BYKdb

Dataset for cluster orphancd of phylum proteobacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

839 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1F9CFF0      ------------------------------------------------------------
A0A2M8B0G5      ------------------------------------------------------------
A0A363TNU9      ------------------------------------------------------------
A0A0C5VQ86      ------------------------------------------------------------
A0A1V8MBH1      ------------------------------------------------------------
A0A0R0BVC7      ------------------------------------------------------------
A0A3N5J7U8      ------------------------------------------------------------
A0A1S7S3I8      ------------------------------------------------------------
A0A519E8D7      ------------------------------------------------------------
A0A3S1NZ06      ------------------------------------------------------------
A0A3S1FD32      ------------------------------------------------------------
A0A434DUT4      ------------------------------------------------------------
A0A528D3U3      ------------------------------------------------------------
A0A3S3UPT3      ------------------------------------------------------------
A0A3S1E286      ------------------------------------------------------------
A0A531AC71      ------------------------------------------------------------
A0A436K268      ------------------------------------------------------------
A0A434IDQ0      ------------------------------------------------------------
A0A435IRM5      ------------------------------------------------------------
A0A3S2C404      ------------------------------------------------------------
A0A435F6C0      ------------------------------------------------------------
A0A435BMN6      ------------------------------------------------------------
A0A529XQ54      ------------------------------------------------------------
A0A530BJC1      ------------------------------------------------------------
Q44570          ------------------------------------------------------------
A0A655ZZQ1      ------------------------------------------------------------
A0A1S0ZAI3      ------------------------------------------------------------
A0A1W9M770      ------------------------------------------------------------
A0A1W9M7R6      ------------------------------------------------------------
A0A3C0L0A8      ------------------------------------------------------------
A0A176S762      ------------------------------------------------------------
A0A377ZC40      ------------------------------------------------------------
A0A378BPJ7      ------------------------------------------------------------
A0A2J5PAJ7      ------------------------------------------------------------
A0A377ZDN3      ------------------------------------------------------------
A0A1W9WUD9      ------------------------------------------------------------
A0A1W1ZQK0      ------------------------------------------------------------
A0A4U1ALN4      ------------------------------------------------------------
A0A4U1B1A8      ------------------------------------------------------------
A0A1M7Y300      ------------------------------------------------------------
A0A4U1A967      ------------------------------------------------------------
A0A3N5MZ53      ------------------------------------------------------------
A0A534E4H4      ------------------------------------------------------------
A0A534I2B6      ------------------------------------------------------------
A0A1C2JGD0      ------------------------------------------------------------
A0A259LQ70      ------------------------------------------------------------
A0A4V2SPR5      ------------------------------------------------------------
A0A3N5PM86      ------------------------------------------------------------
A0A2E5YSA4      ------------------------------------------------------------
A0A519ERR1      ------------------------------------------------------------
A0A4Q3Q1M2      ------------------------------------------------------------
A0A4Q3MHR1      ------------------------------------------------------------
A0A520GDZ4      ------------------------------------------------------------
A0A318DSU0      ------------------------------------------------------------
A0A538PF21      ------------------------------------------------------------
A0A1W1ZH10      ------------------------------------------------------------
A0A1W2FF24      ------------------------------------------------------------
A0A524JYQ6      ------------------------------------------------------------
A0A4Q3MA17      ------------------------------------------------------------
A0A0N0M5F7      ------------------------------------------------------------
A0A537M754      ------------------------------------------------------------
A0A1V1PDB4      ------------------------------------------------------------
A0A2M7C324      ------------------------------------------------------------
A0A4Q3HHG6      ------------------------------------------------------------
A0A3B7DTA4      ------------------------------------------------------------
A0A432ZK62      ------------------------------------------------------------
A0A1V5EEP4      ------------------------------------------------------------
A0A1V5EF48      ------------------------------------------------------------
A0A0S6X1X6      ------------------------------------------------------------
A0A537Y5L8      ------------------------------------------------------------
A0A4Q3L2X2      ------------------------------------------------------------
A0A4Q3T8J1      ------------------------------------------------------------
A0A4Q4ANM4      ------------------------------------------------------------
A0A4Q3UEC7      ------------------------------------------------------------
A0A1H5YYQ4      ------------------------------------------------------------
A0A1X4NLK2      ------------------------------------------------------------
A0A1X4NWB5      ------------------------------------------------------------
A0A1M5UQ38      ------------------------------------------------------------
A0A327YI48      ------------------------------------------------------------
A0A1B1PNL6      ------------------------------------------------------------
A0A2U8H9H9      ------------------------------------------------------------
A0A1X6YIC0      ------------------------------------------------------------
A0A1I5E9E9      ------------------------------------------------------------
A0A1X6Z7N7      ------------------------------------------------------------
A0A2E1DQ13      ------------------------------------------------------------
A0A1H8C800      ------------------------------------------------------------
A0A2N3EZ05      ------------------------------------------------------------
A0A1W9PMU6      ------------------------------------------------------------
A0A1G3VVY5      ------------------------------------------------------------
A0A2N6BZD5      ------------------------------------------------------------
A0A435NNF5      ------------------------------------------------------------
A0A3S2AQS7      ------------------------------------------------------------
A0A436XH86      ------------------------------------------------------------
A0A527ZPD6      ------------------------------------------------------------
A0A529KRW3      ------------------------------------------------------------
A0A530ZLX0      ------------------------------------------------------------
A0A355TB56      ------------------------------------------------------------
A0A524M660      ------------------------------------------------------------
A0A0C1TRU6      ------------------------------------------------------------
A0A2Z5SSF4      ------------------------------------------------------------
A0A327LYE6      ------------------------------------------------------------
A0A5A9ZTV3      ------------------------------------------------------------
A0A4Q4CIB1      ------------------------------------------------------------
A0A522ACJ9      ------------------------------------------------------------
A0A3N5Z7F8      ------------------------------------------------------------
A0A239HD34      ------------------------------------------------------------
A0A534V9L7      ------------------------------------------------------------
A0A0P7ZZE4      ------------------------------------------------------------
A0A369R0Q9      ------------------------------------------------------------
A5G4N9          ------------------------------------------------------------
A0A238LBD3      ------------------------------------------------------------
A0A0P1FRV5      ------------------------------------------------------------
A0A0P1FWI8      ------------------------------------------------------------
A0A1M7BLL7      ------------------------------------------------------------
A0A0H4KZM1      ------------------------------------------------------------
A0A1V1UJT2      ------------------------------------------------------------
A0A0L6CVX1      ------------------------------------------------------------
A0A1V0RR48      ------------------------------------------------------------
A0A0A0HJJ4      ------------------------------------------------------------
A0A5E7YA28      ------------------------------------------------------------
A0A348SRI7      ------------------------------------------------------------
A0A354EI73      ------------------------------------------------------------
A0A4P7EP83      ------------------------------------------------------------
A0A3A4NIE9      ------------------------------------------------------------
A0A3A4NUI9      ------------------------------------------------------------
A0A524I3Z6      ------------------------------------------------------------
A0A524PCL7      ------------------------------------------------------------
A0A356GQV1      ------------------------------------------------------------
A0A1J5DAY8      ------------------------------------------------------------
A0A524P237      ------------------------------------------------------------
A0A1G3JY11      ------------------------------------------------------------
A0A661N3U1      ------------------------------------------------------------
A0A3S1WTQ1      ------------------------------------------------------------
A0A440NX85      ------------------------------------------------------------
A0A530CUR9      ------------------------------------------------------------
A0A1M6N1X5      ------------------------------------------------------------
A0A561M3U0      ------------------------------------------------------------
A0A2W5J775      ------------------------------------------------------------
A0A1F9E324      ------------------------------------------------------------
A0A432SAI6      ------------------------------------------------------------
A0A4Q3LBH4      ------------------------------------------------------------
A0A4Q3LWP3      ------------------------------------------------------------
A0A2N6VGL1      ------------------------------------------------------------
A0A3M3H5V6      ------------------------------------------------------------
A0A2T4ZJZ6      ------------------------------------------------------------
A0A1T2KYM8      ------------------------------------------------------------
A0A2G9ZR82      ------------------------------------------------------------
A0A4U9I390      ------------------------------------------------------------
A0A534XP85      ------------------------------------------------------------
A0A2X3M011      ------------------------------------------------------------
I2WC85          ------------------------------------------------------------
A0A400JH80      ------------------------------------------------------------
A0A2H9EHM4      ------------------------------------------------------------
A0A380B3D7      ------------------------------------------------------------
F5NSX0          ------------------------------------------------------------
D8EEU7          ------------------------------------------------------------
A0A479JNB1      ------------------------------------------------------------
A0A5C9AF52      ------------------------------------------------------------
A0A0P1H2H0      ------------------------------------------------------------
A0A258WKV0      ------------------------------------------------------------
A0A377N8F8      ------------------------------------------------------------
A0A3C2DSE7      ------------------------------------------------------------
A0A2X1JBG5      ------------------------------------------------------------
A0A0B8PTA8      ------------------------------------------------------------
A0A0B8QF75      ------------------------------------------------------------
A0A4Q3LR91      ------------------------------------------------------------
A0A4V1TR68      ------------------------------------------------------------
A0A444IY46      ------------------------------------------------------------
A0A660AID0      ------------------------------------------------------------
A0A3E0WKI3      ------------------------------------------------------------
A0A1H3I2J1      ------------------------------------------------------------
A0A1V5DJV0      ------------------------------------------------------------
A0A520IUC4      ------------------------------------------------------------
A0A521LJG5      ------------------------------------------------------------
A0A531IBQ7      ------------------------------------------------------------
A0A377LY04      ------------------------------------------------------------
A0A5C9ABR5      ------------------------------------------------------------
A0A5J9WU72      ------------------------------------------------------------
A0A2X3K9R3      ------------------------------------------------------------
A0A3T9EHW9      ------------------------------------------------------------
A0A484X141      ------------------------------------------------------------
A0A5N9VWI6      ------------------------------------------------------------
A0A3D3PV27      ------------------------------------------------------------
A0A376LLF8      ------------------------------------------------------------
A0A444R390      ------------------------------------------------------------
A0A1V4WHZ7      ------------------------------------------------------------
A0A1E5AJN5      ---------------------------------------------------MADQQHSHS
A0A2N3D2J1      ------------------------------------------------------------
A0A2N2GVE1      ------------------------------------------------------------
A0A2N2INV3      ------------------------------------------------------------
A0A1Y5DXG5      ------------------------------------------------------------
A0A0B8P2H5      ------------------------------------------------------------
A0A483QWI8      ------------------------------------------------------------
A0A483UXD3      ------------------------------------------------------------
A0A0A8J8L3      ------------------------------------------------------------
A0A660DJ38      ------------------------------------------------------------
A0A380AQW6      ------------------------------------------------------------
A0A2G2GD62      MDSNITKNMEADEESFDIQQALYIIKKYNKSIAFIVVVFIIISGIMAYFKPSMYFSTAVV
A0A524P331      ------------------------------------------------------------
A0A4V1SSM5      ------------------------------------------------------------
A0A4Q3K8G7      ------------------------------------------------------------
A0A1M7HC79      ------------------------------------------------------------
A0A1D3JZN6      ------------------------------------------------------------
A0A1V6ESG1      ------------------------------------------------------------
A0A1H7YHK3      ------------------------------------------------------------
A0A534SH66      ------------------------------------------------------------
A0A3M0ZZ99      ------------------------------------------------------------
A0A328C2K5      ------------------------------------------------------------
A0A5C6X8M3      ------------------------------------------------------------
A0A3D8MRR7      ------------------------------------------------------------
A0A5C6UBJ7      ------------------------------------------------------------
A0A5C6XGM3      ------------------------------------------------------------
A0A537NZJ1      ------------------------------------------------------------
A0A4Q4CVW6      ------------------------------------------------------------
A0A090R136      ------------------------------------------------------------
A0A661JU93      ------------------------------------------------------------
A0A2E2T3V8      ------------------------------------------------------------
A0A367UAB4      ------------------------------------------------------------
A0A377V641      ------------------------------------------------------------
A0A1F2YJ88      ------------------------------------------------------------
A0A0J7XGZ1      ------------------------------------------------------------
I4CBA7          ------------------------------------------------------------
A3VE95          ------------------------------------------------------------
A0A1G0NL95      ------------------------------------------------------------
A0A024KA69      ------------------------------------------------------------
A0A0L1KFN4      ------------------------------------------------------------
A0A3P5DSS6      ------------------------------------------------------------
A0A483YEL5      ------------------------------------------------------------
A0A658GUJ0      ------------------------------------------------------------
A0A358L616      ------------------------------------------------------------
A0A3D5UYX7      ------------------------------------------------------------
A0A2N1WQN5      ------------------------------------------------------------
A0A352G2C2      ------------------------------------------------------------
A0A3C0PZN1      ------------------------------------------------------------
