BYKdb

Dataset for cluster orphancd of phylum proteobacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

932 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


E1Y9C0          ------------------------------------------------------------
A0A1N6SH58      ------------------------------------------------------------
A0A4Q3AQN2      ------------------------------------------------------------
A0A1W9HS52      ------------------------------------------------------------
A0A2D5LFD8      ------------------------------------------------------------
A0A4D8PLT4      ---------------------------------------------------------MII
A0A7J5VV32      ------------------------------------------------------------
A0A6G6X2Z4      ------------------------------------------------------------
Q44570          ------------------------------------------------------------
A0A3N5MZ53      ------------------------------------------------------------
A0A534E4H4      ------------------------------------------------------------
A0A534I2B6      ------------------------------------------------------------
A0A1C2JGD0      ------------------------------------------------------------
A0A259LQ70      ------------------------------------------------------------
A0A4V2SPR5      ------------------------------------------------------------
A0A3N5PM86      ------------------------------------------------------------
A0A2E5YSA4      ------------------------------------------------------------
A0A0N0XAV4      ------------------------------------------------------------
A0A0P9QD19      ------------------------------------------------------------
F3FHG4          ------------------------------------------------------------
F3GGI0          ------------------------------------------------------------
A0A0P9LE74      ------------------------------------------------------------
A0A3M4ZQ14      MCAAAAPCRTPGQPRAAAPGRADPGDGTAAHARPAQVRARSTWQNFLDWPVARPARSRCS
A0A3M5YLE8      MCAAAAPCRTPGQPRAAAPGRADPGDGTAAHARPAQVRARSTWQNFLDWPVARPARSRCS
A0A3M3RP89      MCAAAAPCRTPGQPRAAAPGRADPGDGTAAHARPAQVRARSTWQNFLDWPVARPARSRCS
A0A0P9QIY7      MCAAAAPCRTPGQPRAAAPGRADPGDGTAAHARPAQVRARSTWQNFLDWPVARPARSRCS
A0A0P9VVH7      MCAAAAPCRTPGQPRAAAPGRADPGDGTAAHARPAQVRARSTWQNFLDWPVARPARSRCS
A0A0Q0FJK6      MCAAAAPCRTPGQPRAAAPGRADPGDGTAAHARPAQVRARSTWQNFLDWPVARPARSRCS
A0A0Q0G2J0      MCAAAAPCRTPGQPRAAAPGRADPGDGTAAHARPAQVRARSTWQNFLDWPVARPARSRCS
A0A3M3LF66      MCAAAAPCRTPGQPRAAAPGRADPGDGTAAHARPAQVRARSTWQNFLDWPVARPARSRCS
A0A0P9WIR8      MCAAAAPCRTPGQPRAAAPGRADPGDGTAAHARPAQVRARSTWQNFLDWPVARPARSRCS
A0A3M3KPE5      ------------------------------------------------------------
A0A3M4C263      ------------------------------------------------------------
A0A3M5AD05      ------------------------------------------------------------
A0A0Q0D3D2      ------------------------------------------------------------
A0A0N0FS39      ------------------------------------------------------------
A0A3M6GHH2      ------------------------------------------------------------
A0A0P9R9W0      ------------------------------------------------------------
A0A0Q0B9T0      ------------------------------------------------------------
A0A3M6CFI7      ------------------------------------------------------------
A0A0P9JXN0      ------------------------------------------------------------
A0A3M6FIV7      ------------------------------------------------------------
A0A3M3PLW9      ------------------------------------------------------------
A0A3M4ENY1      ------------------------------------------------------------
A0A3M5EZK7      ------------------------------------------------------------
A0A0P9SPP5      ------------------------------------------------------------
A0A658KL17      ------------------------------------------------------------
A0A3M3NNF2      ------------------------------------------------------------
A0A3M4A0E8      ------------------------------------------------------------
A0A3M4PBZ2      ------------------------------------------------------------
A0A3M6AI26      ------------------------------------------------------------
A0A0P9IWP8      ------------------------------------------------------------
A0A0P9KZ49      ------------------------------------------------------------
A0A0P9V840      ------------------------------------------------------------
A0A0Q0AIE5      ------------------------------------------------------------
A0A3M2ZQH6      ------------------------------------------------------------
A0A0N8SQG2      ------------------------------------------------------------
A0A0W8HFU1      ------------------------------------------------------------
A0A3M5M873      ------------------------------------------------------------
A0A0P9VHH8      ------------------------------------------------------------
A0A0P9YV98      ------------------------------------------------------------
A0A3M3G2W8      ------------------------------------------------------------
A0A3M6C224      ------------------------------------------------------------
A0A3M5K254      ------------------------------------------------------------
A0A3M5JFB0      ------------------------------------------------------------
A0A3M3TQV3      ------------------------------------------------------------
A0A3M3EF92      ------------------------------------------------------------
A0A3M5J1E2      ------------------------------------------------------------
A0A3M5G7H9      ------------------------------------------------------------
A0A3M4A376      ------------------------------------------------------------
A0A0Q0A5T8      ------------------------------------------------------------
A0A0P9SCD7      ------------------------------------------------------------
A0A0P9T4G3      ------------------------------------------------------------
A0A0P9VKB0      ------------------------------------------------------------
A0A0Q0BM35      ------------------------------------------------------------
A0A3M3TPR7      ------------------------------------------------------------
A0A3M3U4Q3      ------------------------------------------------------------
A0A0P9UCX7      ------------------------------------------------------------
A0A0P9S1F1      ------------------------------------------------------------
A0A0P9QCJ2      ------------------------------------------------------------
A0A0P9Q329      ------------------------------------------------------------
A0A3M5GJ64      ------------------------------------------------------------
A0A0P9MPC7      ------------------------------------------------------------
A0A3M2XYQ3      ------------------------------------------------------------
A0A0P9XCE1      ------------------------------------------------------------
A0A3M3EFX7      ------------------------------------------------------------
A0A3M5B9D9      ------------------------------------------------------------
A0A0P9RRZ3      ------------------------------------------------------------
A0A3M2VEK7      ------------------------------------------------------------
A0A0N8R9B3      ------------------------------------------------------------
A0A0P9VA27      ------------------------------------------------------------
A0A3M4YBJ4      ------------------------------------------------------------
A0A0P9J470      ------------------------------------------------------------
A0A0Q0EVJ8      ------------------------------------------------------------
A0A3M5UI30      ------------------------------------------------------------
A0A3M5YQT8      ------------------------------------------------------------
A0A3M5F5X1      ------------------------------------------------------------
A0A3M5R8G1      ------------------------------------------------------------
A0A3M5V012      ------------------------------------------------------------
A0A3M3GA16      ------------------------------------------------------------
A0A3M3UCT3      ----------------------------------------------------MAGPARHH
A0A3M3CJL0      ----------------------------------------------------MAGPARHH
A0A3M3F6F5      ----------------------------------------------------MAGPARHH
A0A3M3P9B7      ----------------------------------------------------MAGPARHH
A0A0N8QB74      ----------------------------------------------------MAGPARHH
A0A0Q0AUD0      ----------------------------------------------------MAGPARHH
A0A3M5VR55      ----------------------------------------------------MAGPARHH
A0A0Q0FK97      ----------------------------------------------------MAGPARHN
A0A3M5KZ75      ------------------------------------------------------------
A0A3M5L3G5      ------------------------------------------------------------
A0A519ERR1      ------------------------------------------------------------
A0A4Q3Q1M2      ------------------------------------------------------------
A0A4Q3MHR1      ------------------------------------------------------------
A0A520GDZ4      ------------------------------------------------------------
A0A318DSU0      ------------------------------------------------------------
A0A538PF21      ------------------------------------------------------------
A0A1W1ZH10      ------------------------------------------------------------
A0A1W2FF24      ------------------------------------------------------------
A0A524JYQ6      ------------------------------------------------------------
A0A4Q3MA17      ------------------------------------------------------------
A0A0N0M5F7      ------------------------------------------------------------
A0A537M754      ------------------------------------------------------------
A0A1V1PDB4      ------------------------------------------------------------
A0A2M7C324      ------------------------------------------------------------
A0A4Q3HHG6      ------------------------------------------------------------
A0A3B7DTA4      ------------------------------------------------------------
A0A432ZK62      ------------------------------------------------------------
A0A1V5EEP4      ------------------------------------------------------------
A0A1V5EF48      ------------------------------------------------------------
A0A0S6X1X6      ------------------------------------------------------------
A0A537Y5L8      ------------------------------------------------------------
A0A4Q3L2X2      ------------------------------------------------------------
A0A4Q3T8J1      ------------------------------------------------------------
A0A4Q4ANM4      ------------------------------------------------------------
A0A4Q3UEC7      ------------------------------------------------------------
A0A1H5YYQ4      ------------------------------------------------------------
A0A1X4NLK2      ------------------------------------------------------------
A0A1X4NWB5      ------------------------------------------------------------
A0A1M5UQ38      ------------------------------------------------------------
A0A327YI48      ------------------------------------------------------------
A0A1B1PNL6      ------------------------------------------------------------
A0A2U8H9H9      ------------------------------------------------------------
A0A6B2NBB8      ------------------------------------------------------------
A0A1X6YIC0      ------------------------------------------------------------
A0A1I5E9E9      ------------------------------------------------------------
A0A1X6Z7N7      ------------------------------------------------------------
A0A2E1DQ13      ------------------------------------------------------------
A0A1H8C800      ------------------------------------------------------------
A0A2N3EZ05      ------------------------------------------------------------
A0A655R819      ------------------------------------------------------------
A0A655RNN3      ------------------------------------------------------------
A0A0R0BVC7      ------------------------------------------------------------
A0A3N5J7U8      ------------------------------------------------------------
A0A1S7S3I8      ------------------------------------------------------------
A0A519E8D7      ------------------------------------------------------------
A0A3S1FD32      ------------------------------------------------------------
A0A434DUT4      ------------------------------------------------------------
A0A528D3U3      ------------------------------------------------------------
A0A3S3UPT3      ------------------------------------------------------------
A0A3S1E286      ------------------------------------------------------------
A0A531AC71      ------------------------------------------------------------
A0A436K268      ------------------------------------------------------------
A0A434IDQ0      ------------------------------------------------------------
A0A435IRM5      ------------------------------------------------------------
A0A3S2C404      ------------------------------------------------------------
A0A435F6C0      ------------------------------------------------------------
A0A435BMN6      ------------------------------------------------------------
A0A529XQ54      ------------------------------------------------------------
A0A530BJC1      ------------------------------------------------------------
A0A348SRI7      ------------------------------------------------------------
A0A354EI73      ------------------------------------------------------------
A0A4P7EP83      ------------------------------------------------------------
A0A6I1QB25      ------------------------------------------------------------
A0A655ZZQ1      ------------------------------------------------------------
A0A1S0ZAI3      ------------------------------------------------------------
A0A3A4NIE9      ------------------------------------------------------------
A0A3A4NUI9      ------------------------------------------------------------
A0A524I3Z6      ------------------------------------------------------------
A0A524PCL7      ------------------------------------------------------------
A0A356GQV1      ------------------------------------------------------------
A0A1J5DAY8      ------------------------------------------------------------
A0A524P237      ------------------------------------------------------------
A0A3C0L0A8      ------------------------------------------------------------
A0A176S762      ------------------------------------------------------------
A0A377ZC40      ------------------------------------------------------------
A0A378BPJ7      ------------------------------------------------------------
A0A2J5PAJ7      ------------------------------------------------------------
A0A377ZDN3      ------------------------------------------------------------
A0A7A9Y5Q1      ------------------------------------------------------------
A0A1G3JY11      ------------------------------------------------------------
A0A661N3U1      ------------------------------------------------------------
A0A1W9WUD9      ------------------------------------------------------------
A0A1W1ZQK0      ------------------------------------------------------------
A0A6I1R304      ------------------------------------------------------------
A0A1W9PMU6      ------------------------------------------------------------
A0A3S1WTQ1      ------------------------------------------------------------
A0A530CUR9      ------------------------------------------------------------
A0A6L6H5T1      ------------------------------------------------------------
A0A6D0ELN7      ------------------------------------------------------------
A0A1M6N1X5      ------------------------------------------------------------
A0A561M3U0      ------------------------------------------------------------
A0A2N6BZD5      ------------------------------------------------------------
A0A1G3VVY5      ------------------------------------------------------------
A0A7C3S273      ------------------------------------------------------------
A0A7C4WJ18      ------------------------------------------------------------
A0A7C3V565      ------------------------------------------------------------
A0A351B422      ------------------------------------------------------------
F2NEE9          ------------------------------------------------------------
A0A2W5J775      ------------------------------------------------------------
A0A352Q5C1      ------------------------------------------------------------
A0A435NNF5      ------------------------------------------------------------
A0A3S2AQS7      ------------------------------------------------------------
A0A436XH86      ------------------------------------------------------------
A0A527ZPD6      ------------------------------------------------------------
A0A529KRW3      ------------------------------------------------------------
A0A530ZLX0      ------------------------------------------------------------
A0A355TB56      ------------------------------------------------------------
A0A1F9E324      ------------------------------------------------------------
A0A432SAI6      ------------------------------------------------------------
A0A4Q3LBH4      ------------------------------------------------------------
A0A4Q3LWP3      ------------------------------------------------------------
A0A7C3JPP4      ------------------------------------------------------------
A0A534V9L7      ------------------------------------------------------------
A0A7C3JJT4      ------------------------------------------------------------
A0A2N6VGL1      ------------------------------------------------------------
A0A3M3H5V6      ------------------------------------------------------------
A0A524M660      ------------------------------------------------------------
A0A7C3JSX5      ------------------------------------------------------------
A0A7I8MQ67      ------------------------------------------------------------
A0A0C1TRU6      ------------------------------------------------------------
A0A2Z5SSF4      ------------------------------------------------------------
A0A2T4ZJZ6      ------------------------------------------------------------
A0A0B8PTA8      ------------------------------------------------------------
A0A0B8QF75      ------------------------------------------------------------
A0A6P2T4F7      ------------------------------------------------------------
A0A4Q4CIB1      ------------------------------------------------------------
A0A522ACJ9      ------------------------------------------------------------
A0A1T2KYM8      ------------------------------------------------------------
A0A3N5Z7F8      ------------------------------------------------------------
A0A239HD34      ------------------------------------------------------------
A0A2G9ZR82      ------------------------------------------------------------
A0A4U9I390      ------------------------------------------------------------
A0A0P7ZZE4      ------------------------------------------------------------
A0A369R0Q9      ------------------------------------------------------------
A0A327LYE6      ------------------------------------------------------------
A0A5A9ZTV3      ------------------------------------------------------------
A0A6J4YZ98      ------------------------------------------------------------
A0A2X3M011      ------------------------------------------------------------
I2WC85          ------------------------------------------------------------
A0A7A9K1G5      ------------------------------------------------------------
A0A7B7KSB7      ------------------------------------------------------------
A0A400JH80      ------------------------------------------------------------
A0A479JNB1      ------------------------------------------------------------
A0A5C9AF52      ------------------------------------------------------------
A0A797FC39      ------------------------------------------------------------
A0A797FHC1      ------------------------------------------------------------
D8EEU7          ------------------------------------------------------------
A0A6D0EYC7      ------------------------------------------------------------
A0A7A6DHB0      ------------------------------------------------------------
A0A2H9EHM4      ------------------------------------------------------------
A0A7A5MLK0      ------------------------------------------------------------
A0A380B3D7      ------------------------------------------------------------
F5NSX0          ------------------------------------------------------------
A0A534XP85      ------------------------------------------------------------
A0A0P1H2H0      ------------------------------------------------------------
A0A258WKV0      ------------------------------------------------------------
A0A377N8F8      ------------------------------------------------------------
A5G4N9          ------------------------------------------------------------
A0A3C2DSE7      ------------------------------------------------------------
A0A2X1JBG5      ------------------------------------------------------------
A0A377LY04      ------------------------------------------------------------
A0A5C9ABR5      ------------------------------------------------------------
A0A5J9WU72      ------------------------------------------------------------
A0A2X3K9R3      ------------------------------------------------------------
A0A3T9EHW9      ------------------------------------------------------------
A0A484X141      ------------------------------------------------------------
A0A5N9VWI6      ------------------------------------------------------------
A0A6D0EJQ0      ------------------------------------------------------------
A0A444R390      ------------------------------------------------------------
A0A376LLF8      ------------------------------------------------------------
A0A6L7CT21      ------------------------------------------------------------
A0A4Q3LR91      ------------------------------------------------------------
A0A6C9IKN8      ------------------------------------------------------------
A0A4V1TR68      ------------------------------------------------------------
A0A444IY46      ------------------------------------------------------------
A0A6I7N627      ------------------------------------------------------------
A0A6L3ZR06      ------------------------------------------------------------
A0A3E0WKI3      ------------------------------------------------------------
A0A1H3I2J1      ------------------------------------------------------------
A0A1V5DJV0      ------------------------------------------------------------
A0A520IUC4      ------------------------------------------------------------
A0A521LJG5      ------------------------------------------------------------
A0A531IBQ7      ------------------------------------------------------------
A0A0P1FWI8      ------------------------------------------------------------
A0A6L8LHC6      ------------------------------------------------------------
A0A1V4WHZ7      ------------------------------------------------------------
A0A1E5AJN5      ------------------------------------------------------------
A0A2N3D2J1      ------------------------------------------------------------
A0A2N2GVE1      ------------------------------------------------------------
A0A2N2INV3      ------------------------------------------------------------
A0A233IKJ2      ------------------------------------------------------------
A0A1Y5DXG5      ------------------------------------------------------------
A0A0B8P2H5      ------------------------------------------------------------
A0A380AQW6      ------------------------------------------------------------
A0A2G2GD62      ------------------------------------------------------------
A0A3R9C3P5      ------------------------------------------------------------
A0A0M3GBT1      ------------------------------------------------------------
B3Q577          ------------------------------------------------------------
A0A483QWI8      ------------------------------------------------------------
A0A483UXD3      ------------------------------------------------------------
A0A0A8J8L3      ------------------------------------------------------------
A0A660DJ38      ------------------------------------------------------------
A0A524P331      ------------------------------------------------------------
A0A4V1SSM5      ------------------------------------------------------------
A0A4Q3K8G7      ------------------------------------------------------------
A0A7C7W7M2      ------------------------------------------------------------
A0A1M7HC79      ------------------------------------------------------------
A0A1D3JZN6      ------------------------------------------------------------
A0A1V6ESG1      ------------------------------------------------------------
A0A1H7YHK3      ------------------------------------------------------------
A0A534SH66      ------------------------------------------------------------
A0A3M0ZZ99      ------------------------------------------------------------
A0A238LBD3      ------------------------------------------------------------
A0A328C2K5      ------------------------------------------------------------
A0A5C6X8M3      ------------------------------------------------------------
A0A3D8MRR7      ------------------------------------------------------------
A0A5C6UBJ7      ------------------------------------------------------------
A0A5C6XGM3      ------------------------------------------------------------
A0A537NZJ1      ------------------------------------------------------------
A0A7C4R3C4      ------------------------------------------------------------
A0A0P1FRV5      ------------------------------------------------------------
A0A4Q4CVW6      ------------------------------------------------------------
A0A090R136      ------------------------------------------------------------
A0A661JU93      ------------------------------------------------------------
A0A2E2T3V8      ------------------------------------------------------------
A0A367UAB4      ------------------------------------------------------------
A0A1F2ZW35      ------------------------------------------------------------
A0A377V641      ------------------------------------------------------------
A0A1F2YJ88      ------------------------------------------------------------
A0A6L3ZWI0      ------------------------------------------------------------
A0A5N8AL61      ------------------------------------------------------------
A0A0J7XGZ1      ------------------------------------------------------------
I4CBA7          ------------------------------------------------------------
A3VE95          ------------------------------------------------------------
A0A1G0NL95      ------------------------------------------------------------
A0A024KA69      ------------------------------------------------------------
A0A0L1KFN4      ------------------------------------------------------------
A0A3P5DSS6      ------------------------------------------------------------
A0A483YEL5      ------------------------------------------------------------
A0A658GUJ0      ------------------------------------------------------------
A0A358L616      ------------------------------------------------------------
A0A1M7BLL7      ------------------------------------------------------------
A0A0H4KZM1      ------------------------------------------------------------
A0A3D5UYX7      ------------------------------------------------------------
A0A2N1WQN5      ------------------------------------------------------------
A0A352G2C2      ------------------------------------------------------------
A0A3C0PZN1      ------------------------------------------------------------
A0A524QFS4      ------------------------------------------------------------
A0A520JSW4      ------------------------------------------------------------
A0A1V1UJT2      ------------------------------------------------------------
A0A0L6CVX1      ------------------------------------------------------------
A0A1V0RR48      ------------------------------------------------------------
A0A0A0HJJ4      ------------------------------------------------------------
A0A5E7YA28      ------------------------------------------------------------
A0A4Q3LTF3      ------------------------------------------------------------
A0A7C3N3Y1      ------------------------------------------------------------
A0A537UTP9      ------------------------------------------------------------
A0A1D2RNR5      ------------------------------------------------------------
A0A4V1TQ46      ------------------------------------------------------------
A0A3A0FZC0      ------------------------------------------------------------
A0A1N7JVZ7      ------------------------------------------------------------
A0A091C4A8      ------------------------------------------------------------
A0A4R3H6P6      ------------------------------------------------------------
A0A3S1NQ09      ------------------------------------------------------------
A0A443GJ52      ------------------------------------------------------------
A0A6N3RE79      ------------------------------------------------------------
A0A6N9S3L5      ------------------------------------------------------------
A0A656BWB0      ------------------------------------------------------------
A0A6D0IFH4      ------------------------------------------------------------
A0A7A3MK38      ------------------------------------------------------------
A0A0A0FHV8      ------------------------------------------------------------
A0A1X3IPU7      ------------------------------------------------------------
A0A0A0G0N2      ------------------------------------------------------------
A0A2I8SDU4      ------------------------------------------------------------
A0A2I8SU55      ------------------------------------------------------------
A0A7I6T806      ------------------------------------------------------------
A0A7I6TQE9      ------------------------------------------------------------
A0A7I6U296      ------------------------------------------------------------
S1EXJ6          ------------------------------------------------------------
A0A376UBS1      ------------------------------------------------------------
A0A2W6S588      ------------------------------------------------------------
A0A483E0N4      ------------------------------------------------------------
A0A2J4YQQ6      ------------------------------------------------------------
A0A483THX4      ------------------------------------------------------------
A0A534MVS2      ------------------------------------------------------------
A0A444I5K6      ------------------------------------------------------------
A0A154VE85      ------------------------------------------------------------
A0A3S1MCW7      ------------------------------------------------------------
A0A434IGN6      ------------------------------------------------------------
A0A528AX40      ------------------------------------------------------------
A0A528MV95      ------------------------------------------------------------
A0A3C1S9Y1      ------------------------------------------------------------
A0A353EH49      ------------------------------------------------------------
A0A1Y1Q9C1      ------------------------------------------------------------
A0A3M7LJH0      ------------------------------------------------------------
A0A316KRG4      ------------------------------------------------------------
A0A1E4JHX8      ------------------------------------------------------------
M2U8P2          ------------------------------------------------------------
A0A1H7KZF8      ------------------------------------------------------------
A0A0J5Q9T7      ------------------------------------------------------------
A0A6N3UC48      ------------------------------------------------------------
A0A257NG76      ------------------------------------------------------------
A0A1T4TW59      ------------------------------------------------------------
A0A1I5YYQ0      ------------------------------------------------------------
A0A5P9FE62      ------------------------------------------------------------
A0A1Q3MB35      ------------------------------------------------------------
A0A259LUN7      ------------------------------------------------------------
A0A2D7AVL1      ------------------------------------------------------------
A0A3B9KZE9      ------------------------------------------------------------
A0A2U0NMP8      ------------------------------------------------------------
A0A4U9HNE9      ------------------------------------------------------------
A0A7C5N053      ------------------------------------------------------------
A0A2G2CXY6      ------------------------------------------------------------
A0A3M1D4H3      ------------------------------------------------------------
A0A7C1A2A2      ------------------------------------------------------------
A0A5C8BYM7      ------------------------------------------------------------
A0A1J5ICP0      ------------------------------------------------------------
A0A379B9V4      ------------------------------------------------------------
A0A0Q6TS97      ------------------------------------------------------------
A0A0Q6UYB4      ------------------------------------------------------------
A0A484XS37      ------------------------------------------------------------
W7Q5J0          ------------------------------------------------------------
A0A654AKT6      ------------------------------------------------------------
A0A7A9JY19      ------------------------------------------------------------
A0A0G9MZA5      ------------------------------------------------------------
H0T8B0          ------------------------------------------------------------
A0A5C7N981      ------------------------------------------------------------
A0A534TV22      ------------------------------------------------------------
A0A351CXR4      ------------------------------------------------------------
A0A2N6GLF5      ------------------------------------------------------------
A0A1W9LJP0      ------------------------------------------------------------
A0A0W1ICB0      ------------------------------------------------------------
A0A7C1C8G2      ------------------------------------------------------------
A0A376KYN0      ------------------------------------------------------------
A0A7A9J338      ------------------------------------------------------------
A0A377E5P7      ------------------------------------------------------------
A0A2X1JB05      ------------------------------------------------------------
A0A376RML0      ------------------------------------------------------------
A0A6N3QTV2      ------------------------------------------------------------
A0A2E0UL88      ------------------------------------------------------------
A0A0T2QIS1      ------------------------------------------------------------
A0A0P7Y1D0      ------------------------------------------------------------
A0A542J310      ------------------------------------------------------------
A0A2M7JRZ7      ------------------------------------------------------------
A0A167IR75      ------------------------------------------------------------
A0A3B8T2U6      ------------------------------------------------------------
A0A365PWR2      ------------------------------------------------------------
A0A2E9H5Z8      ------------------------------------------------------------
A0A2E2BR79      ------------------------------------------------------------
A0A6I4IKZ3      ------------------------------------------------------------
A0A7H4JZ79      ------------------------------------------------------------
A0A0Q4Q524      ------------------------------------------------------------
A0A0Q4CFJ9      ------------------------------------------------------------
A0A0Q4FE58      ------------------------------------------------------------
A0A0Q4JWC8      ------------------------------------------------------------
A0A0Q4KFL8      ------------------------------------------------------------
A0A522R8R0      ------------------------------------------------------------
A0A2U9NDY5      ------------------------------------------------------------
X7F6S5          ------------------------------------------------------------
A0A1G8NKI0      ------------------------------------------------------------
A0A355QPE4      ------------------------------------------------------------
A0A357RN98      ------------------------------------------------------------
A0A1I6U4V1      ------------------------------------------------------------
A0A6B2P8H8      ------------------------------------------------------------
A0A1P8USW9      ------------------------------------------------------------
A0A1G7CFZ2      ------------------------------------------------------------
A0A7G2TPW1      ------------------------------------------------------------
A0A0Q4IGG1      ------------------------------------------------------------
A0A534RUJ5      ------------------------------------------------------------
A0A3M1CJM3      ------------------------------------------------------------
A0A2R7SVD4      ------------------------------------------------------------
A0A3C0PWB6      ------------------------------------------------------------
V4Q8B7          ------------------------------------------------------------
A0A0Q8XKK5      ------------------------------------------------------------
A0A2E0Q2W0      ------------------------------------------------------------
A0A660NIR6      ------------------------------------------------------------
A0A142W0R3      ------------------------------------------------------------
A0A0S4XR18      ------------------------------------------------------------
A0A7C5CFF1      ------------------------------------------------------------
A0A2E0GW64      ------------------------------------------------------------
A0A1A7QJ97      ------------------------------------------------------------
A0A661LW70      ------------------------------------------------------------
W7Q8F9          ------------------------------------------------------------
A0A524PXH8      ------------------------------------------------------------
A0A4Q3P0E4      ------------------------------------------------------------
A0A3M2BE89      ------------------------------------------------------------
A0A4Q4A6K6      ------------------------------------------------------------
A0A257G674      ------------------------------------------------------------
A0A661M5M6      ------------------------------------------------------------
A0A1I1UM01      ------------------------------------------------------------
Q44573          ------------------------------------------------------------
A2W025          ------------------------------------------------------------
A0A534Z362      ------------------------------------------------------------
V4J283          ------------------------------------------------------------
A0A536T443      ------------------------------------------------------------
A0A0Q4UFQ5      ------------------------------------------------------------
A0A527W7E6      ------------------------------------------------------------
A0A432EMV7      ------------------------------------------------------------
A0A7C1SEU7      ------------------------------------------------------------
A0A534WLI3      ------------------------------------------------------------
A0A7C6FBW0      ------------------------------------------------------------
A0A087LTV7      ------------------------------------------------------------
A0A7D7WSS2      ------------------------------------------------------------
A0A318KWA2      ------------------------------------------------------------
A0A522MT86      ------------------------------------------------------------
A0A4Q3I221      ------------------------------------------------------------
A0A534SAL6      ------------------------------------------------------------
A0A534ZDB4      ------------------------------------------------------------
A0A534X3M7      ------------------------------------------------------------
A0A534SPC6      ------------------------------------------------------------
A0A535AD60      ------------------------------------------------------------
A0A4Q3SY08      ------------------------------------------------------------
A0A4Q3LG23      ------------------------------------------------------------
A0A522EX52      ------------------------------------------------------------
A0A1H3KC95      ------------------------------------------------------------
A0A5P8Z4P3      ------------------------------------------------------------
A0A2E9HXF7      ------------------------------------------------------------
A0A0B3RZC9      ------------------------------------------------------------
A0A6F8QET1      ------------------------------------------------------------
A0A520HUH4      ------------------------------------------------------------
A0A2K8U7M6      ------------------------------------------------------------
A0A5B9DKL8      ------------------------------------------------------------
A0A238KJM1      ------------------------------------------------------------
A0A3A0FJZ4      ------------------------------------------------------------
W4HJV8          ------------------------------------------------------------
A0A0P1GDI0      ------------------------------------------------------------
A0A2R8ATV5      ------------------------------------------------------------
A0A1U7D3R6      ------------------------------------------------------------
A0A2D4UVV2      ------------------------------------------------------------
A0A0W7WHP4      ------------------------------------------------------------
A0A238J8F6      ------------------------------------------------------------
A0A238JQI6      ------------------------------------------------------------
A0A222E077      ------------------------------------------------------------
A0A239E3Y2      ------------------------------------------------------------
A0A534QGR3      ------------------------------------------------------------
A0A1F9CFF0      ------------------------------------------------------------
A0A2M8B0G5      ------------------------------------------------------------
A0A363TNU9      ------------------------------------------------------------
A0A0W1GMS6      ------------------------------------------------------------
A0A0Q8RMY3      ------------------------------------------------------------
A0A1A7QC21      ------------------------------------------------------------
A0A2W4RFS2      ------------------------------------------------------------
A0A1Y6DC43      ------------------------------------------------------------
A0A2S6HE06      ------------------------------------------------------------
G3J0M3          ------------------------------------------------------------
V5C6R5          ------------------------------------------------------------
A0A534HBS8      ------------------------------------------------------------
A0A0F0T3Y9      ------------------------------------------------------------
A0A379GWF0      ------------------------------------------------------------
A0A4Q2XLV7      ------------------------------------------------------------
A0A4Q5QYC4      ------------------------------------------------------------
A0A3B8SQ27      ------------------------------------------------------------
A0A0U2VAW2      ------------------------------------------------------------
A0A454CTF1      ------------------------------------------------------------
A0A6B3Q2G1      ------------------------------------------------------------
A0A4Q6G931      ------------------------------------------------------------
A0A2T0VBD8      ------------------------------------------------------------
A0A378APS2      ------------------------------------------------------------
A0A443VCQ6      ------------------------------------------------------------
A0A447RKQ7      ------------------------------------------------------------
W1DSK1          ------------------------------------------------------------
A0A2N1XK22      ------------------------------------------------------------
A0A3D0KAC8      ------------------------------------------------------------
A0A3D2Y902      ------------------------------------------------------------
A0A378G3G7      ------------------------------------------------------------
A0A2X5NHJ9      ------------------------------------------------------------
A0A2J4QEC3      ------------------------------------------------------------
A0A485ADM3      ------------------------------------------------------------
A0A4U9HGU4      ------------------------------------------------------------
A0A3S4JGG5      ------------------------------------------------------------
A0A377ZDH2      ------------------------------------------------------------
A0A3S4HTS8      ------------------------------------------------------------
A0A1W9F5M9      ------------------------------------------------------------
A0A379W6R2      ------------------------------------------------------------
A0A379TA56      ------------------------------------------------------------
A0A655C5P0      ------------------------------------------------------------
A0A6D0I9G1      ------------------------------------------------------------
A0A352MMI7      ------------------------------------------------------------
A0A4Z0LWV1      ------------------------------------------------------------
A0A377K431      ------------------------------------------------------------
A0A376RY66      ------------------------------------------------------------
A0A778GAM7      ------------------------------------------------------------
A0A3C2BN18      ------------------------------------------------------------
A0A447LR75      ------------------------------------------------------------
A0A759KJJ5      ------------------------------------------------------------
A0A376D8L7      ------------------------------------------------------------
A0A1V2FV46      ------------------------------------------------------------
A0A6N8QLT3      ------------------------------------------------------------
A0A376SB61      ------------------------------------------------------------
A0A3D1BYV9      ------------------------------------------------------------
A0A536T0W8      ------------------------------------------------------------
A0A3D2M6Y9      ------------------------------------------------------------
A0A3D2YAZ2      ------------------------------------------------------------
A0A350A102      ------------------------------------------------------------
A0A350L5D2      ------------------------------------------------------------
A0A2G9XLE5      ------------------------------------------------------------
A0A6L3MM74      ------------------------------------------------------------
A0A7C3QM04      ------------------------------------------------------------
A0A7I8MVM0      ------------------------------------------------------------
A0A7C0Y3J7      ------------------------------------------------------------
A0A7C3LF61      ------------------------------------------------------------
A0A4R1HDF2      ------------------------------------------------------------
A0A6N1DL48      ------------------------------------------------------------
A0A1V6FYJ1      ------------------------------------------------------------
A0A0C5VQ86      ------------------------------------------------------------
A0A0Q6QV61      ------------------------------------------------------------
A0A2Z3IKG4      ------------------------------------------------------------
A0A3N5RNY4      ------------------------------------------------------------
A0A4Z0M4C7      ------------------------------------------------------------
A0A5Q2QDL1      ------------------------------------------------------------
A0A1V8MBH1      ------------------------------------------------------------
A0A6J4X8D4      ------------------------------------------------------------
A0A318CT66      ------------------------------------------------------------
A0A3N5P205      ------------------------------------------------------------
A0A443K010      ------------------------------------------------------------
A0A6I7NYG5      ------------------------------------------------------------
A0A212AR83      ------------------------------------------------------------
A0A2E2P4I0      ------------------------------------------------------------
A0A2U2CM86      ------------------------------------------------------------
A0A1I0R9R6      ------------------------------------------------------------
A0A2N3BVE7      ------------------------------------------------------------
A0A7C2IB02      ------------------------------------------------------------
A0A6N6SI00      ------------------------------------------------------------
A0A2S5JE21      ------------------------------------------------------------
A0A2R8BKZ2      ------------------------------------------------------------
A0A2S8S361      ------------------------------------------------------------
A0A520ZTR8      ------------------------------------------------------------
A0A316GHM6      ------------------------------------------------------------
A0A238IZI1      ------------------------------------------------------------
A0A7C9INT8      ------------------------------------------------------------
A0A6M1UAR9      ------------------------------------------------------------
A0A1X7ACC1      ------------------------------------------------------------
A0A238KUF6      ------------------------------------------------------------
A0A095CTW3      ------------------------------------------------------------
A0A2E3UGD6      ------------------------------------------------------------
A0A2T0RFH0      ------------------------------------------------------------
A0A285D390      ------------------------------------------------------------
A0A497VHN4      ------------------------------------------------------------
A0A2N6BEI9      ------------------------------------------------------------
A0A0D5N3E9      ------------------------------------------------------------
A0A2N2G716      ------------------------------------------------------------
A0A7C1UTU6      ------------------------------------------------------------
W9VVY5          ------------------------------------------------------------
A0A1E2URD3      ------------------------------------------------------------
A0A2T6MY81      ------------------------------------------------------------
A0A2T6NBQ8      ------------------------------------------------------------
A0A421K431      ------------------------------------------------------------
A0A2G2I5M1      ------------------------------------------------------------
A0A2G2M6F0      ------------------------------------------------------------
A0A1W9J9F8      ------------------------------------------------------------
A0A2S5LFJ9      ------------------------------------------------------------
A0A2D8R8F8      ------------------------------------------------------------
A0A6I4JXQ8      ------------------------------------------------------------
A0A010SNS0      ------------------------------------------------------------
A0A0C2I782      ------------------------------------------------------------
A0A2N8BYF5      ------------------------------------------------------------
A0A558FKX2      ------------------------------------------------------------
A0A1H1DBA0      ------------------------------------------------------------
J2TAD5          ------------------------------------------------------------
J3H699          ------------------------------------------------------------
A0A1H5J974      ------------------------------------------------------------
A0A0K1QRZ4      ------------------------------------------------------------
A0A560RJW9      ------------------------------------------------------------
A0A5E6TID7      ------------------------------------------------------------
A0A5E7CRU7      ------------------------------------------------------------
A0A5E7C564      ------------------------------------------------------------
A0A2W7MAV4      ------------------------------------------------------------
A0A4R3WQH5      ------------------------------------------------------------
W6VFG3          ------------------------------------------------------------
A0A1P8ENT1      ------------------------------------------------------------
A0A2N7XRV4      ------------------------------------------------------------
A0A0Q6QPG8      ------------------------------------------------------------
A0A0F4SWA7      ------------------------------------------------------------
A0A423J219      ------------------------------------------------------------
A0A4P6G9U8      ------------------------------------------------------------
A0A4Y8JE06      ------------------------------------------------------------
A0A502I1X9      ------------------------------------------------------------
A0A502J776      ------------------------------------------------------------
A0A5B0EZF6      ------------------------------------------------------------
A0A059L434      ------------------------------------------------------------
A0A0F4UWN2      ------------------------------------------------------------
A0A5E7WEF5      ------------------------------------------------------------
A0A1G0KSD0      ------------------------------------------------------------
A0A4P6WX84      ------------------------------------------------------------
A0A1D2S760      ------------------------------------------------------------
A0A5B8RW94      ------------------------------------------------------------
A0A258TN88      ------------------------------------------------------------
A0A1F9EUS2      ------------------------------------------------------------
A0A6H9HII8      ------------------------------------------------------------
A0A3N9VAW3      ------------------------------------------------------------
A0A1X0YE57      ------------------------------------------------------------
A0A2K2H9Q8      ------------------------------------------------------------
A0A6I1KNW9      ------------------------------------------------------------
A0A1H4B8T3      ------------------------------------------------------------
A0A1E7IQC3      ------------------------------------------------------------
A0A1M6KEN5      ------------------------------------------------------------
A0A353QLL3      ------------------------------------------------------------
A0A399I453      ------------------------------------------------------------
A0A651FBV9      ------------------------------------------------------------
A0A5C1MDH8      ------------------------------------------------------------
A0A7J4ZSX4      ------------------------------------------------------------
A0A5A9XE04      ------------------------------------------------------------
A0A643G9R1      ------------------------------------------------------------
A0A1G0M8Q7      ------------------------------------------------------------
A0A353MI14      ------------------------------------------------------------
A0A4S1CAW7      ------------------------------------------------------------
A0A562VHD2      ------------------------------------------------------------
A0A7K0J0R7      ------------------------------------------------------------
A0A6I6JNB5      ------------------------------------------------------------
A0A1G0LDK7      ------------------------------------------------------------
A0A6F9WVL7      ------------------------------------------------------------
A0A351Z9A2      ------------------------------------------------------------
A0A3N5FRH4      ------------------------------------------------------------
A0A1V4Y2C3      ------------------------------------------------------------
A0A2N2KTJ4      ------------------------------------------------------------
A0A2N2LQX0      ------------------------------------------------------------
A0A318D3U4      ------------------------------------------------------------
A0A401FQP5      ------------------------------------------------------------
A0A7C2AA26      ------------------------------------------------------------
A0A351Z4H9      ------------------------------------------------------------
A0A2N2KML4      ------------------------------------------------------------
E1YJF1          ------------------------------------------------------------
A0A1J5EVZ6      ------------------------------------------------------------
A0A2G6FCC5      ------------------------------------------------------------
A0A1F9MR25      ------------------------------------------------------------
A0A2G6M7F1      ------------------------------------------------------------
A0A7C3Q9R6      ------------------------------------------------------------
A0A1Q6DMW3      ------------------------------------------------------------
A0A3A6P8F8      ------------------------------------------------------------
A0A6L4AM84      ------------------------------------------------------------
A0A2G2DSM4      ------------------------------------------------------------
A0A1F9NI02      ------------------------------------------------------------
A0A4U1ABX4      ------------------------------------------------------------
A0A1W9M770      ------------------------------------------------------------
A0A1W9M7R6      ------------------------------------------------------------
A0A1M7Y300      ------------------------------------------------------------
A0A4U1ALN4      ------------------------------------------------------------
A0A1E7H876      ------------------------------------------------------------
A0A7C0U459      ------------------------------------------------------------
A0A0F2NF69      ------------------------------------------------------------
A0A1F9NFD0      ------------------------------------------------------------
A0A1M5YLH5      ------------------------------------------------------------
A0A4U1A4C7      ------------------------------------------------------------
A0A509L3P8      ------------------------------------------------------------
A0A3A4S038      ------------------------------------------------------------
A0A1F9N669      ------------------------------------------------------------
A0A1F9PFA7      ------------------------------------------------------------
A0A1H2EN09      ------------------------------------------------------------
K0NP00          ------------------------------------------------------------
A0A7C4N0I9      ------------------------------------------------------------
A0A1E7JCL5      ------------------------------------------------------------
A0A496YAH9      ------------------------------------------------------------
A0A1V4S7E4      ------------------------------------------------------------
A0A2N2H8D2      ------------------------------------------------------------
A0A2N2KC63      ------------------------------------------------------------
A0A3A4ZYW4      ------------------------------------------------------------
A0A1V4MCJ4      ------------------------------------------------------------
A0A661M0W4      ------------------------------------------------------------
A0A4U8YLL7      ------------------------------------------------------------
A0A445MZQ4      ------------------------------------------------------------
A0A2M7WWF7      ------------------------------------------------------------
A0A0M9E0E3      ------------------------------------------------------------
A0A4Q3IRI1      ------------------------------------------------------------
A0A7C1C6X5      ------------------------------------------------------------
A0A354EF47      ------------------------------------------------------------
A0A2G6MSP7      ------------------------------------------------------------
B7RS54          ------------------------------------------------------------
A0A1I6ENM4      ------------------------------------------------------------
A8LNM8          ------------------------------------------------------------
A0A0T5NSU3      ------------------------------------------------------------
A0A5P9I718      ------------------------------------------------------------
A0A2M8J3R9      ------------------------------------------------------------
A0A1I6X762      ------------------------------------------------------------
A0A0P1EFX8      ------------------------------------------------------------
A0A2G5KB39      ------------------------------------------------------------
A0A2N3CNV1      ------------------------------------------------------------
A0A257F1F4      ------------------------------------------------------------
A0A2D5J8T8      ------------------------------------------------------------
A0A2E3P9W6      ------------------------------------------------------------
A0A2G2B1P9      ------------------------------------------------------------
A0A258GCD5      ------------------------------------------------------------
A0A443INY4      ------------------------------------------------------------
A0A2D9YR88      ------------------------------------------------------------
A0A4Q3ZBK4      ------------------------------------------------------------
A0A1G9FY29      ------------------------------------------------------------
A0A6N9RUN2      ------------------------------------------------------------
A0A1G8QZS5      ------------------------------------------------------------
A0A1H2Y469      ------------------------------------------------------------
A0A497ZQU7      ------------------------------------------------------------
A0A4U8YMP3      ------------------------------------------------------------
A0A1Q8QQ99      ------------------------------------------------------------
A0A7C2SIB2      ------------------------------------------------------------
A0A3D5ZY44      ------------------------------------------------------------
A0A1G5C236      ------------------------------------------------------------
A0A432HIS7      ------------------------------------------------------------
A0A520CSP5      ------------------------------------------------------------
A0A372IH36      ------------------------------------------------------------
A0A540VW45      ------------------------------------------------------------
A0A1H9C241      ------------------------------------------------------------
A0A2E3FCR1      ------------------------------------------------------------
A0A4S3MG69      ------------------------------------------------------------
A0A3E0H727      ------------------------------------------------------------
A0A1I3TTC3      ------------------------------------------------------------
A0A1H3IZW6      ------------------------------------------------------------
A0A0M6YG59      ------------------------------------------------------------
A0A1H7G8B0      ------------------------------------------------------------
A0A7C3Z8T7      ------------------------------------------------------------
A0A1V4QMH7      ------------------------------------------------------------
A0A496XZQ4      ------------------------------------------------------------
A0A7C3UZM2      ------------------------------------------------------------
A0A1F9BJF7      ------------------------------------------------------------
F2NDF5          ------------------------------------------------------------
A0A656PSQ6      ------------------------------------------------------------
A0A4Q3ZDI7      ------------------------------------------------------------
A0A537PRC6      ------------------------------------------------------------
A0A1I3XJ27      ------------------------------------------------------------
A0A562CGU2      ------------------------------------------------------------
A0A7C9VCB3      ------------------------------------------------------------
A0A1I7DCG1      ------------------------------------------------------------
A0A3A3H6D9      ------------------------------------------------------------
A0A0Q6VA36      ------------------------------------------------------------
A0A1B2EQN1      ------------------------------------------------------------
A0A1E7HSL6      ------------------------------------------------------------
A0A2M7JX59      ------------------------------------------------------------
A0A3A4XVN3      ------------------------------------------------------------
A0A1E7JEV6      ------------------------------------------------------------
A0A2N2KDY5      ------------------------------------------------------------
A0A3N5YUD9      ------------------------------------------------------------
A0A0W1DLQ3      ------------------------------------------------------------
A0A246JVD8      ------------------------------------------------------------
A0A2N3BB54      ------------------------------------------------------------
A0A1H6G7A3      ------------------------------------------------------------
A0A0A7PGL6      ------------------------------------------------------------
A0A4Q2Z4L0      ------------------------------------------------------------
A0A5C4N0H6      ------------------------------------------------------------
A0A1V4M8I1      ------------------------------------------------------------
A0A7C0XE92      ------------------------------------------------------------
A0A1E7HFN0      ------------------------------------------------------------
A0A7J0BHG1      ------------------------------------------------------------
A0A1M5GH86      ------------------------------------------------------------
A0A1W1XQZ5      ------------------------------------------------------------
A0A6V8LMJ3      ------------------------------------------------------------
A0A2K8WHP8      ------------------------------------------------------------
A0A1J5N774      ------------------------------------------------------------
A0A2C8F781      ------------------------------------------------------------
A0A2E3R6G0      ------------------------------------------------------------
A0A7J0BUD3      ------------------------------------------------------------
A0A1F8XMK2      ------------------------------------------------------------
A0A3M8EMP2      ------------------------------------------------------------
A0A2J6J6K6      ------------------------------------------------------------
A0A661PSB9      ------------------------------------------------------------
A0A661QBT6      ------------------------------------------------------------
A0A6I2SLK2      ------------------------------------------------------------
A0A0A8WSG4      ------------------------------------------------------------
S7TK97          ------------------------------------------------------------
S7UE93          ------------------------------------------------------------
A0A3D5BR56      ------------------------------------------------------------
A0A2N2IB15      ------------------------------------------------------------
A0A1I3PSR2      ------------------------------------------------------------
A0A1I4GEK4      ------------------------------------------------------------
A0A7C8B5M6      ------------------------------------------------------------
A0A1W7QPT7      ------------------------------------------------------------
A0A6S6M1Y8      ------------------------------------------------------------
A0A6V8MCR2      ------------------------------------------------------------
A0A6V8N3X1      ------------------------------------------------------------
A0A6M4XJ81      ------------------------------------------------------------
A0A0M4D373      ------------------------------------------------------------
A0A1L3GKM9      ------------------------------------------------------------
A0A2T5R3J5      ------------------------------------------------------------
A0A1G6EKK9      ------------------------------------------------------------
A0A7C1DJX8      ------------------------------------------------------------
A0A3D6C3I2      ------------------------------------------------------------
S0G1D4          ------------------------------------------------------------
A0A661T246      ------------------------------------------------------------
A0A2G6CSG7      ------------------------------------------------------------
A0A2G6NB59      ------------------------------------------------------------
A0A5K8A7T9      ------------------------------------------------------------
A0A1W9U045      ------------------------------------------------------------
A0A1F9L9G4      ------------------------------------------------------------
A0A328FD76      ------------------------------------------------------------
A0A348UX90      ------------------------------------------------------------
A0A357Z0N5      ------------------------------------------------------------
A0A0F2R2U0      ------------------------------------------------------------
A0A5K7ZK00      ------------------------------------------------------------
A0A5K7YCX8      ------------------------------------------------------------
A0A5K7Z388      ------------------------------------------------------------
A0A352B502      ------------------------------------------------------------
A0A410V446      ------------------------------------------------------------
A0A0R3KGJ5      ------------------------------------------------------------
A0A0R3N604      ------------------------------------------------------------
A0A1B1UCM8      ------------------------------------------------------------
A0A1N6JQ20      ------------------------------------------------------------
A0A1M5TI07      ------------------------------------------------------------
A3X191          ------------------------------------------------------------
A0A1H4RKV5      ------------------------------------------------------------
A0A160UA87      ------------------------------------------------------------
A0A1Q5SFV5      ------------------------------------------------------------
A0A7C3Y7G3      ------------------------------------------------------------
A0A430DNP0      ------------------------------------------------------------
A0A3A0FQ32      ------------------------------------------------------------
A0A1E4UZA0      ------------------------------------------------------------
A0A1H9KL56      ------------------------------------------------------------
A0A1A9KEF8      ------------------------------------------------------------
A0A5E6PKN5      ------------------------------------------------------------
A0A0N9W1V6      ------------------------------------------------------------
A0A423GQ41      ------------------------------------------------------------
A0A423H7J2      ------------------------------------------------------------
A0A502HNM8      ------------------------------------------------------------
A0A4Q7H223      ------------------------------------------------------------
A0A1H4N2K9      ------------------------------------------------------------
A0A2K4KWF7      ------------------------------------------------------------
A0A3E0WXH2      ------------------------------------------------------------
A0A2N2TRC8      ------------------------------------------------------------
A0A1V4CIZ7      ------------------------------------------------------------
A0A1M3BXA5      ------------------------------------------------------------
A0A1Y2R3U6      ------------------------------------------------------------
A0A167HVD6      ------------------------------------------------------------
A0A1V3SCT6      ------------------------------------------------------------
L0H287          ------------------------------------------------------------
A0A495VG93      ------------------------------------------------------------
A0A4R3MYM4      ------------------------------------------------------------
G2E3C0          ------------------------------------------------------------
                                                                            

E1Y9C0          ------------------------------------------------------------
A0A1N6SH58      ------------------------------------------------------------
A0A4Q3AQN2      ------------------------------------------------------------
A0A1W9HS52      ------------------------------------------------------------
A0A2D5LFD8      -----------------------------------------------------------M
A0A4D8PLT4      YDGRRRKHRDGWAFFFQLLRGAIHGTRSLSDNGRSSGTSRPIRPWSLKDSRILGYLQRKQ
A0A7J5VV32      ------------------------------------------------------------
A0A6G6X2Z4      ------------------------------------------------------------
Q44570          ------------------------------------------------------------
A0A3N5MZ53      ------------------------------------------------------------
A0A534E4H4      ------------------------------------------------------------
A0A534I2B6      ------------------------------------------------------------
A0A1C2JGD0      ------------------------------------------------------------
A0A259LQ70      ------------------------------------------------------------
A0A4V2SPR5      ------------------------------------------------------------
A0A3N5PM86      ------------------------------------------------------------
A0A2E5YSA4      ------------------------------------------------------------
A0A0N0XAV4      ------------------------------------------------------------
A0A0P9QD19      ------------------------------------------------------------
F3FHG4          ------------------------------------------------------------
F3GGI0          ------------------------------------------------------------
A0A0P9LE74      ------------------------------------------------------------
A0A3M4ZQ14      RPLSATPFSLRTDLCAALAVHRRLASSFSVRRDTINDRHEPCSFGSLPGFTGRSGNRSAD
A0A3M5YLE8      RPLSATPFSLRTDLCAALAVHRRLASSFSVRRDTINDRHEPCSFGSLPGFTGRSGNRSAD
A0A3M3RP89      RPLSATPFSLRTDLCAALAVHRRLASSFSVRRDTINDRHEPCSFGSLPGFTGRSGNRSAD
A0A0P9QIY7      RPLSAPPFSLRTDLCAALAVHRRLASSFSVRRDTINDRHEPCSFGSLPGFTGRSGNRSAD
A0A0P9VVH7      RPLSATPFSLRTDLCAALAVHRRLASSFSVRRDTINDRHEPCSFGSLPGFTGRSGNRSAD
A0A0Q0FJK6      RPLSATPFSLRTDLCAALAVHRRLASSFSVRRDTINDRHEPCSFGSLPGFTGRSGNRSAD
A0A0Q0G2J0      RPLSATPFSLRTDLCAALAVHRRLASSFSVRRDTINDRHEPCSFGSLPGFTGRSGNRSAD
A0A3M3LF66      RPLSATPFSLRTDLCAALAVHRRLASSFSVRRDTINDRHEPCSFGSLPGFTGRSGNRSAD
A0A0P9WIR8      RPLSAPPFSLRTDLCAALAVHRRLASSFSVRRDTINDRHEPCSFGSLPGFTGRSGNRSAD
A0A3M3KPE5      ------------------------------------------------------------
A0A3M4C263      ------------------------------------------------------------
A0A3M5AD05      ------------------------------------------------------------
A0A0Q0D3D2      ------------------------------------------------------------
A0A0N0FS39      ------------------------------------------------------------
A0A3M6GHH2      ------------------------------------------------------------
A0A0P9R9W0      -------------------MHRRLASSFSVRSNRINDRHEPSIPGFPTGLADRSGNCSAD
A0A0Q0B9T0      -------------------MHRRLASSFSVRSNRINDRHEPSIPGFPTGLADRSGNSSAD
A0A3M6CFI7      -------------------MHRRLASSFSVRSNRINDRHEPSIPGFPTGLADRSGNSSAD
A0A0P9JXN0      -------------------MHRRLASSFSVRSNRINDRHEPSIPGFPTGLADRSGNCSAD
A0A3M6FIV7      -------------------MHRRLASSFSVRSNRINDRHEPSIPGFPTGLADRSGNCSAD
A0A3M3PLW9      ------------------------------------------------------------
A0A3M4ENY1      ------------------------------------------------------------
A0A3M5EZK7      ------------------------------------------------------------
A0A0P9SPP5      ------------------------------------------------------------
A0A658KL17      ------------------------------------------------------------
A0A3M3NNF2      ------------------------------------------------------------
A0A3M4A0E8      ------------------------------------------------------------
A0A3M4PBZ2      ------------------------------------------------------------
A0A3M6AI26      ------------------------------------------------------------
A0A0P9IWP8      ------------------------------------------------------------
A0A0P9KZ49      ------------------------------------------------------------
A0A0P9V840      ------------------------------------------------------------
A0A0Q0AIE5      ------------------------------------------------------------
A0A3M2ZQH6      ------------------------------------------------------------
A0A0N8SQG2      ------------------------------------------------------------
A0A0W8HFU1      ------------------------------------------------------------
A0A3M5M873      ------------------------------------------------------------
A0A0P9VHH8      ------------------------------------------------------------
A0A0P9YV98      ------------------------------------------------------------
A0A3M3G2W8      ------------------------------------------------------------
A0A3M6C224      ------------------------------------------------------------
A0A3M5K254      ------------------------------------------------------------
A0A3M5JFB0      ------------------------------------------------------------
A0A3M3TQV3      ------------------------------------------------------------
A0A3M3EF92      ------------------------------------------------------------
A0A3M5J1E2      ------------------------------------------------------------
A0A3M5G7H9      ------------------------------------------------------------
A0A3M4A376      ------------------------------------------------------------
A0A0Q0A5T8      ------------------------------------------------------------
A0A0P9SCD7      ------------------------------------------------------------
A0A0P9T4G3      ------------------------------------------------------------
A0A0P9VKB0      ------------------------------------------------------------
A0A0Q0BM35      ------------------------------------------------------------
A0A3M3TPR7      ------------------------------------------------------------
A0A3M3U4Q3      ------------------------------------------------------------
A0A0P9UCX7      ------------------------------------------------------------
A0A0P9S1F1      ------------------------------------------------------------
A0A0P9QCJ2      ------------------------------------------------------------
A0A0P9Q329      ------------------------------------------------------------
A0A3M5GJ64      ------------------------------------------------------------
A0A0P9MPC7      ------------------------------------------------------------
A0A3M2XYQ3      ------------------------------------------------------------
A0A0P9XCE1      ------------------------------------------------------------
A0A3M3EFX7      ------------------------------------------------------------
A0A3M5B9D9      ------------------------------------------------------------
A0A0P9RRZ3      ------------------------------------------------------------
A0A3M2VEK7      ------------------------------------------------------------
A0A0N8R9B3      ------------------------------------------------------------
A0A0P9VA27      ------------------------------------------------------------
A0A3M4YBJ4      ------------------------------------------------------------
A0A0P9J470      ------------------------------------------------------------
A0A0Q0EVJ8      ------------------------------------------------------------
A0A3M5UI30      ------------------------------------------------------------
A0A3M5YQT8      ------------------------------------------------------------
A0A3M5F5X1      ------------------------------------------------------------
A0A3M5R8G1      ------------------------------------------------------------
A0A3M5V012      ------------------------------------------------------------
A0A3M3GA16      ------------------------------------------------------------
A0A3M3UCT3      RPLPAARVSLRTDLRAALALHRRLAPSFSVRSNRINDRHEPSFPEFPSGLPDRSGNSPAD
A0A3M3CJL0      RPLPAARVSLRTDLRAALALHRRLAPSFSVRSNRINDRHEPSFPEFPSGLPDRSGNSPAD
A0A3M3F6F5      RPLPAARVSLRTDLRAALALHRRLAPSFSVRSNRINDRHEPSFPEFPSGLPDRSGNSPAD
A0A3M3P9B7      RPLPAARVSLRTDLRAALALHRRLAPSFSVRSNRINDRHEPSFPEFPSGLPDRSGNSPAD
A0A0N8QB74      RPLPAARVSLRTDLRAALALHRRLAPSFSVRSNRINDRHEPSFPEFPSGLPDRSGNSPAD
A0A0Q0AUD0      RPLPAARVSLRTDLRAALALHRRLAPSFSVRSNRINDRHEPSFPEFPSGLPDRSGNSPAD
A0A3M5VR55      RPLPAARVSLRTDLRAALALHRRLAPSFSVRSNRINDRHEPSFPEFPSGLPDRSGNSPAD
A0A0Q0FK97      RPLPAARVSLRADLRAALALHRRLASPFSVRSNRINDRHEPSFPEFPSGLPDRSGNSPAD
A0A3M5KZ75      ------------------------------------------------------------
A0A3M5L3G5      ------------------------------------------------------------
A0A519ERR1      ------------------------------------------------------------
A0A4Q3Q1M2      ------------------------------------------------------------
A0A4Q3MHR1      ------------------------------------------------------------
A0A520GDZ4      ------------------------------------------------------------
A0A318DSU0      ------------------------------------------------------------
A0A538PF21      ------------------------------------------------------------
A0A1W1ZH10      ------------------------------------------------------------
A0A1W2FF24      ------------------------------------------------------------
A0A524JYQ6      ------------------------------------------------------------
A0A4Q3MA17      ------------------------------------------------------------
A0A0N0M5F7      ------------------------------------------------------------
A0A537M754      ------------------------------------------------------------
A0A1V1PDB4      ------------------------------------------------------------
A0A2M7C324      ------------------------------------------------------------
A0A4Q3HHG6      ------------------------------------------------------------
A0A3B7DTA4      ------------------------------------------------------------
A0A432ZK62      ------------------------------------------------------------
A0A1V5EEP4      ------------------------------------------------------------
A0A1V5EF48      ------------------------------------------------------------
A0A0S6X1X6      ------------------------------------------------------------
A0A537Y5L8      ------------------------------------------------------------
A0A4Q3L2X2      ------------------------------------------------------------
A0A4Q3T8J1      ------------------------------------------------------------
A0A4Q4ANM4      ------------------------------------------------------------
A0A4Q3UEC7      ------------------------------------------------------------
A0A1H5YYQ4      ------------------------------------------------------------
A0A1X4NLK2      ------------------------------------------------------------
A0A1X4NWB5      ------------------------------------------------------------
A0A1M5UQ38      ------------------------------------------------------------
A0A327YI48      ------------------------------------------------------------
A0A1B1PNL6      ------------------------------------------------------------
A0A2U8H9H9      ------------------------------------------------------------
A0A6B2NBB8      ------------------------------------------------------------
A0A1X6YIC0      ------------------------------------------------------------
A0A1I5E9E9      ------------------------------------------------------------
A0A1X6Z7N7      ------------------------------------------------------------
A0A2E1DQ13      ------------------------------------------------------------
A0A1H8C800      ------------------------------------------------------------
A0A2N3EZ05      ------------------------------------------------------------
A0A655R819      ------------------------------------------------------------
A0A655RNN3      ------------------------------------------------------------
A0A0R0BVC7      ------------------------------------------------------------
A0A3N5J7U8      ------------------------------------------------------------
A0A1S7S3I8      ------------------------------------------------------------
A0A519E8D7      ------------------------------------------------------------
A0A3S1FD32      ------------------------------------------------------------
A0A434DUT4      ------------------------------------------------------------
A0A528D3U3      ------------------------------------------------------------
A0A3S3UPT3      ------------------------------------------------------------
A0A3S1E286      ------------------------------------------------------------
A0A531AC71      ------------------------------------------------------------
A0A436K268      ------------------------------------------------------------
A0A434IDQ0      ------------------------------------------------------------
A0A435IRM5      ------------------------------------------------------------
A0A3S2C404      ------------------------------------------------------------
A0A435F6C0      ------------------------------------------------------------
A0A435BMN6      ------------------------------------------------------------
A0A529XQ54      ------------------------------------------------------------
A0A530BJC1      ------------------------------------------------------------
A0A348SRI7      ------------------------------------------------------------
A0A354EI73      ------------------------------------------------------------
A0A4P7EP83      ------------------------------------------------------------
A0A6I1QB25      ------------------------------------------------------------
A0A655ZZQ1      ------------------------------------------------------------
A0A1S0ZAI3      ------------------------------------------------------------
A0A3A4NIE9      ------------------------------------------------------------
A0A3A4NUI9      ------------------------------------------------------------
A0A524I3Z6      ------------------------------------------------------------
A0A524PCL7      ------------------------------------------------------------
A0A356GQV1      ------------------------------------------------------------
A0A1J5DAY8      ------------------------------------------------------------
A0A524P237      ------------------------------------------------------------
A0A3C0L0A8      ------------------------------------------------------------
A0A176S762      ------------------------------------------------------------
A0A377ZC40      ------------------------------------------------------------
A0A378BPJ7      ------------------------------------------------------------
A0A2J5PAJ7      ------------------------------------------------------------
A0A377ZDN3      ------------------------------------------------------------
A0A7A9Y5Q1      ------------------------------------------------------------
A0A1G3JY11      ------------------------------------------------------------
A0A661N3U1      ------------------------------------------------------------
A0A1W9WUD9      ------------------------------------------------------------
A0A1W1ZQK0      ------------------------------------------------------------
A0A6I1R304      ------------------------------------------------------------
A0A1W9PMU6      ------------------------------------------------------------
A0A3S1WTQ1      ------------------------------------------------------------
A0A530CUR9      ------------------------------------------------------------
A0A6L6H5T1      ------------------------------------------------------------
A0A6D0ELN7      ------------------------------------------------------------
A0A1M6N1X5      ------------------------------------------------------------
A0A561M3U0      ------------------------------------------------------------
A0A2N6BZD5      ------------------------------------------------------------
A0A1G3VVY5      ------------------------------------------------------------
A0A7C3S273      ------------------------------------------------------------
A0A7C4WJ18      ------------------------------------------------------------
A0A7C3V565      ------------------------------------------------------------
A0A351B422      ------------------------------------------------------------
F2NEE9          ------------------------------------------------------------
A0A2W5J775      ------------------------------------------------------------
A0A352Q5C1      ------------------------------------------------------------
A0A435NNF5      ------------------------------------------------------------
A0A3S2AQS7      ------------------------------------------------------------
A0A436XH86      ------------------------------------------------------------
A0A527ZPD6      ------------------------------------------------------------
A0A529KRW3      ------------------------------------------------------------
A0A530ZLX0      ------------------------------------------------------------
A0A355TB56      ------------------------------------------------------------
A0A1F9E324      ------------------------------------------------------------
A0A432SAI6      ------------------------------------------------------------
A0A4Q3LBH4      ------------------------------------------------------------
A0A4Q3LWP3      ------------------------------------------------------------
A0A7C3JPP4      ------------------------------------------------------------
A0A534V9L7      ------------------------------------------------------------
A0A7C3JJT4      ------------------------------------------------------------
A0A2N6VGL1      ------------------------------------------------------------
A0A3M3H5V6      ------------------------------------------------------------
A0A524M660      ------------------------------------------------------------
A0A7C3JSX5      ------------------------------------------------------------
A0A7I8MQ67      ------------------------------------------------------------
A0A0C1TRU6      ------------------------------------------------------------
A0A2Z5SSF4      ------------------------------------------------------------
A0A2T4ZJZ6      ------------------------------------------------------------
A0A0B8PTA8      ------------------------------------------------------------
A0A0B8QF75      ------------------------------------------------------------
A0A6P2T4F7      ------------------------------------------------------------
A0A4Q4CIB1      ------------------------------------------------------------
A0A522ACJ9      ------------------------------------------------------------
A0A1T2KYM8      ------------------------------------------------------------
