0H287          -----------------------------------------DHQQSTRGGADAPNDPAGA
A0A495VG93      -----------------------------------------EHAERHRDSPPQTSAKPVA
A0A4R3MYM4      -----------------------------------------DTAGKVRAIRAQTPKPLVD
G2E3C0          -----------------------------------------KAGGSRFAHRTQPRPPASD
A0A4U8YLL7      ------------------------------------------------------------
A0A3N5RNY4      ---------------------------------------AAVVL-----PDRPRSKIPDH
A0A1V4M8I1      ---------------------------------VPIRHDRGVKP-----VYQDRILSGTD
A0A4Z0M4C7      ------------------------------------------------------------
A0A5Q2QDL1      ------------------------------TAPVVAPAPAPIVE-----GAR----DRAQ
A0A1I0R9R6      ------------------------------ASMPEA------------------------
A0A443K010      ------------------------------APVVTLAEQVGA------------------
A0A6I7NYG5      ------------------------------PARAVEARATASGF-----DL---------
A0A238IZI1      ------------------------------RAKSRRIAESEAKD-----SV---------
A0A316GHM6      ------------------------------RNRARRAAKDGAIG-----ER---------
A0A520ZTR8      ------------------------------RNRSRRMAQAEAVD-----DA---------
A0A212AR83      ------------------------------QGAQAYADADGTEA-----A----------
A0A2E2P4I0      ------------------------------TAAQAVARQAVPPA-----G--------DV
A0A2U2CM86      ------------------------------GSKPSAVEPAKPEP-----PREKQATPVEM
A0A1X7ACC1      ------------------------------QPIPIQKDEV--------------------
A0A2N3BVE7      ------------------------------PGAAAAVVAAVPDQ-----F----------
A0A2S5JE21      ------------------------------DKSRPESRADA-------------------
A0A2R8BKZ2   &nbs