A0A524QFS4      ---------------------------------------------MRADEEKSKIQGRDP
A0A520JSW4      ------------------------------------------------------------
A0A4Q3LTF3      ------------------------------------------------------------
A0A537UTP9      ------------------------------------------------------------
A0A1D2RNR5      ------------------------------------------------------------
A0A4V1TQ46      ------------------------------------------------------------
A0A3A0FZC0      ------------------------------------------------------------
A0A1N7JVZ7      ------------------------------------------------------------
A0A091C4A8      ------------------------------------------------------------
A0A4R3H6P6      ------------------------------------------------------------
A0A3S1NQ09      ------------------------------------------------------------
A0A443GJ52      ------------------------------------------------------------
A0A2W6S588      ------------------------------------------------------------
A0A483E0N4      ------------------------------------------------------------
A0A2J4YQQ6      ------------------------------------------------------------
A0A483THX4      ------------------------------------------------------------
A0A534MVS2      ------------------------------------------------------------
A0A444I5K6      ------------------------------------------------------------
A0A154VE85      -------------------------------------------------------MSALA
A0A3S1MCW7      ------------------------------------------------------------
A0A434IGN6      ------------------------------------------------------------
A0A528AX40      ------------------------------------------------------------
A0A528MV95      ------------------------------------------------------------
A0A3C1S9Y1      ------------------------------------------------------------
A0A353EH49      ------------------------------------------------------------
A0A1Y1Q9C1      ------------------------------------------------------------
A0A3M7LJH0      ------------------------------------------------------------
A0A316KRG4      ------------------------------------------------------------
A0A1E4JHX8      ------------------------------------------------------------
M2U8P2          ------------------------------------------------------------
A0A1H7KZF8      ------------------------------------------------------------
A0A0J5Q9T7      ------------------------------------------------------------
A0A257NG76      ------------------------------------------------------------
A0A1T4TW59      ------------------------------------------------------------
A0A1I5YYQ0      ------------------------------------------------------------
A0A5P9FE62      ------------------------------------------------------------
A0A1Q3MB35      ------------------------------------------------------------
A0A259LUN7      ------------------------------------------------------------
A0A2D7AVL1      ------------------------------------------------------------
A0A3B9KZE9      ------------------------------------------------------------
A0A2U0NMP8      ------------------------------------------------------------
A0A4U9HNE9      ------------------------------------------------------------
A0A2G2CXY6      ------------------------------------------------------------
A0A3M1D4H3      ------------------------------------------------------------
A0A5C8BYM7      ------------------------------------------------------------
A0A1J5ICP0      ------------------------------------------------------------
A0A0M3GBT1      ------------------------------------------------------------
B3Q577          ------------------------------------------------------------
A0A379B9V4      ------------------------------------------------------------
A0A0Q6TS97      ------------------------------------------------------------
A0A0Q6UYB4      ------------------------------------------------------------
A0A484XS37      ------------------------------------------------------------
W7Q5J0          -----------------------------------------------------------N
A0A654AKT6      ------------------------------------------------------------
A0A0G9MZA5      ------------------------------------------------------------
H0T8B0          ------------------------------------------------------------
A0A5C7N981      ------------------------------------------------------------
A0A534TV22      ------------------------------------------------------------
A0A351CXR4      ------------------------------------------------------------
A0A2N6GLF5      ------------------------------------------------------------
A0A1W9LJP0      ------------------------------------------------------------
A0A0W1ICB0      ------------------------------------------------------------
A0A2E0UL88      ------------------------------------------------------------
A0A233IKJ2      ------------------------------------------------------------
A0A2T1JE00      ------------------------------------------------------------
A0A0T2QIS1      ------------------------------------------------------------
A0A376KYN0      ------------------------------------------------------------
A0A2X1JB05      ------------------------------------------------------------
A0A376RML0      ------------------------------------------------------------
A0A377E5P7      ------------------------------------------------------------
A0A0P7Y1D0      ------------------------------------------------------------
A0A2M7JRZ7      ------------------------------------------------------------
A0A167IR75      ------------------------------------------------------------
X7F6S5          ------------------------------------------------------------
A0A1G7CFZ2      ------------------------------------------------------------
A0A1P8USW9      ------------------------------------------------------------
A0A1I6U4V1      ------------------------------------------------------------
A0A1G8NKI0      ------------------------------------------------------------
A0A355QPE4      ------------------------------------------------------------
A0A357RN98      ------------------------------------------------------------
A0A3B8T2U6      ------------------------------------------------------------
A0A365PWR2      ------------------------------------------------------------
A0A2E9H5Z8      ------------------------------------------------------------
A0A2E2BR79      ------------------------------------------------------------
A0A0Q4Q524      ------------------------------------------------------------
A0A0Q4CFJ9      ------------------------------------------------------------
A0A0Q4FE58      ------------------------------------------------------------
A0A0Q4JWC8      ------------------------------------------------------------
A0A0Q4KFL8      ------------------------------------------------------------
A0A522R8R0      ------------------------------------------------------------
A0A2U9NDY5      ------------------------------------------------------------
A0A0Q4IGG1      ------------------------------------------------------------
A0A534RUJ5      ------------------------------------------------------------
A0A3M1CJM3      ------------------------------------------------------------
A0A2R7SVD4      ------------------------------------------------------------
A0A3C0PWB6      ------------------------------------------------------------
V4Q8B7          ------------------------------------------------------------
A0A0Q8XKK5      ------------------------------------------------------------
A0A2E0Q2W0      ------------------------------------------------------------
A0A660NIR6      ------------------------------------------------------------
A0A142W0R3      ------------------------------------------------------------
A0A0S4XR18      ------------------------------------------------------------
A0A2E0GW64      ------------------------------------------------------------
A0A1A7QJ97      ------------------------------------------------------------
A0A661LW70      ------------------------------------------------------------
W7Q8F9          ------------------------------------------------------------
A0A524PXH8      ------------------------------------------------------------
A0A4Q3P0E4      ------------------------------------------------------------
A0A3M2BE89      ------------------------------------------------------------
A0A4Q4A6K6      ------------------------------------------------------------
A0A257G674      ------------------------------------------------------------
A0A661M5M6      ------------------------------------------------------------
A0A1I1UM01      ------------------------------------------------------------
Q44573          ------------------------------------------------------------
A2W025          ------------------------------------------------------------
A0A534Z362      -------------------------------MAAADRPLFPLPDPTGAQPTPPGGYLPPP
V4J283          ------------------------------------------------------------
A0A536T443      ------------------------------------------------------------
A0A0Q4UFQ5      ------------------------------------------------------------
A0A527W7E6      ------------------------------------------------------------
A0A432EMV7      ------------------------------------------------------------
A0A087LTV7      ------------------------------------------------------------
A0A534WLI3      ------------------------------------------------------------
A0A318KWA2      ------------------------------------------------------------
A0A522MT86      ------------------------------------------------------------
A0A4Q3I221      ------------------------------------------------------------
A0A534SAL6      ----------------------------------MTEQALTSRPADTRLSAPGGYAAAGV
A0A534ZDB4      ----------------------------------MAEQALASRATDSRLTAPGGYAAAGV
A0A534X3M7      -------------------------------MIARTPVPLRGASAPEQLPPGGGYLPPPI
A0A534SPC6      ------------------------------------------------------------
A0A535AD60      ---------------------------MAAADRPLFPLPADPTGAQPTPPGGYLHLPPPI
A0A4Q3SY08      ------------------------------------------------------------
A0A4Q3LG23      ------------------------------------------------------------
A0A522EX52      ------------------------------------------------------------
A0A1H3KC95      ------------------------------------------------------------
A0A5P8Z4P3      ------------------------------------------------------------
A0A0B3RZC9      ------------------------------------------------------------
A0A2E9HXF7      ------------------------------------------------------------
A0A520HUH4      ------------------------------------------------------------
A0A2K8U7M6      ------------------------------------------------------------
A0A5B9DKL8      ------------------------------------------------------------
A0A238KJM1      ------------------------------------------------------------
A0A3A0FJZ4      ------------------------------------------------------------
W4HJV8          ------------------------------------------------------------
A0A0P1GDI0      ------------------------------------------------------------
A0A2R8ATV5      ------------------------------------------------------------
A0A1U7D3R6      ------------------------------------------------------------
A0A2D4UVV2      ------------------------------------------------------------
A0A0W7WHP4      ------------------------------------------------------------
A0A238J8F6      ------------------------------------------------------------
A0A238JQI6      ------------------------------------------------------------
A0A222E077      ------------------------------------------------------------
A0A239E3Y2      ------------------------------------------------------------
A0A1W9HS52      ------------------------------------------------------------
A0A2D5LFD8      ------------------------------------------------------------
A0A0N0XAV4      ------------------------------------------------------------
A0A0P9QD19      ------------------------------------------------------------
F3FHG4          ------------------------------------------------------------
F3GGI0          ------------------------------------------------------------
A0A0P9LE74      ------------------------------------------------------------
A0A3M4ZQ14      ------------------------------------------------------------
A0A3M5YLE8      ------------------------------------------------------------
A0A3M3RP89      ------------------------------------------------------------
A0A0P9QIY7      ------------------------------------------------------------
A0A0P9VVH7      ------------------------------------------------------------
A0A0Q0FJK6      ------------------------------------------------------------
A0A0Q0G2J0      ------------------------------------------------------------
A0A3M3LF66      ------------------------------------------------------------
A0A0P9WIR8      ------------------------------------------------------------
A0A3M3KPE5      ------------------------------------------------------------
A0A3M4C263      ------------------------------------------------------------
A0A3M5AD05      ------------------------------------------------------------
A0A0Q0D3D2      ------------------------------------------------------------
A0A0N0FS39      ------------------------------------------------------------
A0A3M6GHH2      ------------------------------------------------------------
A0A0P9R9W0      ------------------------------------------------------------
A0A0Q0B9T0      ------------------------------------------------------------
A0A3M6CFI7      ------------------------------------------------------------
A0A0P9JXN0      ------------------------------------------------------------
A0A3M6FIV7      ------------------------------------------------------------
A0A3M3PLW9      ------------------------------------------------------------
A0A3M4ENY1      ------------------------------------------------------------
A0A3M5EZK7      ------------------------------------------------------------
A0A0P9SPP5      ------------------------------------------------------------
A0A658KL17      ------------------------------------------------------------
A0A3M3NNF2      ------------------------------------------------------------
A0A3M4A0E8      ------------------------------------------------------------
A0A3M4PBZ2      ------------------------------------------------------------
A0A3M6AI26      ------------------------------------------------------------
A0A0P9IWP8      ------------------------------------------------------------
A0A0P9KZ49      ------------------------------------------------------------
A0A0P9V840      ------------------------------------------------------------
A0A0Q0AIE5      ------------------------------------------------------------
A0A3M2ZQH6      ------------------------------------------------------------
A0A0N8SQG2      ------------------------------------------------------------
A0A0W8HFU1      ------------------------------------------------------------
A0A3M5M873      ------------------------------------------------------------
A0A0P9VHH8      ------------------------------------------------------------
A0A0P9YV98      ------------------------------------------------------------
A0A3M3G2W8      ------------------------------------------------------------
A0A3M6C224      ------------------------------------------------------------
A0A3M5K254      ------------------------------------------------------------
A0A3M5JFB0      ------------------------------------------------------------
A0A3M3TQV3      ------------------------------------------------------------
A0A3M3EF92      ------------------------------------------------------------
A0A3M5J1E2      ------------------------------------------------------------
A0A3M5G7H9      ------------------------------------------------------------
A0A3M4A376      ------------------------------------------------------------
A0A0Q0A5T8      ------------------------------------------------------------
A0A0P9SCD7      ------------------------------------------------------------
A0A0P9T4G3      ------------------------------------------------------------
A0A0P9VKB0      ------------------------------------------------------------
A0A0Q0BM35      ------------------------------------------------------------
A0A3M3TPR7      ------------------------------------------------------------
A0A3M3U4Q3      ------------------------------------------------------------
A0A0P9UCX7      ------------------------------------------------------------
A0A0P9S1F1      ------------------------------------------------------------
A0A0P9QCJ2      ------------------------------------------------------------
A0A0P9Q329      ------------------------------------------------------------
A0A3M5GJ64      ------------------------------------------------------------
A0A0P9MPC7      ------------------------------------------------------------
A0A3M2XYQ3      ------------------------------------------------------------
A0A0P9XCE1      ------------------------------------------------------------
A0A3M3EFX7      ------------------------------------------------------------
A0A3M5B9D9      ------------------------------------------------------------
A0A0P9RRZ3      ------------------------------------------------------------
A0A3M2VEK7      ------------------------------------------------------------
A0A0N8R9B3      ------------------------------------------------------------
A0A0P9VA27      ------------------------------------------------------------
A0A3M4YBJ4      ------------------------------------------------------------
A0A0P9J470      ------------------------------------------------------------
A0A0Q0EVJ8      ------------------------------------------------------------
A0A3M5UI30      ------------------------------------------------------------
A0A3M5YQT8      ------------------------------------------------------------
A0A3M5F5X1      ------------------------------------------------------------
A0A3M5R8G1      ------------------------------------------------------------