A0A3N5Z7F8      ------------------------------------------------------------
A0A239HD34      ------------------------------------------------------------
A0A2G9ZR82      ------------------------------------------------------------
A0A4U9I390      ------------------------------------------------------------
A0A0P7ZZE4      ------------------------------------------------------------
A0A369R0Q9      ------------------------------------------------------------
A0A327LYE6      ------------------------------------------------------------
A0A5A9ZTV3      ------------------------------------------------------------
A0A6J4YZ98      ------------------------------------------------------------
A0A2X3M011      ------------------------------------------------------------
I2WC85          ------------------------------------------------------------
A0A7A9K1G5      ------------------------------------------------------------
A0A7B7KSB7      ------------------------------------------------------------
A0A400JH80      ------------------------------------------------------------
A0A479JNB1      ------------------------------------------------------------
A0A5C9AF52      ------------------------------------------------------------
A0A797FC39      ------------------------------------------------------------
A0A797FHC1      ------------------------------------------------------------
D8EEU7          ------------------------------------------------------------
A0A6D0EYC7      ------------------------------------------------------------
A0A7A6DHB0      ------------------------------------------------------------
A0A2H9EHM4      ------------------------------------------------------------
A0A7A5MLK0      ------------------------------------------------------------
A0A380B3D7      ------------------------------------------------------------
F5NSX0          ------------------------------------------------------------
A0A534XP85      ------------------------------------------------------------
A0A0P1H2H0      ------------------------------------------------------------
A0A258WKV0      ------------------------------------------------------------
A0A377N8F8      ------------------------------------------------------------
A5G4N9          ------------------------------------------------------------
A0A3C2DSE7      ------------------------------------------------------------
A0A2X1JBG5      ------------------------------------------------------------
A0A377LY04      ------------------------------------------------------------
A0A5C9ABR5      ------------------------------------------------------------
A0A5J9WU72      ------------------------------------------------------------
A0A2X3K9R3      ------------------------------------------------------------
A0A3T9EHW9      ------------------------------------------------------------
A0A484X141      ------------------------------------------------------------
A0A5N9VWI6      ------------------------------------------------------------
A0A6D0EJQ0      ------------------------------------------------------------
A0A444R390      ------------------------------------------------------------
A0A376LLF8      ------------------------------------------------------------
A0A6L7CT21      ------------------------------------------------------------
A0A4Q3LR91      ------------------------------------------------------------
A0A6C9IKN8      ------------------------------------------------------------
A0A4V1TR68      ------------------------------------------------------------
A0A444IY46      ------------------------------------------------------------
A0A6I7N627      ------------------------------------------------------------
A0A6L3ZR06      ------------------------------------------------------------
A0A3E0WKI3      ------------------------------------------------------------
A0A1H3I2J1      ------------------------------------------------------------
A0A1V5DJV0      ------------------------------------------------------------
A0A520IUC4      ------------------------------------------------------------
A0A521LJG5      ------------------------------------------------------------
A0A531IBQ7      ------------------------------------------------------------
A0A0P1FWI8      ------------------------------------------------------------
A0A6L8LHC6      ------------------------------------------------------------
A0A1V4WHZ7      ------------------------------------------------------------
A0A1E5AJN5      ------------------------------------------------------------
A0A2N3D2J1      ------------------------------------------------------------
A0A2N2GVE1      ------------------------------------------------------------
A0A2N2INV3      ------------------------------------------------------------
A0A233IKJ2      ------------------------------------------------------------
A0A1Y5DXG5      ------------------------------------------------------------
A0A0B8P2H5      ------------------------------------------------------------
A0A380AQW6      ------------------------------------------------------------
A0A2G2GD62      ------------------------------MDSNITKNMEADEESFDIQQALYIIKKYNK
A0A3R9C3P5      ------------------------------------------------------------
A0A0M3GBT1      ------------------------------------------------------------
B3Q577          ------------------------------------------------------------
A0A483QWI8      ------------------------------------------------------------
A0A483UXD3      ------------------------------------------------------------
A0A0A8J8L3      ------------------------------------------------------------
A0A660DJ38      ------------------------------------------------------------
A0A524P331      ------------------------------------------------------------
A0A4V1SSM5      ------------------------------------------------------------
A0A4Q3K8G7      ------------------------------------------------------------
A0A7C7W7M2      ------------------------------------------------------------
A0A1M7HC79      ------------------------------------------------------------
A0A1D3JZN6      ------------------------------------------------------------
A0A1V6ESG1      ------------------------------------------------------------
A0A1H7YHK3      ------------------------------------------------------------
A0A534SH66      ------------------------------------------------------------
A0A3M0ZZ99      ------------------------------------------------------------
A0A238LBD3      ------------------------------------------------------------
A0A328C2K5      ------------------------------------------------------------
A0A5C6X8M3      ------------------------------------------------------------
A0A3D8MRR7      ------------------------------------------------------------
A0A5C6UBJ7      ------------------------------------------------------------
A0A5C6XGM3      ------------------------------------------------------------
A0A537NZJ1      ------------------------------------------------------------
A0A7C4R3C4      ------------------------------------------------------------
A0A0P1FRV5      ------------------------------------------------------------
A0A4Q4CVW6      ------------------------------------------------------------
A0A090R136      ------------------------------------------------------------
A0A661JU93      ------------------------------------------------------------
A0A2E2T3V8      ------------------------------------------------------------
A0A367UAB4      ------------------------------------------------------------
A0A1F2ZW35      ------------------------------------------------------------
A0A377V641      ------------------------------------------------------------
A0A1F2YJ88      ------------------------------------------------------------
A0A6L3ZWI0      ------------------------------------------------------------
A0A5N8AL61      ------------------------------------------------------------
A0A0J7XGZ1      ------------------------------------------------------------
I4CBA7          ------------------------------------------------------------
A3VE95          ------------------------------------------------------------
A0A1G0NL95      ------------------------------------------------------------
A0A024KA69      ------------------------------------------------------------
A0A0L1KFN4      ------------------------------------------------------------
A0A3P5DSS6      ------------------------------------------------------------
A0A483YEL5      ------------------------------------------------------------
A0A658GUJ0      ------------------------------------------------------------
A0A358L616      ------------------------------------------------------------
A0A1M7BLL7      ------------------------------------------------------------
A0A0H4KZM1      ------------------------------------------------------------
A0A3D5UYX7      ------------------------------------------------------------
A0A2N1WQN5      ------------------------------------------------------------
A0A352G2C2      ------------------------------------------------------------
A0A3C0PZN1      ------------------------------------------------------------
A0A524QFS4      ------------------------------------------------------------
A0A520JSW4      ------------------------------------------------------------
A0A1V1UJT2      ------------------------------------------------------------
A0A0L6CVX1      ------------------------------------------------------------
A0A1V0RR48      ------------------------------------------------------------
A0A0A0HJJ4      ------------------------------------------------------------
A0A5E7YA28      ------------------------------------------------------------
A0A4Q3LTF3      ------------------------------------------------------------
A0A7C3N3Y1      ------------------------------------------------------------
A0A537UTP9      ------------------------------------------------------------
A0A1D2RNR5      ------------------------------------------------------------
A0A4V1TQ46      ------------------------------------------------------------
A0A3A0FZC0      ------------------------------------------------------------
A0A1N7JVZ7      ------------------------------------------------------------
A0A091C4A8      ------------------------------------------------------------
A0A4R3H6P6      ------------------------------------------------------------
A0A3S1NQ09      ------------------------------------------------------------
A0A443GJ52      ------------------------------------------------------------
A0A6N3RE79      ------------------------------------------------------------
A0A6N9S3L5      ------------------------------------------------------------
A0A656BWB0      ------------------------------------------------------------
A0A6D0IFH4      ------------------------------------------------------------
A0A7A3MK38      ------------------------------------------------------------
A0A0A0FHV8      ------------------------------------------------------------
A0A1X3IPU7      ------------------------------------------------------------
A0A0A0G0N2      ------------------------------------------------------------
A0A2I8SDU4      ------------------------------------------------------------
A0A2I8SU55      ------------------------------------------------------------
A0A7I6T806      ------------------------------------------------------------
A0A7I6TQE9      ------------------------------------------------------------
A0A7I6U296      ------------------------------------------------------------
S1EXJ6          ------------------------------------------------------------
A0A376UBS1      ------------------------------------------------------------
A0A2W6S588      ------------------------------------------------------------
A0A483E0N4      ------------------------------------------------------------
A0A2J4YQQ6      ------------------------------------------------------------
A0A483THX4      ------------------------------------------------------------
A0A534MVS2      ------------------------------------------------------------
A0A444I5K6      ------------------------------------------------------------
A0A154VE85      ------------------------------------------------------------
A0A3S1MCW7      ------------------------------------------------------------
A0A434IGN6      ------------------------------------------------------------
A0A528AX40      ------------------------------------------------------------
A0A528MV95      ------------------------------------------------------------
A0A3C1S9Y1      ------------------------------------------------------------
A0A353EH49      ------------------------------------------------------------
A0A1Y1Q9C1      ------------------------------------------------------------
A0A3M7LJH0      ------------------------------------------------------------
A0A316KRG4      ------------------------------------------------------------
A0A1E4JHX8      ------------------------------------------------------------
M2U8P2          ------------------------------------------------------------
A0A1H7KZF8      ------------------------------------------------------------
A0A0J5Q9T7      ------------------------------------------------------------
A0A6N3UC48      ------------------------------------------------------------
A0A257NG76      ------------------------------------------------------------
A0A1T4TW59      ------------------------------------------------------------
A0A1I5YYQ0      ------------------------------------------------------------
A0A5P9FE62      ------------------------------------------------------------
A0A1Q3MB35      ------------------------------------------------------------
A0A259LUN7      ------------------------------------------------------------
A0A2D7AVL1      ------------------------------------------------------------
A0A3B9KZE9      ------------------------------------------------------------
A0A2U0NMP8      ------------------------------------------------------------
A0A4U9HNE9      ------------------------------------------------------------
A0A7C5N053      ------------------------------------------------------------
A0A2G2CXY6      ------------------------------------------------------------
A0A3M1D4H3      ------------------------------------------------------------
A0A7C1A2A2      --------------------------------------------------AGAALAVLTV
A0A5C8BYM7      ------------------------------------------------------------
A0A1J5ICP0      ------------------------------------------------------------
A0A379B9V4      ------------------------------------------------------------
A0A0Q6TS97      ------------------------------------------------------------
A0A0Q6UYB4      ------------------------------------------------------------
A0A484XS37      ------------------------------------------------------------
W7Q5J0          ------------------------------------------------------------
A0A654AKT6      ------------------------------------------------------------
A0A7A9JY19      ------------------------------------------------------------
A0A0G9MZA5      ------------------------------------------------------------
H0T8B0          ------------------------------------------------------------
A0A5C7N981      ------------------------------------------------------------
A0A534TV22      ------------------------------------------------------------
A0A351CXR4      ------------------------------------------------------------
A0A2N6GLF5      ------------------------------------------------------------
A0A1W9LJP0      ------------------------------------------------------------
A0A0W1ICB0      ------------------------------------------------------------
A0A7C1C8G2      ------------------------------------------------------------
A0A376KYN0      ------------------------------------------------------------
A0A7A9J338      ------------------------------------------------------------
A0A377E5P7      ------------------------------------------------------------
A0A2X1JB05      ------------------------------------------------------------
A0A376RML0      ------------------------------------------------------------
A0A6N3QTV2      ------------------------------------------------------------
A0A2E0UL88      ------------------------------------------------------------
A0A0T2QIS1      ------------------------------------------------------------
A0A0P7Y1D0      ------------------------------------------------------------
A0A542J310      ------------------------------------------------------------
A0A2M7JRZ7      ------------------------------------------------------------
A0A167IR75      ------------------------------------------------------------
A0A3B8T2U6      ------------------------------------------------------------
A0A365PWR2      ------------------------------------------------------------
A0A2E9H5Z8      ------------------------------------------------------------
A0A2E2BR79      ------------------------------------------------------------
A0A6I4IKZ3      ------------------------------------------------------------
A0A7H4JZ79      ------------------------------------------------------------
A0A0Q4Q524      ------------------------------------------------------------
A0A0Q4CFJ9      ------------------------------------------------------------
A0A0Q4FE58      ------------------------------------------------------------
A0A0Q4JWC8      ------------------------------------------------------------
A0A0Q4KFL8      ------------------------------------------------------------
A0A522R8R0      ------------------------------------------------------------
A0A2U9NDY5      ------------------------------------------------------------
X7F6S5          ------------------------------------------------------------
A0A1G8NKI0      ------------------------------------------------------------
A0A355QPE4      ------------------------------------------------------------
A0A357RN98      ------------------------------------------------------------
A0A1I6U4V1      ------------------------------------------------------------
A0A6B2P8H8      ------------------------------------------------------------
A0A1P8USW9      ------------------------------------------------------------
A0A1G7CFZ2      ------------------------------------------------------------
A0A7G2TPW1      ------------------------------------------------------------
A0A0Q4IGG1      ------------------------------------------------------------
A0A534RUJ5      ------------------------------------------------------------
A0A3M1CJM3      ------------------------------------------------------------
A0A2R7SVD4      ------------------------------------------------------------
A0A3C0PWB6      ------------------------------------------------------------
V4Q8B7          ------------------------------------------------------------
A0A0Q8XKK5      ------------------------------------------------------------
A0A2E0Q2W0      ------------------------------------------------------------
A0A660NIR6      ------------------------------------------------------------
A0A142W0R3      ------------------------------------------------------------
A0A0S4XR18      ------------------------------------------------------------
A0A7C5CFF1      ------------------------------------------------------------
A0A2E0GW64      ------------------------------------------------------------
A0A1A7QJ97      ------------------------------------------------------------
A0A661LW70      ------------------------------------------------------------
W7Q8F9          ------------------------------------------------------------
A0A524PXH8      ------------------------------------------------------------
A0A4Q3P0E4      ------------------------------------------------------------
A0A3M2BE89      ------------------------------------------------------------
A0A4Q4A6K6      ------------------------------------------------------------
A0A257G674      ------------------------------------------------------------
A0A661M5M6      ------------------------------------------------------------
A0A1I1UM01      ------------------------------------------------------------
Q44573          ------------------------------------------------------------
A2W025          ------------------------------------------------------------
A0A534Z362      ------------------------------------------------------MAAADR
V4J283          ------------------------------------------------------------
A0A536T443      ------------------------------------------------------------
A0A0Q4UFQ5      ------------------------------------------------------------
A0A527W7E6      ------------------------------------------------------------
A0A432EMV7      ------------------------------------------------------------
A0A7C1SEU7      ------------------------------------------------------------
A0A534WLI3      ------------------------------------------------------------
A0A7C6FBW0      ------------------------------------------------------------
A0A087LTV7      ------------------------------------------------------------
A0A7D7WSS2      ------------------------------------------------------------
A0A318KWA2      ------------------------------------------------------------
A0A522MT86      ------------------------------------------------------------
A0A4Q3I221      ------------------------------------------------------------
A0A534SAL6      ---------------------------------------------------------MTE
A0A534ZDB4      ---------------------------------------------------------MAE
A0A534X3M7      ------------------------------------------------------MIARTP
A0A534SPC6      ------------------------------------------------------------
A0A535AD60      --------------------------------------------------MAAADRPLFP
A0A4Q3SY08      ------------------------------------------------------------
A0A4Q3LG23      ------------------------------------------------------------
A0A522EX52      ------------------------------------------------------------
A0A1H3KC95      ------------------------------------------------------------
A0A5P8Z4P3      ------------------------------------------------------------
A0A2E9HXF7      ------------------------------------------------------------
A0A0B3RZC9      ------------------------------------------------------------
A0A6F8QET1      ------------------------------------------------------------
A0A520HUH4      ------------------------------------------------------------
A0A2K8U7M6      ------------------------------------------------------------
A0A5B9DKL8      ------------------------------------------------------------
A0A238KJM1      ------------------------------------------------------------
A0A3A0FJZ4      ------------------------------------------------------------
W4HJV8          ------------------------------------------------------------
A0A0P1GDI0      ------------------------------------------------------------
A0A2R8ATV5      ------------------------------------------------------------
A0A1U7D3R6      ------------------------------------------------------------
A0A2D4UVV2      ------------------------------------------------------------
A0A0W7WHP4      ------------------------------------------------------------
A0A238J8F6      ------------------------------------------------------------
A0A238JQI6      ------------------------------------------------------------
A0A222E077      ------------------------------------------------------------
A0A239E3Y2      ------------------------------------------------------------
A0A534QGR3      ------------------------------------------------------------
A0A1F9CFF0      ------------------------------------------------------------
A0A2M8B0G5      ------------------------------------------------------------
A0A363TNU9      ------------------------------------------------------------
A0A0W1GMS6      ------------------------------------------------------------
A0A0Q8RMY3      ------------------------------------------------------------
A0A1A7QC21      ------------------------------------------------------------
A0A2W4RFS2      ------------------------------------------------------------
A0A1Y6DC43      ------------------------------------------------------------
A0A2S6HE06      ------------------------------------------------------------
G3J0M3          ------------------------------------------------------------
V5C6R5          ------------------------------------------------------------
A0A534HBS8      ------------------------------------------------------------
A0A0F0T3Y9      ------------------------------------------------------------
A0A379GWF0      ------------------------------------------------------------
A0A4Q2XLV7      ------------------------------------------------------------
A0A4Q5QYC4      ------------------------------------------------------------
A0A3B8SQ27      ------------------------------------------------------------
A0A0U2VAW2      ------------------------------------------------------------
A0A454CTF1      ------------------------------------------------------------
A0A6B3Q2G1      ------------------------------------------------------------
A0A4Q6G931      ------------------------------------------------------------
A0A2T0VBD8      ------------------------------------------------------------
A0A378APS2      ------------------------------------------------------------
A0A443VCQ6      ------------------------------------------------------------
A0A447RKQ7      ------------------------------------------------------------
W1DSK1          ------------------------------------------------------------
A0A2N1XK22      ------------------------------------------------------------
A0A3D0KAC8      ------------------------------------------------------------
A0A3D2Y902      ------------------------------------------------------------
A0A378G3G7      ------------------------------------------------------------
A0A2X5NHJ9      ------------------------------------------------------------
A0A2J4QEC3      ------------------------------------------------------------
A0A485ADM3      ------------------------------------------------------------
A0A4U9HGU4      ------------------------------------------------------------
A0A3S4JGG5      ------------------------------------------------------------
A0A377ZDH2      ------------------------------------------------------------
A0A3S4HTS8      ------------------------------------------------------------
A0A1W9F5M9      ------------------------------------------------------------
A0A379W6R2      ------------------------------------------------------------
A0A379TA56      ------------------------------------------------------------
A0A655C5P0      ------------------------------------------------------------
A0A6D0I9G1      ------------------------------------------------------------
A0A352MMI7      ------------------------------------------------------------
A0A4Z0LWV1      ------------------------------------------------------------
A0A377K431      ------------------------------------------------------------
A0A376RY66      ------------------------------------------------------------
A0A778GAM7      ------------------------------------------------------------
A0A3C2BN18      ------------------------------------------------------------
A0A447LR75      ------------------------------------------------------------
A0A759KJJ5      ------------------------------------------------------------
A0A376D8L7      ------------------------------------------------------------
A0A1V2FV46      ------------------------------------------------------------
A0A6N8QLT3      ------------------------------------------------------------
A0A376SB61      ------------------------------------------------------------
A0A3D1BYV9      ------------------------------------------------------------
A0A536T0W8      ------------------------------------------------------------
A0A3D2M6Y9      ------------------------------------------------------------
A0A3D2YAZ2      ------------------------------------------------------------
A0A350A102      ------------------------------------------------------------
A0A350L5D2      ------------------------------------------------------------
A0A2G9XLE5      ------------------------------------------------------------
A0A6L3MM74      ------------------------------------------------------------
A0A7C3QM04      ------------------------------------------------------------
A0A7I8MVM0      ------------------------------------------------------------
A0A7C0Y3J7      ------------------------------------------------------------
A0A7C3LF61      ------------------------------------------------------------
A0A4R1HDF2      ------------------------------------------------------------
A0A6N1DL48      ------------------------------------------------------------
A0A1V6FYJ1      ------------------------------------------------------------
A0A0C5VQ86      ------------------------------------------------------------
A0A0Q6QV61      ------------------------------------------------------------
A0A2Z3IKG4      ------------------------------------------------------------
A0A3N5RNY4      ------------------------------------------------------------
A0A4Z0M4C7      ------------------------------------------------------------
A0A5Q2QDL1      ------------------------------------------------------------
A0A1V8MBH1      ------------------------------------------------------------
A0A6J4X8D4      ------------------------------------------------------------
A0A318CT66      ------------------------------------------------------------
A0A3N5P205      ------------------------------------------------------------
A0A443K010      ------------------------------------------------------------
A0A6I7NYG5      ------------------------------------------------------------
A0A212AR83      ------------------------------------------------------------
A0A2E2P4I0      ------------------------------------------------------------
A0A2U2CM86      ------------------------------------------------------------
A0A1I0R9R6      ------------------------------------------------------------
A0A2N3BVE7      ------------------------------------------------------------
A0A7C2IB02      ------------------------------------------------------------
A0A6N6SI00      ------------------------------------------------------------
A0A2S5JE21      ------------------------------------------------------------
A0A2R8BKZ2      ------------------------------------------------------------
A0A2S8S361      ------------------------------------------------------------
A0A520ZTR8      ------------------------------------------------------------
A0A316GHM6      ------------------------------------------------------------
A0A238IZI1      ------------------------------------------------------------
A0A7C9INT8      ------------------------------------------------------------
A0A6M1UAR9      ------------------------------------------------------------
A0A1X7ACC1      ------------------------------------------------------------
A0A238KUF6      ------------------------------------------------------------
A0A095CTW3      ------------------------------------------------------------
A0A2E3UGD6      ------------------------------------------------------------
A0A2T0RFH0      ------------------------------------------------------------
A0A285D390      ------------------------------------------------------------
A0A497VHN4      ------------------------------------------------------------
A0A2N6BEI9      ------------------------------------------------------------
A0A0D5N3E9      ------------------------------------------------------------
A0A2N2G716      ------------------------------------------------------------
A0A7C1UTU6      ------------------------------------------------------------
W9VVY5          ------------------------------------------------------------
A0A1E2URD3      ------------------------------------------------------------
A0A2T6MY81      ------------------------------------------------------------
A0A2T6NBQ8      ------------------------------------------------------------
A0A421K431      ------------------------------------------------------------
A0A2G2I5M1      ------------------------------------------------------------
A0A2G2M6F0      ------------------------------------------------------------
A0A1W9J9F8      ------------------------------------------------------------
A0A2S5LFJ9      ------------------------------------------------------------
A0A2D8R8F8      ------------------------------------------------------------
A0A6I4JXQ8      ------------------------------------------------------------
A0A010SNS0      ------------------------------------------------------------
A0A0C2I782      ------------------------------------------------------------
A0A2N8BYF5      ------------------------------------------------------------
A0A558FKX2      ------------------------------------------------------------
A0A1H1DBA0      ------------------------------------------------------------
J2TAD5          ------------------------------------------------------------
J3H699          ------------------------------------------------------------
A0A1H5J974      ------------------------------------------------------------
A0A0K1QRZ4      ------------------------------------------------------------
A0A560RJW9      ------------------------------------------------------------
A0A5E6TID7      ------------------------------------------------------------
A0A5E7CRU7      ------------------------------------------------------------
A0A5E7C564      ------------------------------------------------------------
A0A2W7MAV4      ------------------------------------------------------------
A0A4R3WQH5      ------------------------------------------------------------
W6VFG3          ------------------------------------------------------------
A0A1P8ENT1      ------------------------------------------------------------
A0A2N7XRV4      ------------------------------------------------------------
A0A0Q6QPG8      ------------------------------------------------------------
A0A0F4SWA7      ------------------------------------------------------------
A0A423J219      ------------------------------------------------------------
A0A4P6G9U8      ------------------------------------------------------------
A0A4Y8JE06      ------------------------------------------------------------
A0A502I1X9      ------------------------------------------------------------
A0A502J776      ------------------------------------------------------------
A0A5B0EZF6      ------------------------------------------------------------
A0A059L434      ------------------------------------------------------------
A0A0F4UWN2      ------------------------------------------------------------
A0A5E7WEF5      ------------------------------------------------------------
A0A1G0KSD0      ------------------------------------------------------------
A0A4P6WX84      ------------------------------------------------------------
A0A1D2S760      ------------------------------------------------------------
A0A5B8RW94      ------------------------------------------------------------
A0A258TN88      ------------------------------------------------------------
A0A1F9EUS2      ------------------------------------------------------------
A0A6H9HII8      ------------------------------------------------------------
A0A3N9VAW3      ------------------------------------------------------------
A0A1X0YE57      ------------------------------------------------------------
A0A2K2H9Q8      ------------------------------------------------------------
A0A6I1KNW9      ------------------------------------------------------------
A0A1H4B8T3      ------------------------------------------------------------
A0A1E7IQC3      ------------------------------------------------------------
A0A1M6KEN5      ------------------------------------------------------------
A0A353QLL3      ------------------------------------------------------------
A0A399I453      ------------------------------------------------------------
A0A651FBV9      ------------------------------------------------------------
A0A5C1MDH8      ------------------------------------------------------------
A0A7J4ZSX4      ------------------------------------------------------------
A0A5A9XE04      ------------------------------------------------------------
A0A643G9R1      ------------------------------------------------------------
A0A1G0M8Q7      ------------------------------------------------------------
A0A353MI14      ------------------------------------------------------------
A0A4S1CAW7      ------------------------------------------------------------
A0A562VHD2      ------------------------------------------------------------
A0A7K0J0R7      ------------------------------------------------------------
A0A6I6JNB5      ------------------------------------------------------------
A0A1G0LDK7      ------------------------------------------------------------
A0A6F9WVL7      ------------------------------------------------------------
A0A351Z9A2      ------------------------------------------------------------
A0A3N5FRH4      ------------------------------------------------------------
A0A1V4Y2C3      ------------------------------------------------------------
A0A2N2KTJ4      ------------------------------------------------------------
A0A2N2LQX0      ------------------------------------------------------------
A0A318D3U4      ------------------------------------------------------------
A0A401FQP5      ------------------------------------------------------------
A0A7C2AA26      ------------------------------------------------------------
A0A351Z4H9      ------------------------------------------------------------
A0A2N2KML4      ------------------------------------------------------------
E1YJF1          ------------------------------------------------------------
A0A1J5EVZ6      ------------------------------------------------------------
A0A2G6FCC5      ------------------------------------------------------------
A0A1F9MR25      ------------------------------------------------------------
A0A2G6M7F1      ------------------------------------------------------------
A0A7C3Q9R6      ------------------------------------------------------------
A0A1Q6DMW3      ------------------------------------------------------------
A0A3A6P8F8      ------------------------------------------------------------
A0A6L4AM84      ------------------------------------------------------------
A0A2G2DSM4      ------------------------------------------------------------
A0A1F9NI02      ------------------------------------------------------------
A0A4U1ABX4      ------------------------------------------------------------
A0A1W9M770      ------------------------------------------------------------
A0A1W9M7R6      ------------------------------------------------------------
A0A1M7Y300      ------------------------------------------------------------
A0A4U1ALN4      ------------------------------------------------------------
A0A1E7H876      ------------------------------------------------------------
A0A7C0U459      ------------------------------------------------------------
A0A0F2NF69      ------------------------------------------------------------
A0A1F9NFD0      ------------------------------------------------------------
A0A1M5YLH5      ------------------------------------------------------------
A0A4U1A4C7      ------------------------------------------------------------
A0A509L3P8      ------------------------------------------------------------
A0A3A4S038      ------------------------------------------------------------
A0A1F9N669      ------------------------------------------------------------
A0A1F9PFA7      ------------------------------------------------------------
A0A1H2EN09      ------------------------------------------------------------
K0NP00          ------------------------------------------------------------
A0A7C4N0I9      ------------------------------------------------------------
A0A1E7JCL5      ------------------------------------------------------------
A0A496YAH9      ------------------------------------------------------------
A0A1V4S7E4      ------------------------------------------------------------
A0A2N2H8D2      ------------------------------------------------------------
A0A2N2KC63      ------------------------------------------------------------
A0A3A4ZYW4      ------------------------------------------------------------
A0A1V4MCJ4      ------------------------------------------------------------
A0A661M0W4      ------------------------------------------------------------
A0A4U8YLL7      ------------------------------------------------------------
A0A445MZQ4      ------------------------------------------------------------
A0A2M7WWF7      ------------------------------------------------------------
A0A0M9E0E3      ------------------------------------------------------------
A0A4Q3IRI1      ------------------------------------------------------------
A0A7C1C6X5      ------------------------------------------------------------
A0A354EF47      ------------------------------------------------------------
A0A2G6MSP7      ------------------------------------------------------------
B7RS54          ------------------------------------------------------------
A0A1I6ENM4      ------------------------------------------------------------
A8LNM8          ------------------------------------------------------------
A0A0T5NSU3      ------------------------------------------------------------
A0A5P9I718      ------------------------------------------------------------
A0A2M8J3R9      ------------------------------------------------------------
A0A1I6X762      ------------------------------------------------------------
A0A0P1EFX8      ------------------------------------------------------------
A0A2G5KB39      ------------------------------------------------------------
A0A2N3CNV1      ------------------------------------------------------------
A0A257F1F4      ------------------------------------------------------------
A0A2D5J8T8      ------------------------------------------------------------
A0A2E3P9W6      ------------------------------------------------------------
A0A2G2B1P9      ------------------------------------------------------------
A0A258GCD5      ------------------------------------------------------------
A0A443INY4      ------------------------------------------------------------
A0A2D9YR88      ------------------------------------------------------------
A0A4Q3ZBK4      ------------------------------------------------------------
A0A1G9FY29      ------------------------------------------------------------
A0A6N9RUN2      ------------------------------------------------------------
A0A1G8QZS5      ------------------------------------------------------------
A0A1H2Y469      ------------------------------------------------------------
A0A497ZQU7      ------------------------------------------------------------
A0A4U8YMP3      ------------------------------------------------------------
A0A1Q8QQ99      ------------------------------------------------------------
A0A7C2SIB2      ------------------------------------------------------------
A0A3D5ZY44      ------------------------------------------------------------
A0A1G5C236      ------------------------------------------------------------
A0A432HIS7      ------------------------------------------------------------
A0A520CSP5      ------------------------------------------------------------
A0A372IH36      ------------------------------------------------------------
A0A540VW45      ------------------------------------------------------------
A0A1H9C241      ------------------------------------------------------------
A0A2E3FCR1      ------------------------------------------------------------
A0A4S3MG69      ------------------------------------------------------------
A0A3E0H727      ------------------------------------------------------------
A0A1I3TTC3      ------------------------------------------------------------
A0A1H3IZW6      ------------------------------------------------------------
A0A0M6YG59      ------------------------------------------------------------
A0A1H7G8B0      ------------------------------------------------------------
A0A7C3Z8T7      ------------------------------------------------------------
A0A1V4QMH7      ------------------------------------------------------------
A0A496XZQ4      ------------------------------------------------------------
A0A7C3UZM2      ------------------------------------------------------------
A0A1F9BJF7      ------------------------------------------------------------
F2NDF5          ------------------------------------------------------------
A0A656PSQ6      ------------------------------------------------------------
A0A4Q3ZDI7      ------------------------------------------------------------
A0A537PRC6      ------------------------------------------------------------
A0A1I3XJ27      ------------------------------------------------------------
A0A562CGU2      ------------------------------------------------------------
A0A7C9VCB3      ------------------------------------------------------------
A0A1I7DCG1      ------------------------------------------------------------
A0A3A3H6D9      ------------------------------------------------------------
A0A0Q6VA36      ------------------------------------------------------------
A0A1B2EQN1      ------------------------------------------------------------
A0A1E7HSL6      ------------------------------------------------------------
A0A2M7JX59      ------------------------------------------------------------
A0A3A4XVN3      ------------------------------------------------------------
A0A1E7JEV6      ------------------------------------------------------------
A0A2N2KDY5      ------------------------------------------------------------
A0A3N5YUD9      ------------------------------------------------------------
A0A0W1DLQ3      ------------------------------------------------------------
A0A246JVD8      ------------------------------------------------------------
A0A2N3BB54      ------------------------------------------------------------
A0A1H6G7A3      ------------------------------------------------------------
A0A0A7PGL6      ------------------------------------------------------------
A0A4Q2Z4L0      ------------------------------------------------------------
A0A5C4N0H6      ------------------------------------------------------------
A0A1V4M8I1      ------------------------------------------------------------
A0A7C0XE92      ------------------------------------------------------------
A0A1E7HFN0      ------------------------------------------------------------
A0A7J0BHG1      ------------------------------------------------------------
A0A1M5GH86      ------------------------------------------------------------
A0A1W1XQZ5      ------------------------------------------------------------
A0A6V8LMJ3      ------------------------------------------------------------
A0A2K8WHP8      ------------------------------------------------------------
A0A1J5N774      ------------------------------------------------------------
A0A2C8F781      ------------------------------------------------------------
A0A2E3R6G0      ------------------------------------------------------------
A0A7J0BUD3      ------------------------------------------------------------
A0A1F8XMK2      ------------------------------------------------------------
A0A3M8EMP2      ------------------------------------------------------------
A0A2J6J6K6      ------------------------------------------------------------
A0A661PSB9      ------------------------------------------------------------
A0A661QBT6      ------------------------------------------------------------
A0A6I2SLK2      ------------------------------------------------------------
A0A0A8WSG4      ------------------------------------------------------------
S7TK97          ------------------------------------------------------------
S7UE93          ------------------------------------------------------------
A0A3D5BR56      ------------------------------------------------------------
A0A2N2IB15      ------------------------------------------------------------
A0A1I3PSR2      ------------------------------------------------------------
A0A1I4GEK4      ------------------------------------------------------------
A0A7C8B5M6      ------------------------------------------------------------
A0A1W7QPT7      ------------------------------------------------------------
A0A6S6M1Y8      ------------------------------------------------------------
A0A6V8MCR2      ------------------------------------------------------------
A0A6V8N3X1      ------------------------------------------------------------
A0A6M4XJ81      ------------------------------------------------------------
A0A0M4D373      ------------------------------------------------------------
A0A1L3GKM9      ------------------------------------------------------------
A0A2T5R3J5      ------------------------------------------------------------
A0A1G6EKK9      ------------------------------------------------------------
A0A7C1DJX8      ------------------------------------------------------------
A0A3D6C3I2      ------------------------------------------------------------
S0G1D4          ------------------------------------------------------------
A0A661T246      ------------------------------------------------------------
A0A2G6CSG7      ------------------------------------------------------------
A0A2G6NB59      ------------------------------------------------------------
A0A5K8A7T9      ------------------------------------------------------------
A0A1W9U045      ------------------------------------------------------------
A0A1F9L9G4      ------------------------------------------------------------
A0A328FD76      ------------------------------------------------------------
A0A348UX90      ------------------------------------------------------------
A0A357Z0N5      ------------------------------------------------------------
A0A0F2R2U0      ------------------------------------------------------------
A0A5K7ZK00      ------------------------------------------------------------
A0A5K7YCX8      ------------------------------------------------------------
A0A5K7Z388      ------------------------------------------------------------
A0A352B502      ------------------------------------------------------------
A0A410V446      ------------------------------------------------------------
A0A0R3KGJ5      ------------------------------------------------------------
A0A0R3N604      ------------------------------------------------------------
A0A1B1UCM8      ------------------------------------------------------------
A0A1N6JQ20      ------------------------------------------------------------
A0A1M5TI07      ------------------------------------------------------------
A3X191          ------------------------------------------------------------
A0A1H4RKV5      ------------------------------------------------------------
A0A160UA87      ------------------------------------------------------------
A0A1Q5SFV5      ------------------------------------------------------------
A0A7C3Y7G3      ------------------------------------------------------------
A0A430DNP0      ------------------------------------------------------------
A0A3A0FQ32      ------------------------------------------------------------
A0A1E4UZA0      ------------------------------------------------------------
A0A1H9KL56      ------------------------------------------------------------
A0A1A9KEF8      ------------------------------------------------------------
A0A5E6PKN5      ------------------------------------------------------------
A0A0N9W1V6      ------------------------------------------------------------
A0A423GQ41      ------------------------------------------------------------
A0A423H7J2      ------------------------------------------------------------
A0A502HNM8      ------------------------------------------------------------
A0A4Q7H223      ------------------------------------------------------------
A0A1H4N2K9      ------------------------------------------------------------
A0A2K4KWF7      ------------------------------------------------------------
A0A3E0WXH2      ------------------------------------------------------------
A0A2N2TRC8      ------------------------------------------------------------
A0A1V4CIZ7      ------------------------------------------------------------
A0A1M3BXA5      ------------------------------------------------------------
A0A1Y2R3U6      ------------------------------------------------------------
A0A167HVD6      ------------------------------------------------------------
A0A1V3SCT6      ------------------------------------------------------------
L0H287          ------------------------------------------------------------
A0A495VG93      ------------------------------------------------------------
A0A4R3MYM4      ------------------------------------------------------------
G2E3C0          ------------------------------------------------------------
                                                                            

E1Y9C0          ------------------------------------------------------------
A0A1N6SH58      ------------------------------------------------------------
A0A4Q3AQN2      ------------------------------------------------------------
A0A1W9HS52      --------------------------------MNDRGRTSRALAHSGFDNGDYIFINPRQ
A0A2D5LFD8      AAPIKLLVELLEKNMAPSKSPLDIEKKR-----DHATDQSSGNEGESLEGGASYSEFRQI
A0A4D8PLT4      KAAARPFAAIRHAHPGPDRQPARRKGRRREFFDRQRRDASRPRSARQRPSGQSSAIGRGR
A0A7J5VV32      ------------------------------------------------------------
A0A6G6X2Z4      ------------------------------------------------------------
Q44570          ------------------------------------------------------------
A0A3N5MZ53      ------------------------------------------------------------
A0A534E4H4      ------------------------------------------------------------
A0A534I2B6      ------------------------------------------------------------
A0A1C2JGD0      ------------------------------------------------------------
A0A259LQ70      ------------------------------------------------------------
A0A4V2SPR5      ------------------------------------------------------------
A0A3N5PM86      ------------------------------------------------------------
A0A2E5YSA4      ------------------------------------------------------------
A0A0N0XAV4      ------------------------------------------------------------
A0A0P9QD19      ------------------------------------------------------------
F3FHG4          ------------------------------------------------------------
F3GGI0          ------------------------------------------------------------
A0A0P9LE74      ------------------------------------------------------------
A0A3M4ZQ14      VVRSQSLDSLDRRAVLPDRAGLRDSGDALLPGQCHDPDRAQKNWHRGHARGQRQADVSVP
A0A3M5YLE8      VVRSQSLDSLDRRAVLPDRAGLRDSGDALLPGQCHDPDRAQKNWHRGHARGQRQADVSVP
A0A3M3RP89      VVRSQSLDSLDRRAVLPDRAGLRDSGDALLPGQCHDPDRAQKNWHRGHARGQRQADVSVP
A0A0P9QIY7      VVRSQSLDSLDRRAVLPYRAGLRDSGDALLPGQCHDPDRAQKNRHRGHARGQRQADVSVP
A0A0P9VVH7      VVRSQSLDSLDRRAVLPDRAGLRDSGDALLPGQCHDPDRAQKNWHRGHARGQRQADVSVP
A0A0Q0FJK6      VVRSQSLDSLDRRAVLPDRAGLRDSGDALLPGQCHDPDRAQKNRHRGHARGQRQADVSVP
A0A0Q0G2J0      VVRSQSLDSLDRRAVLPDRAGLRDSGDALLPGQCHDPDRAQKNWHRGHARGQRQADVSVP
A0A3M3LF66      VVRSQSLDSLDRRAVLPDRAGLRDSGDALLPGQCHDPDRAQKNWHRGHARGQRQADVSVP
A0A0P9WIR8      VVRSQSLDSLDRRAVLPYRAGLRDSGDALLPGQCHDPDRAQKNRHRGHARGQRQADVSVP
A0A3M3KPE5      ------------------------------------------------------------
A0A3M4C263      ------------------------------------------------------------
A0A3M5AD05      ------------------------------------------------------------
A0A0Q0D3D2      ---------FQR------------------------------------------------
A0A0N0FS39      ------------------------------------------------------------
A0A3M6GHH2      ------------------------------------------------------------
A0A0P9R9W0      AVRPQDPDRVDRRPVFSGGSGLCHSRHAGVSGHRHDSDRAQKNRHRRHSGGQRQTTLSVA
A0A0Q0B9T0      AVRPQDPDRVDRRPVFSGGSGLCHSRHAGVSGHRHDSDRAQKNRHRRHSGGQRQTTLSVA
A0A3M6CFI7      AVRPQDPDRVDRRPVFSGGSGLCHSRHAGVSGHRHDSDRAQKNRHRRHSGGQRQTTLSVA
A0A0P9JXN0      AVRPQDPDRVDRRPVFSGGSGVCHSRHAGVSGHRHDSDRAQKNRHRRHSGGQRQTTLGVA
A0A3M6FIV7      AVRPQDPDRVDRRPVFSGGSGVCHSRHAGVSGHRHDSDRAQKNRHRRHSGGQRQTTLGVA
A0A3M3PLW9      ---------------------------------------------MPSHSRCRRXXTTEI
A0A3M4ENY1      ------------------------------------------------------------
A0A3M5EZK7      ------------------------------------------------------------
A0A0P9SPP5      -------------------------------------------------------MVSVA
A0A658KL17      -------------------------------------------------------MVSVA
A0A3M3NNF2      -------------------------------------------------------MVSVA
A0A3M4A0E8      ---------MDRQPVFSDRPGLRHSGHAGVSGHRHDSDRAPKNRHRGHPGGQRQAIVSVT
A0A3M4PBZ2      ---------MDRQPVFSDRPGLRHSGHAGVSGHRHDSDRAPKNRHRGHPGGQRQAIVSVT
A0A3M6AI26      ---------MDRQPVFSDRSGLCHSGHSGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A0P9IWP8      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A0P9KZ49      ---------MDRQPVFSDRSGLCHSGHSGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A0P9V840      ---------MDRQPVFSDRSGLCHSGHSGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A0Q0AIE5      ---------MDRQPVFSDRSGLCHSGHSGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A3M2ZQH6      ---------MDRQPVFSDRSGLCHSGHSGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A0N8SQG2      ---------MDRQPVFSDRSGLCHSGHSGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A0W8HFU1      ---------MDRQPVFSDRSGLCHSGHSGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A3M5M873      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHSRGQRQAIVSVA
A0A0P9VHH8      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A0P9YV98      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A3M3G2W8      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A3M6C224      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A3M5K254      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A3M5JFB0      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A3M3TQV3      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A3M3EF92      ---------MDRQPVFSDRSGLCHSGHAGVSDHRHDSDRAPKNRHRGHPGGQRQAIVSVA
A0A3M5J1E2      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDSDRAPKNRHRGHPGGQRQAIVSVA
A0A3M5G7H9      ---------MDRQPVFSDLSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A3M4A376      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A0Q0A5T8      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A0P9SCD7      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A0P9T4G3      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A0P9VKB0      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A0Q0BM35      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A3M3TPR7      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A3M3U4Q3      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A0P9UCX7      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A0P9S1F1      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHSRGQRQAIVSVA
A0A0P9QCJ2      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A0P9Q329      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A3M5GJ64      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A0P9MPC7      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A3M2XYQ3      ---------MDRRPVFSARPGLRHSGHAGVSGHRHDSDRTPKNRHRGYAGSQCQATLGVA
A0A0P9XCE1      ---------MDRRPVFSARPGLRHSGHAGVSGHRHDSDRTPKNRHRGYTGSQCQATLGVA
A0A3M3EFX7      ---------MDRRPVFSARHGLRHSGHAGVSGHRHDSDRTPKNRHRGYAGSQCQATLGVA
A0A3M5B9D9      ---------MDCRPVFSARPGLRHSGHAGVSGHRHDSDRTPKNRHRGYAGSQCQATLGVA
A0A0P9RRZ3      ---------MDSQPVFSDRPGLCHSGHAGLSGHRHDSDRAEKNRHRGYPRGQRQATLGVA
A0A3M2VEK7      ---------MDRRRVFPDRPGLCHSGHTGVSGHRHDSDRASENRHRGHARSQCQATLGVA
A0A0N8R9B3      ---------MDRRRVFSDRPGLCHSCHAGVSGHRHDSDRASENRHRGHAGSQCQATLGVA
A0A0P9VA27      ---------MDRRRVFSDRPGLCHSCHAGVSGHRHDSDRASKNRHRGHAGSQCQATLGVA
A0A3M4YBJ4      ---------MDRRRVFPDRPGLCHSGHTGVSGHRHDSDRASENRHRGHAGSQCQATLGVA
A0A0P9J470      ---------MDRRRVFSDRPGLCHSCHAGVSGHRHDSDRAPENRHRGHAGGQCQATLGVA
A0A0Q0EVJ8      ---------MDRRRVFSDRPGLCHSGHAGVSGHRHDSDRAPENRHRGHAGGQCQATLGVA
A0A3M5UI30      ---------MDRQPVFSDRSGLCHSGHSGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A3M5YQT8      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVA
A0A3M5F5X1      ---------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHSRGQRQAIVSVA
A0A3M5R8G1      ------------------------------------------------------AIVSVA
A0A3M5V012      ------------------------------------------------------AIVNVA
A0A3M3GA16      ----------------------------------------------------RKAIVSVA
A0A3M3UCT3      AVRSQDPDPVDRRRVFPDRPGLCHSGHTGVPGYRHDSDRASENRHRGHAGSQCQATLGVA
A0A3M3CJL0      AVRSQDPDPVDRRRVFPDRPGLCHSGHTGVSGHRHDSDRASKNRHRGHTGSQRQATLGVA
A0A3M3F6F5      AVRSQDPDPVDRRRVFPDRPGLCHSGHTGVSGHRHDSDRASENRHRGHAGSQCQATLGVA
A0A3M3P9B7      AVRSQDPDPVDRRRVFPDRPGLCHSGHTGVSGHRHDSDRASENRHRGHAGSQCQATLGVA
A0A0N8QB74      AVRSQDPDPVDRRRVFPDRPGLCHSGHTGVSGHRHDSDRASENRHRGHAGSQCQATLGVA
A0A0Q0AUD0      AVRSQDPDPVDRRRVFPDRPGLCHSGHTGVSGHRHDSDRASENRHRGHAGSQCQATLGVA
A0A3M5VR55      AVRSQDPDPVDRRRVFPDRPGLCHSGHTGVSGHRHDSDRASENRHRGHARSQCQATLGVA
A0A0Q0FK97      AVRSQDPDPVDRRRVFPDRPGLCHSGHTGVSGHRHDSDRASENRHRGHAGSQCQATLGVA
A0A3M5KZ75      ------------------------------------------MPSHSRCRRRPXXXTTEI
A0A3M5L3G5      ------------------------------------------------------------
A0A519ERR1      ------------------------------------------------------------
A0A4Q3Q1M2      ------------------------------------------------------------
A0A4Q3MHR1      ------------------------------------------------------------
A0A520GDZ4      ------------------------------------------------------------
A0A318DSU0      ------------------------------------------------------------
A0A538PF21      ------------------------------------------------------------
A0A1W1ZH10      ------------------------------------------------------------
A0A1W2FF24      ------------------------------------------------------------
A0A524JYQ6      ------------------------------------------------------------
A0A4Q3MA17      ------------------------------------------------------------
A0A0N0M5F7      ------------------------------------------------------------
A0A537M754      ------------------------------------------------------------
A0A1V1PDB4      ------------------------------------------------------------
A0A2M7C324      ------------------------------------------------------------
A0A4Q3HHG6      ------------------------------------------------------------
A0A3B7DTA4      ------------------------------------------------------------
A0A432ZK62      ------------------------------------------------------------
A0A1V5EEP4      ------------------------------------------------------------
A0A1V5EF48      ------------------------------------------------------------
A0A0S6X1X6      ------------------------------------------------------------
A0A537Y5L8      ------------------------------------------------------------
A0A4Q3L2X2      ------------------------------------------------------------
A0A4Q3T8J1      ------------------------------------------------------------
A0A4Q4ANM4      ------------------------------------------------------------
A0A4Q3UEC7      ------------------------------------------------------------
A0A1H5YYQ4      ------------------------------------------------------------
A0A1X4NLK2      ------------------------------------------------------------
A0A1X4NWB5      ------------------------------------------------------------
A0A1M5UQ38      ------------------------------------------------------------
A0A327YI48      ------------------------------------------------------------
A0A1B1PNL6      ------------------------------------------------------------
A0A2U8H9H9      ------------------------------------------------------------
A0A6B2NBB8      ------------------------------------------------------------
A0A1X6YIC0      ------------------------------------------------------------
A0A1I5E9E9      ------------------------------------------------------------
A0A1X6Z7N7      ------------------------------------------------------------
A0A2E1DQ13      ------------------------------------------------------------
A0A1H8C800      ------------------------------------------------------------
A0A2N3EZ05      ------------------------------------------------------------
A0A655R819      ------------------------------------------------------------
A0A655RNN3      ------------------------------------------------------------
A0A0R0BVC7      ------------------------------------------------------------
A0A3N5J7U8      ------------------------------------------------------------
A0A1S7S3I8      ------------------------------------------------------------
A0A519E8D7      ------------------------------------------------------------
A0A3S1FD32      ------------------------------------------------------------
A0A434DUT4      ------------------------------------------------------------
A0A528D3U3      ------------------------------------------------------------
A0A3S3UPT3      ------------------------------------------------------------
A0A3S1E286      ------------------------------------------------------------
A0A531AC71      ------------------------------------------------------------
A0A436K268      ------------------------------------------------------------
A0A434IDQ0      ------------------------------------------------------------
A0A435IRM5      ------------------------------------------------------------
A0A3S2C404      ------------------------------------------------------------
A0A435F6C0      ------------------------------------------------------------
A0A435BMN6      ------------------------------------------------------------
A0A529XQ54      ------------------------------------------------------------
A0A530BJC1      ------------------------------------------------------------
A0A348SRI7      ------------------------------------------------------------
A0A354EI73      ------------------------------------------------------------
A0A4P7EP83      ------------------------------------------------------------
A0A6I1QB25      ------------------------------------------------------------
A0A655ZZQ1      ------------------------------------------------------------
A0A1S0ZAI3      ------------------------------------------------------------
A0A3A4NIE9      ------------------------------------------------------------
A0A3A4NUI9      ------------------------------------------------------------
A0A524I3Z6      ------------------------------------------------------------
A0A524PCL7      ------------------------------------------------------------
A0A356GQV1      ------------------------------------------------------------
A0A1J5DAY8      ------------------------------------------------------------
A0A524P237      ------------------------------------------------------------
A0A3C0L0A8      ------------------------------------------------------------
A0A176S762      ------------------------------------------------------------
A0A377ZC40      ------------------------------------------------------------
A0A378BPJ7      ------------------------------------------------------------
A0A2J5PAJ7      ------------------------------------------------------------
A0A377ZDN3      ------------------------------------------------------------
A0A7A9Y5Q1      ------------------------------------------------------------
A0A1G3JY11      ------------------------------------------------------------
A0A661N3U1      ------------------------------------------------------------
A0A1W9WUD9      ------------------------------------------------------------
A0A1W1ZQK0      ------------------------------------------------------------
A0A6I1R304      ------------------------------------------------------------
A0A1W9PMU6      ------------------------------------------------------------
A0A3S1WTQ1      ------------------------------------------------------------
A0A530CUR9      ------------------------------------------------------------
A0A6L6H5T1      ------------------------------------------------------------
A0A6D0ELN7      ------------------------------------------------------------
A0A1M6N1X5      ------------------------------------------------------------
A0A561M3U0      ------------------------------------------------------------
A0A2N6BZD5      ------------------------------------------------------------
A0A1G3VVY5      ------------------------------------------------------------
A0A7C3S273      ------------------------------------------------------------
A0A7C4WJ18      ------------------------------------------------------------
A0A7C3V565      ------------------------------------------------------------
A0A351B422      ------------------------------------------------------------
F2NEE9          ------------------------------------------------------------
A0A2W5J775      ------------------------------------------------------------
A0A352Q5C1      ------------------------------------------------------------
A0A435NNF5      ------------------------------------------------------------
A0A3S2AQS7      ------------------------------------------------------------
A0A436XH86      ------------------------------------------------------------
A0A527ZPD6      ------------------------------------------------------------
A0A529KRW3      ------------------------------------------------------------
A0A530ZLX0      ------------------------------------------------------------
A0A355TB56      ------------------------------------------------------------
A0A1F9E324      ------------------------------------------------------------
A0A432SAI6      ------------------------------------------------------------
A0A4Q3LBH4      ------------------------------------------------------------
A0A4Q3LWP3      ------------------------------------------------------------
A0A7C3JPP4      ------------------------------------------------------------
A0A534V9L7      ------------------------------------------------------------
A0A7C3JJT4      ------------------------------------------------------------
A0A2N6VGL1      ------------------------------------------------------------
A0A3M3H5V6      ------------------------------------------------------------
A0A524M660      ------------------------------------------------------------
A0A7C3JSX5      ------------------------------------------------------------
A0A7I8MQ67      ------------------------------------------------------------
A0A0C1TRU6      ------------------------------------------------------------
A0A2Z5SSF4      ------------------------------------------------------------
A0A2T4ZJZ6      ------------------------------------------------------------
A0A0B8PTA8      ------------------------------------------------------------
A0A0B8QF75      ------------------------------------------------------------
A0A6P2T4F7      ------------------------------------------------------------
A0A4Q4CIB1      ------------------------------------------------------------
A0A522ACJ9      ------------------------------------------------------------
A0A1T2KYM8      ------------------------------------------------------------
A0A3N5Z7F8      ------------------------------------------------------------
A0A239HD34      ------------------------------------------------------------
A0A2G9ZR82      ------------------------------------------------------------
A0A4U9I390      ------------------------------------------------------------
A0A0P7ZZE4      ------------------------------------------------------------
A0A369R0Q9      ------------------------------------------------------------
A0A327LYE6      ------------------------------------------------------------
A0A5A9ZTV3      ------------------------------------------------------------
A0A6J4YZ98      ------------------------------------------------------------
A0A2X3M011      ------------------------------------------------------------
I2WC85          ------------------------------------------------------------
A0A7A9K1G5      ------------------------------------------------------------
A0A7B7KSB7      ------------------------------------------------------------
A0A400JH80      ------------------------------------------------------------
A0A479JNB1      ------------------------------------------------------------
A0A5C9AF52      ------------------------------------------------------------
A0A797FC39      ------------------------------------------------------------
A0A797FHC1      ------------------------------------------------------------
D8EEU7          ------------------------------------------------------------
A0A6D0EYC7      ------------------------------------------------------------
A0A7A6DHB0      ------------------------------------------------------------
A0A2H9EHM4      ------------------------------------------------------------
A0A7A5MLK0      ------------------------------------------------------------
A0A380B3D7      ------------------------------------------------------------
F5NSX0          ------------------------------------------------------------
A0A534XP85      ------------------------------------------------------------
A0A0P1H2H0      ------------------------------------------------------------
A0A258WKV0      ------------------------------------------------------------
A0A377N8F8      ------------------------------------------------------------
A5G4N9          ------------------------------------------------------------
A0A3C2DSE7      ------------------------------------------------------------
A0A2X1JBG5      ------------------------------------------------------------
A0A377LY04      ------------------------------------------------------------
A0A5C9ABR5      ------------------------------------------------------------
A0A5J9WU72      ------------------------------------------------------------
A0A2X3K9R3      ------------------------------------------------------------
A0A3T9EHW9      ------------------------------------------------------------
A0A484X141      ------------------------------------------------------------
A0A5N9VWI6      ------------------------------------------------------------
A0A6D0EJQ0      ------------------------------------------------------------
A0A444R390      ------------------------------------------------------------
A0A376LLF8      ------------------------------------------------------------
A0A6L7CT21      ------------------------------------------------------------
A0A4Q3LR91      ------------------------------------------------------------
A0A6C9IKN8      ------------------------------------------------------------
A0A4V1TR68      ------------------------------------------------------------
A0A444IY46      ------------------------------------------------------------
A0A6I7N627      ------------------------------------------------------------
A0A6L3ZR06      ------------------------------------------------------------
A0A3E0WKI3      ------------------------------------------------------------
A0A1H3I2J1      ------------------------------------------------------------
A0A1V5DJV0      ------------------------------------------------------------
A0A520IUC4      ------------------------------------------------------------
A0A521LJG5      ------------------------------------------------------------
A0A531IBQ7      ------------------------------------------------------------
A0A0P1FWI8      ------------------------------------------------------------
A0A6L8LHC6      ------------------------------------------------------------
A0A1V4WHZ7      ------------------------------------------------------------
A0A1E5AJN5      ---------------------MADQQHSHSSNPGPVFLPGEASGTGNFVPSLGGSLLTDP
A0A2N3D2J1      ------------------------------------------------------------
A0A2N2GVE1      ------------------------------------------------MAEPLGPFDAAP
A0A2N2INV3      ------------------------------------------------MAEPLGPFDAAP
A0A233IKJ2      ------------------------------------------------------------
A0A1Y5DXG5      ------------------------------------------------------------
A0A0B8P2H5      ------------------------------------------------------------
A0A380AQW6      ------------------------------------------------------------
A0A2G2GD62      SIAFIVVVFIIISGIMAYFKPSMYFSTAVVQISEKGRSGWNDPVLTALGLGDSQGQNIDS
A0A3R9C3P5      ------------------------------MTISTLPPDRNLPISPMRYDPRFQVETKAD
A0A0M3GBT1      ------------------------------------------------------------
B3Q577          ------------------------------------------------------------
A0A483QWI8      ------------------------------------------------------------
A0A483UXD3      ------------------------------------------------------------
A0A0A8J8L3      ------------------------------------------------------------
A0A660DJ38      ------------------------------------------------------------
A0A524P331      ------------------------------------------------------------
A0A4V1SSM5      ------------------------------------------------------------
A0A4Q3K8G7      ------------------------------------------------------------
A0A7C7W7M2      -----------------------------------------MASQPELYDEIVDYRYYLE
A0A1M7HC79      ------------------------------------------------------------
A0A1D3JZN6      ------------------------------------------------------------
A0A1V6ESG1      ------------------------------------------------------------
A0A1H7YHK3      ------------------------------------------------------------
A0A534SH66      ------------------------------------------------------------
A0A3M0ZZ99      ------------------------------------------------------------
A0A238LBD3      ------------------------------------------------------------
A0A328C2K5      ------------------------------------------------MSDQYGFQEPRS
A0A5C6X8M3      ------------------------------------------------MSDQYGFQEPRP
A0A3D8MRR7      ------------------------------------------------MSDQYGFQEPRQ
A0A5C6UBJ7      ------------------------------------------------MSDQYGFQEPRQ
A0A5C6XGM3      ------------------------------------------------MSDQYGFQEPRP
A0A537NZJ1      ------------------------------------------------------------
A0A7C4R3C4      ------------------------------------------------------------
A0A0P1FRV5      ------------------------------------------------------------
A0A4Q4CVW6      ------------------------------------------------------------
A0A090R136      ------------------------------------------------------------
A0A661JU93      ------------------------------------------------------------
A0A2E2T3V8      ------------------------------------------------------------
A0A367UAB4      ------------------------------------------------------------
A0A1F2ZW35      -----------------MPRQGSAGPEDASSELWGWLRLVNRHKTLIIGCGLVAVVLMAL
A0A377V641      ------------------------------------------------------------
A0A1F2YJ88      ------------------------------------------------------------
A0A6L3ZWI0      ------------------------------------------------------------
A0A5N8AL61      ---------------------------------MYPHKAVKIQEQRVNAEPKPSSPQAPG
A0A0J7XGZ1      ------------------------------------------------------------
I4CBA7          ------------------------------------------------------------
A3VE95          ------------------------------------------------------MTTFDM
A0A1G0NL95      ------------------------------------------------------------
A0A024KA69      ------------------------------------------------------------
A0A0L1KFN4      ------------------------------------------------------------
A0A3P5DSS6      ------------------------------------------------------------
A0A483YEL5      ------------------------------------------------------------
A0A658GUJ0      ------------------------------------------------------------
A0A358L616      ------------------------------------------------------------
A0A1M7BLL7      ------------------------------------------------------------
A0A0H4KZM1      ------------------------------------------------------------
A0A3D5UYX7      ------------------------------------------------------------
A0A2N1WQN5      ------------------------------------------------------------
A0A352G2C2      ------------------------------------------------------------
A0A3C0PZN1      ------------------------------------------------------------
A0A524QFS4      ---------------MRADEEKSKIQGRDPATGSGSDGKESRRQQGNVPRVGPGVDAPRG
A0A520JSW4      ---------------------------------------------------MPDVFVQSS
A0A1V1UJT2      ------------------------------------------------------------
A0A0L6CVX1      ------------------------------------------------------------
A0A1V0RR48      ------------------------------------------------------------
A0A0A0HJJ4      ------------------------------------------------------------
A0A5E7YA28      ------------------------------------------------------------
A0A4Q3LTF3      ------------------------------------------------------------
A0A7C3N3Y1      ------------------------------------------------------------
A0A537UTP9      ------------------------------------------------------------
A0A1D2RNR5      ------------------------------------------------------------
A0A4V1TQ46      ------------------------------------------------------------
A0A3A0FZC0      ------------------------------------------------------------
A0A1N7JVZ7      ------------------------------------------------------------
A0A091C4A8      ------------------------------------------------------------
A0A4R3H6P6      ----------------------------------MERISPQMLGLATSEMTLFSGRAAPE
A0A3S1NQ09      ------------------------------------------------------------
A0A443GJ52      ------------------------------------------------------------
A0A6N3RE79      ------------------------------------------------------------
A0A6N9S3L5      ------------------------------------------------------------
A0A656BWB0      ------------------------------------------------------------
A0A6D0IFH4      ------------------------------------------------------------
A0A7A3MK38      ------------------------------------------------------------
A0A0A0FHV8      ------------------------------------------------------------
A0A1X3IPU7      ------------------------------------------------------------
A0A0A0G0N2      ------------------------------------------------------------
A0A2I8SDU4      ------------------------------------------------------------
A0A2I8SU55      ------------------------------------------------------------
A0A7I6T806      ------------------------------------------------------------
A0A7I6TQE9      ------------------------------------------------------------
A0A7I6U296      ------------------------------------------------------------
S1EXJ6          ------------------------------------------------------------
A0A376UBS1      ------------------------------------------------------------
A0A2W6S588      ------------------------------------------------------------
A0A483E0N4      ------------------------------------------------------------
A0A2J4YQQ6      ------------------------------------------------------------
A0A483THX4      ------------------------------------------------------------
A0A534MVS2      ------------------------------------------------------------
A0A444I5K6      ------------------------------------------------------------
A0A154VE85      -------------------------MSALAPLQPNPAARAGMAPSPADAPMPLRRGLSRN
A0A3S1MCW7      ------------------------------------------------------------
A0A434IGN6      ------------------------------------------------------------
A0A528AX40      ------------------------------------------------------------
A0A528MV95      ------------------------------------------------------------
A0A3C1S9Y1      ------------------------------------------------------------
A0A353EH49      ------------------------------------------------------------
A0A1Y1Q9C1      ------------------------------------------------------------
A0A3M7LJH0      ------------------------------------------------------------
A0A316KRG4      ------------------------------------------------------------
A0A1E4JHX8      ------------------------------------------------------------
M2U8P2          -------------------------------------------------------MTADF
A0A1H7KZF8      -----------------------------------------------------MNAPFGR
A0A0J5Q9T7      ------------------------------------------------------------
A0A6N3UC48      ------------------------------------------------------------
A0A257NG76      ------------------------------------------------------------
A0A1T4TW59      ------------------------------------------------------------
A0A1I5YYQ0      ------------------------------------------------------------
A0A5P9FE62      ------------------------------------------------------------
A0A1Q3MB35      ------------------------------------------------------------
A0A259LUN7      ------------------------------------------------------------
A0A2D7AVL1      ------------------------------------------------------------
A0A3B9KZE9      ------------------------------------------------------------
A0A2U0NMP8      ------------------------------------------------------------
A0A4U9HNE9      ------------------------------------------------------------
A0A7C5N053      ------------------------------------------------------------
A0A2G2CXY6      ------------------------------------------------------------
A0A3M1D4H3      ------------------------------------------------------------
A0A7C1A2A2      LLARPVFRANGSLYLGDVSKKSGLGGESEQGIGVSMLFGGLLGGSGIETQIEILKSRDLV
A0A5C8BYM7      ------------------------------------------------------------
A0A1J5ICP0      ------------------------------------------------------------
A0A379B9V4      ------------------------------------------------------------
A0A0Q6TS97      ------------------------------------------------------------
A0A0Q6UYB4      ------------------------------------------------------------
A0A484XS37      ------------------------------------------------------------
W7Q5J0          ----------------------NTSAEIQILQSRMVLGHAVDRLGQENIIRPVTMPIIGD
A0A654AKT6      ------------------------------------------------------------
A0A7A9JY19      ------------------------------------------------------------
A0A0G9MZA5      ------------------------------------------------------------
H0T8B0          ------------------------------------------------------------
A0A5C7N981      ------------------------------------------------------------
A0A534TV22      ------------------------------------------------------------
A0A351CXR4      ------------------------------------------------------------
A0A2N6GLF5      ------------------------------------------------------------
A0A1W9LJP0      ------------------------------------------------------------
A0A0W1ICB0      ------------------------------------------------------------
A0A7C1C8G2      ------------------------------------------------------------
A0A376KYN0      ------------------------------------------------------------
A0A7A9J338      ------------------------------------------------------------
A0A377E5P7      ------------------------------------------------------------
A0A2X1JB05      ------------------------------------------------------------
A0A376RML0      ------------------------------------------------------------
A0A6N3QTV2      ------------------------------------------------------------
A0A2E0UL88      ------------------------------------------------------------
A0A0T2QIS1      ------------------------------------------------------------
A0A0P7Y1D0      ------------------------------------------------------------
A0A542J310      ------------------------------------------------------------
A0A2M7JRZ7      ------------------------------------------------------------
A0A167IR75      ------------------------------------------------------------
A0A3B8T2U6      ------------------------------------------------------------
A0A365PWR2      ------------------------------------------------------------
A0A2E9H5Z8      ------------------------------------------------------------
A0A2E2BR79      ------------------------------------------------------------
A0A6I4IKZ3      ------------------------------------------------------------
A0A7H4JZ79      ------------------------------------------------------------
A0A0Q4Q524      ------------------------------------------------------------
A0A0Q4CFJ9      ------------------------------------------------------------
A0A0Q4FE58      ------------------------------------------------------------
A0A0Q4JWC8      ------------------------------------------------------------
A0A0Q4KFL8      ------------------------------------------------------------
A0A522R8R0      ------------------------------------------------------------
A0A2U9NDY5      ------------------------------------------------------------
X7F6S5          ------------------------------------------------------------
A0A1G8NKI0      ------------------------------------------------------------
A0A355QPE4      ------------------------------------------------------------
A0A357RN98      ------------------------------------------------------------
A0A1I6U4V1      ------------------------------------------------------------
A0A6B2P8H8      ------------------------------------------------------------
A0A1P8USW9      ------------------------------------------------------------
A0A1G7CFZ2      ------------------------------------------------------------
A0A7G2TPW1      ------------------------------------------------------------
A0A0Q4IGG1      ------------------------------------------------------------
A0A534RUJ5      ------------------------------------------------------------
A0A3M1CJM3      ------------------------------------------------------------
A0A2R7SVD4      ------------------------------------------------------------
A0A3C0PWB6      ------------------------------------------------------------
V4Q8B7          ------------------------------------------------------------
A0A0Q8XKK5      ------------------------------------------------------------
A0A2E0Q2W0      ------------------------------------------------------------
A0A660NIR6      ------------------------------------------------------------
A0A142W0R3      ------------------------------------------------------------
A0A0S4XR18      ------------------------------------------------------------
A0A7C5CFF1      ------------------------------------------------------------
A0A2E0GW64      ------------------------------------------------------------
A0A1A7QJ97      ------------------------------------------------------------
A0A661LW70      ------------------------------------------------------------
W7Q8F9          ------------------------------------------------------------
A0A524PXH8      ------------------------------------------------------------
A0A4Q3P0E4      ------------------------------------------------------------
A0A3M2BE89      ------------------------------------------------------------
A0A4Q4A6K6      ------------------------------------------------------------
A0A257G674      ------------------------------------------------------------
A0A661M5M6      ------------------------------------------------------------
A0A1I1UM01      ------------------------------------------------------------
Q44573          ------------------------------------------------------------
A2W025          ------------------------------------------------------------
A0A534Z362      PLFPLPDPTGAQPTPPGGYLPPPIIDAEFSGAPRHLREYLWVLHKYRWLAATCFGLTFGL
V4J283          ------------------------------------------------------------
A0A536T443      ------------------------------------------------------------
A0A0Q4UFQ5      ------------------------------------------------------------
A0A527W7E6      ------------------------------------------------------------
A0A432EMV7      ------------------------------------------------------------
A0A7C1SEU7      ------------------------------------------------------------
A0A534WLI3      ------------------------------------------------------------
A0A7C6FBW0      ------------------------------------------------------------
A0A087LTV7      ------------------------------------------------------------
A0A7D7WSS2      ------------------------------------------------------------
A0A318KWA2      ------------------------------------------------------------
A0A522MT86      ------------------------------------------------------------
A0A4Q3I221      ------------------------------------------------------------
A0A534SAL6      QALTSRPADTRLSAPGGYAAAGVIDAEFSEVPARHLRDYLRLLYKYRWLAATCLA-----
A0A534ZDB4      QALASRATDSRLTAPGGYAAAGVIDAEFSEVPARHLRDYLRLLYKYRWLAATCLALTLGL
A0A534X3M7      VPLRGASAPEQLPPGGGYLPPPIFDAEFSEQP-RHLRAHLSVLHKHRWLAVTCFAVTVVS
A0A534SPC6      ------------------------------------------------------------
A0A535AD60      LPADPTGAQPTPPGGYLHLPPPIIDAEFSEAP-RHLREHLWVLHKYRWLAATCFGLTFGL
A0A4Q3SY08      ------------------------------------------------------------
A0A4Q3LG23      ------------------------------------------------------------
A0A522EX52      ------------------------------------------------------------
A0A1H3KC95      ------------------------------------------------------------
A0A5P8Z4P3      ------------------------------------------------------------
A0A2E9HXF7      ------------------------------------------------------------
A0A0B3RZC9      ------------------------------------------------------------
A0A6F8QET1      ------------------------------------------------------------
A0A520HUH4      ------------------------------------------------------------
A0A2K8U7M6      ------------------------------------------------------------
A0A5B9DKL8      ------------------------------------------------------------
A0A238KJM1      ------------------------------------------------------------
A0A3A0FJZ4      ------------------------------------------------------------
W4HJV8          ------------------------------------------------------------
A0A0P1GDI0      ------------------------------------------------------------
A0A2R8ATV5      ------------------------------------------------------------
A0A1U7D3R6      ------------------------------------------------------------
A0A2D4UVV2      ------------------------------------------------------------
A0A0W7WHP4      ------------------------------------------------------------
A0A238J8F6      ------------------------------------------------------------
A0A238JQI6      ------------------------------------------------------------
A0A222E077      ------------------------------------------------------------
A0A239E3Y2      ------------------------------------------------------------
A0A534QGR3      ------------------------------------------------------------
A0A1F9CFF0      ------------------------------------------------------------
A0A2M8B0G5      ------------------------------------------------------------
A0A363TNU9      ------------------------------------------------------------
A0A0W1GMS6      ------------------------------------------------------------
A0A0Q8RMY3      ------------------------------------------------------------
A0A1A7QC21      ------------------------------------------------------------
A0A2W4RFS2      ------------------------------------------------------------
A0A1Y6DC43      ------------------------------------------------------------
A0A2S6HE06      ------------------------------------------------------------
G3J0M3          ------------------------------------------------------------
V5C6R5          ------------------------------------------------------------
A0A534HBS8      ------------------------------------------------------------
A0A0F0T3Y9      ------------------------------------------------------------
A0A379GWF0      ------------------------------------------------------------
A0A4Q2XLV7      ------------------------------------------------------------
A0A4Q5QYC4      ------------------------------------------------------------
A0A3B8SQ27      ------------------------------------------------------------
A0A0U2VAW2      ------------------------------------------------------------
A0A454CTF1      ------------------------------------------------------------
A0A6B3Q2G1      ------------------------------------------------------------
A0A4Q6G931      ------------------------------------------------------------
A0A2T0VBD8      ------------------------------------------------------------
A0A378APS2      ------------------------------------------------------------
A0A443VCQ6      ------------------------------------------------------------
A0A447RKQ7      ------------------------------------------------------------
W1DSK1          ------------------------------------------------------------
A0A2N1XK22      ------------------------------------------------------------
A0A3D0KAC8      ------------------------------------------------------------
A0A3D2Y902      ------------------------------------------------------------
A0A378G3G7      ------------------------------------------------------------
A0A2X5NHJ9      ------------------------------------------------------------
A0A2J4QEC3      ------------------------------------------------------------
A0A485ADM3      ------------------------------------------------------------
A0A4U9HGU4      ------------------------------------------------------------
A0A3S4JGG5      ------------------------------------------------------------
A0A377ZDH2      ------------------------------------------------------------
A0A3S4HTS8      ------------------------------------------------------------
A0A1W9F5M9      ------------------------------------------------------------
A0A379W6R2      ------------------------------------------------------------
A0A379TA56      ------------------------------------------------------------
A0A655C5P0      ------------------------------------------------------------
A0A6D0I9G1      ------------------------------------------------------------
A0A352MMI7      ------------------------------------------------------------
A0A4Z0LWV1      ------------------------------------------------------------
A0A377K431      ------------------------------------------------------------
A0A376RY66      ------------------------------------------------------------
A0A778GAM7      ------------------------------------------------------------
A0A3C2BN18      ------------------------------------------------------------
A0A447LR75      ------------------------------------------------------------
A0A759KJJ5      ------------------------------------------------------------
A0A376D8L7      ------------------------------------------------------------
A0A1V2FV46      ------------------------------------------------------------
A0A6N8QLT3      ------------------------------------------------------------
A0A376SB61      ------------------------------------------------------------
A0A3D1BYV9      ------------------------------------------------------------
A0A536T0W8      ------------------------------------------------------------
A0A3D2M6Y9      ------------------------------------------------------------
A0A3D2YAZ2      ------------------------------------------------------------
A0A350A102      ------------------------------------------------------------
A0A350L5D2      ------------------------------------------------------------
A0A2G9XLE5      ------------------------------------------------------------
A0A6L3MM74      ------------------------------------------------------------
A0A7C3QM04      ------------------------------------------------------------
A0A7I8MVM0      ------------------------------------------------------------
A0A7C0Y3J7      ------------------------------------------------------------
A0A7C3LF61      ------------------------------------------------------------
A0A4R1HDF2      ------------------------------------------------------------
A0A6N1DL48      ------------------------------------------------------------
A0A1V6FYJ1      ------------------------------------------------------------
A0A0C5VQ86      ------------------------------------------------------------
A0A0Q6QV61      ------------------------------------------------------------
A0A2Z3IKG4      ------------------------------------------------------------
A0A3N5RNY4      ------------------------------------------------------------
A0A4Z0M4C7      ------------------------------------------------------------
A0A5Q2QDL1      ------------------------------------------------------------
A0A1V8MBH1      ------------------------------------------------------------
A0A6J4X8D4      ------------------------------------------------------------
A0A318CT66      ------------------------------------------------------------
A0A3N5P205      ------------------------------------------------------------
A0A443K010      ------------------------------------------------------------
A0A6I7NYG5      ------------------------------------------------------------
A0A212AR83      ------------------------------------------------------------
A0A2E2P4I0      ------------------------------------------------------------
A0A2U2CM86      ------------------------------------------------------------
A0A1I0R9R6      ------------------------------------------------------------
A0A2N3BVE7      ------------------------------------------------------------
A0A7C2IB02      ------------------------------------------------------------
A0A6N6SI00      ------------------------------------------------------------
A0A2S5JE21      ------------------------------------------------------------
A0A2R8BKZ2      ------------------------------------------------------------
A0A2S8S361      ------------------------------------------------------------
A0A520ZTR8      ------------------------------------------------------------
A0A316GHM6      ------------------------------------------------------------
A0A238IZI1      ------------------------------------------------------------
A0A7C9INT8      ------------------------------------------------------------
A0A6M1UAR9      ------------------------------------------------------------
A0A1X7ACC1      ------------------------------------------------------------
A0A238KUF6      ------------------------------------------------------------
A0A095CTW3      ------------------------------------------------------------
A0A2E3UGD6      ------------------------------------------------------------
A0A2T0RFH0      ------------------------------------------------------------
A0A285D390      ------------------------------------------------------------
A0A497VHN4      ------------------------------------------------------------
A0A2N6BEI9      ------------------------------------------------------------
A0A0D5N3E9      ------------------------------------------------------------
A0A2N2G716      ------------------------------------------------------------
A0A7C1UTU6      ------------------------------------------------------------
W9VVY5          ------------------------------------------------------------
A0A1E2URD3      ------------------------------------------------------------
A0A2T6MY81      ------------------------------------------------------------
A0A2T6NBQ8      ------------------------------------------------------------
A0A421K431      ------------------------------------------------------------
A0A2G2I5M1      ------------------------------------------------------------
A0A2G2M6F0      ------------------------------------------------------------
A0A1W9J9F8      ------------------------------------------------------------
A0A2S5LFJ9      ------------------------------------------------------------
A0A2D8R8F8      ------------------------------------------------------------
A0A6I4JXQ8      ------------------------------------------------------------
A0A010SNS0      ------------------------------------------------------------
A0A0C2I782      ------------------------------------------------------------
A0A2N8BYF5      ------------------------------------------------------------
A0A558FKX2      ------------------------------------------------------------
A0A1H1DBA0      ------------------------------------------------------------
J2TAD5          ------------------------------------------------------------
J3H699          ------------------------------------------------------------
A0A1H5J974      ------------------------------------------------------------
A0A0K1QRZ4      ------------------------------------------------------------
A0A560RJW9      ------------------------------------------------------------
A0A5E6TID7      ------------------------------------------------------------
A0A5E7CRU7      ------------------------------------------------------------
A0A5E7C564      ------------------------------------------------------------
A0A2W7MAV4      ------------------------------------------------------------
A0A4R3WQH5      ------------------------------------------------------------
W6VFG3          ------------------------------------------------------------
A0A1P8ENT1      ------------------------------------------------------------
A0A2N7XRV4      ------------------------------------------------------------
A0A0Q6QPG8      ------------------------------------------------------------
A0A0F4SWA7      ------------------------------------------------------------
A0A423J219      ------------------------------------------------------------
A0A4P6G9U8      ------------------------------------------------------------
A0A4Y8JE06      ------------------------------------------------------------
A0A502I1X9      ------------------------------------------------------------
A0A502J776      ------------------------------------------------------------
A0A5B0EZF6      ------------------------------------------------------------
A0A059L434      ------------------------------------------------------------
A0A0F4UWN2      ------------------------------------------------------------
A0A5E7WEF5      ------------------------------------------------------------
A0A1G0KSD0      ------------------------------------------------------------
A0A4P6WX84      ------------------------------------------------------------
A0A1D2S760      ------------------------------------------------------------
A0A5B8RW94      ------------------------------------------------------------
A0A258TN88      ------------------------------------------------------------
A0A1F9EUS2      ------------------------------------------------------------
A0A6H9HII8      ------------------------------------------------------------
A0A3N9VAW3      ------------------------------------------------------------
A0A1X0YE57      ------------------------------------------------------------
A0A2K2H9Q8      ------------------------------------------------------------
A0A6I1KNW9      ------------------------------------------------------------
A0A1H4B8T3      ------------------------------------------------------------
A0A1E7IQC3      ------------------------------------------------------------
A0A1M6KEN5      ------------------------------------------------------------
A0A353QLL3      ------------------------------------------------------------
A0A399I453      ------------------------------------------------------------
A0A651FBV9      ------------------------------------------------------------
A0A5C1MDH8      ------------------------------------------------------------
A0A7J4ZSX4      ------------------------------------------------------------
A0A5A9XE04      ------------------------------------------------------------
A0A643G9R1      ------------------------------------------------------------
A0A1G0M8Q7      ------------------------------------------------------------
A0A353MI14      ------------------------------------------------------------
A0A4S1CAW7      ------------------------------------------------------------
A0A562VHD2      ------------------------------------------------------------
A0A7K0J0R7      ------------------------------------------------------------
A0A6I6JNB5      ------------------------------------------------------------
A0A1G0LDK7      ------------------------------------------------------------
A0A6F9WVL7      ------------------------------------------------------------
A0A351Z9A2      ------------------------------------------------------------
A0A3N5FRH4      ------------------------------------------------------------
A0A1V4Y2C3      ------------------------------------------------------------
A0A2N2KTJ4      ------------------------------------------------------------
A0A2N2LQX0      ------------------------------------------------------------
A0A318D3U4      ------------------------------------------------------------
A0A401FQP5      ------------------------------------------------------------
A0A7C2AA26      ------------------------------------------------------------
A0A351Z4H9      ------------------------------------------------------------
A0A2N2KML4      ------------------------------------------------------------
E1YJF1          ------------------------------------------------------------
A0A1J5EVZ6      ------------------------------------------------------------
A0A2G6FCC5      ------------------------------------------------------------
A0A1F9MR25      ------------------------------------------------------------
A0A2G6M7F1      ------------------------------------------------------------
A0A7C3Q9R6      ------------------------------------------------------------
A0A1Q6DMW3      ------------------------------------------------------------
A0A3A6P8F8      ------------------------------------------------------------
A0A6L4AM84      ------------------------------------------------------------
A0A2G2DSM4      ------------------------------------------------------------
A0A1F9NI02      ------------------------------------------------------------
A0A4U1ABX4      ------------------------------------------------------------
A0A1W9M770      ------------------------------------------------------------
A0A1W9M7R6      ------------------------------------------------------------
A0A1M7Y300      ------------------------------------------------------------
A0A4U1ALN4      ------------------------------------------------------------
A0A1E7H876      ------------------------------------------------------------
A0A7C0U459      ------------------------------------------------------------
A0A0F2NF69      ------------------------------------------------------------
A0A1F9NFD0      ------------------------------------------------------------
A0A1M5YLH5      ------------------------------------------------------------
A0A4U1A4C7      ------------------------------------------------------------
A0A509L3P8      ------------------------------------------------------------
A0A3A4S038      ------------------------------------------------------------
A0A1F9N669      ------------------------------------------------------------
A0A1F9PFA7      ------------------------------------------------------------
A0A1H2EN09      ------------------------------------------------------------
K0NP00          ------------------------------------------------------------
A0A7C4N0I9      ------------------------------------------------------------
A0A1E7JCL5      ------------------------------------------------------------
A0A496YAH9      ------------------------------------------------------------
A0A1V4S7E4      ------------------------------------------------------------
A0A2N2H8D2      ------------------------------------------------------------
A0A2N2KC63      ------------------------------------------------------------
A0A3A4ZYW4      ------------------------------------------------------------
A0A1V4MCJ4      ------------------------------------------------------------
A0A661M0W4      ------------------------------------------------------------
A0A4U8YLL7      ------------------------------------------------------------
A0A445MZQ4      ------------------------------------------------------------
A0A2M7WWF7      ------------------------------------------------------------
A0A0M9E0E3      ------------------------------------------------------------
A0A4Q3IRI1      ------------------------------------------------------------
A0A7C1C6X5      ------------------------------------------------------------
A0A354EF47      ------------------------------------------------------------
A0A2G6MSP7      ------------------------------------------------------------
B7RS54          ------------------------------------------------------------
A0A1I6ENM4      ------------------------------------------------------------
A8LNM8          ------------------------------------------------------------
A0A0T5NSU3      ------------------------------------------------------------
A0A5P9I718      ------------------------------------------------------------
A0A2M8J3R9      ------------------------------------------------------------
A0A1I6X762      ------------------------------------------------------------
A0A0P1EFX8      ------------------------------------------------------------
A0A2G5KB39      ------------------------------------------------------------
A0A2N3CNV1      ------------------------------------------------------------
A0A257F1F4      ------------------------------------------------------------
A0A2D5J8T8      ------------------------------------------------------------
A0A2E3P9W6      ------------------------------------------------------------
A0A2G2B1P9      ------------------------------------------------------------
A0A258GCD5      ------------------------------------------------------------
A0A443INY4      ------------------------------------------------------------
A0A2D9YR88      ------------------------------------------------------------
A0A4Q3ZBK4      ------------------------------------------------------------
A0A1G9FY29      ------------------------------------------------------------
A0A6N9RUN2      ------------------------------------------------------------
A0A1G8QZS5      ------------------------------------------------------------
A0A1H2Y469      ------------------------------------------------------------
A0A497ZQU7      ------------------------------------------------------------
A0A4U8YMP3      ------------------------------------------------------------
A0A1Q8QQ99      ------------------------------------------------------------
A0A7C2SIB2      ------------------------------------------------------------
A0A3D5ZY44      ------------------------------------------------------------
A0A1G5C236      ------------------------------------------------------------
A0A432HIS7      ------------------------------------------------------------
A0A520CSP5      ------------------------------------------------------------
A0A372IH36      ------------------------------------------------------------
A0A540VW45      ------------------------------------------------------------
A0A1H9C241      ------------------------------------------------------------
A0A2E3FCR1      ------------------------------------------------------------
A0A4S3MG69      ------------------------------------------------------------
A0A3E0H727      ------------------------------------------------------------
A0A1I3TTC3      ------------------------------------------------------------
A0A1H3IZW6      ------------------------------------------------------------
A0A0M6YG59      ------------------------------------------------------------
A0A1H7G8B0      ------------------------------------------------------------
A0A7C3Z8T7      ------------------------------------------------------------
A0A1V4QMH7      ------------------------------------------------------------
A0A496XZQ4      ------------------------------------------------------------
A0A7C3UZM2      ------------------------------------------------------------
A0A1F9BJF7      ------------------------------------------------------------
F2NDF5          ------------------------------------------------------------
A0A656PSQ6      ------------------------------------------------------------
A0A4Q3ZDI7      ------------------------------------------------------------
A0A537PRC6      ------------------------------------------------------------
A0A1I3XJ27      ------------------------------------------------------------
A0A562CGU2      ------------------------------------------------------------
A0A7C9VCB3      ------------------------------------------------------------
A0A1I7DCG1      ------------------------------------------------------------
A0A3A3H6D9      ------------------------------------------------------------
A0A0Q6VA36      ------------------------------------------------------------
A0A1B2EQN1      ------------------------------------------------------------
A0A1E7HSL6      ------------------------------------------------------------
A0A2M7JX59      ------------------------------------------------------------
A0A3A4XVN3      ------------------------------------------------------------
A0A1E7JEV6      ------------------------------------------------------------
A0A2N2KDY5      ------------------------------------------------------------
A0A3N5YUD9      ------------------------------------------------------------
A0A0W1DLQ3      ------------------------------------------------------------
A0A246JVD8      ------------------------------------------------------------
A0A2N3BB54      ------------------------------------------------------------
A0A1H6G7A3      ------------------------------------------------------------
A0A0A7PGL6      ------------------------------------------------------------
A0A4Q2Z4L0      ------------------------------------------------------------
A0A5C4N0H6      ------------------------------------------------------------
A0A1V4M8I1      ------------------------------------------------------------
A0A7C0XE92      ------------------------------------------------------------
A0A1E7HFN0      ------------------------------------------------------------
A0A7J0BHG1      ------------------------------------------------------------
A0A1M5GH86      ------------------------------------------------------------
A0A1W1XQZ5      ------------------------------------------------------------
A0A6V8LMJ3      ------------------------------------------------------------
A0A2K8WHP8      ------------------------------------------------------------
A0A1J5N774      ------------------------------------------------------------
A0A2C8F781      ------------------------------------------------------------
A0A2E3R6G0      ------------------------------------------------------------
A0A7J0BUD3      ------------------------------------------------------------
A0A1F8XMK2      ------------------------------------------------------------
A0A3M8EMP2      ------------------------------------------------------------
A0A2J6J6K6      ------------------------------------------------------------
A0A661PSB9      ------------------------------------------------------------
A0A661QBT6      ------------------------------------------------------------
A0A6I2SLK2      ------------------------------------------------------------
A0A0A8WSG4      ------------------------------------------------------------
S7TK97          ------------------------------------------------------------
S7UE93          ------------------------------------------------------------
A0A3D5BR56      ------------------------------------------------------------
A0A2N2IB15      ------------------------------------------------------------
A0A1I3PSR2      ------------------------------------------------------------
A0A1I4GEK4      ------------------------------------------------------------
A0A7C8B5M6      ------------------------------------------------------------
A0A1W7QPT7      ------------------------------------------------------------
A0A6S6M1Y8      ------------------------------------------------------------
A0A6V8MCR2      ------------------------------------------------------------
A0A6V8N3X1      ------------------------------------------------------------
A0A6M4XJ81      ------------------------------------------------------------
A0A0M4D373      ------------------------------------------------------------
A0A1L3GKM9      ------------------------------------------------------------
A0A2T5R3J5      ------------------------------------------------------------
A0A1G6EKK9      ------------------------------------------------------------
A0A7C1DJX8      ------------------------------------------------------------
A0A3D6C3I2      ------------------------------------------------------------
S0G1D4          ------------------------------------------------------------
A0A661T246      ------------------------------------------------------------
A0A2G6CSG7      ------------------------------------------------------------
A0A2G6NB59      ------------------------------------------------------------
A0A5K8A7T9      ------------------------------------------------------------
A0A1W9U045      ------------------------------------------------------------
A0A1F9L9G4      ------------------------------------------------------------
A0A328FD76      ------------------------------------------------------------
A0A348UX90      ------------------------------------------------------------
A0A357Z0N5      ------------------------------------------------------------
A0A0F2R2U0      ------------------------------------------------------------
A0A5K7ZK00      ------------------------------------------------------------
A0A5K7YCX8      ------------------------------------------------------------
A0A5K7Z388      ------------------------------------------------------------
A0A352B502      ------------------------------------------------------------
A0A410V446      ------------------------------------------------------------
A0A0R3KGJ5      ------------------------------------------------------------
A0A0R3N604      ------------------------------------------------------------
A0A1B1UCM8      ------------------------------------------------------------
A0A1N6JQ20      ------------------------------------------------------------
A0A1M5TI07      ------------------------------------------------------------
A3X191          ------------------------------------------------------------
A0A1H4RKV5      ------------------------------------------------------------
A0A160UA87      ------------------------------------------------------------
A0A1Q5SFV5      ------------------------------------------------------------
A0A7C3Y7G3      ------------------------------------------------------------
A0A430DNP0      ------------------------------------------------------------
A0A3A0FQ32      ------------------------------------------------------------
A0A1E4UZA0      ------------------------------------------------------------
A0A1H9KL56      ------------------------------------------------------------
A0A1A9KEF8      ------------------------------------------------------------
A0A5E6PKN5      ------------------------------------------------------------
A0A0N9W1V6      ------------------------------------------------------------
A0A423GQ41      ------------------------------------------------------------
A0A423H7J2      ------------------------------------------------------------
A0A502HNM8      ------------------------------------------------------------
A0A4Q7H223      ------------------------------------------------------------
A0A1H4N2K9      ------------------------------------------------------------
A0A2K4KWF7      ------------------------------------------------------------
A0A3E0WXH2      ------------------------------------------------------------
A0A2N2TRC8      ------------------------------------------------------------
A0A1V4CIZ7      ------------------------------------------------------------
A0A1M3BXA5      ------------------------------------------------------------
A0A1Y2R3U6      ------------------------------------------------------------
A0A167HVD6      ------------------------------------------------------------
A0A1V3SCT6      ------------------------------------------------------------
L0H287          ------------------------------------------------------------
A0A495VG93      ------------------------------------------------------------
A0A4R3MYM4      ------------------------------------------------------------
G2E3C0          ------------------------------------------------------------
                                                                            

E1Y9C0          ------------------------------------------------------------
A0A1N6SH58      ------------------------------------------------------------
A0A4Q3AQN2      ------------------------------------------------------------
A0A1W9HS52      VVRVLKANKNFIIMCTLSALLLAFLHQSFLYVPIFVSESKLKVEPKSDSMSITPLLERFQ
A0A2D5LFD8      IYR--RKKLIAISAIAITSAITGQLIFQRLFHPVYEGTFSLLIKDPINNSSSSNNSQSAN
A0A4D8PLT4      VLR--RPQPAGGDRLRLAGRAVAAQAAAAHHHPAGTATITYVMQSLKPMYRATAMVQLDS
A0A7J5VV32      ------------------------------------------------------------
A0A6G6X2Z4      ------------------------------------------------------------
Q44570          ------------------------------------------------------------
A0A3N5MZ53      ------------------------------------------------------------
A0A534E4H4      ------------------------------------------------------------
A0A534I2B6      ------------------------------------------------------------
A0A1C2JGD0      ------------------------------------------------------------
A0A259LQ70      ------------------------------------------------------------
A0A4V2SPR5      ------------------------------------------------------------
A0A3N5PM86      ------------------------------------------------------------
A0A2E5YSA4      ------------------------------------------------------------
A0A0N0XAV4      ------------------------------------------------------------
A0A0P9QD19      ------------------------------------------------------------
F3FHG4          ------------------------------------------------------------
F3GGI0          ------------------------------------------------------------
A0A0P9LE74      ------------------------------------------------------------
A0A3M4ZQ14      ---------ELIKSRALLGKVVDDLKLNVLQTPDFFPVIGPYLHRTFTPGSQRTLAEPLF
A0A3M5YLE8      ---------ELIKSRALLGKVVDDLKLNVLQTPDFFPVIGPYLHRTFTPGSQRTLAEPLF
A0A3M3RP89      ---------ELIKSRALLGKVVDDLKLNVLQTPDFFPVIGPYLHRTFTPGSQRTLAEPLF
A0A0P9QIY7      ---------ELIKSRALLGKVVDDLKLNVLQTPDFFPVIGPYLHRTFTPGSQRTLAEPLF
A0A0P9VVH7      ---------ELIKSRALLGKVVDDLKLNVLQTPDFFPVIGPYLHRTFTPGSQRTLAEPLF
A0A0Q0FJK6      ---------ELIKSRALLGKVVDDLKLNVLQTPDFFPVIGPYLHRTFTPGSQRTLAEPLF
A0A0Q0G2J0      ---------ELIKSRALLGKVVDDLKLNVLQTPDFFPVIGPYLHRTFTPGSQRTLAEPLF
A0A3M3LF66      ---------ELIKSRALLGKVVDDLKLNVLQTPDFFPVIGPYLHRTFTPGSQRTLAEPLF
A0A0P9WIR8      ---------ELIKSRALLGKVVDDLKLNVLQTPDFFPVIGPYLHRTFTPGSQRTLAEPLF
A0A3M3KPE5      ----------MIKSRALLGKVVDDLKLNVLQTPDFFPVIGPYLHRTFTPGSQRTLAEPLF
A0A3M4C263      ----------MIKSRALLGKVVDDLKLNVLQTPDFFPVIGPYLHRTFTPGSQRTLAEPLF
A0A3M5AD05      ----------MIKSRALLGKVVDDLKLNVLQTPDFFPVIGPYLHRTFTPGSQRTLAEPLF
A0A0Q0D3D2      ------------------------------------------------------LPKPLF
A0A0N0FS39      ------------------------------------------------------------
A0A3M6GHH2      ------------------------------------------------------------
A0A0P9R9W0      ---------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPLRDGELAEPLF
A0A0Q0B9T0      ---------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPLRDGELAEPLF
A0A3M6CFI7      ---------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPLRDGELAEPLF
A0A0P9JXN0      ---------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAEPLF
A0A3M6FIV7      ---------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAEPLF
A0A3M3PLW9      ---------ELIKSRALLGKVVDDLKLNRLQTPDLFPVIGPYLYRTFKPARDGELAQPLF
A0A3M4ENY1      ----------MIKSRALLGKVVDDLQLNRLQTPDLFPVIGPYLYRTFKPARDGELAQPLF
A0A3M5EZK7      ----------MIKSRALLGKVVDDLKLNRLQTPDLFPVIGPYLYRTFKPARDGELAQPLF
A0A0P9SPP5      ---------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAQPLF
A0A658KL17      ---------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAQPLF
A0A3M3NNF2      ---------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLF
A0A3M4A0E8      ---------ELIKSRALLGKVVDDLKLSTLQTPDFFPVIGPYLYRTFKPVRDGELAQPLF
A0A3M4PBZ2      ---------ELIKSRALLGKVVDDLKLSTLQTPDFFPVIGPYLYRTFKPVRDGELAQPLF
A0A3M6AI26      ---------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLF
A0A0P9IWP8      ---------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLF
A0A0P9KZ49      ---------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLF
A0A0P9V840      ---------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLF
A0A0Q0AIE5      ---------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLF
A0A3M2ZQH6      ---------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLF
A0A0N8SQG2      ---------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLF
A0A0W8HFU1      ---------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLF
A0A3M5M873      ---------ELIKSRALLGKVVDDLKLNTLQTPDLFPVIGPYLYRTFKPVRDGELAKPLF
A0A0P9VHH8      ---------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLF
A0A0P9YV98      ---------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLF
A0A3M3G2W8      ---------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLF
A0A3M6C224      ---------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLF
A0A3M5K254      ---------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLF
A0A3M5JFB0      ---------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLF
A0A3M3TQV3      ---------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLF
A0A3M3EF92      ---------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLF
A0A3M5J1E2      ---------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLF
A0A3M5G7H9      ---------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLF
A0A3M4A376      ---------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLF
A0A0Q0A5T8      ---------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLF
A0A0P9SCD7      ---------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLF
A0A0P9T4G3      ---------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLF
A0A0P9VKB0      ---------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVREGELAKPLF
A0A0Q0BM35      ---------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVREGELAKPLF
A0A3M3TPR7      ---------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLF
A0A3M3U4Q3      ---------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLF
A0A0P9UCX7      ---------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAQPLF
A0A0P9S1F1      ---------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAQPLF
A0A0P9QCJ2      ---------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLF
A0A0P9Q329      ---------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAQPLF
A0A3M5GJ64      ---------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAQPLF
A0A0P9MPC7      ---------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELSKPLF
A0A3M2XYQ3      ---------ELIKSRALLGKVVDDLRLNRLQTPDLFPVIGPYLYRTFKPARDGELAQPLF
A0A0P9XCE1      ---------ELIKSRALLGKVVDDLKLNRLQTPDLFPVIGPYLYRTFKPARDGELAQPLF
A0A3M3EFX7      ---------ELIKSRALLGKVVDDLKLNRLQTPDLFPVIGPYLYRTFKPARDGELAQPLF
A0A3M5B9D9      ---------ELIKSRALLGKVVDDLKLNRLQTPDLFPVIGPYLYRTFKPARDGELAQPLF
A0A0P9RRZ3      ---------ELIKSRALLGKVVDDLKLSTLQTPDFFPVIGPYLYRTFKPARDGELAQPLF
A0A3M2VEK7      ---------ELIKSRALLGKVVDDLQLNRLQTPDLFPVIGPYLYRTFKPARDGELAQPLF
A0A0N8R9B3      ---------ELIKSRALLGKVVDDLQLNRLQTPDLFPVIGPYLYRTFKPARDGELAQPLF
A0A0P9VA27      ---------ELIKSRALLGKVVDDLQLNRLQTPDLFPVIGPYLYRTFKPARDGELAQPLF
A0A3M4YBJ4      ---------ELIKSRALLGKVVDDLQLNRLQTPDLFPVIGPYLYRTFKPARDGELAQPLF
A0A0P9J470      ---------ELIKSRALLGKVVDDLQLNRLQTPDLFPVIGPYLYRTFKPARDGELAQPLF
A0A0Q0EVJ8      ---------ELIKSRALLGKVVDDLQLNRLQTPDLFPVIGPYLYRTFKPAREGELAQPLF
A0A3M5UI30      ---------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLF
A0A3M5YQT8      ---------ELIKSRALLGKVVDDLKLNTLQTPDFFSVIGPYLYRTFKPVREGELSKPLF
A0A3M5F5X1      XXX--XXXXELIKSRALLGKVVDDLKLNTLQTPDLFPVIGPYLYRTFKPVRDGELAKPLF
A0A3M5R8G1      ---------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLF
A0A3M5V012      ---------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLF
A0A3M3GA16      ---------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLF
A0A3M3UCT3      ---------ELIKSRALLGKVVDDLQLNRLQTPDLFPVIGPYLYRTFKPARDGELAQPLF
A0A3M3CJL0      ---------ELIKSRALLGKVVDDLQLNRLQTPDLFPVIGPYLYRTFKPARDGELAQPLF
A0A3M3F6F5      ---------ELIKSRALLGKVVDDLQLNRLQTPDLFPVIGPYLYRTFKPARDGELAQPLF
A0A3M3P9B7      ---------ELIKSRALLGKVVDDLQLNRLQTPDLFPVIGPYLYRTFKPARDGELAQPLF
A0A0N8QB74      ---------ELIKSRALLGKVVDDLQLNRLQTPDLFPVIGPYLYRTFKPARDGELAQPLF
A0A0Q0AUD0      ---------ELIKSRALLGKVVDDLQLNRLQTPDLFPVIGAYLYRTFKPARDGELAQPLF
A0A3M5VR55      ---------ELIKSRALLGKVVDDLQLNRLQTPDLFPVIGPYLYRTFKPARDGELAQPLF
A0A0Q0FK97      ---------ELIKSRALLGKVVDDLQLNRLQTPDLFPVIGPYLYRTFKPARDGELAQPLF
A0A3M5KZ75      ---------ELIKSRALLGKVVDDLQLNRLQTPDLFPVIGPYLYRTFKPAREGELAQPLF
A0A3M5L3G5      ---------ELIKSRALLGKVVDDLQLNRLQTPDLFPVIGPYLYRTFKPAREGELAQPLF
A0A519ERR1      ------------------------------------------------------------
A0A4Q3Q1M2      ------------------------------------------------------------
A0A4Q3MHR1      ------------------------------------------------------------
A0A520GDZ4      ------------------------------------------------------------
A0A318DSU0      ------------------------------------------------------------
A0A538PF21      ------------------------------------------------------------
A0A1W1ZH10      ------------------------------------------------------------
A0A1W2FF24      ------------------------------------------------------------
A0A524JYQ6      ------------------------------------------------------------
A0A4Q3MA17      ------------------------------------------------------------
A0A0N0M5F7      ------------------------------------------------------------
A0A537M754      ------------------------------------------------------------
A0A1V1PDB4      ------------------------------------------------------------
A0A2M7C324      ------------------------------------------------------------
A0A4Q3HHG6      ------------------------------------------------------------
A0A3B7DTA4      ------------------------------------------------------------
A0A432ZK62      ------------------------------------------------------------
A0A1V5EEP4      ------------------------------------------------------------
A0A1V5EF48      ------------------------------------------------------------
A0A0S6X1X6      ------------------------------------------------------------
A0A537Y5L8      ------------------------------------------------------------
A0A4Q3L2X2      ------------------------------------------------------------
A0A4Q3T8J1      ------------------------------------------------------------
A0A4Q4ANM4      ------------------------------------------------------------
A0A4Q3UEC7      ------------------------------------------------------------
A0A1H5YYQ4      ------------------------------------------------------------
A0A1X4NLK2      ------------------------------------------------------------
A0A1X4NWB5      ------------------------------------------------------------
A0A1M5UQ38      ------------------------------------------------------------
A0A327YI48      ------------------------------------------------------------
A0A1B1PNL6      ------------------------------------------------------------
A0A2U8H9H9      ------------------------------------------------------------
A0A6B2NBB8      ------------------------------------------------------------
A0A1X6YIC0      ------------------------------------------------------------
A0A1I5E9E9      ------------------------------------------------------------
A0A1X6Z7N7      ------------------------------------------------------------
A0A2E1DQ13      ------------------------------------------------------------
A0A1H8C800      ------------------------------------------------------------
A0A2N3EZ05      ------------------------------------------------------------
A0A655R819      ------------------------------------------------------------
A0A655RNN3      ------------------------------------------------------------
A0A0R0BVC7      ------------------------------------------------------------
A0A3N5J7U8      ------------------------------------------------------------
A0A1S7S3I8      ------------------------------------------------------------
A0A519E8D7      ------------------------------------------------------------
A0A3S1FD32      ------------------------------------------------------------
A0A434DUT4      ------------------------------------------------------------
A0A528D3U3      ------------------------------------------------------------
A0A3S3UPT3      ------------------------------------------------------------
A0A3S1E286      ------------------------------------------------------------
A0A531AC71      ------------------------------------------------------------
A0A436K268      ------------------------------------------------------------
A0A434IDQ0      ------------------------------------------------------------
A0A435IRM5      ------------------------------------------------------------
A0A3S2C404      ------------------------------------------------------------
A0A435F6C0      ------------------------------------------------------------
A0A435BMN6      ------------------------------------------------------------
A0A529XQ54      ------------------------------------------------------------
A0A530BJC1      ------------------------------------------------------------
A0A348SRI7      ------------------------------------------------------------
A0A354EI73      ------------------------------------------------------------
A0A4P7EP83      ------------------------------------------------------------
A0A6I1QB25      ------------------------------------------------------------
A0A655ZZQ1      ------------------------------------------------------------
A0A1S0ZAI3      ------------------------------------------------------------
A0A3A4NIE9      ------------------------------------------------------------
A0A3A4NUI9      ------------------------------------------------------------
A0A524I3Z6      ------------------------------------------------------------
A0A524PCL7      ------------------------------------------------------------
A0A356GQV1      ------------------------------------------------------------
A0A1J5DAY8      ------------------------------------------------------------
A0A524P237      ------------------------------------------------------------
A0A3C0L0A8      ------------------------------------------------------------
A0A176S762      ------------------------------------------------------------
A0A377ZC40      ------------------------------------------------------------
A0A378BPJ7      ------------------------------------------------------------
A0A2J5PAJ7      ------------------------------------------------------------
A0A377ZDN3      ------------------------------------------------------------
A0A7A9Y5Q1      ------------------------------------------------------------
A0A1G3JY11      ------------------------------------------------------------
A0A661N3U1      ------------------------------------------------------------
A0A1W9WUD9      ------------------------------------------------------------
A0A1W1ZQK0      ------------------------------------------------------------
A0A6I1R304      ------------------------------------------------------------
A0A1W9PMU6      ------------------------------------------------------------
A0A3S1WTQ1      ------------------------------------------------------------
A0A530CUR9      ------------------------------------------------------------
A0A6L6H5T1      ------------------------------------------------------------
A0A6D0ELN7      ------------------------------------------------------------
A0A1M6N1X5      ------------------------------------------------------------
A0A561M3U0      ------------------------------------------------------------
A0A2N6BZD5      ------------------------------------------------------------
A0A1G3VVY5      ------------------------------------------------------------
A0A7C3S273      ------------------------------------------------------------
A0A7C4WJ18      ------------------------------------------------------------
A0A7C3V565      ------------------------------------------------------------
A0A351B422      ------------------------------------------------------------
F2NEE9          ------------------------------------------------------------
A0A2W5J775      ------------------------------------------------------------
A0A352Q5C1      ------------------------------------------------------------
A0A435NNF5      ------------------------------------------------------------
A0A3S2AQS7      ------------------------------------------------------------
A0A436XH86      ------------------------------------------------------------
A0A527ZPD6      ------------------------------------------------------------
A0A529KRW3      ------------------------------------------------------------
A0A530ZLX0      ------------------------------------------------------------
A0A355TB56      ------------------------------------------------------------
A0A1F9E324      ------------------------------------------------------------
A0A432SAI6      ------------------------------------------------------------
A0A4Q3LBH4      ------------------------------------------------------------
A0A4Q3LWP3      ------------------------------------------------------------
A0A7C3JPP4      ------------------------------------------------------------
A0A534V9L7      ------------------------------------------------------------
A0A7C3JJT4      ------------------------------------------------------------
A0A2N6VGL1      ------------------------------------------------------------
A0A3M3H5V6      ------------------------------------------------------------
A0A524M660      ------------------------------------------------------------
A0A7C3JSX5      ------------------------------------------------------------
A0A7I8MQ67      ------------------------------------------------------------
A0A0C1TRU6      ------------------------------------------------------------
A0A2Z5SSF4      ------------------------------------------------------------
A0A2T4ZJZ6      ------------------------------------------------------------
A0A0B8PTA8      ------------------------------------------------------------
A0A0B8QF75      ------------------------------------------------------------
A0A6P2T4F7      ------------------------------------------------------------
A0A4Q4CIB1      ------------------------------------------------------------
A0A522ACJ9      ------------------------------------------------------------
A0A1T2KYM8      ------------------------------------------------------------
A0A3N5Z7F8      ------------------------------------------------------------
A0A239HD34      ------------------------------------------------------------
A0A2G9ZR82      ------------------------------------------------------------
A0A4U9I390      ------------------------------------------------------------
A0A0P7ZZE4      ------------------------------------------------------------
A0A369R0Q9      ------------------------------------------------------------
A0A327LYE6      ------------------------------------------------------------
A0A5A9ZTV3      ------------------------------------------------------------
A0A6J4YZ98      ------------------------------------------------------------
A0A2X3M011      ------------------------------------------------------------
I2WC85          ------------------------------------------------------------
A0A7A9K1G5      ------------------------------------------------------------
A0A7B7KSB7      ------------------------------------------------------------
A0A400JH80      ------------------------------------------------------------
A0A479JNB1      ------------------------------------------------------------
A0A5C9AF52      ------------------------------------------------------------
A0A797FC39      ------------------------------------------------------------
A0A797FHC1      ------------------------------------------------------------
D8EEU7          ------------------------------------------------------------
A0A6D0EYC7      ------------------------------------------------------------
A0A7A6DHB0      ------------------------------------------------------------
A0A2H9EHM4      ------------------------------------------------------------
A0A7A5MLK0      ------------------------------------------------------------
A0A380B3D7      ------------------------------------------------------------
F5NSX0          ------------------------------------------------------------
A0A534XP85      ------------------------------------------------------------
A0A0P1H2H0      ------------------------------------------------------------
A0A258WKV0      ------------------------------------------------------------
A0A377N8F8      ------------------------------------------------------------
A5G4N9          ------------------------------------------------------------
A0A3C2DSE7      ------------------------------------------------------------
A0A2X1JBG5      ------------------------------------------------------------
A0A377LY04      ------------------------------------------------------------
A0A5C9ABR5      ------------------------------------------------------------
A0A5J9WU72      ------------------------------------------------------------
A0A2X3K9R3      ------------------------------------------------------------
A0A3T9EHW9      ------------------------------------------------------------
A0A484X141      ------------------------------------------------------------
A0A5N9VWI6      ------------------------------------------------------------
A0A6D0EJQ0      ------------------------------------------------------------
A0A444R390      ------------------------------------------------------------
A0A376LLF8      ------------------------------------------------------------
A0A6L7CT21      ------------------------------------------------------------
A0A4Q3LR91      ------------------------------------------------------------
A0A6C9IKN8      ------------------------------------------------------------
A0A4V1TR68      ------------------------------------------------------------
A0A444IY46      ------------------------------------------------------------
A0A6I7N627      ------------------------------------------------------------
A0A6L3ZR06      ------------------------------------------------------------
A0A3E0WKI3      ------------------------------------------------------------
A0A1H3I2J1      ------------------------------------------------------------
A0A1V5DJV0      ------------------------------------------------------------
A0A520IUC4      ------------------------------------------------------------
A0A521LJG5      ------------------------------------------------------------
A0A531IBQ7      ------------------------------------------------------------
A0A0P1FWI8      ------------------------------------------------------------
A0A6L8LHC6      ------------------------------------------------------------
A0A1V4WHZ7      ------------------------------------------------------------
A0A1E5AJN5      VRLFMTAVSYSWLIIACAISGLVMGSVYASLQTKQYRASLQINIDVGRASALREFEVVGE
A0A2N3D2J1      ------------------------------------------------------------
A0A2N2GVE1      ANNNAPAQTQVDWKRIFHIVRNYFWIVLLTCGVGVSLAFFVTKKQTPLYRTSCSVVISSQ
A0A2N2INV3      ASNNAPAQTQVDWKRIFHIVRNYFWIVLLTCGVGVSLAFFVTKKQTPLYRTSCSVVISSQ
A0A233IKJ2      ------------------------------------------------------------
A0A1Y5DXG5      ------------------------------------------------------------
A0A0B8P2H5      ------------------------------------------------------------
A0A380AQW6      ------------------------------------------------------------
A0A2G2GD62      IMSSGYLISKMLENLELGTRYYKEKNYRLVELYKKSPLVVNVTFMEYNLLEKKLKIRAID
A0A3R9C3P5      QFDLAAAVGLVRRRMIMIITIAVLLMVPAAMMISGLKPAYQGSARLIIRQPLATLLGVDD
A0A0M3GBT1      --------------------------------------------------------MEDK
B3Q577          --------------------------------------------------------MEDK
A0A483QWI8      ------------------------------------------------------------
A0A483UXD3      ------------------------------------------------------------
A0A0A8J8L3      ------------------------------------------------------------
A0A660DJ38      ------------------------------------------------------------
A0A524P331      -----------------------------------------------------KTPDYTI
A0A4V1SSM5      ------------------------------------------------------------
A0A4Q3K8G7      ------------------------------------------------------------
A0A7C7W7M2      LVRTVLLKYNKLIALFCAVSVITSVIYVQSQAPAYISTVTMHIAPSNAGMFNLEQWWTSD
A0A1M7HC79      ------------------------------------------------------------
A0A1D3JZN6      ------------------------------------------------------------
A0A1V6ESG1      ------------------------------------------------------------
A0A1H7YHK3      ------------------------------------------------------------
A0A534SH66      ------------------------------------------------------------
A0A3M0ZZ99      ------------------------------------------------------------
A0A238LBD3      ------------------------------------------------------------
A0A328C2K5      QSAPEERGESLGALIGRYWVLFRRFYWVLILTSIACVAAAYFWTDRQPRIYQATSKLIFH
A0A5C6X8M3      SSAPEERGESLGALIGRYWALFRRFYWVLILTSIACVAAAYFWTERQPRIYQATSKLMFH
A0A3D8MRR7      SSAPEERGESLGALIGRYWALFRRFYWVLILTSIACVAAAYFWTDRQPRIYQATSKLIFH
A0A5C6UBJ7      SSAPEERGESLGALIGRYWALFRRFYWVLILTSIACVAAAYFWTDRQPRIYQATSKLIFH
A0A5C6XGM3      SSAPEERGESLGALIGRYWALFRRFYWVLILTSIACVAAAYFWTERQPRIYQATSKLIFH
A0A537NZJ1      ------------------------------------------------------------
A0A7C4R3C4      ------------------------------------------------------------
A0A0P1FRV5      ------------------------------------------------------------
A0A4Q4CVW6      ------------------------------------------------------------
A0A090R136      ------------------------------------------------------------
A0A661JU93      ------------------------------------------------------------
A0A2E2T3V8      -MTISDLVGILYRRRGVFAVSFVALLMMASVAISFFSPVYKSFASVGFVREEPATTQTDF
A0A367UAB4      -MTISDLVGILYRRRGVFAVSFVALLMMASVAISFFSPVYKSFASVGFVREEPATTQTDF
A0A1F2ZW35      VIAQQTPMYKASSRLILDTRTFKVLSTEGALSGVDTLNMGAIQSELEVIGSEFVVGRVVD
A0A377V641      ------------------------------------------------------------
A0A1F2YJ88      ------------------------------------------------------------
A0A6L3ZWI0      ------------------------------------------------------------
A0A5N8AL61      NAYTDYGQAYTERDSLVDLGSVIETVRRRKLPMAIACAIILVLTAVTYLMSDRVYMASGR
A0A0J7XGZ1      ---------------------------MLPRTYTATSALLLEPREAQPVKVNDRGFVAPA
I4CBA7          ----------------MSTYSPHDSEAFEFSSPRHSLTGHVRTIFRKKWLFLGIVALALA
A3VE95          QAVRSGRSSERSEDIDRVDVRGLLRAIFSRGPLIGGLAVGCALLLFVVTQFIPSTYTAYS
A0A1G0NL95      ------------------------------------------------------------
A0A024KA69      ------------------------------------------------------------
A0A0L1KFN4      -----------------------------------MTPQYTAVSTIEISREADQVTNIEG
A0A3P5DSS6      ------------------------------------------------------------
A0A483YEL5      ------------------------------------------------------------
A0A658GUJ0      ------------------------------------------------------------
A0A358L616      ------------------------------------------------------------
A0A1M7BLL7      ------------------------------------------------------------
A0A0H4KZM1      ------------------------------------------------------------
A0A3D5UYX7      ------------------------------------------------------------
A0A2N1WQN5      ------------------------------------------------------------
A0A352G2C2      ------------------------------------------------------------
A0A3C0PZN1      ------------------------------------------------------------
A0A524QFS4      YPAYHVPGYPSYATMNDSRFAELDLFDFRDLFRSLWIKKRLIMIVLAFALTSWMFYLSIA
A0A520JSW4      GDGDHRRNGSAAGGSRELSLAVLWRIAFEWRWLILAAIGTGIVAAMLMTMLTPLQYRSVT
A0A1V1UJT2      ------------------------------------------------------------
A0A0L6CVX1      ------------------------------------------------------------
A0A1V0RR48      ------------------------------------------------------------
A0A0A0HJJ4      ------------------------------------------------------------
A0A5E7YA28      ------------------------------------------------------------
A0A4Q3LTF3      ------------------------------------------------------------
A0A7C3N3Y1      -----------------------------------------QTQYKILESRTLARRVIES
A0A537UTP9      ------------------------------------------------------------
A0A1D2RNR5      ------------------------------------------------------------
A0A4V1TQ46      ------------------------------------------------------------
A0A3A0FZC0      ------------------------------------------------------------
A0A1N7JVZ7      ------------------------------------------------------------
A0A091C4A8      ------------------------------------------------------------
A0A4R3H6P6      ATGHAGAPPLRRLLRAATRWRWVLLGGVAAGALAGIALTLVMPRQYASTARMEISRETAR
A0A3S1NQ09      ------------------------------------------------------------
A0A443GJ52      ------------------------------------------------------------
A0A6N3RE79      ------------------------------------------------------------
A0A6N9S3L5      ------------------------------------------------------------
A0A656BWB0      ------------------------------------------------------------
A0A6D0IFH4      ------------------------------------------------------------
A0A7A3MK38      ------------------------------------------------------------
A0A0A0FHV8      ------------------------------------------------------------
A0A1X3IPU7      ------------------------------------------------------------
A0A0A0G0N2      ------------------------------------------------------------
A0A2I8SDU4      ------------------------------------------------------------
A0A2I8SU55      ------------------------------------------------------------
A0A7I6T806      ------------------------------------------------------------
A0A7I6TQE9      ------------------------------------------------------------
A0A7I6U296      ------------------------------------------------------------
S1EXJ6          ------------------------------------------------------------
A0A376UBS1      ------------------------------------------------------------
A0A2W6S588      -----MNQEQDGSATQDLAGIVSRFRRHLPIGFAIIVLMMVLAYGATKMMTPKYSASAQL
A0A483E0N4      ------------------------------------------------------------
A0A2J4YQQ6      ------------------------------------------------------------
A0A483THX4      ------------------------------------------------------------
A0A534MVS2      ------------------------------------------------------------
A0A444I5K6      ------------------------------------------------------------
A0A154VE85      KPLFAISFLALAGLGLAIVAGLPERYRATAQLVFQDRSSGFGGSALLLDRGAIETEAAIV
A0A3S1MCW7      ------------------------------------------------------------
A0A434IGN6      ------------------------------------------------------------
A0A528AX40      -------------------------------------------------------DIEVV
A0A528MV95      -------------------------------------------LEVLVPSAKVFQDIEVV
A0A3C1S9Y1      ------------------------------------------------------------
A0A353EH49      ----MMARKFERSQAGVAEPLLGFDAYAWGGEILEVAKLEVPDFLKGNALRLVVEHDSEY
A0A1Y1Q9C1      ---------------------------------------------EGMQVVNFGTVSSAS
A0A3M7LJH0      ------------------------------------------------------------
A0A316KRG4      ------------------------------------------------------------
A0A1E4JHX8      ------------------------------------------------------------
M2U8P2          AEKNATGPLLDFGKLTVIARRRIVPMAVAAALCALAVAALYFTSEPTYSASGQIGFERGA
A0A1H7KZF8      IEAAVAPPPAPLFALDFDRLWVPVRRSLVPMAAIVFASLAAALLAFVLIRPSFRADATLR
A0A0J5Q9T7      ------------------------------------------------------------
A0A6N3UC48      ------------------------------------------------------------
A0A257NG76      ------------------------------------------------------------
A0A1T4TW59      --------------------------------------------------MHLILIKKYY
A0A1I5YYQ0      ------------------------------------------------------------
A0A5P9FE62      ------------------------------------------------------------
A0A1Q3MB35      ------------------------------------------------------------
A0A259LUN7      ------------------------------------------------------------
A0A2D7AVL1      ------------------------------------------------------------
A0A3B9KZE9      ------------------------------------------------------------
A0A2U0NMP8      ----------------------------------------------GLARLFNKTKNTIQ
A0A4U9HNE9      ------------------------------------------------------------
A0A7C5N053      ----------------------------------------------YQAEATLKFDPNPP
A0A2G2CXY6      -----------------MGSWAARRYDPYEAGEVAEPWLGLDSFAWGGEELAIFQLEVPP
A0A3M1D4H3      ------------------------------------------------------------
A0A7C1A2A2      VSTIEVSGLNARVWRGADGEPPSIRYWRWRLLDGKRLSAWAPGPQALAARNAAVTDPALA
A0A5C8BYM7      ------------------------------------------------------------
A0A1J5ICP0      ------------------------------------------------------------
A0A379B9V4      ---------------MRLKKLDLTTQVEPIYPVPILGKLFASATGYSPQITISHFTPLNE
A0A0Q6TS97      ------------------------------------------------------------
A0A0Q6UYB4      ------------------------------------------------------------
A0A484XS37      ------------------------------------------------------------
W7Q5J0          YVVRQGIQRPDFPIMLPYISDYVLSSGIPQPSFMQRQPYVWGGENLEVARFVLAEHRRSH
A0A654AKT6      ------------------------------------------------------------
A0A7A9JY19      ------------------------------------------------------------
A0A0G9MZA5      ------------------------------------------------------------
H0T8B0          ---------------------------------------------MIGSKKDVWIRSDLT
A0A5C7N981      ------------------------------------------------------------
A0A534TV22      ------------------------------------------------------------
A0A351CXR4      -------MLGYNSSLNNTPMYQSSLTLMVTENMPNMAMVGQGYVDPMSMLSLWSGGTLDT
A0A2N6GLF5      ------------------------------------------------------------
A0A1W9LJP0      ------------------------------------------------------------
A0A0W1ICB0      ---------------------------MTPQYTATSRIEIAREQANVTNVEGLKRDSNAP
A0A7C1C8G2      ------------------------------------------------------------
A0A376KYN0      ------------------------------------------------------------
A0A7A9J338      ------------------------------------------------------------
A0A377E5P7      ------------------------------------------------------------
A0A2X1JB05      ------------------------------------------------------------
A0A376RML0      ------------------------------------------------------------
A0A6N3QTV2      ------------------------------------------------------------
A0A2E0UL88      ------------------------------------------------------------
A0A0T2QIS1      ------------------------------------------------------------
A0A0P7Y1D0      ------------------------------------------------------------
A0A542J310      ------------------------------------------------------------
A0A2M7JRZ7      ------------------------------------------------------------
A0A167IR75      ------------------------------------------------------------
A0A3B8T2U6      ------------------------------------------------------------
A0A365PWR2      ------------------------------------------------------------
A0A2E9H5Z8      ------------------------------------------------------------
A0A2E2BR79      ------------------------------------------------------------
A0A6I4IKZ3      ------------------------------------------------------------
A0A7H4JZ79      ------------------------------------------------------------
A0A0Q4Q524      ------------------------------------------------------------
A0A0Q4CFJ9      ------------------------------------------------------------
A0A0Q4FE58      ------------------------------------------------------------
A0A0Q4JWC8      ------------------------------------------------------------
A0A0Q4KFL8      ------------------------------------------------------------
A0A522R8R0      ------------------------------------------------------------
A0A2U9NDY5      ------------------------------------------------------------
X7F6S5          ------------------------------------------------------------
A0A1G8NKI0      ------------------------------------------------------------
A0A355QPE4      ------------------------------------------------------------
A0A357RN98      ------------------------------------------------------------
A0A1I6U4V1      ------------------------------------------------------------
A0A6B2P8H8      ------------------------------------------------------------
A0A1P8USW9      ------------------------------------------------------------
A0A1G7CFZ2      ------------------------------------------------------------
A0A7G2TPW1      ------------------------------------------------------------
A0A0Q4IGG1      ------------------------------------------------------------
A0A534RUJ5      ------------------------------------------------------------
A0A3M1CJM3      ------------------------------------------------------------
A0A2R7SVD4      ------------------------------------------------------------
A0A3C0PWB6      ------------------------------------------------------------
V4Q8B7          ------------------------------------------------------------
A0A0Q8XKK5      ------------------------------------------------------------
A0A2E0Q2W0      ------------------------------------------------------------
A0A660NIR6      ------------------------------------------------------------
A0A142W0R3      -----------------------------------------------------METDVEG
A0A0S4XR18      ------------------------------------------------------------
A0A7C5CFF1      ------------------------------------------------------------
A0A2E0GW64      ------------------------------------------------------------
A0A1A7QJ97      ------------------------------------------------------------
A0A661LW70      ------------------------------------------------------------
W7Q8F9          ------------------------------------------------------------
A0A524PXH8      ------------------------------------------------------------
A0A4Q3P0E4      ------------------------------------------------------------
A0A3M2BE89      ------------------------------------------------------------
A0A4Q4A6K6      ------------------------------------------------------------
A0A257G674      ------------------------------------------------------------
A0A661M5M6      ------------------------------------------------------------
A0A1I1UM01      ------------------------------------------------------------
Q44573          ------------------------------------------------------------
A2W025          ----------------------------------------------------------MP
A0A534Z362      TVFATLLTPRLYSASTRLELARQSPIQLRLEGNVLRLDDGDPSANGAATFLSTQVAALQS
V4J283          ------------------------------------------------------------
A0A536T443      ------------------------------------------------------------
A0A0Q4UFQ5      ------------------------------------------------------------
A0A527W7E6      ------------------------------------------------------------
A0A432EMV7      ------------------------------------------------------------
A0A7C1SEU7      ------------------------------------------------------------
A0A534WLI3      ------------------------------------------------------------
A0A7C6FBW0      ------------------------------------------------------------
A0A087LTV7      ------------------------------------------------------------
A0A7D7WSS2      ------------------------------------------------------------
A0A318KWA2      ------------------------------------------------------------
A0A522MT86      ------------------------------------------------------------
A0A4Q3I221      ------------------------------------------------------------
A0A534SAL6      ---VTLLTTRLYTASTRLQMARQSPIQLQLQENVLHLDESDRSVNGTSSFLATQVAALKS
A0A534ZDB4      ALLVTLVTTRLYTG--------------------------DRSVNGTSSFLATQVATLKS
A0A534X3M7      TAVLTLLTPRLYTASTRLEVARQSPIQLRLEGNVLRLGESDRDANGAATFVGMQVAALRS
A0A534SPC6      ------------------------------------------------------------
A0A535AD60      TVFATLLTPRLYTASTRLELARQSPIQLRLEGNVLRLGDGDLSANGAATFLSTQVAALQS
A0A4Q3SY08      ------------------------------------------------------------
A0A4Q3LG23      ------------------------------------------------------------
A0A522EX52      ------------------------------------------------------------
A0A1H3KC95      ------------------------------------------------------------
A0A5P8Z4P3      ------------------------------------------------------------
A0A2E9HXF7      ------------------------------------------------------------
A0A0B3RZC9      ------------------------------------------------------------
A0A6F8QET1      ------------------------------------------------------------
A0A520HUH4      ------------------------------------------------------------
A0A2K8U7M6      ------------------------------------------------------------
A0A5B9DKL8      ------------------------------------------------------------
A0A238KJM1      ------------------------------------------------------------
A0A3A0FJZ4      ------------------------------------------------------------
W4HJV8          ------------------------------------------------------------
A0A0P1GDI0      ------------------------------------------------------------
A0A2R8ATV5      ------------------------------------------------------------
A0A1U7D3R6      ------------------------------------------------------------
A0A2D4UVV2      ------------------------------------------------------------
A0A0W7WHP4      ------------------------------------------------------------
A0A238J8F6      ------------------------------------------------------------
A0A238JQI6      ------------------------------------------------------------
A0A222E077      ------------------------------------------------------------
A0A239E3Y2      ------------------------------------------------------------
A0A534QGR3      ------------------------------------------------------------
A0A1F9CFF0      ------------------------------------------------------------
A0A2M8B0G5      ------------------------------------------------------------
A0A363TNU9      ------------------------------------------------------------
A0A0W1GMS6      ------------------------------------------------------------
A0A0Q8RMY3      ------------------------------------------------------------
A0A1A7QC21      ------------------------------------------------------------
A0A2W4RFS2      ------------------------------------------------------------
A0A1Y6DC43      ------------------------------------------------------------
A0A2S6HE06      ------------------------------------------------------------
G3J0M3          ------------------------------------------------------------
V5C6R5          ------------------------------------------------------------
A0A534HBS8      ------------------------------------------------------------
A0A0F0T3Y9      ------------------------------------------------------------
A0A379GWF0      ------------------------------------------------------------
A0A4Q2XLV7      ------------------------------------------------------------
A0A4Q5QYC4      ------------------------------------------------------------
A0A3B8SQ27      ------------------------------------------------------------
A0A0U2VAW2      ------------------------------------------------------------
A0A454CTF1      ------------------------------------------------------------
A0A6B3Q2G1      ------------------------------------------------------------
A0A4Q6G931      ------------------------------------------------------------
A0A2T0VBD8      ------------------------------------------------------------
A0A378APS2      ------------------------------------------------------------
A0A443VCQ6      ------------------------------------------------------------
A0A447RKQ7      ------------------------------------------------------------
W1DSK1          ------------------------------------------------------------
A0A2N1XK22      ------------------------------------------------------------
A0A3D0KAC8      ------------------------------------------------------------
A0A3D2Y902      ------------------------------------------------------------
A0A378G3G7      ------------------------------------------------------------
A0A2X5NHJ9      ------------------------------------------------------------
A0A2J4QEC3      ------------------------------------------------------------
A0A485ADM3      ------------------------------------------------------------
A0A4U9HGU4      ------------------------------------------------------------
A0A3S4JGG5      ------------------------------------------------------------
A0A377ZDH2      ------------------------------------------------------------
A0A3S4HTS8      ------------------------------------------------------------
A0A1W9F5M9      ------------------------------------------------------------
A0A379W6R2      ------------------------------------------------------------
A0A379TA56      ------------------------------------------------------------
A0A655C5P0      ------------------------------------------------------------
A0A6D0I9G1      ------------------------------------------------------------
A0A352MMI7      ------------------------------------------------------------
A0A4Z0LWV1      ------------------------------------------------------------
A0A377K431      ------------------------------------------------------------
A0A376RY66      ------------------------------------------------------------
A0A778GAM7      ------------------------------------------------------------
A0A3C2BN18      ------------------------------------------------------------
A0A447LR75      ------------------------------------------------------------
A0A759KJJ5      ------------------------------------------------------------
A0A376D8L7      ------------------------------------------------------------
A0A1V2FV46      ------------------------------------------------------------
A0A6N8QLT3      ------------------------------------------------------------
A0A376SB61      ------------------------------------------------------------
A0A3D1BYV9      ------------------------------------------------------------
A0A536T0W8      ------------------------------------------------------------
A0A3D2M6Y9      ------------------------------------------------------------
A0A3D2YAZ2      ------------------------------------------------------------
A0A350A102      ------------------------------------------------------------
A0A350L5D2      ------------------------------------------------------------
A0A2G9XLE5      ------------------------------------------------------------
A0A6L3MM74      ------------------------------------------------------------
A0A7C3QM04      ------------------------------------------------------------
A0A7I8MVM0      ------------------------------------------------------------
A0A7C0Y3J7      ------------------------------------------------------------
A0A7C3LF61      ------------------------------------------------------------
A0A4R1HDF2      ------------------------------------------------------------
A0A6N1DL48      ------------------------------------------------------------
A0A1V6FYJ1      ------------------------------------------------------------
A0A0C5VQ86      ------------------------------------------------------------
A0A0Q6QV61      ------------------------------------------------------------
A0A2Z3IKG4      ------------------------------------------------------------
A0A3N5RNY4      ------------------------------------------------------------
A0A4Z0M4C7      ------------------------------------------------------------
A0A5Q2QDL1      ------------------------------------------------------------
A0A1V8MBH1      ------------------------------------------------------------
A0A6J4X8D4      ------------------------------------------------------------
A0A318CT66      ------------------------------------------------------------
A0A3N5P205      ------------------------------------------------------------
A0A443K010      ------------------------------------------------------------
A0A6I7NYG5      ------------------------------------------------------------
A0A212AR83      ------------------------------------------------------------
A0A2E2P4I0      ------------------------------------------------------------
A0A2U2CM86      ------------------------------------------------------------
A0A1I0R9R6      ------------------------------------------------------------
A0A2N3BVE7      ------------------------------------------------------------
A0A7C2IB02      ------------------------------------------------------------
A0A6N6SI00      ------------------------------------------------------------
A0A2S5JE21      ------------------------------------------------------------
A0A2R8BKZ2      ------------------------------------------------------------
A0A2S8S361      ------------------------------------------------------------
A0A520ZTR8      ------------------------------------------------------------
A0A316GHM6      ------------------------------------------------------------
A0A238IZI1      ------------------------------------------------------------
A0A7C9INT8      ------------------------------------------------------------
A0A6M1UAR9      ------------------------------------------------------------
A0A1X7ACC1      ------------------------------------------------------------
A0A238KUF6      ------------------------------------------------------------
A0A095CTW3      ------------------------------------------------------------
A0A2E3UGD6      ------------------------------------------------------------
A0A2T0RFH0      ------------------------------------------------------------
A0A285D390      ------------------------------------------------------------
A0A497VHN4      ------------------------------------------------------------
A0A2N6BEI9      ------------------------------------------------------------
A0A0D5N3E9      ------------------------------------------------------------
A0A2N2G716      ------------------------------------------------------------
A0A7C1UTU6      ------------------------------------------------------------
W9VVY5          ------------------------------------------------------------
A0A1E2URD3      ------------------------------------------------------------
A0A2T6MY81      ------------------------------------------------------------
A0A2T6NBQ8      ------------------------------------------------------------
A0A421K431      ------------------------------------------------------------
A0A2G2I5M1      ------------------------------------------------------------
A0A2G2M6F0      ------------------------------------------------------------
A0A1W9J9F8      ------------------------------------------------------------
A0A2S5LFJ9      ------------------------------------------------------------
A0A2D8R8F8      ------------------------------------------------------------
A0A6I4JXQ8      ------------------------------------------------------------
A0A010SNS0      ------------------------------------------------------------
A0A0C2I782      ------------------------------------------------------------
A0A2N8BYF5      ------------------------------------------------------------
A0A558FKX2      ------------------------------------------------------------
A0A1H1DBA0      ------------------------------------------------------------
J2TAD5          ------------------------------------------------------------
J3H699          ------------------------------------------------------------
A0A1H5J974      ------------------------------------------------------------
A0A0K1QRZ4      ------------------------------------------------------------
A0A560RJW9      ------------------------------------------------------------
A0A5E6TID7      ------------------------------------------------------------
A0A5E7CRU7      ------------------------------------------------------------
A0A5E7C564      ------------------------------------------------------------
A0A2W7MAV4      ------------------------------------------------------------
A0A4R3WQH5      ------------------------------------------------------------
W6VFG3          ------------------------------------------------------------
A0A1P8ENT1      ------------------------------------------------------------
A0A2N7XRV4      ------------------------------------------------------------
A0A0Q6QPG8      ------------------------------------------------------------
A0A0F4SWA7      ------------------------------------------------------------
A0A423J219      ------------------------------------------------------------
A0A4P6G9U8      ------------------------------------------------------------
A0A4Y8JE06      ------------------------------------------------------------
A0A502I1X9      ------------------------------------------------------------
A0A502J776      ------------------------------------------------------------
A0A5B0EZF6      ------------------------------------------------------------
A0A059L434      ------------------------------------------------------------
A0A0F4UWN2      ------------------------------------------------------------
A0A5E7WEF5      ------------------------------------------------------------
A0A1G0KSD0      ------------------------------------------------------------
A0A4P6WX84      ------------------------------------------------------------
A0A1D2S760      ------------------------------------------------------------
A0A5B8RW94      ------------------------------------------------------------
A0A258TN88      ------------------------------------------------------------
A0A1F9EUS2      ------------------------------------------------------------
A0A6H9HII8      ------------------------------------------------------------
A0A3N9VAW3      ------------------------------------------------------------
A0A1X0YE57      ------------------------------------------------------------
A0A2K2H9Q8      ------------------------------------------------------------
A0A6I1KNW9      ------------------------------------------------------------
A0A1H4B8T3      ------------------------------------------------------------
A0A1E7IQC3      ------------------------------------------------------------
A0A1M6KEN5      ------------------------------------------------------------
A0A353QLL3      ------------------------------------------------------------
A0A399I453      ------------------------------------------------------------
A0A651FBV9      ------------------------------------------------------------
A0A5C1MDH8      ------------------------------------------------------------
A0A7J4ZSX4      ------------------------------------------------------------
A0A5A9XE04      ------------------------------------------------------------
A0A643G9R1      ------------------------------------------------------------
A0A1G0M8Q7      ------------------------------------------------------------
A0A353MI14      ------------------------------------------------------------
A0A4S1CAW7      ------------------------------------------------------------