A0A3M5V012      ------------------------------------------------------------
A0A3M3GA16      ------------------------------------------------------------
A0A3M3UCT3      ------------------------------------------------------------
A0A3M3CJL0      ------------------------------------------------------------
A0A3M3F6F5      ------------------------------------------------------------
A0A3M3P9B7      ------------------------------------------------------------
A0A0N8QB74      ------------------------------------------------------------
A0A0Q0AUD0      ------------------------------------------------------------
A0A3M5VR55      ------------------------------------------------------------
A0A0Q0FK97      ------------------------------------------------------------
A0A3M5KZ75      ------------------------------------------------------------
A0A3M5L3G5      ------------------------------------------------------------
A0A1V6FYJ1      ------------------------------------------------------------
A0A445MZQ4      ------------------------------------------------------------
A0A0M9E0E3      ------------------------------------------------------------
A0A0Q6QV61      ------------------------------------------------------------
A0A2Z3IKG4      ------------------------------------------------------------
A0A4Q3IRI1      ------------------------------------------------------------
A0A2W4RFS2      ------------------------------------------------------------
A0A1Y6DC43      ------------------------------------------------------------
A0A2S6HE06      ------------------------------------------------------------
G3J0M3          ------------------------------------------------------------
V5C6R5          ------------------------------------------------------------
A0A354EF47      ------------------------------------------------------------
A0A2G6MSP7      ------------------------------------------------------------
A0A1V4M8I1      ------------------------------------------------------------
A0A4Z0M4C7      ------------------------------------------------------------
A0A4U8YMP3      ------------------------------------------------------------
A0A1Q8QQ99      ------------------------------------------------------------
A0A3D5ZY44      ------------------------------------------------------------
A0A646J2A6      ------------------------------------------------------------
A0A1G5C236      ------------------------------------------------------------
A0A5Q2QDL1      ------------------------------------------------------------
A0A656PSQ6      ------------------------------------------------------------
A0A1I3XJ27      ------------------------------------------------------------
A0A1I7DCG1      ------------------------------------------------------------
A0A3A3H6D9      ------------------------------------------------------------
A0A562CGU2      ------------------------------------------------------------
A0A0Q6VA36      ------------------------------------------------------------
A0A1B2EQN1      ------------------------------------------------------------
A0A1E7HSL6      ------------------------------------------------------------
W9VVY5          ------------------------------------------------------------
A0A1E2URD3      ------------------------------------------------------------
A0A2T6MY81      ------------------------------------------------------------
A0A2T6NBQ8      ------------------------------------------------------------
A0A421K431      ------------------------------------------------------------
A0A2G2I5M1      ------------------------------------------------------------
A0A2G2M6F0      ------------------------------------------------------------
A0A1W9J9F8      ------------------------------------------------------------
A0A2S5LFJ9      ------------------------------------------------------------
A0A2D8R8F8      ------------------------------------------------------------
A0A010SNS0      ------------------------------------------------------------
A0A0C2I782      ------------------------------------------------------------
A0A2N8BYF5      ------------------------------------------------------------
A0A558FKX2      ------------------------------------------------------------
A0A1H1DBA0      ------------------------------------------------------------
J2TAD5          ------------------------------------------------------------
J3H699          ------------------------------------------------------------
A0A1H5J974      ------------------------------------------------------------
A0A0K1QRZ4      ------------------------------------------------------------
A0A560RJW9      ------------------------------------------------------------
A0A5E6TID7      ------------------------------------------------------------
A0A5E7CRU7      ------------------------------------------------------------
A0A5E7C564      ------------------------------------------------------------
A0A2W7MAV4      ------------------------------------------------------------
A0A4R3WQH5      ------------------------------------------------------------
W6VFG3          ------------------------------------------------------------
A0A1P8ENT1      ------------------------------------------------------------
A0A2N7XRV4      ------------------------------------------------------------
A0A0Q6QPG8      ------------------------------------------------------------
A0A0F4SWA7      ------------------------------------------------------------
A0A423J219      ------------------------------------------------------------
A0A4P6G9U8      ------------------------------------------------------------
A0A4Y8JE06      ------------------------------------------------------------
A0A502I1X9      ------------------------------------------------------------
A0A502J776      ------------------------------------------------------------
A0A5B0EZF6      ------------------------------------------------------------
A0A059L434      ------------------------------------------------------------
A0A0F4UWN2      ------------------------------------------------------------
A0A5E7WEF5      ------------------------------------------------------------
A0A1G0KSD0      ------------------------------------------------------------
A0A4P6WX84      ------------------------------------------------------------
A0A1D2S760      ------------------------------------------------------------
A0A5B8RW94      ------------------------------------------------------------
A0A258TN88      ------------------------------------------------------------
A0A4Q3ZDI7      ------------------------------------------------------------
A0A537PRC6      ------------------------------------------------------------
A0A2M7JX59      ------------------------------------------------------------
A0A3A4XVN3      ------------------------------------------------------------
A0A1E7JEV6      ------------------------------------------------------------
A0A2N2KDY5      ------------------------------------------------------------
A0A3N5YUD9      ------------------------------------------------------------
A0A0W1DLQ3      ------------------------------------------------------------
A0A246JVD8      ------------------------------------------------------------
A0A2N3BB54      ------------------------------------------------------------
A0A1H6G7A3      ------------------------------------------------------------
A0A0A7PGL6      ------------------------------------------------------------
A0A4Q2Z4L0      ------------------------------------------------------------
A0A5C4N0H6      ------------------------------------------------------------
A0A4R1HDF2      ------------------------------------------------------------
A0A1E7HFN0      ------------------------------------------------------------
A0A1M5GH86      ------------------------------------------------------------
A0A1W1XQZ5      ------------------------------------------------------------
A0A3D6C3I2      ------------------------------------------------------------
S0G1D4          ------------------------------------------------------------
A0A661T246      ------------------------------------------------------------
A0A2G6CSG7      ------------------------------------------------------------
A0A2G6NB59      ------------------------------------------------------------
A0A5K8A7T9      ------------------------------------------------------------
A0A1W9U045      ------------------------------------------------------------
A0A1F9L9G4      ------------------------------------------------------------
A0A328FD76      ------------------------------------------------------------
A0A348UX90      ------------------------------------------------------------
A0A357Z0N5      ------------------------------------------------------------
A0A0F2R2U0      ------------------------------------------------------------
A0A5K7ZK00      ------------------------------------------------------------
A0A5K7YCX8      ------------------------------------------------------------
A0A5K7Z388      ------------------------------------------------------------
A0A352B502      ------------------------------------------------------------
A0A2K8WHP8      ------------------------------------------------------------
A0A410V446      ------------------------------------------------------------
A0A0R3KGJ5      ------------------------------------------------------------
A0A0R3N604      ------------------------------------------------------------
A0A1B1UCM8      ------------------------------------------------------------
A0A1N6JQ20      ------------------------------------------------------------
A0A1M5TI07      ------------------------------------------------------------
A3X191          ------------------------------------------------------------
A0A1H4RKV5      ------------------------------------------------------------
A0A160UA87      ------------------------------------------------------------
A0A1Q5SFV5      ------------------------------------------------------------
A0A1J5N774      ------------------------------------------------------------
A0A2C8F781      ------------------------------------------------------------
A0A2E3R6G0      ------------------------------------------------------------
A0A1F8XMK2      ------------------------------------------------------------
A0A3M8EMP2      ------------------------------------------------------------
A0A2J6J6K6      ------------------------------------------------------------
A0A1G6EKK9      ------------------------------------------------------------
S7TK97          ------------------------------------------------------------
S7UE93          ------------------------------------------------------------
A0A3D5BR56      ------------------------------------------------------------
A0A2N2IB15      ------------------------------------------------------------
A0A1I3PSR2      ------------------------------------------------------------
A0A1I4GEK4      ------------------------------------------------------------
A0A0A8WSG4      ------------------------------------------------------------
A0A2T5R3J5      ------------------------------------------------------------
A0A661PSB9      ------------------------------------------------------------
A0A661QBT6      ------------------------------------------------------------
A0A1W7QPT7      ------------------------------------------------------------
A0A1L3GKM9      ------------------------------------------------------------
A0A0M4D373      ------------------------------------------------------------
A0A5J4MX76      ------------------------------------------------------------
A0A430DNP0      ------------------------------------------------------------
A0A3A0FQ32      ------------------------------------------------------------
A0A1E4UZA0      ------------------------------------------------------------
A0A1H9KL56      ------------------------------------------------------------
A0A1A9KEF8      ------------------------------------------------------------
A0A5E6PKN5      ------------------------------------------------------------
A0A0N9W1V6      ------------------------------------------------------------
A0A423GQ41      ------------------------------------------------------------
A0A423H7J2      ------------------------------------------------------------
A0A502HNM8      ------------------------------------------------------------
A0A4Q7H223      ------------------------------------------------------------
A0A1H4N2K9      ------------------------------------------------------------
A0A2K4KWF7      ------------------------------------------------------------
A0A3E0WXH2      ------------------------------------------------------------
A0A2N2TRC8      ------------------------------------------------------------
A0A1V4CIZ7      ------------------------------------------------------------
A0A1M3BXA5      ------------------------------------------------------------
A0A1Y2R3U6      ------------------------------------------------------------
A0A167HVD6      ------------------------------------------------------------
A0A1V3SCT6      ------------------------------------------------------------
L0H287          ------------------------------------------------------------
A0A495VG93      ------------------------------------------------------------
A0A4R3MYM4      ------------------------------------------------------------
G2E3C0          ------------------------------------------------------------
A0A534QGR3      ------------------------------------------------------------
A0A4U8YLL7      ------------------------------------------------------------
A0A655RNN3      ------------------------------------------------------------
A0A655R819      ------------------------------------------------------------
A0A655ZEY0      ------------------------------------------------------------
A0A0W1GMS6      ------------------------------------------------------------
A0A0Q8RMY3      ------------------------------------------------------------
A0A1A7QC21      ------------------------------------------------------------
A0A2M7WWF7      ------------------------------------------------------------
A0A351Z9A2      ------------------------------------------------------------
A0A3N5RNY4      ------------------------------------------------------------
A0A1E7H876      ------------------------------------------------------------
A0A0F2NF69      ------------------------------------------------------------
A0A1F9NFD0      ------------------------------------------------------------
A0A1M5YLH5      ------------------------------------------------------------
A0A4U1A4C7      ------------------------------------------------------------
A0A509L3P8      ------------------------------------------------------------
A0A3A4S038      ------------------------------------------------------------
A0A1F9N669      ------------------------------------------------------------
A0A1F9PFA7      ------------------------------------------------------------
A0A1H2EN09      ------------------------------------------------------------
K0NP00          ------------------------------------------------------------
A0A432HIS7      ------------------------------------------------------------
A0A127AL56      ------------------------------------------------------------
A0A1E7JCL5      ------------------------------------------------------------
A0A496YAH9      ------------------------------------------------------------
A0A1V4S7E4      ------------------------------------------------------------
A0A2N2H8D2      ------------------------------------------------------------
A0A2N2KC63      ------------------------------------------------------------
A0A3A4ZYW4      ------------------------------------------------------------
A0A1V4MCJ4      ------------------------------------------------------------
A0A661M0W4      ------------------------------------------------------------
A0A1X0YE57      ------------------------------------------------------------
A0A2K2H9Q8      ------------------------------------------------------------
A0A2N6BEI9      ------------------------------------------------------------
A0A318CT66      ------------------------------------------------------------
A0A3N5P205      ------------------------------------------------------------
A0A0D5N3E9      ------------------------------------------------------------
A0A2N2G716      ------------------------------------------------------------
A0A1F9EUS2      ------------------------------------------------------------
A0A3N9VAW3      ------------------------------------------------------------
A0A1H4B8T3      ------------------------------------------------------------
A0A1E7IQC3      ------------------------------------------------------------
A0A1M6KEN5      ------------------------------------------------------------
A0A353QLL3      ------------------------------------------------------------
A0A399I453      ------------------------------------------------------------
A0A651FBV9      ------------------------------------------------------------
A0A1G0LDK7      ------------------------------------------------------------
A0A562VHD2      ------------------------------------------------------------
A0A5C1MDH8      ------------------------------------------------------------
A0A5A9XE04      ------------------------------------------------------------
A0A643G9R1      ------------------------------------------------------------
A0A1G0M8Q7      ------------------------------------------------------------
A0A353MI14      ------------------------------------------------------------
A0A4S1CAW7      ------------------------------------------------------------
A0A534HBS8      ------------------------------------------------------------
A0A0F0T3Y9      ------------------------------------------------------------
A0A351B422      ------------------------------------------------------------
F2NEE9          ------------------------------------------------------------
B7RS54          ------------------------------------------------------------
A0A3N5FRH4      ------------------------------------------------------------