A0A562VHD2      ------------------------------------------------------------
A0A7K0J0R7      ------------------------------------------------------------
A0A6I6JNB5      ------------------------------------------------------------
A0A1G0LDK7      ------------------------------------------------------------
A0A6F9WVL7      ------------------------------------------------------------
A0A351Z9A2      ------------------------------------------------------------
A0A3N5FRH4      ------------------------------------------------------------
A0A1V4Y2C3      ------------------------------------------------------------
A0A2N2KTJ4      ------------------------------------------------------------
A0A2N2LQX0      ------------------------------------------------------------
A0A318D3U4      ------------------------------------------------------------
A0A401FQP5      ------------------------------------------------------------
A0A7C2AA26      ------------------------------------------------------------
A0A351Z4H9      ------------------------------------------------------------
A0A2N2KML4      ------------------------------------------------------------
E1YJF1          ------------------------------------------------------------
A0A1J5EVZ6      ------------------------------------------------------------
A0A2G6FCC5      ------------------------------------------------------------
A0A1F9MR25      ------------------------------------------------------------
A0A2G6M7F1      ------------------------------------------------------------
A0A7C3Q9R6      ------------------------------------------------------------
A0A1Q6DMW3      ------------------------------------------------------------
A0A3A6P8F8      ------------------------------------------------------------
A0A6L4AM84      ------------------------------------------------------------
A0A2G2DSM4      ------------------------------------------------------------
A0A1F9NI02      ------------------------------------------------------------
A0A4U1ABX4      ------------------------------------------------------------
A0A1W9M770      ------------------------------------------------------------
A0A1W9M7R6      ------------------------------------------------------------
A0A1M7Y300      ------------------------------------------------------------
A0A4U1ALN4      ------------------------------------------------------------
A0A1E7H876      ------------------------------------------------------------
A0A7C0U459      ------------------------------------------------------------
A0A0F2NF69      ------------------------------------------------------------
A0A1F9NFD0      ------------------------------------------------------------
A0A1M5YLH5      ------------------------------------------------------------
A0A4U1A4C7      ------------------------------------------------------------
A0A509L3P8      ------------------------------------------------------------
A0A3A4S038      ------------------------------------------------------------
A0A1F9N669      ------------------------------------------------------------
A0A1F9PFA7      ------------------------------------------------------------
A0A1H2EN09      ------------------------------------------------------------
K0NP00          ------------------------------------------------------------
A0A7C4N0I9      ------------------------------------------------------------
A0A1E7JCL5      ------------------------------------------------------------
A0A496YAH9      ------------------------------------------------------------
A0A1V4S7E4      ------------------------------------------------------------
A0A2N2H8D2      ------------------------------------------------------------
A0A2N2KC63      ------------------------------------------------------------
A0A3A4ZYW4      ------------------------------------------------------------
A0A1V4MCJ4      ------------------------------------------------------------
A0A661M0W4      ------------------------------------------------------------
A0A4U8YLL7      ------------------------------------------------------------
A0A445MZQ4      ------------------------------------------------------------
A0A2M7WWF7      ------------------------------------------------------------
A0A0M9E0E3      ------------------------------------------------------------
A0A4Q3IRI1      ------------------------------------------------------------
A0A7C1C6X5      ------------------------------------------------------------
A0A354EF47      ------------------------------------------------------------
A0A2G6MSP7      ------------------------------------------------------------
B7RS54          ------------------------------------------------------------
A0A1I6ENM4      ------------------------------------------------------------
A8LNM8          ------------------------------------------------------------
A0A0T5NSU3      ------------------------------------------------------------
A0A5P9I718      ------------------------------------------------------------
A0A2M8J3R9      ------------------------------------------------------------
A0A1I6X762      ------------------------------------------------------------
A0A0P1EFX8      ------------------------------------------------------------
A0A2G5KB39      ------------------------------------------------------------
A0A2N3CNV1      ------------------------------------------------------------
A0A257F1F4      ------------------------------------------------------------
A0A2D5J8T8      ------------------------------------------------------------
A0A2E3P9W6      ------------------------------------------------------------
A0A2G2B1P9      ------------------------------------------------------------
A0A258GCD5      ------------------------------------------------------------
A0A443INY4      ------------------------------------------------------------
A0A2D9YR88      ------------------------------------------------------------
A0A4Q3ZBK4      ------------------------------------------------------------
A0A1G9FY29      ------------------------------------------------------------
A0A6N9RUN2      ------------------------------------------------------------
A0A1G8QZS5      ------------------------------------------------------------
A0A1H2Y469      ------------------------------------------------------------
A0A497ZQU7      ------------------------------------------------------------
A0A4U8YMP3      ------------------------------------------------------------
A0A1Q8QQ99      ------------------------------------------------------------
A0A7C2SIB2      ------------------------------------------------------------
A0A3D5ZY44      ------------------------------------------------------------
A0A1G5C236      ------------------------------------------------------------
A0A432HIS7      ------------------------------------------------------------
A0A520CSP5      ------------------------------------------------------------
A0A372IH36      ------------------------------------------------------------
A0A540VW45      ------------------------------------------------------------
A0A1H9C241      ------------------------------------------------------------
A0A2E3FCR1      ------------------------------------------------------------
A0A4S3MG69      ------------------------------------------------------------
A0A3E0H727      ------------------------------------------------------------
A0A1I3TTC3      ------------------------------------------------------------
A0A1H3IZW6      ------------------------------------------------------------
A0A0M6YG59      ------------------------------------------------------------
A0A1H7G8B0      ------------------------------------------------------------
A0A7C3Z8T7      ------------------------------------------------------------
A0A1V4QMH7      ------------------------------------------------------------
A0A496XZQ4      ------------------------------------------------------------
A0A7C3UZM2      ------------------------------------------------------------
A0A1F9BJF7      ------------------------------------------------------------
F2NDF5          ------------------------------------------------------------
A0A656PSQ6      ------------------------------------------------------------
A0A4Q3ZDI7      ------------------------------------------------------------
A0A537PRC6      ------------------------------------------------------------
A0A1I3XJ27      ------------------------------------------------------------
A0A562CGU2      ------------------------------------------------------------
A0A7C9VCB3      ------------------------------------------------------------
A0A1I7DCG1      ------------------------------------------------------------
A0A3A3H6D9      ------------------------------------------------------------
A0A0Q6VA36      ------------------------------------------------------------
A0A1B2EQN1      ------------------------------------------------------------
A0A1E7HSL6      ------------------------------------------------------------
A0A2M7JX59      ------------------------------------------------------------
A0A3A4XVN3      ------------------------------------------------------------
A0A1E7JEV6      ------------------------------------------------------------
A0A2N2KDY5      ------------------------------------------------------------
A0A3N5YUD9      ------------------------------------------------------------
A0A0W1DLQ3      ------------------------------------------------------------
A0A246JVD8      ------------------------------------------------------------
A0A2N3BB54      ------------------------------------------------------------
A0A1H6G7A3      ------------------------------------------------------------
A0A0A7PGL6      ------------------------------------------------------------
A0A4Q2Z4L0      ------------------------------------------------------------
A0A5C4N0H6      ------------------------------------------------------------
A0A1V4M8I1      ------------------------------------------------------------
A0A7C0XE92      ------------------------------------------------------------
A0A1E7HFN0      ------------------------------------------------------------
A0A7J0BHG1      ------------------------------------------------------------
A0A1M5GH86      ------------------------------------------------------------
A0A1W1XQZ5      ------------------------------------------------------------
A0A6V8LMJ3      ------------------------------------------------------------
A0A2K8WHP8      ------------------------------------------------------------
A0A1J5N774      ------------------------------------------------------------
A0A2C8F781      ------------------------------------------------------------
A0A2E3R6G0      ------------------------------------------------------------
A0A7J0BUD3      ------------------------------------------------------------
A0A1F8XMK2      ------------------------------------------------------------
A0A3M8EMP2      ------------------------------------------------------------
A0A2J6J6K6      ------------------------------------------------------------
A0A661PSB9      ------------------------------------------------------------
A0A661QBT6      ------------------------------------------------------------
A0A6I2SLK2      ------------------------------------------------------------
A0A0A8WSG4      ------------------------------------------------------------
S7TK97          ------------------------------------------------------------
S7UE93          ------------------------------------------------------------
A0A3D5BR56      ------------------------------------------------------------
A0A2N2IB15      ------------------------------------------------------------
A0A1I3PSR2      ------------------------------------------------------------
A0A1I4GEK4      ------------------------------------------------------------
A0A7C8B5M6      ------------------------------------------------------------
A0A1W7QPT7      ------------------------------------------------------------
A0A6S6M1Y8      ------------------------------------------------------------
A0A6V8MCR2      ------------------------------------------------------------
A0A6V8N3X1      ------------------------------------------------------------
A0A6M4XJ81      ------------------------------------------------------------
A0A0M4D373      ------------------------------------------------------------
A0A1L3GKM9      ------------------------------------------------------------
A0A2T5R3J5      ------------------------------------------------------------
A0A1G6EKK9      ------------------------------------------------------------
A0A7C1DJX8      ------------------------------------------------------------
A0A3D6C3I2      ------------------------------------------------------------
S0G1D4          ------------------------------------------------------------
A0A661T246      ------------------------------------------------------------
A0A2G6CSG7      ------------------------------------------------------------
A0A2G6NB59      ------------------------------------------------------------
A0A5K8A7T9      ------------------------------------------------------------
A0A1W9U045      ------------------------------------------------------------
A0A1F9L9G4      ------------------------------------------------------------
A0A328FD76      ------------------------------------------------------------
A0A348UX90      ------------------------------------------------------------
A0A357Z0N5      ------------------------------------------------------------
A0A0F2R2U0      ------------------------------------------------------------
A0A5K7ZK00      ------------------------------------------------------------
A0A5K7YCX8      ------------------------------------------------------------
A0A5K7Z388      ------------------------------------------------------------
A0A352B502      ------------------------------------------------------------
A0A410V446      ------------------------------------------------------------
A0A0R3KGJ5      ------------------------------------------------------------
A0A0R3N604      ------------------------------------------------------------
A0A1B1UCM8      ------------------------------------------------------------
A0A1N6JQ20      ------------------------------------------------------------
A0A1M5TI07      ------------------------------------------------------------
A3X191          ------------------------------------------------------------
A0A1H4RKV5      ------------------------------------------------------------
A0A160UA87      ------------------------------------------------------------
A0A1Q5SFV5      ------------------------------------------------------------
A0A7C3Y7G3      ------------------------------------------------------------
A0A430DNP0      ------------------------------------------------------------
A0A3A0FQ32      ------------------------------------------------------------
A0A1E4UZA0      ------------------------------------------------------------
A0A1H9KL56      ------------------------------------------------------------
A0A1A9KEF8      ------------------------------------------------------------
A0A5E6PKN5      ------------------------------------------------------------
A0A0N9W1V6      ------------------------------------------------------------
A0A423GQ41      ------------------------------------------------------------
A0A423H7J2      ------------------------------------------------------------
A0A502HNM8      ------------------------------------------------------------
A0A4Q7H223      ------------------------------------------------------------
A0A1H4N2K9      ------------------------------------------------------------
A0A2K4KWF7      ------------------------------------------------------------
A0A3E0WXH2      ------------------------------------------------------------
A0A2N2TRC8      ------------------------------------------------------------
A0A1V4CIZ7      ------------------------------------------------------------
A0A1M3BXA5      ------------------------------------------------------------
A0A1Y2R3U6      ------------------------------------------------------------
A0A167HVD6      ------------------------------------------------------------
A0A1V3SCT6      ------------------------------------------------------------
L0H287          ------------------------------------------------------------
A0A495VG93      ------------------------------------------------------------
A0A4R3MYM4      ------------------------------------------------------------
G2E3C0          ------------------------------------------------------------
                                                                            

E1Y9C0          ------------------------------------------------------------
A0A1N6SH58      ------------------------------------------------------------
A0A4Q3AQN2      ------------------------------------------------------------
A0A1W9HS52      QNEQLFTRTSAVLEEVQSEPFLNLVVANYLKEGNKISFIVPAERVRGLILFIKAALKKGA
A0A2D5LFD8      TNFQNLALNSISNDLPTLISVM------------RSPLIL--------------------
A0A4D8PLT4      RRVELAEFKSVVSNLTPEAPAV------------RSEVSIVGSRALAERVVEKLGLINDP
A0A7J5VV32      ------------------------------------------------------------
A0A6G6X2Z4      ------------------------------------------------------------
Q44570          ------------------------------------------------------------
A0A3N5MZ53      ------------------------------------------------------------
A0A534E4H4      ------------------------------------------------------------
A0A534I2B6      ------------------------------------------------------------
A0A1C2JGD0      ------------------------------------------------------------
A0A259LQ70      ------------------------------------------------------------
A0A4V2SPR5      ------------------------------------------------------------
A0A3N5PM86      ------------------------------------------------------------
A0A2E5YSA4      ------------------------------------------------------------
A0A0N0XAV4      ------------------------------------------------------------
A0A0P9QD19      ------------------------------------------------------------
F3FHG4          ------------------------------------------------------------
F3GGI0          ------------------------------------------------------------
A0A0P9LE74      ------------------------------------------------------------
A0A3M4ZQ14      GLNRYAWGGEKIDVFQLDVPESLLGENLTLTAGQPGQFSL--------------------
A0A3M5YLE8      GLNRYAWGGEKIDVFQLDVPESLLGENLTLTAGQPGQFSL--------------------
A0A3M3RP89      GLNRYAWGGEKIDVFQLDVPESLLGENLTLTAGQPGQFSL--------------------
A0A0P9QIY7      GLNRYAWGGEKIDVFQLDVPESLLGENLTLTAGQPGQFSL--------------------
A0A0P9VVH7      GLNRYAWGGEKIDVFQLDVPESLLGENLTLTAGQPGQFSL--------------------
A0A0Q0FJK6      GLNRYAWGGEKIDVFQLDVPESLLGENLTLTAGQPGQFSL--------------------
A0A0Q0G2J0      GLNRYAWGGEKIDVFQLDVPESLLGENLTLTAGQPGQFSL--------------------
A0A3M3LF66      GLNRYAWGGEKIDVFQLDVPESLLGENLTLTAGQPGQFSL--------------------
A0A0P9WIR8      GLNRYAWGGEKIDVFQLDVPESLLGENLTLTAGQPGQFSL--------------------
A0A3M3KPE5      GLNRYAWGGEKIDVFQLDVPESLLGENLTLTAGQPGQFSL--------------------
A0A3M4C263      GLNRYAWGGEKIDVFQLDVPESLLGENLTLTAGQPGQFSL--------------------
A0A3M5AD05      GLNRYAWGGEKIDVFQLDVPESLLGENLTLTAGQPGQFSL--------------------
A0A0Q0D3D2      GLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSL--------------------
A0A0N0FS39      ------------------------------------------------------------
A0A3M6GHH2      ------------------------------------------------------------
A0A0P9R9W0      GLTHYAWGGEKIDVFQLEVPEYLLGEKLTLTAGRPGQFSL--------------------
A0A0Q0B9T0      GLTHYAWGGEKIDVFQLEVPEYLLGEKLTLTAGRPGQFSL--------------------
A0A3M6CFI7      GLTHYAWGGEKIDVFQLEVPEYLLGEKLTLTAGRPGQFSL--------------------
A0A0P9JXN0      GLTHYAWGGEKIDVFQLEVPEHLLGEKLTLTAGRPGQFSL--------------------
A0A3M6FIV7      GLTHYAWGGEKIDVFQLEVPEHLLGEKLTLTAGRPGQFSL--------------------
A0A3M3PLW9      GLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSL--------------------
A0A3M4ENY1      GLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSL--------------------
A0A3M5EZK7      GLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSL--------------------
A0A0P9SPP5      GLTQYAWGGEKIEVFQLEVPEHLLGKKLTLTAGKPGQFSL--------------------
A0A658KL17      GLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSL--------------------
A0A3M3NNF2      GLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSL--------------------
A0A3M4A0E8      GLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSL--------------------
A0A3M4PBZ2      GLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSL--------------------
A0A3M6AI26      GLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSL--------------------
A0A0P9IWP8      GLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSL--------------------
A0A0P9KZ49      GLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSL--------------------
A0A0P9V840      GLTQYAWGGENIEVFQLEVPEHLLGEKLTLTAGKPGQFSL--------------------
A0A0Q0AIE5      GLTQYAWGGENIEVFQLEVPEHLLGEKLTLTAGKPGQFSL--------------------
A0A3M2ZQH6      GLTQYAWGGENIEVFQLEVPEHLLGEKLTLTAGKPGQFSL--------------------
A0A0N8SQG2      GLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSL--------------------
A0A0W8HFU1      GLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSL--------------------
A0A3M5M873      GLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSL--------------------
A0A0P9VHH8      GLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSL--------------------
A0A0P9YV98      GLTQYAWGGEKIEVFQLEVPEHLLGEKLTLIAGKPGQFSL--------------------
A0A3M3G2W8      GLTQYAWGGEKIEVFQLEVPEHLLGEKLTLIAGKPGQFSL--------------------
A0A3M6C224      GLTQYAWGGEKIEVFQLEVPEHLLGEKLTLIAGKPGQFSL--------------------
A0A3M5K254      GLTQYAWGGEKIEVFQLEVPEHLLGEKLTLIAGKPGQFSL--------------------
A0A3M5JFB0      GLTQYAWGGEKIEVFQLEVPEHLLGEKLTLIAGKPGQFSL--------------------
A0A3M3TQV3      GLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSL--------------------
A0A3M3EF92      GLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSL--------------------
A0A3M5J1E2      GLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSL--------------------
A0A3M5G7H9      GLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSL--------------------
A0A3M4A376      GLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSL--------------------
A0A0Q0A5T8      GLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSL--------------------
A0A0P9SCD7      GLTQYAWGGEKIEVFQLEVPEHLLGEKLTLIAGKPGQFSL--------------------
A0A0P9T4G3      GLTQYAWGGEKIEVFQLEVPEHLLGEKLTLIAGKPGQFSL--------------------
A0A0P9VKB0      GLTQYAWGGEKIEVFQLEVPEHLLGEKLTLIAGKPGQFSL--------------------
A0A0Q0BM35      GLTQYAWGGEKIEVFQLEVPEHLLGEKLTLIAGKPGQFSL--------------------
A0A3M3TPR7      GLTQYAWGGEKIEVFQLEVPEHLLGEKLTLIAGKPGQFSL--------------------
A0A3M3U4Q3      GLTQYAWGGEKIEVFQLEVPEHLLGEKLTLIAGKPGQLSL--------------------
A0A0P9UCX7      GLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSL--------------------
A0A0P9S1F1      GLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSL--------------------
A0A0P9QCJ2      GLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSL--------------------
A0A0P9Q329      GLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSL--------------------
A0A3M5GJ64      GLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSL--------------------
A0A0P9MPC7      GLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSL--------------------
A0A3M2XYQ3      GLTQYAWGGEKIEVFQLEVPENLLGEKLTLTAGKPGQFSL--------------------
A0A0P9XCE1      GLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSL--------------------
A0A3M3EFX7      GLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSL--------------------
A0A3M5B9D9      GLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSL--------------------
A0A0P9RRZ3      GLTHYAWGGEKIELFQLEVPEHLLGEKLTLTAGKPGQFSL--------------------
A0A3M2VEK7      GLTQYAWGGEKIEVFQLEVPEHLLGERLTLTAGKPGQFSL--------------------
A0A0N8R9B3      GLTQYAWGGEKIEVFQLEVPEHLLGERLTLTAGKPGQFSL--------------------
A0A0P9VA27      GLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSL--------------------
A0A3M4YBJ4      GLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTSGKPGQFSL--------------------
A0A0P9J470      GLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSL--------------------
A0A0Q0EVJ8      GLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSL--------------------
A0A3M5UI30      GLTQYAWGGENIEVFQLEVPEHLLGEKLTLTAGKPGQFSL--------------------
A0A3M5YQT8      GLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSL--------------------
A0A3M5F5X1      GLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSL--------------------
A0A3M5R8G1      GLTQYAWGGEKIEVFQLEVPEHLLGEKLTLIAGKPGQLSL--------------------
A0A3M5V012      GLTQYAWGGEKIEVFQLEVPEHLLGEKLTLIAGKPGQLSL--------------------
A0A3M3GA16      GLTQYAWGGEKIEVFQLEVPEHLLGEKLTLIAGKPGQFSL--------------------
A0A3M3UCT3      GLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSL--------------------
A0A3M3CJL0      GLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSL--------------------
A0A3M3F6F5      GLTQYAWGGEKIEVFQLEVPEHLLGERLTLTAGKPGQFSL--------------------
A0A3M3P9B7      GLTQYAWGGEKIEVFQLEVPEHLLGERLTLTAGKPGQFSL--------------------
A0A0N8QB74      GLTQYAWGGEKIEVFQLEVPEHLLGERLTLTAGKPGQFSL--------------------
A0A0Q0AUD0      GLTQYAWGGEKIEVFQLEVPEHLLGERLTLTAGKPGQFSL--------------------
A0A3M5VR55      GLTQYAWGGEKIEVFQLEVPEHLLGERLTLTAGKPGQFSL--------------------
A0A0Q0FK97      GLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSL--------------------
A0A3M5KZ75      GLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSL--------------------
A0A3M5L3G5      GLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSL--------------------
A0A519ERR1      ------------------------------------------------------------
A0A4Q3Q1M2      ------------------------------------------------------------
A0A4Q3MHR1      ------------------------------------------------------------
A0A520GDZ4      ------------------------------------------------------------
A0A318DSU0      ------------------------------------------------------------
A0A538PF21      ------------------------------------------------------------
A0A1W1ZH10      ------------------------------------------------------------
A0A1W2FF24      ------------------------------------------------------------
A0A524JYQ6      ------------------------------------------------------------
A0A4Q3MA17      ------------------------------------------------------------
A0A0N0M5F7      ------------------------------------------------------------
A0A537M754      ------------------------------------------------------------
A0A1V1PDB4      ------------------------------------------------------------
A0A2M7C324      ------------------------------------------------------------
A0A4Q3HHG6      ------------------------------------------------------------
A0A3B7DTA4      ------------------------------------------------------------
A0A432ZK62      ------------------------------------------------------------
A0A1V5EEP4      ------------------------------------------------------------
A0A1V5EF48      ------------------------------------------------------------
A0A0S6X1X6      ------------------------------------------------------------
A0A537Y5L8      ------------------------------------------------------------
A0A4Q3L2X2      ------------------------------------------------------------
A0A4Q3T8J1      ------------------------------------------------------------
A0A4Q4ANM4      ------------------------------------------------------------
A0A4Q3UEC7      ------------------------------------------------------------
A0A1H5YYQ4      ------------------------------------------------------------
A0A1X4NLK2      ------------------------------------------------------------
A0A1X4NWB5      ------------------------------------------------------------
A0A1M5UQ38      ------------------------------------------------------------
A0A327YI48      ------------------------------------------------------------
A0A1B1PNL6      ------------------------------------------------------------
A0A2U8H9H9      ------------------------------------------------------------
A0A6B2NBB8      ------------------------------------------------------------
A0A1X6YIC0      ------------------------------------------------------------
A0A1I5E9E9      ------------------------------------------------------------
A0A1X6Z7N7      ------------------------------------------------------------
A0A2E1DQ13      ------------------------------------------------------------
A0A1H8C800      ------------------------------------------------------------
A0A2N3EZ05      ------------------------------------------------------------
A0A655R819      ------------------------------------------------------------
A0A655RNN3      ------------------------------------------------------------
A0A0R0BVC7      ------------------------------------------------------------
A0A3N5J7U8      ------------------------------------------------------------
A0A1S7S3I8      ------------------------------------------------------------
A0A519E8D7      ------------------------------------------------------------
A0A3S1FD32      ------------------------------------------------------------
A0A434DUT4      ------------------------------------------------------------
A0A528D3U3      ------------------------------------------------------------
A0A3S3UPT3      ------------------------------------------------------------
A0A3S1E286      ------------------------------------------------------------
A0A531AC71      ------------------------------------------------------------
A0A436K268      ------------------------------------------------------------
A0A434IDQ0      ------------------------------------------------------------
A0A435IRM5      ------------------------------------------------------------
A0A3S2C404      ------------------------------------------------------------
A0A435F6C0      ------------------------------------------------------------
A0A435BMN6      ------------------------------------------------------------
A0A529XQ54      ------------------------------------------------------------
A0A530BJC1      ------------------------------------------------------------
A0A348SRI7      ------------------------------------------------------------
A0A354EI73      ------------------------------------------------------------
A0A4P7EP83      ------------------------------------------------------------
A0A6I1QB25      ------------------------------------------------------------
A0A655ZZQ1      ------------------------------------------------------------
A0A1S0ZAI3      ------------------------------------------------------------
A0A3A4NIE9      ------------------------------------------------------------
A0A3A4NUI9      ------------------------------------------------------------
A0A524I3Z6      ------------------------------------------------------------
A0A524PCL7      ------------------------------------------------------------
A0A356GQV1      ------------------------------------------------------------
A0A1J5DAY8      ------------------------------------------------------------
A0A524P237      ------------------------------------------------------------
A0A3C0L0A8      ------------------------------------------------------------
A0A176S762      ------------------------------------------------------------
A0A377ZC40      ------------------------------------------------------------
A0A378BPJ7      ------------------------------------------------------------
A0A2J5PAJ7      ------------------------------------------------------------
A0A377ZDN3      ------------------------------------------------------------
A0A7A9Y5Q1      ------------------------------------------------------------
A0A1G3JY11      ------------------------------------------------------------
A0A661N3U1      ------------------------------------------------------------
A0A1W9WUD9      ------------------------------------------------------------
A0A1W1ZQK0      ------------------------------------------------------------
A0A6I1R304      ------------------------------------------------------------
A0A1W9PMU6      ------------------------------------------------------------
A0A3S1WTQ1      ------------------------------------------------------------
A0A530CUR9      ------------------------------------------------------------
A0A6L6H5T1      ------------------------------------------------------------
A0A6D0ELN7      ------------------------------------------------------------
A0A1M6N1X5      ------------------------------------------------------------
A0A561M3U0      ------------------------------------------------------------
A0A2N6BZD5      ------------------------------------------------------------
A0A1G3VVY5      ------------------------------------------------------------
A0A7C3S273      ------------------------------------------------------------
A0A7C4WJ18      ------------------------------------------------------------
A0A7C3V565      ------------------------------------------------------------
A0A351B422      ------------------------------------------------------------
F2NEE9          ------------------------------------------------------------
A0A2W5J775      ------------------------------------------------------------
A0A352Q5C1      ------------------------------------------------------------
A0A435NNF5      ------------------------------------------------------------
A0A3S2AQS7      ------------------------------------------------------------
A0A436XH86      ------------------------------------------------------------
A0A527ZPD6      ------------------------------------------------------------
A0A529KRW3      ------------------------------------------------------------
A0A530ZLX0      ------------------------------------------------------------
A0A355TB56      ------------------------------------------------------------
A0A1F9E324      ------------------------------------------------------------
A0A432SAI6      ------------------------------------------------------------
A0A4Q3LBH4      ------------------------------------------------------------
A0A4Q3LWP3      ------------------------------------------------------------
A0A7C3JPP4      ------------------------------------------------------------
A0A534V9L7      ------------------------------------------------------------
A0A7C3JJT4      ------------------------------------------------------------
A0A2N6VGL1      ------------------------------------------------------------
A0A3M3H5V6      ------------------------------------------------------------
A0A524M660      ------------------------------------------------------------
A0A7C3JSX5      ------------------------------------------------------------
A0A7I8MQ67      ------------------------------------------------------------
A0A0C1TRU6      ------------------------------------------------------------
A0A2Z5SSF4      ------------------------------------------------------------
A0A2T4ZJZ6      ------------------------------------------------------------
A0A0B8PTA8      ------------------------------------------------------------
A0A0B8QF75      ------------------------------------------------------------
A0A6P2T4F7      ------------------------------------------------------------
A0A4Q4CIB1      ------------------------------------------------------------
A0A522ACJ9      ------------------------------------------------------------
A0A1T2KYM8      ------------------------------------------------------------
A0A3N5Z7F8      ------------------------------------------------------------
A0A239HD34      ------------------------------------------------------------
A0A2G9ZR82      ------------------------------------------------------------
A0A4U9I390      ------------------------------------------------------------
A0A0P7ZZE4      ------------------------------------------------------------
A0A369R0Q9      ------------------------------------------------------------
A0A327LYE6      ------------------------------------------------------------
A0A5A9ZTV3      ------------------------------------------------------------
A0A6J4YZ98      ------------------------------------------------------------
A0A2X3M011      ------------------------------------------------------------
I2WC85          ------------------------------------------------------------
A0A7A9K1G5      ------------------------------------------------------------
A0A7B7KSB7      ------------------------------------------------------------
A0A400JH80      ------------------------------------------------------------
A0A479JNB1      ------------------------------------------------------------
A0A5C9AF52      ------------------------------------------------------------
A0A797FC39      ------------------------------------------------------------
A0A797FHC1      ------------------------------------------------------------
D8EEU7          ------------------------------------------------------------
A0A6D0EYC7      ------------------------------------------------------------
A0A7A6DHB0      ------------------------------------------------------------
A0A2H9EHM4      ------------------------------------------------------------
A0A7A5MLK0      ------------------------------------------------------------
A0A380B3D7      ------------------------------------------------------------
F5NSX0          ------------------------------------------------------------
A0A534XP85      ------------------------------------------------------------
A0A0P1H2H0      ------------------------------------------------------------
A0A258WKV0      ------------------------------------------------------------
A0A377N8F8      ------------------------------------------------------------
A5G4N9          ------------------------------------------------------------
A0A3C2DSE7      ------------------------------------------------------------
A0A2X1JBG5      ------------------------------------------------------------
A0A377LY04      ------------------------------------------------------------
A0A5C9ABR5      ------------------------------------------------------------
A0A5J9WU72      ------------------------------------------------------------
A0A2X3K9R3      ------------------------------------------------------------
A0A3T9EHW9      ------------------------------------------------------------
A0A484X141      ------------------------------------------------------------
A0A5N9VWI6      ------------------------------------------------------------
A0A6D0EJQ0      ------------------------------------------------------------
A0A444R390      ------------------------------------------------------------
A0A376LLF8      ------------------------------------------------------------
A0A6L7CT21      ------------------------------------------------------------
A0A4Q3LR91      ------------------------------------------------------------
A0A6C9IKN8      ------------------------------------------------------------
A0A4V1TR68      ------------------------------------------------------------
A0A444IY46      ------------------------------------------------------------
A0A6I7N627      ------------------------------------------------------------
A0A6L3ZR06      ------------------------------------------------------------
A0A3E0WKI3      ------------------------------------------------------------
A0A1H3I2J1      ------------------------------------------------------------
A0A1V5DJV0      ------------------------------------------------------------
A0A520IUC4      ------------------------------------------------------------
A0A521LJG5      ------------------------------------------------------------
A0A531IBQ7      ------------------------------------------------------------
A0A0P1FWI8      ------------------------------------------------------------
A0A6L8LHC6      ------------------------------------------------------------
A0A1V4WHZ7      ------------------------------------------------------------
A0A1E5AJN5      SRSFFVTAESTIAASIRTRRLARRVVYELNLTEKPNFYIQPVRFSLVGILKRAITGRAEQ
A0A2N3D2J1      ------------------------------------------------------------
A0A2N2GVE1      LPSYLGSTVKSNLAETSEDFWYEQRYLATQIEVIKSRNIALLAARRLENVDLHQLLGQPQ
A0A2N2INV3      LPSYLGSTVKSNLAETSEDFWYEQRYLATQIEVIKSRNIALLAARRLENAELHQLLGQPQ
A0A233IKJ2      ------------------------------------------------------------
A0A1Y5DXG5      ------------------------------------GKVGEEVTNGTFTLTIKELVARAG
A0A0B8P2H5      ---------------------------------------MARSENGEFLLFVSQLVGKQG
A0A380AQW6      ------------------------------------------------------------
A0A2G2GD62      GETYELSYKTKIKINIDYFTRLLFGKQKVYIEYKGIHKFGEDVISKYFQLKVIKVRELNS
A0A3R9C3P5      TSRNDLIDVKSETERLLSRGITERVVRELRLNELQEFNPALRKISFIDRIRATLRGLFDA
A0A0M3GBT1      SSSSDLLDAKSETERLLSRSIAERVVRELQLNLRPEFNPALREVTFFESIRTNLRGLFDP
B3Q577          SSSSDLLDAKSETERLLSRSIAERVVRELQLNLRPEFNPALREVTFFESIRTNLRGLFDP
A0A483QWI8      ------------------------------------------------------------
A0A483UXD3      ------------------------------------------------------------
A0A0A8J8L3      ------------------------------------------------------------
A0A660DJ38      ------------------------------------------------------------
A0A524P331      VLTGPEKSKVANADGSVRMGMPTFVVKNADGSIAAQGKTGQRVRTQDLTLLLDEIQGKKG
A0A4V1SSM5      ------------------------------------------------------------
A0A4Q3K8G7      ------------------------------------------------------------
A0A7C7W7M2      DDKFEDTQVGILQSNKLNRRVVQKLSLHEAGKLTPASFDAGIANSLKRWFAGLTETRVPI
A0A1M7HC79      ------------------------------------------------------------
A0A1D3JZN6      ------------------------------------------------------------
A0A1V6ESG1      ------------------------------------------------------------
A0A1H7YHK3      ------------------------------------------------------------
A0A534SH66      ------------------------------------------------------------
A0A3M0ZZ99      ------------------------------------------------------------
A0A238LBD3      ------------------------------------------------------------
A0A328C2K5      ESRPNVFGKQFERVELVDPGGRWQFEQFWNTQKEVLGSKWFARRVVEREGLLDAPGFLPA
A0A5C6X8M3      ESRPNVFGKQFERVELVDPGGRWQFEQFWNTQKEVLGSKWFAQRVIEREGLLDAPGFLPP
A0A3D8MRR7      ESRPNVFGKQFERVELVDPGGRWQFEQFWNTQKEVLGSKWFAQRVIEREGLLDAPGFLSP
A0A5C6UBJ7      ESRPNVFGKQFERVELVDPGGRWQFEQFWNTQKEVLGSKWFAQRVIEREGLLDAPGFLSP
A0A5C6XGM3      ESRPNVFGKQFERVELVDPGGRWQFEQFWNTQKEVLGSKWFAQRVIEREGLLDAPGFLPP
A0A537NZJ1      ------------------------------------------------------------
A0A7C4R3C4      ------------------------------------------------------------
A0A0P1FRV5      ------------------------------------------------------------
A0A4Q4CVW6      ------------------------------------------------------------
A0A090R136      ------------------------------------------------------------
A0A661JU93      ------------------------------------------------------------
A0A2E2T3V8      PKAVWPNAAEFVETRMEMIIGNETLSTVMSVLRGQGVSFSQEANVQGNFLRRIFGNDQGF
A0A367UAB4      PKAVWPNAAEFVETRMEMIVGNETLSTVMSILRGQGIIFSQEANARGNFLRRIFGNDQGF
A0A1F2ZW35      KLGLANNPDFNGTKPPGVLDSALDPIRELWSSGISSLLAPAPPPAPAQAPKPATSPSPRA
A0A377V641      ------------------------------------------------------------
A0A1F2YJ88      -----------------------------VILTGKTNQANTLRTADGLWNISIYTQDQLN
A0A6L3ZWI0      ------------------------------------------------------------
A0A5N8AL61      VAVDRQDNDIVNVEGSQRPLTTDSPSVDTEVQVILSPNTAMAVVENLKLQDRPGFGFPEG
A0A0J7XGZ1      DDNLIDTAVQIIRSPTLTLDVVRSLRLDRVPEFGGDSKSPSAKLTPPLATGTDGHGSTGD
I4CBA7          GGVVVGLVRSPVYKSSAILRVELGGPSQRGLQGALEFFAEFSIFYETQVQSLKEMAQSGS
A3VE95          KVMLDAREVRIMSSDEVVSNLSLSDPVIQSEVSVMTSNILIERLILEVGIERLETLYWGE
A0A1G0NL95      ------------------------------------------------------------
A0A024KA69      -----------------------------------------------------MALAVAA
A0A0L1KFN4      VERETSVADQEFYQTQYGLLRARSLAERVAAELGLVDRPEFFEMFRFDGADDPAFEIVNG
A0A3P5DSS6      ------------------------------------------------------------
A0A483YEL5      ------------------------------------------------------------
A0A658GUJ0      -------------------VKNDHQYSISGENIDFDGEIGRLIDKNGIRIQVDSINAEPG
A0A358L616      ------------------------------------------------------------
A0A1M7BLL7      ------------------------------------------------------------
A0A0H4KZM1      ------------------------------------------------------------
A0A3D5UYX7      ------------------------------------------------------------
A0A2N1WQN5      ------------------------------------------------------------
A0A352G2C2      ------------------------------------------------------------
A0A3C0PZN1      ------------------------------------------------------------
A0A524QFS4      TRVYRGESILELSLRRPRISGQQEAVIDDARYLSSSADQLNTQIMKLQGAGLRNLVLNKA
A0A520JSW4      TLELNPPEVEILADEGSKGGRQNAARSDINFIGTQLGLLGSRALAERVAQNLNLAADTAI
A0A1V1UJT2      ------------------------------------------------------------
A0A0L6CVX1      ------------------------------------------------------------
A0A1V0RR48      ------------------------------------------------------------
A0A0A0HJJ4      ------------------------------------------------------------
A0A5E7YA28      ------------------------------------------------------------
A0A4Q3LTF3      ------------------------------------------------------------
A0A7C3N3Y1      LKLKNHPEFSIEQPGFFRSLGSDLWNFLSGLPGSLSSSKKDSDKEPLKTDLSNRRDLTKE
A0A537UTP9      -VDSQVEVLQSENVALAVIKDLHLTKDPQFLWPKLGLFSAIKGSVLGLVDSVLRLFQSSS
A0A1D2RNR5      ------------------------------------------------------------
A0A4V1TQ46      ------------------------------------------------------------
A0A3A0FZC0      -------------------------MLEQPEIKSALFDTANQGFFGQLFGGDSESKQESD
A0A1N7JVZ7      ------------------------------------------------------------
A0A091C4A8      ------------------------------------MTAPAPWKLLLGLAGETDDEELDA
A0A4R3H6P6      VVKIDSVERDTSIGDQEFYQTQYGLLRTQVLAERVARDLGVVDDPAFFKLFGRRDLFQDG
A0A3S1NQ09      ----------------------------------------YVRPSSSMPGGADFSKLDPA
A0A443GJ52      -------------------------------------VIRYFRPNPAV-GTTDVAQLDPA
A0A6N3RE79      ------------------------------------------------------------
A0A6N9S3L5      ------------------------------------------------------------
A0A656BWB0      ------------------------------------------------------------
A0A6D0IFH4      ------------------------------------------------------------
A0A7A3MK38      ------------------------------------------------------------
A0A0A0FHV8      ------------------------------------------------------------
A0A1X3IPU7      ------------------------------------------------------------
A0A0A0G0N2      ------------------------------------------------------------
A0A2I8SDU4      ------------------------------------------------------------
A0A2I8SU55      ------------------------------------------------------------
A0A7I6T806      ------------------------------------------------------------
A0A7I6TQE9      ------------------------------------------------------------
A0A7I6U296      ------------------------------------------------------------
S1EXJ6          ------------------------------------------------------------
A0A376UBS1      ------------------------------------------------------------
A0A2W6S588      SYSPQQALSRDGQPAPPTQTTDAARDAAIESQLQIATSLPVAIRALQDPEVAKNPTILAR
A0A483E0N4      ----------------------------------INGYVGQLYENDDFSIKVDKMDAKPG
A0A2J4YQQ6      ------------------------------------------------------------
A0A483THX4      --------------------------------------------------------ALPG
A0A534MVS2      ------------------------------------------------------------
A0A444I5K6      -----------HELRIVDEFQLVDNPFMGPKSSLFSVSTLKSFMNFRSWFADDAAVAPDP
A0A154VE85      ASRDLALRAVESLRLIDDPAFNPALQPSASFAFGAWLRDHVLAPLGVAPSSGSGRASQGS
A0A3S1MCW7      ------------------------------------------------------------
A0A434IGN6      ------------------------------------------------------------
A0A528AX40      SENADVRAFLTAREKLKSRALAQRVVFQLGLSEKPDFLFPTSGFSLSNVFYRAFGISKSP
A0A528MV95      SESSDVRAFLTAREKLKSRALAQRVVFQLGLSEKPDFLFPTPNFSLSNIFYRAFGISKSP
A0A3C1S9Y1      ---------------------MPGTEDNMFSNLREWFKEKRQSWKDQMDSLLSSDKNKGN
A0A353EH49      TLYDGDEYLLKGRVGQDAVISLKDVKKYNRYYDQQYVLAREQEFSPYLKINIEYLKARVG
A0A1Y1Q9C1      PDMGEQDPFFRTQYEQLKSRKLAAQVIDGLDLKTRLFERPAPFSVLSSFKVIIKGLIAPL
A0A3M7LJH0      ------------------------------------------------------------
A0A316KRG4      ------------------------------------------------------------
A0A1E4JHX8      ----------------------------------------------------MRNTPAGR
M2U8P2          DELLPGLSERRAEITDAASVETAVQALRAPEIATAVARTVGPERILRAYMDPDQPIPTER
A0A1H7KZF8      IDAAAQRIVGTEDVAGPVQVADIDRQMETTLLMARSVPVAEAVMRALKLSADDTFLRQMH
A0A0J5Q9T7      ------------------------------------------------------------
A0A6N3UC48      ------------------------------------------------------------
A0A257NG76      ------------------------------------------------------------
A0A1T4TW59      QTQFEILRSSHIAESVIDELGLANLPEFNSLVGKPSARDQLLTLLRQIDGLDGFLPKPIA
A0A1I5YYQ0      ------------------------------------------------------------
A0A5P9FE62      ------------------------------------------------------------
A0A1Q3MB35      ------------------------------------------------------------
A0A259LUN7      ------------------------------------------------------------
A0A2D7AVL1      ------------------------------------------------------------
A0A3B9KZE9      ------------------------------------------------------------
A0A2U0NMP8      VHKLFISPNMYDDNFITLTVKNDHQYSISGENIDFDGEIGRLIDKNGIRIQVDSINAEPG
A0A4U9HNE9      --------------------------------------------MTTLSAEPGATFSVVK
A0A7C5N053      TPLGQDVEGVVDIGVGTYWNRQEYYQTQYQIIESQRVARETVARLALHHDQGFLANLPAG
A0A2G2CXY6      GYLGKTLILTAQDAGTFTLHDQDGMLLIEGNTLEQIDRDGFKIQVQALVARPGTEFLVTK
A0A3M1D4H3      ------------------------------------------------------------
A0A7C1A2A2      DVPLTIRFAAGGAYRVLRDGRTALDGRLGEPAAGPGLRLLLTAAHPGFVPAPGAEYRLRV
A0A5C8BYM7      ------------------------------------------------------------
A0A1J5ICP0      -----SYVLKFDGPDSYKIIEDKSGALAGKGELNKPFLGPNFSILVEGDHARKGRKMKFS
A0A379B9V4      AANTLILEIGEQRDSYTLFLEKTTEPLLTGKVGEKYDTDLIQFSLSQINAKPKQRFLINK
A0A0Q6TS97      ------------------------------------------------------------
A0A0Q6UYB4      ------------------------------------------------------------
A0A484XS37      ------------------MLSNNGTEIIKGKVGALESGHGISLLVSEISAEPGTVFEIAK
W7Q5J0          VVVVERDSEERYRVMLNEQHIGDGHIGQLHTFLDGEMELLIDEFNAAPGAQFRLAKRNRN
A0A654AKT6      --------------------------MYSKIVSVLFYMFFTCVIFNPQINGATIYFYLFI
A0A7A9JY19      --------------------------------------------------QPGESFKIKY
A0A0G9MZA5      --------------------------------------------------------MPEN
H0T8B0          IENLLVDDAAVETEIETTVSEKVIATVVSRLRLDQNPEFECPDRGLFAIFSPSKTSLPPS
A0A5C7N981      MAFIDRQTFDQTQYELLKSDALAQRVIEQLSLVAPARTASKSTGWLDIFKSADQKEDNAP
A0A534TV22      ------------------------------------------------------------
A0A351CXR4      RIIQSRAITTKAAQALNLTEKEFNLPAPATPFADLTNDISQMLLGRKLIDTPQNEQPKLA
A0A2N6GLF5      -----------MAEDVIAKLELTKHPEFQPEENKLISFDWKTWLKSYLPQQSGGAELDEA
A0A1W9LJP0      ---------------------------MSKNWFAEPLRFWKEKLLSLRNTGKPEDKDKKD
A0A0W1ICB0      DQEFYLTQYSLLNARSLAERVERRLRLARNPEFFAAHGETPEGEGLLSGLRSGPVSAADL
A0A7C1C8G2      -----------------------------------------------------MNRKVQE
A0A376KYN0      ------------------------------------------------------------
A0A7A9J338      ------------------------------------------------------------
A0A377E5P7      ------------------------------------------------------------
A0A2X1JB05      ------------------------------------------------------------
A0A376RML0      ------------------------------------------------------------
A0A6N3QTV2      ------------------------------------------------------------
A0A2E0UL88      ------------------------------------------------------------
A0A0T2QIS1      -----------------------------------------------MDDSSAASSSEDR
A0A0P7Y1D0      -----------MSELDLAADPEFNSRLREPSGLGAVAGAVAGFLSALLPSQVADSQSGEA
A0A542J310      ------------------------------------------------------------
A0A2M7JRZ7      ----------------------------------------MTGLFTSSKKNAPSEKEISE
A0A167IR75      -------------------------------------------------MTNERYSAEGR
A0A3B8T2U6      -----------------------------------KKLVKTAIPLFPDPQEVVLTDTEKQ
A0A365PWR2      ---------------------------------------------------------MTK
A0A2E9H5Z8      ------------------------------------------------------------
A0A2E2BR79      ------------------------------------------------------------
A0A6I4IKZ3      -------------------TEEVILTVPLNQANHVAGPHGLWKVAIFTKDQFDATYNIKS
A0A7H4JZ79      ------------------------------------------------------------
A0A0Q4Q524      -------------------------------------------------MVNGRYPAAGR
A0A0Q4CFJ9      -------------------------------------------------MVNGRYPASGR
A0A0Q4FE58      -------------------------------------------------MVNGRYPASGR
A0A0Q4JWC8      -------------------------------------------------MVNGRYPASGR
A0A0Q4KFL8      -------------------------------------------------MVNGRYPASGR
A0A522R8R0      ------------------------------------------------------------
A0A2U9NDY5      -----------------------------------MEGQGGKGQSAERQAHPGTEGGRRR
X7F6S5          ------------------------------------------------------------
A0A1G8NKI0      ------------------------------------------------------------
A0A355QPE4      ------------------------------------------------------------
A0A357RN98      ------------------------------------------------------------
A0A1I6U4V1      ------------------------------------------------------------
A0A6B2P8H8      ------------------------------------------------------------
A0A1P8USW9      ------------------------------------------------------------
A0A1G7CFZ2      ------------------------------------------------------------
A0A7G2TPW1      ------------------------------------------------------------
A0A0Q4IGG1      -------------------------------------------------MVNGQYKAAGR
A0A534RUJ5      ------------------------------------------------------------
A0A3M1CJM3      ------------------------------------------------------------
A0A2R7SVD4      ------------------------------------AQDGVEVLVAQLAANPGTRFEVVR
A0A3C0PWB6      ------------------------------------------------------------
V4Q8B7          ------------------------------------------MQIAQLDARPGTEFALVR
A0A0Q8XKK5      ------------------------------------------------------MTAVER
A0A2E0Q2W0      ------------------------------------------------------------
A0A660NIR6      ----------------MRSREVGIRVIKALGLENNPYFNPELTPEGKEQAAEGNVKELSQ
A0A142W0R3      AREKTISNEIAFFNTQYSLLESRSLAARTVRAGNLLNDKDFLAQYDLTGGEEGTPNSAQR
A0A0S4XR18      -----------MAQNSTKPWEIDGEYKFGQAIKTPYFTFVIKATKDFGLNDTSYKIIHQS
A0A7C5CFF1      ------------------------------------------------------------
A0A2E0GW64      -----------------------------------------------------------M
A0A1A7QJ97      -------------------------------------------------MNNGRFPAQGR
A0A661LW70      ------------------------------------------------------------
W7Q8F9          -MVVERDSEERYRVMLNEQHIGDGHIGQLHTFLDGEMELLIDEFNAAPGAQFRLAKRNRN
A0A524PXH8      ------------------------------------------------------------
A0A4Q3P0E4      --------HYLDILLANKWLIAAITGKVGTPLKTNTPNGPIDLLVSQLDGKPGAEFVVNR
A0A3M2BE89      --LGQPLTLVAQASNHYRLLDEEGEMLLEGQIGRVAEDHGISLYVSELIARPGTRFDLKK
A0A4Q4A6K6      ------------------------------------------------------------
A0A257G674      ---------------------DILKSRTLLERVAQKLRLIGNPRFYDAMGMRQPAGDLSR
A0A661M5M6      ------------------------------------------------------------
A0A1I1UM01      ------------------------------------------------------------
Q44573          -------------MIHSRDVAAAVMAQLPPPAAPPHVGLRDRLCHMGLGFLCHASTPVDP
A2W025          ALEGKKLTLTAGPNGTYSLVDENGTRLLAGRVGESAQGGGVTLLVQKLVARPGTQFTVVR
A0A534Z362      RDLAERVIRSRGLADSEAFLDPGSRRRGLLSLSGTMLRLLRPRGLETAPAGPSEDGSAGR
V4J283          -----------------------------------------------------------K
A0A536T443      ------------------------------------------------------------
A0A0Q4UFQ5      ----------------------------------------------MFESGRPIQTAAAR
A0A527W7E6      -------------------------------------------IPGIQNVDAATREAMIK
A0A432EMV7      ------------------------------------------------------------
A0A7C1SEU7      ------------------------------------------------------------
A0A534WLI3      ------------------------------------------------------------
A0A7C6FBW0      -------------ILRSDAVALAVIRAKGLVADPEFGGHVGLGKRLARLVGAANAAAEAP
A0A087LTV7      ------------------------------------------------------------
A0A7D7WSS2      ------------------------------------------------------------
A0A318KWA2      ------------MDGETPRALGEARVGELARFAEGDIELRVAALEAPAEAEFTLVKHRRA
A0A522MT86      ------------------------------------------------------------
A0A4Q3I221      ------------------------------------------------------------
A0A534SAL6      RDIAERVIRREGLATDEAFLHPGSGRKGLLNLTGNLVNLLRPRGWDGAPAAGSGAERAVA
A0A534ZDB4      RDLAERVIRSERLATDEAFLHPGAERKGLLSLSGNLVNLLRPRGWDGAPAASGGAEHAMP
A0A534X3M7      RDLAERVIRGRGLAANDAFLDPRPRRHGLLSLGESMPRPVRPRGFETAPARSSAPEAATR
A0A534SPC6      ------------------------------------------------------------
A0A535AD60      RDLAERVIRSRGLADSEAFLDPGPRRRGRLSLSGTTLRLLRPRGLETAPAGPSEDGSAGR
A0A4Q3SY08      ------------------------------------------------------------
A0A4Q3LG23      -----------------------------------SVAGRLERQRVAGKLLRDNLSISPT
A0A522EX52      ------------------------------------------------------------
A0A1H3KC95      -----------------------------------MNAGPRFRRR---------------
A0A5P8Z4P3      ---MTAERIFRRKNRPGARSDSSRDVQMSGSGETSGAEKPKVFRRHKRAETKRNAEAPDK
A0A2E9HXF7      ------------------------------------MDSPKFRRK------RTSATAHP-
A0A0B3RZC9      ---------------------------------MNMMDSPKFRRK------RTSATGSAR
A0A6F8QET1      ----------------MGRTGDTRGPKGCGARGMNMMDSPKFRRK------RTSATGSAR
A0A520HUH4      ------------------------------------------------------------
A0A2K8U7M6      -----------------------MTPLGNSRLVSVAFDSPN-------------------
A0A5B9DKL8      -----------------------MQEDAWGFDSFEGLIRRQWRMIALIWVGIVAAAALAL
A0A238KJM1      -----------------------------------MMDDRKFRRK---------------
A0A3A0FJZ4      ---------------------------------MSDAPAPGFDLRDAVLCLRRRAGWLAL
W4HJV8          ---------------------------------MNMANRPKFRRR------HRPAATGWD
A0A0P1GDI0      -----------------------------------MTERRKFRRK------NRSADAVED
A0A2R8ATV5      -----------------------------------MSERRKFTRK------KTQGAASSA
A0A1U7D3R6      ------------------------------------------------------------
A0A2D4UVV2      -----------------------------------MVERRKFQRK------KRPTAETDA
A0A0W7WHP4      -----------------------------------MTDQRKFRRK------GKRVR----
A0A238J8F6      ---------------------------------MNEMDNRKFRRK------YKSVDATAE
A0A238JQI6      ---------------------------------MNMMDGPKFRRK------HRSAAGKPR
A0A222E077      ---------------------------------MNMMDSPKFRRK------RTSATAHP-
A0A239E3Y2      ---------------------------------MNMMDSPKFKRK------RTSATAPH-
A0A534QGR3      ------------------------------------------------------------
A0A1F9CFF0      ------------------------------------------------------------
A0A2M8B0G5      ------------------------------------------------------------
A0A363TNU9      ------------------------------------------------------------
A0A0W1GMS6      ------------------------------------------------------------
A0A0Q8RMY3      ------------------------------------------------------------
A0A1A7QC21      ------------------------------------------------------------
A0A2W4RFS2      ------------------------------------------------------------
A0A1Y6DC43      ------------------------------------------------------------
A0A2S6HE06      ------------------------------------------------------------
G3J0M3          ------------------------------------------------------------
V5C6R5          ------------------------------------------------------------
A0A534HBS8      ------------------------------------------------------------
A0A0F0T3Y9      ------------------------------------------------------------
A0A379GWF0      ------------------------------------------------------------
A0A4Q2XLV7      ------------------------------------------------------------
A0A4Q5QYC4      ------------------------------------------------------------
A0A3B8SQ27      ------------------------------------------------------------
A0A0U2VAW2      ------------------------------------------------------------
A0A454CTF1      ------------------------------------------------------------
A0A6B3Q2G1      ------------------------------------------------------------
A0A4Q6G931      ------------------------------------------------------------
A0A2T0VBD8      ------------------------------------------------------------
A0A378APS2      ------------------------------------------------------------
A0A443VCQ6      ------------------------------------------------------------
A0A447RKQ7      ------------------------------------------------------------
W1DSK1          ------------------------------------------------------------
A0A2N1XK22      ------------------------------------------------------------
A0A3D0KAC8      ------------------------------------------------------------
A0A3D2Y902      ------------------------------------------------------------
A0A378G3G7      ------------------------------------------------------------
A0A2X5NHJ9      ------------------------------------------------------------
A0A2J4QEC3      ------------------------------------------------------------
A0A485ADM3      ------------------------------------------------------------
A0A4U9HGU4      ------------------------------------------------------------
A0A3S4JGG5      ------------------------------------------------------------
A0A377ZDH2      ------------------------------------------------------------
A0A3S4HTS8      ------------------------------------------------------------
A0A1W9F5M9      ------------------------------------------------------------
A0A379W6R2      ------------------------------------------------------------
A0A379TA56      ------------------------------------------------------------
A0A655C5P0      ------------------------------------------------------------
A0A6D0I9G1      ------------------------------------------------------------
A0A352MMI7      ------------------------------------------------------------
A0A4Z0LWV1      ------------------------------------------------------------
A0A377K431      ------------------------------------------------------------
A0A376RY66      ------------------------------------------------------------
A0A778GAM7      ------------------------------------------------------------
A0A3C2BN18      ------------------------------------------------------------
A0A447LR75      ------------------------------------------------------------
A0A759KJJ5      ------------------------------------------------------------
A0A376D8L7      ------------------------------------------------------------
A0A1V2FV46      ------------------------------------------------------------
A0A6N8QLT3      ------------------------------------------------------------
A0A376SB61      ------------------------------------------------------------
A0A3D1BYV9      ------------------------------------------------------------
A0A536T0W8      ------------------------------------------------------------
A0A3D2M6Y9      ------------------------------------------------------------
A0A3D2YAZ2      ------------------------------------------------------------
A0A350A102      ------------------------------------------------------------
A0A350L5D2      ------------------------------------------------------------
A0A2G9XLE5      ------------------------------------------------------------
A0A6L3MM74      ------------------------------------------------------------
A0A7C3QM04      ------------------------------------------------------------
A0A7I8MVM0      ------------------------------------------------------------
A0A7C0Y3J7      ------------------------------------------------------------
A0A7C3LF61      ------------------------------------------------------------
A0A4R1HDF2      ------------------------------------------------------------
A0A6N1DL48      ------------------------------------------------------------
A0A1V6FYJ1      ------------------------------------------------------------
A0A0C5VQ86      ------------------------------------------------------------
A0A0Q6QV61      ------------------------------------------------------------
A0A2Z3IKG4      ------------------------------------------------------------
A0A3N5RNY4      ------------------------------------------------------------
A0A4Z0M4C7      ------------------------------------------------------------
A0A5Q2QDL1      ------------------------------------------------------------
A0A1V8MBH1      ------------------------------------------------------------
A0A6J4X8D4      ------------------------------------------------------------
A0A318CT66      ------------------------------------------------------------
A0A3N5P205      ------------------------------------------------------------
A0A443K010      ------------------------------------------------------------
A0A6I7NYG5      ------------------------------------------------------------
A0A212AR83      ------------------------------------------------------------
A0A2E2P4I0      ------------------------------------------------------------
A0A2U2CM86      ------------------------------------------------------------
A0A1I0R9R6      ------------------------------------------------------------
A0A2N3BVE7      ------------------------------------------------------------
A0A7C2IB02      ------------------------------------------------------------
A0A6N6SI00      ------------------------------------------------------------
A0A2S5JE21      ------------------------------------------------------------
A0A2R8BKZ2      ------------------------------------------------------------
A0A2S8S361      ------------------------------------------------------------
A0A520ZTR8      ------------------------------------------------------------
A0A316GHM6      ------------------------------------------------------------
A0A238IZI1      ------------------------------------------------------------
A0A7C9INT8      ------------------------------------------------------------
A0A6M1UAR9      ------------------------------------------------------------
A0A1X7ACC1      ------------------------------------------------------------
A0A238KUF6      ------------------------------------------------------------
A0A095CTW3      ------------------------------------------------------------
A0A2E3UGD6      ------------------------------------------------------------
A0A2T0RFH0      ------------------------------------------------------------
A0A285D390      ------------------------------------------------------------
A0A497VHN4      ------------------------------------------------------------
A0A2N6BEI9      ------------------------------------------------------------
A0A0D5N3E9      ------------------------------------------------------------
A0A2N2G716      ------------------------------------------------------------
A0A7C1UTU6      ------------------------------------------------------------
W9VVY5          ------------------------------------------------------------
A0A1E2URD3      ------------------------------------------------------------
A0A2T6MY81      ------------------------------------------------------------
A0A2T6NBQ8      ------------------------------------------------------------
A0A421K431      ------------------------------------------------------------
A0A2G2I5M1      ------------------------------------------------------------
A0A2G2M6F0      ------------------------------------------------------------
A0A1W9J9F8      ------------------------------------------------------------
A0A2S5LFJ9      ------------------------------------------------------------
A0A2D8R8F8      ------------------------------------------------------------
A0A6I4JXQ8      ------------------------------------------------------------
A0A010SNS0      ------------------------------------------------------------
A0A0C2I782      ------------------------------------------------------------
A0A2N8BYF5      ------------------------------------------------------------
A0A558FKX2      ------------------------------------------------------------
A0A1H1DBA0      ------------------------------------------------------------
J2TAD5          ------------------------------------------------------------
J3H699          ------------------------------------------------------------
A0A1H5J974      ------------------------------------------------------------
A0A0K1QRZ4      ------------------------------------------------------------
A0A560RJW9      ------------------------------------------------------------
A0A5E6TID7      ------------------------------------------------------------
A0A5E7CRU7      ------------------------------------------------------------
A0A5E7C564      ------------------------------------------------------------
A0A2W7MAV4      ------------------------------------------------------------
A0A4R3WQH5      ------------------------------------------------------------
W6VFG3          ------------------------------------------------------------
A0A1P8ENT1      ------------------------------------------------------------
A0A2N7XRV4      ------------------------------------------------------------
A0A0Q6QPG8      ------------------------------------------------------------
A0A0F4SWA7      ------------------------------------------------------------
A0A423J219      ------------------------------------------------------------
A0A4P6G9U8      ------------------------------------------------------------
A0A4Y8JE06      ------------------------------------------------------------
A0A502I1X9      ------------------------------------------------------------
A0A502J776      ------------------------------------------------------------
A0A5B0EZF6      ------------------------------------------------------------
A0A059L434      ------------------------------------------------------------
A0A0F4UWN2      ------------------------------------------------------------
A0A5E7WEF5      ------------------------------------------------------------
A0A1G0KSD0      ------------------------------------------------------------
A0A4P6WX84      ------------------------------------------------------------
A0A1D2S760      ------------------------------------------------------------
A0A5B8RW94      ------------------------------------------------------------
A0A258TN88      ------------------------------------------------------------
A0A1F9EUS2      ------------------------------------------------------------
A0A6H9HII8      ------------------------------------------------------------
A0A3N9VAW3      ------------------------------------------------------------
A0A1X0YE57      ------------------------------------------------------------
A0A2K2H9Q8      ------------------------------------------------------------
A0A6I1KNW9      ------------------------------------------------------------
A0A1H4B8T3      ------------------------------------------------------------
A0A1E7IQC3      ------------------------------------------------------------
A0A1M6KEN5      ------------------------------------------------------------
A0A353QLL3      ------------------------------------------------------------
A0A399I453      ------------------------------------------------------------
A0A651FBV9      ------------------------------------------------------------
A0A5C1MDH8      ------------------------------------------------------------
A0A7J4ZSX4      ------------------------------------------------------------
A0A5A9XE04      ------------------------------------------------------------
A0A643G9R1      ------------------------------------------------------------
A0A1G0M8Q7      ------------------------------------------------------------
A0A353MI14      ------------------------------------------------------------
A0A4S1CAW7      ------------------------------------------------------------
A0A562VHD2      ------------------------------------------------------------
A0A7K0J0R7      ------------------------------------------------------------
A0A6I6JNB5      ------------------------------------------------------------
A0A1G0LDK7      ------------------------------------------------------------
A0A6F9WVL7      ------------------------------------------------------------
A0A351Z9A2      ------------------------------------------------------------
A0A3N5FRH4      ------------------------------------------------------------
A0A1V4Y2C3      ------------------------------------------------------------
A0A2N2KTJ4      ------------------------------------------------------------
A0A2N2LQX0      ------------------------------------------------------------
A0A318D3U4      ------------------------------------------------------------
A0A401FQP5      ------------------------------------------------------------
A0A7C2AA26      ------------------------------------------------------------
A0A351Z4H9      ------------------------------------------------------------
A0A2N2KML4      ------------------------------------------------------------
E1YJF1          ------------------------------------------------------------
A0A1J5EVZ6      ------------------------------------------------------------
A0A2G6FCC5      ------------------------------------------------------------
A0A1F9MR25      ------------------------------------------------------------
A0A2G6M7F1      ------------------------------------------------------------
A0A7C3Q9R6      ------------------------------------------------------------
A0A1Q6DMW3      ------------------------------------------------------------
A0A3A6P8F8      ------------------------------------------------------------
A0A6L4AM84      ------------------------------------------------------------
A0A2G2DSM4      ------------------------------------------------------------
A0A1F9NI02      ------------------------------------------------------------
A0A4U1ABX4      ------------------------------------------------------------
A0A1W9M770      ------------------------------------------------------------
A0A1W9M7R6      ------------------------------------------------------------
A0A1M7Y300      ------------------------------------------------------------
A0A4U1ALN4      ------------------------------------------------------------
A0A1E7H876      ------------------------------------------------------------
A0A7C0U459      ------------------------------------------------------------
A0A0F2NF69      ------------------------------------------------------------
A0A1F9NFD0      ------------------------------------------------------------
A0A1M5YLH5      ------------------------------------------------------------
A0A4U1A4C7      ------------------------------------------------------------
A0A509L3P8      ------------------------------------------------------------
A0A3A4S038      ------------------------------------------------------------
A0A1F9N669      ------------------------------------------------------------
A0A1F9PFA7      ------------------------------------------------------------
A0A1H2EN09      ------------------------------------------------------------
K0NP00          ------------------------------------------------------------
A0A7C4N0I9      ------------------------------------------------------------
A0A1E7JCL5      ------------------------------------------------------------
A0A496YAH9      ------------------------------------------------------------
A0A1V4S7E4      ------------------------------------------------------------
A0A2N2H8D2      ------------------------------------------------------------
A0A2N2KC63      ------------------------------------------------------------
A0A3A4ZYW4      ------------------------------------------------------------
A0A1V4MCJ4      ------------------------------------------------------------
A0A661M0W4      ------------------------------------------------------------
A0A4U8YLL7      ------------------------------------------------------------
A0A445MZQ4      ------------------------------------------------------------
A0A2M7WWF7      ------------------------------------------------------------
A0A0M9E0E3      ------------------------------------------------------------
A0A4Q3IRI1      ------------------------------------------------------------
A0A7C1C6X5      ------------------------------------------------------------
A0A354EF47      ------------------------------------------------------------
A0A2G6MSP7      ------------------------------------------------------------
B7RS54          ------------------------------------------------------------
A0A1I6ENM4      ------------------------------------------------------------
A8LNM8          ------------------------------------------------------------
A0A0T5NSU3      ------------------------------------------------------------
A0A5P9I718      ------------------------------------------------------------
A0A2M8J3R9      ------------------------------------------------------------
A0A1I6X762      ------------------------------------------------------------
A0A0P1EFX8      ------------------------------------------------------------
A0A2G5KB39      ------------------------------------------------------------
A0A2N3CNV1      ------------------------------------------------------------
A0A257F1F4      ------------------------------------------------------------
A0A2D5J8T8      ------------------------------------------------------------
A0A2E3P9W6      ------------------------------------------------------------
A0A2G2B1P9      ------------------------------------------------------------
A0A258GCD5      ------------------------------------------------------------
A0A443INY4      ------------------------------------------------------------
A0A2D9YR88      ------------------------------------------------------------
A0A4Q3ZBK4      ------------------------------------------------------------
A0A1G9FY29      ------------------------------------------------------------
A0A6N9RUN2      ------------------------------------------------------------
A0A1G8QZS5      ------------------------------------------------------------
A0A1H2Y469      ------------------------------------------------------------
A0A497ZQU7      ------------------------------------------------------------
A0A4U8YMP3      ------------------------------------------------------------
A0A1Q8QQ99      ------------------------------------------------------------
A0A7C2SIB2      ------------------------------------------------------------
A0A3D5ZY44      ------------------------------------------------------------
A0A1G5C236      ------------------------------------------------------------
A0A432HIS7      ------------------------------------------------------------
A0A520CSP5      ------------------------------------------------------------
A0A372IH36      ------------------------------------------------------------
A0A540VW45      ------------------------------------------------------------
A0A1H9C241      ------------------------------------------------------------
A0A2E3FCR1      ------------------------------------------------------------
A0A4S3MG69      ------------------------------------------------------------
A0A3E0H727      ------------------------------------------------------------
A0A1I3TTC3      ------------------------------------------------------------
A0A1H3IZW6      ------------------------------------------------------------
A0A0M6YG59      ------------------------------------------------------------
A0A1H7G8B0      ------------------------------------------------------------
A0A7C3Z8T7      ------------------------------------------------------------
A0A1V4QMH7      ------------------------------------------------------------
A0A496XZQ4      ------------------------------------------------------------
A0A7C3UZM2      ------------------------------------------------------------
A0A1F9BJF7      ------------------------------------------------------------
F2NDF5          ------------------------------------------------------------
A0A656PSQ6      ------------------------------------------------------------
A0A4Q3ZDI7      ------------------------------------------------------------
A0A537PRC6      ------------------------------------------------------------
A0A1I3XJ27      ------------------------------------------------------------
A0A562CGU2      ------------------------------------------------------------
A0A7C9VCB3      ------------------------------------------------------------
A0A1I7DCG1      ------------------------------------------------------------
A0A3A3H6D9      ------------------------------------------------------------
A0A0Q6VA36      ------------------------------------------------------------
A0A1B2EQN1      ------------------------------------------------------------
A0A1E7HSL6      ------------------------------------------------------------
A0A2M7JX59      ------------------------------------------------------------
A0A3A4XVN3      ------------------------------------------------------------
A0A1E7JEV6      ------------------------------------------------------------
A0A2N2KDY5      ------------------------------------------------------------
A0A3N5YUD9      ------------------------------------------------------------
A0A0W1DLQ3      ------------------------------------------------------------
A0A246JVD8      ------------------------------------------------------------
A0A2N3BB54      ------------------------------------------------------------
A0A1H6G7A3      ------------------------------------------------------------
A0A0A7PGL6      ------------------------------------------------------------
A0A4Q2Z4L0      ------------------------------------------------------------
A0A5C4N0H6      ------------------------------------------------------------
A0A1V4M8I1      ------------------------------------------------------------
A0A7C0XE92      ------------------------------------------------------------
A0A1E7HFN0      ------------------------------------------------------------
A0A7J0BHG1      ------------------------------------------------------------
A0A1M5GH86      ------------------------------------------------------------
A0A1W1XQZ5      ------------------------------------------------------------
A0A6V8LMJ3      ------------------------------------------------------------
A0A2K8WHP8      ------------------------------------------------------------
A0A1J5N774      ------------------------------------------------------------
A0A2C8F781      ------------------------------------------------------------
A0A2E3R6G0      ------------------------------------------------------------
A0A7J0BUD3      ------------------------------------------------------------
A0A1F8XMK2      ------------------------------------------------------------
A0A3M8EMP2      ------------------------------------------------------------
A0A2J6J6K6      ------------------------------------------------------------
A0A661PSB9      ------------------------------------------------------------
A0A661QBT6      ------------------------------------------------------------
A0A6I2SLK2      ------------------------------------------------------------
A0A0A8WSG4      ------------------------------------------------------------
S7TK97          ------------------------------------------------------------
S7UE93          ------------------------------------------------------------
A0A3D5BR56      ------------------------------------------------------------
A0A2N2IB15      ------------------------------------------------------------
A0A1I3PSR2      ------------------------------------------------------------
A0A1I4GEK4      ------------------------------------------------------------
A0A7C8B5M6      ------------------------------------------------------------
A0A1W7QPT7      ------------------------------------------------------------
A0A6S6M1Y8      ------------------------------------------------------------
A0A6V8MCR2      ------------------------------------------------------------
A0A6V8N3X1      ------------------------------------------------------------
A0A6M4XJ81      ------------------------------------------------------------
A0A0M4D373      ------------------------------------------------------------
A0A1L3GKM9      ------------------------------------------------------------
A0A2T5R3J5      ------------------------------------------------------------
A0A1G6EKK9      ------------------------------------------------------------
A0A7C1DJX8      ------------------------------------------------------------
A0A3D6C3I2      ------------------------------------------------------------
S0G1D4          ------------------------------------------------------------
A0A661T246      ------------------------------------------------------------
A0A2G6CSG7      ------------------------------------------------------------
A0A2G6NB59      ------------------------------------------------------------
A0A5K8A7T9      ------------------------------------------------------------
A0A1W9U045      ------------------------------------------------------------
A0A1F9L9G4      ------------------------------------------------------------
A0A328FD76      ------------------------------------------------------------
A0A348UX90      ------------------------------------------------------------
A0A357Z0N5      ------------------------------------------------------------
A0A0F2R2U0      ------------------------------------------------------------
A0A5K7ZK00      ------------------------------------------------------------
A0A5K7YCX8      ------------------------------------------------------------
A0A5K7Z388      ------------------------------------------------------------
A0A352B502      ------------------------------------------------------------
A0A410V446      ------------------------------------------------------------
A0A0R3KGJ5      ------------------------------------------------------------
A0A0R3N604      ------------------------------------------------------------
A0A1B1UCM8      ------------------------------------------------------------
A0A1N6JQ20      ------------------------------------------------------------
A0A1M5TI07      ------------------------------------------------------------
A3X191          ------------------------------------------------------------
A0A1H4RKV5      ------------------------------------------------------------
A0A160UA87      ------------------------------------------------------------
A0A1Q5SFV5      ------------------------------------------------------------
A0A7C3Y7G3      ------------------------------------------------------------
A0A430DNP0      ------------------------------------------------------------
A0A3A0FQ32      ------------------------------------------------------------
A0A1E4UZA0      ------------------------------------------------------------
A0A1H9KL56      ------------------------------------------------------------
A0A1A9KEF8      ------------------------------------------------------------
A0A5E6PKN5      ------------------------------------------------------------
A0A0N9W1V6      ------------------------------------------------------------
A0A423GQ41      ------------------------------------------------------------
A0A423H7J2      ------------------------------------------------------------
A0A502HNM8      ------------------------------------------------------------
A0A4Q7H223      ------------------------------------------------------------
A0A1H4N2K9      ------------------------------------------------------------
A0A2K4KWF7      ------------------------------------------------------------
A0A3E0WXH2      ------------------------------------------------------------
A0A2N2TRC8      ------------------------------------------------------------
A0A1V4CIZ7      ------------------------------------------------------------
A0A1M3BXA5      ------------------------------------------------------------
A0A1Y2R3U6      ------------------------------------------------------------
A0A167HVD6      ------------------------------------------------------------
A0A1V3SCT6      ------------------------------------------------------------
L0H287          ------------------------------------------------------------
A0A495VG93      ------------------------------------------------------------
A0A4R3MYM4      ------------------------------------------------------------
G2E3C0          ------------------------------------------------------------
                                                                            

E1Y9C0          ------------------------------------------------------------
A0A1N6SH58      ------------------------------------------------------------
A0A4Q3AQN2      ------------------------------------------------------------
A0A1W9HS52      KLEDIQKHRDWIELRGYFRAAIESFANFETGIITIRIRTRHKDTSFNLAHVASEALVDRN
A0A2D5LFD8      --SPIAESFDLSELQLAGRITITPVGEGRTGQGAGILNVKLK-------------GKDPD
A0A4D8PLT4      EFNPTLKAADGADDHWLKRVTKAGVG-ALPPEGNDVLRQIVQQATALFRAEESPNAGDPN
A0A7J5VV32      ------------------------------------------------------------
A0A6G6X2Z4      ------------------------------------------------------------
Q44570          ------------------------------------------------------------
A0A3N5MZ53      ------------------------------------------------------------
A0A534E4H4      ------------------------------------------------------------
A0A534I2B6      ------------------------------------------------------------
A0A1C2JGD0      ------------------------------------------------------------
A0A259LQ70      ------------------------------------------------------------
A0A4V2SPR5      ------------------------------------------------------------
A0A3N5PM86      ------------------------------------------------------------
A0A2E5YSA4      ------------------------------------------------------------
A0A0N0XAV4      ------------------------------------------------------------
A0A0P9QD19      ------------------------------------------------------------
F3FHG4          ------------------------------------------------------------
F3GGI0          ------------------------------------------------------------
A0A0P9LE74      ------------------------------------------------------------
A0A3M4ZQ14      ----------------------------------------YDDEHRLLLRGATNRVVEGS
A0A3M5YLE8      ----------------------------------------YDDEHRLLLRGATNRVVEGS
A0A3M3RP89      ----------------------------------------YDDEHSLLLRGATNRVVEGS
A0A0P9QIY7      ----------------------------------------YDDERRLLLRGATNRVVEGS
A0A0P9VVH7      ----------------------------------------YDDEHRLLLRGATNRVVEGS
A0A0Q0FJK6      ----------------------------------------YDDERRLLLRGATNRVVEGS
A0A0Q0G2J0      ----------------------------------------YDDEHRLLLRGATNRVVEGS
A0A3M3LF66      ----------------------------------------YDDEHRLLLRGATNRVVEGS
A0A0P9WIR8      ----------------------------------------YDDERRLLLRGATNRVVEGS
A0A3M3KPE5      ----------------------------------------YDDEHRLLLRGATNRVVEGS
A0A3M4C263      ----------------------------------------YDDEHRLLLRGATNRVVEGS
A0A3M5AD05      ----------------------------------------YDDEHRLLLRGATNRVVEGS
A0A0Q0D3D2      ----------------------------------------YDNEHNLLLGGTINRIVEGN
A0A0N0FS39      ------------------------------------------------------------
A0A3M6GHH2      ------------------------------------------------------------
A0A0P9R9W0      ----------------------------------------YDNEHNLLLGGTTNRVVEGN
A0A0Q0B9T0      ----------------------------------------YDNEHNLLLGGTTNRVVEGN
A0A3M6CFI7      ----------------------------------------YDNEHNLLLGGTTNRVVEGN
A0A0P9JXN0      ----------------------------------------YDNEHNLLLGGTTNRVVEGN
A0A3M6FIV7      ----------------------------------------YDNEHNLLLGGTTNRVVEGN
A0A3M3PLW9      ----------------------------------------YDSEHNLLLGGAINRVVEGH
A0A3M4ENY1      ----------------------------------------YDSEHNLLLGGALNRVVEGH
A0A3M5EZK7      ----------------------------------------YDSEHNLLLGGAINRVVEGQ
A0A0P9SPP5      ----------------------------------------YDNEHNLLLGGTINRIVEGN
A0A658KL17      ----------------------------------------YDNEHNLLLGGTINRIVEGN
A0A3M3NNF2      ----------------------------------------YDNEHNLLLGGTINRIVEGN
A0A3M4A0E8      ----------------------------------------YDNEHNLLLGGTINRIVEGN
A0A3M4PBZ2      ----------------------------------------YDNEHNLLLGGTINRIVEGN
A0A3M6AI26      ----------------------------------------YDNEHNLLLGGTINRIVEGN
A0A0P9IWP8      ----------------------------------------YDNEHNLLLGGTINRIVEGN
A0A0P9KZ49      ----------------------------------------YDNEHNLLLGGTINRIVEGN
A0A0P9V840      ----------------------------------------YDNEHNLLLGGTINRIVEGN
A0A0Q0AIE5      ----------------------------------------YDNEHNLLLGGTINRIVEGN
A0A3M2ZQH6      ----------------------------------------YDNEHNLLLGGTINRIVEGN
A0A0N8SQG2      ----------------------------------------YDNEHNLLLGGTINRIVEGN
A0A0W8HFU1      ----------------------------------------YDNEHNLLLGGTINRIVEGN
A0A3M5M873      ----------------------------------------YDNEHNLLLGGTINRIVEGN
A0A0P9VHH8      ----------------------------------------YDNEHNLLLGGTINRIVEGN
A0A0P9YV98      ----------------------------------------YDNEHNLLLGGTINRIVEGN
A0A3M3G2W8      ----------------------------------------YDNEHNLLLGGTINRIVEGN
A0A3M6C224      ----------------------------------------YDNEHKLLLGGTINRIVEGN
A0A3M5K254      ----------------------------------------YDNEHNLLLGGTINRIVEGN
A0A3M5JFB0      ----------------------------------------YDNEHNLLLGGTINRIVEGN
A0A3M3TQV3      ----------------------------------------YDNEHNLLLGGTINRIVEGN
A0A3M3EF92      ----------------------------------------YDNEHNLLLGGTINRIVEGN
A0A3M5J1E2      ----------------------------------------YDNEHNLLLGGTINRIVEGN
A0A3M5G7H9      ----------------------------------------YDNEHNLLLGGTINRIVEGN
A0A3M4A376      ----------------------------------------YDNEHNLLLGGTINRIVEGN
A0A0Q0A5T8      ----------------------------------------YDNEHNLLLGGTINRIVEGN
A0A0P9SCD7      ----------------------------------------YDNEHNLLLGGTINRIVEGN
A0A0P9T4G3      ----------------------------------------YDNEHNLLLGGTINRIVEGN
A0A0P9VKB0      ----------------------------------------YDNEHNLLLGGTINRIVEGN
A0A0Q0BM35      ----------------------------------------YDNEHNLLLGGTINRIVEGN
A0A3M3TPR7      ----------------------------------------YDNEHNLLLGGTINRIVEGN
A0A3M3U4Q3      ----------------------------------------YDNEHNLLLGGTINRIVEGN
A0A0P9UCX7      ----------------------------------------YDNEHNLLLGGTINRIVEGN
A0A0P9S1F1      ----------------------------------------YDNEHNLLLGGTINRIVEGN
A0A0P9QCJ2      ----------------------------------------YDNEHNLLLGGTINRIVEGN
A0A0P9Q329      ----------------------------------------YDNEHNLLLGGTINRIVEGN
A0A3M5GJ64      ----------------------------------------YDNEHNLLLGGTINRIVEGN
A0A0P9MPC7      ----------------------------------------YDNEHNLLLGGTINRIVEGN
A0A3M2XYQ3      ----------------------------------------YDSEHNLLLGGAINRVVEGH
A0A0P9XCE1      ----------------------------------------YDSEHNLLLGGAINRVVEGH
A0A3M3EFX7      ----------------------------------------YDSEHNLLLGGAINRVVEGH
A0A3M5B9D9      ----------------------------------------YDSEHNLLLGGAINRVVEGQ
A0A0P9RRZ3      ----------------------------------------YDNEHNLLLGGAVNRVVEGK
A0A3M2VEK7      ----------------------------------------YDSEHNLLLGGAINRVVEGH
A0A0N8R9B3      ----------------------------------------YDSEHTLLLGGAINRVVEGH
A0A0P9VA27      ----------------------------------------YDSEHTLLLGGAINRVVEGH
A0A3M4YBJ4      ----------------------------------------YDSEHNLLLGGALNRVVEGH
A0A0P9J470      ----------------------------------------YDSEHTLLLGGAINRVVEGH
A0A0Q0EVJ8      ----------------------------------------YDSEHTLLLGGAINRVVEGH
A0A3M5UI30      ----------------------------------------YDNEHNLLLGGTINRIVEGN
A0A3M5YQT8      ----------------------------------------YDNEHNLLLGGTINRIVEGN
A0A3M5F5X1      ----------------------------------------YDNEHNLLLGGTINRIVEGN
A0A3M5R8G1      ----------------------------------------YDNEHNLLLGGTINRIVEGN
A0A3M5V012      ----------------------------------------YDNEHNLLLGGTINRIVEGN
A0A3M3GA16      ----------------------------------------YDNEHNLLLGGTINRIVEGN
A0A3M3UCT3      ----------------------------------------YDSEHNLLLGGALNRVVEGH
A0A3M3CJL0      ----------------------------------------YDSEHNLLLGGAINRVVEGH
A0A3M3F6F5      ----------------------------------------YDSEHNLLLGGAINRVVEGH
A0A3M3P9B7      ----------------------------------------YDSEHNLLLGGAINRVVEGH
A0A0N8QB74      ----------------------------------------YDSEHNLLLGGAINRVVEGH
A0A0Q0AUD0      ----------------------------------------YDSEHNLLLGGAINRVVEGH
A0A3M5VR55      ----------------------------------------YDSEHNLLLGGAINRVVEGH
A0A0Q0FK97      ----------------------------------------YDSEHNLLLGGALNRVVEGH
A0A3M5KZ75      ----------------------------------------YDSEHTLLLGGAINRVVEGH
A0A3M5L3G5      ----------------------------------------YDSEHTLLLGGAINRVVEGH
A0A519ERR1      ------------------------------------------------------------
A0A4Q3Q1M2      ------------------------------------------------------------
A0A4Q3MHR1      ------------------------------------------------------------
A0A520GDZ4      ------------------------------------------------------------
A0A318DSU0      ------------------------------------------------------------
A0A538PF21      ------------------------------------------------------------
A0A1W1ZH10      ------------------------------------------------------------
A0A1W2FF24      ------------------------------------------------------------
A0A524JYQ6      ------------------------------------------------------------
A0A4Q3MA17      ------------------------------------------------------------
A0A0N0M5F7      ------------------------------------------------------------
A0A537M754      ------------------------------------------------------------
A0A1V1PDB4      ------------------------------------------------------------
A0A2M7C324      ------------------------------------------------------------
A0A4Q3HHG6      ------------------------------------------------------------
A0A3B7DTA4      ------------------------------------------------------------
A0A432ZK62      ------------------------------------------------------------
A0A1V5EEP4      ------------------------------------------------------------
A0A1V5EF48      ------------------------------------------------------------
A0A0S6X1X6      ------------------------------------------------------------
A0A537Y5L8      ------------------------------------------------------------
A0A4Q3L2X2      ------------------------------------------------------------
A0A4Q3T8J1      ------------------------------------------------------------
A0A4Q4ANM4      ------------------------------------------------------------
A0A4Q3UEC7      ------------------------------------------------------------
A0A1H5YYQ4      ------------------------------------------------------------
A0A1X4NLK2      ------------------------------------------------------------
A0A1X4NWB5      ------------------------------------------------------------
A0A1M5UQ38      ------------------------------------------------------------
A0A327YI48      ------------------------------------------------------------
A0A1B1PNL6      ------------------------------------------------------------
A0A2U8H9H9      ------------------------------------------------------------
A0A6B2NBB8      ------------------------------------------------------------
A0A1X6YIC0      ------------------------------------------------------------
A0A1I5E9E9      ------------------------------------------------------------
A0A1X6Z7N7      ------------------------------------------------------------
A0A2E1DQ13      ------------------------------------------------------------
A0A1H8C800      ------------------------------------------------------------
A0A2N3EZ05      ------------------------------------------------------------
A0A655R819      ------------------------------------------------------------
A0A655RNN3      ------------------------------------------------------------
A0A0R0BVC7      ------------------------------------------------------------
A0A3N5J7U8      ------------------------------------------------------------
A0A1S7S3I8      ------------------------------------------------------------
A0A519E8D7      ------------------------------------------------------------
A0A3S1FD32      ------------------------------------------------------------
A0A434DUT4      ------------------------------------------------------------
A0A528D3U3      ------------------------------------------------------------
A0A3S3UPT3      ------------------------------------------------------------
A0A3S1E286      ------------------------------------------------------------
A0A531AC71      ------------------------------------------------------------
A0A436K268      ------------------------------------------------------------
A0A434IDQ0      ------------------------------------------------------------
A0A435IRM5      ------------------------------------------------------------
A0A3S2C404      ------------------------------------------------------------
A0A435F6C0      ------------------------------------------------------------
A0A435BMN6      ------------------------------------------------------------
A0A529XQ54      ------------------------------------------------------------
A0A530BJC1      ------------------------------------------------------------
A0A348SRI7      ------------------------------------------------------------
A0A354EI73      ------------------------------------------------------------
A0A4P7EP83      ------------------------------------------------------------
A0A6I1QB25      ------------------------------------------------------------
A0A655ZZQ1      ------------------------------------------------------------
A0A1S0ZAI3      ------------------------------------------------------------
A0A3A4NIE9      ------------------------------------------------------------
A0A3A4NUI9      ------------------------------------------------------------
A0A524I3Z6      ------------------------------------------------------------
A0A524PCL7      ------------------------------------------------------------
A0A356GQV1      ------------------------------------------------------------
A0A1J5DAY8      ------------------------------------------------------------
A0A524P237      ------------------------------------------------------------
A0A3C0L0A8      ------------------------------------------------------------
A0A176S762      ------------------------------------------------------------
A0A377ZC40      ------------------------------------------------------------
A0A378BPJ7      ------------------------------------------------------------
A0A2J5PAJ7      ------------------------------------------------------------
A0A377ZDN3      ------------------------------------------------------------
A0A7A9Y5Q1      ------------------------------------------------------------
A0A1G3JY11      ------------------------------------------------------------
A0A661N3U1      ------------------------------------------------------------
A0A1W9WUD9      ------------------------------------------------------------
A0A1W1ZQK0      ------------------------------------------------------------
A0A6I1R304      ------------------------------------------------------------
A0A1W9PMU6      ------------------------------------------------------------
A0A3S1WTQ1      ------------------------------------------------------------
A0A530CUR9      ------------------------------------------------------------
A0A6L6H5T1      ------------------------------------------------------------
A0A6D0ELN7      ------------------------------------------------------------
A0A1M6N1X5      ------------------------------------------------------------
A0A561M3U0      ------------------------------------------------------------
A0A2N6BZD5      ------------------------------------------------------------
A0A1G3VVY5      ------------------------------------------------------------
A0A7C3S273      ------------------------------------------------------------
A0A7C4WJ18      ------------------------------------------------------------
A0A7C3V565      ------------------------------------------------------------
A0A351B422      ------------------------------------------------------------
F2NEE9          ------------------------------------------------------------
A0A2W5J775      ------------------------------------------------------------
A0A352Q5C1      ------------------------------------------------------------
A0A435NNF5      ------------------------------------------------------------
A0A3S2AQS7      ------------------------------------------------------------
A0A436XH86      ------------------------------------------------------------
A0A527ZPD6      ------------------------------------------------------------
A0A529KRW3      ------------------------------------------------------------
A0A530ZLX0      ------------------------------------------------------------
A0A355TB56      ------------------------------------------------------------
A0A1F9E324      ------------------------------------------------------------
A0A432SAI6      ------------------------------------------------------------
A0A4Q3LBH4      ------------------------------------------------------------
A0A4Q3LWP3      ------------------------------------------------------------
A0A7C3JPP4      ------------------------------------------------------------
A0A534V9L7      ------------------------------------------------------------
A0A7C3JJT4      ------------------------------------------------------------
A0A2N6VGL1      ------------------------------------------------------------
A0A3M3H5V6      ------------------------------------------------------------
A0A524M660      ------------------------------------------------------------
A0A7C3JSX5      ------------------------------------------------------------
A0A7I8MQ67      ------------------------------------------------------------
A0A0C1TRU6      ------------------------------------------------------------
A0A2Z5SSF4      ------------------------------------------------------------
A0A2T4ZJZ6      ------------------------------------------------------------
A0A0B8PTA8      ------------------------------------------------------------
A0A0B8QF75      ------------------------------------------------------------
A0A6P2T4F7      ------------------------------------------------------------
A0A4Q4CIB1      ------------------------------------------------------------
A0A522ACJ9      ------------------------------------------------------------
A0A1T2KYM8      ------------------------------------------------------------
A0A3N5Z7F8      ------------------------------------------------------------
A0A239HD34      ------------------------------------------------------------
A0A2G9ZR82      ------------------------------------------------------------
A0A4U9I390      ------------------------------------------------------------
A0A0P7ZZE4      ------------------------------------------------------------
A0A369R0Q9      ------------------------------------------------------------
A0A327LYE6      ------------------------------------------------------------
A0A5A9ZTV3      ------------------------------------------------------------
A0A6J4YZ98      ------------------------------------------------------------
A0A2X3M011      ------------------------------------------------------------
I2WC85          ------------------------------------------------------------
A0A7A9K1G5      ------------------------------------------------------------
A0A7B7KSB7      ------------------------------------------------------------
A0A400JH80      ------------------------------------------------------------
A0A479JNB1      ------------------------------------------------------------
A0A5C9AF52      ------------------------------------------------------------
A0A797FC39      ------------------------------------------------------------
A0A797FHC1      ------------------------------------------------------------
D8EEU7          ------------------------------------------------------------
A0A6D0EYC7      ------------------------------------------------------------
A0A7A6DHB0      ------------------------------------------------------------
A0A2H9EHM4      ------------------------------------------------------------
A0A7A5MLK0      ------------------------------------------------------------
A0A380B3D7      ------------------------------------------------------------
F5NSX0          ------------------------------------------------------------
A0A534XP85      ------------------------------------------------------------
A0A0P1H2H0      ------------------------------------------------------------
A0A258WKV0      ------------------------------------------------------------
A0A377N8F8      ------------------------------------------------------------
A5G4N9          ------------------------------------------------------------
A0A3C2DSE7      ------------------------------------------------------------
A0A2X1JBG5      ------------------------------------------------------------
A0A377LY04      ---------------------------------------------------MKIKIKSAK
A0A5C9ABR5      ------------------------------------------------------------
A0A5J9WU72      ------------------------------------------------------------
A0A2X3K9R3      ------------------------------------------------------------
A0A3T9EHW9      ------------------------------------------------------------
A0A484X141      ------------------------------------------------------------
A0A5N9VWI6      ------------------------------------------------------------
A0A6D0EJQ0      ------------------------------------------------------------
A0A444R390      ------------------------------------------------------------
A0A376LLF8      ------------------------------------------------------------
A0A6L7CT21      ------------------------------------------------------------
A0A4Q3LR91      ------------------------------------------------------------
A0A6C9IKN8      ------------------------------------------------------------
A0A4V1TR68      ------------------------------------------------------------
A0A444IY46      ------------------------------------------------------------
A0A6I7N627      ------------------------------------------------------------
A0A6L3ZR06      ------------------------------------------------------------
A0A3E0WKI3      ------------------------------------------------------------
A0A1H3I2J1      ------------------------------------------------------------
A0A1V5DJV0      ------------------------------------------------------------
A0A520IUC4      ------------------------------------------------------------
A0A521LJG5      ------------------------------------------------------------
A0A531IBQ7      ------------------------------------------------------------
A0A0P1FWI8      ------------------------------------------------------------
A0A6L8LHC6      ------------------------------------------------------------
A0A1V4WHZ7      ------------------------------------------------------------
A0A1E5AJN5      PFIPRTYDERERAAINRVLAGMQITTLRRSPIVRIAFVHNERSYPHVVVNQIARSFIELS
A0A2N3D2J1      -----------------------------------------------------TAYANAR
A0A2N2GVE1      FAHREPTEEELQRAAGVMRGMIQVIPVPESRLVNISAVSTMPLMAKKVADAITEAFIDDN
A0A2N2INV3      FAHREPTEEELQRAAGVMRGMIQVIPVPDSRLVNISAVSTNPLMAKKVADAVTEAFIDDN
A0A233IKJ2      ---------------------------------------------------IGNVFMDSH
A0A1Y5DXG5      TEFFVTRKDRLNTILDLQSSIGASEKGKDSGIVNLSFQHESPEYSQMVLNEITEIYVRRN
A0A0B8P2H5      QEYGLGKRSKLDAIQWLNGSLSVSERGKQSGILSFGFEGENKAQIIDLLNDIANNYFLQN
A0A380AQW6      ------------------------------------------------------------
A0A2G2GD62      LEYFFSYIDNRNMVGYIQNNLSTEQDAKYSSNIFVRFDDTVALRAKDIVDGITTAYIQDS
A0A3R9C3P5      KKPTLPAGDGIEATIPEYYQALGVWHEDKSEVIQISFTASDAELAAAVPNRVVSIYLDER
A0A0M3GBT1      RKPAEPVRDGIDAVIPEFYRALGVWHEDKSDVVQVSFTTNDPQLAAAVPNRVISIYLDER
B3Q577          RKPAEPVRDGIDAVIPEFYRALGVWHEDKSDVVQVSFTTNDPQLAAAVPNRVISIYLDER
A0A483QWI8      -------------MKDLQESFTVTDQGKDTGLLVLSLTGDDPKAFEKILNTISNYYLAQN
A0A483UXD3      ---------RLKAIKDLQESFTVSDQGKDTGMLVLSLTGDDPKALEKILNTISNNYLAQN
A0A0A8J8L3      ---------------------------------------DNPILISNILDNISQNYLSQN
A0A660DJ38      -------------------------------MLGLTLTGTDPNLISKTLNSIANNYLEQN
A0A524P331      DLFRLQQQSFIGTVQGVMGSTNVSQVGKYTNVIQITCSDTDPVLASAMVNTLVQAYLGQT
A0A4V1SSM5      ------------------------------------------------------------
A0A4Q3K8G7      ------------------------------------------------------------
A0A7C7W7M2      TEPDAERISSTADELASLTSIEKPVDREYSNLLNITVKMADPQLAALTANTIADEYIATV
A0A1M7HC79      ---------------------------------------------------MAETFLTQN
A0A1D3JZN6      ---------------------------------------------MRTLNEISSLYVRQN
A0A1V6ESG1      ------------------------------------------------------------
A0A1H7YHK3      ----------------------------------------------------MEAYGRRK
A0A534SH66      ------------------------------------------------------------
A0A3M0ZZ99      ------------------------------------------------------------
A0A238LBD3      ------------------------------------------------------------
A0A328C2K5      SAQQLDEDERMKRAVNTLQSVAVYSLQRDSRVGLIQVRYEDPELAARIADGISETYVEYI
A0A5C6X8M3      SVQQLDEDERMKRAVNILQRVAVYSLQRDSRVGLVQVRFEDPELAANIADGISETYVEYI
A0A3D8MRR7      SVQQLDEDERMKRAVNTLQRVAVYSLQRDSRVGLVQVRFKDPELAASIADGISETYVEYI
A0A5C6UBJ7      SVQQLDEDERMKRAVNTLQRVAVYSLQRDSRVGLVQVRFKDPELAASIADGISETYVEYI
A0A5C6XGM3      SVQQLDEDERMKRAVNTLQRVAVYSLQRDSRVGLVQVRFEDPELAASIADGISETYVEYI
A0A537NZJ1      ------------------------------------------------------------
A0A7C4R3C4      ------------------------------------------------------------
A0A0P1FRV5      ------------------------------------------------------------
A0A4Q4CVW6      ------------------------------------------------------------
A0A090R136      ------------------------------------------------------------
A0A661JU93      ------------------------------------------------------------
A0A2E2T3V8      IASDAKVSDEIDKDVEALRRRIDVERIGNSTVIQIGVTDDDPERAYQIVSAVAESFVWLR
A0A367UAB4      IASDAKVSDEIDKDVEALRRRIDVERIGNSTVIQIGVTDDDPERAYQIVSAVAESFVWLR
A0A1F2ZW35      DRSADASDPRRQAAIGYVSGHLNVNLVGRTFVILITAESPDGTMSARIANAVAEAYLADQ
A0A377V641      --------------------------------------------------------MAQN
A0A1F2YJ88      DVYLIQKQSLPSAVNNILANYSVAEKGKLTGILGLNYQGTDKTHITQVLNAILVSYSQQN
A0A6L3ZWI0      ------------------------------------------------------------
A0A5N8AL61      TTPAKSLEDRKQRAMRTVMNSLKVQREGTSYAIVIGARNPDAAIAAEIANGVMDAYVGQQ
A0A0J7XGZ1      REQIATINPAERQAAGRLLTHSYVRRVGVTYLVEITASSEDPDLAARIANALARRYIGLD
I4CBA7          LSTPDRRGLEDAAKALPRWSDIRITENRGSQLINVEASANDPFAAREKLRDYLEQYIRAD
A3VE95          VRGDRDEASRLADLTWAIRQDLNVSRESESYVFEIQFSAAEPGIAQQIANGIADTYIALQ
A0A1G0NL95      -------------------MTTVREQGKQSGVLQLSVRADSPQAAALAANAVAGAYLQQN
A0A024KA69      GLALASAALLVMPVSYSATALLYFDPSPRGVLEDGRPGAGDGARVDSAVDLIASEPVLAS
A0A0L1KFN4      RYPAEGRAQRQREAAKILLDQVSIEPTRLSRLVDINFTSPDALFSAQVANAWAENFIEIN
A0A3P5DSS6      ------------------------------------------------------------
A0A483YEL5      ---------------------------------------------------ISDNYLEQN
A0A658GUJ0      TRFLLTYTSRINAINYLRDSLLIADQGKDTGMLTISLLGSDPDLIKRVIDSISDNYLEQN
A0A358L616      ----------------------------------------DPELISQVLDRVMSNYLMQN
A0A1M7BLL7      ------------------------MPWRATSLWALSGDGA--------------------
A0A0H4KZM1      ---------------------------------------------------MEKRWTRKK
A0A3D5UYX7      ------------------------------------------------------------
A0A2N1WQN5      ------------------------------------------------------------
A0A352G2C2      -------------------------RGKQSGIVNVTLEDPNPEHAIRVLEEVASRYVDQN
A0A3C0PZN1      ------------------------------------------------------------
A0A524QFS4      KGTLALHGVTGDDAKQFLKGGVDINLVRRTSMVKITVDFPDPDVAAFLANTYASVALQDM
A0A520JSW4      VGPGGDRSLNTASAAGFVQGGTQVRLQPLSMIVSVSFVARDPQIAAKIVNGVADAYISTN
A0A1V1UJT2      ------------------------------------------------------------
A0A0L6CVX1      ------------------------------------------------------------
A0A1V0RR48      ------------------------------------------------------------
A0A0A0HJJ4      ------------------------------------------------------------
A0A5E7YA28      ------------------------------------------------------------
A0A4Q3LTF3      ------------------------------------------------------------
A0A7C3N3Y1      RLEMAPETARDTLLVNRFLGKLKIEPIRNSRLVKIHFDSNDRELSPRVANELAAAYIQQN
A0A537UTP9      TSTSDPEFALTRAAVERFQSQLIITRAGLTYIISVGFRAQDAQQAAKIANAVADAYIADQ
A0A1D2RNR5      ------------------------------------------------------------
A0A4V1TQ46      -------------------------------MVTASLVQLNTAYAGALGAKLAAQ-----
A0A3A0FZC0      KLDQLAGYKSTVRQIKVYLSTIEIKPVRRTSLVTVEATVSDPRLAALIANRHSESYIDWV
A0A1N7JVZ7      -MTAERVFRRKNRPHARSEPEAQAQPAASRDDSADAHDSPSPKVFRRQKRSVAPGETQAE
A0A091C4A8      AHLAATESVRQTLRINSFLASLSIEPVRNSRLVRVHFDSPDAAFSQRVVNAVAEAYIASN
A0A4R3H6P6      KADPTARAKRNEVAGKILLLHVGVAPVRGSSLVDIRAVTPDPVLSQKIAKAWSENYIASN
A0A3S1NQ09      ARDALIATSRRDYAILKLQNEIRAERVGRSYVIALGYQATDPALANAITKAYADAYLADQ
A0A443GJ52      TRDAMIASSRRDYAILKLQNEVQAERIGRSYVISIAYQATDPVLATAVTKAYADAYLADQ
A0A6N3RE79      ------------------------------------------------------------
A0A6N9S3L5      ------------------------------------------------------------
A0A656BWB0      ------------------------------------------------------------
A0A6D0IFH4      ------------------------------------------------------------
A0A7A3MK38      ------------------------------------------------------------
A0A0A0FHV8      ------------------------------------------------------------
A0A1X3IPU7      ------------------------------------------------------------
A0A0A0G0N2      ------------------------------------------------------------
A0A2I8SDU4      ------------------------------------------------------------
A0A2I8SU55      ------------------------------------------------------------
A0A7I6T806      ------------------------------------------------------------
A0A7I6TQE9      ------------------------------------------------------------
A0A7I6U296      ------------------------------------------------------------
S1EXJ6          ------------------------------------------------------------
A0A376UBS1      ------------------------------------------------------------
A0A2W6S588      AKAFDPSGKSSDAMAAALLSGVSAARVGTTALFSIGYSDGDPLAAARIANVVAGAYLAVQ
A0A483E0N4      SEYNIYYESRLKAISDLQNTLSVADQGKDTGMLTISLTGEDPSIIERIVESISDNYLAQN
A0A2J4YQQ6      --FTIGYLSRLKAITDLQENLIVADQGKDTGMLTLSLTGDNPALIERIINSITENYLAQN
A0A483THX4      TKFKISYLPRLKAITDLQTNLVVADLGKDTGMLNVSYTGDNADLIKNIVDSITRNYLEQN
A0A534MVS2      ------------------------------------------------------------
A0A444I5K6      EMRRRGAAETVA-------GNIDVERVGRSYVLDVSYTAQSPDLARDIAAAIADVYLVDK
A0A154VE85      AVIAPPPAVLAERAVDAYLDRLSVSPADNARIVAVDFTAADPDLAAAAANRTAGLYVEDR
A0A3S1MCW7      ------------------------------------------------------------
A0A434IGN6      ------------------------------------------------------------
A0A528AX40      SIEEKTPEEREAIAIGRILKDLTVNLVTNTSLLTISFIDQKPKYASDIANQVAQSFIDQR
A0A528MV95      SIEEKTPEQREAIAIGRVLNDLTVNLVSNTSLLSITFADQNPKYASDIANQVAQSFIDQR
A0A3C1S9Y1      TVPKSDDPSQDSPLVSAFITRIKVSPIRNSRLVDVTAEAKNPALAARMANEVVKVYIDQN
A0A353EH49      TEFTLEKQHVYKSAEVLNGKLQVSESGKQSGMLTLAFTSIHQHQVADVLNQIVNSYVDQN
A0A1Y1Q9C1      LPAKIETVTEAADYTDLFSQHLYVEPIEKTHLVKVFYESPDPVLSADIVNALVNAFIKDN
A0A3M7LJH0      -----------------------------TGIVELSFTGENPSQIQAILDDISQNYFLQN
A0A316KRG4      ------------------------------------------------------------
A0A1E4JHX8      EKRSREAARILL-------ENIDIVPDRLSRLVTITFTSPDPKLSARVANAWTANFIESN
M2U8P2          QAATRRAAAFIR-------GGLSARREGTSFVITIASEGPDPEIAAAAVNSVIDIYVGGQ
A0A1H7KZF8      ADPAPTPGERRQAVLDLLDRKRSAAIIPNSRAASIAFTSPDPQLSALIANSFADHLVRRD
A0A0J5Q9T7      ------------------------------------------------------MAERRK
A0A6N3UC48      ------------------------------------LESPRPADAARILDEVSRLYVLQN
A0A257NG76      --------------------------GKKTGILELTMESTSQDSVLQTLNEIANIYVRQN
A0A1T4TW59      PSTDPNSEVAKRAVLKKFKSHFAIEPIRYTQLVRIHFDSANPELAAKVANAVGNAYIESN
A0A1I5YYQ0      ------------------------------------------------------------
A0A5P9FE62      ------------------------------------------------------------
A0A1Q3MB35      --MASAAQQRLELATDILLDNVSINPVRGSRLVDVKFTSPSPKLSAQVADLWVSQFQQAA
A0A259LUN7      ------------------------------------------------------------
A0A2D7AVL1      --------------------------------------------NSSIFSLDGETIVTLN
A0A3B9KZE9      ------------------------------------------------------------
A0A2U0NMP8      TRFLLTYTSRINAINYLRDSLLIADQGKDTGMLTISLLGSDPDLIKRVIDSISDNYLEQN
A0A4U9HNE9      LARQQAIDDLRR-------TLSIALAGKESGIMTFKLESEDPQRAKRVLQSITENYLQQN
A0A7C5N053      AEPAHPRKVDEDGAALILRARLEVKPIKDSQLAIVRVTDANPERAARIVNTLTDVYVELN
A0A2G2CXY6      HRMLNSILAYQE-------ELGASEKGKDSGIISLSMQHESPAQATRILDEVSRLYVLQN
A0A3M1D4H3      ------------------------------------------------------------
A0A7C1A2A2      VRAVHLYRELLKGGGFGVSTTTGGGSTQPTLVVSLSYKGFDPYRAQRFLADLMRGYLAQN
A0A5C8BYM7      ------------------------------------------------------------
A0A1J5ICP0      VLTPASAVEGLQ-------GSLAVSPIKNTELVTISATAPNPSMAATKVNVIVSEYKSLA
A0A379B9V4      LPELTVISALQE-------QLSVHEIGKQTGIINIAIQGKDKKHIQDIVSSIAESYLLQN
A0A0Q6TS97      -----MAGKILL-------QHVGVAPVRGSSLVDVRAVTPDPALSQRIAQAWGEDFIASN
A0A0Q6UYB4      -----MAGKILL-------QHVGVAPVRGSSLVDVRAVTPDPALSQRIAQAWGEDFIASN
A0A484XS37      LPRLVAINNLLD-------ALTVEDKGKDTGVLALSLVGDDPVLVRNILNSISKNYLLQN
W7Q5J0          GDIRSLGGRLQI-------AEVGGGRGSSTGVLRLSMTGPDTQEIVRSLDAVADTFLTQN
A0A654AKT6      PFLDPKFVRFLT-------ATVRHWSVPLVLAVAVSLLGSPSVAARVVSIAICIGYLMYT
A0A7A9JY19      KTRLEAINDLAN-------SFHVEDQGKDTGMLALTLIGDDPSLISVILNKISENYLEQN
A0A0G9MZA5      ADIEPALAGTLL-------NNVSITPIINSTLVDISFSSPDPQVSARIANAWADAYIAEN
H0T8B0          EARIRCAVSTVA-------SNLSIVRVGRSYIEEITYTSRDPVLAGEVANAIAQAYIEDQ
A0A5C7N981      APAATGLLSGLP-------GALSVMPVRNSQLARVHFDSPDPQMAARIANEVAVAYTKLN
A0A534TV22      ------------------------------------------------------------
A0A351CXR4      FANTRQASAFIQ-------AALTVEVESHDGVLDLGFTSPNADLSADVLNVLAETYIDHK
A0A2N6GLF5      ETFYDSVVEYYF-------ERLKVTPVKNSQLVRVAFEANDRQLAADVANNLANIYIVND
A0A1W9LJP0      EDADAWLVNALI-------GRIKAEPVRNSRLVNVRVEAKDPALAAKIANAVVQAYIDQN
A0A0W1ICB0      RQRERQAVELLL-------DNVGISPLRGSALVDVSYSSASPQLSRLIASTWVNEFVQQS
A0A7C1C8G2      NITLDNNLGKIK-------NALTITPVRGTQLINISFQNPHAGLAADIVNNLMKEFLQVN
A0A376KYN0      ------------------------------------------------------------
A0A7A9J338      ------------------------------------------------------------
A0A377E5P7      ------------------------------------MTGDDPQLITRILNSIANNYLQQN
A0A2X1JB05      ---------MQE-------TFTVSERSKESGMLELTMTGDDPQLITRILNSIANNYLQQN
A0A376RML0      ---------MQE-------TFTVSERSKESGMLELTMTGDDPQLITRILNSIANNYLQQN
A0A6N3QTV2      ---------MQE-------TFTVSERSKESGMLELTMTGDDPQLITRILNSIANNYLQQN
A0A2E0UL88      --------------------------------------------------SYQQTEGIVS
A0A0T2QIS1      AGREKLAVDLLL-------SHVTISPITRSRLVDIGYTSGSADLSATIANTWAQQFVASS
A0A0P7Y1D0      EQELEAVTSAVL-------DRLSARRSGMTFMLTIAFTSENAAKAARIANAFADQYLLSQ
A0A542J310      --------MELR-------DYLRGLRRHWVAIILMTGIGVGAGFGWTLLQTPVYVASASG
A0A2M7JRZ7      NKKDTALIDQFL-------SKLKVEPIRNSRLVKVHFDSNYPELSAKVPNTLAVTYIQQS
A0A167IR75      AERQREAADILL-------TNVTINPTRLSRLVDISMTSPDPAFSAEVANSWAENFITTN
A0A3B8T2U6      QNRLDFAIAKLQ-------ANIDIKPVFHTHVVEIEFVSEDPLLAATISDTVANVYIENY
A0A365PWR2      EPRLAALLRLQN-------QLQIDEVEEGSGIFVLSITDADPERAVNILAEVMKAYVAQN
A0A2E9H5Z8      -------------------------------------------------MGQSEEYILKS
A0A2E2BR79      -----LSSRLSV-------SETGSGFVGNAGMLRLTLTGTDREEIRRLLDAISETFLMQN
A0A6I4IKZ3      QSIPAAVNALSA-------NYSVAERGKLTGVLGLNYQGQDKEQITKVLNAILATYSAQN
A0A7H4JZ79      ------------------------------------------EHITKVLNAILVTYGDQN
A0A0Q4Q524      PIRQRTAGQILR-------DHLDVAPTRLSRLVEIRFTSPDAAFSARIVNTWSDAFIQTN
A0A0Q4CFJ9      ATRQRVAGEILI-------DHLAIVPTRLSRLVDIRFTSPNPEFSAKIVNTWSDAFIQTN
A0A0Q4FE58      EIRQRVAGETLL-------KNLNIAPTRLSRLVDIRFTSPNPEFSAKIVNTWSEAFIQTN
A0A0Q4JWC8      EIRQRVAGETLL-------KNLNIAPTRLSRLVDIRFTSPNPEFSAKIVNTWSEAFIQTN
A0A0Q4KFL8      EIRQRVAGETLL-------KNLNIAPTRLSRLVDIRFTSPNPEFSAKIVNTWSEAFIQTN
A0A522R8R0      ----------------------------------------------RAAHGLNSTSGNLL
A0A2U9NDY5      KRPQTTAREDQD-------RRKGGEAGKDAGSSDMAREEPDPQLASRVRDESSRRDGNQN
X7F6S5          ------------------------------------------------------MAAGPR
A0A1G8NKI0      ----------------------------------------------------MTMSERRP
A0A355QPE4      ----------------------------------------------------MTMSERRP
A0A357RN98      ----------------------------------------------------MTMSERRP
A0A1I6U4V1      ------------------------------------------------------MVERRK
A0A6B2P8H8      ------------------------------------------------------MVERRR
A0A1P8USW9      ----------------------------------------------------MNMVDRRK
A0A1G7CFZ2      ----------------------------------------------------MTMTERRR
A0A7G2TPW1      ------------------------------------------------------MTERRR
A0A0Q4IGG1      AERQQLAGKILL-------DNISINPTRLSSLVDISFDSPDPILSTQIVNAWSDSFIQTN
A0A534RUJ5      --------------------------VQRTRLVKVAFLTPDPALSARVANAHVESYIHKG
A0A3M1CJM3      ------------------------------------------------------------
A0A2R7SVD4      NPRIVTIQGYQD-------ALDISEQGKESGIIRLALASADAAEAVKILNKIAALYVDQN
A0A3C0PWB6      ------ALDYQD-------RLKVGEAGKDSGIIYMSLEDPDPQLASRVLDEISRLYVSQN
V4Q8B7          NRPQTTALDYQN-------RLKVGEAGKDSGIIYMSLEDPDPQLANQVLDEISRLYVSQN
A0A0Q8XKK5      AKREKAAVQILQ-------SNIAISPIRNSALVDIKYTSGSPELAAQIANTWAQQFIEAS
A0A2E0Q2W0      ------------------------------------------------------------
A0A660NIR6      EALEEQVLMRYK-------AGLDISPIKNSQLVEIRFESPDPVLAAKIANQTAESYITAD
A0A142W0R3      ARMAERAEKILL-------DAVSIEPVRQSSLVDVSFSTPSATLSAKLTNLWVQQFVAAN
A0A0S4XR18      NKNSFIDGFIRP-------NLNVAQISKQASIVKITFEDAIPQRGVDIVNNLVKVYFAQK
A0A7C5CFF1      --------------------------------------------VSLQIQAVKNFRQSLK
A0A2E0GW64      LSGQLKVSDQGD-------QTQKNSYLRETGVVQASFTWGKPQQAQEILNAIINTTQEKD
A0A1A7QJ97      AQRQRVAGEVLL-------DHVSIEPTRLSRLVDIRFTSPDPAFSASVANAWAENFIESN
A0A661LW70      ---------------------------TDFSSDVENITAQKLAHLNTQVVEAESNRVEAE
W7Q8F9          GDIRSLGGRLQI-------TEAAGGRGSPTGVLRLTMTGPDPQEIVRSLDAVADTFLTQN
A0A524PXH8      ----------------------------------MKFSSPDPRQAASIADTVTREYIDLT
A0A4Q3P0E4      FAKLATIEGLQS-------RLVLTEKGKQSSVINASLQDIDAIKVTEVLNAIGAQYVRQN
A0A3M2BE89      TGWLTAVKTLQK-------TLKVSEKGKKTGVFLLTLEDPDADRAVAILNAIANVYLRQN
A0A4Q4A6K6      -------------------------------------------------NNIVVSDGKLI
A0A257G674      GELEDLTLQALE-------DARDVSMPRNSRLASVSFTSPQPELAARISNTLAAEFIQAN
A0A661M5M6      -----------------------------TRLVRIHARDVNPERARLIADAVADSYVQKT
A0A1I1UM01      ---------------------------------MTNRPKFRRRRRTQPEQEPAEDDLRPI
Q44573          QVQREHEEDAFL-------NNLTVTPEPRTQILDINVVDGNPERAAALANAVVTNYQRIA
A2W025          YNDLDAISGFQA-------GIQVSEQGKQTGVVQISLEGKDPDQTAAIANALAQSYLNQH
A0A534Z362      GSVDPALIDRYM-------RYLSVQEIRGTDLVAVRFTTPSPSLSAFLAAAHTQAYLEAN
V4J283          ISLVAAAGALSG-------AFTAVEYPNYSGILNVGFSAGEPEQAATILNAILDNYQRRN
A0A536T443      -----------------------MKRERLTELSSILREQRDRAQANLRSAEAALTQFRVH
A0A0Q4UFQ5      ASRIKAAGNLIL-------ARMDVEPERMSRLVEISFTSPDPELSKRVVDAWSTNFIQST
A0A527W7E6      TATHDYAVLMLQ-------TGLLADRVSRSNVISIGYQATNPALATAITKAYADAYLADQ
A0A432EMV7      ----------------------------KSLIAYLSYVSKDPQLSADAANAISEAFIEVG
A0A7C1SEU7      ---------------------------------SISFTSPDRHLSQDVVNTLIEEFVRWK
A0A534WLI3      ----------------------SVETVPGTDLVEVRFTTPSPTLSAFLAATHAEAYVDAN
A0A7C6FBW0      DDAISQTLTRFK-------QSRTVRRKGLTYLISVSASSNSPEKAADLANELARTYIERQ
A0A087LTV7      -----------------------MHEDAWDLRGLEGAIRRQWRVVALAVAAGLALASAAL
A0A7D7WSS2      -----------------------MHEDAWDLRGLEGAIRRQWRVVALAVAAGLALASAAL
A0A318KWA2      SAIRDLGDRLSV-------AEVGVGRGTSTGMLRLTLTGPDRDEIRRSLDAVAETFLTQN
A0A522MT86      ---------------------------------------------AEVANAISQQYMLTA
A0A4Q3I221      -----------------------------------------AKIANAIGEAYLVDKLNSK
A0A534SAL6      SEVDPMLLDRYM-------RYLSVQDVRGTDLVEVSFTTPSPTLSAFLAAAHTQAYIESN
A0A534ZDB4      GEVEPVLLDRYM-------RYLSVQDVRGTDLVEVSFTTPSPALSAFLAAAHTEAYIEAN
A0A534X3M7      TSIDPALIDRYM-------RYLAVEEVRGSDVVEVRFTTPDPSLSAFLAAAHTQAYLEAN
A0A534SPC6      -----------M-------RYLSVQEIRGTDLVAVRFTTPSPSLSAFLAAAHTQAYLEAN
A0A535AD60      GAVDPALIDRYM-------RYLSVQEIRGTDLVAVRFTTPSPSLSAFLAAAHTQAYLEAN
A0A4Q3SY08      ---------------------------SYTSSDPRKAALIADTFAKTYVSEQLAAKASAN
A0A4Q3LG23      -----------------------RLSRLVDVAFTSPDPAFSAKIANAWADSFIQTNLERK
A0A522EX52      -----------------------ININDLDRKNNIGIFDISVRHEDPALATRIANEIASV
A0A1H3KC95      ------------------------------------WPLHDGAEDYREAPLVLGPETRSC
A0A5P8Z4P3      SPAQA------------------PRIADRPPQDIAGETTEPGTAAAQLPPLEPSETPAPA
A0A2E9HXF7      -----------------------PAADPASPYAAVKAASQEAARLRVEADERARAEAETQ
A0A0B3RZC9      -----------------------PVSEPPDPVRPLDETAREAARKRDAAAEQARSEAEAR
A0A6F8QET1      -----------------------PVSEPPDPVRPLDETAR--------------------
A0A520HUH4      -----------------------PVAIAHRIETATSAVVQRLTVTQQERSYVLAIGFRAR
A0A2K8U7M6      -----------------------PAEAAAVAQTLAENFVNSGLERRYEASVPARAFLDER
A0A5B9DKL8      TLMPASFTATTW-------LFSDPTVRTILPGESRGSAPLNDTARLESAVELIGSERTLQ
A0A238KJM1      ----------------------------------------------------HRSPTETV
A0A3A0FJZ4      ALALGVAGGVAA-------HRLLPPRYVGESTLLVESSWVRDGFIDTPVASSLRSQVQTL
W4HJV8          DGARVPA----------------RTTGPETSFDVQGTDAAEAGADTDTAFDPVRDGGRST
A0A0P1GDI0      EMPPI------------------APLESREERLARRRAEQEAEQARLAAEEAARVEAERL
A0A2R8ATV5      ALAPESRPVVSE-------EERREQIVAEKRRRAEESRQQRVAMRQAEAEARRQAEAEAR
A0A1U7D3R6      ---------------------------------------------------------MTA
A0A2D4UVV2      P----------------------EPAEVTSAAPPAAAPTHRRKRRRTDAAQTPPTEAVTA
A0A0W7WHP4      -----------------------DAAPTETDMTPVPPLEPRARRSEDTLPETGGTSARET
A0A238J8F6      QAAEEVLRQEEL-------RAAAAEAKAAAQKAALEAQRREVAKR--AAAERARQQAEAE
A0A238JQI6      PAPESV-----------------PETLPETLPESVPKNLPEIAPE--TAPEPPVPDPEAG
A0A222E077      -----------------------PAAAPASPYAAVKAASQEAAHLRVEADERARAEAETQ
A0A239E3Y2      -----------------------PAADAASPYAAVKAASQEAARL--------RAEAEAQ
A0A534QGR3      ------------------------------------------------------------
A0A1F9CFF0      ------------------------------------------------------------
A0A2M8B0G5      ------------------------------------------------------------
A0A363TNU9      ------------------------------------------------------------
A0A0W1GMS6      ------------------------------------------------------------
A0A0Q8RMY3      ------------------------------------------------------------
A0A1A7QC21      ------------------------------------------------------------
A0A2W4RFS2      ------------------------------------------------------------
A0A1Y6DC43      ------------------------------------------------------------
A0A2S6HE06      ------------------------------------------------------------
G3J0M3          ------------------------------------------------------------
V5C6R5          ------------------------------------------------------------
A0A534HBS8      ------------------------------------------------------------
A0A0F0T3Y9      ------------------------------------------------------------
A0A379GWF0      ------------------------------------------------------------
A0A4Q2XLV7      ------------------------------------------------------------
A0A4Q5QYC4      ------------------------------------------------------------
A0A3B8SQ27      ------------------------------------------------------------
A0A0U2VAW2      ------------------------------------------------------------
A0A454CTF1      ------------------------------------------------------------
A0A6B3Q2G1      ------------------------------------------------------------
A0A4Q6G931      ------------------------------------------------------------
A0A2T0VBD8      ------------------------------------------------------------
A0A378APS2      ------------------------------------------------------------
A0A443VCQ6      ------------------------------------------------------------
A0A447RKQ7      ------------------------------------------------------------
W1DSK1          ------------------------------------------------------------
A0A2N1XK22      ------------------------------------------------------------
A0A3D0KAC8      ------------------------------------------------------------
A0A3D2Y902      ------------------------------------------------------------
A0A378G3G7      ------------------------------------------------------------
A0A2X5NHJ9      ------------------------------------------------------------
A0A2J4QEC3      ------------------------------------------------------------
A0A485ADM3      ------------------------------------------------------------
A0A4U9HGU4      ------------------------------------------------------------
A0A3S4JGG5      ------------------------------------------------------------
A0A377ZDH2      ------------------------------------------------------------
A0A3S4HTS8      ------------------------------------------------------------
A0A1W9F5M9      ------------------------------------------------------------
A0A379W6R2      ------------------------------------------------------------
A0A379TA56      ------------------------------------------------------------
A0A655C5P0      ------------------------------------------------------------
A0A6D0I9G1      ------------------------------------------------------------
A0A352MMI7      ------------------------------------------------------------
A0A4Z0LWV1      ------------------------------------------------------------
A0A377K431      ------------------------------------------------------------
A0A376RY66      ------------------------------------------------------------
A0A778GAM7      ------------------------------------------------------------
A0A3C2BN18      ------------------------------------------------------------
A0A447LR75      ------------------------------------------------------------
A0A759KJJ5      ------------------------------------------------------------
A0A376D8L7      ------------------------------------------------------------
A0A1V2FV46      ------------------------------------------------------------
A0A6N8QLT3      ------------------------------------------------------------
A0A376SB61      ------------------------------------------------------------
A0A3D1BYV9      ------------------------------------------------------------
A0A536T0W8      ------------------------------------------------------------
A0A3D2M6Y9      ------------------------------------------------------------
A0A3D2YAZ2      ------------------------------------------------------------
A0A350A102      ------------------------------------------------------------
A0A350L5D2      ------------------------------------------------------------
A0A2G9XLE5      ------------------------------------------------------------
A0A6L3MM74      ------------------------------------------------------------
A0A7C3QM04      ------------------------------------------------------------
A0A7I8MVM0      ------------------------------------------------------------
A0A7C0Y3J7      ------------------------------------------------------------
A0A7C3LF61      ------------------------------------------------------------
A0A4R1HDF2      ------------------------------------------------------------
A0A6N1DL48      ------------------------------------------------------------
A0A1V6FYJ1      ------------------------------------------------------------
A0A0C5VQ86      ------------------------------------------------------------
A0A0Q6QV61      ------------------------------------------------------------
A0A2Z3IKG4      ------------------------------------------------------------
A0A3N5RNY4      ------------------------------------------------------------
A0A4Z0M4C7      ------------------------------------------------------------
A0A5Q2QDL1      ------------------------------------------------------------
A0A1V8MBH1      ------------------------------------------------------------
A0A6J4X8D4      ------------------------------------------------------------
A0A318CT66      ------------------------------------------------------------
A0A3N5P205      ------------------------------------------------------------
A0A443K010      ------------------------------------------------------------
A0A6I7NYG5      ------------------------------------------------------------
A0A212AR83      ------------------------------------------------------------
A0A2E2P4I0      ------------------------------------------------------------
A0A2U2CM86      ------------------------------------------------------------
A0A1I0R9R6      ------------------------------------------------------------
A0A2N3BVE7      ------------------------------------------------------------
A0A7C2IB02      ------------------------------------------------------------
A0A6N6SI00      ------------------------------------------------------------
A0A2S5JE21      ------------------------------------------------------------
A0A2R8BKZ2      ------------------------------------------------------------
A0A2S8S361      ------------------------------------------------------------
A0A520ZTR8      ------------------------------------------------------------
A0A316GHM6      ------------------------------------------------------------
A0A238IZI1      ------------------------------------------------------------
A0A7C9INT8      ------------------------------------------------------------
A0A6M1UAR9      ------------------------------------------------------------
A0A1X7ACC1      ------------------------------------------------------------
A0A238KUF6      ------------------------------------------------------------
A0A095CTW3      ------------------------------------------------------------
A0A2E3UGD6      ------------------------------------------------------------
A0A2T0RFH0      ------------------------------------------------------------
A0A285D390      ------------------------------------------------------------
A0A497VHN4      ------------------------------------------------------------
A0A2N6BEI9      ------------------------------------------------------------
A0A0D5N3E9      ------------------------------------------------------------
A0A2N2G716      ------------------------------------------------------------
A0A7C1UTU6      ------------------------------------------------------------
W9VVY5          ------------------------------------------------------------
A0A1E2URD3      ------------------------------------------------------------
A0A2T6MY81      ------------------------------------------------------------
A0A2T6NBQ8      ------------------------------------------------------------
A0A421K431      ------------------------------------------------------------
A0A2G2I5M1      ------------------------------------------------------------
A0A2G2M6F0      ------------------------------------------------------------
A0A1W9J9F8      ------------------------------------------------------------
A0A2S5LFJ9      ------------------------------------------------------------
A0A2D8R8F8      ------------------------------------------------------------
A0A6I4JXQ8      ------------------------------------------------------------
A0A010SNS0      ------------------------------------------------------------
A0A0C2I782      ------------------------------------------------------------
A0A2N8BYF5      ------------------------------------------------------------
A0A558FKX2      ------------------------------------------------------------
A0A1H1DBA0      ------------------------------------------------------------
J2TAD5          ------------------------------------------------------------
J3H699          ------------------------------------------------------------
A0A1H5J974      ------------------------------------------------------------
A0A0K1QRZ4      ------------------------------------------------------------
A0A560RJW9      ------------------------------------------------------------
A0A5E6TID7      ------------------------------------------------------------
A0A5E7CRU7      ------------------------------------------------------------
A0A5E7C564      ------------------------------------------------------------
A0A2W7MAV4      ------------------------------------------------------------
A0A4R3WQH5      ------------------------------------------------------------
W6VFG3          ------------------------------------------------------------
A0A1P8ENT1      ------------------------------------------------------------
A0A2N7XRV4      ------------------------------------------------------------
A0A0Q6QPG8      ------------------------------------------------------------
A0A0F4SWA7      ------------------------------------------------------------
A0A423J219      ------------------------------------------------------------
A0A4P6G9U8      ------------------------------------------------------------
A0A4Y8JE06      ------------------------------------------------------------
A0A502I1X9      ------------------------------------------------------------
A0A502J776      ------------------------------------------------------------
A0A5B0EZF6      ------------------------------------------------------------
A0A059L434      ------------------------------------------------------------
A0A0F4UWN2      ------------------------------------------------------------
A0A5E7WEF5      ------------------------------------------------------------
A0A1G0KSD0      ------------------------------------------------------------
A0A4P6WX84      ------------------------------------------------------------
A0A1D2S760      ------------------------------------------------------------
A0A5B8RW94      ------------------------------------------------------------
A0A258TN88      ------------------------------------------------------------
A0A1F9EUS2      ------------------------------------------------------------
A0A6H9HII8      ------------------------------------------------------------
A0A3N9VAW3      ------------------------------------------------------------
A0A1X0YE57      ------------------------------------------------------------
A0A2K2H9Q8      ------------------------------------------------------------
A0A6I1KNW9      ------------------------------------------------------------
A0A1H4B8T3      ------------------------------------------------------------
A0A1E7IQC3      ------------------------------------------------------------
A0A1M6KEN5      ------------------------------------------------------------
A0A353QLL3      ------------------------------------------------------------
A0A399I453      ------------------------------------------------------------
A0A651FBV9      ------------------------------------------------------------
A0A5C1MDH8      ------------------------------------------------------------
A0A7J4ZSX4      ------------------------------------------------------------
A0A5A9XE04      ------------------------------------------------------------
A0A643G9R1      ------------------------------------------------------------
A0A1G0M8Q7      ------------------------------------------------------------
A0A353MI14      ------------------------------------------------------------
A0A4S1CAW7      ------------------------------------------------------------
A0A562VHD2      ------------------------------------------------------------
A0A7K0J0R7      ------------------------------------------------------------
A0A6I6JNB5      ------------------------------------------------------------
A0A1G0LDK7      ------------------------------------------------------------
A0A6F9WVL7      ------------------------------------------------------------
A0A351Z9A2      ------------------------------------------------------------
A0A3N5FRH4      ------------------------------------------------------------
A0A1V4Y2C3      ------------------------------------------------------------
A0A2N2KTJ4      ------------------------------------------------------------
A0A2N2LQX0      ------------------------------------------------------------
A0A318D3U4      ------------------------------------------------------------
A0A401FQP5      ------------------------------------------------------------
A0A7C2AA26      ------------------------------------------------------------
A0A351Z4H9      ------------------------------------------------------------
A0A2N2KML4      ------------------------------------------------------------
E1YJF1          ------------------------------------------------------------
A0A1J5EVZ6      ------------------------------------------------------------
A0A2G6FCC5      ------------------------------------------------------------
A0A1F9MR25      ------------------------------------------------------------
A0A2G6M7F1      ------------------------------------------------------------
A0A7C3Q9R6      ------------------------------------------------------------
A0A1Q6DMW3      ------------------------------------------------------------
A0A3A6P8F8      ------------------------------------------------------------
A0A6L4AM84      ------------------------------------------------------------
A0A2G2DSM4      ------------------------------------------------------------
A0A1F9NI02      ------------------------------------------------------------
A0A4U1ABX4      ------------------------------------------------------------
A0A1W9M770      ------------------------------------------------------------
A0A1W9M7R6      ------------------------------------------------------------
A0A1M7Y300      ------------------------------------------------------------
A0A4U1ALN4      ------------------------------------------------------------
A0A1E7H876      ------------------------------------------------------------
A0A7C0U459      ------------------------------------------------------------
A0A0F2NF69      ------------------------------------------------------------
A0A1F9NFD0      ------------------------------------------------------------
A0A1M5YLH5      ------------------------------------------------------------
A0A4U1A4C7      ------------------------------------------------------------
A0A509L3P8      ------------------------------------------------------------
A0A3A4S038      ------------------------------------------------------------
A0A1F9N669      ------------------------------------------------------------
A0A1F9PFA7      ------------------------------------------------------------
A0A1H2EN09      ------------------------------------------------------------
K0NP00          ------------------------------------------------------------
A0A7C4N0I9      ------------------------------------------------------------
A0A1E7JCL5      ------------------------------------------------------------
A0A496YAH9      ------------------------------------------------------------
A0A1V4S7E4      ------------------------------------------------------------
A0A2N2H8D2      ------------------------------------------------------------
A0A2N2KC63      ------------------------------------------------------------
A0A3A4ZYW4      ------------------------------------------------------------
A0A1V4MCJ4      ------------------------------------------------------------
A0A661M0W4      ------------------------------------------------------------
A0A4U8YLL7      ------------------------------------------------------------
A0A445MZQ4      ------------------------------------------------------------
A0A2M7WWF7      ------------------------------------------------------------
A0A0M9E0E3      ------------------------------------------------------------
A0A4Q3IRI1      ------------------------------------------------------------
A0A7C1C6X5      ------------------------------------------------------------
A0A354EF47      ------------------------------------------------------------
A0A2G6MSP7      ------------------------------------------------------------
B7RS54          ------------------------------------------------------------
A0A1I6ENM4      ------------------------------------------------------------
A8LNM8          ------------------------------------------------------------
A0A0T5NSU3      ------------------------------------------------------------
A0A5P9I718      ------------------------------------------------------------
A0A2M8J3R9      ------------------------------------------------------------
A0A1I6X762      ------------------------------------------------------------
A0A0P1EFX8      ------------------------------------------------------------
A0A2G5KB39      ------------------------------------------------------------
A0A2N3CNV1      ------------------------------------------------------------
A0A257F1F4      ------------------------------------------------------------
A0A2D5J8T8      ------------------------------------------------------------
A0A2E3P9W6      ------------------------------------------------------------
A0A2G2B1P9      ------------------------------------------------------------
A0A258GCD5      ------------------------------------------------------------
A0A443INY4      ------------------------------------------------------------
A0A2D9YR88      ------------------------------------------------------------
A0A4Q3ZBK4      ------------------------------------------------------------
A0A1G9FY29      ------------------------------------------------------------
A0A6N9RUN2      ------------------------------------------------------------
A0A1G8QZS5      ------------------------------------------------------------
A0A1H2Y469      ------------------------------------------------------------
A0A497ZQU7      ------------------------------------------------------------
A0A4U8YMP3      ------------------------------------------------------------
A0A1Q8QQ99      ------------------------------------------------------------
A0A7C2SIB2      ------------------------------------------------------------
A0A3D5ZY44      ------------------------------------------------------------
A0A1G5C236      ------------------------------------------------------------
A0A432HIS7      ------------------------------------------------------------
A0A520CSP5      ------------------------------------------------------------
A0A372IH36      ------------------------------------------------------------
A0A540VW45      ------------------------------------------------------------
A0A1H9C241      ------------------------------------------------------------
A0A2E3FCR1      ------------------------------------------------------------
A0A4S3MG69      ------------------------------------------------------------
A0A3E0H727      ------------------------------------------------------------
A0A1I3TTC3      ------------------------------------------------------------
A0A1H3IZW6      ------------------------------------------------------------
A0A0M6YG59      ------------------------------------------------------------
A0A1H7G8B0      ------------------------------------------------------------
A0A7C3Z8T7      ------------------------------------------------------------
A0A1V4QMH7      ------------------------------------------------------------
A0A496XZQ4      ------------------------------------------------------------
A0A7C3UZM2      ------------------------------------------------------------
A0A1F9BJF7      ------------------------------------------------------------
F2NDF5          ------------------------------------------------------------
A0A656PSQ6      ------------------------------------------------------------
A0A4Q3ZDI7      ------------------------------------------------------------
A0A537PRC6      ------------------------------------------------------------
A0A1I3XJ27      ------------------------------------------------------------
A0A562CGU2      ------------------------------------------------------------
A0A7C9VCB3      ------------------------------------------------------------
A0A1I7DCG1      ------------------------------------------------------------
A0A3A3H6D9      ------------------------------------------------------------
A0A0Q6VA36      ------------------------------------------------------------
A0A1B2EQN1      ------------------------------------------------------------
A0A1E7HSL6      ------------------------------------------------------------
A0A2M7JX59      ------------------------------------------------------------
A0A3A4XVN3      ------------------------------------------------------------
A0A1E7JEV6      ------------------------------------------------------------
A0A2N2KDY5      ------------------------------------------------------------
A0A3N5YUD9      ------------------------------------------------------------
A0A0W1DLQ3      ------------------------------------------------------------
A0A246JVD8      ------------------------------------------------------------
A0A2N3BB54      ------------------------------------------------------------
A0A1H6G7A3      ------------------------------------------------------------
A0A0A7PGL6      ------------------------------------------------------------
A0A4Q2Z4L0      ------------------------------------------------------------
A0A5C4N0H6      ------------------------------------------------------------
A0A1V4M8I1      ------------------------------------------------------------
A0A7C0XE92      ------------------------------------------------------------
A0A1E7HFN0      ------------------------------------------------------------
A0A7J0BHG1      ------------------------------------------------------------
A0A1M5GH86      ------------------------------------------------------------
A0A1W1XQZ5      ------------------------------------------------------------
A0A6V8LMJ3      ------------------------------------------------------------
A0A2K8WHP8      ------------------------------------------------------------
A0A1J5N774      ------------------------------------------------------------
A0A2C8F781      ------------------------------------------------------------
A0A2E3R6G0      ------------------------------------------------------------
A0A7J0BUD3      ------------------------------------------------------------
A0A1F8XMK2      ------------------------------------------------------------
A0A3M8EMP2      ------------------------------------------------------------
A0A2J6J6K6      ------------------------------------------------------------
A0A661PSB9      ------------------------------------------------------------
A0A661QBT6      ------------------------------------------------------------
A0A6I2SLK2      ------------------------------------------------------------
A0A0A8WSG4      ------------------------------------------------------------
S7TK97          ------------------------------------------------------------
S7UE93          ------------------------------------------------------------
A0A3D5BR56      ------------------------------------------------------------
A0A2N2IB15      ------------------------------------------------------------
A0A1I3PSR2      ------------------------------------------------------------
A0A1I4GEK4      ------------------------------------------------------------
A0A7C8B5M6      ------------------------------------------------------------
A0A1W7QPT7      ------------------------------------------------------------
A0A6S6M1Y8      ------------------------------------------------------------
A0A6V8MCR2      ------------------------------------------------------------
A0A6V8N3X1      ------------------------------------------------------------
A0A6M4XJ81      ------------------------------------------------------------
A0A0M4D373      ------------------------------------------------------------
A0A1L3GKM9      ------------------------------------------------------------
A0A2T5R3J5      ------------------------------------------------------------
A0A1G6EKK9      ------------------------------------------------------------
A0A7C1DJX8      ------------------------------------------------------------
A0A3D6C3I2      ------------------------------------------------------------
S0G1D4          ------------------------------------------------------------
A0A661T246      ------------------------------------------------------------
A0A2G6CSG7      ------------------------------------------------------------
A0A2G6NB59      ------------------------------------------------------------
A0A5K8A7T9      ------------------------------------------------------------
A0A1W9U045      ------------------------------------------------------------
A0A1F9L9G4      ------------------------------------------------------------
A0A328FD76      ------------------------------------------------------------
A0A348UX90      ------------------------------------------------------------
A0A357Z0N5      ------------------------------------------------------------
A0A0F2R2U0      ------------------------------------------------------------
A0A5K7ZK00      ------------------------------------------------------------
A0A5K7YCX8      ------------------------------------------------------------
A0A5K7Z388      ------------------------------------------------------------
A0A352B502      ------------------------------------------------------------
A0A410V446      ------------------------------------------------------------
A0A0R3KGJ5      ------------------------------------------------------------
A0A0R3N604      ------------------------------------------------------------
A0A1B1UCM8      ------------------------------------------------------------
A0A1N6JQ20      ------------------------------------------------------------
A0A1M5TI07      ------------------------------------------------------------
A3X191          ------------------------------------------------------------
A0A1H4RKV5      ------------------------------------------------------------
A0A160UA87      ------------------------------------------------------------
A0A1Q5SFV5      ------------------------------------------------------------
A0A7C3Y7G3      ------------------------------------------------------------
A0A430DNP0      ------------------------------------------------------------
A0A3A0FQ32      ------------------------------------------------------------
A0A1E4UZA0      ------------------------------------------------------------
A0A1H9KL56      ------------------------------------------------------------
A0A1A9KEF8      ------------------------------------------------------------
A0A5E6PKN5      ------------------------------------------------------------
A0A0N9W1V6      ------------------------------------------------------------
A0A423GQ41      ------------------------------------------------------------
A0A423H7J2      ------------------------------------------------------------
A0A502HNM8      ------------------------------------------------------------
A0A4Q7H223      ------------------------------------------------------------
A0A1H4N2K9      ------------------------------------------------------------
A0A2K4KWF7      ------------------------------------------------------------
A0A3E0WXH2      ------------------------------------------------------------
A0A2N2TRC8      ------------------------------------------------------------
A0A1V4CIZ7      ------------------------------------------------------------
A0A1M3BXA5      ------------------------------------------------------------
A0A1Y2R3U6      ------------------------------------------------------------
A0A167HVD6      ------------------------------------------------------------
A0A1V3SCT6      ------------------------------------------------------------
L0H287          ------------------------------------------------------------
A0A495VG93      ------------------------------------------------------------
A0A4R3MYM4      ------------------------------------------------------------
G2E3C0          ------------------------------------------------------------
                                                                            

E1Y9C0          ------------------------------------------------------------
A0A1N6SH58      ------------------------------------------------------------
A0A4Q3AQN2      ------------------------------------------------------------
A0A1W9HS52      FERLKEKVYRLKDFVGRQTSERKKILEDLEQHRVELQRKHEVGNTQEYRREVYQRYGDVQ
A0A2D5LFD8      NDKILLDQLADVYLEIAQRQRQQSLRDGLAF----LDQQKPALEAKSTAL----------
A0A4D8PLT4      QARLLTIDTLLRRIEARNDDRSFTIIIEASS----VDPAKAAAIANAFGQAYLDYRTEMN
A0A7J5VV32      ------------------------------------------------------------
A0A6G6X2Z4      ------------------------------------------------------------
Q44570          ------------------------------------------------------------
A0A3N5MZ53      ------------------------------------------------------------
A0A534E4H4      ------------------------------------------------------------
A0A534I2B6      ------------------------------------------------------------
A0A1C2JGD0      ------------------------------------------------------------
A0A259LQ70      ------------------------------------------------------------
A0A4V2SPR5      ------------------------------------------------------------
A0A3N5PM86      ------------------------------------------------------------
A0A2E5YSA4      --------MGSRSGCRFAREFQS-------------------------------------
A0A0N0XAV4      ------------------------------------------------------------
A0A0P9QD19      ------------------------------------------------------------
F3FHG4          ------------------------------------------------------------
F3GGI0          -------------------------------------RLKIAEAGRDSGIIYLSIEDQD-
A0A0P9LE74      ------------------------------------------------------------
A0A3M4ZQ14      GVTIQVAALQARPGTDFTVSRQRTFSTALSY----QNRLKITEAGRDSGIIYLSIEDPD-
A0A3M5YLE8      GVTIQVAALQARPGTDFTVSRQRTFSTALSY----QNRLKITEAGRDSGIIYLSIEDPD-
A0A3M3RP89      GVTIQVAALQARPGTDFTVSRQRTFSTALSY----QNRLKITEAGRDSGIIYLSIEDPD-
A0A0P9QIY7      GVTIQVAALQARPGTDFTVSRQRTFSTALSY----QNRLKITEAGRDSGIIYLSIEDPD-
A0A0P9VVH7      GVTIQVAALQARPGTDFTVSRQRTFSTALSY----QNRLKITEAGRDSGIIYLSIEDPD-
A0A0Q0FJK6      GVTIQVAALQARPGTDFTVSRQRTFSTALSY----QNRLKITEAGRDSGIIYLSIEDPD-
A0A0Q0G2J0      GVTIQVAALQARPGTDFTVSRQRTFSTALSY----QNRLKITEAGRDSGIIYLSIEDPD-
A0A3M3LF66      GVTIQVAALQARPGTDFTVSRQRTFSTALSY----QNRLKITEAGRDSGIIYLSIEDPD-
A0A0P9WIR8      GVTIQVAALQARPGTDFTVSRQRTFSTALSY----QNRLKITEAGRDSGIIYLSIEDPD-
A0A3M3KPE5      GVTIQVAALQARPGTDFTVSRQRTFSTALSY----QNRLKITEAGRDSGIIYLSIEDPD-
A0A3M4C263      GVTIQVAALQARPGTDFTVSRQRTFSTALSY----QNRLKITEAGRDSGIIYLSIEDPD-
A0A3M5AD05      GVTIQVAALQARPGTDFTVSRQRTFSTALSY----QNRLKITEAGRDSGIIYLSIEDPD-
A0A0Q0D3D2      GVKIQVAALRAHPGTDFSVSRQRTLSTALVY----QNRLKIAEAGRDSGIIYLSIEDQE-
A0A0N0FS39      ------------------------------------------------------------
A0A3M6GHH2      ------------------------------------------------------------
A0A0P9R9W0      GIRIQVATLLARPGTNFSLSRQRTLSTALVY----QNRLKIAEAGRDSGIIYLSIEDQN-
A0A0Q0B9T0      GIRIQVATLLARPGTNFSLSRQRTLSTALVY----QNRLKIAEAGRDSGIIYLSIEDQN-
A0A3M6CFI7      GIRIQVATLLARPGTNFSLSRQRTLSTALVY----QNRLKIAEAGRDSGIIYLSIEDQN-
A0A0P9JXN0      GIRIQVATLLARPGTNFSLSRQRTLSTALVY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A3M6FIV7      GIRIQVATLLARPGTNFSLSRQRTLSTALVY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A3M3PLW9      GIKIQVATLQARPGTDFTVSRQRTLSTALIY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A3M4ENY1      GIKIQVATLQARPGTDFTVSRQRTLSTALIY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A3M5EZK7      GIKIQVATLQARPGTDFTVSRQRTLSTALIY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A0P9SPP5      GIKIQVAALRARPGTDFSVSRQRTLSTALVY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A658KL17      GIKIQVATLRARPGTDFSVSRQRTLSTALVY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A3M3NNF2      GVKIQVAALRARPGTDFSVSRQRTLSTALVY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A3M4A0E8      GVKIQVAALRAHPGTDFSVSRQRTLSTALVY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A3M4PBZ2      GVKIQVAALRAHPGTDFSVSRQRTLSTALVY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A3M6AI26      GVKIQVAALRARPGTDFSVSRQHTLSTALVY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A0P9IWP8      GVKIQVAALRAHPGTDFSVSRQRTLSTALVY----QNRLKIAEAGRDSGIIYLSIEDQE-
A0A0P9KZ49      GVKIQVAALRARPGTDFSVSRQRTLSTALVY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A0P9V840      GVKIQVAALRARPGTDFSVSRQRTLSTALVY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A0Q0AIE5      GVKIQVAALRARPGTDFSVSRQRTLSTALVY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A3M2ZQH6      GVKIQVAALRARPGTDFSVSRQRTLSTALVY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A0N8SQG2      GVKIQVAALRARPGTDFSVSRQRTLSTALVY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A0W8HFU1      GVKIQVAALRARPGTDFSVSRQRTLSTALVY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A3M5M873      GVKIQVAALRAHPGTDFSVSRQRTLSTALVY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A0P9VHH8      GVKIQVAALRAHPGTDFSVSRQRTLSTALVY----QNRLKIAEAGRDSGIIYLSIEDQE-
A0A0P9YV98      GVKIQVAALRARPGTDFSVSRQRTLSTALVY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A3M3G2W8      GVKIQVAALRARPGTDFSVSRQRTLSTALVY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A3M6C224      GVKIQVAALRARPGTDFSVSRQRTLSTALVY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A3M5K254      GVKIQVAALRARPGTDFSVSRQRTLSTALVY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A3M5JFB0      GVKIQVAALRARPGTDFSVSRQRTLSTALVY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A3M3TQV3      GVKIQVAALRAHPGTDFSVSRQRTLSTALVY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A3M3EF92      GVKIQVAALRAHPGTDFSVSRQRTLSTALVY----QNRLKIAEAGRDSGIIYLSIEDQN-
A0A3M5J1E2      GVKIQVAALRAHPGTDFSVSRQRTLSTALVY----QNRLKIAEAGRDSGIIYLSIEDQN-
A0A3M5G7H9      GVKIQVAALRARPGTDFSVSRQRTLSTALVY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A3M4A376      GVKIQVAALRAHPGTDFSVSRQRTLSTALVY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A0Q0A5T8      GVKIQVAALRARPGTDFSVSRQRTLSTALVY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A0P9SCD7      GVKIQVAALRARPGTDFSVSRQRTLSTALVY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A0P9T4G3      GVKIQVAALRARPGTDFSVSRQRTLSTALVY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A0P9VKB0      GVKIQVAALRARPGTDFSVSRQRTLSTALVY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A0Q0BM35      GVKIQVAALRARPGTDFSVSRQRTLSTALVY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A3M3TPR7      GVKIQVAALRARPGTDFSVSRQRTLSTALVY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A3M3U4Q3      GVKIQVAALRARPGTDFSVSRQRTLSTALVY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A0P9UCX7      GIKIQVATLRARHGTDFSVSRQRTLSTALVY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A0P9S1F1      GIKIQVATLRARPGTDFSVSRQRTLSTALVY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A0P9QCJ2      GVKIQVAALRARPGTDFSVSRQRTLSTALVY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A0P9Q329      GIKIQVATLRARPGTDFSVSRQRTLSTALVY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A3M5GJ64      GIKIQVATLRARPGTDFSVSRQRTLSTALVY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A0P9MPC7      GVKIQVAALRARPGTDFSVSRQRTLSTALVY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A3M2XYQ3      GIKIQVATLQARPGTDFTVSRQRTLSTALIY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A0P9XCE1      GIKIQVATLQARPGTDFTVSRQRTLSTALIY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A3M3EFX7      GIKIQVATLQARPGTDFTVSRQRTLSTALIY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A3M5B9D9      GIKIQVATLQARPGTDFTVSRQRTLSTALIY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A0P9RRZ3      GIKIQVATLQARPGTDFTVSRQRTLSTALLY----QNRLKIIEAGRDSGIIYLSIEDQD-
A0A3M2VEK7      GIKIQVATLQARPGTDFTVSRQRTLSTALIY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A0N8R9B3      GIKIQVATLQARPGTDFTVSRQRTLSTALIY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A0P9VA27      GIKIQVATLQARPGTDFTVSRQRTLSTALIY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A3M4YBJ4      GIKIQVATLQARPGTDFTVSRQRTLSTALIY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A0P9J470      GIKIQVATLQARPGTDFTVSRQRTLSTALIY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A0Q0EVJ8      GIKIQVATLQARPGTDFTVSRQRTLSTALIY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A3M5UI30      GVKIQVAALRARPGTDFSVSRQRTLSTALVY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A3M5YQT8      GVKIQVAALRARPGTDFSVSRQRTLSTALVY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A3M5F5X1      GVKIQVAALRAHPGTDFSVSRQRTLSTALVY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A3M5R8G1      GVKIQVAALRARPGTDFSVSRQRTLSTALVY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A3M5V012      GVKIQVAALRARPGTDFSVSRQRTLSTALVY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A3M3GA16      GVKIQVAALRARPGTDFSVSRQRTLSTALVY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A3M3UCT3      GIKIQVATLQARPGTDFTVSRQRTLSTALIY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A3M3CJL0      GIKIQVATLQARPGTDFTVSRQRTLSTALIY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A3M3F6F5      GIKIQVATLQARPGTDFTVSRQRTLSTALIY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A3M3P9B7      GIKIQVATLQARPGTDFTVSRQRTLSTALIY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A0N8QB74      GIKIQVATLQARPGTDFTVSRQRTLSTALIY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A0Q0AUD0      GIKIQVATLQARPGTDFTVSRQRTLSTALIY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A3M5VR55      GIKIQVATLQARPGTDFTVSRQRTLSTALIY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A0Q0FK97      GIKIQVATLQARPGTDFTISRQRTLSTALIY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A3M5KZ75      GIKIQVATLQARPGTDFTVSRQRTLSTALIY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A3M5L3G5      GIKIQVATLQARPGTDFTVSRQRTLSTALIY----QNRLKIAEAGRDSGIIYLSIEDQD-
A0A519ERR1      ------------------------------------------------------------
A0A4Q3Q1M2      ------------------------------------------------------------
A0A4Q3MHR1      ------------------------------------------------------------
A0A520GDZ4      ------------------------------------------------------------
A0A318DSU0      ------------------------------------------------------------
A0A538PF21      ------------------------------------------------------------
A0A1W1ZH10      ------------------------------------------------------------
A0A1W2FF24      ------------------------------------------------------------
A0A524JYQ6      ------------------------------------------------------------
A0A4Q3MA17      ------------------------------------------------------------
A0A0N0M5F7      ------------------------------------------------------------
A0A537M754      ------------------------------------------------------------
A0A1V1PDB4      ------------------------------------------------------------
A0A2M7C324      ------------------------------------------------------------
A0A4Q3HHG6      ------------------------------------------------------------
A0A3B7DTA4      ------------------------------------------------------------
A0A432ZK62      ------------------------------------------------------------
A0A1V5EEP4      ------------------------------------------------------------
A0A1V5EF48      ------------------------------------------------------------
A0A0S6X1X6      ------------------------------------------------------------
A0A537Y5L8      ------------------------------------------------------------
A0A4Q3L2X2      ------------------------------------------------------------
A0A4Q3T8J1      ------------------------------------------------------------
A0A4Q4ANM4      ------------------------------------------------------------
A0A4Q3UEC7      ------------------------------------------------------------
A0A1H5YYQ4      ------------------------------------------------------------
A0A1X4NLK2      ------------------------------------------------------------
A0A1X4NWB5      ------------------------------------------------------------
A0A1M5UQ38      ------------------------------------------------------------
A0A327YI48      ------------------------------------------------------------
A0A1B1PNL6      ------------------------------------------------------------
A0A2U8H9H9      ------------------------------------------------------------
A0A6B2NBB8      ------------------------------------------------------------
A0A1X6YIC0      ------------------------------------------------------------
A0A1I5E9E9      ------------------------------------------------------------
A0A1X6Z7N7      ------------------------------------------------------------
A0A2E1DQ13      ------------------------------------------------------------
A0A1H8C800      ------------------------------------------------------------
A0A2N3EZ05      ------------------------------------------------------------
A0A655R819      ------------------------------------------------------------
A0A655RNN3      ------------------------------------------------------------
A0A0R0BVC7      ------------------------------------------------------------
A0A3N5J7U8      ------------------------------------------------------------
A0A1S7S3I8      ------------------------------------------------------------
A0A519E8D7      ------------------------------------------------------------
A0A3S1FD32      ------------------------------------------------------------
A0A434DUT4      ------------------------------------------------------------
A0A528D3U3      ------------------------------------------------------------
A0A3S3UPT3      ------------------------------------------------------------
A0A3S1E286      ------------------------------------------------------------
A0A531AC71      ------------------------------------------------------------
A0A436K268      ------------------------------------------------------------
A0A434IDQ0      ------------------------------------------------------------
A0A435IRM5      ------------------------------------------------------------
A0A3S2C404      ------------------------------------------------------------
A0A435F6C0      ------------------------------------------------------------
A0A435BMN6      ------------------------------------------------------------
A0A529XQ54      ------------------------------------------------------------
A0A530BJC1      ------------------------------------------------------------
A0A348SRI7      ------------------------------------------------------------
A0A354EI73      ------------------------------------------------------------
A0A4P7EP83      ------------------------------------------------------------
A0A6I1QB25      ------------------------------------------------------------
A0A655ZZQ1      ------------------------------------------------------------
A0A1S0ZAI3      ------------------------------------------------------------
A0A3A4NIE9      ------------------------------------------------------------
A0A3A4NUI9      ------------------------------------------------------------
A0A524I3Z6      ------------------------------------------------------------
A0A524PCL7      ------------------------------------------------------------
A0A356GQV1      ------------------------------------------------------------
A0A1J5DAY8      ------------------------------------------------------------
A0A524P237      ------------------------------------------------------------
A0A3C0L0A8      ------------------------------------------------------------
A0A176S762      ------------------------------------------------------------
A0A377ZC40      ------------------------------------------------------------
A0A378BPJ7      ------------------------------------------------------------
A0A2J5PAJ7      ------------------------------------------------------------
A0A377ZDN3      ------------------------------------------------------------
A0A7A9Y5Q1      ------------------------------------------------------------
A0A1G3JY11      ------------------------------------------------------------
A0A661N3U1      ------------------------------------------------------------
A0A1W9WUD9      ------------------------------------------------------------
A0A1W1ZQK0      ------------------------------------------------------------
A0A6I1R304      ------------------------------------------------------------
A0A1W9PMU6      ------------------------------------------------------------
A0A3S1WTQ1      ------------------------------------------------------------
A0A530CUR9      ------------------------------------------------------------
A0A6L6H5T1      ------------------------------------------------------------
A0A6D0ELN7      ------------------------------------------------------------
A0A1M6N1X5      ------------------------------------------------------------
A0A561M3U0      ------------------------------------------------------------
A0A2N6BZD5      ------------------------------------------------------------
A0A1G3VVY5      ------------------------------------------------------------
A0A7C3S273      ------------------------------------------------------------
A0A7C4WJ18      ------------------------------------------------------------
A0A7C3V565      ------------------------------------------------------------
A0A351B422      ------------------------------------------------------------
F2NEE9          ------------------------------------------------------------
A0A2W5J775      ------------------------------------------------------------
A0A352Q5C1      ------------------------------------------------------------
A0A435NNF5      ------------------------------------------------------------
A0A3S2AQS7      ------------------------------------------------------------
A0A436XH86      ------------------------------------------------------------
A0A527ZPD6      ------------------------------------------------------------
A0A529KRW3      ------------------------------------------------------------
A0A530ZLX0      ------------------------------------------------------------
A0A355TB56      ------------------------------------------------------------
A0A1F9E324      ------------------------------------------------------------
A0A432SAI6      ------------------------------------------------------------
A0A4Q3LBH4      ------------------------------------------------------------
A0A4Q3LWP3      ------------------------------------------------------------
A0A7C3JPP4      ------------------------------------------------------------
A0A534V9L7      ------------------------------------------------------------
A0A7C3JJT4      ------------------------------------------------------------
A0A2N6VGL1      ------------------------------------------------------------
A0A3M3H5V6      ------------------------------------------------------------
A0A524M660      ------------------------------------------------------------
A0A7C3JSX5      ------------------------------------------------------------
A0A7I8MQ67      ------------------------------------------------------------
A0A0C1TRU6      ------------------------------------------------------------
A0A2Z5SSF4      ------------------------------------------------------------
A0A2T4ZJZ6      ------------------------------------------------------------
A0A0B8PTA8      ------------------------------------------------------------
A0A0B8QF75      ------------------------------------------------------------
A0A6P2T4F7      ------------------------------------------------------------
A0A4Q4CIB1      ------------------------------------------------------------
A0A522ACJ9      ------------------MDRGQDCAWIIVMTDDKA------------------------
A0A1T2KYM8      -----------------QSRLVATGDYAPSILSPWR------------------------