A0A1V4Y2C3      ------------------------------------------------------------
A0A2N2KTJ4      ------------------------------------------------------------
A0A2N2LQX0      ------------------------------------------------------------
A0A318D3U4      ------------------------------------------------------------
A0A401FQP5      ------------------------------------------------------------
A0A1Q6DMW3      ------------------------------------------------------------
A0A3A6P8F8      ------------------------------------------------------------
A0A2G2DSM4      ------------------------------------------------------------
A0A1F9NI02      ------------------------------------------------------------
A0A4U1ABX4      ------------------------------------------------------------
A0A351Z4H9      ------------------------------------------------------------
A0A2N2KML4      ------------------------------------------------------------
E1YJF1          ------------------------------------------------------------
A0A1J5EVZ6      ------------------------------------------------------------
A0A2G6FCC5      ------------------------------------------------------------
A0A1F9MR25      ------------------------------------------------------------
A0A2G6M7F1      ------------------------------------------------------------
A0A1I0R9R6      ------------------------------------------------------------
A0A443K010      ------------------------------------------------------------
A0A238IZI1      ------------------------------------------------------------
A0A316GHM6      ------------------------------------------------------------
A0A520ZTR8      ------------------------------------------------------------
A0A212AR83      ------------------------------------------------------------
A0A2E2P4I0      ------------------------------------------------------------
A0A2U2CM86      ------------------------------------------------------------
A0A1X7ACC1      ------------------------------------------------------------
A0A2N3BVE7      ------------------------------------------------------------
A0A2S5JE21      ------------------------------------------------------------
A0A2R8BKZ2      ------------------------------------------------------------
A0A2S8S361      ------------------------------------------------------------
A0A238KUF6      ------------------------------------------------------------
A0A095CTW3      ------------------------------------------------------------
A0A2E3UGD6      ------------------------------------------------------------
A0A2T0RFH0      ------------------------------------------------------------
A0A285D390      ------------------------------------------------------------
A0A497VHN4      ------------------------------------------------------------
A0A379GWF0      ------------------------------------------------------------
A0A536T0W8      ------------------------------------------------------------
A0A2G9XLE5      ------------------------------------------------------------
A0A3D2M6Y9      ------------------------------------------------------------
A0A3D2YAZ2      ------------------------------------------------------------
A0A350A102      ------------------------------------------------------------
A0A350L5D2      ------------------------------------------------------------
A0A1I6ENM4      ------------------------------------------------------------
A8LNM8          ------------------------------------------------------------
A0A0T5NSU3      ------------------------------------------------------------
A0A5P9I718      ------------------------------------------------------------
A0A2M8J3R9      ------------------------------------------------------------
A0A1I6X762      ------------------------------------------------------------
A0A0P1EFX8      ------------------------------------------------------------
A0A2G5KB39      ------------------------------------------------------------
A0A2N3CNV1      ------------------------------------------------------------
A0A257F1F4      ------------------------------------------------------------
A0A1G9FY29      ------------------------------------------------------------
A0A4Q3ZBK4      ------------------------------------------------------------
A0A2D5J8T8      ------------------------------------------------------------
A0A2E3P9W6      ------------------------------------------------------------
A0A2G2B1P9      ------------------------------------------------------------
A0A258GCD5      ------------------------------------------------------------
A0A2D9YR88      ------------------------------------------------------------
A0A443INY4      ------------------------------------------------------------
A0A372IH36      ------------------------------------------------------------
A0A540VW45      ------------------------------------------------------------
A0A1H9C241      ------------------------------------------------------------
A0A2E3FCR1      ------------------------------------------------------------
A0A4S3MG69      ------------------------------------------------------------
A0A1G8QZS5      ------------------------------------------------------------
A0A1V4QMH7      ------------------------------------------------------------
A0A496XZQ4      ------------------------------------------------------------
A0A1F9BJF7      ------------------------------------------------------------
F2NDF5          ------------------------------------------------------------
A0A1I3TTC3      ------------------------------------------------------------
A0A1H3IZW6      ------------------------------------------------------------
A0A0M6YG59      ------------------------------------------------------------
A0A1H7G8B0      ------------------------------------------------------------
A0A059IPK4      ------------------------------------------------------------
A0A1H2Y469      ------------------------------------------------------------
A0A497ZQU7      ------------------------------------------------------------
A0A520CSP5      ------------------------------------------------------------
A0A4Q2XLV7      ------------------------------------------------------------
A0A4Q5QYC4      ------------------------------------------------------------
A0A3B8SQ27      ------------------------------------------------------------
A0A3E0H727      ------------------------------------------------------------
A0A352Q5C1      ------------------------------------------------------------
A0A656BWB0      ------------------------------------------------------------
A0A3Y2RPN4      ------------------------------------------------------------
A0A0A0FHV8      ------------------------------------------------------------
A0A1X3IPU7      ------------------------------------------------------------
A0A0A0G0N2      ------------------------------------------------------------
A0A243TPR1      ------------------------------------------------------------
A0A2I8SDU4      ------------------------------------------------------------
A0A2I8SU55      ------------------------------------------------------------
S1EXJ6          ------------------------------------------------------------
A0A376UBS1      ------------------------------------------------------------
A0A4Q6G931      ------------------------------------------------------------
A0A4Q8R6L6      ------------------------------------------------------------
A0A2T0VBD8      ------------------------------------------------------------
A0A378APS2      ------------------------------------------------------------
A0A443VCQ6      ------------------------------------------------------------
A0A447RKQ7      ------------------------------------------------------------
W1DSK1          ------------------------------------------------------------
A0A0U2VAW2      ------------------------------------------------------------
A0A454CTF1      ------------------------------------------------------------
A0A1W9F5M9      ------------------------------------------------------------
A0A352MMI7      ------------------------------------------------------------
A0A379W6R2      ------------------------------------------------------------
A0A376RY66      ------------------------------------------------------------
A0A377K431      ------------------------------------------------------------
A0A379TA56      ------------------------------------------------------------
A0A4Z0LWV1      ------------------------------------------------------------
A0A620QD02      ------------------------------------------------------------
A0A5H3HSJ8      ------------------------------------------------------------
A0A655C5P0      ------------------------------------------------------------
A0A3C2BN18      ------------------------------------------------------------
A0A447LR75      ------------------------------------------------------------
A0A376D8L7      ------------------------------------------------------------
A0A1V2FV46      ------------------------------------------------------------
A0A376SB61      ------------------------------------------------------------
A0A3D1BYV9      ------------------------------------------------------------
A0A378G3G7      ------------------------------------------------------------
A0A2X5NHJ9      ------------------------------------------------------------
A0A2J4QEC3      ------------------------------------------------------------
A0A485ADM3      ------------------------------------------------------------
A0A4U9HGU4      ------------------------------------------------------------
A0A3S4JGG5      ------------------------------------------------------------
A0A377ZDH2      ------------------------------------------------------------
A0A3S4HTS8      ------------------------------------------------------------
A0A2N1XK22      ------------------------------------------------------------
A0A3D0KAC8      ------------------------------------------------------------
A0A3D2Y902      ------------------------------------------------------------
E1Y9C0          ------------------------------------------------------------
A0A1N6SH58      ------------------------------------------------------------
A0A4Q3AQN2      ------------------------------------------------------------
                                                                            

A0A1F9CFF0      ------------------------------------------------------------
A0A2M8B0G5      ------------------------------------------------------------
A0A363TNU9      ------------------------------------------------------------
A0A0C5VQ86      ------------------------------------------------------------
A0A1V8MBH1      ------------------------------------------------------------
A0A0R0BVC7      ------------------------------------------------------------
A0A3N5J7U8      ------------------------------------------------------------
A0A1S7S3I8      ------------------------------------------------------------
A0A519E8D7      ------------------------------------------------------------
A0A3S1NZ06      ------------------------------------------------------------
A0A3S1FD32      ------------------------------------------------------------
A0A434DUT4      ------------------------------------------------------------
A0A528D3U3      ------------------------------------------------------------
A0A3S3UPT3      ------------------------------------------------------------
A0A3S1E286      ------------------------------------------------------------
A0A531AC71      ------------------------------------------------------------
A0A436K268      ------------------------------------------------------------
A0A434IDQ0      ------------------------------------------------------------
A0A435IRM5      ------------------------------------------------------------
A0A3S2C404      ------------------------------------------------------------
A0A435F6C0      ------------------------------------------------------------
A0A435BMN6      ------------------------------------------------------------
A0A529XQ54      ------------------------------------------------------------
A0A530BJC1      ------------------------------------------------------------
Q44570          ------------------------------------------------------------
A0A655ZZQ1      ------------------------------------------------------------
A0A1S0ZAI3      ------------------------------------------------------------
A0A1W9M770      ------------------------------------------------------------
A0A1W9M7R6      ------------------------------------------------------------
A0A3C0L0A8      ------------------------------------------------------------
A0A176S762      ------------------------------------------------------------
A0A377ZC40      ------------------------------------------------------------
A0A378BPJ7      ------------------------------------------------------------
A0A2J5PAJ7      ------------------------------------------------------------
A0A377ZDN3      ------------------------------------------------------------
A0A1W9WUD9      ------------------------------------------------------------
A0A1W1ZQK0      ------------------------------------------------------------
A0A4U1ALN4      ------------------------------------------------------------
A0A4U1B1A8      ------------------------------------------------------------
A0A1M7Y300      ------------------------------------------------------------
A0A4U1A967      ------------------------------------------------------------
A0A3N5MZ53      ------------------------------------------------------------
A0A534E4H4      ------------------------------------------------------------
A0A534I2B6      ------------------------------------------------------------
A0A1C2JGD0      ------------------------------------------------------------
A0A259LQ70      ------------------------------------------------------------
A0A4V2SPR5      ------------------------------------------------------------
A0A3N5PM86      ------------------------------------------------------------
A0A2E5YSA4      ------------------------------------------------------------
A0A519ERR1      ------------------------------------------------------------
A0A4Q3Q1M2      ------------------------------------------------------------
A0A4Q3MHR1      ------------------------------------------------------------
A0A520GDZ4      ------------------------------------------------------------
A0A318DSU0      ------------------------------------------------------------
A0A538PF21      ------------------------------------------------------------
A0A1W1ZH10      ------------------------------------------------------------
A0A1W2FF24      ------------------------------------------------------------
A0A524JYQ6      ------------------------------------------------------------
A0A4Q3MA17      ------------------------------------------------------------
A0A0N0M5F7      ------------------------------------------------------------
A0A537M754      ------------------------------------------------------------
A0A1V1PDB4      ------------------------------------------------------------
A0A2M7C324      ------------------------------------------------------------
A0A4Q3HHG6      ------------------------------------------------------------
A0A3B7DTA4      ------------------------------------------------------------
A0A432ZK62      ------------------------------------------------------------
A0A1V5EEP4      ------------------------------------------------------------
A0A1V5EF48      ------------------------------------------------------------
A0A0S6X1X6      ------------------------------------------------------------
A0A537Y5L8      ------------------------------------------------------------
A0A4Q3L2X2      ------------------------------------------------------------
A0A4Q3T8J1      ------------------------------------------------------------
A0A4Q4ANM4      ------------------------------------------------------------
A0A4Q3UEC7      ------------------------------------------------------------
A0A1H5YYQ4      ------------------------------------------------------------
A0A1X4NLK2      ------------------------------------------------------------
A0A1X4NWB5      ------------------------------------------------------------
A0A1M5UQ38      ------------------------------------------------------------
A0A327YI48      ------------------------------------------------------------
A0A1B1PNL6      ------------------------------------------------------------
A0A2U8H9H9      ------------------------------------------------------------
A0A1X6YIC0      ------------------------------------------------------------
A0A1I5E9E9      ------------------------------------------------------------
A0A1X6Z7N7      ------------------------------------------------------------
A0A2E1DQ13      ------------------------------------------------------------
A0A1H8C800      ------------------------------------------------------------
A0A2N3EZ05      ------------------------------------------------------------
A0A1W9PMU6      ------------------------------------------------------------
A0A1G3VVY5      ------------------------------------------------------------
A0A2N6BZD5      ------------------------------------------------------------
A0A435NNF5      ------------------------------------------------------------
A0A3S2AQS7      ------------------------------------------------------------
A0A436XH86      ------------------------------------------------------------
A0A527ZPD6      ------------------------------------------------------------
A0A529KRW3      ------------------------------------------------------------
A0A530ZLX0      ------------------------------------------------------------
A0A355TB56      ------------------------------------------------------------
A0A524M660      ------------------------------------------------------------
A0A0C1TRU6      ------------------------------------------------------------
A0A2Z5SSF4      ------------------------------------------------------------
A0A327LYE6      ------------------------------------------------------------
A0A5A9ZTV3      ------------------------------------------------------------
A0A4Q4CIB1      ------------------------------------------------------------