A0A3N5Z7F8      ------------------------------------------------------------
A0A239HD34      ------------------------------------------------------------
A0A2G9ZR82      ------------------------------------------------------------
A0A4U9I390      ------------------------------------------------------------
A0A0P7ZZE4      ------------------------------------------------------------
A0A369R0Q9      ------------------------------------------------------------
A0A327LYE6      ------------------------------------------------------------
A0A5A9ZTV3      ------------------------------------------------------------
A0A6J4YZ98      ------------------------------------------------------------
A0A2X3M011      ------------------------------------------------------------
I2WC85          ------------------------------------------------------------
A0A7A9K1G5      ------------------------------------------------------------
A0A7B7KSB7      ------------------------------------------------------------
A0A400JH80      ------------------------------------------------------------
A0A479JNB1      ------------------------------------------------------------
A0A5C9AF52      ------------------------------------------------------------
A0A797FC39      ------------------------------------------------------------
A0A797FHC1      ------------------------------------------------------------
D8EEU7          ------------------------------------------------------------
A0A6D0EYC7      ------------------------------------------------------------
A0A7A6DHB0      ------------------------------------------------------------
A0A2H9EHM4      ------------------------------------------------------------
A0A7A5MLK0      ------------------------------------------------------------
A0A380B3D7      ------------------------------------------------------------
F5NSX0          ------------------------------------------------------------
A0A534XP85      ------------------------------------------------------------
A0A0P1H2H0      --------------------------MVEQSKKVLR------------------------
A0A258WKV0      ------------------------------------------------------------
A0A377N8F8      ------------------------------------------------------------
A5G4N9          ------------------------------------------------------------
A0A3C2DSE7      ------------------------------------------------------------
A0A2X1JBG5      ------------------------------------------------------------
A0A377LY04      FSTALPATTLSRTSNASRLKRRKAWPSSPDSSRKYA------------------------
A0A5C9ABR5      ------------------------------------------------------------
A0A5J9WU72      ------------------------------------------------------------
A0A2X3K9R3      ------------------------------------------------------------
A0A3T9EHW9      ------------------------------------------------------------
A0A484X141      ------------------------------------------------------------
A0A5N9VWI6      -------------IERKSAEASKSLAFLAKQLPEVR------------------------
A0A6D0EJQ0      ------------------------------------------------------------
A0A444R390      ------------------------------------------------------------
A0A376LLF8      ------------------------------------------------------------
A0A6L7CT21      ------------------------------------------------------------
A0A4Q3LR91      ------------------------------MLAESR------------------------
A0A6C9IKN8      ------------------------------------------------------------
A0A4V1TR68      ---------------------------------MVQ------------------------
A0A444IY46      ------------------------------------------------------------
A0A6I7N627      ------------------------------------------------------------
A0A6L3ZR06      ---------------------------------LVQ------------------------
A0A3E0WKI3      ------------------------------------------------------------
A0A1H3I2J1      --------------------------------MGER------------------------
A0A1V5DJV0      ------------------------------------------------------------
A0A520IUC4      ------------------------------------------------------------
A0A521LJG5      ------------------------------------------------------------
A0A531IBQ7      ------------------------------------------------------------
A0A0P1FWI8      ------------------------------------------------------------
A0A6L8LHC6      ------------------------------------------------------------
A0A1V4WHZ7      ---------------------------------MVN------------------------
A0A1E5AJN5      VDQKA-------------ESANKIRLLLQGQADLVK------------------------
A0A2N3D2J1      SKRLE----------------------AEQRWQQAR------------------------
A0A2N2GVE1      LERRL-------------SSTKSASTWLESQLLSLR------------------------
A0A2N2INV3      LERRL-------------SSTKSASTWLESQLLSLR------------------------
A0A233IKJ2      IEDKL-------------QVELKANSWLNNRMGDLR------------------------
A0A1Y5DXG5      VDRNS-------------AEAKKSLDFLAVQLPEIK------------------------
A0A0B8P2H5      VDRNA-------------AEAENSLEFLQEKLPEIK------------------------
A0A380AQW6      ------------------------------------------------------------
A0A2G2GD62      VDQKK-------------SSTERSLAFIDKQLDNIN------------------------
A0A3R9C3P5      KDSVR-------------GRLVSAGDWLRQRVAEQQ------------------------
A0A0M3GBT1      KGSVR-------------SRLDAAEKWIVQRISEQK------------------------
B3Q577          KGSVR-------------SRLDAAEKWIVQRISEQK------------------------
A0A483QWI8      IARQA-------------AQDAKSLDFLNEQLPKVR------------------------
A0A483UXD3      IARQA-------------AQDAKSLDFLNEQLPKVR------------------------
A0A0A8J8L3      VARQA-------------AQDAKSLEFLNQQLPKVR------------------------
A0A660DJ38      VERQA-------------AQDAKSLDFLNQQLPKVR------------------------
A0A524P331      LSFRT-------------EEASNTVKFVEEQLKGTR------------------------
A0A4V1SSM5      ------------------------------------------------------------
A0A4Q3K8G7      ------------------------------------------------------------
A0A7C7W7M2      FENEV-------------ETARKNQQFLSGRLTFLR------------------------
A0A1M7HC79      VERQS-------------AEAQQSLEFLQEQSPELR------------------------
A0A1D3JZN6      VDRTS-------------AEAAQSLAFLNDQLPQVR------------------------
A0A1V6ESG1      --------------------------MINQTFTDYS------------------------
A0A1H7YHK3      VDRNS-------------AEVSSQLKFVKDQLLEVR------------------------
A0A534SH66      ------------------------------------------------------------
A0A3M0ZZ99      ------------------------------------------------------------
A0A238LBD3      ------------------------------------------------------------
A0A328C2K5      REFQT-------------GGLRQLANWFDDYVSTKR------------------------
A0A5C6X8M3      REFQT-------------GGLRQLANWFDDYVSTKR------------------------
A0A3D8MRR7      REFQT-------------GGLRQLANWFDDYVSTKR------------------------
A0A5C6UBJ7      REFQT-------------GGLRQLANWFDDYVSTKR------------------------
A0A5C6XGM3      REFQT-------------GGLRQLANWFDDYVSTKR------------------------
A0A537NZJ1      ------------------------------------------------------------
A0A7C4R3C4      --------------------MGKISEALSRFTEESR------------------------
A0A0P1FRV5      ------------------------------------------------------------
A0A4Q4CVW6      ------------------------------------------------------------
A0A090R136      ------------------------MHFLSDHLPNIK------------------------
A0A661JU93      ------------------------------------------------------------
A0A2E2T3V8      NNELR-------------RGMDNQLTVIQRQLDEAR------------------------
A0A367UAB4      NNELR-------------RGMDNQLTVIQRQLDEAR------------------------
A0A1F2ZW35      IDTKN-------------EANRRATEWLEQRLAELR------------------------
A0A377V641      ISRQA-------------AQDEKSLEFLNKQLPMVR------------------------
A0A1F2YJ88      IERRS-------------AETAQTLKFLDEQLPELK------------------------
A0A6L3ZWI0      ------------------------------------------------------------
A0A5N8AL61      RSGKA-------------QARSQEIEMLRSRLDELR------------------------
A0A0J7XGZ1      SAKKQ-------------ARNAQSAHYVESQAAALR------------------------
I4CBA7          RERLE-------------TLANSLLAKLQNELRQAE------------------------
A3VE95          LENRR-------------DSAVQATAWIQEQVNEAR------------------------
A0A1G0NL95      VSRRS-------------REAGLTLAFIARQLPQVR------------------------
A0A024KA69      AARALG------------LAGERAPDWLGSRVKVQR------------------------
A0A0L1KFN4      LERKV-------------QSTSYGRTALQRQLAEYK------------------------
A0A3P5DSS6      ----------------------------------MR------------------------
A0A483YEL5      IARQA-------------AQDAKSLDFLNQQLPKVR------------------------
A0A658GUJ0      IARQA-------------AQDAKSLDFLNQQLPKVR------------------------
A0A358L616      VERKS-------------AEAQKSLEFLQHQLPQVR------------------------
A0A1M7BLL7      ------------------------------------------------------------
A0A0H4KZM1      RASRE-------------AGGPAPKPALTGPIHLAP------------------------
A0A3D5UYX7      --------------------------ELNAQLILAR------------------------
A0A2N1WQN5      ------------------------------------------------------------
A0A352G2C2      VARNA-------------AEATQSLEFLNEQVPAVR------------------------
A0A3C0PZN1      --------------------------FLNEQVPAVR------------------------
A0A524QFS4      LDVNK-------------SNSKSAVEWLESQMEVQR------------------------
A0A520JSW4      LERRY-------------QSSSYAREFLQRQIATTR------------------------
A0A1V1UJT2      ------------------------------------------------------------
A0A0L6CVX1      ------------------------------------------------------------
A0A1V0RR48      ------------------------------------------------------------
A0A0A0HJJ4      ------------------------------------------------------------
A0A5E7YA28      ------------------------------------------------------------
A0A4Q3LTF3      ------------------ATLNASLSQATAERIQAE------------------------
A0A7C3N3Y1      LDYRF-------------SATEQAKDWLTAQIDQLK------------------------
A0A537UTP9      LEAKY-------------QAALRAGTWMQDRIKELR------------------------
A0A1D2RNR5      ------------------------------------------------------------
A0A4V1TQ46      ------------------KGWEQAAKAPLLSIPEVQ------------------------
A0A3A0FZC0      RQNRI-------------DQQARGLTFLRAQADELR------------------------
A0A1N7JVZ7      PTPEP-------------QQPAPKPQLVHNERPRRSAEQAF-------------------
A0A091C4A8      LERRF-------------DASSYAKTFLEERLEQLR------------------------
A0A4R3H6P6      LERRF-------------DASSYARKFLEGRIEQLR------------------------
A0A3S1NQ09      LDASF-------------DATERAAVWLQGRLTELR------------------------
A0A443GJ52      LDASF-------------DATERAAVWLQGRLTELR------------------------
A0A6N3RE79      ------------------------------------------------------------
A0A6N9S3L5      ------------------------------------------------------------
A0A656BWB0      ------------------------------------------------------------
A0A6D0IFH4      ------------------------------------------------------------
A0A7A3MK38      ------------------------------------------------------------
A0A0A0FHV8      ------------------------------------------------------------
A0A1X3IPU7      ------------------------------------------------------------
A0A0A0G0N2      ------------------------------------------------------------
A0A2I8SDU4      ------------------------------------------------------------
A0A2I8SU55      ------------------------------------------------------------
A0A7I6T806      ------------------------------------------------------------
A0A7I6TQE9      ------------------------------------------------------------
A0A7I6U296      ------------------------------------------------------------
S1EXJ6          ------------------------------------------------------------
A0A376UBS1      ------------------------------------------------------------
A0A2W6S588      AQQKL-------------GQGSATSNQLKGQVEKLR------------------------
A0A483E0N4      IARQA-------------AQDAKSLEFLNKQLPQVR------------------------
A0A2J4YQQ6      ISRQA-------------AQDAKSLEFLSKQLPQVR------------------------
A0A483THX4      ISRQA-------------AQDAKSLEFLSQQLPKVR------------------------
A0A534MVS2      -MQQI-------------NSILGQIRRLSEDRENGT------------------------
A0A444I5K6      LNSKY-------------EATRRAGQWLQERIEELR------------------------
A0A154VE85      VAQRA-------------AAARRADEWLGGRLERLR------------------------
A0A3S1MCW7      ------------------------------------------------------------
A0A434IGN6      ------------------------------------------------------------
A0A528AX40      LDQTS-------------ETSDLARQFIQEQVLQVK------------------------
A0A528MV95      LDQTS-------------ETSDLARQFIQEQVLQVK------------------------
A0A3C1S9Y1      METKL-------------AAAKDAVRWLTERIEDER------------------------
A0A353EH49      LERSA-------------AEARLSLEFLERQLPPLK------------------------
A0A1Y1Q9C1      ISSQS-------------ETDTYAKEFLEQEMEKAR------------------------
A0A3M7LJH0      VQRNS-------------AEAEKSLAFLKGHLPTIK------------------------
A0A316KRG4      --------------------MTEQPKFQRRKRRGAD------------------------
A0A1E4JHX8      LERRF-------------EATSYARKFLEERLRQWR------------------------
M2U8P2          VSEKS-------------SQRQREISILRERIAELK------------------------
A0A1H7KZF8      VQQRA-------------DQSRYARAFLESELANIR------------------------
A0A0J5Q9T7      FHRRH-------------GPTQDATGTQPAEDLAPI------------------------
A0A6N3UC48      VQRKS-------------AEAQQSLDFLKEQLPTVR------------------------
A0A257NG76      VEQKS-------------AEAQKTLEFLEKQLPQLK------------------------
A0A1T4TW59      LEARL-------------LATQTASTWLTERLAVLE------------------------
A0A1I5YYQ0      ---------------------MSADRTFRRKNRPVR------------------------
A0A5P9FE62      ---------------------MSADRTFRRKNRPVR------------------------
A0A1Q3MB35      LDRRF-------------LSTADAREFLEGRLAELR------------------------
A0A259LUN7      MEEKY-------------NATRKATEWLQLRVSALQ------------------------
A0A2D7AVL1      KELAT-------------------------------------------------------
A0A3B9KZE9      ------------------------------------------------------------
A0A2U0NMP8      IARQA-------------AQDAKSLDFLNQQLPKVR------------------------
A0A4U9HNE9      IDRKT-------------EEAQRMLAFLARQLPQIR------------------------
A0A7C5N053      ISDAY-------------ESTDRAIADLSEQQEKLE------------------------
A0A2G2CXY6      VARNS-------------AEAAQSLEFIREQLPVVR------------------------
A0A3M1D4H3      -------------------------------IQETR------------------------
A0A7C1A2A2      LRWST-------------EQAGTAYHYLDGQLHKMR------------------------
A0A5C8BYM7      ------------------LTLDEKTNVINQTFVDFS------------------------
A0A1J5ICP0      VLKDT-------------QNAASALAFIDEQIGILE------------------------
A0A379B9V4      VARNS-------------AEASKSLEFLNQQLPDVR------------------------
A0A0Q6TS97      LERRF-------------EASGYARKFLEGRIEQLR------------------------
A0A0Q6UYB4      LERRF-------------EASGYARKFLEGRIEQLR------------------------
A0A484XS37      VERKS-------------EEAAKSLDFLKDQLPEVR------------------------
W7Q5J0          VERQS-------------AQAEQSLVFLEEQTPELR------------------------
A0A654AKT6      MGRRISYLHHWMGINIVFAMVQFVLYYVDKGLAWQL------------------------
A0A7A9JY19      VSRQA-------------AQDARSLEFLNERLPKVR------------------------
A0A0G9MZA5      LDRRF-------------GATRDARSSLEEQLQQYR------------------------
H0T8B0          LQSYF-------------ETSIRTNTWLEKRVAELH------------------------
A0A5C7N981      LERRM-------------EATSYARTFLQEHLAQIK------------------------
A0A534TV22      ------------------------------------------------------------
A0A351CXR4      RSSKT-------------NRVSEASEWLNAQMTEIK------------------------
A0A2N6GLF5      LEARL-------------SMTSKASDWLTQRIEDLG------------------------
A0A1W9LJP0      LETKL-------------TAAKDAVKWLIDQMDEER------------------------
A0A0W1ICB0      MDRRL-------------ASTADARIYLEGRLQGLR------------------------
A0A7C1C8G2      AEQKL-------------AAFHSSGVFLDKQVNASK------------------------
A0A376KYN0      ------------------------------------------------------------
A0A7A9J338      IARQA-------------AQDSQSLEFLQRQLPEVR------------------------
A0A377E5P7      IARQA-------------AQDSQSLEFLQRQLPEVR------------------------
A0A2X1JB05      IARQA-------------AQDSQSLEFLQRQLPEVR------------------------
A0A376RML0      IARQA-------------AQDSQSLEFLQRQLPEVR------------------------
A0A6N3QTV2      IARQA-------------AQDSQSLEFLQRQLPEVR------------------------
A0A2E0UL88      LDQES-------------EGLINQLSNFEAQREQAK------------------------
A0A0T2QIS1      LDRRF-------------SSTADARKFLEGRLAELA------------------------
A0A0P7Y1D0      LEAKF-------------DATERANTWLNERLETLR------------------------
A0A542J310      IVQST-------------GIGDVSNVSLGDSVARSR------------------------
A0A2M7JRZ7      VESRF-------------IATEQVKEWLTKQLEDLK------------------------
A0A167IR75      LERKV-------------QATSYGRDALQRQLTEYK------------------------
A0A3B8T2U6      LEAKL-------------EMTAKATTWLNTSLAGLK------------------------
A0A365PWR2      IERAA-------------ADASSGLEFLTTELPAMR------------------------
A0A2E9H5Z8      AEMQQ-------------FGAEERKAELENQIQ---------------------------
A0A2E2BR79      VERQS-------------AQVDQSLAFISEQAPDLR------------------------
A0A6I4IKZ3      IERRS-------------AESAQTLKFLDEQLPDLK------------------------
A0A7H4JZ79      VERRS-------------AESAQTLKFLDEQLPDLK------------------------
A0A0Q4Q524      LERKV-------------QATSYGRNLLQRQLAQQK------------------------
A0A0Q4CFJ9      LERKV-------------QATSYGRNLLQRQLAQQK------------------------
A0A0Q4FE58      LERKV-------------EATSYGRNLLQRQLAQQK------------------------
A0A0Q4JWC8      LERKV-------------EATSYGRNLLQRQLAQQK------------------------
A0A0Q4KFL8      LERKV-------------EATSYGRNLLQRQLAQQK------------------------
A0A522R8R0      SDQQL-------------SDLNKQLILAQADTANAR------------------------
A0A2U9NDY5      SQRSA-------------AEAAQRLDGLRAQRPQVR------------------------
X7F6S5          FRRR------------------KGRAAPAEDDLRPV------------------------
A0A1G8NKI0      FRRR-----------------NRPEDTPPP---APT------------------------
A0A355QPE4      FRRR-----------------NRPEDTPAP---APA------------------------
A0A357RN98      FRRR-----------------NRPEDTPAP---APA------------------------
A0A1I6U4V1      FSRR-----------------KRAEELPED---PPI------------------------
A0A6B2P8H8      FRRR-----------------KRSEETPED---PPI------------------------
A0A1P8USW9      FRRKF-------------GRTEAPAPETQPED-PPI------------------------
A0A1G7CFZ2      FRRR-----------------NRPLDDLPDEDISPV------------------------
A0A7G2TPW1      FRRR-----------------NRPLDDLPDENISPV------------------------
A0A0Q4IGG1      LERKV-------------QATSYGRNMLQRQLALQK------------------------
A0A534RUJ5      LELRT-------------QANEEAQRFLEEKLVELK------------------------
A0A3M1CJM3      -----------------------AAAWLASQAAELK------------------------
A0A2R7SVD4      VRRTS-------------AEAAQSLAFLQSQLPQVK------------------------
A0A3C0PWB6      IQRSS-------------AEAAQRLDFLRSQLPQVR------------------------
V4Q8B7          IQRSS-------------AEAAQRLDFLRSQLPQVR------------------------
A0A0Q8XKK5      MDRRF-------------ASTADARKFLESRLADLR------------------------
A0A2E0Q2W0      -------------------------------MAEQR------------------------
A0A660NIR6      LDARF-------------DMQQTASRWLNDRLNQLR------------------------
A0A142W0R3      LDRRF-------------SATSDARRFLEQRIGSLR------------------------
A0A0S4XR18      LDYQR-------------EEVEKKLKFVNDQLTITH------------------------
A0A7C5CFF1      QGILS-------------SVSLVTAGIDTSSIQPLM------------------------
A0A2E0GW64      IQKKS-------------QQAAQALQFINSQLPKVK------------------------
A0A1A7QJ97      LERKL-------------QSTSYGRDALQRQLTDYK------------------------
A0A661LW70      TRYKQ-------------AMALTGTPDMLDSIPEVL------------------------
W7Q8F9          VERQS-------------AQAEQSLAFLEEQTPELR------------------------
A0A524PXH8      LDQRI-------------QSVSQGRKFIAKQLDVTK------------------------
A0A4Q3P0E4      VERKA-------------AEAQKTLAFLDVQLPQYK------------------------
A0A3M2BE89      VERKS-------------EEAQKALEFLQGQLPKLK------------------------
A0A4Q4A6K6      DDQQI-------------SELNSRLVAARALTSDSL------------------------
A0A257G674      LQRRF-------------DSSAYARDFISGQLAEAR------------------------
A0A661M5M6      IEDRL-------------ESTDRAKDWLERQLATLR------------------------
A0A1I1UM01      PPLDT-------------RQERLARREAEAEAERQR------------------------
Q44573          LARQT-------------ADINRVATWLDNRTAALRQRWLDAV-----------------
A2W025          VVAKQ-------------AEATKMLDFLKGEEPRLK------------------------
A0A534Z362      EEARR-------------ADDVTAKEFLGRQLRESR------------------------
V4J283          VERKG-------------EEADKTLEFLEKQLPPLK------------------------
A0A536T443      HAVRA-------------SEGPAQGPDGRRITADPTYASY--------------------
A0A0Q4UFQ5      LERRY-------------SATSYARNFLEERLKQLR------------------------
A0A527W7E6      LNASF-------------DATERAAVWLQGRLTELR------------------------
A0A432EMV7      LETQL-------------DETRQAKQWLLSNLDSLR------------------------
A0A7C1SEU7      MDQKL-------------EASQLAREFLTKQIYQSK------------------------
A0A534WLI3      EEARL-------------ASNLSTRDFVDRQLRDAR------------------------
A0A7C6FBW0      VSSKV-------------ENLLRARDVLREQMQSAQ------------------------
A0A087LTV7      LVMPV-------------SYSATALLYFDPSPRGVL------------------------
A0A7D7WSS2      LVMPV-------------SYSATALLYFDPSPRGVL------------------------
A0A318KWA2      VRRQS-------------AEIEQSLAFLEEQAPELR------------------------
A0A522MT86      VAAKQ-------------RNDSSTLAFINKELPRLH------------------------
A0A4Q3I221      YEATR-------------RASGWLQDRIAELRQKALDSDLAVQKFRSSNGLVAAGSVLVA
A0A534SAL6      EEARR-------------ATDVTAKDFLGRQLLESR------------------------
A0A534ZDB4      EEARR-------------ATDVTAKDFLGRQLLESR------------------------
A0A534X3M7      EEARR-------------ANDVTAQEFLGRQLDESR------------------------
A0A534SPC6      EEARR-------------ADDVTAKEFLGRQLRESR------------------------
A0A535AD60      EEARR-------------ADDVTAKEFLGRQLRESR------------------------
A0A4Q3SY08      RQASG-------------LL-------GERLQELQR---QAVADAAAVQQYRIQNDLLST
A0A4Q3LG23      VQATS-------------YGRNLLQRQLGQAKERLDGSQRQLVNYASAEQI---------
A0A522EX52      TVKKN-------------AK-------KKSLEASKS---LEFLHYQLPTVK---------
A0A1H3KC95      DRFAP-------------QE-------------------DPPPPSAESDDV---------
A0A5P8Z4P3      QTSRE-------------ALMALAEDLTAPEDDPER---EAEQETDPDTDDDAAEVQNFW
A0A2E9HXF7      RIAKA-------------AE-------RAKFEEKA----RRKAEFEERAQT---------
A0A0B3RZC9      RIAEA-------------AD-------KAKAREKAQEKLRRRAELEELARA---------
A0A6F8QET1      ---EA-------------AD-------NAKAREKAQEKLRRRAELEELARA---------
A0A520HUH4      DAAKA-------------AR-------IANAVALAY---I--------------------
A0A2K8U7M6      LRAAQ-------------AALADAERRLAAYADEHR---IIDLDGQRTLLL---------
A0A5B9DKL8      AVVRD-------------LGLAVGMPGATAMEREHQ---AIRWLGERIKAQ---------
A0A238KJM1      SVLKS-------------KR-------ESEEEIQAR---LEA------------------
A0A3A0FJZ4      RHRLT-------------SDRALAGIVAALGDAPLA---ALPAAGREGALR---------
W4HJV8          AKASG-------------ET-------PSNRESGPP---DTTSDEPDRGAL---------
A0A0P1GDI0      EQARL-------------EE-------QARQEALAR---KAEADARAKAEAEARAAAEER
A0A2R8ATV5      RQAEE-------------EEARQQAAAQAKADLQRR---KAAAAARRRAEE---------
A0A1U7D3R6      ERTRS-------------ES-------ASDAQEAAR---VAA--------A---------
A0A2D4UVV2      ERTRS-------------ES-------ASDAQEAAR---VAP--------A---------
A0A0W7WHP4      EEARE-------------AE-------EARAAETQR---ATEEQAKRDAEA---------
A0A238J8F6      QRARE-------------EA-------EKTAAEAKR---LAALEAQKMAAE---------
A0A238JQI6      ARRTA-------------EA-------QARAEEKAR---RKA-EFERIARE---------
A0A222E077      RIAKA-------------AE-------RAKFEEKAR---RKA-EFEERAQT---------
A0A239E3Y2      RIAKA-------------AE-------QAKSEEKAR---RKA-EFEERAQV---------
A0A534QGR3      ------------------------------------------------------------
A0A1F9CFF0      ------------------------------------------------------------
A0A2M8B0G5      ------------------------------------------------------------
A0A363TNU9      ------------------------------------------------------------
A0A0W1GMS6      ------------------------------------------------------------
A0A0Q8RMY3      ------------------------------------------------------------
A0A1A7QC21      ------------------------------------------------------------
A0A2W4RFS2      ------------------------------------------------------------
A0A1Y6DC43      ------------------------------------------------------------
A0A2S6HE06      ------------------------------------------------------------
G3J0M3          ------------------------------------------------------------
V5C6R5          ------------------------------------------------------------
A0A534HBS8      ------------------------------------------------------------
A0A0F0T3Y9      ------------------------------------------------------------
A0A379GWF0      ------------------------------------------------------------
A0A4Q2XLV7      ------------------------------------------------------------
A0A4Q5QYC4      ------------------------------------------------------------
A0A3B8SQ27      ------------------------------------------------------------
A0A0U2VAW2      ------------------------------------------------------------
A0A454CTF1      ------------------------------------------------------------
A0A6B3Q2G1      ------------------------------------------------------NEDTFT
A0A4Q6G931      ------------------------------------------------------------
A0A2T0VBD8      ------------------------------------------------------------
A0A378APS2      ------------------------------------------------------------
A0A443VCQ6      ------------------------------------------------------------
A0A447RKQ7      ------------------------------------------------------------
W1DSK1          ------------------------------------------------------------
A0A2N1XK22      ------------------------------------------------------------
A0A3D0KAC8      ------------------------------------------------------------
A0A3D2Y902      ------------------------------------------------------------
A0A378G3G7      ------------------------------------------------------------
A0A2X5NHJ9      ------------------------------------------------------------
A0A2J4QEC3      ------------------------------------------------------------
A0A485ADM3      ------------------------------------------------------------
A0A4U9HGU4      ------------------------------------------------------------
A0A3S4JGG5      ------------------------------------------------------------
A0A377ZDH2      ------------------------------------------------------------
A0A3S4HTS8      ------------------------------------------------------------
A0A1W9F5M9      ------------------------------------------------------------
A0A379W6R2      ------------------------------------------------------------
A0A379TA56      ------------------------------------------------------------
A0A655C5P0      ------------------------------------------------------------
A0A6D0I9G1      ------------------------------------------------------------
A0A352MMI7      ------------------------------------------------------------
A0A4Z0LWV1      ------------------------------------------------------------
A0A377K431      ------------------------------------------------------------
A0A376RY66      ------------------------------------------------------------
A0A778GAM7      ------------------------------------------------------------
A0A3C2BN18      ------------------------------------------------------------
A0A447LR75      ------------------------------------------------------------
A0A759KJJ5      ------------------------------------------------------------
A0A376D8L7      ------------------------------------------------------------
A0A1V2FV46      ------------------------------------------------------------
A0A6N8QLT3      ------------------------------------------------------------
A0A376SB61      ------------------------------------------------------------
A0A3D1BYV9      ------------------------------------------------------------
A0A536T0W8      ------------------------------------------------------------
A0A3D2M6Y9      ------------------------------------------------------------
A0A3D2YAZ2      ------------------------------------------------------------
A0A350A102      ------------------------------------------------------------
A0A350L5D2      ------------------------------------------------------------
A0A2G9XLE5      ------------------------------------------------------------
A0A6L3MM74      ------------------------------------------------------------
A0A7C3QM04      ------------------------------------------------------------
A0A7I8MVM0      ------------------------------------------------------------
A0A7C0Y3J7      ------------------------------------------------------------
A0A7C3LF61      ------------------------------------------------------------
A0A4R1HDF2      ------------------------------------------------------------
A0A6N1DL48      ------------------------------------------------------------
A0A1V6FYJ1      ------------------------------------------------------------
A0A0C5VQ86      ------------------------------------------------------------
A0A0Q6QV61      ------------------------------------------------------------
A0A2Z3IKG4      ------------------------------------------------------------
A0A3N5RNY4      ------------------------------------------------------------
A0A4Z0M4C7      ------------------------------------------------------------
A0A5Q2QDL1      ------------------------------------------------------------
A0A1V8MBH1      ------------------------------------------------------------
A0A6J4X8D4      ------------------------------------------------------------
A0A318CT66      ------------------------------------------------------------
A0A3N5P205      ------------------------------------------------------------
A0A443K010      ------------------------------------------------------------
A0A6I7NYG5      ------------------------------------------------------------
A0A212AR83      ------------------------------------------------------------
A0A2E2P4I0      ------------------------------------------------------------
A0A2U2CM86      ------------------------------------------------------------
A0A1I0R9R6      ------------------------------------------------------------
A0A2N3BVE7      ------------------------------------------------------------
A0A7C2IB02      ------------------------------------------------------------
A0A6N6SI00      ------------------------------------------------------------
A0A2S5JE21      ------------------------------------------------------------
A0A2R8BKZ2      ------------------------------------------------------------
A0A2S8S361      ------------------------------------------------------------
A0A520ZTR8      ------------------------------------------------------------
A0A316GHM6      ------------------------------------------------------------
A0A238IZI1      ------------------------------------------------------------
A0A7C9INT8      ------------------------------------------------------------
A0A6M1UAR9      ------------------------------------------------------------
A0A1X7ACC1      ------------------------------------------------------------
A0A238KUF6      ------------------------------------------------------------
A0A095CTW3      ------------------------------------------------------------
A0A2E3UGD6      ------------------------------------------------------------
A0A2T0RFH0      ------------------------------------------------------------
A0A285D390      ------------------------------------------------------------
A0A497VHN4      ------------------------------------------------------------
A0A2N6BEI9      ------------------------------------------------------------
A0A0D5N3E9      ------------------------------------------------------------
A0A2N2G716      ------------------------------------------------------------
A0A7C1UTU6      ------------------------------------------------------------
W9VVY5          ------------------------------------------------------------
A0A1E2URD3      ------------------------------------------------------------
A0A2T6MY81      ------------------------------------------------------------
A0A2T6NBQ8      ------------------------------------------------------------
A0A421K431      ------------------------------------------------------------
A0A2G2I5M1      ------------------------------------------------------------
A0A2G2M6F0      ------------------------------------------------------------
A0A1W9J9F8      ------------------------------------------------------------
A0A2S5LFJ9      ------------------------------------------------------------
A0A2D8R8F8      ------------------------------------------------------------
A0A6I4JXQ8      ------------------------------------------------------------
A0A010SNS0      ------------------------------------------------------------
A0A0C2I782      ------------------------------------------------------------
A0A2N8BYF5      ------------------------------------------------------------
A0A558FKX2      ------------------------------------------------------------
A0A1H1DBA0      ------------------------------------------------------------
J2TAD5          ------------------------------------------------------------
J3H699          ------------------------------------------------------------
A0A1H5J974      ------------------------------------------------------------
A0A0K1QRZ4      ------------------------------------------------------------
A0A560RJW9      ------------------------------------------------------------
A0A5E6TID7      ------------------------------------------------------------
A0A5E7CRU7      ------------------------------------------------------------
A0A5E7C564      ------------------------------------------------------------
A0A2W7MAV4      ------------------------------------------------------------
A0A4R3WQH5      ------------------------------------------------------------
W6VFG3          ------------------------------------------------------------
A0A1P8ENT1      ------------------------------------------------------------
A0A2N7XRV4      ------------------------------------------------------------
A0A0Q6QPG8      ------------------------------------------------------------
A0A0F4SWA7      ------------------------------------------------------------
A0A423J219      ------------------------------------------------------------
A0A4P6G9U8      ------------------------------------------------------------
A0A4Y8JE06      ------------------------------------------------------------
A0A502I1X9      ------------------------------------------------------------
A0A502J776      ------------------------------------------------------------
A0A5B0EZF6      ------------------------------------------------------------
A0A059L434      ------------------------------------------------------------
A0A0F4UWN2      ------------------------------------------------------------
A0A5E7WEF5      ------------------------------------------------------------
A0A1G0KSD0      ------------------------------------------------------------
A0A4P6WX84      ------------------------------------------------------------
A0A1D2S760      ------------------------------------------------------------
A0A5B8RW94      ------------------------------------------------------------
A0A258TN88      ------------------------------------------------------------
A0A1F9EUS2      ------------------------------------------------------------
A0A6H9HII8      ------------------------------------------------------------
A0A3N9VAW3      ------------------------------------------------------------
A0A1X0YE57      ------------------------------------------------------------
A0A2K2H9Q8      ------------------------------------------------------------
A0A6I1KNW9      ------------------------------------------------------------
A0A1H4B8T3      ------------------------------------------------------------
A0A1E7IQC3      ------------------------------------------------------------
A0A1M6KEN5      ------------------------------------------------------------
A0A353QLL3      ------------------------------------------------------------
A0A399I453      ------------------------------------------------------------
A0A651FBV9      ------------------------------------------------------------
A0A5C1MDH8      ------------------------------------------------------------
A0A7J4ZSX4      ------------------------------------------------------------
A0A5A9XE04      ------------------------------------------------------------
A0A643G9R1      ------------------------------------------------------------
A0A1G0M8Q7      ------------------------------------------------------------
A0A353MI14      ------------------------------------------------------------
A0A4S1CAW7      ------------------------------------------------------------
A0A562VHD2      ------------------------------------------------------------
A0A7K0J0R7      ------------------------------------------------------------
A0A6I6JNB5      ------------------------------------------------------------
A0A1G0LDK7      ------------------------------------------------------------
A0A6F9WVL7      ------------------------------------------------------------
A0A351Z9A2      ------------------------------------------------------------
A0A3N5FRH4      ------------------------------------------------------------
A0A1V4Y2C3      ------------------------------------------------------------
A0A2N2KTJ4      ------------------------------------------------------------
A0A2N2LQX0      ------------------------------------------------------------
A0A318D3U4      ------------------------------------------------------------
A0A401FQP5      ------------------------------------------------------------
A0A7C2AA26      ------------------------------------------------------------
A0A351Z4H9      ------------------------------------------------------------
A0A2N2KML4      ------------------------------------------------------------
E1YJF1          ------------------------------------------------------------
A0A1J5EVZ6      ------------------------------------------------------------
A0A2G6FCC5      ------------------------------------------------------------
A0A1F9MR25      ------------------------------------------------------------
A0A2G6M7F1      ------------------------------------------------------------
A0A7C3Q9R6      ------------------------------------------------------------
A0A1Q6DMW3      ------------------------------------------------------------
A0A3A6P8F8      ------------------------------------------------------------
A0A6L4AM84      ------------------------------------------------------------
A0A2G2DSM4      ------------------------------------------------------------
A0A1F9NI02      ------------------------------------------------------------
A0A4U1ABX4      ------------------------------------------------------------
A0A1W9M770      ------------------------------------------------------------
A0A1W9M7R6      ------------------------------------------------------------
A0A1M7Y300      ------------------------------------------------------------
A0A4U1ALN4      ------------------------------------------------------------
A0A1E7H876      ------------------------------------------------------------
A0A7C0U459      ------------------------------------------------------------
A0A0F2NF69      ------------------------------------------------------------
A0A1F9NFD0      ------------------------------------------------------------
A0A1M5YLH5      ------------------------------------------------------------
A0A4U1A4C7      ------------------------------------------------------------
A0A509L3P8      ------------------------------------------------------------
A0A3A4S038      ------------------------------------------------------------
A0A1F9N669      ------------------------------------------------------------
A0A1F9PFA7      ------------------------------------------------------------
A0A1H2EN09      ------------------------------------------------------------
K0NP00          ------------------------------------------------------------
A0A7C4N0I9      ------------------------------------------------------------
A0A1E7JCL5      ------------------------------------------------------------
A0A496YAH9      ------------------------------------------------------------
A0A1V4S7E4      ------------------------------------------------------------
A0A2N2H8D2      ------------------------------------------------------------
A0A2N2KC63      ------------------------------------------------------------
A0A3A4ZYW4      ------------------------------------------------------------
A0A1V4MCJ4      ------------------------------------------------------------
A0A661M0W4      ------------------------------------------------------------
A0A4U8YLL7      ------------------------------------------------------------
A0A445MZQ4      ------------------------------------------------------------
A0A2M7WWF7      ------------------------------------------------------------
A0A0M9E0E3      ------------------------------------------------------------
A0A4Q3IRI1      ------------------------------------------------------------
A0A7C1C6X5      ------------------------------------------------------------
A0A354EF47      ------------------------------------------------------------
A0A2G6MSP7      ------------------------------------------------------------
B7RS54          ------------------------------------------------------------
A0A1I6ENM4      ------------------------------------------------------------
A8LNM8          ------------------------------------------------------------
A0A0T5NSU3      ------------------------------------------------------------
A0A5P9I718      ------------------------------------------------------------
A0A2M8J3R9      ------------------------------------------------------------
A0A1I6X762      ------------------------------------------------------------
A0A0P1EFX8      ------------------------------------------------------------
A0A2G5KB39      ------------------------------------------------------------
A0A2N3CNV1      ------------------------------------------------------------
A0A257F1F4      ------------------------------------------------------------
A0A2D5J8T8      ------------------------------------------------------------
A0A2E3P9W6      ------------------------------------------------------------
A0A2G2B1P9      ------------------------------------------------------------
A0A258GCD5      ------------------------------------------------------------
A0A443INY4      ------------------------------------------------------------
A0A2D9YR88      ------------------------------------------------------------
A0A4Q3ZBK4      ------------------------------------------------------------
A0A1G9FY29      ------------------------------------------------------------
A0A6N9RUN2      ------------------------------------------------------------
A0A1G8QZS5      ------------------------------------------------------------
A0A1H2Y469      ------------------------------------------------------------
A0A497ZQU7      ------------------------------------------------------------
A0A4U8YMP3      ------------------------------------------------------------
A0A1Q8QQ99      ------------------------------------------------------------
A0A7C2SIB2      ------------------------------------------------------------
A0A3D5ZY44      ------------------------------------------------------------
A0A1G5C236      ------------------------------------------------------------
A0A432HIS7      ------------------------------------------------------------
A0A520CSP5      ------------------------------------------------------------
A0A372IH36      ------------------------------------------------------------
A0A540VW45      ------------------------------------------------------------
A0A1H9C241      ------------------------------------------------------------
A0A2E3FCR1      ------------------------------------------------------------
A0A4S3MG69      ------------------------------------------------------------
A0A3E0H727      ------------------------------------------------------------
A0A1I3TTC3      ------------------------------------------------------------
A0A1H3IZW6      ------------------------------------------------------------
A0A0M6YG59      ------------------------------------------------------------
A0A1H7G8B0      ------------------------------------------------------------
A0A7C3Z8T7      ------------------------------------------------------------
A0A1V4QMH7      ------------------------------------------------------------
A0A496XZQ4      ------------------------------------------------------------
A0A7C3UZM2      ------------------------------------------------------------
A0A1F9BJF7      ------------------------------------------------------------
F2NDF5          ------------------------------------------------------------
A0A656PSQ6      ------------------------------------------------------------
A0A4Q3ZDI7      ------------------------------------------------------------
A0A537PRC6      ------------------------------------------------------------
A0A1I3XJ27      ------------------------------------------------------------
A0A562CGU2      ------------------------------------------------------------
A0A7C9VCB3      ------------------------------------------------------------
A0A1I7DCG1      ------------------------------------------------------------
A0A3A3H6D9      ------------------------------------------------------------
A0A0Q6VA36      ------------------------------------------------------------
A0A1B2EQN1      ------------------------------------------------------------
A0A1E7HSL6      ------------------------------------------------------------
A0A2M7JX59      ------------------------------------------------------------
A0A3A4XVN3      ------------------------------------------------------------
A0A1E7JEV6      ------------------------------------------------------------
A0A2N2KDY5      ------------------------------------------------------------
A0A3N5YUD9      ------------------------------------------------------------
A0A0W1DLQ3      ------------------------------------------------------------
A0A246JVD8      ------------------------------------------------------------
A0A2N3BB54      ------------------------------------------------------------
A0A1H6G7A3      ------------------------------------------------------------
A0A0A7PGL6      ------------------------------------------------------------
A0A4Q2Z4L0      ------------------------------------------------------------
A0A5C4N0H6      ------------------------------------------------------------
A0A1V4M8I1      ------------------------------------------------------------
A0A7C0XE92      ------------------------------------------------------------
A0A1E7HFN0      ------------------------------------------------------------
A0A7J0BHG1      ------------------------------------------------------------
A0A1M5GH86      ------------------------------------------------------------
A0A1W1XQZ5      ------------------------------------------------------------
A0A6V8LMJ3      ------------------------------------------------------------
A0A2K8WHP8      ------------------------------------------------------------
A0A1J5N774      ------------------------------------------------------------
A0A2C8F781      ------------------------------------------------------------
A0A2E3R6G0      ------------------------------------------------------------
A0A7J0BUD3      ------------------------------------------------------------
A0A1F8XMK2      ------------------------------------------------------------
A0A3M8EMP2      ------------------------------------------------------------
A0A2J6J6K6      ------------------------------------------------------------
A0A661PSB9      ------------------------------------------------------------
A0A661QBT6      ------------------------------------------------------------
A0A6I2SLK2      ------------------------------------------------------------
A0A0A8WSG4      ------------------------------------------------------------
S7TK97          ------------------------------------------------------------
S7UE93          ------------------------------------------------------------
A0A3D5BR56      ------------------------------------------------------------
A0A2N2IB15      ------------------------------------------------------------
A0A1I3PSR2      ------------------------------------------------------------
A0A1I4GEK4      ------------------------------------------------------------
A0A7C8B5M6      ------------------------------------------------------------
A0A1W7QPT7      ------------------------------------------------------------
A0A6S6M1Y8      ------------------------------------------------------------
A0A6V8MCR2      ------------------------------------------------------------
A0A6V8N3X1      ------------------------------------------------------------
A0A6M4XJ81      ------------------------------------------------------------
A0A0M4D373      ------------------------------------------------------------
A0A1L3GKM9      ------------------------------------------------------------
A0A2T5R3J5      ------------------------------------------------------------
A0A1G6EKK9      ------------------------------------------------------------
A0A7C1DJX8      ------------------------------------------------------------
A0A3D6C3I2      ------------------------------------------------------------
S0G1D4          ------------------------------------------------------------
A0A661T246      ------------------------------------------------------------
A0A2G6CSG7      ------------------------------------------------------------
A0A2G6NB59      ------------------------------------------------------------
A0A5K8A7T9      ------------------------------------------------------------
A0A1W9U045      ------------------------------------------------------------
A0A1F9L9G4      ------------------------------------------------------------
A0A328FD76      ------------------------------------------------------------
A0A348UX90      ------------------------------------------------------------
A0A357Z0N5      ------------------------------------------------------------
A0A0F2R2U0      ------------------------------------------------------------
A0A5K7ZK00      ------------------------------------------------------------
A0A5K7YCX8      ------------------------------------------------------------
A0A5K7Z388      ------------------------------------------------------------
A0A352B502      ------------------------------------------------------------
A0A410V446      ------------------------------------------------------------
A0A0R3KGJ5      ------------------------------------------------------------
A0A0R3N604      ------------------------------------------------------------
A0A1B1UCM8      ------------------------------------------------------------
A0A1N6JQ20      ------------------------------------------------------------
A0A1M5TI07      ------------------------------------------------------------
A3X191          ------------------------------------------------------------
A0A1H4RKV5      ------------------------------------------------------------
A0A160UA87      ------------------------------------------------------------
A0A1Q5SFV5      ------------------------------------------------------------
A0A7C3Y7G3      ------------------------------------------------------------
A0A430DNP0      ------------------------------------------------------------
A0A3A0FQ32      ------------------------------------------------------------
A0A1E4UZA0      ------------------------------------------------------------
A0A1H9KL56      ------------------------------------------------------------
A0A1A9KEF8      ------------------------------------------------------------
A0A5E6PKN5      ------------------------------------------------------------
A0A0N9W1V6      ------------------------------------------------------------
A0A423GQ41      ------------------------------------------------------------
A0A423H7J2      ------------------------------------------------------------
A0A502HNM8      ------------------------------------------------------------
A0A4Q7H223      ------------------------------------------------------------
A0A1H4N2K9      ------------------------------------------------------------
A0A2K4KWF7      ------------------------------------------------------------
A0A3E0WXH2      ------------------------------------------------------------
A0A2N2TRC8      ------------------------------------------------------------
A0A1V4CIZ7      ------------------------------------------------------------
A0A1M3BXA5      ------------------------------------------------------------
A0A1Y2R3U6      ------------------------------------------------------------
A0A167HVD6      ------------------------------------------------------------
A0A1V3SCT6      ------------------------------------------------------------
L0H287          ------------------------------------------------------------
A0A495VG93      ------------------------------------------------------------
A0A4R3MYM4      ------------------------------------------------------------
G2E3C0          ------------------------------------------------------------
                                                                            

E1Y9C0          ------------------------------------------------------------
A0A1N6SH58      ------------------------------------------------------------
A0A4Q3AQN2      ------------------------------------------------------------
A0A1W9HS52      SRLTEIERAVEINRHMEKHTESELKKIKENIVNPQLSSSELFLSQNQHRMELLQ------
A0A2D5LFD8      --LTELENFRKQNLLID--ASTEALKIEANLSS--TEQSLLSLQNTRRNLEQVRKQVAAG
A0A4D8PLT4      RDLTERVNQWLGGRLIE--AREAVRGAEEAIRSFRKENSLLELPPDGRNMVQQQMNELAT
A0A7J5VV32      ------------------------------------------------------------
A0A6G6X2Z4      ------------------------------------------------------------
Q44570          ------------------------------------------------------------
A0A3N5MZ53      ------------------------------------------------------------
A0A534E4H4      ------------------------------------------------------------
A0A534I2B6      ------------------------------------------------------------
A0A1C2JGD0      ------------------------------------------------------------
A0A259LQ70      ------------------------------------------------------------
A0A4V2SPR5      ------------------------------------------------------------
A0A3N5PM86      ------------------------------------------------------------
A0A2E5YSA4      ------------------------------------------------------------
A0A0N0XAV4      ------------------------------------------------------------
A0A0P9QD19      ------------------------------------------------------------
F3FHG4          ------------------------------------------------------------
F3GGI0          -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A0P9LE74      ------------------------------------------------------------
A0A3M4ZQ14      -------------------AQKANRILEEVSHLYVRQNVERSSAEAAQRLEFLRSQLPAV
A0A3M5YLE8      -------------------AQKANRILEEVSHLYVRQNVERSSAEAAQRLEFLRSQLPAV
A0A3M3RP89      -------------------AQKANRILEEVSHLYVRQNVERSSAEAAQRLEFLRSQLPAV
A0A0P9QIY7      -------------------AQKANRILEEVSHLYVRQNVERSSAEAAQRLEFLRSQLPAV
A0A0P9VVH7      -------------------AQKANRILEEVSHLYVRQNVERSSAEAAQRLEFLRSQLPAV
A0A0Q0FJK6      -------------------AQKANRILEEVSHLYVRQNVERSSAEAAQRLEFLRSQLPAV
A0A0Q0G2J0      -------------------AQKANRILEEVSHLYVRQNVERSSAEAAQRLEFLRSQLPAV
A0A3M3LF66      -------------------AQKANRILEEVSHLYVRQNVERSSAEAAQRLEFLRSQLPAV
A0A0P9WIR8      -------------------AQKANRILEEVSHLYVRQNVERSSAEAAQRLEFLRSQLPAV
A0A3M3KPE5      -------------------AQKANRILEEVSHLYVRQNVERSSAEAAQRLEFLRSQLPAV
A0A3M4C263      -------------------AQKANRILEEVSHLYVRQNVERSSAEAAQRLEFLRSQLPAV
A0A3M5AD05      -------------------AQKANRILEEVSHLYVRQNVERSSAEAAQRLEFLRSQLPAV
A0A0Q0D3D2      -------------------AQRANRILDEVSHIYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A0N0FS39      --------------------------------------------------------MPAV
A0A3M6GHH2      ------------------------------------------------------------
A0A0P9R9W0      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A0Q0B9T0      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A3M6CFI7      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A0P9JXN0      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A3M6FIV7      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A3M3PLW9      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A3M4ENY1      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A3M5EZK7      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A0P9SPP5      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A658KL17      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A3M3NNF2      -------------------AQRANRILDGVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A3M4A0E8      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A3M4PBZ2      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A3M6AI26      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A0P9IWP8      -------------------AQRANRILDEVSHIYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A0P9KZ49      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A0P9V840      -------------------AQRANRILDGVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A0Q0AIE5      -------------------AQRANRILDGVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A3M2ZQH6      -------------------AQRANRILDGVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A0N8SQG2      -------------------AQRANRILDGVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A0W8HFU1      -------------------AQRANRILDGVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A3M5M873      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A0P9VHH8      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A0P9YV98      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A3M3G2W8      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A3M6C224      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A3M5K254      -------------------AQRANQILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A3M5JFB0      -------------------AQRANQILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A3M3TQV3      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A3M3EF92      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A3M5J1E2      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A3M5G7H9      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A3M4A376      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A0Q0A5T8      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A0P9SCD7      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A0P9T4G3      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A0P9VKB0      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A0Q0BM35      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A3M3TPR7      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A3M3U4Q3      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A0P9UCX7      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A0P9S1F1      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A0P9QCJ2      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A0P9Q329      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A3M5GJ64      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A0P9MPC7      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A3M2XYQ3      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A0P9XCE1      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A3M3EFX7      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A3M5B9D9      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A0P9RRZ3      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A3M2VEK7      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A0N8R9B3      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A0P9VA27      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A3M4YBJ4      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A0P9J470      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A0Q0EVJ8      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A3M5UI30      -------------------AQRANRILDGVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A3M5YQT8      -------------------AQRANQILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A3M5F5X1      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A3M5R8G1      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A3M5V012      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A3M3GA16      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A3M3UCT3      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A3M3CJL0      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A3M3F6F5      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A3M3P9B7      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A0N8QB74      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A0Q0AUD0      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A3M5VR55      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A0Q0FK97      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A3M5KZ75      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A3M5L3G5      -------------------AQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAV
A0A519ERR1      ------------------------------------------------------------
A0A4Q3Q1M2      ------------------------------------------------------------
A0A4Q3MHR1      ------------------------------------------------------------
A0A520GDZ4      ------------------------------------------------------------
A0A318DSU0      ------------------------------------------------------------
A0A538PF21      ------------------------------------------------------------
A0A1W1ZH10      ------------------------------------------------------------
A0A1W2FF24      ------------------------------------------------------------
A0A524JYQ6      ------------------------------------------------------------
A0A4Q3MA17      ------------------------------------------------------------
A0A0N0M5F7      ------------------------------------------------------------
A0A537M754      ------------------------------------------------------------
A0A1V1PDB4      ------------------------------------------------------------
A0A2M7C324      ------------------------------------------------------------
A0A4Q3HHG6      ------------------------------------------------------------
A0A3B7DTA4      ------------------------------------------------------------
A0A432ZK62      ------------------------------------------------------------
A0A1V5EEP4      ------------------------------------------------------------
A0A1V5EF48      ------------------------------------------------------------
A0A0S6X1X6      ------------------------------------------------------------
A0A537Y5L8      ------------------------------------------------------------
A0A4Q3L2X2      ------------------------------------------------------------
A0A4Q3T8J1      ------------------------------------------------------------
A0A4Q4ANM4      ------------------------------------------------------------
A0A4Q3UEC7      ------------------------------------------------------------
A0A1H5YYQ4      ------------------------------------------------------------
A0A1X4NLK2      ------------------------------------------------------------
A0A1X4NWB5      ------------------------------------------------------------
A0A1M5UQ38      ------------------------------------------------------------
A0A327YI48      ------------------------------------------------------------
A0A1B1PNL6      ------------------------------------------------------------
A0A2U8H9H9      ------------------------------------------------------------
A0A6B2NBB8      ------------------------------------------------------------
A0A1X6YIC0      ------------------------------------------------------------
A0A1I5E9E9      ------------------------------------------------------------
A0A1X6Z7N7      ------------------------------------------------------------
A0A2E1DQ13      ------------------------------------------------------------
A0A1H8C800      ------------------------------------------------------------
A0A2N3EZ05      ------------------------------------------------------------
A0A655R819      ------------------------------------------------------------
A0A655RNN3      ------------------------------------------------------------
A0A0R0BVC7      ------------------------------------------------------------
A0A3N5J7U8      ------------------------------------------------------------
A0A1S7S3I8      ------------------------------------------------------------
A0A519E8D7      ------------------------------------------------------------
A0A3S1FD32      ------------------------------------------------------------
A0A434DUT4      ------------------------------------------------------------
A0A528D3U3      ------------------------------------------------------------
A0A3S3UPT3      ------------------------------------------------------------
A0A3S1E286      ------------------------------------------------------------
A0A531AC71      ------------------------------------------------------------
A0A436K268      ------------------------------------------------------------
A0A434IDQ0      ------------------------------------------------------------
A0A435IRM5      ------------------------------------------------------------
A0A3S2C404      ------------------------------------------------------------
A0A435F6C0      ------------------------------------------------------------
A0A435BMN6      ------------------------------------------------------------
A0A529XQ54      ------------------------------------------------------------
A0A530BJC1      ------------------------------------------------------------
A0A348SRI7      ------------------------------------------------------------
A0A354EI73      ------------------------------------------------------------
A0A4P7EP83      ------------------------------------------------------------
A0A6I1QB25      ------------------------------------------------------------
A0A655ZZQ1      ------------------------------------------------------------
A0A1S0ZAI3      ------------------------------------------------------------
A0A3A4NIE9      ------------------------------------------------------------
A0A3A4NUI9      ------------------------------------------------------------
A0A524I3Z6      ------------------------------------------------------------
A0A524PCL7      ------------------------------------------------------------
A0A356GQV1      ------------------------------------------------------------
A0A1J5DAY8      ------------------------------------------------------------
A0A524P237      ------------------------------------------------------------
A0A3C0L0A8      ------------------------------------------------------------
A0A176S762      ------------------------------------------------------------
A0A377ZC40      ------------------------------------------------------------
A0A378BPJ7      ------------------------------------------------------------
A0A2J5PAJ7      ------------------------------------------------------------
A0A377ZDN3      ------------------------------------------------------------
A0A7A9Y5Q1      ------------------------------------------------------------
A0A1G3JY11      ------------------------------------------------------------
A0A661N3U1      ------------------------------------------------------------
A0A1W9WUD9      ------------------------------------------------------------
A0A1W1ZQK0      ------------------------------------------------------------
A0A6I1R304      ------------------------------------------------------------
A0A1W9PMU6      ------------------------------------------------------------
A0A3S1WTQ1      ------------------------------------------------------------
A0A530CUR9      ------------------------------------------------------------
A0A6L6H5T1      ------------------------------------------------------------
A0A6D0ELN7      ------------------------------------------------------------
A0A1M6N1X5      ------------------------------------------------------------
A0A561M3U0      --------MLKKQLEDAEVRYTLLRNKRGSVDLTEEAKI---------------------
A0A2N6BZD5      ------------------------------------------------------------
A0A1G3VVY5      ------------------------------------------------------------
A0A7C3S273      ------------------------------------------------------------
A0A7C4WJ18      ------------------------------------------------------------
A0A7C3V565      ------------------------------------------------------------
A0A351B422      ------------------------------------------------------------
F2NEE9          ------------------------------------------------------------
A0A2W5J775      ------------------------------------------------------------
A0A352Q5C1      ------------------------------------------------------------
A0A435NNF5      ------------------------------------------------------------
A0A3S2AQS7      ------------------------------------------------------------
A0A436XH86      ------------------------------------------------------------
A0A527ZPD6      ------------------------------------------------------------
A0A529KRW3      ------------------------------------------------------------
A0A530ZLX0      ------------------------------------------------------------
A0A355TB56      ------------------------------------------------------------
A0A1F9E324      ------------------------------------------------------------
A0A432SAI6      ------------------------------------------------------------
A0A4Q3LBH4      ------------------------------------------------------------
A0A4Q3LWP3      ------------------------------------------------------------
A0A7C3JPP4      ------------------------------------------------------------
A0A534V9L7      ------------------------------------------------------------
A0A7C3JJT4      ------------------------------------------------------------
A0A2N6VGL1      ------------------------------------------------------------
A0A3M3H5V6      ------------------------------------------------------------
A0A524M660      ------------------------------------------------------------
A0A7C3JSX5      ------------------------------------------------------------
A0A7I8MQ67      ------------------------------------------------------------
A0A0C1TRU6      ------------------------------------------------------------
A0A2Z5SSF4      ------------------------------------------------------------
A0A2T4ZJZ6      ----------KEQMEASIVALNEYKNQKGSVNLDIETQN---------------------
A0A0B8PTA8      ------------------------------------------------------------
A0A0B8QF75      ------------------------------------------------------------
A0A6P2T4F7      ------------------------------------------------------------
A0A4Q4CIB1      ------------------------------------------------------------
A0A522ACJ9      ------------------------------------------------------------
A0A1T2KYM8      ------------------------------------------------------------
A0A3N5Z7F8      ------------------------------------------------------------
A0A239HD34      ------------------------------------------------------------
A0A2G9ZR82      ------------------------------------------------------------
A0A4U9I390      ------------------------------------------------------------
A0A0P7ZZE4      ------------------------------------------------------------
A0A369R0Q9      ------------------------------------------------------------
A0A327LYE6      ------------------------------------------------------------
A0A5A9ZTV3      ------------------------------------------------------------
A0A6J4YZ98      ------------------------------------------------------------
A0A2X3M011      ------------------------------------------------------------
I2WC85          ------------------------------------------------------------
A0A7A9K1G5      ----------------------------------------NIARQAAQDSQSLEFLQRQL
A0A7B7KSB7      ----------------------------------------NIARQAAQDSQSLEFLQRQL
A0A400JH80      --------------------------TRILNSIANNYLQQNIARQAAQDSQSLEFLQRQL
A0A479JNB1      ------------------------------------------------------------
A0A5C9AF52      ------------------------------------------------------------
A0A797FC39      ------------------------------------------------------------
A0A797FHC1      ------------------------------------------------------------
D8EEU7          ------------------------------------------------------------
A0A6D0EYC7      ------------------------------------------------------------
A0A7A6DHB0      ------------------------------------------------------------
A0A2H9EHM4      ------------------------------------------------------------
A0A7A5MLK0      ------------------------------------------------------------
A0A380B3D7      ------------------------------------------------------------
F5NSX0          ------------------------------------------------------------
A0A534XP85      ------------------------------------------------------------
A0A0P1H2H0      ------------------------------------------------------------
A0A258WKV0      -----------GKIGLSGAARNQFIT----------------------------------
A0A377N8F8      ------------------------------------------------------------
A5G4N9          ------------------------------------------------------------
A0A3C2DSE7      ------------------------------------------------------------
A0A2X1JBG5      ------------------------------------------------------------
A0A377LY04      -----------HVWDDAENKLNAFRQDKDSVDLPLEAKS---------------------
A0A5C9ABR5      ------------------------------------------------------------
A0A5J9WU72      ------------------------------------------------------------
A0A2X3K9R3      ------------------------------MDLPLEAKA---------------------
A0A3T9EHW9      ------------------------------------------------------------
A0A484X141      --------------------MNAFRQDKDSVDLPLEAKA---------------------
A0A5N9VWI6      -----------SRLDVAENKLNAFRQDKDSVDLPLEAKA---------------------
A0A6D0EJQ0      ------------------------------------------------------------
A0A444R390      ------------------------------------------------------------
A0A376LLF8      ------------------------------------------------------------
A0A6L7CT21      ------------------------------------------------------------
A0A4Q3LR91      ------------------------------------------------------------
A0A6C9IKN8      ------------------------------------------------------------
A0A4V1TR68      ------------------------------------------------------------
A0A444IY46      ------------------------------------------------------------
A0A6I7N627      ------------------------------------------------------------
A0A6L3ZR06      ------------------------------------------------------------
A0A3E0WKI3      ------------------------------------------------------------
A0A1H3I2J1      -----------RSFSRTPRKALSREARQQLISDMLDEE----------------------
A0A1V5DJV0      ------------------------------------------------------------
A0A520IUC4      ------------------------------------------------------------
A0A521LJG5      ------------------------------------------------------------
A0A531IBQ7      ------------------------------------------------------------
A0A0P1FWI8      ------------------------------------------------------------
A0A6L8LHC6      ------------------------------------------------------------
A0A1V4WHZ7      ------------------------------------------------------------
A0A1E5AJN5      -----------QQLTSAERELNDYAKSISFTDLEEQPAILASRLSAVNDALNAAVQDRLE
A0A2N3D2J1      ------------------------------------------------------------
A0A2N2GVE1      -----------KKLDEDEKRLYEFKLKNNILAVSLEARI-----QSTTGLILSRSNSVET
A0A2N2INV3      -----------KKLDEDEKRLYDFKLKNNILAVSLEARI-----QSTTGLILSRSNAVET
A0A233IKJ2      -----------EKLKESEVQLQTFLKSEGLVDIQGVESLASQELEELTSQLNKTRDRRVA
A0A1Y5DXG5      -----------KQLEVSEALFNDYQKNQKSVNISLETQG---------------------
A0A0B8P2H5      -----------AELTANEDALNKYRQDNESVDLGLEAQS---------------------
A0A380AQW6      ------------------------------------------------------------
A0A2G2GD62      -----------KTLSKSEKVLQGFKQKNNLLSLDIKAAMVSKNVEKIGTEISSLSSEESI
A0A3R9C3P5      -----------ARADTARDAARNYQESMDIVSKEDAQDERIKSLLELTGREGKIEESRVE
A0A0M3GBT1      -----------ARADTAREAARSYQESMDVISKEDAQDERLKSLIELTGREGKIEETRVE
B3Q577          -----------ARADTAREAARSYQESMDVISKEDAQDERLKSLIELTGREGKIEETRVE
A0A483QWI8      -----------ADLDVAEDKLNQYRRQKDSVDLSLEAKS---------------------
A0A483UXD3      -----------ADLDVAEDKLNQYRRQKDSVDLSLEAKS---------------------
A0A0A8J8L3      -----------AELDQAEDKLNVYRKQKDSVDLSMEAKT---------------------
A0A660DJ38      -----------ADLDIAEDKLNSYRKEKDSVDLSMEAKS---------------------
A0A524P331      -----------EELDRAEQNLQTYKSTSGMIKLDAEAEELVRKLSGIEKERAAVAMQRNQ
A0A4V1SSM5      ------------------------------------------------------------
A0A4Q3K8G7      ------------------------------------------------------------
A0A7C7W7M2      -----------QEWKEAESRLQSYREAENIVTRSSGENEVDEELSSLSNRYFSARENRLR
A0A1M7HC79      -----------AQLADAEERLNQYRVAMDSVDLSSESQA---------------------
A0A1D3JZN6      -----------RDLEKAESALNSFQTRSKSIDISLEAKA---------------------
A0A1V6ESG1      -----------AALSKAEQERVKAESQYREMERSPENSAQVL------------------
A0A1H7YHK3      -----------KQVEAAQAAMNAYQTKAKSVDITMQTKG---------------------
A0A534SH66      ------------------------------------------------------------
A0A3M0ZZ99      ------------------------------------------------------------
A0A238LBD3      ------------------------------------------------------------
A0A328C2K5      -----------EELDQASSELQKYQRDNNILSHSFEDRR-----EMAAEGLASVSEQHRE
A0A5C6X8M3      -----------EELDEARSELQKYQRDNNILSHTFEDRR-----EMAAEGLAAVSTQLRE
A0A3D8MRR7      -----------EELDESRSELQKYQRDNNILSHTFEDRR-----EMAAEGLAAVSTQLRD
A0A5C6UBJ7      -----------EELDESRSELQKYQRDNNILSHTFEDRR-----EMAAEGLAAVSTQLRD
A0A5C6XGM3      -----------EELDESRSELQKYQRDNNILSHTFEDRR-----EMAAEGLAAVSTQLRE
A0A537NZJ1      ------------------------------------------------------------
A0A7C4R3C4      -----------NRPKEQEPPPLAPEAALEASDFAALAGYDP-------------------
A0A0P1FRV5      ------------------------------------------------------------
A0A4Q4CVW6      ------------------------------------------------------------
A0A090R136      -----------SQLTIAEDLLNAYRQENESIDLGLEAKS---------------------
A0A661JU93      ------------------------------------------------------------
A0A2E2T3V8      -----------KRLETVEQRHADWEKSSGNIADRERELILERIYDLNAELDTAFQEREAA
A0A367UAB4      -----------KRLETVEQRHADWEKSSGNIADRERELILERIYDLNAELDTAFQEKEAA
A0A1F2ZW35      -----------RNLQVAEEAVAAYRRDKGLAGSPEGAIS--------TQTLSELNTRYTA
A0A377V641      -----------SDLDSAEDKLNDFRKRNDSVDLSLEAKS---------------------
A0A1F2YJ88      -----------QQLDVAEREFNKFRQQYNTVDVTKESEL---------------------
A0A6L3ZWI0      -----------GRLDTENRS----------------------------------------
A0A5N8AL61      -----------DDVIAANRDVAQYRSSANLVSSGDDVAGQQALAGLNSQYATARAESAAA
A0A0J7XGZ1      -----------KHAVADDATLQQYMIRNNLMSAEGATMA--------EQEVSELNRQIAD
I4CBA7          -----------ERMRKSQEELVNFAREHGMVLLDDEPELESSLLETAGKTFLDIRNERLN
A3VE95          -----------ATVEAAEAALAEYRSDALTREGGTYETSTQQLGNLSSQLVVARSERVTA
A0A1G0NL95      -----------ARLETAEDALNRYRLASSSADLEIETQG---------------------
A0A024KA69      --------------DGPTYLVSVRANAPSPIEAASYANAVANSFI---------------
A0A0L1KFN4      -----------DRLDESQRQLVTYASNQEIINLPSQSVGDGSTTQERSIVVDNLAALNAA
A0A3P5DSS6      -----------NDLDLAEDKLNEYRRKSDSVDLSLEAKS---------------------
A0A483YEL5      -----------TELNESEDKLNAYRRQKDSVDLSLEAKS---------------------
A0A658GUJ0      -----------TELNESEDKLNAYRRQKDSVDLSLEAKS---------------------
A0A358L616      -----------GKLDEAEDKLNTYRRNNESVDMSLEAKS---------------------
A0A1M7BLL7      -----------MKLSRYEAHMRRRAARRDALENPHSHSPDQEDI----------------
A0A0H4KZM1      ------------------------------------------------------------
A0A3D5UYX7      -----------ASLAEAQAKYNRARQLRAQ------------------------------
A0A2N1WQN5      ------------------------------------------------------------
A0A352G2C2      -----------KKLEAAQTALNKYQTGSGSVDITAETQS---------------------
A0A3C0PZN1      -----------RNLEAAQTALNKYQTGSRSVDITAETQS---------------------
A0A524QFS4      -----------GALNEMEQRILGFKRTHPLETLEARRDA---------------------
A0A520JSW4      -----------RDLERSERQLTAYAQAQRLISTSSSDEGGDTNSLTGSSLVALNTALATT
A0A1V1UJT2      -----------MNLSRHDAYMRRREARRAAEEAGEMPEPVYEESC---------------
A0A0L6CVX1      ------------------------------------------------------------
A0A1V0RR48      ------------------------------------------------------------
A0A0A0HJJ4      -----------MTLKRHEEYMRRRAARRAEMEA----------EA---------------
A0A5E7YA28      -----------MSLTRHEEYMRRRAARRAALEA----------EA---------------
A0A4Q3LTF3      -----------ARYEQAGRAGASTEAL---------------------------------
A0A7C3N3Y1      -----------AKVERADEALQAFGSKHDILSLEEKENITMQRLADLNEALAKAEADRMA
A0A537UTP9      -----------VQATNAERAVEDFKAKNNIVAASGRLMNEQQLSELNTSLIQARALTAET
A0A1D2RNR5      ------------------------------------------------------------
A0A4V1TQ46      ------------------------------------------------------------
A0A3A0FZC0      -----------EKVADLERELADYAEANSIVAVNKDENITAQKMSQLNRLLTDATAKRIE
A0A1N7JVZ7      -----------PPLASDEPAPHPETSREALLAFAEDLAFPDLTVEDDAPPARSEKPTPEA
A0A091C4A8      -----------IQLEDSESRLVEFAQRERIVDAIDGSSLSTQSLSELNSTLAAAQDQRIR
A0A4R3H6P6      -----------EKLEVSERDVVAYAAQQGIINLPSPIDPNTGGAAGGGGRSLLTDDLIAL
A0A3S1NQ09      -----------QSSQAASLAVEKFRAEHGLAANSDGQLMSDKQLSDLNAQLIVAQADTAR
A0A443GJ52      -----------ESSQAAALAVEKFRAEHGLAVN-DGQLISDKKLGDLNGQLIEAQADTAR
A0A6N3RE79      ------------------------------------------------------------
A0A6N9S3L5      ------------------------------------------------------------
A0A656BWB0      ------------------------------------------------------------
A0A6D0IFH4      ------------------------------------------------------------
A0A7A3MK38      ------------------------------------------------------------
A0A0A0FHV8      ------------------------------------------------------------
A0A1X3IPU7      ------------------------------------------------------------
A0A0A0G0N2      ------------------------------------------------------------
A0A2I8SDU4      ------------------------------------------------------------
A0A2I8SU55      ------------------------------------------------------------
A0A7I6T806      ------------------------------------------------------------
A0A7I6TQE9      ------------------------------------------------------------
A0A7I6U296      ------------------------------------------------------------
S1EXJ6          ------------------------------------------------------------
A0A376UBS1      ------------------------------------------------------------
A0A2W6S588      -----------QQALEADAAVAAYRLKHNILTDPNATLPDNELSNIGVQLSDARGAAAQA
A0A483E0N4      -----------SDLDIAEDKLNQYRRKNDSVDLSLEAKS---------------------
A0A2J4YQQ6      -----------SDLDQAEDKLNQYRRQSDSVDLSLEAKS---------------------
A0A483THX4      -----------SELDFAEDKLNLYRQQNDSVDLSLEAKS---------------------
A0A534MVS2      -----------LALCKGDQRVEVFYREGMIEAVSSNVDLHRLGHYLVKEGWLQS------
A0A444I5K6      -----------QQALDTDLAVQKFRSEHGLVEAGSGTLISDQQLSEINTQLINAQAETAK
A0A154VE85      -----------EEAAAAQQRLDAYRRETGMLEIGGGSIYRDQLTQVNAQLVAARGSRTEA
A0A3S1MCW7      ------------------------------------------------------------
A0A434IGN6      -----------------------------------------------NTALATAIQERLD
A0A528AX40      -----------QKLQESEENLVAYAKDVGITITGDDKSLIGSNIEALNTALATAIQERLD
A0A528MV95      -----------QKLQKSEEDLVAYAKDVGITITGDEKSLIGSNIETLNTALATAIQERLD
A0A3C1S9Y1      -----------KKVETAENALLQYKQEQGIITGFSNDAEKITAEKLAKLNNQVVEFESKR
A0A353EH49      -----------EQLDAAENAYNKYRVQHGSIDLGAETTG---------------------
A0A1Y1Q9C1      -----------QRLTLQEAKLIEYAKQNNILEVNNSQSSQERKLDELYSALGEAERARIQ
A0A3M7LJH0      -----------TELDSAEDVLNRYRQANDSIDLSLEAKS---------------------
A0A316KRG4      -----------APVDTPDHRPSNAQKP---------------------------------
A0A1E4JHX8      -----------ERLEESERVLVAYASDEKIINLPAAGATRDGPTVERSIVADDLASLNAE
M2U8P2          -----------TDLQDAETQVANYRARTNLVDIKDDSTAAQQILSQLGAELAQAEAEQAV
A0A1H7KZF8      -----------TRLSESERRANDYARRAAIIAVPARKNQRTDATLTSDTLDRVNQQLSDA
A0A0J5Q9T7      -----------SPLETRAERQARRTAERIRAN----------------------------
A0A6N3UC48      -----------RQLEAAEQALNAYQAKAGSVDITLETQA---------------------
A0A257NG76      -----------EQLEAATTALNDYRTRHGSIDLDLETQS---------------------
A0A1T4TW59      -----------DSLEAAEFALTDFLRQEGLIELDDIDELAGTELTNLTIRVSEAKERRVA
A0A1I5YYQ0      -----------AREEDDMRPVAPLERPKDRVPQDAAPPA---------------------
A0A5P9FE62      -----------AREEDDMRPVAPLERPKDRVPQDAAPPA---------------------
A0A1Q3MB35      -----------GRLEDAQRQLVAYAADKQIITLANGQDESGRTDTAETLVSNDLKVLNGA
A0A259LUN7      -----------EEVEEKERRVETFRAETGLLEAQGTTLT--------EQQIAYLTSQRSE
A0A2D7AVL1      -----------AESERIAAYQKYIEAENSPITLDVL------------------------
A0A3B9KZE9      ------------------------------------------------------------
A0A2U0NMP8      -----------TELNESEDKLNAYRRQKDSVDLSLEAKS---------------------
A0A4U9HNE9      -----------ASLNQAENRLNQFRRQNDSVDLSLEAKS---------------------
A0A7C5N053      -----------RDLRASEEKLHDFKEEHDILSVALDDKSSMLLSEMQAYNDALAKVRAEI
A0A2G2CXY6      -----------QELERYEQALNEYQISTQSVDITIETQA---------------------
A0A3M1D4H3      -----------ARLARARAFQGRESVDQVAATTSA-------------------------
A0A7C1A2A2      -----------DALEHADRRLADYKKTSGVIAVSADAKAMIGQLAEYQTQRGAAELRLYN
A0A5C8BYM7      -----------AALAKAEQERFKAESEYEAVRRTPDTARQVL------------------
A0A1J5ICP0      -----------KSLRSSEGRLMSFKEKEKLVSLSDDARATLQQLMNFDTELKQAEGLRKQ
A0A379B9V4      -----------QKLSDSENRLNEFRLKNESVDLSLEAKA---------------------
A0A0Q6TS97      -----------EKLEMSERQVVAYAVQQGIINLPSSVDASTSGAAVGGRSLLTDDLIALN
A0A0Q6UYB4      -----------EKLEMSERQVVAYAVQQGIINLPSSVDASTSGAAVGGRSLLTDDLIALN
A0A484XS37      -----------SFLDSAEDKLNRFRQANDSVDLSLEAKS---------------------
W7Q5J0          -----------HQLTTAEERLNRYRAELDSVDLSSEAQA---------------------
A0A654AKT6      -----------GPTQLAETIWGPYATRTYTNFFEIFYFARVSGFSREAGFFSSLLVASLI
A0A7A9JY19      -----------DDLDRAEDKLNSYRKQKDSVDLSLEAKA---------------------
A0A0G9MZA5      -----------QRLEEAERAVIAYATAQGLVSIDVPREDGDSAGTASQTLVATELAAFNS
H0T8B0          -----------KQVQESLQAVQDFKFQNAIILGSQGRLASEVELDKLAKELAKSRAETIQ
A0A5C7N981      -----------VKLEDSEKNLNAFMRKEGIVRPDDKQQSPDAQV---------LGEFTSA
A0A534TV22      ------------------------------------------------------------
A0A351CXR4      -----------VDLKLAENALQDYRTEQGETTTRSLESS---------------------
A0A2N6GLF5      -----------EKLKASEIALQSYREREKLIEVGGVSTLTAQQLQDLGGQLVMAEQRRAT
A0A1W9LJP0      -----------KKVEISENALLNYKEMQGIITNFSNDAENITAEKLAKLNAQVVESESQR
A0A0W1ICB0      -----------DRLEKSERDLVNYAARQGIVRLSEIQGEDGRTRTTQTLASSDLEQLNRL
A0A7C1C8G2      -----------IKLEKSEKELNAYARRTGIISLNSKLNLIMGQLEAVNEALAQAVTARIS
A0A376KYN0      ------------------------------------------------------------
A0A7A9J338      -----------SELDQAEEKLNVYRQQRDSVDLNLEAKA---------------------
A0A377E5P7      -----------SELDQAEEKLNVYRQQRDSVDLNLEAKA---------------------
A0A2X1JB05      -----------SELDQAEEKLNVYRQQRDSVDLNLEAKA---------------------
A0A376RML0      -----------SELDQAEEKLNVYRQQRDSVDLNLEAKA---------------------
A0A6N3QTV2      -----------SELDQAEEKLNVYRQQRDSVDLNLEAKA---------------------
A0A2E0UL88      -----------IELQAARRVMEEYESKVASIEPTLSTKITETADPMIQQLAREKAQVDLE
A0A0T2QIS1      -----------QRLEESERLAVNYAARNDIVLLGRTITPDGRTLVDRTLTSSDLEALNTA
A0A0P7Y1D0      -----------EEVRTDEQAVEMYRAENGLLDTGGSTLTEQQISDLNAQLAIQRAELSAA
A0A542J310      ------------------------------------------------------------
A0A2M7JRZ7      -----------AKVERADEALQAFGSKHDIISLEEKENVTMQRLTELNEVLTKAESERMA
A0A167IR75      -----------ERLDESQRQLVAYASDQEIVNLPSEGGNDGTNTQERPIVVDNLASLNAA
A0A3B8T2U6      -----------NNLIKSEQALNAFYEKEKLVNIDGVIGLASEELQRYTALFVDAQNNLAR
A0A365PWR2      -----------AKLEQSELALNRFQTQAGSVDISLEIEG---------------------
A0A2E9H5Z8      -----------QLLTLRDDELIDFAEGLKL------------------------------
A0A2E2BR79      -----------TQLSSAEDKLNEYRVKMDSVDLDSESQS---------------------
A0A6I4IKZ3      -----------KQLDDAERQFNKFRQQYNTVDVTKESEL---------------------
A0A7H4JZ79      -----------KQLDDAERQFNKFRQQYNTVDVTKESEL---------------------
A0A0Q4Q524      -----------ERLDESQRQLVAYASQERIINLPAQQNGDGTTSERSIVADDLASLNTAL
A0A0Q4CFJ9      -----------ERLDESQRQLVTYASQERIINLPAQSNADGSTAERSIVADDLASLNTAL
A0A0Q4FE58      -----------ERLDESQRQLVGYASQERIINLPAQSNADGSTSERSIVADDLASLNTAL
A0A0Q4JWC8      -----------ERLDESQRQLVGYASQERIINLPAQSNADGSTSERSIVADDLASLNTAL
A0A0Q4KFL8      -----------ERLDESQRQLVGYASQERIINLPAQSNADGSTSERSIVADDLASLNTAL
A0A522R8R0      -----------ARYFQFKAIVDSGPDNAVRNATIPVNKDSGTGT----------------
A0A2U9NDY5      -----------KELEKAEAALHDYQTSAKAVDSSSETKG---------------------
X7F6S5          -----------PPLASREERLARRAEDMSATESR--------------------------
A0A1G8NKI0      -----------PRPDPQAEALAKAQ----AQAEA--------------------------
A0A355QPE4      -----------PRPDPQAEALAKAQAEAEAQAEV--------------------------
A0A357RN98      -----------PRPDPQAEALAKAQAEAEAQAEA--------------------------
A0A1I6U4V1      -----------LPLERREERLARRRADREAE-----------------------------
A0A6B2P8H8      -----------LPLERREERLARRRADRDAE-----------------------------
A0A1P8USW9      -----------EPLESRETRLARRKAETEAAAAAEEAARKAQEDDARRKAEAKRKAEDAR
A0A1G7CFZ2      -----------EPLATRAERLARRETKTSAAQAT-------------RRAEAERVAEAAR
A0A7G2TPW1      -----------EPLGTRAERLARRETKTSAVQAA-------------RRA----------
A0A0Q4IGG1      -----------SRLDDSQRQLVAYASAQQIINLPAQGAGSGGSTTVERSIVADDLAALNA
A0A534RUJ5      -----------ERVEKSEAALNRYRRDKGIISLDDKENIVVARLTDLNARLTDAEAERIG
A0A3M1CJM3      -----------TRMEQAEYQLYEYKRKQHILSVSLEDRQNIISQRLQDLNQTLNKVQAER
A0A2R7SVD4      -----------RDLAKASDALNAYQTHGKTVNISLETQS---------------------
A0A3C0PWB6      -----------KELEKAEAALHDYQTSSKSVDISIETKG---------------------
V4Q8B7          -----------KELEKAEAALNAYQTSSKSVDISIETKG---------------------
A0A0Q8XKK5      -----------TRLETSERDLVNYAAEKGITALGTSKSADGRTEVERTLVSSDLEALNAA
A0A2E0Q2W0      -----------ERLEXSEAALISXANEXGIVVLQRGASGDSEGGGQQTLVETRLSQLNEA
A0A660NIR6      -----------TDLENAEANLQAYREEIGLVATPTSALGGNERQLDNSSDRLIAARVERQ
A0A142W0R3      -----------RNLEDSERELITYAANNDIITLETRSDPGTGRTIGDRTLVAADVEKIST
A0A0S4XR18      -----------DNLSKSQLEIKDFKQSNTVATIPNSASTLLNAMVDIDTQLQQANMKLSV
A0A7C5CFF1      -----------DSFIKSEETIRELKLQQNNIEKSVT------------------------
A0A2E0GW64      -----------TDLNHSEKQLNDYRSQSNILDISAESKM---------------------
A0A1A7QJ97      -----------QRLDESQRQLVTYASNQEIINLPATSEGAQERPIVADNLAALNSALSEA
A0A661LW70      ------------------------------------------------------------
W7Q8F9          -----------SQLTAAEERLNSYRAELDSVDLSSEAQA---------------------
A0A524PXH8      -----------ARLEDSEQLLQQFARGRNIYALEQEELVIHEKLADLNARLTEAESQRIT
A0A4Q3P0E4      -----------KQLEESEEVYNRYRNQKGTVAFDEEAKL---------------------
A0A3M2BE89      -----------AQLETSESRLNDYRLQRGSVDVGLEAEA---------------------
A0A4Q4A6K6      -----------ARLNRFDEVINAIAPDSLSLAGIDTPGSEVL------------------
A0A257G674      -----------AKLEKSERELNAYARQAGLIRDRNPSNTIDKGSTSGSVTTASLLQVNTA
A0A661M5M6      -----------QELDEAELALHNFKKGHNVLSVSMEDRQNLVASDVQTTHAKLTEIRNRR
A0A1I1UM01      -----------EEARQQAEEDARRQAQEDRLRAEEEARRQAEQDR---------------
Q44573          -----------QKANTFDNVHGLTNTSEGSTSTPLIERQIADTSANLSQAEGRLAAAQAR
A2W025          -----------ADLERAEAALTQYQRTSGSINASDEAKVYLEGSVQ--------------
A0A534Z362      -----------DQVDRAEAALSRFAAEHPNVAINEEQKTVAQRIADVSSLLSKAEGARLA
V4J283          -----------ARLEAAESAYNDYLREHGTIDITRETEN---------------------
A0A536T443      -----------VDLQVAIEALARDRAAITQVVAR--------------------------
A0A0Q4UFQ5      -----------IRIDESERALVNYASQQNIVNIPGSTDSNGQTTGERSLVVDDLANLNRE
A0A527W7E6      -----------ESSQAASLAVEKFRAEHGLSANSDGQLLSDKQLADLNAQLIVAQADTAR
A0A432EMV7      -----------EKLSQSEARLREYKDKEGLVDSESFAAQTSDKLGELTSELVKAKAKRAE
A0A7C1SEU7      -----------INLEKVEEELNRFARMSGIVSLDTKLNSVYSQLGELNTALARAEAEMIG
A0A534WLI3      -----------AQVERAEGELDHFATDHPSVAVNQEQRLVAQRTAELSDLLTKAEADRVG
A0A7C6FBW0      -----------LALAMNEADYDRFIAAHLETISDT-------------------------
A0A087LTV7      -----------EDGRPGAGDGARVDSAVDLIASEPVLASAARALGLAGEQAPDWLGSRVK
A0A7D7WSS2      -----------EDGRPGAGDGARVDSAVDLIASEPVLASAARALGLAGEPAPDWLGSRVK
A0A318KWA2      -----------TQLRAAEDSLNEYRAAQHSVDLTSEAQA---------------------
A0A522MT86      -----------AELDKAEQALSSFQTKAQSMQPTSEAQAYLQGGID--------------
A0A4Q3I221      D----------QQLSELNSALIVAQSDTAKAEARLQRIAQIIASGQGDAIVTDVL-----
A0A534SAL6      -----------QQLEKAQDTLGRFAADHPNVAINQEQKTVAQRIGEVSSLLTKVEGTRLN
A0A534ZDB4      -----------QQLEKAQDALGRFAADHPNVAINEEQKTVAQRIGEVSSLLTKVEGTRLN
A0A534X3M7      -----------QQVERGEAALSRFAAEHPNVAVNEEQKTVAQRITDVSSLLTRAEGTRVE
A0A534SPC6      -----------DQVDRAEAALSRFAAEHPNVAINEEQKTVAQRIADVSSLLSKAEGARLA
A0A535AD60      -----------EHAERAEAALSRFAAEHPNVAINEEQKTVAQRISDVSSLLSKAEGTRLA
A0A4Q3SY08      SGATLTEQEISTYNQRVAEARVEAAADQARLNTARQQLATG-------------------
A0A4Q3LG23      -----------INLPAQSNGDGRVTSERSIVADDLATINSALSQAIADRIQAEARFRQVG
A0A522EX52      -----------QSLEVAEMKLNRYRAQSGKLDIKL-------------------------
A0A1H3KC95      -----------PRPRRPRLVRKHRKAVPSAPEERH-------------------------
A0A5P8Z4P3      GSDVDRDEANDEALDTADASTDVADSDVAEMDQDFAPGGHPPKSAQPATVEASDMSEPLA
A0A2E9HXF7      -----------EALRRVKAAREQRAADAMKAREDA-------------------------
A0A0B3RZC9      -----------EALRRVMAARARREAEARKAAERA-------------------------
A0A6F8QET1      -----------EALRRVMAARARREAEAHEAAERA-------------------------
A0A520HUH4      -----------DSTADFQASTATRQTETGQTALLRLSREAEAAAASVARYRADSGIVQGG
A0A2K8U7M6      -----------ERLKALGRQETAAFAAQLAAQTEA-------------------------
A0A5B9DKL8      -----------RRGQTYLISVRASAGDPLMAARLANGVANA-------------------
A0A238KJM1      ----------------------EREAELRRIALERIAARKE-------------------
A0A3A0FJZ4      -----------KHLELEVVDGASPEAAVVRIAFRSPDRALA-----------------LG
W4HJV8          -----------AESEAPPPASVETGVPAGRVNATSLSSDSD-------------------
A0A0P1GDI0      ARIEAEAEQRRERARRAREALARQAAEKQRLAEEQAKAEAEEKARLAAEAEAQAEAARLA
A0A2R8ATV5      -----------RRAAEEQARQAAEAAEERAQAKAAALARQK-------------------
A0A1U7D3R6      -----------RRAERAREAMAQRKAEEARLAEEQ---RQA-------------------
A0A2D4UVV2      -----------RRAERAREAMAQRKAEEARLAEEQ---RQA-------------------
A0A0W7WHP4      -----------Q-----RAADAKRAADAKRAAEEQ-------------------------
A0A238J8F6      -----------EARQKAFAEERAREAERVKAAEQAEKDRQR-------------------
A0A238JQI6      -----------EALRRVAAARARREAEARQKAEAEAAEKAR-------------------
A0A222E077      -----------EALRRVKAAREQRAADAMKAREDA-------------------------
A0A239E3Y2      -----------EALRRVKAAREQRAADALKASEDA-------------------------
A0A534QGR3      ------------------------------------------------------------
A0A1F9CFF0      ------------------------------------------------------------
A0A2M8B0G5      ------------------------------------------------------------
A0A363TNU9      ------------------------------------------------------------
A0A0W1GMS6      ------------------------------------------------------------
A0A0Q8RMY3      ------------------------------------------------------------
A0A1A7QC21      ------------------------------------------------------------
A0A2W4RFS2      ------------------------------------------------------------
A0A1Y6DC43      ------------------------------------------------------------
A0A2S6HE06      ------------------------------------------------------------
G3J0M3          ------------------------------------------------------------
V5C6R5          ------------------------------------------------------------
A0A534HBS8      ------------------------------------------------------------
A0A0F0T3Y9      ------------------------------------------------------------
A0A379GWF0      ------------------------------------------------------------
A0A4Q2XLV7      ------------------------------------------------------------
A0A4Q5QYC4      ------------------------------------------------------------
A0A3B8SQ27      ------------------------------------------------------------
A0A0U2VAW2      ------------------------------------------------------------
A0A454CTF1      ------------------------------------------------------------
A0A6B3Q2G1      ISKISKLDAINKLASQLSISERGSQTGIVSLSIEGEYPDHNQLVLNDVVQNYFLQNVRRN
A0A4Q6G931      ------------------------------------------------------------
A0A2T0VBD8      ------------------------------------------------------------
A0A378APS2      ------------------------------------------------------------
A0A443VCQ6      ------------------------------------------------------------
A0A447RKQ7      ------------------------------------------------------------
W1DSK1          ------------------------------------------------------------
A0A2N1XK22      ------------------------------------------------------------
A0A3D0KAC8      ------------------------------------------------------------
A0A3D2Y902      ------------------------------------------------------------
A0A378G3G7      ------------------------------------------------------------
A0A2X5NHJ9      ------------------------------------------------------------
A0A2J4QEC3      ------------------------------------------------------------
A0A485ADM3      ------------------------------------------------------------
A0A4U9HGU4      ------------------------------------------------------------
A0A3S4JGG5      ------------------------------------------------------------
A0A377ZDH2      ------------------------------------------------------------
A0A3S4HTS8      ------------------------------------------------------------
A0A1W9F5M9      ------------------------------------------------------------
A0A379W6R2      ------------------------------------------------------------
A0A379TA56      ------------------------------------------------------------
A0A655C5P0      ------------------------------------------------------------
A0A6D0I9G1      ------------------------------------------------------------
A0A352MMI7      ------------------------------------------------------------
A0A4Z0LWV1      ------------------------------------------------------------
A0A377K431      ------------------------------------------------------------
A0A376RY66      ------------------------------------------------------------
A0A778GAM7      ------------------------------------------------------------
A0A3C2BN18      ------------------------------------------------------------
A0A447LR75      ------------------------------------------------------------
A0A759KJJ5      ------------------------------------------------------------
A0A376D8L7      ------------------------------------------------------------
A0A1V2FV46      ------------------------------------------------------------
A0A6N8QLT3      ------------------------------------------------------------
A0A376SB61      ------------------------------------------------------------
A0A3D1BYV9      ------------------------------------------------------------
A0A536T0W8      ------------------------------------------------------------
A0A3D2M6Y9      ------------------------------------------------------------
A0A3D2YAZ2      ------------------------------------------------------------
A0A350A102      ------------------------------------------------------------
A0A350L5D2      ------------------------------------------------------------
A0A2G9XLE5      ------------------------------------------------------------
A0A6L3MM74      ------------------------------------------------------------
A0A7C3QM04      ------------------------------------------------------------
A0A7I8MVM0      ------------------------------------------------------------
A0A7C0Y3J7      ------------------------------------------------------------
A0A7C3LF61      ------------------------------------------------------------
A0A4R1HDF2      ------------------------------------------------------------
A0A6N1DL48      ------------------------------------------------------------
A0A1V6FYJ1      ------------------------------------------------------------
A0A0C5VQ86      ------------------------------------------------------------
A0A0Q6QV61      ------------------------------------------------------------
A0A2Z3IKG4      ------------------------------------------------------------
A0A3N5RNY4      ------------------------------------------------------------
A0A4Z0M4C7      ------------------------------------------------------------
A0A5Q2QDL1      ------------------------------------------------------------
A0A1V8MBH1      ------------------------------------------------------------
A0A6J4X8D4      ------------------------------------------------------------
A0A318CT66      ------------------------------------------------------------
A0A3N5P205      ------------------------------------------------------------
A0A443K010      ------------------------------------------------------------
A0A6I7NYG5      ------------------------------------------------------------
A0A212AR83      ------------------------------------------------------------
A0A2E2P4I0      ------------------------------------------------------------
A0A2U2CM86      ------------------------------------------------------------
A0A1I0R9R6      ------------------------------------------------------------
A0A2N3BVE7      ------------------------------------------------------------
A0A7C2IB02      ------------------------------------------------------------
A0A6N6SI00      ------------------------------------------------------------
A0A2S5JE21      ------------------------------------------------------------
A0A2R8BKZ2      ------------------------------------------------------------
A0A2S8S361      ------------------------------------------------------------
A0A520ZTR8      ------------------------------------------------------------
A0A316GHM6      ------------------------------------------------------------
A0A238IZI1      ------------------------------------------------------------
A0A7C9INT8      ------------------------------------------------------------
A0A6M1UAR9      ------------------------------------------------------------
A0A1X7ACC1      ------------------------------------------------------------
A0A238KUF6      ------------------------------------------------------------
A0A095CTW3      ------------------------------------------------------------
A0A2E3UGD6      ------------------------------------------------------------
A0A2T0RFH0      ------------------------------------------------------------
A0A285D390      ------------------------------------------------------------
A0A497VHN4      ------------------------------------------------------------
A0A2N6BEI9      ------------------------------------------------------------
A0A0D5N3E9      ------------------------------------------------------------
A0A2N2G716      ------------------------------------------------------------
A0A7C1UTU6      ------------------------------------------------------------
W9VVY5          ------------------------------------------------------------
A0A1E2URD3      ------------------------------------------------------------
A0A2T6MY81      ------------------------------------------------------------
A0A2T6NBQ8      ------------------------------------------------------------
A0A421K431      ------------------------------------------------------------
A0A2G2I5M1      ------------------------------------------------------------
A0A2G2M6F0      ------------------------------------------------------------
A0A1W9J9F8      ------------------------------------------------------------
A0A2S5LFJ9      ------------------------------------------------------------
A0A2D8R8F8      ------------------------------------------------------------
A0A6I4JXQ8      ------------------------------------------------------------
A0A010SNS0      ------------------------------------------------------------
A0A0C2I782      ------------------------------------------------------------
A0A2N8BYF5      ------------------------------------------------------------
A0A558FKX2      ------------------------------------------------------------
A0A1H1DBA0      ------------------------------------------------------------
J2TAD5          ------------------------------------------------------------
J3H699          ------------------------------------------------------------
A0A1H5J974      ------------------------------------------------------------
A0A0K1QRZ4      ------------------------------------------------------------
A0A560RJW9      ------------------------------------------------------------
A0A5E6TID7      ------------------------------------------------------------
A0A5E7CRU7      ------------------------------------------------------------
A0A5E7C564      ------------------------------------------------------------
A0A2W7MAV4      ------------------------------------------------------------
A0A4R3WQH5      ------------------------------------------------------------
W6VFG3          ------------------------------------------------------------
A0A1P8ENT1      ------------------------------------------------------------
A0A2N7XRV4      ------------------------------------------------------------
A0A0Q6QPG8      ------------------------------------------------------------
A0A0F4SWA7      ------------------------------------------------------------
A0A423J219      ------------------------------------------------------------
A0A4P6G9U8      ------------------------------------------------------------
A0A4Y8JE06      ------------------------------------------------------------
A0A502I1X9      ------------------------------------------------------------
A0A502J776      ------------------------------------------------------------
A0A5B0EZF6      ------------------------------------------------------------
A0A059L434      ------------------------------------------------------------
A0A0F4UWN2      ------------------------------------------------------------
A0A5E7WEF5      ------------------------------------------------------------
A0A1G0KSD0      ------------------------------------------------------------
A0A4P6WX84      ------------------------------------------------------------
A0A1D2S760      ------------------------------------------------------------
A0A5B8RW94      ------------------------------------------------------------
A0A258TN88      ------------------------------------------------------------
A0A1F9EUS2      ------------------------------------------------------------
A0A6H9HII8      ------------------------------------------------------------
A0A3N9VAW3      ------------------------------------------------------------
A0A1X0YE57      ------------------------------------------------------------
A0A2K2H9Q8      ------------------------------------------------------------
A0A6I1KNW9      ------------------------------------------------------------
A0A1H4B8T3      ------------------------------------------------------------
A0A1E7IQC3      ------------------------------------------------------------
A0A1M6KEN5      ------------------------------------------------------------
A0A353QLL3      ------------------------------------------------------------
A0A399I453      ------------------------------------------------------------
A0A651FBV9      ------------------------------------------------------------
A0A5C1MDH8      ------------------------------------------------------------
A0A7J4ZSX4      ------------------------------------------------------------
A0A5A9XE04      ------------------------------------------------------------
A0A643G9R1      ------------------------------------------------------------
A0A1G0M8Q7      ------------------------------------------------------------
A0A353MI14      ------------------------------------------------------------
A0A4S1CAW7      ------------------------------------------------------------
A0A562VHD2      ------------------------------------------------------------
A0A7K0J0R7      ------------------------------------------------------------
A0A6I6JNB5      ------------------------------------------------------------
A0A1G0LDK7      ------------------------------------------------------------
A0A6F9WVL7      ------------------------------------------------------------
A0A351Z9A2      ------------------------------------------------------------
A0A3N5FRH4      ------------------------------------------------------------
A0A1V4Y2C3      ------------------------------------------------------------
A0A2N2KTJ4      ------------------------------------------------------------
A0A2N2LQX0      ------------------------------------------------------------
A0A318D3U4      ------------------------------------------------------------
A0A401FQP5      ------------------------------------------------------------
A0A7C2AA26      ------------------------------------------------------------
A0A351Z4H9      ------------------------------------------------------------
A0A2N2KML4      ------------------------------------------------------------
E1YJF1          ------------------------------------------------------------
A0A1J5EVZ6      ------------------------------------------------------------
A0A2G6FCC5      ------------------------------------------------------------
A0A1F9MR25      ------------------------------------------------------------
A0A2G6M7F1      ------------------------------------------------------------
A0A7C3Q9R6      ------------------------------------------------------------
A0A1Q6DMW3      ------------------------------------------------------------
A0A3A6P8F8      ------------------------------------------------------------
A0A6L4AM84      ------------------------------------------------------------
A0A2G2DSM4      ------------------------------------------------------------
A0A1F9NI02      ------------------------------------------------------------
A0A4U1ABX4      ------------------------------------------------------------
A0A1W9M770      ------------------------------------------------------------
A0A1W9M7R6      ------------------------------------------------------------
A0A1M7Y300      ------------------------------------------------------------
A0A4U1ALN4      ------------------------------------------------------------
A0A1E7H876      ------------------------------------------------------------
A0A7C0U459      ------------------------------------------------------------
A0A0F2NF69      ------------------------------------------------------------
A0A1F9NFD0      ------------------------------------------------------------
A0A1M5YLH5      ------------------------------------------------------------
A0A4U1A4C7      ------------------------------------------------------------
A0A509L3P8      ------------------------------------------------------------
A0A3A4S038      ------------------------------------------------------------
A0A1F9N669      ------------------------------------------------------------
A0A1F9PFA7      ------------------------------------------------------------
A0A1H2EN09      ------------------------------------------------------------
K0NP00          ------------------------------------------------------------
A0A7C4N0I9      ------------------------------------------------------------
A0A1E7JCL5      ------------------------------------------------------------
A0A496YAH9      ------------------------------------------------------------
A0A1V4S7E4      ------------------------------------------------------------
A0A2N2H8D2      ------------------------------------------------------------
A0A2N2KC63      ------------------------------------------------------------
A0A3A4ZYW4      ------------------------------------------------------------
A0A1V4MCJ4      ------------------------------------------------------------
A0A661M0W4      ------------------------------------------------------------
A0A4U8YLL7      ------------------------------------------------------------
A0A445MZQ4      ------------------------------------------------------------
A0A2M7WWF7      ------------------------------------------------------------
A0A0M9E0E3      ------------------------------------------------------------
A0A4Q3IRI1      ------------------------------------------------------------
A0A7C1C6X5      ------------------------------------------------------------
A0A354EF47      ------------------------------------------------------------
A0A2G6MSP7      ------------------------------------------------------------
B7RS54          ------------------------------------------------------------
A0A1I6ENM4      ------------------------------------------------------------
A8LNM8          ------------------------------------------------------------
A0A0T5NSU3      ------------------------------------------------------------
A0A5P9I718      ------------------------------------------------------------
A0A2M8J3R9      ------------------------------------------------------------
A0A1I6X762      ------------------------------------------------------------
A0A0P1EFX8      ------------------------------------------------------------
A0A2G5KB39      ------------------------------------------------------------
A0A2N3CNV1      ------------------------------------------------------------
A0A257F1F4      ------------------------------------------------------------
A0A2D5J8T8      ------------------------------------------------------------
A0A2E3P9W6      ------------------------------------------------------------
A0A2G2B1P9      ------------------------------------------------------------
A0A258GCD5      ------------------------------------------------------------
A0A443INY4      ------------------------------------------------------------
A0A2D9YR88      ------------------------------------------------------------
A0A4Q3ZBK4      ------------------------------------------------------------
A0A1G9FY29      ------------------------------------------------------------
A0A6N9RUN2      ------------------------------------------------------------
A0A1G8QZS5      ------------------------------------------------------------
A0A1H2Y469      ------------------------------------------------------------
A0A497ZQU7      ------------------------------------------------------------
A0A4U8YMP3      ------------------------------------------------------------
A0A1Q8QQ99      ------------------------------------------------------------
A0A7C2SIB2      ------------------------------------------------------------
A0A3D5ZY44      ------------------------------------------------------------
A0A1G5C236      ------------------------------------------------------------
A0A432HIS7      ------------------------------------------------------------
A0A520CSP5      ------------------------------------------------------------
A0A372IH36      ------------------------------------------------------------
A0A540VW45      ------------------------------------------------------------
A0A1H9C241      ------------------------------------------------------------
A0A2E3FCR1      ------------------------------------------------------------
A0A4S3MG69      ------------------------------------------------------------
A0A3E0H727      ------------------------------------------------------------
A0A1I3TTC3      ------------------------------------------------------------
A0A1H3IZW6      ------------------------------------------------------------
A0A0M6YG59      ------------------------------------------------------------
A0A1H7G8B0      ------------------------------------------------------------
A0A7C3Z8T7      ------------------------------------------------------------
A0A1V4QMH7      ------------------------------------------------------------
A0A496XZQ4      ------------------------------------------------------------
A0A7C3UZM2      ------------------------------------------------------------
A0A1F9BJF7      ------------------------------------------------------------
F2NDF5          ------------------------------------------------------------
A0A656PSQ6      ------------------------------------------------------------
A0A4Q3ZDI7      ------------------------------------------------------------
A0A537PRC6      ------------------------------------------------------------
A0A1I3XJ27      ------------------------------------------------------------
A0A562CGU2      ------------------------------------------------------------
A0A7C9VCB3      ------------------------------------------------------------
A0A1I7DCG1      ------------------------------------------------------------
A0A3A3H6D9      ------------------------------------------------------------
A0A0Q6VA36      ------------------------------------------------------------
A0A1B2EQN1      ------------------------------------------------------------
A0A1E7HSL6      ------------------------------------------------------------
A0A2M7JX59      ------------------------------------------------------------
A0A3A4XVN3      ------------------------------------------------------------
A0A1E7JEV6      ------------------------------------------------------------
A0A2N2KDY5      ------------------------------------------------------------
A0A3N5YUD9      ------------------------------------------------------------
A0A0W1DLQ3      ------------------------------------------------------------
A0A246JVD8      ------------------------------------------------------------
A0A2N3BB54      ------------------------------------------------------------
A0A1H6G7A3      ------------------------------------------------------------
A0A0A7PGL6      ------------------------------------------------------------
A0A4Q2Z4L0      ------------------------------------------------------------
A0A5C4N0H6      ------------------------------------------------------------
A0A1V4M8I1      ------------------------------------------------------------
A0A7C0XE92      ------------------------------------------------------------
A0A1E7HFN0      ------------------------------------------------------------
A0A7J0BHG1      ------------------------------------------------------------
A0A1M5GH86      ------------------------------------------------------------
A0A1W1XQZ5      ------------------------------------------------------------
A0A6V8LMJ3      ------------------------------------------------------------
A0A2K8WHP8      ------------------------------------------------------------
A0A1J5N774      ------------------------------------------------------------
A0A2C8F781      ------------------------------------------------------------
A0A2E3R6G0      ------------------------------------------------------------
A0A7J0BUD3      ------------------------------------------------------------
A0A1F8XMK2      ------------------------------------------------------------
A0A3M8EMP2      ------------------------------------------------------------
A0A2J6J6K6      ------------------------------------------------------------
A0A661PSB9      ------------------------------------------------------------
A0A661QBT6      ------------------------------------------------------------
A0A6I2SLK2      ------------------------------------------------------------
A0A0A8WSG4      ------------------------------------------------------------
S7TK97          ------------------------------------------------------------
S7UE93          ------------------------------------------------------------
A0A3D5BR56      ------------------------------------------------------------
A0A2N2IB15      ------------------------------------------------------------
A0A1I3PSR2      ------------------------------------------------------------
A0A1I4GEK4      ------------------------------------------------------------
A0A7C8B5M6      ------------------------------------------------------------
A0A1W7QPT7      ------------------------------------------------------------
A0A6S6M1Y8      ------------------------------------------------------------
A0A6V8MCR2      ------------------------------------------------------------
A0A6V8N3X1      ------------------------------------------------------------
A0A6M4XJ81      ------------------------------------------------------------
A0A0M4D373      ------------------------------------------------------------
A0A1L3GKM9      ------------------------------------------------------------
A0A2T5R3J5      ------------------------------------------------------------
A0A1G6EKK9      ------------------------------------------------------------
A0A7C1DJX8      ------------------------------------------------------------
A0A3D6C3I2      ------------------------------------------------------------
S0G1D4          ------------------------------------------------------------
A0A661T246      ------------------------------------------------------------
A0A2G6CSG7      ------------------------------------------------------------
A0A2G6NB59      ------------------------------------------------------------
A0A5K8A7T9      ------------------------------------------------------------
A0A1W9U045      ------------------------------------------------------------
A0A1F9L9G4      ------------------------------------------------------------
A0A328FD76      ------------------------------------------------------------
A0A348UX90      ------------------------------------------------------------
A0A357Z0N5      ------------------------------------------------------------
A0A0F2R2U0      ------------------------------------------------------------
A0A5K7ZK00      ------------------------------------------------------------
A0A5K7YCX8      ------------------------------------------------------------
A0A5K7Z388      ------------------------------------------------------------
A0A352B502      ------------------------------------------------------------
A0A410V446      ------------------------------------------------------------
A0A0R3KGJ5      ------------------------------------------------------------
A0A0R3N604      ------------------------------------------------------------
A0A1B1UCM8      ------------------------------------------------------------
A0A1N6JQ20      ------------------------------------------------------------
A0A1M5TI07      ------------------------------------------------------------
A3X191          ------------------------------------------------------------
A0A1H4RKV5      ------------------------------------------------------------
A0A160UA87      ------------------------------------------------------------
A0A1Q5SFV5      ------------------------------------------------------------
A0A7C3Y7G3      ------------------------------------------------------------
A0A430DNP0      ------------------------------------------------------------
A0A3A0FQ32      ------------------------------------------------------------
A0A1E4UZA0      ------------------------------------------------------------
A0A1H9KL56      ------------------------------------------------------------
A0A1A9KEF8      ------------------------------------------------------------
A0A5E6PKN5      ------------------------------------------------------------
A0A0N9W1V6      ------------------------------------------------------------
A0A423GQ41      ------------------------------------------------------------
A0A423H7J2      ------------------------------------------------------------
A0A502HNM8      ------------------------------------------------------------
A0A4Q7H223      ------------------------------------------------------------
A0A1H4N2K9      ------------------------------------------------------------
A0A2K4KWF7      ------------------------------------------------------------
A0A3E0WXH2      ------------------------------------------------------------
A0A2N2TRC8      ------------------------------------------------------------
A0A1V4CIZ7      ------------------------------------------------------------
A0A1M3BXA5      ------------------------------------------------------------
A0A1Y2R3U6      ------------------------------------------------------------
A0A167HVD6      ------------------------------------------------------------
A0A1V3SCT6      ------------------------------------------------------------
L0H287          ------------------------------------------------------------
A0A495VG93      ------------------------------------------------------------
A0A4R3MYM4      ------------------------------------------------------------
G2E3C0          ------------------------------------------------------------
                                                                            

E1Y9C0          ------------------------------------------------------------
A0A1N6SH58      ------------------------------------------------------------
A0A4Q3AQN2      ------------------------------------------------------------
A0A1W9HS52      ------YQKALLENDTSPDSKTRKDEIQSELDTV-AQNLQKAIQEADQSGNLTFVSPQEY
A0A2D5LFD8      NLNSFDFQGSIISGGGASTSGTTETAGSSLSGSIGISGIDSXLEEELTTLKEALYEARSI
A0A4D8PLT4      QLTAAQAQKAAAEARVRQAREQTAANNAAAIPEVLASPLIQKLREAEAMLERRLAELQQV
A0A7J5VV32      ------------------------------------------------------------
A0A6G6X2Z4      ------------------------------------------------------------
Q44570          ------------------------------------------------------------
A0A3N5MZ53      ------------------------------------------------------------
A0A534E4H4      ------------------------------------------------------------
A0A534I2B6      --------------------------------MI------AAQNELAQATENLNNQARSV
A0A1C2JGD0      ------------------------------------------------------------
A0A259LQ70      ------------------------------------------------------------
A0A4V2SPR5      ------------------------------------------------------------
A0A3N5PM86      -------------------MVRLSAAMKGINEKI------AQ-------------EVKKI
A0A2E5YSA4      ------------------------------------------------------------
A0A0N0XAV4      ------------------------------------------------------------
A0A0P9QD19      -----------------------------------------------------------M
F3FHG4          -------------------------------------------------MKLKRVELERL
F3GGI0          RKQLEESETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLKRVELERL
A0A0P9LE74      -----------------VRGAD--------------------------------------
A0A3M4ZQ14      RKQLEESEVALNNFQTSAKSVDLSIETKGVLDQV------VSLDATLSELKLKRVELERL
A0A3M5YLE8      RKQLEESEVALNNFQTSAKSVDLSIETKGVLDQV------VSLDATLSELKLKRVELERL
A0A3M3RP89      RKQLEESEVALNNFQTSAKSVDLSIETKGVLDQV------VSLDATLSELKLKRVELERL
A0A0P9QIY7      RKQLEESEVALNNFQTSAKSVDLSIETKGVLDQV------VSLDATLSELKLKRVELERL
A0A0P9VVH7      RKQLEESEVALNNFQTSAKSVDLSIETKGVLDQV------VSLDATLSELKLKRVELERL
A0A0Q0FJK6      RKQLEESEVALNNFQTSAKSVDLSIETKGVLDQV------VSLDATLSELKLKRVELERL
A0A0Q0G2J0      RKQLEESEVALNNFQTSAKSVDLSIETKGVLDQV------VSLDATLSELKLKRVELERL
A0A3M3LF66      RKQLEESEVALNNFQTSAKSVDLSIETKGVLDQV------VSLDATLSELKLKRVELERL
A0A0P9WIR8      RKQLEESEVALNNFQTSAKSVDLSIETKGVLDQV------VSLDATLSELKLKRVELERL
A0A3M3KPE5      RKQLEESEVALNNFQTSAKSVDLSIETKGVLDQV------VSLDATLSELKLKRVELERL
A0A3M4C263      RKQLEESEVALNNFQTSAKSVDLSIETKGVLDQV------VSLDATLSELKLKRVELERL
A0A3M5AD05      RKQLEESEVALNNFQTSAKSVDLSIETKGVLDQV------VSLDATLSELKLKRVELERL
A0A0Q0D3D2      RKQLEDAETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLRRVELERL
A0A0N0FS39      RKQLEDAETALNNFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLRRVELERL
A0A3M6GHH2      --------------------MDLSIETKGVLDQV------VSLDSMLSELKLRRVELERL
A0A0P9R9W0      RKQLEESEAALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLRRVELERL
A0A0Q0B9T0      RKQLEESEAALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLRRVELERL
A0A3M6CFI7      RKQLEESEAALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLRRVELERL
A0A0P9JXN0      RKQLEESEAALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLRRVELERL
A0A3M6FIV7      RKQLEESEAALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLRRVELERL
A0A3M3PLW9      RKQLEESETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLKRVELERL
A0A3M4ENY1      RKQLEESETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLKRVELERL
A0A3M5EZK7      RKQLEESETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLKRVELERL
A0A0P9SPP5      RKQLEDAETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLRRVELERL
A0A658KL17      RKQLEDAETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLRRVELERL
A0A3M3NNF2      RKQLEDAETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLRRVELERL
A0A3M4A0E8      RKQLEDAETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLRRVELERL
A0A3M4PBZ2      RKQLEDAETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLRRVELERL
A0A3M6AI26      RKQLEDAETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLRRVELERL
A0A0P9IWP8      RKQLEDAETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLRRVELERL
A0A0P9KZ49      RKQLEDAETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLRRVELERL
A0A0P9V840      RKQLEDAETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLRRVELERL
A0A0Q0AIE5      RKQLEDAETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLRRVELERL
A0A3M2ZQH6      RKQLEDAETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLRRVELERL
A0A0N8SQG2      RKQLEDAETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLRRVELERL
A0A0W8HFU1      RKQLEDAETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLRRVELERL
A0A3M5M873      RKQLEDAETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLRRVELERL
A0A0P9VHH8      RKQLEDAETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLRRLELERL
A0A0P9YV98      RKQLEDAETALNNFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLRRVELERL
A0A3M3G2W8      RKQLEDAETALNNFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLRRVELERL
A0A3M6C224      RKQLEDAETALNNFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLRRVELERL
A0A3M5K254      RKQLEDAETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLRRVELERL
A0A3M5JFB0      RKQLEDAETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLRRVELERL
A0A3M3TQV3      RKQLEEAETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLRRVELERL
A0A3M3EF92      RKQLEEAETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLRRVELERL
A0A3M5J1E2      RKQLEEAETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLRRVELERL
A0A3M5G7H9      RKQLEDAETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLRRVELERL
A0A3M4A376      RKQLEEAETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLRRVELERL
A0A0Q0A5T8      RKQLEEAETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLKRVELERL
A0A0P9SCD7      RKQLEDAETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLRRVELERL
A0A0P9T4G3      RKQLEDAETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLRRVELERL
A0A0P9VKB0      RKQLEDAETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLRRVELERL
A0A0Q0BM35      RKQLEDAETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLRRVELERL
A0A3M3TPR7      RKQLEDAETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLRRVELERL
A0A3M3U4Q3      RKQLEDAETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLRRVELERL
A0A0P9UCX7      RKQLEDAETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLRRVELERL
A0A0P9S1F1      RKQLEDAETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLRRVELERL
A0A0P9QCJ2      RKQLEEAETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLRRVELERL
A0A0P9Q329      RKQLEDAETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLRRVELERL
A0A3M5GJ64      RKQLEDAETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLRRVELERL
A0A0P9MPC7      RKQLEDAETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLRRVELERL
A0A3M2XYQ3      RKQLEESETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLKRVELERL
A0A0P9XCE1      RKQLEESETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLKRVELERL
A0A3M3EFX7      RKQLEESETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLKRVELERL
A0A3M5B9D9      RKQLEESETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLKRVELERL
A0A0P9RRZ3      RKQLEESETALNTFQTSARSVDLSIETKGVLDQV------VSLESMLSELKLKRVELERL
A0A3M2VEK7      RKQLEESETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLKRVELERL
A0A0N8R9B3      RKQLEESETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLKRVELERL
A0A0P9VA27      RKQLEESETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLKRVELERL
A0A3M4YBJ4      RKQLEESETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLKRVELERL
A0A0P9J470      RKQLEESETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLKRVELERL
A0A0Q0EVJ8      RKQLEESETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLKRVELERL
A0A3M5UI30      RKQLEDAETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLRRVELERL
A0A3M5YQT8      RKQLEEAETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLRRVELERL
A0A3M5F5X1      RKQLEDAETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLRRVELERL
A0A3M5R8G1      RKQLEDAETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLRRVELERL
A0A3M5V012      RKQLEDAETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLRRVELERL
A0A3M3GA16      RKQLEDAETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLRRVELERL
A0A3M3UCT3      RKQLEESETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLKRVELERL
A0A3M3CJL0      RKQLEESETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLKRVELERL
A0A3M3F6F5      RKQLEESETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLKRVELERL
A0A3M3P9B7      RKQLEESETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLKRVELERL
A0A0N8QB74      RKQLEESETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLKRVELERL
A0A0Q0AUD0      RKQLEESETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLKRVELERL
A0A3M5VR55      RKQLEESETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLKRVELERL
A0A0Q0FK97      RKQLEESETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLKRVELERL
A0A3M5KZ75      RKQLEESETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLKRVELERL
A0A3M5L3G5      RKQLEESETALNTFQTSARSVDLSIETKGVLDQV------VSLDSMLSELKLKRVELERL
A0A519ERR1      ------------------------------------------------------------
A0A4Q3Q1M2      ------------------------------------------------------------
A0A4Q3MHR1      ------------------------------------------------------------
A0A520GDZ4      ------------------------------------------------------------
A0A318DSU0      ------------------------------------------------------------
A0A538PF21      ------------------------------------------------------------
A0A1W1ZH10      ------------------------------------------------------------
A0A1W2FF24      ------------------------------------------------------------
A0A524JYQ6      -------------------------------------------QQLAELGVKLDKACQLA
A0A4Q3MA17      ------------------------------------------------------------
A0A0N0M5F7      ------------------------------------------------------------
A0A537M754      ------------------------------------------------------------
A0A1V1PDB4      ------------------------------------------------------------
A0A2M7C324      ------------------------------------------------------MQVADV
A0A4Q3HHG6      ------------------------------------------------------------
A0A3B7DTA4      ------------------------------------------------------------
A0A432ZK62      ------------------------------------------------------------
A0A1V5EEP4      ------------------------------------------------------------
A0A1V5EF48      ------------------------------------------------------------
A0A0S6X1X6      ------------------------------------------------------------
A0A537Y5L8      ------------------------------------------------------------
A0A4Q3L2X2      ------------------------------------------------------------
A0A4Q3T8J1      ------------------------------------------------------------
A0A4Q4ANM4      ------------------------------------------------------------
A0A4Q3UEC7      ------------------------------------------------------------
A0A1H5YYQ4      ------------------------------------------------------------
A0A1X4NLK2      --------------------------------------------------MTEQPKFQRR
A0A1X4NWB5      --------------------------------------------------MTEQPKFQRR
A0A1M5UQ38      ------------------------------------------------------------
A0A327YI48      ------------------------------------------------------------
A0A1B1PNL6      --------------------------------------------------MVERRRFRRR
A0A2U8H9H9      --------------------------------------------------MVERRKFQRR
A0A6B2NBB8      --------------------------------------------------MVERRKFQRR
A0A1X6YIC0      ------------------------------------------------------------
A0A1I5E9E9      ------------------------------------------------------------
A0A1X6Z7N7      ------------------------------------------------------------
A0A2E1DQ13      -------------------------------------------------------MAGDP
A0A1H8C800      ------------------------------------------------------------
A0A2N3EZ05      ------------------------------------------------------------
A0A655R819      ------------------------------------------------------------
A0A655RNN3      ------------------------------------------------------------
A0A0R0BVC7      ------------------------------------------------------------
A0A3N5J7U8      ------------------------------------------------------------
A0A1S7S3I8      ------------------------------------------------------------
A0A519E8D7      ------------------------------------------------------------
A0A3S1FD32      ------------------------------------------------------------
A0A434DUT4      ------------------------------------------------------------
A0A528D3U3      ------------------------------------------------------------
A0A3S3UPT3      ------------------------------------------------------------
A0A3S1E286      ------------------------------------------------------------
A0A531AC71      ------------------------------------------------------------
A0A436K268      ------------------------------------------------------------
A0A434IDQ0      ------------------------------------------------------------
A0A435IRM5      ------------------------------------------------------------
A0A3S2C404      ------------------------------------------------------------
A0A435F6C0      ------------------------------------------------------------
A0A435BMN6      ------------------------------------------------------------
A0A529XQ54      ------------------------------------------------------------
A0A530BJC1      ------------------------------------------------------------
A0A348SRI7      ------------------------------------------------------------
A0A354EI73      ------------------------------------------------------------
A0A4P7EP83      ------------------------------------------------------------
A0A6I1QB25      ------------------------------------------------------------
A0A655ZZQ1      ------------------------------------------------------------
A0A1S0ZAI3      ------------------------------------------------------------
A0A3A4NIE9      ------------------------------------------------------------
A0A3A4NUI9      ------------------------------------------------------------
A0A524I3Z6      ------------------------------------------------------------
A0A524PCL7      ------------------------------------------------------------
A0A356GQV1      ------------------------------------------------------------
A0A1J5DAY8      ------------------------------------------------------------
A0A524P237      ------------------------------------------------------------
A0A3C0L0A8      ------------------------------------------------------------
A0A176S762      ------------------------------------------------------------
A0A377ZC40      ------------------------------------------------------------
A0A378BPJ7      ------------------------------------------------------------
A0A2J5PAJ7      ------------------------------------------------------------
A0A377ZDN3      ------------------------------------------------------------
A0A7A9Y5Q1      ------------------------------------------------------------
A0A1G3JY11      ------------------------------------------------------------
A0A661N3U1      ------------------------------------------------------------
A0A1W9WUD9      ------------------------------------------------------------
A0A1W1ZQK0      --------------------------------MGKFFTALQKSKTPIHERDKKDKVRLVS
A0A6I1R304      ------------------------------------MSRVFDALAKASEEKKHQVKSALR
A0A1W9PMU6      ----------------------------------------------------------MK
A0A3S1WTQ1      ------------------------------------------------------------
A0A530CUR9      ------------------------------------------------------------
A0A6L6H5T1      ------------------------------------------------------------
A0A6D0ELN7      ------------------------------------------------------------
A0A1M6N1X5      ------------------------------------------------------------
A0A561M3U0      --------------------------------ALQQTADAKTRMLELQQKRDELSSR-FT
A0A2N6BZD5      ------------------------------------------------------------
A0A1G3VVY5      ------------------------------------MGKMFDALQKAEKERYRESERVSY
A0A7C3S273      ------------------------------------------------------------
A0A7C4WJ18      ------------------------------------------------------------
A0A7C3V565      ------------------------------------------------------------
A0A351B422      ------------------------------------------------------------
F2NEE9          ------------------------------------------------------------
A0A2W5J775      ------------------------------------------------------------
A0A352Q5C1      ------------------------------------------------------------
A0A435NNF5      ------------------------------------------------------------
A0A3S2AQS7      ------------------------------------------------------------
A0A436XH86      ------------------------------------------------------------
A0A527ZPD6      ------------------------------------------------------------
A0A529KRW3      ------------------------------------------------------------
A0A530ZLX0      ------------------------------------------------------------
A0A355TB56      ------------------------------------------------------------
A0A1F9E324      ---------------------------------------------------MKLSEN-YK
A0A432SAI6      ------------------------------------------------------------
A0A4Q3LBH4      ------------------------------------VQLLLERRADIQGQYQQQLAT-RQ
A0A4Q3LWP3      ----------------------------------MNRQWLLVLRS--------QLSI-HR
A0A7C3JPP4      ------------------------------------------------------------
A0A534V9L7      ----------------------------------------------------------MH
A0A7C3JJT4      ------------------------------------------------------------
A0A2N6VGL1      ------------------------------------------------------------
A0A3M3H5V6      ------------------------------------------------------------
A0A524M660      ------------------------------------------------------------
A0A7C3JSX5      ------------------------------------------------------------
A0A7I8MQ67      ----------------------------------------------------------MG
A0A0C1TRU6      ------------------------------------------------------------
A0A2Z5SSF4      ------------------------------------------------------------
A0A2T4ZJZ6      --------------------------------TLTGVVEMKTQITLLQQKRDELRQK-FT
A0A0B8PTA8      ------------------------------------------------------------
A0A0B8QF75      ------------------------------------------------------------
A0A6P2T4F7      ------------------------------------------------------------
A0A4Q4CIB1      ------------------------------------------------------------
A0A522ACJ9      -------------------------------------------RFDLVGRVAARLAHGTS
A0A1T2KYM8      -----------------------------------AAKEAKREELDSELEIAQLAKR-YG
A0A3N5Z7F8      ------------------------------------------------------------
A0A239HD34      ----------------------------------------------------------MD
A0A2G9ZR82      -------------------------------------THLKNEYAKLYAKYEEMSTT-FH
A0A4U9I390      ------------------------------------------------------------
A0A0P7ZZE4      ---------------------------------MERLKAALDKARETRAATAASAPATAA
A0A369R0Q9      ---------------------------------MERLKAALDKARETRAATAAPAPASGA
A0A327LYE6      ---------------------------------------MPDISTDMASTDDDDVARPPG
A0A5A9ZTV3      ---------------------------------------MPDISTDMASTDDDDVARPPG
A0A6J4YZ98      -------------------------------MEKDIITDLKGEYARLRSEYEELTTT-FH
A0A2X3M011      ------------------------------------------------------------
I2WC85          ------------------------------------------------------------
A0A7A9K1G5      PEVRSELDQAEEKLNVYRQQRDSVDLNLEAKAVLEQIVNVDNQLNELTFREAEISQL-YK
A0A7B7KSB7      PEVRSELDQAEEKLNVYRQQRDSVDLNLEAKAVLEQIVNVDNQFNELTFREAEISQL-YK
A0A400JH80      PEVRSELDQAEEKLNVYRQQRDSVDLNLEAKAVLEQIVNVDNQLNELTFREAEISQL-YK
A0A479JNB1      ------------------------------------------------------------
A0A5C9AF52      ------------------------------------------------------------
A0A797FC39      ------------------------------------------------------------
A0A797FHC1      ------------------------------------------------------------
D8EEU7          --------------------------------------------------------M-YK
A0A6D0EYC7      ------------------------------------------------------------
A0A7A6DHB0      ------------------------------------------------------------
A0A2H9EHM4      ------------------------------------------------------------
A0A7A5MLK0      ------------------------------------------------------------
A0A380B3D7      ------------------------------------------------------------
F5NSX0          ------------------------------------------------------------
A0A534XP85      ------------------------------------------------------------
A0A0P1H2H0      -------------------------------------QKRQARRAARAARAAEGTQANVM
A0A258WKV0      ------------------------------------------------------------
A0A377N8F8      -------------------------------------MAVTTQLNGLRFEEAELSKR-YT
A5G4N9          --------------------------------------------MEAMEPHTEVLEPPMD
A0A3C2DSE7      ----------------------------------------QADRAHARSRVEELSRR-YG
A0A2X1JBG5      ------------------------------------MVGLEKQLNELTFREAELQQL-YT
A0A377LY04      --------------------------------VLDSMVNIDAQLNELTFKEAEISKL-YT
A0A5C9ABR5      ------------------------------------------------------------
A0A5J9WU72      ------------------------------------------------------------
A0A2X3K9R3      --------------------------------VLDSMVNIDAQLNELTFKEAEISKL-FT
A0A3T9EHW9      ------------------------------------------------------------
A0A484X141      --------------------------------VLDSMVNIDAQLNELTFKEAEISKL-YT
A0A5N9VWI6      --------------------------------VLDSMVNIDAQLNELTFKEAEISKL-YT
A0A6D0EJQ0      ------------------------------------------------------------
A0A444R390      ------------------------------------------------------------
A0A376LLF8      ------------------------------------------------------------
A0A6L7CT21      ------------------------------------------------------------
A0A4Q3LR91      ---------------------LHTGDVAKEQLDNGASSTLRARRAELSGDYARMMQQ-FD
A0A6C9IKN8      -----------------------------------------PIVIDLNNSLAAMKQTIIR
A0A4V1TR68      ----------------------------------------------------------FA
A0A444IY46      ------------------------------------------------------------
A0A6I7N627      ------------------------------------------------------------
A0A6L3ZR06      ----------------------------------------------------------FE
A0A3E0WKI3      --------------------------------MLNQVVEVEQRLAEMDLERSQLRMS-YA
A0A1H3I2J1      --------------------------------FGTSTVEVTEIGEPARAAPAPVARDTLA
A0A1V5DJV0      ------------------------------------------------------------
A0A520IUC4      ------------------------------------VQALRAERAKLEADYRERLAT-FK
A0A521LJG5      ----------------------------------------RIQDVELTRKGAELASQ-LG
A0A531IBQ7      ------------------------------------------------------------
A0A0P1FWI8      --------------------------------MVEQNKRYRRKTRQQPPKSPGF------
A0A6L8LHC6      --------------------------------MVEQSRKFRRKQRPQQDEARGFPRP---
A0A1V4WHZ7      ------------------------------------------------------------
A0A1E5AJN5      LGLIVQQIT------------EGKAPSLSAVLESQAIEGLKQRLATLRADYQDKLSI-YK
A0A2N3D2J1      ---------------------GSAIFSLPDVLNNGTIQQLTQRRAQLQAEYQEKGRL-FR
A0A2N2GVE1      LDGMARELRAKIQQVRRMRTTDPTLDPSADFLNKPAIVSLRSRYHSAQEKLKEVQVE-VM
A0A2N2INV3      LDGMARELRAKIQQVRRMRTTDPTLDPSADFLNKPTIVSLRSRYHAAQEKLKEVQVE-VM
A0A233IKJ2      AETLYLVAQTYSRQDSD----LSALASIPEISNHPTIRDVKLAEVQAERKVSELSKR-YG
A0A1Y5DXG5      --------------------------------VLEQIVELDTKLQELDLERLAMSRK-FK
A0A0B8P2H5      --------------------------------TLKVMVELEAQLNELTFKESELAQR-FT
A0A380AQW6      --------------------------------MLDTQVQLEGQLNELTFKEAEISKL-YT
A0A2G2GD62      LENLKEYIDENDDLTGL---------------TVQSLETTATNLNELIINYQTALTN-RR
A0A3R9C3P5      VKATISTLEGA----------DNASAAAQNIAVPDNIATKQRDLHAQEQDLARLLET-YD
A0A0M3GBT1      VKAVISTLEAA----------DSASVAVQNIALPDDITSKQRDLHAQEDDLARLLEL-YD
B3Q577          VKAVISTLEAA----------DSASVAVQNIALPDDITSKQRDLHAQEDDLARLLEL-YD
A0A483QWI8      --------------------------------VLEQIVNVDNQLNELTFRESEISQL-YT
A0A483UXD3      --------------------------------VLEQIVNVDNQLNELTFRESEISQL-YT
A0A0A8J8L3      --------------------------------VLDQIVNVDNQLNELTFREAEVSQL-YT
A0A660DJ38      --------------------------------VLDQIVNVDNQLNELTFREAEISQL-YT
A0A524P331      VEFALAALKKARR--------RGGVYSPAAFRDDPLIGTMASKLTELEMQRRALVAE-NT
A0A4V1SSM5      ------------------------------------------------HDQTQILER-YG
A0A4Q3K8G7      ------------------------------------------------------------
A0A7C7W7M2      QENLYQQLKDIRPG-------NRSAEKLQAISSHPSISTIQSTLFTLNQRKEELSKR-YG
A0A1M7HC79      --------------------------------TIQQFIALEQQLNELEFQEAEMAQR-FT
A0A1D3JZN6      --------------------------------VLDQVVALDTGISELKLQQAEMDRK-FT
A0A1V6ESG1      --------------------------------ENKTVQTIKEQKAKLEAEYLVNLGT-YK
A0A1H7YHK3      --------------------------------LLEQQVAVETSIQQLHMQQAEMDRS-FT
A0A534SH66      ------------------------------------------------------------
A0A3M0ZZ99      ----------------------------------------------------------ME
A0A238LBD3      --------------------------------MNAKYSRRTGRPRLDASERARLLAEIAK
A0A328C2K5      VQARLFAEEALLNQLENMESSGEDLRALGDLVDSPALKRGLDRESELLERRAELTTR-YL
A0A5C6X8M3      VQARLFAEEALLNQLETMESRGDDLRALGDLVDNPALKRGLDRESELLERRAELKTR-YL
A0A3D8MRR7      VQARLFAEEALLNQLETMESRGDDLRALGDLVDNPALKRGLDRESELLERRAELKTR-YL
A0A5C6UBJ7      VQARLFAEEALLNQLETMESRGDDLRALGDLVDNPALKRGLDRESELLERRAELKTR-YL
A0A5C6XGM3      VQARLFAEEALLNQLETMESRGDDLRALGDLVDNPALKRGLDRESELLERRAELKTR-YL
A0A537NZJ1      -----------------------------------------------MTRPASVRMR---
A0A7C4R3C4      --------------------------------LSKHLLRLDPQDDAKNAASLEKLKQSGT
A0A0P1FRV5      --------------------------------MVEQSKRFRRGMRQRPAKAPE-----EA
A0A4Q4CVW6      ------------------------------------------------------------
A0A090R136      --------------------------------TLDMMVKIESQLNELTFKESEISQR-FT
A0A661JU93      ------------------------------------MRSLKEKLTSLEIQKAMLLEK-YT
A0A2E2T3V8      RMLFEKRQAVKS---------SEELLALPDIAKDDQVRDLQVKYEVLQQNYAELEQR-YQ
A0A367UAB4      RMLFEKRQAVKS---------SEELLALPDIAKDDQVRDLQVKYEVLQQNYAELEQR-YQ
A0A1F2ZW35      ARGRRIEKEGRLVALSKASLNPGELANIPEVAGNTTLAALRIQDVDLSRKSAELASQ-LG
A0A377V641      --------------------------------VLDQIVNVDNQLNELTFRESEISQL-YT
A0A1F2YJ88      --------------------------------FLTQSVTLETQKAQLEQQVAEAGAK-YT
A0A6L3ZWI0      ------------------------------------------------------------
A0A5N8AL61      NARAS----------------ASRRGSVTDITNNAVINNLKGTRANLLAKKSDLEGR-YG
A0A0J7XGZ1      AQAQLAEQRGKLGAAQAQIARGGGGADIGSALASDTIRQLRQQEAQASARLAQLDAR-YG
I4CBA7          LETLT----------------LHKQMILPKYIDNEFLSTLKKNSAALKADYVSAASV-LG
A3VE95          EAQYEQLRNLLE---------NQGLDALAKAVTSPLLERLNQDKLALERQDAQWGAS-FG
A0A1G0NL95      --------------------------------RLTRLLEVDKQITELRQKRDETAQQ-FA
A0A024KA69      --------------------------------HEEVAAKIDGVLADVAALRAQVTVA---
A0A0L1KFN4      LNEATADRIAAEARFRQ----AGGSGSSAEALSNYAINNLRQKRAELESEYRELMVR-FE
A0A3P5DSS6      --------------------------------VLDQIVNVDNQLNELTFRESEISQL-YT
A0A483YEL5      --------------------------------VLDQIVNVDNQLNELTFKESEISQL-YT
A0A658GUJ0      --------------------------------VLDQIVNVDNQLNELTFKESEISQL-YT
A0A358L616      --------------------------------ALDSSVSVQSQLNELTFREAEVSQL-FT
A0A1M7BLL7      --------------------------------LSPEADEATQEADEAPFALSPEMIAPPL
A0A0H4KZM1      ----------------------------------------------------------ER
A0A3D5UYX7      ---------------------GGSVESVADVLASGTISGLRQKQAELAREKANLSAK-YG
A0A2N1WQN5      ------------------------------------------------------------
A0A352G2C2      --------------------------------VLDRIVDLEKQISEQNLKRTEMERR-FT
A0A3C0PZN1      --------------------------------VLDRIVDLEKQISEQNLKRTEMERR-FT
A0A524QFS4      --------------------------------IRQSLAAHSKDLTESNAERDRLLSL-YT
A0A520JSW4      QARRIAAEQRYREAALGGATTE----------SSVNAAPLRAQIAALDAEYQQKLQG-FR
A0A1V1UJT2      --------------------------------GESAIEEIADEFALPLDPGMRADPEEAL
A0A0L6CVX1      ------------------------------------------------------------
A0A1V0RR48      ------------------------------------------------------------
A0A0A0HJJ4      --------------------------------DDEVPQVVDTPEPEAPAQDEIAQEETAL
A0A5E7YA28      --------------------------------EENAAHFPEMPVAEP------TEEEAPL
A0A4Q3LTF3      --------------------------------RNVAINNLRQRRAELAAEYQRLMIQ-FE
A0A7C3N3Y1      KEALYRQTF------------NRKIDSLPMVFENKLILELKQTYVQLESQYMKLSQT-YK
A0A537UTP9      KAKLDRIDEILRTGVEVPD------ATVTDSLKSEVINKLRSQYLDFSRQAAELSAK-YG
A0A1D2RNR5      ------------------------------------------------------------
A0A4V1TQ46      --------------------------------SDPSYQGLSQQRARAVAQYEQDAKH-WT
A0A3A0FZC0      AENLYKEAEAALSNPSAGF-------------DDPSTQHMRGELAKLEAEYQQLSAK-FT
A0A1N7JVZ7      APAAWDDTKMEGHAEADEEKPSVPPTASEPDAPNSSGPGADTRSDAATAPDAPLVLQ-DT
A0A091C4A8      AEARWKHAE------------SASGMGLSAVLGSEIVQALQERRADLQAQYQDKLSI-FK
A0A4R3H6P6      NSALEVATAERIVAESRLNE-AKRPDASSIALGNDAIASMRQRRADAAAEYAKLMVQ-FR
A0A3S1NQ09      ASARYQQYKAIVDSGSENA--FKDAAISSDQPSSSVISALKTRYLTVAKRLQDVEAN-FG
A0A443GJ52      ASARYQQYKSIVESGSDNA--FRDAAISADQPSNSVISTLKTRYLTVAKRQQDVEAN-FG
A0A6N3RE79      --------------------------------MNVVLGFILGLFISVGAVLARAMLR---
A0A6N9S3L5      ------------------------------------------------------------
A0A656BWB0      ------------------------------------------------------------
A0A6D0IFH4      ------------------------------------------------------------
A0A7A3MK38      ------------------------------------------------------------
A0A0A0FHV8      ------------------------------------------------------------
A0A1X3IPU7      ------------------------------------------------------------
A0A0A0G0N2      ------------------------------------------------------------
A0A2I8SDU4      ------------------------------------------------------------
A0A2I8SU55      ------------------------------------------------------------
A0A7I6T806      ------------------------------------------------------------
A0A7I6TQE9      ------------------------------------------------------------
A0A7I6U296      ------------------------------------------------------------
S1EXJ6          ------------------------------------------------------------
A0A376UBS1      ------------------------------------------------------------
A0A2W6S588      ETRSA----------------ASGSTVISGGVDTTALSTLREQRAEASRDLAGLTSR-YG
A0A483E0N4      --------------------------------VLDQIVNVDNQLNELTFRESEISQL-YT
A0A2J4YQQ6      --------------------------------VLDQIVNVDNQLNELTFRESEISQL-YT
A0A483THX4      --------------------------------VLDQIVNVDNQLNELTFRESEISQL-YT
A0A534MVS2      --------------------------------RDLDALLSESRRNNMLLGEAAIWKK-FL
A0A444I5K6      AEARYARVKSIIDA-------KQTDAIVTDVLDSSISNDLRKKYLEASKLETEIEAR-LG
A0A154VE85      EARAAQARRLIGQGSNTGTNTGGGLETAAAVLNADLVRELRLQEAALQRRIAELRVE-YR
A0A3S1MCW7      -----------------------------PVLESAGLQKLSDKLADLTSQYQQKLGI-LK
A0A434IGN6      AGRMVDQID------------KGRGASLGPVLESEGLQKITDKLADLTSQYQQKLGI-LK
A0A528AX40      AGRMVDQID------------KGRGSSLGPVLESEGLQKITEKLADLTSQYQQKLGI-LK
A0A528MV95      AGRMVDQID------------KGRGSSLGPVLESEGLQKITEKLSDLTSQYQQKLGI-LK
A0A3C1S9Y1      VETETRY-----QQALALEKTPDLLDSIPEVLSNDIIKEIKKMEVNLYNKMSELSKK-YG
A0A353EH49      --------------------------------LLTEMSHLGAAILELEQERKELRNL-YK
A0A1Y1Q9C1      AESQMIQ--------------GRKRTNAHAVLNSPVVESLKQNLATLEAEYREKLKL-FK
A0A3M7LJH0      --------------------------------TLEVMVKLEAQLNELTFKESEVSQR-FT
A0A316KRG4      --------------------------------DFAGDRASKPEPAAPAPRKSKIKAIKKH
A0A1E4JHX8      LSAAKGEMVRAHSRVTE----VGANGAVEEALTNNAITGIRQKRAEVAAEYARLLSQ-FE
M2U8P2          AE-------------------SRAASPAAAIQSSSLLRELRAREAALSAERADLAGR-YG
A0A1H7KZF8      AQRRIRAQADWRAVA------ARPPLSIPEVIGNAAVQSLVSQSTDVQARLNAAAAR-HG
A0A0J5Q9T7      --------------------------------AAQSIVEEQTQRRADAQAKAQAPRA-AA
A0A6N3UC48      --------------------------------VLDQVVELDTSISELQLKRSEMERR-FT
A0A257NG76      --------------------------------VLKGVVEIQTQITLLQQKRDELRQK-FT
A0A1T4TW59      AEAIYSLLQSSGSS-------AASLLSVPEISNHPQVRDVKSAEIDAERKVSELAKR-YG
A0A1I5YYQ0      ---------------------------------------------ALESGEARDKPRTFR
A0A5P9FE62      ---------------------------------------------SVESGEARDKPRTFR
A0A1Q3MB35      LADATRARITAESTVRQTSSASEGSL------NNQALNLMRDRRAQYASELASSLAV-FE
A0A259LUN7      LQIELDRARARYEAMRRQIDSGAGVEGVSEVINSALINQLKSQRAEILRRVAELETR-VG
A0A2D7AVL1      --------------------------------DSPDLKKLREQRFQLDTEYQNKLEI-YR
A0A3B9KZE9      --------------------------------------------------YQNKLEI-YR
A0A2U0NMP8      --------------------------------VLDQIVNVDNQLNELTFKESEISQL-YT
A0A4U9HNE9      --------------------------------VLDTQVQLEAQLNELTFRESEISKL-YT
A0A7C5N053      QEAAARHSQLSKVSADVSK------LPASELLKSPVLQSLRLEYIATIRERDAILATGKG
A0A2G2CXY6      --------------------------------ILDQIVELDTMISELNLRRAEMERR-FT
A0A3M1D4H3      --------------------------------ANKLVARLQDDLTNLRQKRANELTD-KT
A0A7C1A2A2      LRQIARSLDERH---------PNIDPYLLSTVDDGVLDKLSGTLAAAQTELAALAPR-ET
A0A5C8BYM7      --------------------------------ESKTIQDYKAQRSKLDLEYEQSAKV-YK
A0A1J5ICP0      AEFIAENIMQSDGMPDKSIVALGAST------KSERLNALAQKLSELQSRMITLKIN-YK
A0A379B9V4      --------------------------------TLDTIIQIEADLSELSIQESEISRK-FT
A0A0Q6TS97      SALEVATAERIVAESRLNE--IKRPDASSIALGNDAIASMRQRRADAAAEYAKLMVQ-FR
A0A0Q6UYB4      SALEVATAERIVAESRLNE--IKRPDASSIALGNDAIASMRQRRADAAAEYAKLMVQ-FR
A0A484XS37      --------------------------------VLDTVVGVEAQLNELTLKEAEISKL-YT
W7Q5J0          --------------------------------AVQRYIDIERRINELEFQEAELAQR-YT
A0A654AKT6      AYLLTEK-------------------------VNKKVVALYAVGLFISFSKSSLILFIFL
A0A7A9JY19      --------------------------------TLDQLVNVDNQINELTFREAEISQL-FT
A0A0G9MZA5      ALQQATTQRIAAEAALAARSGANAGSTE----ASATADALRARRAELQVELAELRSR-FS
H0T8B0          AQAKLEQITHVLVQRSKSQDFDVSSPAVPDALNSPVINGLRDDFLKDKSKEAELSAR-YG
A0A5C7N981      LAKSQGERIRAETLYQQAK--AGDVATLQAVVDNKLIAEYKARLSKLEGDYQEGLTT-YK
A0A534TV22      -----------------ME--NKSTLSLSQVINQGLVPQLRSTLLSLEAEKVKSSTV-FK
A0A351CXR4      --------------------------------TENRLVQLSEALQLAKEDYARLAQR-YG
A0A2N6GLF5      AESSLRQI----NALKGQP--VERLASIPAVLSDSLVSSLREAEAEAQRKVSSFSKR-YG
A0A1W9LJP0      VEAETRYRQ---ALAAQNS--PDMLDSISQVLNNPLVQDIKKMEVELYNRMSELSKK-YG
A0A0W1ICB0      LVQATAERAEAESKLSAAR--APGATQLGL--SNQSLSTLRQRRAEANAAYQELLVQ-FE
A0A7C1C8G2      KE----------SLYLQTK--KNGGENLPQVLNNPLLQNLKQQYSELRSQYEVLSTV-FK
A0A376KYN0      -------------------------------------MNVDNQLNELTFREAEISQL-YK
A0A7A9J338      --------------------------------VLEQIVNVDNQLNELTFREAEISQL-YK
A0A377E5P7      --------------------------------VLEQIVNVDNQLNELTFREAEISQL-YK
A0A2X1JB05      --------------------------------VLEQIVNVDNQLNELTFREAEISQL-YK
A0A376RML0      --------------------------------VLEQIVNVDNQLNELTFREAEISQL-YK
A0A6N3QTV2      --------------------------------VLEQIVNVDNQLNELTFREAEISQL-YK
A0A2E0UL88      IQKAEFGRDNALAARPELE--EY---------SQKSLKDLRARSKELEMRINKLASD---
A0A0T2QIS1      LAQATAE-----RVAAESR--ARTAGPSELSITNPTIVALRDRRAQAAADYAKLMVQ-FE
A0A0P7Y1D0      ESSLRN------VQTQLER--GASLDTIGEVLRSETIRALRAQQTDTSRRRSDLTSR-YG
A0A542J310      ------------------------VPSYLVMAGWTDVAEGVIADLGLETTPEALIER-IV
A0A2M7JRZ7      KE----------ALYRQTK--DKHFDALPSILENKLVMDLKQAYIQLEAQYMKLSET-FK
A0A167IR75      LNEATADRIA--AEARFRR--AGGGGSSAEALSNNAINNLRQRRAELNAEYQDLMIR-FE
A0A3B8T2U6      VRSIFEQVNGQESKQDLAS--LQEVQ------NHPTVQNVKKQQLNAQSRVSELAKV-YG
A0A365PWR2      --------------------------------YLNQLVALDSKISALRLQQTELASR-FT
A0A2E9H5Z8      --------------------------------PGSQVPFLRSRIQESQLNMEAMQASGLG
A0A2E2BR79      --------------------------------VIAQLIDVEKKLSEVEFQEAEMAQR-FT
A0A6I4IKZ3      --------------------------------YLTQSITLETKKAELEQKQAEMAAK-YT
A0A7H4JZ79      --------------------------------YLTQSITLETKKAELEQKQAEMAAK-YT
A0A0Q4Q524      SQATAERIAAEARYREGGR--AGASSEAL---RNQAINTLRQRRAEFAAEYQKLLIQ-FE
A0A0Q4CFJ9      SQATAERIAAESRYREGSR--AGASSEAL---RNQAINSLRQRRAEYAAEYQKLLTQ-FE
A0A0Q4FE58      SQATAERIAVEARYREGGR--AGASSEAL---RNQAINALRQRRAEYAADYQKLLTQ-FE
A0A0Q4JWC8      SQATAERIAVEARYREGGR--AGASSEAL---RNQAINALRQRRAEYAADYQKLLTQ-FE
A0A0Q4KFL8      SQATAERIAVEARYREGGR--AGASSEAL---RNQAINALRQRRAEYAADYQKLLTQ-FE
A0A522R8R0      --------------------------------NTNIINDLRVRYLDVTRREQQIESQ-FG
A0A2U9NDY5      --------------------------------VRDQSVQRETQLAERARKRVEDDRR-YT
X7F6S5          ---------------------------------------------SAAAEEARARDG-QA
A0A1G8NKI0      -----------------------------------------QREAEADAEDQRRRAE-AA
A0A355QPE4      -----------------------------------------QREAEAAAEDQRRRAE-AA
A0A357RN98      -----------------------------------------QREAEAAAEDQRRRAE-AA
A0A1I6U4V1      -------------------------------------------EARAAEQRRAEQQR-LE
A0A6B2P8H8      -------------------------------------------EARAAAQDRARRQA-EE
A0A1P8USW9      RAAERLE-------------------------AVQRQRAEAARRKREAEEQARKQAE-DA
A0A1G7CFZ2      LQQQVEK-------------------------EARRQREAERRRTEA------RQAE-AA
A0A7G2TPW1      ---------------------------------------------EA------RQAE-AA
A0A0Q4IGG1      TLSQATAERIQAQARAQQS--GRAGASTEAL-RNQAINTLRQRRAELAADYQRLMVQ-FE
A0A534RUJ5      LE----------AQMRSVS--QTDYDSLPAVVNNTLIQALKEQLTTLQGQYAQLSTQ-FK
A0A3M1CJM3      IALEARRQKILDIKEHRLA--LDAVDKVI---SNPLIQQLKANYVKLKEEHTELSTK-YL
A0A2R7SVD4      --------------------------------VLGQSVALETRISELKMQQAEMDRK-FT
A0A3C0PWB6      --------------------------------VLDQIVQLETQLSELTLKRVDYDRL-YT
V4Q8B7          --------------------------------VLDQIVALETQISELSLKRVEYDRL-YT
A0A0Q8XKK5      LASATADRLAAESRSVRQR--GASPQAL----TNPAISSLRQRRAEVASELAKLSVQ-FE
A0A2E0Q2W0      LA----------EATARRI--EAEGASRAASVANAGAATIRSRIAXVEATLARLRTT-LG
A0A660NIR6      RLEQVYHQVQRGSRNRYEV--PE-------VFNNPAVVAARAAEANAEKRMAEVAGS-MG
A0A142W0R3      ALSVARDARIAAESQLSSS--VSSTDLS----SNAAVSALRQRRAELMADLARLRKI-FG
A0A0S4XR18      LEGLIRQMKTGNGINFVSI--DVLGA------PNSSINNIITALQQKNAARTALLAE-YT
A0A7C5CFF1      --------------------------------SNPQISSLIQDLKEKRTLLQSLLTD-FT
A0A2E0GW64      --------------------------------MLTQLVKSQNDLEALKLEKTQLQQG-FT
A0A1A7QJ97      IADRIA------AESRFRQ--AGSAGSTAAALGNTAINNLRQRRAELAADYQQLMVR-FE
A0A661LW70      --------------------------------NNELIRQIKSMEIGLYKRMSELSKK-YG
W7Q8F9          --------------------------------AVQRYIDIERRINELEFQEAEMAQR-YT
A0A524PXH8      VE----------SLYQQSQ--GASRDSLPIIVNSPLLKSLVEQLAQAEGERAELADR-FT
A0A4Q3P0E4      --------------------------------VLGTAVDRQTKLLDAQQRRRELEAL-FT
A0A3M2BE89      --------------------------------LLDQSAKLEQQISELKLKKLELRRR-FT
A0A4Q4A6K6      --------------------------------LSPIINNLRQQYLDYSRRESELSLK-VG
A0A257G674      ANQAQATRIAAQQRWNLVS--RSDPLNSPDVLANPAISQLLSERARVQSELQKQRAN-HL
A0A661M5M6      IELEARLKRLNASLGEAPK--QIDPAVVA---DDPTLGDLVTELRNKEQEHEALAVK-YG
A0A1I1UM01      --------------------------------QRAEAEAQRQAEAERLRVEAETRRR-AE
Q44573          AD----------ALQDAAA--RGDARAAVALSQEPILVATANALMQLQSTRQEEAAT-YG
A2W025          --------------------------------YEQQIAAQRLQLASLAQRFTDSHPM-VI
A0A534Z362      LH----------SRYEFLT--RPHGDALAYFLDRPGIQKLHLALLDLRAQRAGLGQR-LG
V4J283          --------------------------------VLTSIMEIENELFTLQQERETLRSR-FK
A0A536T443      ------------ARDGGVP--VDELTMIGAVQRSSALSAALKELADRQAELRVLRFR-YA
A0A0Q4UFQ5      LAQATAE-----RVAAESR--LNSGGATKEQLDNTANSTLRTKRAELAADYARMLQQ-FD
A0A527W7E6      ASARYQQYKAIVDSGSETA--FNDSAIAADQPSSSVIIGLKTRYLAIAKRLQDVENN-FG
A0A432EMV7      AEVLFKQ-----VKAAEKR--GDDYGSLAAVLNNTLIQALKQEQSQLQRKVSELSGR-YL
A0A7C1SEU7      KR----A-----IYNQAIK--DG-PASLPRVLSNLVIANLKADYARLVSQYQDLTTT-FL
A0A534WLI3      LE----S-----RNEFLSH--AD-SEPLAYLLDRPAIAKLHGTLLDLETQEAPLTHR-LG
A0A7C6FBW0      --------------------------------GNAELTALRNRLQQLEKERQAMQRR---
A0A087LTV7      VQ----R-----EGPTYLV--SV---------RANAPSPIEAASYANAVANSFIHEE-VA
A0A7D7WSS2      VQ----R-----EGPTYLV--SV---------RANAPSPIEAASYANAVANSFIHEE-VA
A0A318KWA2      --------------------------------AIEQFVALDSQLNELEFREAELAQR-YT
A0A522MT86      --------------------------------FDRRIADLQIQRTQLLDRYTPDSRW-VR
A0A4Q3I221      --------------------------------DSSISNELRQKYLDASKREAQISDR-LG
A0A534SAL6      LE----S-----RYQFLTT--PG-SDPLAFFLDRPGVQKLHLALLDLRAQRAGLGQR-LG
A0A534ZDB4      LE----T-----RYEFLTT--PG-SEALAYFLDRPGVQKLHLALLDMRAQRAGLAQR-LG
A0A534X3M7      LQ----T-----QNDSLAK--KQYGDLLAFFLDRPGIQKLHLALLELRAQRAGLEGR-LG
A0A534SPC6      LH----S-----RYEFLTR--PH-GDALAYFLDRPGIQKLHLALLDLRAQRAGLGQR-LG
A0A535AD60      LH----S-----RYEFLTR--PD-GDALAYFLGRPGIQKLHLAILDLRAQRAGLGQR-LG
A0A4Q3SY08      ------S-----TGEDVGE--AL---------DSGVIQSLRGQRVAVSAKVADMQGR-YG
A0A4Q3LG23      AA----G-----ASTEALR--NS---------AINNLRQRRAELAAEYQRLMVQFKP-EY
A0A522EX52      -----------------QT--EN---------FLRQLAELDKKLAELRISKIDMLQR-YT
A0A1H3KC95      ------------DVPSTPR--AT---------EPTVANTGDASAPPDTGPSREAFDA-QL
A0A5P8Z4P3      DE----P-----NARDAES--LP---------PQAIAPAHHPERPLRKSAEPVSRPV-TA
A0A2E9HXF7      ------------ERQESAR--QH---------REAEEARSRQEAAAKAAQDAEDHRQ---
A0A0B3RZC9      ------------EAEAALQ--AE---------KEAEERRIQAERA---------------
A0A6F8QET1      ------------EAEAALQ--AE---------KQAEERRIEAERA---------------
A0A520HUH4      GV----G-----TINDQQV--GP---------ISQQLASAKAEAAALRSNVAAAERQ-IA
A0A2K8U7M6      ------R-----QAGTDAA--AT---------DSPVIQRLQARKAELSADYQQQLKV-FK
A0A5B9DKL8      FL----R-----IEVEGKV--DD---------ILAEQAALRDR-VIAAGVAVDRTQG-IL
A0A238KJM1      ---------------------RE---------AEKQIATERAQAEAEARKAEDDTKR-LT
A0A3A0FJZ4      VV----R-----ASAEQLI--AE---------REAERASQAQATEALLASQLRDLQA-EL
W4HJV8          ------S-----DSDSDSD--SD---------SDSDSDSPEEDRSPEQATALAASDP-SV
A0A0P1GDI0      KL----A-----EERAAEA--KR---------KQAELAAQRKA-EAEAAERAEKQRK-QA
A0A2R8ATV5      ------A-----EAIKRAK--AE---------EAEEQARLKAE-AAKRAQAEEAARL-QA
A0A1U7D3R6      ------A-----AQREAER--LR---------LEQTRAAEEAE-AARRAEDAERARL---
A0A2D4UVV2      ------A-----AQREAER--LR---------LEQTRAAEEAE-AARRAEDAERARL---
A0A0W7WHP4      ---------------------AR---------REAEEQARREA-AEHARREEQAQRE---
A0A238J8F6      ------V-----EAE------KR---------RQAEIEAQRQA-ELAAREKAEAVRR---
A0A238JQI6      ------T-----EAEDAAR--KA---------EEARLAEERRK-AEDAARKAEEARL---
A0A222E077      ------------ERQESAR--QH---------REAEEARSRQEAAAKAAQDAEDHRQ---
A0A239E3Y2      ------------ERQERER--QH---------REAEEARTRQE-ATKAAQDAAEIRQ---
A0A534QGR3      ------------------------------------------------------------
A0A1F9CFF0      ------------------------------------------------------------
A0A2M8B0G5      ------------------------------------------------------------
A0A363TNU9      ------------------------------------------------------------
A0A0W1GMS6      ------------------------------------------------------------
A0A0Q8RMY3      ------------------------------------------------------------
A0A1A7QC21      ------------------------------------------------------------
A0A2W4RFS2      ------------------------------------------------------------
A0A1Y6DC43      ------------------------------------------------------------
A0A2S6HE06      ------------------------------------------------------------
G3J0M3          ------------------------------------------------------------
V5C6R5          ------------------------------------------------------------
A0A534HBS8      ------------------------------------------------------------
A0A0F0T3Y9      ------------------------------------------------------------
A0A379GWF0      ------------------------------------------------------------
A0A4Q2XLV7      ------------------------------------------------------------
A0A4Q5QYC4      ------------------------------------------------------------
A0A3B8SQ27      ------------------------------------------------------------
A0A0U2VAW2      ---------------------------------------------------------MLT
A0A454CTF1      --------------------------------------------------MMVALEAQLN
A0A6B3Q2G1      SAEAEQSLNFLKGHLPEIKDKLTISEDTLNSFRQENESIDLNLEAQSTLKVMVALEAQLN
A0A4Q6G931      ------------------------------------------------------------
A0A2T0VBD8      ------------------------------------------------------------
A0A378APS2      ------------------------------------------------------------
A0A443VCQ6      ------------------------------------------------------------
A0A447RKQ7      ------------------------------------------------------------
W1DSK1          ------------------------------------------------------------
A0A2N1XK22      ------------------------------------------------------------
A0A3D0KAC8      ----------LNEQVPAVRRNLEAAQTALNKYQTGSRSVDITAETQSVLDRIVDLEKQIS
A0A3D2Y902      ------------------------------------------------------------
A0A378G3G7      ------------------------------------------MEAKSLLDTMVQLDAQIN
A0A2X5NHJ9      ----------------------------------------------------MNVDNQLN
A0A2J4QEC3      ------------------------------------------------------------
A0A485ADM3      ------------------------------------------------------------
A0A4U9HGU4      ------------MQLPKVRASLDGAEDKLSHYRQQKDSVDLTMEAKSILDSIVAVEGQLN
A0A3S4JGG5      --------------MPEVRSSLDSAEDKLNRFRQANDSVDLSLEAKSVLDTIVGVEAQLN
A0A377ZDH2      ------------------------------------------------------------
A0A3S4HTS8      ------------------------------------------------------------
A0A1W9F5M9      ------------------------------------------------------------
A0A379W6R2      ------------------------------------------------------------
A0A379TA56      ------------------------------------------------------------
A0A655C5P0      ------------------------------------------------------------
A0A6D0I9G1      ------------------------------------------------------------
A0A352MMI7      ------------------------------------------------------------
A0A4Z0LWV1      ---------------------------------------------------RVHLDAPLN
A0A377K431      ---------------------------------------------------MVNIDAQLN
A0A376RY66      ---------------------MDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQLN
A0A778GAM7      -----------AQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQLN
A0A3C2BN18      ------------------------------------------------------------
A0A447LR75      ------------------------------------------------------------
A0A759KJJ5      ------------------------------------------------------------
A0A376D8L7      ------------------------------------------------------------
A0A1V2FV46      ------------------------------------------------------------
A0A6N8QLT3      ------------------------------------------------------------
A0A376SB61      ------------------------------------------------------------
A0A3D1BYV9      ------------------------------------------------------------
A0A536T0W8      ------------------------------------------------------------
A0A3D2M6Y9      ------------------------------------------------------------
A0A3D2YAZ2      ------------------------------------------------------------
A0A350A102      ------------------------------------------------------------
A0A350L5D2      ------------------------------------------------------------
A0A2G9XLE5      ------------------------------------------------------------
A0A6L3MM74      ------------------------------------------------------------
A0A7C3QM04      ------------------------------------------------------------
A0A7I8MVM0      ------------------------------------------------------------
A0A7C0Y3J7      ------------------------------------------------------------
A0A7C3LF61      ------------------------------------------------------------
A0A4R1HDF2      ------------------------------------------------------------
A0A6N1DL48      ------------------------------------------------------------
A0A1V6FYJ1      ------------------------------------------------------------
A0A0C5VQ86      ------------------------------------------------------------
A0A0Q6QV61      ------------------------------------------------------------
A0A2Z3IKG4      ------------------------------------------------------------
A0A3N5RNY4      ------------------------------------------------------------
A0A4Z0M4C7      ------------------------------------------------------------
A0A5Q2QDL1      ------------------------------------------------------------
A0A1V8MBH1      ------------------------------------------------------------
A0A6J4X8D4      ------------------------------------------------------------
A0A318CT66      ------------------------------------------------------------
A0A3N5P205      ------------------------------------------------------------
A0A443K010      ------------------------------------------------------------
A0A6I7NYG5      ------------------------------------------------------------
A0A212AR83      ------------------------------------------------------------
A0A2E2P4I0      ------------------------------------------------------------
A0A2U2CM86      ------------------------------------------------------------
A0A1I0R9R6      ------------------------------------------------------------
A0A2N3BVE7      ------------------------------------------------------------
A0A7C2IB02      ------------------------------------------------------------
A0A6N6SI00      ------------------------------------------------------------
A0A2S5JE21      ------------------------------------------------------------
A0A2R8BKZ2      ------------------------------------------------------------
A0A2S8S361      ------------------------------------------------------------
A0A520ZTR8      ------------------------------------------------------------
A0A316GHM6      ------------------------------------------------------------
A0A238IZI1      ------------------------------------------------------------
A0A7C9INT8      ------------------------------------------------------------
A0A6M1UAR9      ------------------------------------------------------------
A0A1X7ACC1      ------------------------------------------------------------
A0A238KUF6      ------------------------------------------------------------
A0A095CTW3      ------------------------------------------------------------
A0A2E3UGD6      ------------------------------------------------------------
A0A2T0RFH0      ------------------------------------------------------------
A0A285D390      ------------------------------------------------------------
A0A497VHN4      ------------------------------------------------------------
A0A2N6BEI9      ------------------------------------------------------------
A0A0D5N3E9      ------------------------------------------------------------
A0A2N2G716      ------------------------------------------------------------
A0A7C1UTU6      ------------------------------------------------------------
W9VVY5          ------------------------------------------------------------
A0A1E2URD3      ------------------------------------------------------------
A0A2T6MY81      ------------------------------------------------------------
A0A2T6NBQ8      ------------------------------------------------------------
A0A421K431      ------------------------------------------------------------
A0A2G2I5M1      ------------------------------------------------------------
A0A2G2M6F0      ------------------------------------------------------------
A0A1W9J9F8      ------------------------------------------------------------
A0A2S5LFJ9      ------------------------------------------------------------
A0A2D8R8F8      ------------------------------------------------------------
A0A6I4JXQ8      ------------------------------------------------------------
A0A010SNS0      ------------------------------------------------------------
A0A0C2I782      ------------------------------------------------------------
A0A2N8BYF5      ------------------------------------------------------------
A0A558FKX2      ------------------------------------------------------------
A0A1H1DBA0      ------------------------------------------------------------
J2TAD5          ------------------------------------------------------------
J3H699          ------------------------------------------------------------
A0A1H5J974      ------------------------------------------------------------
A0A0K1QRZ4      ------------------------------------------------------------
A0A560RJW9      ------------------------------------------------------------
A0A5E6TID7      ------------------------------------------------------------
A0A5E7CRU7      ------------------------------------------------------------
A0A5E7C564      ------------------------------------------------------------
A0A2W7MAV4      ------------------------------------------------------------
A0A4R3WQH5      ------------------------------------------------------------
W6VFG3          ------------------------------------------------------------
A0A1P8ENT1      ------------------------------------------------------------
A0A2N7XRV4      ------------------------------------------------------------
A0A0Q6QPG8      ------------------------------------------------------------
A0A0F4SWA7      ------------------------------------------------------------
A0A423J219      ------------------------------------------------------------
A0A4P6G9U8      ------------------------------------------------------------
A0A4Y8JE06      ------------------------------------------------------------
A0A502I1X9      ------------------------------------------------------------
A0A502J776      ------------------------------------------------------------
A0A5B0EZF6      ------------------------------------------------------------
A0A059L434      ------------------------------------------------------------
A0A0F4UWN2      ------------------------------------------------------------
A0A5E7WEF5      ------------------------------------------------------------
A0A1G0KSD0      ------------------------------------------------------------
A0A4P6WX84      ------------------------------------------------------------
A0A1D2S760      ------------------------------------------------------------
A0A5B8RW94      ------------------------------------------------------------
A0A258TN88      ------------------------------------------------------------
A0A1F9EUS2      ------------------------------------------------------------
A0A6H9HII8      ------------------------------------------------------------
A0A3N9VAW3      ------------------------------------------------------------
A0A1X0YE57      ------------------------------------------------------------
A0A2K2H9Q8      ------------------------------------------------------------
A0A6I1KNW9      ------------------------------------------------------------
A0A1H4B8T3      ------------------------------------------------------------
A0A1E7IQC3      ------------------------------------------------------------
A0A1M6KEN5      ------------------------------------------------------------
A0A353QLL3      ------------------------------------------------------------
A0A399I453      ------------------------------------------------------------
A0A651FBV9      ------------------------------------------------------------
A0A5C1MDH8      ------------------------------------------------------------
A0A7J4ZSX4      ------------------------------------------------------------
A0A5A9XE04      ------------------------------------------------------------