A0A522ACJ9      ------------------------------------------------------------
A0A3N5Z7F8      ------------------------------------------------------------
A0A239HD34      ------------------------------------------------------------
A0A534V9L7      ------------------------------------------------------------
A0A0P7ZZE4      ------------------------------------------------------------
A0A369R0Q9      ------------------------------------------------------------
A5G4N9          ------------------------------------------------------------
A0A238LBD3      ------------------------------------------------------------
A0A0P1FRV5      ------------------------------------------------------------
A0A0P1FWI8      ------------------------------------------------------------
A0A1M7BLL7      ------------------------------------------------------------
A0A0H4KZM1      ------------------------------------------------------------
A0A1V1UJT2      ------------------------------------------------------------
A0A0L6CVX1      ------------------------------------------------------------
A0A1V0RR48      ------------------------------------------------------------
A0A0A0HJJ4      ------------------------------------------------------------
A0A5E7YA28      ------------------------------------------------------------
A0A348SRI7      ------------------------------------------------------------
A0A354EI73      ------------------------------------------------------------
A0A4P7EP83      ------------------------------------------------------------
A0A3A4NIE9      ------------------------------------------------------------
A0A3A4NUI9      ------------------------------------------------------------
A0A524I3Z6      ------------------------------------------------------------
A0A524PCL7      ------------------------------------------------------------
A0A356GQV1      ------------------------------------------------------------
A0A1J5DAY8      ------------------------------------------------------------
A0A524P237      ------------------------------------------------------------
A0A1G3JY11      ------------------------------------------------------------
A0A661N3U1      ------------------------------------------------------------
A0A3S1WTQ1      ------------------------------------------------------------
A0A440NX85      ------------------------------------------------------------
A0A530CUR9      ------------------------------------------------------------
A0A1M6N1X5      ------------------------------------------------------------
A0A561M3U0      ------------------------------------------------------------
A0A2W5J775      ------------------------------------------------------------
A0A1F9E324      ------------------------------------------------------------
A0A432SAI6      ------------------------------------------------------------
A0A4Q3LBH4      ------------------------------------------------------------
A0A4Q3LWP3      ------------------------------------------------------------
A0A2N6VGL1      ------------------------------------------------------------
A0A3M3H5V6      ------------------------------------------------------------
A0A2T4ZJZ6      ------------------------------------------------------------
A0A1T2KYM8      ------------------------------------------------------------
A0A2G9ZR82      ------------------------------------------------------------
A0A4U9I390      ------------------------------------------------------------
A0A534XP85      ------------------------------------------------------------
A0A2X3M011      ------------------------------------------------------------
I2WC85          ------------------------------------------------------------
A0A400JH80      ------------------------------------------------------------
A0A2H9EHM4      ------------------------------------------------------------
A0A380B3D7      ------------------------------------------------------------
F5NSX0          ------------------------------------------------------------
D8EEU7          ------------------------------------------------------------
A0A479JNB1      ------------------------------------------------------------
A0A5C9AF52      ------------------------------------------------------------
A0A0P1H2H0      ------------------------------------------------------------
A0A258WKV0      ------------------------------------------------------------
A0A377N8F8      ------------------------------------------------------------
A0A3C2DSE7      ------------------------------------------------------------
A0A2X1JBG5      ------------------------------------------------------------
A0A0B8PTA8      ------------------------------------------------------------
A0A0B8QF75      ------------------------------------------------------------
A0A4Q3LR91      ------------------------------------------------------------
A0A4V1TR68      ------------------------------------------------------------
A0A444IY46      ------------------------------------------------------------
A0A660AID0      ------------------------------------------------------------
A0A3E0WKI3      ------------------------------------------------------------
A0A1H3I2J1      ------------------------------------------------------------
A0A1V5DJV0      ------------------------------------------------------------
A0A520IUC4      ------------------------------------------------------------
A0A521LJG5      ------------------------------------------------------------
A0A531IBQ7      ------------------------------------------------------------
A0A377LY04      ------------------------------------------------------------
A0A5C9ABR5      ------------------------------------------------------------
A0A5J9WU72      ------------------------------------------------------------
A0A2X3K9R3      ------------------------------------------------------------
A0A3T9EHW9      ------------------------------------------------------------
A0A484X141      ------------------------------------------------------------
A0A5N9VWI6      ------------------------------------------------------------
A0A3D3PV27      ------------------------------------------------------------
A0A376LLF8      ------------------------------------------------------------
A0A444R390      ------------------------------------------------------------
A0A1V4WHZ7      ------------------------------------------------------------
A0A1E5AJN5      SNPGPVFLPGEASGTGNFVPSLGGSLLTDPVRLFMTAVSYSWLIIACAISGLVMGSVYAS
A0A2N3D2J1      ------------------------------------------------------------
A0A2N2GVE1      ------------------MAEPLGPFDAAPANNNAPAQTQVDWKRIFHIVRNYFWIVLLT
A0A2N2INV3      ------------------MAEPLGPFDAAPASNNAPAQTQVDWKRIFHIVRNYFWIVLLT
A0A1Y5DXG5      ------------------------------------------------------------
A0A0B8P2H5      ------------------------------------------------------------
A0A483QWI8      ------------------------------------------------------------
A0A483UXD3      ------------------------------------------------------------
A0A0A8J8L3      ------------------------------------------------------------
A0A660DJ38      ------------------------------------------------------------
A0A380AQW6      ------------------------------------------------------------
A0A2G2GD62      QISEKGRSGWNDPVLTALGLGDSQGQNIDSIMSSGYLISKMLENLELGTRYYKEKNYRLV
A0A524P331      ------------------------------------------------------------
A0A4V1SSM5      ------------------------------------------------------------
A0A4Q3K8G7      ------------------------------------------------------------
A0A1M7HC79      ------------------------------------------------------------
A0A1D3JZN6      ------------------------------------------------------------
A0A1V6ESG1      ------------------------------------------------------------
A0A1H7YHK3      ------------------------------------------------------------
A0A534SH66      ------------------------------------------------------------
A0A3M0ZZ99      ------------------------------------------------------------
A0A328C2K5      ------------------MSDQYGFQEPRSQSAPEERGESLGALIGRYWVLFRRFYWVLI
A0A5C6X8M3      ------------------MSDQYGFQEPRPSSAPEERGESLGALIGRYWALFRRFYWVLI
A0A3D8MRR7      ------------------MSDQYGFQEPRQSSAPEERGESLGALIGRYWALFRRFYWVLI
A0A5C6UBJ7      ------------------MSDQYGFQEPRQSSAPEERGESLGALIGRYWALFRRFYWVLI
A0A5C6XGM3      ------------------MSDQYGFQEPRPSSAPEERGESLGALIGRYWALFRRFYWVLI
A0A537NZJ1      ------------------------------------------------------------
A0A4Q4CVW6      ------------------------------------------------------------
A0A090R136      ------------------------------------------------------------
A0A661JU93      ------------------------------------------------------------
A0A2E2T3V8      -------------------------------MTISDLVGILYRRRGVFAVSFVALLMMAS
A0A367UAB4      -------------------------------MTISDLVGILYRRRGVFAVSFVALLMMAS
A0A377V641      ------------------------------------------------------------
A0A1F2YJ88      ------------------------------------------------------------
A0A0J7XGZ1      ---------------------------------------------------------MLP
I4CBA7          ----------------------------------------------MSTYSPHDSEAFEF
A3VE95          ------------------------MTTFDMQAVRSGRSSERSEDIDRVDVRGLLRAIFSR
A0A1G0NL95      ------------------------------------------------------------
A0A024KA69      ------------------------------------------------------------
A0A0L1KFN4      ------------------------------------------------------------
A0A3P5DSS6      ------------------------------------------------------------
A0A483YEL5      ------------------------------------------------------------
A0A658GUJ0      ------------------------------------------------------------
A0A358L616      ------------------------------------------------------------
A0A3D5UYX7      ------------------------------------------------------------
A0A2N1WQN5      ------------------------------------------------------------
A0A352G2C2      ------------------------------------------------------------
A0A3C0PZN1      ------------------------------------------------------------
A0A524QFS4      ATGSGSDGKESRRQQGNVPRVGPGVDAPRGYPAYHVPGYPSYATMNDSRFAELDLFDFRD
A0A520JSW4      ---------------------MPDVFVQSSGDGDHRRNGSAAGGSRELSLAVLWRIAFEW
A0A4Q3LTF3      ------------------------------------------------------------
A0A537UTP9      ------------------------------------------------------------
A0A1D2RNR5      ------------------------------------------------------------
A0A4V1TQ46      ------------------------------------------------------------
A0A3A0FZC0      ------------------------------------------------------------
A0A1N7JVZ7      ------------------------------------------------------------
A0A091C4A8      ------------------------------------------------------------
A0A4R3H6P6      ----MERISPQMLGLATSEMTLFSGRAAPEATGHAGAPPLRRLLRAATRWRWVLLGGVAA
A0A3S1NQ09      ------------------------------------------------------------
A0A443GJ52      ------------------------------------------------------------
A0A2W6S588      -----------------------------------MNQEQDGSATQDLAGIVSRFRRHLP
A0A483E0N4      ------------------------------------------------------------
A0A2J4YQQ6      ------------------------------------------------------------
A0A483THX4      ------------------------------------------------------------
A0A534MVS2      ------------------------------------------------------------
A0A444I5K6      ------------------------------------------------------------
A0A154VE85      PLQPNPAARAGMAPSPADAPMPLRRGLSRNKPLFAISFLALAGLGLAIVAGLPERYRATA
A0A3S1MCW7      ------------------------------------------------------------
A0A434IGN6      ------------------------------------------------------------
A0A528AX40      ------------------------------------------------------------
A0A528MV95      ------------------------------------------------------------
A0A3C1S9Y1      ------------------------------------------------------------
A0A353EH49      ----------------------------------MMARKFERSQAGVAEPLLGFDAYAWG
A0A1Y1Q9C1      ------------------------------------------------------------
A0A3M7LJH0      ------------------------------------------------------------
A0A316KRG4      ------------------------------------------------------------
A0A1E4JHX8      ------------------------------------------------------------
M2U8P2          --------------------------------MTADFAEKNATGPLLDFGKLTVIARRRI
A0A1H7KZF8      -----------------------MNAPFGRIEAAVAPPPAPLFALDFDRLWVPVRRSLVP
A0A0J5Q9T7      ------------------------------------------------------------
A0A257NG76      ------------------------------------------------------------
A0A1T4TW59      ------------------------------------------------------------
A0A1I5YYQ0      ------------------------------------------------------------
A0A5P9FE62      ------------------------------------------------------------
A0A1Q3MB35      ------------------------------------------------------------
A0A259LUN7      ------------------------------------------------------------
A0A2D7AVL1      ------------------------------------------------------------
A0A3B9KZE9      ------------------------------------------------------------
A0A2U0NMP8      ------------------------------------------------------------
A0A4U9HNE9      ------------------------------------------------------------
A0A2G2CXY6      ------------------------------------------------------MGSWAA
A0A3M1D4H3      ------------------------------------------------------------
A0A5C8BYM7      ------------------------------------------------------------
A0A1J5ICP0      ------------------------------------------------------------
A0A0M3GBT1      ------------------------------------------------------------
B3Q577          ------------------------------------------------------------
A0A379B9V4      ----------------------------------------------------MRLKKLDL
A0A0Q6TS97      ------------------------------------------------------------
A0A0Q6UYB4      ------------------------------------------------------------
A0A484XS37      ------------------------------------------------------------
W7Q5J0          TSAEIQILQSRMVLGHAVDRLGQENIIRPVTMPIIGDYVVRQGIQRPDFPIMLPYISDYV
A0A654AKT6      ------------------------------------------------------------
A0A0G9MZA5      ------------------------------------------------------------
H0T8B0          ------------------------------------------------------------
A0A5C7N981      ------------------------------------------------------------
A0A534TV22      ------------------------------------------------------------
A0A351CXR4      --------------------------------------------MLGYNSSLNNTPMYQS
A0A2N6GLF5      ------------------------------------------------------------
A0A1W9LJP0      ------------------------------------------------------------
A0A0W1ICB0      ------------------------------------------------------------
A0A2E0UL88      ------------------------------------------------------------
A0A233IKJ2      ------------------------------------------------------------
A0A2T1JE00      ------------------------------------------------------------
A0A0T2QIS1      ------------------------------------------------------------
A0A376KYN0      ------------------------------------------------------------
A0A2X1JB05      ------------------------------------------------------------
A0A376RML0      ------------------------------------------------------------
A0A377E5P7      ------------------------------------------------------------
A0A0P7Y1D0      ------------------------------------------------------------
A0A2M7JRZ7      ------------------------------------------------------------
A0A167IR75      ------------------------------------------------------------
X7F6S5          ------------------------------------------------------------
A0A1G7CFZ2      ------------------------------------------------------------
A0A1P8USW9      ------------------------------------------------------------
A0A1I6U4V1      ------------------------------------------------------------
A0A1G8NKI0      ------------------------------------------------------------
A0A355QPE4      ------------------------------------------------------------
A0A357RN98      ------------------------------------------------------------
A0A3B8T2U6      ------------------------------------------------------------
A0A365PWR2      ------------------------------------------------------------
A0A2E9H5Z8      ------------------------------------------------------------
A0A2E2BR79      ------------------------------------------------------------
A0A0Q4Q524      ------------------------------------------------------------
A0A0Q4CFJ9      ------------------------------------------------------------
A0A0Q4FE58      ------------------------------------------------------------
A0A0Q4JWC8      ------------------------------------------------------------
A0A0Q4KFL8      ------------------------------------------------------------
A0A522R8R0      ------------------------------------------------------------
A0A2U9NDY5      ------------------------------------------------------------
A0A0Q4IGG1      ------------------------------------------------------------
A0A534RUJ5      ------------------------------------------------------------
A0A3M1CJM3      ------------------------------------------------------------
A0A2R7SVD4      ------------------------------------------------------------
A0A3C0PWB6      ------------------------------------------------------------
V4Q8B7          ------------------------------------------------------------
A0A0Q8XKK5      ------------------------------------------------------------
A0A2E0Q2W0      ------------------------------------------------------------
A0A660NIR6      ------------------------------------------------------------
A0A142W0R3      ------------------------------------------------------------
A0A0S4XR18      ------------------------------------------------------------
A0A2E0GW64      ------------------------------------------------------------
A0A1A7QJ97      ------------------------------------------------------------
A0A661LW70      ------------------------------------------------------------
W7Q8F9          ------------------------------------------------------------
A0A524PXH8      ------------------------------------------------------------
A0A4Q3P0E4      ------------------------------------------------------------
A0A3M2BE89      ------------------------------------------------------------
A0A4Q4A6K6      ------------------------------------------------------------
A0A257G674      ------------------------------------------------------------
A0A661M5M6      ------------------------------------------------------------
A0A1I1UM01      ------------------------------------------------------------
Q44573          ------------------------------------------------------------
A2W025          ------------------------------------------------------------
A0A534Z362      IIDAEFSGAPRHLREYLWVLHKYRWLAATCFGLTFGLTVFATLLTPRLYSASTRLELARQ
V4J283          ------------------------------------------------------------
A0A536T443      ------------------------------------------------------------
A0A0Q4UFQ5      ------------------------------------------------------------
A0A527W7E6      ------------------------------------------------------------
A0A432EMV7      ------------------------------------------------------------
A0A087LTV7      ------------------------------------------------------------
A0A534WLI3      ------------------------------------------------------------
A0A318KWA2      ------------------------------------------------------------
A0A522MT86      ------------------------------------------------------------
A0A4Q3I221      ------------------------------------------------------------
A0A534SAL6      IDAEFSEVPARHLRDYLRLLYKYRWLAATCLA--------VTLLTTRLYTASTRLQMARQ
A0A534ZDB4      IDAEFSEVPARHLRDYLRLLYKYRWLAATCLALTLGLALLVTLVTTRLYTG---------
A0A534X3M7      FDAEFSEQP-RHLRAHLSVLHKHRWLAVTCFAVTVVSTAVLTLLTPRLYTASTRLEVARQ
A0A534SPC6      ------------------------------------------------------------
A0A535AD60      IDAEFSEAP-RHLREHLWVLHKYRWLAATCFGLTFGLTVFATLLTPRLYTASTRLELARQ
A0A4Q3SY08      ------------------------------------------------------------
A0A4Q3LG23      ------------------------------------------------------------
A0A522EX52      ------------------------------------------------------------
A0A1H3KC95      ------------------------------------------------------------
A0A5P8Z4P3      ------------------------------------------------------------
A0A0B3RZC9      ------------------------------------------------------------
A0A2E9HXF7      ------------------------------------------------------------
A0A520HUH4      ------------------------------------------------------------
A0A2K8U7M6      ------------------------------------------------------------
A0A5B9DKL8      ------------------------------------------------------------
A0A238KJM1      ------------------------------------------------------------
A0A3A0FJZ4      ------------------------------------------------------------
W4HJV8          ------------------------------------------------------------
A0A0P1GDI0      ------------------------------------------------------------
A0A2R8ATV5      ------------------------------------------------------------
A0A1U7D3R6      ------------------------------------------------------------
A0A2D4UVV2      ------------------------------------------------------------
A0A0W7WHP4      ------------------------------------------------------------
A0A238J8F6      ------------------------------------------------------------
A0A238JQI6      ------------------------------------------------------------
A0A222E077      ------------------------------------------------------------
A0A239E3Y2      ------------------------------------------------------------
A0A1W9HS52      ------------------------------------------------------------
A0A2D5LFD8      ------------------------------------------------------------
A0A0N0XAV4      ------------------------------------------------------------
A0A0P9QD19      ------------------------------------------------------------
F3FHG4          ------------------------------------------------------------
F3GGI0          ------------------------------------------------------------
A0A0P9LE74      ------------------------------------------------------------
A0A3M4ZQ14      -----------------------------------------------------------M
A0A3M5YLE8      -----------------------------------------------------------M
A0A3M3RP89      -----------------------------------------------------------M
A0A0P9QIY7      -----------------------------------------------------------M
A0A0P9VVH7      -----------------------------------------------------------M
A0A0Q0FJK6      -----------------------------------------------------------M
A0A0Q0G2J0      -----------------------------------------------------------M
A0A3M3LF66      -----------------------------------------------------------M
A0A0P9WIR8      -----------------------------------------------------------M
A0A3M3KPE5      ------------------------------------------------------------
A0A3M4C263      ------------------------------------------------------------
A0A3M5AD05      ------------------------------------------------------------
A0A0Q0D3D2      ------------------------------------------------------------
A0A0N0FS39      ------------------------------------------------------------
A0A3M6GHH2      ------------------------------------------------------------
A0A0P9R9W0      ------------------------------------------------------------
A0A0Q0B9T0      ------------------------------------------------------------
A0A3M6CFI7      ------------------------------------------------------------
A0A0P9JXN0      ------------------------------------------------------------
A0A3M6FIV7      ------------------------------------------------------------
A0A3M3PLW9      ------------------------------------------------------------
A0A3M4ENY1      ------------------------------------------------------------
A0A3M5EZK7      ------------------------------------------------------------
A0A0P9SPP5      ------------------------------------------------------------
A0A658KL17      ------------------------------------------------------------
A0A3M3NNF2      ------------------------------------------------------------
A0A3M4A0E8      ------------------------------------------------------------
A0A3M4PBZ2      ------------------------------------------------------------
A0A3M6AI26      ------------------------------------------------------------
A0A0P9IWP8      ------------------------------------------------------------
A0A0P9KZ49      ------------------------------------------------------------
A0A0P9V840      ------------------------------------------------------------
A0A0Q0AIE5      ------------------------------------------------------------
A0A3M2ZQH6      ------------------------------------------------------------
A0A0N8SQG2      ------------------------------------------------------------
A0A0W8HFU1      ------------------------------------------------------------
A0A3M5M873      ------------------------------------------------------------
A0A0P9VHH8      ------------------------------------------------------------
A0A0P9YV98      ------------------------------------------------------------
A0A3M3G2W8      ------------------------------------------------------------
A0A3M6C224      ------------------------------------------------------------
A0A3M5K254      ------------------------------------------------------------
A0A3M5JFB0      ------------------------------------------------------------
A0A3M3TQV3      ------------------------------------------------------------
A0A3M3EF92      ------------------------------------------------------------
A0A3M5J1E2      ------------------------------------------------------------
A0A3M5G7H9      ------------------------------------------------------------
A0A3M4A376      ------------------------------------------------------------
A0A0Q0A5T8      ------------------------------------------------------------
A0A0P9SCD7      ------------------------------------------------------------
A0A0P9T4G3      ------------------------------------------------------------
A0A0P9VKB0      ------------------------------------------------------------
A0A0Q0BM35      ------------------------------------------------------------
A0A3M3TPR7      ------------------------------------------------------------
A0A3M3U4Q3      ------------------------------------------------------------
A0A0P9UCX7      ------------------------------------------------------------
A0A0P9S1F1      ------------------------------------------------------------
A0A0P9QCJ2      ------------------------------------------------------------
A0A0P9Q329      ------------------------------------------------------------
A0A3M5GJ64      ------------------------------------------------------------
A0A0P9MPC7      ------------------------------------------------------------
A0A3M2XYQ3      ------------------------------------------------------------
A0A0P9XCE1      ------------------------------------------------------------
A0A3M3EFX7      ------------------------------------------------------------
A0A3M5B9D9      ------------------------------------------------------------
A0A0P9RRZ3      ------------------------------------------------------------
A0A3M2VEK7      ------------------------------------------------------------
A0A0N8R9B3      ------------------------------------------------------------
A0A0P9VA27      ------------------------------------------------------------
A0A3M4YBJ4      ------------------------------------------------------------
A0A0P9J470      ------------------------------------------------------------
A0A0Q0EVJ8      ------------------------------------------------------------
A0A3M5UI30      ------------------------------------------------------------
A0A3M5YQT8      ------------------------------------------------------------
A0A3M5F5X1      ------------------------------------------------------------
A0A3M5R8G1      ------------------------------------------------------------
A0A3M5V012      ------------------------------------------------------------
A0A3M3GA16      ------------------------------------------------------------
A0A3M3UCT3      ------------------------------------------------------------
A0A3M3CJL0      ------------------------------------------------------------
A0A3M3F6F5      ------------------------------------------------------------
A0A3M3P9B7      ------------------------------------------------------------
A0A0N8QB74      ------------------------------------------------------------
A0A0Q0AUD0      ------------------------------------------------------------
A0A3M5VR55      ------------------------------------------------------------
A0A0Q0FK97      ------------------------------------------------------------
A0A3M5KZ75      ------------------------------------------------------------
A0A3M5L3G5      ------------------------------------------------------------
A0A1V6FYJ1      ------------------------------------------------------------
A0A445MZQ4      ------------------------------------------------------------
A0A0M9E0E3      ------------------------------------------------------------
A0A0Q6QV61      ------------------------------------------------------------
A0A2Z3IKG4      ------------------------------------------------------------
A0A4Q3IRI1      ------------------------------------------------------------
A0A2W4RFS2      ------------------------------------------------------------
A0A1Y6DC43      ------------------------------------------------------------
A0A2S6HE06      ------------------------------------------------------------
G3J0M3          ------------------------------------------------------------
V5C6R5          ------------------------------------------------------------
A0A354EF47      ------------------------------------------------------------
A0A2G6MSP7      ------------------------------------------------------------
A0A1V4M8I1      ------------------------------------------------------------
A0A4Z0M4C7      ------------------------------------------------------------
A0A4U8YMP3      ------------------------------------------------------------
A0A1Q8QQ99      ------------------------------------------------------------
A0A3D5ZY44      ------------------------------------------------------------
A0A646J2A6      ------------------------------------------------------------
A0A1G5C236      ------------------------------------------------------------
A0A5Q2QDL1      ------------------------------------------------------------
A0A656PSQ6      ------------------------------------------------------------
A0A1I3XJ27      ------------------------------------------------------------
A0A1I7DCG1      ------------------------------------------------------------
A0A3A3H6D9      ------------------------------------------------------------
A0A562CGU2      ------------------------------------------------------------
A0A0Q6VA36      ------------------------------------------------------------
A0A1B2EQN1      ------------------------------------------------------------
A0A1E7HSL6      ------------------------------------------------------------
W9VVY5          ------------------------------------------------------------
A0A1E2URD3      ------------------------------------------------------------
A0A2T6MY81      ------------------------------------------------------------
A0A2T6NBQ8      ------------------------------------------------------------
A0A421K431      ------------------------------------------------------------
A0A2G2I5M1      ------------------------------------------------------------
A0A2G2M6F0      ------------------------------------------------------------
A0A1W9J9F8      ------------------------------------------------------------
A0A2S5LFJ9      ------------------------------------------------------------
A0A2D8R8F8      ------------------------------------------------------------
A0A010SNS0      ------------------------------------------------------------
A0A0C2I782      ------------------------------------------------------------
A0A2N8BYF5      ------------------------------------------------------------
A0A558FKX2      ------------------------------------------------------------
A0A1H1DBA0      ------------------------------------------------------------
J2TAD5          ------------------------------------------------------------
J3H699          ------------------------------------------------------------
A0A1H5J974      ------------------------------------------------------------
A0A0K1QRZ4      ------------------------------------------------------------
A0A560RJW9      ------------------------------------------------------------
A0A5E6TID7      ------------------------------------------------------------
A0A5E7CRU7      ------------------------------------------------------------
A0A5E7C564      ------------------------------------------------------------
A0A2W7MAV4      ------------------------------------------------------------
A0A4R3WQH5      ------------------------------------------------------------
W6VFG3          ------------------------------------------------------------
A0A1P8ENT1      ------------------------------------------------------------
A0A2N7XRV4      ------------------------------------------------------------
A0A0Q6QPG8      ------------------------------------------------------------
A0A0F4SWA7      ------------------------------------------------------------
A0A423J219      ------------------------------------------------------------
A0A4P6G9U8      ------------------------------------------------------------
A0A4Y8JE06      ------------------------------------------------------------
A0A502I1X9      ------------------------------------------------------------
A0A502J776      ------------------------------------------------------------
A0A5B0EZF6      ------------------------------------------------------------
A0A059L434      ------------------------------------------------------------
A0A0F4UWN2      ------------------------------------------------------------
A0A5E7WEF5      ------------------------------------------------------------
A0A1G0KSD0      ------------------------------------------------------------
A0A4P6WX84      ------------------------------------------------------------
A0A1D2S760      ------------------------------------------------------------
A0A5B8RW94      ------------------------------------------------------------
A0A258TN88      ------------------------------------------------------------
A0A4Q3ZDI7      ------------------------------------------------------------
A0A537PRC6      ------------------------------------------------------------
A0A2M7JX59      ------------------------------------------------------------
A0A3A4XVN3      ------------------------------------------------------------
A0A1E7JEV6      ------------------------------------------------------------
A0A2N2KDY5      ------------------------------------------------------------
A0A3N5YUD9      ------------------------------------------------------------
A0A0W1DLQ3      ------------------------------------------------------------
A0A246JVD8      ------------------------------------------------------------
A0A2N3BB54      ------------------------------------------------------------
A0A1H6G7A3      ------------------------------------------------------------
A0A0A7PGL6      ------------------------------------------------------------
A0A4Q2Z4L0      ------------------------------------------------------------
A0A5C4N0H6      ------------------------------------------------------------
A0A4R1HDF2      ------------------------------------------------------------
A0A1E7HFN0      ------------------------------------------------------------
A0A1M5GH86      ------------------------------------------------------------
A0A1W1XQZ5      ------------------------------------------------------------
A0A3D6C3I2      ------------------------------------------------------------
S0G1D4          ------------------------------------------------------------