A0A643G9R1      ------------------------------------------------------------
A0A1G0M8Q7      ------------------------------------------------------------
A0A353MI14      ------------------------------------------------------------
A0A4S1CAW7      ------------------------------------------------------------
A0A562VHD2      ------------------------------------------------------------
A0A7K0J0R7      ------------------------------------------------------------
A0A6I6JNB5      ------------------------------------------------------------
A0A1G0LDK7      ------------------------------------------------------------
A0A6F9WVL7      ------------------------------------------------------------
A0A351Z9A2      ------------------------------------------------------------
A0A3N5FRH4      ------------------------------------------------------------
A0A1V4Y2C3      ------------------------------------------------------------
A0A2N2KTJ4      ------------------------------------------------------------
A0A2N2LQX0      ------------------------------------------------------------
A0A318D3U4      ------------------------------------------------------------
A0A401FQP5      ------------------------------------------------------------
A0A7C2AA26      ------------------------------------------------------------
A0A351Z4H9      ------------------------------------------------------------
A0A2N2KML4      ------------------------------------------------------------
E1YJF1          ------------------------------------------------------------
A0A1J5EVZ6      ------------------------------------------------------------
A0A2G6FCC5      ------------------------------------------------------------
A0A1F9MR25      ------------------------------------------------------------
A0A2G6M7F1      ------------------------------------------------------------
A0A7C3Q9R6      ------------------------------------------------------------
A0A1Q6DMW3      ------------------------------------------------------------
A0A3A6P8F8      ------------------------------------------------------------
A0A6L4AM84      ------------------------------------------------------------
A0A2G2DSM4      ------------------------------------------------------------
A0A1F9NI02      ------------------------------------------------------------
A0A4U1ABX4      ------------------------------------------------------------
A0A1W9M770      ------------------------------------------------------------
A0A1W9M7R6      ------------------------------------------------------------
A0A1M7Y300      ------------------------------------------------------------
A0A4U1ALN4      ------------------------------------------------------------
A0A1E7H876      ------------------------------------------------------------
A0A7C0U459      ------------------------------------------------------------
A0A0F2NF69      ------------------------------------------------------------
A0A1F9NFD0      ------------------------------------------------------------
A0A1M5YLH5      ------------------------------------------------------------
A0A4U1A4C7      ------------------------------------------------------------
A0A509L3P8      ------------------------------------------------------------
A0A3A4S038      ------------------------------------------------------------
A0A1F9N669      ------------------------------------------------------------
A0A1F9PFA7      ------------------------------------------------------------
A0A1H2EN09      ------------------------------------------------------------
K0NP00          ------------------------------------------------------------
A0A7C4N0I9      ------------------------------------------------------------
A0A1E7JCL5      ------------------------------------------------------------
A0A496YAH9      ------------------------------------------------------------
A0A1V4S7E4      ------------------------------------------------------------
A0A2N2H8D2      ------------------------------------------------------------
A0A2N2KC63      ------------------------------------------------------------
A0A3A4ZYW4      ------------------------------------------------------------
A0A1V4MCJ4      ------------------------------------------------------------
A0A661M0W4      ------------------------------------------------------------
A0A4U8YLL7      ------------------------------------------------------------
A0A445MZQ4      ------------------------------------------------------------
A0A2M7WWF7      ------------------------------------------------------------
A0A0M9E0E3      ------------------------------------------------------------
A0A4Q3IRI1      ------------------------------------------------------------
A0A7C1C6X5      ------------------------------------------------------------
A0A354EF47      ------------------------------------------------------------
A0A2G6MSP7      ------------------------------------------------------------
B7RS54          ------------------------------------------------------------
A0A1I6ENM4      ------------------------------------------------------------
A8LNM8          ------------------------------------------------------------
A0A0T5NSU3      ------------------------------------------------------------
A0A5P9I718      ------------------------------------------------------------
A0A2M8J3R9      ------------------------------------------------------------
A0A1I6X762      ------------------------------------------------------------
A0A0P1EFX8      ------------------------------------------------------------
A0A2G5KB39      ------------------------------------------------------------
A0A2N3CNV1      ------------------------------------------------------------
A0A257F1F4      ------------------------------------------------------------
A0A2D5J8T8      ------------------------------------------------------------
A0A2E3P9W6      ------------------------------------------------------------
A0A2G2B1P9      ------------------------------------------------------------
A0A258GCD5      ------------------------------------------------------------
A0A443INY4      ------------------------------------------------------------
A0A2D9YR88      ------------------------------------------------------------
A0A4Q3ZBK4      ------------------------------------------------------------
A0A1G9FY29      ------------------------------------------------------------
A0A6N9RUN2      ------------------------------------------------------------
A0A1G8QZS5      ------------------------------------------------------------
A0A1H2Y469      ------------------------------------------------------------
A0A497ZQU7      ------------------------------------------------------------
A0A4U8YMP3      ------------------------------------------------------------
A0A1Q8QQ99      ------------------------------------------------------------
A0A7C2SIB2      ------------------------------------------------------------
A0A3D5ZY44      ------------------------------------------------------------
A0A1G5C236      ------------------------------------------------------------
A0A432HIS7      ------------------------------------------------------------
A0A520CSP5      ------------------------------------------------------------
A0A372IH36      ------------------------------------------------------------
A0A540VW45      ------------------------------------------------------------
A0A1H9C241      ------------------------------------------------------------
A0A2E3FCR1      ------------------------------------------------------------
A0A4S3MG69      ------------------------------------------------------------
A0A3E0H727      ------------------------------------------------------------
A0A1I3TTC3      ------------------------------------------------------------
A0A1H3IZW6      ------------------------------------------------------------
A0A0M6YG59      ------------------------------------------------------------
A0A1H7G8B0      ------------------------------------------------------------
A0A7C3Z8T7      ------------------------------------------------------------
A0A1V4QMH7      ------------------------------------------------------------
A0A496XZQ4      ------------------------------------------------------------
A0A7C3UZM2      ------------------------------------------------------------
A0A1F9BJF7      ------------------------------------------------------------
F2NDF5          ------------------------------------------------------------
A0A656PSQ6      ------------------------------------------------------------
A0A4Q3ZDI7      ------------------------------------------------------------
A0A537PRC6      ------------------------------------------------------------
A0A1I3XJ27      ------------------------------------------------------------
A0A562CGU2      ------------------------------------------------------------
A0A7C9VCB3      ------------------------------------------------------------
A0A1I7DCG1      ------------------------------------------------------------
A0A3A3H6D9      ------------------------------------------------------------
A0A0Q6VA36      ------------------------------------------------------------
A0A1B2EQN1      ------------------------------------------------------------
A0A1E7HSL6      ------------------------------------------------------------
A0A2M7JX59      ------------------------------------------------------------
A0A3A4XVN3      ------------------------------------------------------------
A0A1E7JEV6      ------------------------------------------------------------
A0A2N2KDY5      ------------------------------------------------------------
A0A3N5YUD9      ------------------------------------------------------------
A0A0W1DLQ3      ------------------------------------------------------------
A0A246JVD8      ------------------------------------------------------------
A0A2N3BB54      ------------------------------------------------------------
A0A1H6G7A3      ------------------------------------------------------------
A0A0A7PGL6      ------------------------------------------------------------
A0A4Q2Z4L0      ------------------------------------------------------------
A0A5C4N0H6      ------------------------------------------------------------
A0A1V4M8I1      ------------------------------------------------------------
A0A7C0XE92      ------------------------------------------------------------
A0A1E7HFN0      ------------------------------------------------------------
A0A7J0BHG1      ------------------------------------------------------------
A0A1M5GH86      ------------------------------------------------------------
A0A1W1XQZ5      ------------------------------------------------------------
A0A6V8LMJ3      ------------------------------------------------------------
A0A2K8WHP8      ------------------------------------------------------------
A0A1J5N774      ------------------------------------------------------------
A0A2C8F781      ------------------------------------------------------------
A0A2E3R6G0      ------------------------------------------------------------
A0A7J0BUD3      ------------------------------------------------------------
A0A1F8XMK2      ------------------------------------------------------------
A0A3M8EMP2      ------------------------------------------------------------
A0A2J6J6K6      ------------------------------------------------------------
A0A661PSB9      ------------------------------------------------------------
A0A661QBT6      ------------------------------------------------------------
A0A6I2SLK2      ------------------------------------------------------------
A0A0A8WSG4      ------------------------------------------------------------
S7TK97          ------------------------------------------------------------
S7UE93          ------------------------------------------------------------
A0A3D5BR56      ------------------------------------------------------------
A0A2N2IB15      ------------------------------------------------------------
A0A1I3PSR2      ------------------------------------------------------------
A0A1I4GEK4      ------------------------------------------------------------
A0A7C8B5M6      ------------------------------------------------------------
A0A1W7QPT7      ------------------------------------------------------------
A0A6S6M1Y8      ------------------------------------------------------------
A0A6V8MCR2      ------------------------------------------------------------
A0A6V8N3X1      ------------------------------------------------------------
A0A6M4XJ81      ------------------------------------------------------------
A0A0M4D373      ------------------------------------------------------------
A0A1L3GKM9      ------------------------------------------------------------
A0A2T5R3J5      ------------------------------------------------------------
A0A1G6EKK9      ------------------------------------------------------------
A0A7C1DJX8      ------------------------------------------------------------
A0A3D6C3I2      ------------------------------------------------------------
S0G1D4          ------------------------------------------------------------
A0A661T246      ------------------------------------------------------------
A0A2G6CSG7      ------------------------------------------------------------
A0A2G6NB59      ------------------------------------------------------------
A0A5K8A7T9      ------------------------------------------------------------
A0A1W9U045      ------------------------------------------------------------
A0A1F9L9G4      ------------------------------------------------------------
A0A328FD76      ------------------------------------------------------------
A0A348UX90      ------------------------------------------------------------
A0A357Z0N5      ------------------------------------------------------------
A0A0F2R2U0      ------------------------------------------------------------
A0A5K7ZK00      ------------------------------------------------------------
A0A5K7YCX8      ------------------------------------------------------------
A0A5K7Z388      ------------------------------------------------------------
A0A352B502      ------------------------------------------------------------
A0A410V446      ------------------------------------------------------------
A0A0R3KGJ5      ------------------------------------------------------------
A0A0R3N604      ------------------------------------------------------------
A0A1B1UCM8      ------------------------------------------------------------
A0A1N6JQ20      ------------------------------------------------------------
A0A1M5TI07      ------------------------------------------------------------
A3X191          ------------------------------------------------------------
A0A1H4RKV5      ------------------------------------------------------------
A0A160UA87      ------------------------------------------------------------
A0A1Q5SFV5      ------------------------------------------------------------
A0A7C3Y7G3      ------------------------------------------------------------
A0A430DNP0      ------------------------------------------------------------
A0A3A0FQ32      ------------------------------------------------------------
A0A1E4UZA0      ------------------------------------------------------------
A0A1H9KL56      ------------------------------------------------------------
A0A1A9KEF8      ------------------------------------------------------------
A0A5E6PKN5      ------------------------------------------------------------
A0A0N9W1V6      ------------------------------------------------------------
A0A423GQ41      ------------------------------------------------------------
A0A423H7J2      ------------------------------------------------------------
A0A502HNM8      ------------------------------------------------------------
A0A4Q7H223      ------------------------------------------------------------
A0A1H4N2K9      ------------------------------------------------------------
A0A2K4KWF7      ------------------------------------------------------------
A0A3E0WXH2      ------------------------------------------------------------
A0A2N2TRC8      ------------------------------------------------------------
A0A1V4CIZ7      ------------------------------------------------------------
A0A1M3BXA5      ------------------------------------------------------------
A0A1Y2R3U6      ------------------------------------------------------------
A0A167HVD6      ------------------------------------------------------------
A0A1V3SCT6      ------------------------------------------------------------
L0H287          ------------------------------------------------------------
A0A495VG93      ------------------------------------------------------------
A0A4R3MYM4      ------------------------------------------------------------
G2E3C0          ------------------------------------------------------------
                                                                            

E1Y9C0          ------------------------------------------------------------
A0A1N6SH58      ------------------------------------------------------------
A0A4Q3AQN2      ------------------------------------------------------------
A0A1W9HS52      YKNLENTLVKLKEESRKLE--------TEKSTLNARLKADKSEI--------------SK
A0A2D5LFD8      YQPGSFAMKSLEQKKAALEPLL---LASQLRALDTALQVNSNQINSTKLELKNLIQNFLR
A0A4D8PLT4      YGDKHQDIVNLRRGIGELKARIRDEVGKIQKGLDADLEVAR-----------------IR
A0A7J5VV32      ------------------------------------------------------------
A0A6G6X2Z4      --------------MSKMV-----------------------------------------
Q44570          ------------------------------------------------------------
A0A3N5MZ53      ------------------------------------------------------------
A0A534E4H4      ------------------------------------------------------------
A0A534I2B6      IEGIRKRYEAA---KSEEA-----------------------------------------
A0A1C2JGD0      ------------------------------------------------------------
A0A259LQ70      ------------------------------------------------------------
A0A4V2SPR5      ------------------------------------------------------------
A0A3N5PM86      LQSVETEYRVA---LAEEK-----------------------------------------
A0A2E5YSA4      --------------GDEIE-----------------------------------------
A0A0N0XAV4      -----------------MN-----------------------------------------
A0A0P9QD19      YTREHPTYRSL---MSQMN-----------------------------------------
F3FHG4          YTREHPTYRSL---MSQMN-----------------------------------------
F3GGI0          YTREHPTYRSL---MSQMN-----------------------------------------
A0A0P9LE74      --TEHPTYRSL---MSQMN-----------------------------------------
A0A3M4ZQ14      YTREHPTYRGL---MSQIN-----------------------------------------
A0A3M5YLE8      YTREHPTYRGL---MSQIN-----------------------------------------
A0A3M3RP89      YTREHPTYRGL---MSQIN-----------------------------------------
A0A0P9QIY7      YTREHPTYRGL---MSQIN-----------------------------------------
A0A0P9VVH7      YTREHPTYRGL---MSQIN-----------------------------------------
A0A0Q0FJK6      YTREHPTYRGL---MSQIN-----------------------------------------
A0A0Q0G2J0      YTREHPTYRGL---MSQIN-----------------------------------------
A0A3M3LF66      YTREHPTYRGL---MSQIN-----------------------------------------
A0A0P9WIR8      YTREHPTYRSL---MSQIN-----------------------------------------
A0A3M3KPE5      YTREHPTYRSL---MSQIN-----------------------------------------
A0A3M4C263      YTREHPTYRSL---MSQIN-----------------------------------------
A0A3M5AD05      YTREHPTYRSL---MSQIN-----------------------------------------
A0A0Q0D3D2      YTREHPTYRSL---MSQMN-----------------------------------------
A0A0N0FS39      YTREHPTYRSL---MSQMN-----------------------------------------
A0A3M6GHH2      YTREHPTYRSL---MSQMN-----------------------------------------
A0A0P9R9W0      YTREHPTYRSL---MSQMN-----------------------------------------
A0A0Q0B9T0      YTREHPTYRSL---MSQMN-----------------------------------------
A0A3M6CFI7      YTREHPTYRSL---MSQMN-----------------------------------------
A0A0P9JXN0      YTREHPTYRSL---MSQMN-----------------------------------------
A0A3M6FIV7      YTREHPTYRSL---MSQMN-----------------------------------------
A0A3M3PLW9      YTREHPTYRSL---MSQMN-----------------------------------------
A0A3M4ENY1      YTREHPTYRSL---MSQMS-----------------------------------------
A0A3M5EZK7      YTREHPTYRSL---MSQMN-----------------------------------------
A0A0P9SPP5      YTREHPTYRSL---MSQMN-----------------------------------------
A0A658KL17      YTREHPTYRSL---MSQMN-----------------------------------------
A0A3M3NNF2      YTREHPTYRSL---MSQMN-----------------------------------------
A0A3M4A0E8      YTREHPTYRSL---MSQMN-----------------------------------------
A0A3M4PBZ2      YTREHPTYRSL---MSQMN-----------------------------------------
A0A3M6AI26      YTREHPTYRSL---MSQMN-----------------------------------------
A0A0P9IWP8      YTREHPTYRSL---MSQMN-----------------------------------------
A0A0P9KZ49      YTREHPTYRSL---MSQMN-----------------------------------------
A0A0P9V840      YTREHPTYRSL---MSQMN-----------------------------------------
A0A0Q0AIE5      YTREHPTYRSL---MSQMN-----------------------------------------
A0A3M2ZQH6      YTREHPTYRSL---MSQMN-----------------------------------------
A0A0N8SQG2      YTREHPTYRSL---MSQMN-----------------------------------------
A0A0W8HFU1      YTREHPTYRSL---MSQMN-----------------------------------------
A0A3M5M873      YTREHPTYRSL---MSQMN-----------------------------------------
A0A0P9VHH8      YTREHPTYRSL---MSQMN-----------------------------------------
A0A0P9YV98      YTREHPTYRSL---MSQMN-----------------------------------------
A0A3M3G2W8      YTREHPTYRSL---MSQMN-----------------------------------------
A0A3M6C224      YTREHPTYRSL---MSQMN-----------------------------------------
A0A3M5K254      YTREHPTYRSL---MSQMN-----------------------------------------
A0A3M5JFB0      YTREHPTYRSL---MSQMN-----------------------------------------
A0A3M3TQV3      YTREHPTYRSL---MSQMN-----------------------------------------
A0A3M3EF92      YTREHPTYRSL---MSQMN-----------------------------------------
A0A3M5J1E2      YTREHPTYRSL---MSQMN-----------------------------------------
A0A3M5G7H9      YTREHPTYRSL---MSQMN-----------------------------------------
A0A3M4A376      YTREHPTYRSL---MSQMN-----------------------------------------
A0A0Q0A5T8      YTREHPTYRSL---MSQMN-----------------------------------------
A0A0P9SCD7      YTREHPTYRSL---MSQMN-----------------------------------------
A0A0P9T4G3      YTREHPTYRSL---MSQMN-----------------------------------------
A0A0P9VKB0      YTREHPTYRSL---MSQMN-----------------------------------------
A0A0Q0BM35      YTREHPTYRSL---MSQMN-----------------------------------------
A0A3M3TPR7      YTREHPTYRSL---MSQMN-----------------------------------------
A0A3M3U4Q3      YTREHPTYRSL---MSQMN-----------------------------------------
A0A0P9UCX7      YTREHPTYRSL---MSQMN-----------------------------------------
A0A0P9S1F1      YTREHPTYRSL---MSQMN-----------------------------------------
A0A0P9QCJ2      YTREHPTYRSL---MSQLN-----------------------------------------
A0A0P9Q329      YTREHPTYRSL---MSQMN-----------------------------------------
A0A3M5GJ64      YTREHPTYRSL---MSQMN-----------------------------------------
A0A0P9MPC7      YTREHPTYRSL---MSQMN-----------------------------------------
A0A3M2XYQ3      YTREHPTYRSL---MSQMN-----------------------------------------
A0A0P9XCE1      YTREHPTYRSL---MSQMN-----------------------------------------
A0A3M3EFX7      YTREHPTYRSL---MSQMN-----------------------------------------
A0A3M5B9D9      YTREHPTYRSL---MSQMN-----------------------------------------
A0A0P9RRZ3      YTREHPTYRSL---MSQMN-----------------------------------------
A0A3M2VEK7      YTREHPTYRSL---MSQMN-----------------------------------------
A0A0N8R9B3      YTREHPTYRSL---MSQMN-----------------------------------------
A0A0P9VA27      YTREHPTYRSL---MSQMS-----------------------------------------
A0A3M4YBJ4      YTREHPTYRSL---MSQMS-----------------------------------------
A0A0P9J470      YTREHPTYRSL---MSQIN-----------------------------------------
A0A0Q0EVJ8      YTREHPTYRSL---MSQIN-----------------------------------------
A0A3M5UI30      YTREHPTYRSL------MN-----------------------------------------
A0A3M5YQT8      YTREHPTYRSLMSQMSQMN-----------------------------------------
A0A3M5F5X1      YTREHPTYRSL---MSQMN-----------------------------------------
A0A3M5R8G1      YTREHPTYRSL---MSQMN-----------------------------------------
A0A3M5V012      YTREHPTYRSL---MSQMN-----------------------------------------
A0A3M3GA16      YTREHPTYRSL---MSQMN-----------------------------------------
A0A3M3UCT3      YTREHPTYRSL---MSQMN-----------------------------------------
A0A3M3CJL0      YTREHPTYRSL---MSQMN-----------------------------------------
A0A3M3F6F5      YTREHPTYRSL---MSQMS-----------------------------------------
A0A3M3P9B7      YTREHPTYRSL---MSQMS-----------------------------------------
A0A0N8QB74      YTREHPTYRSL---MSQMN-----------------------------------------
A0A0Q0AUD0      YTREHPTYRSL---MSQMN-----------------------------------------
A0A3M5VR55      YTREHPTYRSL---MSQMN-----------------------------------------
A0A0Q0FK97      YTREHPTYRSL---MSQMN-----------------------------------------
A0A3M5KZ75      YTREHPTYRSL---MSQIN-----------------------------------------
A0A3M5L3G5      YTREHPTYRSL---MSQIN-----------------------------------------
A0A519ERR1      ------------------------------------------------------------
A0A4Q3Q1M2      ------------------------------------------------------------
A0A4Q3MHR1      ------------------------------------------------------------
A0A520GDZ4      ------------------------------------------------------------
A0A318DSU0      --------------MSQIG-----------------------------------------
A0A538PF21      ------------------------------------------------------------
A0A1W1ZH10      ------------------------------------------------------------
A0A1W2FF24      ------------------------------------------------------------
A0A524JYQ6      AEGVSSRLAMA---QSKED-----------------------------------------
A0A4Q3MA17      ------------------------------------------------------------
A0A0N0M5F7      ------------------------------------------------------------
A0A537M754      ------------------------------------------------------------
A0A1V1PDB4      ------------------------------------------------------------
A0A2M7C324      VSGFEREYEMA---RANES-----------------------------------------
A0A4Q3HHG6      ------------------------------------------------------------
A0A3B7DTA4      ------------------------------------------------------------
A0A432ZK62      MVACLGLDLCW---FDRRL-----------------------------------------
A0A1V5EEP4      ------------------------------------------------------------
A0A1V5EF48      ------------------------------------------------------------
A0A0S6X1X6      ------------------------------------------------------------
A0A537Y5L8      ------------------------------------------------------------
A0A4Q3L2X2      ------------------------------------------------------------
A0A4Q3T8J1      ------------------------------------------------------------
A0A4Q4ANM4      ------------------------------------------------------------
A0A4Q3UEC7      ------------------------------------------------------------
A0A1H5YYQ4      ------------------------------------------------------------
A0A1X4NLK2      KRRGANTAAEQ---AQPVA-----------------------------------------
A0A1X4NWB5      KRREEASADVQ---PKRTP-----------------------------------------
A0A1M5UQ38      ------------------------------------------------------------
A0A327YI48      ------------------------------------------------------------
A0A1B1PNL6      KRSEETPEDPP---ILP-------------------------------------------
A0A2U8H9H9      KRVDETPEDPP---IFP-------------------------------------------
A0A6B2NBB8      KRVDETPEDPP---IFP-------------------------------------------
A0A1X6YIC0      ------------------------------------------------------------
A0A1I5E9E9      ---------------MK-------------------------------------------
A0A1X6Z7N7      ---------------MK-------------------------------------------
A0A2E1DQ13      AMKQAPEAAAE---DVT-------------------------------------------
A0A1H8C800      ---------------MK-------------------------------------------
A0A2N3EZ05      -MRQAPEAEAE---DAT-------------------------------------------
A0A655R819      ------------------------------------------------------------
A0A655RNN3      ------------------------------------------------------------
A0A0R0BVC7      ------------------------------------------------------------
A0A3N5J7U8      ------------------------------------------------------------
A0A1S7S3I8      ------------------------------------------------------------
A0A519E8D7      ------------------------------------------------------------
A0A3S1FD32      ------------------------------------------------------------
A0A434DUT4      ------------------------------------------------------------
A0A528D3U3      ------------------------------------------------------------
A0A3S3UPT3      ------------------------------------------------------------
A0A3S1E286      ------------------------------------------------------------
A0A531AC71      ------------------------------------------------------------
A0A436K268      ------------------------------------------------------------
A0A434IDQ0      ------------------------------------------------------------
A0A435IRM5      ------------------------------------------------------------
A0A3S2C404      ------------------------------------------------------------
A0A435F6C0      ------------------------------------------------------------
A0A435BMN6      ------------------------------------------------------------
A0A529XQ54      ------------------------------------------------------------
A0A530BJC1      ------------------------------------------------------------
A0A348SRI7      ------------------------------------------------------------
A0A354EI73      ------------------------------------------------------------
A0A4P7EP83      ------------------------------------------------------------
A0A6I1QB25      ------------------------------------------------------------
A0A655ZZQ1      -------MVRKQRGKLDAKAYFDEKLREL-------------------------------
A0A1S0ZAI3      --MPTLEIAHKKLEQARKA-----------------------------------------
A0A3A4NIE9      ------------------------------------------------------------
A0A3A4NUI9      ------------------------------------------------------------
A0A524I3Z6      ------------------------------------------------------------
A0A524PCL7      ------------------------------------------------------------
A0A356GQV1      ------------------------------------------------------------
A0A1J5DAY8      ------------------------------------------------------------
A0A524P237      ------------------------------------------------------------
A0A3C0L0A8      ------------------------------------------------------------
A0A176S762      ------------------------------------------------------------
A0A377ZC40      ------------------------------------------------------------
A0A378BPJ7      ------------------------------------------------------------
A0A2J5PAJ7      ------------------------------------------------------------
A0A377ZDN3      ------------------------------------------------------------
A0A7A9Y5Q1      ------------------------------------------------------------
A0A1G3JY11      ------------------------------------------------------------
A0A661N3U1      ------------------------------------------------------------
A0A1W9WUD9      ------------------------------------------------------------
A0A1W1ZQK0      TQSQKKVEKKTSASLLNPVAPTQLDDDSF-------------------------------
A0A6I1R304      VVEPELRDSAHTKMEFSLSEVLPANRYQE-------------------------------
A0A1W9PMU6      NLLASCQPRSVSLPTLRE------------------------------------------
A0A3S1WTQ1      ------------------------------------------------------------
A0A530CUR9      ------------------------------------------------------------
A0A6L6H5T1      ------------------------------------------------------------
A0A6D0ELN7      ------------------------------------------------------------
A0A1M6N1X5      ------------------------------------------------------------
A0A561M3U0      GSHPEVIALNAQIATLRAQESVFAQQIER-------------------------------
A0A2N6BZD5      ------------------------------------------------------------
A0A1G3VVY5      KGVPKDNVFDRQEAQ---------------------------------------------
A0A7C3S273      ------------------------------------------------------------
A0A7C4WJ18      ------------------------------------------------------------
A0A7C3V565      ------------------------------------------------------------
A0A351B422      ------------------------------------------------------------
F2NEE9          ------------------------------------------------------------
A0A2W5J775      ------------------------------------------------------------
A0A352Q5C1      ------------------------------------------------------------
A0A435NNF5      ------------------------------------------------------------
A0A3S2AQS7      ----------------------------------------------------------NK
A0A436XH86      ------------------------------------------------------------
A0A527ZPD6      ------------------------------------------------------------
A0A529KRW3      ------------------------------------------------------------
A0A530ZLX0      ------------------------------------------------------------
A0A355TB56      ------------------------------------------------------------
A0A1F9E324      SEYPEMKRLRNQMETIQKRLTLEGNRIIA----GIRSEYESGLR---------------K
A0A432SAI6      ------------------------------------------------------------
A0A4Q3LBH4      EDYPTVAAAKAQLRELDRQIGSLAGNIRS----GIRNAYQISNA---------------R
A0A4Q3LWP3      EDFPAVVEITAQMRELARQINLIGGNIRS----GIKNQYDVARA---------------R
A0A7C3JPP4      -----MSRVFEALTKASHEKEHGAASGAA-------------------------------
A0A534V9L7      QGALPMSRVFEALNKASNEKKRDGQTAPT-------------------------------
A0A7C3JJT4      -----MSRVFEALTKASRERGGHGDSHVN-------------------------------
A0A2N6VGL1      ------------------------------------------------------------
A0A3M3H5V6      ------------------------------------------------------------
A0A524M660      ------------------------------------------------------------
A0A7C3JSX5      ------------------------------------------------------------
A0A7I8MQ67      KLSKAFEKQNKASQKANSEKVLSFSRLQE-------------------------------
A0A0C1TRU6      ------------------------------------------------------------
A0A2Z5SSF4      ------------------------------------------------------------
A0A2T4ZJZ6      ESHPNVIAVDKQIARLQSQLQSHNQMIKT-------------------------------
A0A0B8PTA8      ------------------------------------------------------------
A0A0B8QF75      ------------------------------------------------------------
A0A6P2T4F7      ------------------------------------------------------------
A0A4Q4CIB1      ------------------------------------------------------------
A0A522ACJ9      GVEPDSNSPSSPPDQIAAHRATDQPTSSD-------------------------------
A0A1T2KYM8      PKHPKMIAAKAAHQARISRMKKEVDIVLN----NIDKEFERAQW---------------L
A0A3N5Z7F8      ------------------------------------------------------------
A0A239HD34      RLHAAIEKARAEREKA--------------------------------------------
A0A2G9ZR82      DAYPPVNALKSNMASISEQIKTEENKIFQ----SIASDYKTALK---------------K
A0A4U9I390      ------------------------------------------------------------
A0A0P7ZZE4      RANPAAKPAPRGNGHASADAGAARRPQAA-------------------------------
A0A369R0Q9      RPEPAANPARRGAGQAGAVAGAVRGPQAA-------------------------------
A0A327LYE6      PEDAASTQTSPEPPRARDQEDQGATSPDA-------------------------------
A0A5A9ZTV3      PEDAASTQTSPEPPRARDQEDQGATSPDA-------------------------------
A0A6J4YZ98      EDYPKVKPLKTRMLSLAARIESEEDKIFQ----AIKIDYLEALK---------------K
A0A2X3M011      ------------------------------------------------------------
I2WC85          ------------------------------------------------------------
A0A7A9K1G5      KDHPTYRALLEKRQTLEQERKRLNKRVSA-------------------------------
A0A7B7KSB7      KDHPTYRALLEKRQTLEQERKRLNKRVSA-------------------------------
A0A400JH80      KDHPTYRALLEKRQTLEQERKRLNKRVSA-------------------------------
A0A479JNB1      ------------------------------------------------------------
A0A5C9AF52      ------------------------------------------------------------
A0A797FC39      ------------------------------------------------------------
A0A797FHC1      ------------------------------------------------------------
D8EEU7          KDHPTYRALLEKRQTLEQERKRLNKRVSA-------------------------------
A0A6D0EYC7      ------------------------------------------------------------
A0A7A6DHB0      ------------------------------------------------------------
A0A2H9EHM4      ------------------------------------------------------------
A0A7A5MLK0      ------------------------------------------------------------
A0A380B3D7      ------------------------------------------------------------
F5NSX0          ------------------------------------------------------------
A0A534XP85      ------------------------------------------------------------
A0A0P1H2H0      ADVEAPAPVKDDAPQATGFLGLSGRSADD-------------------------------
A0A258WKV0      -----------------------------------------------------------E
A0A377N8F8      SAHPIYRALDEKRKTLLANKAALELKINA----MPKTQQNILR-----------------
A5G4N9          VLEPHMEVLEPHMEVLEPHDESSTGERLV-------------------------------
A0A3C2DSE7      DRYPAMQSARSDLNAATASLRQQVEQVVA----SIERSYQLAVA---------------N
A0A2X1JBG5      RQHPAYIALLEKRQTLLNTKNAINKSIKR----LPKTQQEILR-----------------
A0A377LY04      KRHPAYRTLLEKRRTLEEEKAKLNDRVTA-------------------------------
A0A5C9ABR5      ------------------------------------------------------------
A0A5J9WU72      ------------------------------------------------------------
A0A2X3K9R3      KAHPAYRTLLEKRQALEDEKSKLNGRVTA-------------------------------
A0A3T9EHW9      KVHPAYRTLLEKRQALEDEKAKLNGRVTA-------------------------------
A0A484X141      KVHPAYRTLLEKRQALEDEKAKLNGRVTA-------------------------------
A0A5N9VWI6      KVHPAYRTLLEKRQALEDEKAKLNGRVTA-------------------------------
A0A6D0EJQ0      ------------------------------------------------------------
A0A444R390      ------------------------------------------------------------
A0A376LLF8      ------------------------------------------------------------
A0A6L7CT21      ------------------------------------------------------------
A0A4Q3LR91      AGYPPAKALQAQIRALDASLRSEDNRVSN----VLSQNYQASLR---------------R
A0A6C9IKN8      SVDNLIVGLNIKLKNNREHEEQTQKRIEA----VPAQQKYVLT-----------------
A0A4V1TR68      PDYPPAKALREQRKQIDASIEREQARVTG----ALTENYTAAVS---------------R
A0A444IY46      ------------------------------------------------------------
A0A6I7N627      ------------------------------------------------------------
A0A6L3ZR06      PEYPAAKALREKADSLKRSIAAQEGRAVE----SYVTNFEAAAK---------------R
A0A3E0WKI3      SQHPNIIALDEQMERLRERRREFDSRIRE----LPQSQQELLR-----------------
A0A1H3I2J1      DSFDALDALDAQPLALEDELRSPERDETE-------------------------------
A0A1V5DJV0      ------------------------------------------------------------
A0A520IUC4      PDFPDMVALRNRIQEIDISLRRETGEVSS----SLRSAYLAALG---------------R
A0A521LJG5      DNHPKIQAVRSELNAVRARFITETQRITL----AVRAELDAAKS---------------E
A0A531IBQ7      ---------------VSKQIFDQLNQLTE----SYRNDYEVALQ---------------R
A0A0P1FWI8      ------------------------------------------------------------
A0A6L8LHC6      ------------------------------------------------------------
A0A1V4WHZ7      ---------------------------------AIKNDYAIARA---------------K
A0A1E5AJN5      PDFPEMVRLAGQIEDTQNQLAKEISIISD----SFVLRLAQAQQ---------------R
A0A2N3D2J1      SDYPVMVQLAAQIAEVNRQIDREAGNVRS----AIRTEFEVARD---------------Q
A0A2N2GVE1      ERHEEVIRQERILDVVRGQLTSELALSED----ALVAEYQLKER---------------N
A0A2N2INV3      ERHEEVIRQERILDVVRGQLTSELALSED----ALVAEYQLKER---------------N
A0A233IKJ2      DKHPKLKAAQAELASVKRNLNSELKQLLN----GINNELQAAKQ---------------A
A0A1Y5DXG5      RNHPNYQGIVEQISAVQKQRDALAQKIAN----LPETQQKLLG-----------------
A0A0B8P2H5      KQHPAYVAVLEKRKTLEAQKRRLEGQIKQ----LPKTQREVLR-----------------
A0A380AQW6      RVHPAYRALLEKRATLEAEKARLGKQVQS----LPKTQQEILR-----------------
A0A2G2GD62      SMLVSVTEFHPEVIKLNEEVFNLRKNIQA----TVVLGIKTIKT---------------R
A0A3R9C3P5      GNAEAVVDLRGKIEQSRADLDRATKQYLQ----TMRAKLAALDH---------------E
A0A0M3GBT1      GNAEAVVDLRGKIEKSRADLSFATKQYLQ----TMRAKLAALDH---------------E
B3Q577          GNAEAVVDLRGKIEKSRADLSFATKQYLQ----TMRAKLAALDH---------------E
A0A483QWI8      KEHPTYKALIEKRETLKEERAKLNKKVTA----MPKTQQEILR-----------------
A0A483UXD3      KEHPTYKALIEKRETLKEERAKLNKKVTA----MPKTQQEILR-----------------
A0A0A8J8L3      KEHPTYKALMEKQQTLQTEKIKLNKKVSA----MPSTQQEVLR-----------------
A0A660DJ38      KEHPTYKALIEKRQTLQQEKTKLNKRVSG----MPSTQQEVLR-----------------
A0A524P331      ERHPQVKAVQGQIDQLQGKIQSTFETARL--------------------------NLTKQ
A0A4V1SSM5      PRYPDAIRVTQQLEQIDRQIADESRRIVS----GLQANAQAASA---------------R
A0A4Q3K8G7      -------RARDELAKVDGEIQAEIRRVMS----NLEARVQVAGQ---------------R
A0A7C7W7M2      SRHNRMIALESEISSAKRDLLVRVADVVA----GISNEYKLAVR---------------I
A0A1M7HC79      PRHPNYKTLQRKKRQLQQERAELNERVNQ----LPAEQQEVVR-----------------
A0A1D3JZN6      RQHPAYRALLAKLDELTGKQAQLTKRIEG----LPSTQQELLS-----------------
A0A1V6ESG1      PDFPKMLQTKAQIAELDLRIKAEIAAVLA----SVKSQYDAAKR---------------Q
A0A1H7YHK3      REHPAYRALMKQIGELESRKAGFNKQVGE----LPDTQQELLR-----------------
A0A534SH66      ------------------------------------------------------------
A0A3M0ZZ99      ALRGELAAIEGREAEVTAELRRALQQGNL-------------------------------
A0A238LBD3      LGAPATTELDAQSAALRAALSESVEPPAD----EPEAAQDAVTP----------------
A0A328C2K5      DEYPEVRAVDEQLAVVRQSIDEEIGRIRS----AVANRAAVTRR---------------N
A0A5C6X8M3      DAHPEVRAVDEQLEVVRRSIEDEIGRIRT----AVANRAAVTRR---------------N
A0A3D8MRR7      DAHPEVRAVDEQLEVVRRSIEEEIGRIRT----AVANRAAVTRR---------------N
A0A5C6UBJ7      DAHPEVRAVDEQLEVVRRSIEEEIGRIRT----AVANRAAVTRR---------------N
A0A5C6XGM3      DAHPEVRAVDEQLEVVRRSIEDEIGRIRT----AVANRAAVTRR---------------N
A0A537NZJ1      ------------------------------------------------------------
A0A7C4R3C4      IDRLIQNGLLYPGGKLTPKGIAEAERVKS-------------------------------
A0A0P1FRV5      PVDPPVEASVEVPAEVTDAAPVQRRGLLS-------------------------------
A0A4Q4CVW6      ---------SQEIGKVGEALRSELAVLDR------------------------------N
A0A090R136      KEHPAYIALLDKKSVLISERKKINKQVQD----LPKTQREVLR-----------------
A0A661JU93      ELHPEVVAVNREIAKTKEELNRAVANALKSGPSAGDPIFQNLIA-GIIESETKIQSTEGR
A0A2E2T3V8      PAHPSMVRITGEIWSVQQTLAKALERSAR----QIDFGNANAQA---------------R
A0A367UAB4      PAHPSMVRISGEIWSVQQTLAKALERSAR----QIDFGNANAQA---------------R
A0A1F2ZW35      DSHPKLIQVRNELSAVRARFIIETQRITL----AVRAELDAATS---------------E
A0A377V641      KEHPTYKALMEKRKTLQDERGKLNKRVAT----MPETQQEILR-----------------
A0A1F2YJ88      AEHPVMQQMNAQLGAINKKIGELNSTLKE-------------------------------
A0A6L3ZWI0      ------------------------------------------------------------
A0A5N8AL61      AMHPALVSVNSQIAEIDRNIQAETERVRM----GVAAEANAASQ---------------R
A0A0J7XGZ1      ALHPDVVQARDELADVRAQLGAELGRIVS----GLRADVQIAES---------------R
I4CBA7          SGHFQHSLAQGKLYAMEKAISEVEQS-------EIASSLEAAKK---------------R
A3VE95          PDHPQRVRIANEIAGVEAEMQTEAERIIE----LRRNEVEVARL---------------R
A0A1G0NL95      PGHPRMLALAQQEARLQTAARSLNDWVKK----LPETQRNILR-----------------
A0A024KA69      -----GEAVRAAQQALGLRSGFEERQALA-------------------------------
A0A0L1KFN4      PGYPQAQSLQSRIDELSRAIEREEARVSA----SVQAEYQQALA---------------R
A0A3P5DSS6      KEHPTYKALMEKRKTLQDEKAKLNKRVSA----MPETQQEILR-----------------
A0A483YEL5      QEHPTYKALMEKRKILQDERAKLNKRVST----MPETQQEVLR-----------------
A0A658GUJ0      QEHPTYKALMEKRKILQDERAKLNKRVST----MPETQQEVLR-----------------
A0A358L616      KDHPTYRALLEKRKTLEDEQKKLNHKIGQ----MPQTQQEILR-----------------
A0A1M7BLL7      DEKPLVAEADGQLPEPEPEPDVEDAPNVA-------------------------------
A0A0H4KZM1      ETPLEPEELTPPETPTTADVRSEAERTSE-------------------------------
A0A3D5UYX7      PRHPAIVNIEAQQSDIGSQISAEVSRIIE----SLANNVSVAKT---------------R
A0A2N1WQN5      ------------------------------------------------------------
A0A352G2C2      RQHPNFQALMNQINQLQMQKEELEKQIGT----LPSTQQELLR-----------------
A0A3C0PZN1      RQHPNFQALMNQINQLQMQKDQLEKQIDT----LPSTQQELLR-----------------
A0A524QFS4      DQHPEVITQDQLILAARRQYEEAIENAES-------------------------------
A0A520JSW4      PDYPEMIALKARIDALRTSVIRETHTANTDRLGTLRQDFQAARA---------------E
A0A1V1UJT2      AVTPESQDVPEPEPEPEPEPEPEPEPEPE----PEPEPEP--------------------
A0A0L6CVX1      ------------------------------------------------------------
A0A1V0RR48      ------------------------------------------------------------
A0A0A0HJJ4      AAPPESLELSEPEPEPEPEPEPEPEPEPE----P--------------------------
A0A5E7YA28      ALSPESLNIPEPEPEPEPEPEPEPEPEPE----PEPEPEPEPE-----------------
A0A4Q3LTF3      PGYPAAKAIQSQIDQLDRSIGREEGRVSN----SLQADYREALE---------------R
A0A7C3N3Y1      SDYPEMVRLKKQMDSIQRQIDAETERVIA----GIRNDYEAALR---------------R
A0A537UTP9      ARHLAVVDLRARMQEIRKVIIDELNRIAQ----TYRSDYEIAKA---------------R
A0A1D2RNR5      ------------MDELKARINAEVQSVLA----SVRNQALMAKR---------------Q
A0A4V1TQ46      PDYPEMVQQTAQIRGLDRQINAVANRVKG----AIQQRYLVAAA---------------Q
A0A3A0FZC0      SSYPRMVQLKAQISGLKQSIEGQRRQVVT----GLKAKMLAAQQ---------------E
A0A1N7JVZ7      QRADAPEPAPKEADPVTPPVAQKPDQTPE----THPLPPQAIAPTREPEKPLPTAMPPAD
A0A091C4A8      PAFPEMQQLQAQIDELDRQIQTEVGNIKA----AIRGEYESALA---------------Q
A0A4R3H6P6      PDYPQAQALASQVQALDVSIAQEENRVRV----SLRQAYESSVM---------------R
A0A3S1NQ09      PEHPQAVALSKEKADISTQIFGELKQLTE----SYRNEYEVAQA---------------R
A0A443GJ52      AEHPQAVALAKEKADISAQIFGELKQLTE----SYRNEYEVALA---------------R
A0A6N3RE79      ------------------------------------------------------------
A0A6N9S3L5      ------------------------------------------------------------
A0A656BWB0      ------------------------------------------------------------
A0A6D0IFH4      ------------------------------------------------------------
A0A7A3MK38      ------------------------------------------------------------
A0A0A0FHV8      ------------------------------------------------------------
A0A1X3IPU7      ------------------------------------------------------------
A0A0A0G0N2      ------------------------------------------------------------
A0A2I8SDU4      ------------------------------------------------------------
A0A2I8SU55      ------------------------------------------------------------
A0A7I6T806      ------------------------------------------------------------
A0A7I6TQE9      ------------------------------------------------------------
A0A7I6U296      ------------------------------------------------------------
S1EXJ6          ------------------------------------------------------------
A0A376UBS1      ------------------------------------------------------------
A0A2W6S588      DRNPQVIDARQKVADLDTAIGREMASMSR----SARAESAAAAA---------------R
A0A483E0N4      KEHPTYKALMEKRKTLQEEKAKLNKKVST----MPETQQEILR-----------------
A0A2J4YQQ6      KEHPTYKALMEKRKTLQDERGKLNKRVSS----MPETQQEILR-----------------
A0A483THX4      KEHPTYKALMEKRKTLQDEKAKLNKRVSS----MPETQQEILR-----------------
A0A534MVS2      ESAEVAEAVRLQAMDLLKHVVENDFSIDV----FTSGLHSFHVPAKINFSHLLLELFRSD
A0A444I5K6      PDHVQAVRLRAEMEEYKRLMFDELNRIAE----SYQSELQVAKS---------------R
A0A154VE85      DDHPRLQEALSESEGLRRTIAGEVEKIGI----GLANEVEVARA---------------R
A0A3S1MCW7      PGFPEMQQLQSQIKELQRLYNNGVLTITD----SLRQKYQEAQN---------------K
A0A434IGN6      PGFPEMQQLQAQIKELQRLYNNGVLTITD----SLRQKYQEAQN---------------K
A0A528AX40      PGFPEMQQLQAQIKELQRLYNNGVLTITD----SLRQKYQEAQS---------------K
A0A528MV95      PGFPEMQQLQAQIKELQRLYDNGVLTITD----SLRQKYQEAQN---------------K
A0A3C1S9Y1      SNHPQMVAIQSELAELHQRKATEGKRIVS----SLRNEYRMAVA---------------K
A0A353EH49      PEHSVIKALDEKIQLLKIEQRKLEIDADV----LPNVQKDILR-----------------
A0A1Y1Q9C1      PAFPDMVSLQGRIDEVRGQLNREMSSLRQ----SLQTEDATIRQ-------ADYISARKL
A0A3M7LJH0      TDHPAYKSLLDKRQVLLGEKERLNQQVQK----LPKTQREILR-----------------
A0A316KRG4      PAPKAAAPVSAKRISADSDSRPEPARDHD----T--------------------------
A0A1E4JHX8      PEYPEVKALATQLSQLDRSIASEENRIRT----SLQQSYQASVA---------------R
M2U8P2          ERHPSLANIDRQLSDLNERISEEIARERD----AARREAQTASR---------------R
A0A1H7KZF8      PEHPEVRQLTAQATALHRELTRLADGIKA----GLHTPLDSATR---------------D
A0A0J5Q9T7      AAQAVLRAEETQASERLKREATERAEAER----VTRDEAVRVKA----------------
A0A6N3UC48      RQHPSYQALMEQLNQLNSRRNALVDRVGD----LPATQQELLR-----------------
A0A257NG76      ESHPSVVAIDKQISRLQGQMNSNDKKIEV----LPETQQVILR-----------------
A0A1T4TW59      PKHDKMIQARAQLDAVRARSRAVIRELGI----GIGIQKELDNA-------------IKQ
A0A1I5YYQ0      RKNPPRRTPEAQRPAGPPEARPDPADKEP----DVPRKTLTEPP----------------
A0A5P9FE62      RKNPPRRTPEAQRPAGAPEARPDPADKEP----DVPRKTLTKPP----------------
A0A1Q3MB35      PEYPQVQALQSQLSELDRNIAREEARVRQ----AAQTTYQEALA---------------R
A0A259LUN7      DRHPDLISARNEVADIDRQMMAEMNRIAA----NLESELRVAES---------------Q
A0A2D7AVL1      PEYSEMTELKRRIELTDREIEAERTRIVD----ALETSFRAAEA---------------K
A0A3B9KZE9      PEYSEMTELKRRIELTDREIEAERTRIVD----ALETSFRAAEA---------------K
A0A2U0NMP8      QEHPTYKALMEKRKILQDERAKLNKRVST----MPETQQEVLR-----------------
A0A4U9HNE9      RAHPAYRALLEKRATLQQEKARLGKQVQN----LPKTQQEVLR-----------------
A0A7C5N053      PEHPLAKAAIARSEAAKAELLEEVNNIKG----ATAAELRVLQS---------------R
A0A2G2CXY6      REHPNYQAMLQQMQQLERQKAALEARVGD----LPSTQQELLR-----------------
A0A3M1D4H3      PEHPDIQNLDKLIAETEAQLAEALAAQHA----LDPTVEQYEAQ---------LAGLVKK
A0A7C1A2A2      RHAPQVIQVRARIARIRASIRALIHNQKA----LAGH----------------------Q
A0A5C8BYM7      EDFPKMQQLKAQMNDLDAKIQSEVASILA----SVSNTLEMTKR---------------Q
A0A1J5ICP0      EKHPLVVEAVEQIKETKKGIMAELSSIIA----SLKV----------------------N
A0A379B9V4      LKHPSYVALIDKRNVLNAEKERLNKQLEK----LPNTQKEMIR-----------------
A0A0Q6TS97      PDYPQAKALASQIQALDAAIGQEEGRVRV----SLQQAYDSSQT---------------R
A0A0Q6UYB4      PDYPQAKALASQIQALDAAIGQEEGRVRV----SLQQAYDSSQT---------------R
A0A484XS37      KEHPAYRALMEKRATLQQEKDKLNKRVSV----MPKTQQVILR-----------------
W7Q5J0          TSHPSYQTLLRQKRHLQAEKTQLNNRVNE----LPTAQQEVLR-----------------
A0A654AKT6      ALFPLRHKLRLIHPLVILTAFIGVVGLIA----VYLGNHAFFGS----------------
A0A7A9JY19      KDHPTYKALIEKKNTLSKERGLLNNRISA----MPATQQEVLR-----------------
A0A0G9MZA5      PSYPPVQALQVQIDELERAIREEQAGAQS----GSQSRLRANYN-----------EALAA
H0T8B0          TDHQAAVQLRERMAARQQAIWDEIGRLAE----GYKSQVQIAKA---------------H
A0A5C7N981      PGYPKMQQMESQIKELQAKISQETKGAIG----GLKANYEAALA---------------Q
A0A534TV22      PDHPRMIELNQQITEARRSLNAEISSVVR----GIQESYGAARA---------------K
A0A351CXR4      PRHPKMIEAESEIQRTQASLKMGGGQAVS----DREKEFELAR-----------------
A0A2N6GLF5      PKHPKMIEAQADLTEARLNVQRQIESVIK----GVEKEYQVARE---------------N
A0A1W9LJP0      AKHPQITAITSELATLQERKMGEAKRVVS----SLRNEYNLALA---------------R
A0A0W1ICB0      PEYPQAQAAREKVAALDRAISAEETRVRG----AYSADYNAAVQ---------------R
A0A7C1C8G2      DQYPKVKKLKAQMQDLRNRYAQEQQQILD----SIRLAYEEALE---------------K
A0A376KYN0      KDHPTYRALLEKRQTLEQERKRLNKRVSA----MPSTQQEVLR-----------------
A0A7A9J338      KDHPTYRALLEKRQTLEQERKRLNKRVSA----MPSTQQEVLR-----------------
A0A377E5P7      KDHPTYRALLEKRQTLEQERKRLNKRVSA----MPSTQQEVLR-----------------
A0A2X1JB05      KDHPTYRALLEKRQTLEQERKRLNKRVSA----MPSTQQEVLR-----------------
A0A376RML0      KDHPTYRALLEKRQTLEQERKRLNKRVSA----MPSTQQEVLR-----------------
A0A6N3QTV2      KDHPTYRALLEKRQTLEQERKRLNKRVSA----MPSTQQEVLR-----------------
A0A2E0UL88      ------AMESGDLTTSPLQLSRDLRRSIV----TQQIEIEALKA---------------K
A0A0T2QIS1      PGYPAAQALQEQIASLDSAIAREDARIVN----SRTAEFRNVAT---------------R
A0A0P7Y1D0      PRHPEILAVEREAADLEEQVNREIQRIVA----GLETEVNVARQ---------------R
A0A542J310      VENPAGTVILSVTARAETAEGARAL-----------------------------------
A0A2M7JRZ7      PEYPEMVRLKNQMQSIQRRMDVETNKIIA----GIKNDYESNLR---------------R
A0A167IR75      PGYPQARAIQSQIEALDQAIAREESRVSG----SVRAEYQQAEA---------------R
A0A3B8T2U6      PRHPKMIAANAELESIDDSLARQVRALVD----GIYQEYQAAES---------------K
A0A365PWR2      SEHPAYQTLVNQIESLTLEQQSLARKIGT----LPETQQELVR-----------------
A0A2E9H5Z8      RKHPSMEMALIAQNKMQENLETAVTVLRD----LLKTQLRLVNG---------------Q
A0A2E2BR79      RNHPAYQALMRQKSFLRNERDRLNARVEK----MPAAQQEVVR-----------------
A0A6I4IKZ3      AEHPAMREINGQLAAINKQIGELNSTLKQ----LPDVQRQYLQ-----------------
A0A7H4JZ79      AEHPAMREINGQLTAVNKQISELNSTLKQ----LPDIQRQYLQ-----------------
A0A0Q4Q524      PEYPAVKALKSQIDQLDRSIANEERRVSG----SLETDYRGAVE---------------R
A0A0Q4CFJ9      PEYPAAKALKSQIDQLDRSITNEERRVSG----SIETDYRGAVE---------------R
A0A0Q4FE58      PEYPAARALKSQIDQLDRSISNEERRVSG----SLETEYRGAVE---------------R
A0A0Q4JWC8      PEYPAARALKSQIDQLDRSISNEERRVSG----SLETEYRGAVE---------------R
A0A0Q4KFL8      PEYPAARALKSQIDQLDRSISNEERRVSG----SLETEYRGAVE---------------R
A0A522R8R0      KDHPQAVALRHQQEELAGQIYQELKQLTE----SYRNEYEVAKA---------------R
A0A2U9NDY5      REHPTYRTLMTQMNELQAQKAQLLKKVDA----LPMTQQELLRR----------------
X7F6S5          AEAERARHAAEAEAETERLRIERDAERAR----IARELAEAREA----------------
A0A1G8NKI0      GDQARRQAEAAAQAQADAEAEEQQRQAEA----AAR------------------------
A0A355QPE4      GDQARRQAEAAAQAQADAEAEEQRRQAEA----AAR------------------------
A0A357RN98      GDQARRQAEAAAQAQADAEAEEQRRQAEA----AAR------------------------
A0A1I6U4V1      DQRLE-------ERRLEEHRAEMDTARRQ----LAA------------------------
A0A6B2P8H8      AERLQVARERAAQEQAEREQAEMEAARRE----LAS------------------------
A0A1P8USW9      AREAELRAQQEAAREAESARAAEKARQED----ETRRAAIAERR----------------
A0A1G7CFZ2      ARMAQTTRQTGAEHRVETGRVSTEP-----------------------------------
A0A7G2TPW1      GRMAQATRQTGAEHRVETGRVSTEP-----------------------------------
A0A0Q4IGG1      PGYPAARAIQTQIDQLDRSISREESRVTG----SIQAEYREALQ---------------R
A0A534RUJ5      PAYPRLAQLKAQVVDTEQRVQKEIQRVVE----GVKTSYLDAEA---------------K
A0A3M1CJM3      PDHPKMKVVENKLKLLQRSINREIDNVLE----SLEAEYQVKLD---------------S
A0A2R7SVD4      SQHPAYRALMSQIGELTQQQKSLAGKVQD----LPATQQELLN-----------------
A0A3C0PWB6      REHPTYRTLMSQMNELQAQKAQLLKKVDA----LPMTQQELLR-----------------
V4Q8B7          REHPTYRTLITQMNELQAQKAQLLKKVDA----LPMTQQELLR-----------------
A0A0Q8XKK5      PGYPASRALAEQLQSLDSAISREEARVDS----SRSTEYREAQM---------------R
A0A2E0Q2W0      PENSQVEASEAELRSLRSALSKESGITGA----ASDAQLRGARQ---------------V
A0A660NIR6      ASHPAYKQAQSELELARSSLRKQSEAVIS----SISKAYEVARE---------------T
A0A142W0R3      EEYPEIVAKKEQLAALNQSVSTETQRSRA----LNQESYASALK---------------R
A0A0S4XR18      PKHPDVIEISEEISALEVSLRGSIKSLYN----SVQK----------------------Q
A0A7C5CFF1      AEHPQVIEQRNEVDNMINRIHANIVANLE----KLRKNKAVAKSTILSNMLMVQNNLTNR
A0A2E0GW64      EKHPIVIAINEKIHKQQAALSALESEAKK----LPHSDQKALS-----------------
A0A1A7QJ97      PGYPAAQAIQQQIDALDSAITREESRVSG----SVQAEYRQAVQ---------------R
A0A661LW70      QKHPRMVAIESELNTLQKRRTQEVSRVIN----SLKNEYKVALA---------------K
W7Q8F9          HSHPSYRTLLRQKRHLQNEKSQLNDRVNE----LPAAQQEVLR-----------------
A0A524PXH8      SEFPKLRALDARLSQARGRVMHEEGRLVA----SIETEYRGAVD---------------R
A0A4Q3P0E4      PNHPLMQTLDAQIAALSRDIGDVQGRIKS----LPAVQQDAVR-----------------
A0A3M2BE89      DNHPVIQSLEDKLGRLQTEQQTLEQRIKA----LPSTEQEVLR-----------------
A0A4Q4A6K6      KNHIAVINLRNRMRDIRTSIMDEVRRLAE----TSRSDHEIAKQ---------------K
A0A257G674      EDYPAVAQLRAQVGVIDNQLQSVARSIRA----SVKQQFDAAVE---------------T
A0A661M5M6      GEHPTMKTLAHELEALAKQVTKEKAAIIA----SAEHDVQQIKT---------------V
A0A1I1UM01      EVRLREETEARQQAEEDRQRARARADQVA----HGDAGPDGADE---------------Q
Q44573          PQHPRLRALDQQIATTRASLEAETQAALS----TIREDQISARA---------------E
A2W025          AAKQQLAELQGEKDKFSNRFRSLPATEVK----AVQ------------------------
A0A534Z362      PKHPQILELGRQQAEIEQQLGAEVAQEVA----AVRSRDEAAQL---------------R
V4J283          PTHPKIRSLDGLMATLTGKLRTLEQQTEA----LPEVQQTVLR-----------------
A0A536T443      DTHPPVRRLAQQVDTLARFVIPELGGALI----A------GLAA---------------R
A0A0Q4UFQ5      PAYPPAKALQAQIRSIDAALRGEGSRVDA----VLRATYQASLS---------------R
A0A527W7E6      KDHPQAVALAKEKADVSAQIFGQLKQITE----SYRNDFEVAQT---------------R
A0A432EMV7      DKHPKMIAAKADLEEAISRVELETAKVVD----GIKRDYEAARA---------------Q
A0A7C1SEU7      DDYPEVKNLKSRMLSIGERIHIEEKKIFK----AIENEYQTVLK---------------K
A0A534WLI3      PNHPQMLELRRQQAAVQRQLATEVAGEIE----AVRARYDAARL---------------R
A0A7C6FBW0      GDAAPNLAPDAIPASASARAADETVADAA----RADARLRSLET---------------E
A0A087LTV7      AKIDGVLADVAALRARVTVAGEAVRAAQQ----ALALRSGFE------------------
A0A7D7WSS2      AKIDGVLADVAALRAQVTVAGEAVRAAQQ----ALALRSEFE------------------
A0A318KWA2      PNHPAYQSLLRQKRHLEAERAALNARVDD----LPEAQQEVVR-----------------
A0A522MT86      NIDEQLGQLRAQKAEFDSRFAAMPSSERK----NVD------------------------
A0A4Q3I221      VNHIQAIRLRSEMTEYNRLMFEEVNRIAE----SYKSDLNVAKA---------------R
A0A534SAL6      QSHPQMLELARNEAELERQLDAEVAAETA----SVRARYDAARL---------------R
A0A534ZDB4      QNHPQMLELARNEAELERQLGAEVAEETT----SVRARYDAARL---------------R
A0A534X3M7      PKHPQTLELRRQQAEIEDQLRAEVTQEVE----AIRARYDAARL---------------H
A0A534SPC6      PKHPQILELGRQQAEIEQQLGAEVAQEVA----AVRSRDEAAQL---------------R
A0A535AD60      PRHPQILELRRQEDEIEHQLRAEVGQEVA----SVRSRNDAAQL---------------R
A0A4Q3SY08      ARHPEILKAQRELADIDAQIQGEVTRVIS----NLEAKAEVSRQ---------------R
A0A4Q3LG23      PAAEAIQSQIGQLDRSIAREEGRVSSSLE----ADYREAAERER---------------G
A0A522EX52      EEHPAFIALSRQIQEIKEDKKNL-------------------------------------
A0A1H3KC95      PKAAGKAEAHPTPPDMEPAPAASPASGAR----RVRLAALPKAE---------------L
A0A5P8Z4P3      DDELDDIEDIEAAPSVSTASPDTVAAPPT----KVEDLRADTPE---------------Q
A0A2E9HXF7      ------QVEKRAAEEAARREKAKRDAEAR----AASALRAAETE---------------R
A0A0B3RZC9      --------------DEERAAEARRKAAEE----KAEAERLAEEE---------------K
A0A6F8QET1      --------------DEERAAEARRKAAEE----KAEAERLAEEQ---------------K
A0A520HUH4      AGGSDAVSAVLSAPVITDLRRQRTEAERQ----RAQLAARYGEK---------------F
A0A2K8U7M6      PGYPKMQQLRRALAELERQLRQEATAIGS----AARAAAAARAH---------------Q
A0A5B9DKL8      DATAEPGYEARQEAQAAQAQYQMLLGRLK----QVETEAFLQVP---------------S
A0A238KJM1      AEQARLTEEKQVAEAAAA------------------------------------------
A0A3A0FJZ4      ASQARELDEIELARSGAALGASGDGGEVH----TLRSSALASIQ---------------E
W4HJV8          PTPSAAPENAAPAHDATVPAPNLAYATPD----ALASETSEEAL---------------P
A0A0P1GDI0      EADRRAQEKAKEAQRQAERAAAQRQAEEA----ARHKAKAAAEQ---------------Q
A0A2R8ATV5      EAKARAAEDARKQHEAEQAAREEAEAQAR----AKALADE--------------------
A0A1U7D3R6      ------ADEARRQQEAEHRAQEQREAEAR----AAE------------------------
A0A2D4UVV2      ------ADEARRQQEAEHRAQEQREAEAR----AAE------------------------
A0A0W7WHP4      ------AQAQRAAEEQAHREAEEQ------------------------------------
A0A238J8F6      ------AEEARQIAEAEEARQKAEAEEAR----KKADAEKKRLA---------------E
A0A238JQI6      ------AEERRKVEDAARKAEEARLAEER----RKAED----------------------
A0A222E077      ------QVEKRAAEEAARREKAKR------------------------------------
A0A239E3Y2      ------QAEKRAAKEAARRARAERDAEDR-------------------------------
A0A534QGR3      ------------------------------------------------------------
A0A1F9CFF0      ------------------------------------------------------------
A0A2M8B0G5      ------------------------------------------------------------
A0A363TNU9      ------------------------------------------------------------
A0A0W1GMS6      ------------------------------------------------------------
A0A0Q8RMY3      ------------------------------------------------------------
A0A1A7QC21      ------------------------------------------------------------
A0A2W4RFS2      ------------------------------------------------------------
A0A1Y6DC43      ------------------------------------------------------------
A0A2S6HE06      ------------------------------------------------------------
G3J0M3          ------------------------------------------------------------
V5C6R5          ------------------------------------------------------------
A0A534HBS8      ------------------------------------------------------------
A0A0F0T3Y9      ------------------------------------------------------------
A0A379GWF0      ------------------------------------------------------------
A0A4Q2XLV7      ------------------------------------------------------------
A0A4Q5QYC4      ------------------------------------------------------------
A0A3B8SQ27      ------------------------------------------------------------
A0A0U2VAW2      DWHY-------------PTYQGLVEQIAAVKEQRKALVGEVGNLPETQQELLRLKRDVEV
A0A454CTF1      ELTFKESEISQKFTQDHPAYKSLLDKRQTLLQEKARLNRQVQKLPKTQREVLRMTRDVEV
A0A6B3Q2G1      ELTFKESEISQKFTQDHPAYKSLLDKRQTLLQEKERLNKQVQKLPKTQREVLRMTRDVEV
A0A4Q6G931      ------------------------------------------------------------
A0A2T0VBD8      ------------------------------------------------------------
A0A378APS2      ------------------------------------------------------------
A0A443VCQ6      ------------------------------------------------------------
A0A447RKQ7      ------------------------------------------------------------
W1DSK1          ------------------------------------------------------------
A0A2N1XK22      ------------------------------------------------------------
A0A3D0KAC8      EQNLKRTEMERRFTRQHPNFQALMNQINQLQMQKDQLEKQIDTLPSTQQELLRLTRDVEV
A0A3D2Y902      ----------------------------------------------TQQELLRLTRDVEV
A0A378G3G7      QLTFSEAEVSKLYTKEHPTYRALLEKRKTLEEEKNNLKKKINNLPETQQEVLRLTRDVQV
A0A2X5NHJ9      QLTFREAEVSQLFTKDHPTYKALLEKRKVLQQEKAKLNQQVSGMPATQQEVLRLSRNVES
A0A2J4QEC3      ------------------------------------------------------------
A0A485ADM3      -----------------------MEKRKTLQDEKAKLNKRVSAMPETQQEILRLSRDVES
A0A4U9HGU4      ELTFKEADISKLYTKEHPAYRSLLEKRKTLEEERDRLNKRVNAMPETQQEVVRLSRDVDS
A0A3S4JGG5      ELTFKEAEISKLYTKEHPAYRALMEKRATLQQEKDKLNKRVSGMPKTQQEILRLTRDVQA
A0A377ZDH2      ------------------------------------------------------------
A0A3S4HTS8      ------------------------------------------------------------
A0A1W9F5M9      ------------------------------------------------------------
A0A379W6R2      ------------------------------------------------------------
A0A379TA56      -------------------------------------------MPKTQQEIVRLTRDVES
A0A655C5P0      -------------------------------------------MPKTQQEIVRLTRDVES
A0A6D0I9G1      ---------------------------------------------------------VES
A0A352MMI7      ---FKEAEISKLYTKAHPAYRTLLEKRRALEDEKDRLSGRVSAMPKTQQEIVRLTRDVES
A0A4Z0LWV1      DLTVNEAEISKLFTKAHPAYRTLLEKRKALEDEKAKLNGRVTAMPKTQQEIVRLTRDVES
A0A377K431      ELTFKEAEISKLYTKVHPAYRTLLEKRQALEDEKAKLNGRVTAMPKPSRKLCVLTRDVES
A0A376RY66      ELTFKEAEISKLYTKVHPAYRTLLEKRQALEDEKAKLNGRVTAMPKTQQEIVRLTRDVES
A0A778GAM7      ELTFKEAEISKLYTKVHPAYRTLLEKRQALEDEKAKLNGRVTAMPKTQQEIVRLTRDVES
A0A3C2BN18      ------------------------------------------------------------
A0A447LR75      ------------------------------------------------------------
A0A759KJJ5      ------------------------------------------------------------
A0A376D8L7      ------------------------------------------------------------
A0A1V2FV46      ------------------------------------------------------------
A0A6N8QLT3      ------------------------------------------------------------
A0A376SB61      ------------------------------------------------------------
A0A3D1BYV9      ------------------------------------------------------------
A0A536T0W8      ------------------------------------------------------------
A0A3D2M6Y9      ------------------------------------------------------------
A0A3D2YAZ2      ------------------------------------------------------------
A0A350A102      ------------------------------------------------------------
A0A350L5D2      ------------------------------------------------------------
A0A2G9XLE5      ------------------------------------------------------------
A0A6L3MM74      ------------------------------------------------------------
A0A7C3QM04      ------------------------------------------------------------
A0A7I8MVM0      ------------------------------------------------------------
A0A7C0Y3J7      ------------------------------------------------------------
A0A7C3LF61      ------------------------------------------------------------
A0A4R1HDF2      ------------------------------------------------------------
A0A6N1DL48      ------------------------------------------------------------
A0A1V6FYJ1      ------------------------------------------------------------
A0A0C5VQ86      ------------------------------------------------------------
A0A0Q6QV61      ------------------------------------------------------------
A0A2Z3IKG4      ------------------------------------------------------------
A0A3N5RNY4      ------------------------------------------------------------
A0A4Z0M4C7      ------------------------------------------------------------
A0A5Q2QDL1      ------------------------------------------------------------
A0A1V8MBH1      ------------------------------------------------------------
A0A6J4X8D4      ------------------------------------------------------------
A0A318CT66      ------------------------------------------------------------
A0A3N5P205      ------------------------------------------------------------
A0A443K010      ------------------------------------------------------------
A0A6I7NYG5      ------------------------------------------------------------
A0A212AR83      ------------------------------------------------------------
A0A2E2P4I0      ------------------------------------------------------------
A0A2U2CM86      ------------------------------------------------------------
A0A1I0R9R6      ------------------------------------------------------------
A0A2N3BVE7      ------------------------------------------------------------
A0A7C2IB02      ------------------------------------------------------------
A0A6N6SI00      -------------------------------------------MPITSRSTSSSARSWQS
A0A2S5JE21      ------------------------------------------------------------
A0A2R8BKZ2      ------------------------------------------------------------
A0A2S8S361      ------------------------------------------------------------
A0A520ZTR8      ------------------------------------------------------------
A0A316GHM6      ------------------------------------------------------------
A0A238IZI1      ------------------------------------------------------------
A0A7C9INT8      ------------------------------------------------------------
A0A6M1UAR9      ------------------------------------------------------------
A0A1X7ACC1      ------------------------------------------------------------
A0A238KUF6      ------------------------------------------------------------
A0A095CTW3      ------------------------------------------------------------
A0A2E3UGD6      ------------------------------------------------------------
A0A2T0RFH0      ------------------------------------------------------------
A0A285D390      ------------------------------------------------------------
A0A497VHN4      ------------------------------------------------------------
A0A2N6BEI9      ------------------------------------------------------------
A0A0D5N3E9      ------------------------------------------------------------
A0A2N2G716      ------------------------------------------------------------
A0A7C1UTU6      ------------------------------------------------------------
W9VVY5          ------------------------------------------------------------
A0A1E2URD3      ------------------------------------------------------------
A0A2T6MY81      ------------------------------------------------------------
A0A2T6NBQ8      ------------------------------------------------------------
A0A421K431      ------------------------------------------------------------
A0A2G2I5M1      ------------------------------------------------------------
A0A2G2M6F0      ------------------------------------------------------------
A0A1W9J9F8      ------------------------------------------------------------
A0A2S5LFJ9      ------------------------------------------------------------
A0A2D8R8F8      ------------------------------------------------------------
A0A6I4JXQ8      ------------------------------------------------------------
A0A010SNS0      ------------------------------------------------------------
A0A0C2I782      ------------------------------------------------------------
A0A2N8BYF5      ------------------------------------------------------------
A0A558FKX2      ------------------------------------------------------------
A0A1H1DBA0      ------------------------------------------------------------
J2TAD5          ------------------------------------------------------------
J3H699          ------------------------------------------------------------
A0A1H5J974      ------------------------------------------------------------
A0A0K1QRZ4      ------------------------------------------------------------
A0A560RJW9      ------------------------------------------------------------
A0A5E6TID7      ------------------------------------------------------------
A0A5E7CRU7      ------------------------------------------------------------
A0A5E7C564      ------------------------------------------------------------
A0A2W7MAV4      ------------------------------------------------------------
A0A4R3WQH5      ------------------------------------------------------------
W6VFG3          ------------------------------------------------------------
A0A1P8ENT1      ------------------------------------------------------------
A0A2N7XRV4      ------------------------------------------------------------
A0A0Q6QPG8      ------------------------------------------------------------
A0A0F4SWA7      ------------------------------------------------------------
A0A423J219      ------------------------------------------------------------
A0A4P6G9U8      ------------------------------------------------------------
A0A4Y8JE06      ------------------------------------------------------------
A0A502I1X9      ------------------------------------------------------------
A0A502J776      ------------------------------------------------------------
A0A5B0EZF6      ------------------------------------------------------------
A0A059L434      ------------------------------------------------------------
A0A0F4UWN2      ------------------------------------------------------------
A0A5E7WEF5      ------------------------------------------------------------
A0A1G0KSD0      ------------------------------------------------------------
A0A4P6WX84      ------------------------------------------------------------
A0A1D2S760      ------------------------------------------------------------
A0A5B8RW94      ------------------------------------------------------------
A0A258TN88      ------------------------------------------------------------
A0A1F9EUS2      ------------------------------------------------------------
A0A6H9HII8      ------------------------------------------------------------
A0A3N9VAW3      ------------------------------------------------------------
A0A1X0YE57      ------------------------------------------------------------
A0A2K2H9Q8      ------------------------------------------------------------
A0A6I1KNW9      ------------------------------------------------------------
A0A1H4B8T3      ------------------------------------------------------------
A0A1E7IQC3      ------------------------------------------------------------
A0A1M6KEN5      ------------------------------------------------------------
A0A353QLL3      ------------------------------------------------------------
A0A399I453      ------------------------------------------------------------
A0A651FBV9      ------------------------------------------------------------
A0A5C1MDH8      ------------------------------------------------------------
A0A7J4ZSX4      ------------------------------------------------------------
A0A5A9XE04      ------------------------------------------------------------
A0A643G9R1      ------------------------------------------------------------
A0A1G0M8Q7      ------------------------------------------------------------
A0A353MI14      ------------------------------------------------------------
A0A4S1CAW7      ------------------------------------------------------------
A0A562VHD2      ------------------------------------------------------------
A0A7K0J0R7      ------------------------------------------------------------
A0A6I6JNB5      ------------------------------------------------------------
A0A1G0LDK7      ------------------------------------------------------------
A0A6F9WVL7      ------------------------------------------------------------
A0A351Z9A2      ------------------------------------------------------------
A0A3N5FRH4      ------------------------------------------------------------
A0A1V4Y2C3      ------------------------------------------------------------
A0A2N2KTJ4      ------------------------------------------------------------
A0A2N2LQX0      ------------------------------------------------------------
A0A318D3U4      ------------------------------------------------------------
A0A401FQP5      ------------------------------------------------------------
A0A7C2AA26      ------------------------------------------------------------
A0A351Z4H9      ------------------------------------------------------------
A0A2N2KML4      ------------------------------------------------------------
E1YJF1          ------------------------------------------------------------
A0A1J5EVZ6      ------------------------------------------------------------
A0A2G6FCC5      ------------------------------------------------------------
A0A1F9MR25      ------------------------------------------------------------
A0A2G6M7F1      ------------------------------------------------------------
A0A7C3Q9R6      ------------------------------------------------------------
A0A1Q6DMW3      ------------------------------------------------------------
A0A3A6P8F8      ------------------------------------------------------------
A0A6L4AM84      ------------------------------------------------------------
A0A2G2DSM4      ------------------------------------------------------------
A0A1F9NI02      ------------------------------------------------------------
A0A4U1ABX4      ------------------------------------------------------------
A0A1W9M770      ------------------------------------------------------------
A0A1W9M7R6      ------------------------------------------------------------
A0A1M7Y300      ------------------------------------------------------------
A0A4U1ALN4      ------------------------------------------------------------
A0A1E7H876      ------------------------------------------------------------
A0A7C0U459      ------------------------------------------------------------
A0A0F2NF69      ------------------------------------------------------------
A0A1F9NFD0      ------------------------------------------------------------
A0A1M5YLH5      ------------------------------------------------------------
A0A4U1A4C7      ------------------------------------------------------------
A0A509L3P8      ------------------------------------------------------------
A0A3A4S038      ------------------------------------------------------------
A0A1F9N669      ------------------------------------------------------------
A0A1F9PFA7      ------------------------------------------------------------
A0A1H2EN09      ------------------------------------------------------------
K0NP00          ------------------------------------------------------------
A0A7C4N0I9      ------------------------------------------------------------
A0A1E7JCL5      ------------------------------------------------------------
A0A496YAH9      ----------------------------------------------------------MT
A0A1V4S7E4      ------------------------------------------------------------
A0A2N2H8D2      ------------------------------------------------------------
A0A2N2KC63      ------------------------------------------------------------
A0A3A4ZYW4      ------------------------------------------------------------
A0A1V4MCJ4      ------------------------------------------------------------
A0A661M0W4      ------------------------------------------------------------
A0A4U8YLL7      ------------------------------------------------------------
A0A445MZQ4      ------------------------------------------------------------
A0A2M7WWF7      ------------------------------------------------------------
A0A0M9E0E3      ------------------------------------------------------------
A0A4Q3IRI1      ------------------------------------------------------------
A0A7C1C6X5      ------------------------------------------------------------
A0A354EF47      ------------------------------------------------------------
A0A2G6MSP7      ------------------------------------------------------------
B7RS54          ------------------------------------------------------------
A0A1I6ENM4      ------------------------------------------------------------
A8LNM8          ------------------------------------------------------------
A0A0T5NSU3      ------------------------------------------------------------
A0A5P9I718      ------------------------------------------------------------
A0A2M8J3R9      ------------------------------------------------------------
A0A1I6X762      ------------------------------------------------------------
A0A0P1EFX8      ------------------------------------------------------------
A0A2G5KB39      ------------------------------------------------------------
A0A2N3CNV1      ------------------------------------------------------------
A0A257F1F4      ------------------------------------------------------------
A0A2D5J8T8      ------------------------------------------------------------
A0A2E3P9W6      ------------------------------------------------------------
A0A2G2B1P9      ------------------------------------------------------------
A0A258GCD5      ------------------------------------------------------------
A0A443INY4      ------------------------------------------------------------
A0A2D9YR88      ------------------------------------------------------------
A0A4Q3ZBK4      ------------------------------------------------------------
A0A1G9FY29      ------------------------------------------------------------
A0A6N9RUN2      ------------------------------------------------------------
A0A1G8QZS5      ------------------------------------------------------------
A0A1H2Y469      ------------------------------------------------------------
A0A497ZQU7      ------------------------------------------------------------
A0A4U8YMP3      ------------------------------------------------------------
A0A1Q8QQ99      ------------------------------------------------------------
A0A7C2SIB2      ------------------------------------------------------------
A0A3D5ZY44      ------------------------------------------------------------
A0A1G5C236      ------------------------------------------------------------
A0A432HIS7      ------------------------------------------------------------
A0A520CSP5      ------------------------------------------------------------
A0A372IH36      ------------------------------------------------------------
A0A540VW45      ------------------------------------------------------------
A0A1H9C241      ------------------------------------------------------------
A0A2E3FCR1      ------------------------------------------------------------
A0A4S3MG69      ------------------------------------------------------------
A0A3E0H727      ------------------------------------------------------------
A0A1I3TTC3      ------------------------------------------------------------
A0A1H3IZW6      ------------------------------------------------------------
A0A0M6YG59      ------------------------------------------------------------
A0A1H7G8B0      ------------------------------------------------------------
A0A7C3Z8T7      ------------------------------------------------------------
A0A1V4QMH7      ------------------------------------------------------------
A0A496XZQ4      ------------------------------------------------------------
A0A7C3UZM2      ------------------------------------------------------------
A0A1F9BJF7      ------------------------------------------------------------
F2NDF5          ------------------------------------------------------------
A0A656PSQ6      ------------------------------------------------------------
A0A4Q3ZDI7      ------------------------------------------------------------
A0A537PRC6      ------------------------------------------------------------
A0A1I3XJ27      ------------------------------------------------------------
A0A562CGU2      ------------------------------------------------------------
A0A7C9VCB3      ------------------------------------------------------------
A0A1I7DCG1      ------------------------------------------------------------
A0A3A3H6D9      ------------------------------------------------------------
A0A0Q6VA36      ------------------------------------------------------------
A0A1B2EQN1      ------------------------------------------------------------
A0A1E7HSL6      ------------------------------------------------------------
A0A2M7JX59      ------------------------------------------------------------
A0A3A4XVN3      ------------------------------------------------------------
A0A1E7JEV6      ------------------------------------------------------------
A0A2N2KDY5      ------------------------------------------------------------
A0A3N5YUD9      ------------------------------------------------------------
A0A0W1DLQ3      ------------------------------------------------------------
A0A246JVD8      ------------------------------------------------------------
A0A2N3BB54      ------------------------------------------------------------
A0A1H6G7A3      ------------------------------------------------------------
A0A0A7PGL6      ------------------------------------------------------------
A0A4Q2Z4L0      ------------------------------------------------------------
A0A5C4N0H6      ------------------------------------------------------------
A0A1V4M8I1      ------------------------------------------------------------
A0A7C0XE92      ------------------------------------------------------------
A0A1E7HFN0      ------------------------------------------------------------
A0A7J0BHG1      ------------------------------------------------------------
A0A1M5GH86      ------------------------------------------------------------
A0A1W1XQZ5      ------------------------------------------------------------
A0A6V8LMJ3      ------------------------------------------------------------
A0A2K8WHP8      ------------------------------------------------------------
A0A1J5N774      ------------------------------------------------------------
A0A2C8F781      ------------------------------------------------------------
A0A2E3R6G0      ------------------------------------------------------------
A0A7J0BUD3      ------------------------------------------------------------
A0A1F8XMK2      ------------------------------------------------------------
A0A3M8EMP2      ------------------------------------------------------------
A0A2J6J6K6      ------------------------------------------------------------
A0A661PSB9      ------------------------------------------------------------
A0A661QBT6      ------------------------------------------------------------
A0A6I2SLK2      ------------------------------------------------------------
A0A0A8WSG4      ------------------------------------------------------------
S7TK97          ------------------------------------------------------------
S7UE93          ------------------------------------------------------------
A0A3D5BR56      ------------------------------------------------------------
A0A2N2IB15      ------------------------------------------------------------
A0A1I3PSR2      ------------------------------------------------------------
A0A1I4GEK4      ------------------------------------------------------------
A0A7C8B5M6      ------------------------------------------------------------
A0A1W7QPT7      ------------------------------------------------------------
A0A6S6M1Y8      ------------------------------------------------------------
A0A6V8MCR2      ------------------------------------------------------------
A0A6V8N3X1      ------------------------------------------------------------
A0A6M4XJ81      ------------------------------------------------------------
A0A0M4D373      ------------------------------------------------------------
A0A1L3GKM9      ------------------------------------------------------------
A0A2T5R3J5      ------------------------------------------------------------
A0A1G6EKK9      ------------------------------------------------------------
A0A7C1DJX8      ------------------------------------------------------------
A0A3D6C3I2      ------------------------------------------------------------
S0G1D4          ------------------------------------------------------------
A0A661T246      ------------------------------------------------------------
A0A2G6CSG7      ------------------------------------------------------------
A0A2G6NB59      ------------------------------------------------------------
A0A5K8A7T9      ------------------------------------------------------------
A0A1W9U045      ------------------------------------------------------------
A0A1F9L9G4      ------------------------------------------------------------
A0A328FD76      ------------------------------------------------------------
A0A348UX90      ------------------------------------------------------------
A0A357Z0N5      ------------------------------------------------------------
A0A0F2R2U0      ------------------------------------------------------------
A0A5K7ZK00      ------------------------------------------------------------
A0A5K7YCX8      ------------------------------------------------------------
A0A5K7Z388      ------------------------------------------------------------
A0A352B502      ------------------------------------------------------------
A0A410V446      ------------------------------------------------------------
A0A0R3KGJ5      ------------------------------------------------------------
A0A0R3N604      ------------------------------------------------------------
A0A1B1UCM8      ------------------------------------------------------------
A0A1N6JQ20      ------------------------------------------------------------
A0A1M5TI07      ------------------------------------------------------------
A3X191          ------------------------------------------------------------
A0A1H4RKV5      ------------------------------------------------------------
A0A160UA87      ------------------------------------------------------------
A0A1Q5SFV5      ------------------------------------------------------------
A0A7C3Y7G3      ------------------------------------------------------------
A0A430DNP0      ------------------------------------------------------------
A0A3A0FQ32      ------------------------------------------------------------
A0A1E4UZA0      ------------------------------------------------------------
A0A1H9KL56      ------------------------------------------------------------
A0A1A9KEF8      ------------------------------------------------------------
A0A5E6PKN5      ------------------------------------------------------------
A0A0N9W1V6      ------------------------------------------------------------
A0A423GQ41      ------------------------------------------------------------
A0A423H7J2      ------------------------------------------------------------
A0A502HNM8      ------------------------------------------------------------
A0A4Q7H223      ------------------------------------------------------------
A0A1H4N2K9      ------------------------------------------------------------
A0A2K4KWF7      ------------------------------------------------------------
A0A3E0WXH2      ------------------------------------------------------------
A0A2N2TRC8      ------------------------------------------------------------
A0A1V4CIZ7      ------------------------------------------------------------
A0A1M3BXA5      ------------------------------------------------------------
A0A1Y2R3U6      ------------------------------------------------------------
A0A167HVD6      ------------------------------------------------------------
A0A1V3SCT6      ------------------------------------------------------------
L0H287          ------------------------------------------------------------
A0A495VG93      ------------------------------------------------------------
A0A4R3MYM4      ------------------------------------------------------------
G2E3C0          ------------------------------------------------------------
                                                                            

E1Y9C0          ------------------------------------------------------------
A0A1N6SH58      ------------------------------------------------------------
A0A4Q3AQN2      ------------------------------------------------------------
A0A1W9HS52      IPHILQEFEALQRQISVSSD-----------------LYLGL-QQKLQEIEIMDAGISND
A0A2D5LFD8      QPALMKGFEELQSRLXLVQG---NLAALTSTQESFR--------------LELAQNSVPW
A0A4D8PLT4      EATLLKSIAELQEQQKGIEATGIQLRDLERAADAHRTLYRSL-AERYEQTMALKNTGALD
A0A7J5VV32      ---------------------------MGKISQALEKTY---------------------
A0A6G6X2Z4      --ERMQVIVGKQDFVSSI------------------------------------------
Q44570          ------------------------------------------------------------
A0A3N5MZ53      -------------------------------------------------------LASAQ
A0A534E4H4      ----------------------------------DRQLYDLF-LKRLSETSATGDLASAR
A0A534I2B6      --AIVAALNRAGQQYQQVGRKEAKLESLQRAVDTNRQLYDLF-FKRLSETSATGDLATAR
A0A1C2JGD0      ---------------------------------------MFL-LEKQKEAAISRASTITK
A0A259LQ70      -----------------------------------------------------MAGGVGS
A0A4V2SPR5      ------------------------------------------------------------
A0A3N5PM86      --SIREAMEEKKREALYLNEKQIGYNSLKRDTDTSRSLYESL-LKRVKEAGLTEGLEATN
A0A2E5YSA4      --SMGEIAEALRRADGANPIGQKE----------------------RSAENLPRATPGPR
A0A0N0XAV4      --QLEEQKKALLKKIEALPMTQQELLRLTRDMQVTSQTYSLM-LNKSQEQDILRAGSIGN
A0A0P9QD19      --QLEQQKQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLM-LNKSQEQDILRAGSIGN
F3FHG4         &n