A0A661T246      ------------------------------------------------------------
A0A2G6CSG7      ------------------------------------------------------------
A0A2G6NB59      ------------------------------------------------------------
A0A5K8A7T9      ------------------------------------------------------------
A0A1W9U045      ------------------------------------------------------------
A0A1F9L9G4      ------------------------------------------------------------
A0A328FD76      ------------------------------------------------------------
A0A348UX90      ------------------------------------------------------------
A0A357Z0N5      ------------------------------------------------------------
A0A0F2R2U0      ------------------------------------------------------------
A0A5K7ZK00      ------------------------------------------------------------
A0A5K7YCX8      ------------------------------------------------------------
A0A5K7Z388      ------------------------------------------------------------
A0A352B502      ------------------------------------------------------------
A0A2K8WHP8      ------------------------------------------------------------
A0A410V446      ------------------------------------------------------------
A0A0R3KGJ5      ------------------------------------------------------------
A0A0R3N604      ------------------------------------------------------------
A0A1B1UCM8      ------------------------------------------------------------
A0A1N6JQ20      ------------------------------------------------------------
A0A1M5TI07      ------------------------------------------------------------
A3X191          ------------------------------------------------------------
A0A1H4RKV5      ------------------------------------------------------------
A0A160UA87      ------------------------------------------------------------
A0A1Q5SFV5      ------------------------------------------------------------
A0A1J5N774      ------------------------------------------------------------
A0A2C8F781      ------------------------------------------------------------
A0A2E3R6G0      ------------------------------------------------------------
A0A1F8XMK2      ------------------------------------------------------------
A0A3M8EMP2      ------------------------------------------------------------
A0A2J6J6K6      ------------------------------------------------------------
A0A1G6EKK9      ------------------------------------------------------------
S7TK97          ------------------------------------------------------------
S7UE93          ------------------------------------------------------------
A0A3D5BR56      ------------------------------------------------------------
A0A2N2IB15      ------------------------------------------------------------
A0A1I3PSR2      ------------------------------------------------------------
A0A1I4GEK4      ------------------------------------------------------------
A0A0A8WSG4      ------------------------------------------------------------
A0A2T5R3J5      ------------------------------------------------------------
A0A661PSB9      ------------------------------------------------------------
A0A661QBT6      ------------------------------------------------------------
A0A1W7QPT7      ------------------------------------------------------------
A0A1L3GKM9      ------------------------------------------------------------
A0A0M4D373      ------------------------------------------------------------
A0A5J4MX76      ------------------------------------------------------------
A0A430DNP0      ------------------------------------------------------------
A0A3A0FQ32      ------------------------------------------------------------
A0A1E4UZA0      ------------------------------------------------------------
A0A1H9KL56      ------------------------------------------------------------
A0A1A9KEF8      ------------------------------------------------------------
A0A5E6PKN5      ------------------------------------------------------------
A0A0N9W1V6      ------------------------------------------------------------
A0A423GQ41      ------------------------------------------------------------
A0A423H7J2      ------------------------------------------------------------
A0A502HNM8      ------------------------------------------------------------
A0A4Q7H223      ------------------------------------------------------------
A0A1H4N2K9      ------------------------------------------------------------
A0A2K4KWF7      ------------------------------------------------------------
A0A3E0WXH2      ------------------------------------------------------------
A0A2N2TRC8      ------------------------------------------------------------
A0A1V4CIZ7      ------------------------------------------------------------
A0A1M3BXA5      ------------------------------------------------------------
A0A1Y2R3U6      ------------------------------------------------------------
A0A167HVD6      ------------------------------------------------------------
A0A1V3SCT6      ------------------------------------------------------------
L0H287          ------------------------------------------------------------
A0A495VG93      ------------------------------------------------------------
A0A4R3MYM4      ------------------------------------------------------------
G2E3C0          ------------------------------------------------------------
A0A534QGR3      ------------------------------------------------------------
A0A4U8YLL7      ------------------------------------------------------------
A0A655RNN3      ------------------------------------------------------------
A0A655R819      ------------------------------------------------------------
A0A655ZEY0      ------------------------------------------------------------
A0A0W1GMS6      ------------------------------------------------------------
A0A0Q8RMY3      ------------------------------------------------------------
A0A1A7QC21      ------------------------------------------------------------
A0A2M7WWF7      ------------------------------------------------------------
A0A351Z9A2      ------------------------------------------------------------
A0A3N5RNY4      ------------------------------------------------------------
A0A1E7H876      ------------------------------------------------------------
A0A0F2NF69      ------------------------------------------------------------
A0A1F9NFD0      ------------------------------------------------------------
A0A1M5YLH5      ------------------------------------------------------------
A0A4U1A4C7      ------------------------------------------------------------
A0A509L3P8      ------------------------------------------------------------
A0A3A4S038      ------------------------------------------------------------
A0A1F9N669      ------------------------------------------------------------
A0A1F9PFA7      ------------------------------------------------------------
A0A1H2EN09      ------------------------------------------------------------
K0NP00          ------------------------------------------------------------
A0A432HIS7      ------------------------------------------------------------
A0A127AL56      ------------------------------------------------------------
A0A1E7JCL5      ------------------------------------------------------------
A0A496YAH9      ------------------------------------------------------------
A0A1V4S7E4      ------------------------------------------------------------
A0A2N2H8D2      ------------------------------------------------------------
A0A2N2KC63      ------------------------------------------------------------
A0A3A4ZYW4      ------------------------------------------------------------
A0A1V4MCJ4      ------------------------------------------------------------
A0A661M0W4      ------------------------------------------------------------
A0A1X0YE57      ------------------------------------------------------------
A0A2K2H9Q8      ------------------------------------------------------------
A0A2N6BEI9      ------------------------------------------------------------
A0A318CT66      ------------------------------------------------------------
A0A3N5P205      ------------------------------------------------------------
A0A0D5N3E9      ------------------------------------------------------------
A0A2N2G716      ------------------------------------------------------------
A0A1F9EUS2      ------------------------------------------------------------
A0A3N9VAW3      ------------------------------------------------------------
A0A1H4B8T3      ------------------------------------------------------------
A0A1E7IQC3      ------------------------------------------------------------
A0A1M6KEN5      ------------------------------------------------------------
A0A353QLL3      ------------------------------------------------------------
A0A399I453      ------------------------------------------------------------
A0A651FBV9      ------------------------------------------------------------
A0A1G0LDK7      ------------------------------------------------------------
A0A562VHD2      ------------------------------------------------------------
A0A5C1MDH8      ------------------------------------------------------------
A0A5A9XE04      ------------------------------------------------------------
A0A643G9R1      ------------------------------------------------------------
A0A1G0M8Q7      ------------------------------------------------------------
A0A353MI14      ------------------------------------------------------------
A0A4S1CAW7      ------------------------------------------------------------
A0A534HBS8      ------------------------------------------------------------
A0A0F0T3Y9      ------------------------------------------------------------
A0A351B422      ------------------------------------------------------------
F2NEE9          ------------------------------------------------------------
B7RS54          ------------------------------------------------------------
A0A3N5FRH4      ------------------------------------------------------------
A0A1V4Y2C3      ------------------------------------------------------------
A0A2N2KTJ4      ------------------------------------------------------------
A0A2N2LQX0      ------------------------------------------------------------
A0A318D3U4      ------------------------------------------------------------
A0A401FQP5      ------------------------------------------------------------
A0A1Q6DMW3      ------------------------------------------------------------
A0A3A6P8F8      ------------------------------------------------------------
A0A2G2DSM4      ------------------------------------------------------------
A0A1F9NI02      ------------------------------------------------------------
A0A4U1ABX4      ------------------------------------------------------------
A0A351Z4H9      ------------------------------------------------------------
A0A2N2KML4      ------------------------------------------------------------
E1YJF1          ------------------------------------------------------------
A0A1J5EVZ6      ------------------------------------------------------------
A0A2G6FCC5      ------------------------------------------------------------
A0A1F9MR25      ------------------------------------------------------------
A0A2G6M7F1      ------------------------------------------------------------
A0A1I0R9R6      ------------------------------------------------------------
A0A443K010      ------------------------------------------------------------
A0A238IZI1      ------------------------------------------------------------
A0A316GHM6      ------------------------------------------------------------
A0A520ZTR8      ------------------------------------------------------------
A0A212AR83      ------------------------------------------------------------
A0A2E2P4I0      ------------------------------------------------------------
A0A2U2CM86      ------------------------------------------------------------
A0A1X7ACC1      ------------------------------------------------------------
A0A2N3BVE7      ------------------------------------------------------------
A0A2S5JE21      ------------------------------------------------------------
A0A2R8BKZ2      ------------------------------------------------------------
A0A2S8S361      ------------------------------------------------------------
A0A238KUF6      ------------------------------------------------------------
A0A095CTW3      ------------------------------------------------------------
A0A2E3UGD6      ------------------------------------------------------------
A0A2T0RFH0      ------------------------------------------------------------
A0A285D390      ------------------------------------------------------------
A0A497VHN4      ------------------------------------------------------------
A0A379GWF0      ------------------------------------------------------------
A0A536T0W8      ------------------------------------------------------------
A0A2G9XLE5      ------------------------------------------------------------
A0A3D2M6Y9      ------------------------------------------------------------
A0A3D2YAZ2      ------------------------------------------------------------
A0A350A102      ------------------------------------------------------------
A0A350L5D2      ------------------------------------------------------------
A0A1I6ENM4      ------------------------------------------------------------
A8LNM8          ------------------------------------------------------------
A0A0T5NSU3      ------------------------------------------------------------
A0A5P9I718      ------------------------------------------------------------
A0A2M8J3R9      ------------------------------------------------------------
A0A1I6X762      ------------------------------------------------------------
A0A0P1EFX8      ------------------------------------------------------------
A0A2G5KB39      ------------------------------------------------------------
A0A2N3CNV1      ------------------------------------------------------------
A0A257F1F4      ------------------------------------------------------------
A0A1G9FY29      ------------------------------------------------------------
A0A4Q3ZBK4      ------------------------------------------------------------
A0A2D5J8T8      ------------------------------------------------------------
A0A2E3P9W6      ------------------------------------------------------------
A0A2G2B1P9      ------------------------------------------------------------
A0A258GCD5      ------------------------------------------------------------
A0A2D9YR88      ------------------------------------------------------------
A0A443INY4      ------------------------------------------------------------
A0A372IH36      ------------------------------------------------------------
A0A540VW45      ------------------------------------------------------------
A0A1H9C241      ------------------------------------------------------------
A0A2E3FCR1      ------------------------------------------------------------
A0A4S3MG69      ------------------------------------------------------------
A0A1G8QZS5      ------------------------------------------------------------
A0A1V4QMH7      ------------------------------------------------------------
A0A496XZQ4      ------------------------------------------------------------
A0A1F9BJF7      ------------------------------------------------------------
F2NDF5          ------------------------------------------------------------
A0A1I3TTC3      ------------------------------------------------------------
A0A1H3IZW6      ------------------------------------------------------------
A0A0M6YG59      ------------------------------------------------------------
A0A1H7G8B0      ------------------------------------------------------------
A0A059IPK4      ------------------------------------------------------------
A0A1H2Y469      ------------------------------------------------------------
A0A497ZQU7      ------------------------------------------------------------
A0A520CSP5      ------------------------------------------------------------
A0A4Q2XLV7      ------------------------------------------------------------
A0A4Q5QYC4      ------------------------------------------------------------
A0A3B8SQ27      ------------------------------------------------------------
A0A3E0H727      ------------------------------------------------------------
A0A352Q5C1      ------------------------------------------------------------
A0A656BWB0      ------------------------------------------------------------
A0A3Y2RPN4      ------------------------------------------------------------
A0A0A0FHV8      ------------------------------------------------------------
A0A1X3IPU7      ------------------------------------------------------------
A0A0A0G0N2      ------------------------------------------------------------
A0A243TPR1      ------------------------------------------------------------
A0A2I8SDU4      ------------------------------------------------------------
A0A2I8SU55      ------------------------------------------------------------
S1EXJ6          ------------------------------------------------------------
A0A376UBS1      ------------------------------------------------------------
A0A4Q6G931      ------------------------------------------------------------
A0A4Q8R6L6      ------------------------------------------------------------
A0A2T0VBD8      ------------------------------------------------------------
A0A378APS2      ------------------------------------------------------------
A0A443VCQ6      ------------------------------------------------------------
A0A447RKQ7      ------------------------------------------------------------
W1DSK1          ------------------------------------------------------------
A0A0U2VAW2      ------------------------------------------------------------
A0A454CTF1      ------------------------------------------------------------
A0A1W9F5M9      ------------------------------------------------------------
A0A352MMI7      ------------------------------------------------------------
A0A379W6R2      ------------------------------------------------------------
A0A376RY66      ------------------------------------------------------------
A0A377K431      ------------------------------------------------------------
A0A379TA56      ------------------------------------------------------------
A0A4Z0LWV1      ------------------------------------------------------------
A0A620QD02      ------------------------------------------------------------
A0A5H3HSJ8      ------------------------------------------------------------
A0A655C5P0      ------------------------------------------------------------
A0A3C2BN18      ------------------------------------------------------------
A0A447LR75      ------------------------------------------------------------
A0A376D8L7      ------------------------------------------------------------
A0A1V2FV46      ------------------------------------------------------------
A0A376SB61      ------------------------------------------------------------
A0A3D1BYV9      ------------------------------------------------------------
A0A378G3G7      ------------------------------------------------------------
A0A2X5NHJ9      ------------------------------------------------------------
A0A2J4QEC3      ------------------------------------------------------------
A0A485ADM3      ------------------------------------------------------------
A0A4U9HGU4      ------------------------------------------------------------
A0A3S4JGG5      ------------------------------------------------------------
A0A377ZDH2      ------------------------------------------------------------
A0A3S4HTS8      ------------------------------------------------------------
A0A2N1XK22      ------------------------------------------------------------
A0A3D0KAC8      ------------------------------------------------------------
A0A3D2Y902      ------------------------------------------------------------
E1Y9C0          ------------------------------------------------------------
A0A1N6SH58      ------------------------------------------------------------
A0A4Q3AQN2      ------------------------------------------------------------
                                                                            

A0A1F9CFF0      ------------------------------------------------------------
A0A2M8B0G5      ------------------------------------------------------------
A0A363TNU9      ------------------------------------------------------------
A0A0C5VQ86      ------------------------------------------------------------
A0A1V8MBH1      ------------------------------------------------------------
A0A0R0BVC7      ------------------------------------------------------------
A0A3N5J7U8      ------------------------------------------------------------
A0A1S7S3I8      ------------------------------------------------------------
A0A519E8D7      ------------------------------------------------------------
A0A3S1NZ06      ------------------------------------------------------------
A0A3S1FD32      ------------------------------------------------------------
A0A434DUT4      ------------------------------------------------------------
A0A528D3U3      ------------------------------------------------------------
A0A3S3UPT3      ------------------------------------------------------------
A0A3S1E286      ------------------------------------------------------------
A0A531AC71      ------------------------------------------------------------
A0A436K268      ------------------------------------------------------------
A0A434IDQ0      ------------------------------------------------------------
A0A435IRM5      ------------------------------------------------------------
A0A3S2C404      ------------------------------------------------------------
A0A435F6C0      ------------------------------------------------------------
A0A435BMN6      ------------------------------------------------------------
A0A529XQ54      ------------------------------------------------------------
A0A530BJC1      ------------------------------------------------------------
Q44570          ------------------------------------------------------------
A0A655ZZQ1      ------------------------------------------------------------
A0A1S0ZAI3      ------------------------------------------------------------
A0A1W9M770      ------------------------------------------------------------
A0A1W9M7R6      ------------------------------------------------------------
A0A3C0L0A8      ------------------------------------------------------------
A0A176S762      ------------------------------------------------------------
A0A377ZC40      ------------------------------------------------------------
A0A378BPJ7      ------------------------------------------------------------
A0A2J5PAJ7      ------------------------------------------------------------
A0A377ZDN3      ------------------------------------------------------------
A0A1W9WUD9      ------------------------------------------------------------
A0A1W1ZQK0      ------------------------------------------------------------
A0A4U1ALN4      ------------------------------------------------------------
A0A4U1B1A8      ------------------------------------------------------------
A0A1M7Y300      ------------------------------------------------------------
A0A4U1A967      ------------------------------------------------------------
A0A3N5MZ53      ------------------------------------------------------------
A0A534E4H4      ------------------------------------------------------------
A0A534I2B6      ------------------------------------------------------------
A0A1C2JGD0      ------------------------------------------------------------
A0A259LQ70      ------------------------------------------------------------
A0A4V2SPR5      ------------------------------------------------------------
A0A3N5PM86      ------------------------------------------------------------
A0A2E5YSA4      ------------------------------------------------------------
A0A519ERR1      ------------------------------------------------------------
A0A4Q3Q1M2      ------------------------------------------------------------
A0A4Q3MHR1      ------------------------------------------------------------
A0A520GDZ4      ------------------------------------------------------------
A0A318DSU0      ------------------------------------------------------------
A0A538PF21      ------------------------------------------------------------
A0A1W1ZH10      ------------------------------------------------------------
A0A1W2FF24      ------------------------------------------------------------
A0A524JYQ6      ------------------------------------------------------------
A0A4Q3MA17      ------------------------------------------------------------
A0A0N0M5F7      ------------------------------------------------------------
A0A537M754      ------------------------------------------------------------
A0A1V1PDB4      ------------------------------------------------------------
A0A2M7C324      ------------------------------------------------------------
A0A4Q3HHG6      ------------------------------------------------------------
A0A3B7DTA4      ------------------------------------------------------------
A0A432ZK62      ------------------------------------------------------------
A0A1V5EEP4      ------------------------------------------------------------
A0A1V5EF48      ------------------------------------------------------------
A0A0S6X1X6      ------------------------------------------------------------
A0A537Y5L8      ------------------------------------------------------------
A0A4Q3L2X2      ------------------------------------------------------------
A0A4Q3T8J1      ------------------------------------------------------------
A0A4Q4ANM4      ------------------------------------------------------------
A0A4Q3UEC7      ------------------------------------------------------------
A0A1H5YYQ4      ------------------------------------------------------------
A0A1X4NLK2      ------------------------------------------------------------
A0A1X4NWB5      ------------------------------------------------------------
A0A1M5UQ38      ------------------------------------------------------------
A0A327YI48      ------------------------------------------------------------
A0A1B1PNL6      ------------------------------------------------------------
A0A2U8H9H9      ------------------------------------------------------------
A0A1X6YIC0      ------------------------------------------------------------
A0A1I5E9E9      ------------------------------------------------------------
A0A1X6Z7N7      ------------------------------------------------------------
A0A2E1DQ13      ------------------------------------------------------------
A0A1H8C800      ------------------------------------------------------------
A0A2N3EZ05      ------------------------------------------------------------
A0A1W9PMU6      ------------------------------------------------------------
A0A1G3VVY5      ------------------------------------------------------------
A0A2N6BZD5      ------------------------------------------------------------
A0A435NNF5      ------------------------------------------------------------
A0A3S2AQS7      ------------------------------------------------------------
A0A436XH86      ------------------------------------------------------------
A0A527ZPD6      ------------------------------------------------------------
A0A529KRW3      ------------------------------------------------------------
A0A530ZLX0      ------------------------------------------------------------
A0A355TB56      ------------------------------------------------------------
A0A524M660      ------------------------------------------------------------
A0A0C1TRU6      ------------------------------------------------------------
A0A2Z5SSF4      ------------------------------------------------------------
A0A327LYE6      ------------------------------------------------------------
A0A5A9ZTV3      ------------------------------------------------------------
A0A4Q4CIB1      ------------------------------------------------------------
A0A522ACJ9      ------------------------------------------------------------
A0A3N5Z7F8      ------------------------------------------------------------
A0A239HD34      ------------------------------------------------------------
A0A534V9L7      ------------------------------------------------------------
A0A0P7ZZE4      ------------------------------------------------------------
A0A369R0Q9      ------------------------------------------------------------
A5G4N9          ------------------------------------------------------------
A0A238LBD3      ------------------------------------------------------------
A0A0P1FRV5      ------------------------------------------------------------
A0A0P1FWI8      ------------------------------------------------------------
A0A1M7BLL7      ------------------------------------------------------------
A0A0H4KZM1      ------------------------------------------------------------
A0A1V1UJT2      ------------------------------------------------------------
A0A0L6CVX1      ------------------------------------------------------------
A0A1V0RR48      ------------------------------------------------------------
A0A0A0HJJ4      ------------------------------------------------------------
A0A5E7YA28      ------------------------------------------------------------
A0A348SRI7      ------------------------------------------------------------
A0A354EI73      ------------------------------------------------------------
A0A4P7EP83      ------------------------------------------------------------
A0A3A4NIE9      ------------------------------------------------------------
A0A3A4NUI9      ------------------------------------------------------------
A0A524I3Z6      ------------------------------------------------------------
A0A524PCL7      ------------------------------------------------------------
A0A356GQV1      ------------------------------------------------------------
A0A1J5DAY8      ------------------------------------------------------------
A0A524P237      ------------------------------------------------------------
A0A1G3JY11      ------------------------------------------------------------
A0A661N3U1      ------------------------------------------------------------
A0A3S1WTQ1      ------------------------------------------------------------
A0A440NX85      ------------------------------------------------------------
A0A530CUR9      ------------------------------------------------------------
A0A1M6N1X5      ------------------------------------------------------------
A0A561M3U0      ------------------------------------------------------------
A0A2W5J775      ------------------------------------------------------------
A0A1F9E324      ------------------------------------------------------------
A0A432SAI6      ------------------------------------------------------------
A0A4Q3LBH4      ------------------------------------------------------------
A0A4Q3LWP3      ------------------------------------------------------------
A0A2N6VGL1      ------------------------------------------------------------
A0A3M3H5V6      ------------------------------------------------------------
A0A2T4ZJZ6      ------------------------------------------------------------
A0A1T2KYM8      ------------------------------------------------------------
A0A2G9ZR82      ------------------------------------------------------------
A0A4U9I390      ------------------------------------------------------------
A0A534XP85      ------------------------------------------------------------
A0A2X3M011      ------------------------------------------------------------
I2WC85          ------------------------------------------------------------
A0A400JH80      ------------------------------------------------------------
A0A2H9EHM4      ------------------------------------------------------------
A0A380B3D7      ------------------------------------------------------------
F5NSX0          ------------------------------------------------------------
D8EEU7          ------------------------------------------------------------
A0A479JNB1      ------------------------------------------------------------
A0A5C9AF52      ------------------------------------------------------------
A0A0P1H2H0      ------------------------------------------------------------
A0A258WKV0      ------------------------------------------------------------
A0A377N8F8      ------------------------------------------------------------
A0A3C2DSE7      ------------------------------------------------------------
A0A2X1JBG5      ------------------------------------------------------------
A0A0B8PTA8      ------------------------------------------------------------
A0A0B8QF75      ------------------------------------------------------------
A0A4Q3LR91      ------------------------------------------------------------
A0A4V1TR68      ------------------------------------------------------------
A0A444IY46      ------------------------------------------------------------
A0A660AID0      ------------------------------------------------------------
A0A3E0WKI3      ------------------------------------------------------------
A0A1H3I2J1      ------------------------------------------------------------
A0A1V5DJV0      ------------------------------------------------------------
A0A520IUC4      ------------------------------------------------------------
A0A521LJG5      ------------------------------------------------------------
A0A531IBQ7      ------------------------------------------------------------
A0A377LY04      ------------------------------------------------------------
A0A5C9ABR5      ------------------------------------------------------------
A0A5J9WU72      ------------------------------------------------------------
A0A2X3K9R3      ------------------------------------------------------------
A0A3T9EHW9      ------------------------------------------------------------
A0A484X141      ------------------------------------------------------------
A0A5N9VWI6      ------------------------------------------------------------
A0A3D3PV27      ------------------------------------------------------------
A0A376LLF8      ------------------------------------------------------------
A0A444R390      ------------------------------------------------------------
A0A1V4WHZ7      ------------------------------------------------------------
A0A1E5AJN5      LQTKQYRASLQINIDVGRASALREFEVVGESRSFFVTAESTIAASIRTRRLARRVVYELN
A0A2N3D2J1      ------------------------------------------------------------
A0A2N2GVE1      CGVGVSLAFFVTKKQTPLYRTSCSVVISSQLPSYLGSTVKSNLAETSEDFWYEQRYLATQ
A0A2N2INV3      CGVGVSLAFFVTKKQTPLYRTSCSVVISSQLPSYLGSTVKSNLAETSEDFWYEQRYLATQ
A0A1Y5DXG5      ------------------------------------------------------------
A0A0B8P2H5      ------------------------------------------------------------
A0A483QWI8      ------------------------------------------------------------
A0A483UXD3      ------------------------------------------------------------
A0A0A8J8L3      ------------------------------------------------------------
A0A660DJ38      ------------------------------------------------------------
A0A380AQW6      ------------------------------------------------------------
A0A2G2GD62      ELYKKSPLVVNVTFMEYNLLEKKLKIRAIDGETYELSYKTKIKINIDYFTRLLFGKQKVY
A0A524P331      -----------------------KTPDYTIVLTGPEKSKVANADGSVRMGMPTFVVKNAD
A0A4V1SSM5      ------------------------------------------------------------
A0A4Q3K8G7      ------------------------------------------------------------
A0A1M7HC79      ------------------------------------------------------------
A0A1D3JZN6      ------------------------------------------------------------
A0A1V6ESG1      ------------------------------------------------------------
A0A1H7YHK3      ------------------------------------------------------------
A0A534SH66      ------------------------------------------------------------
A0A3M0ZZ99      ------------------------------------------------------------
A0A328C2K5      LTSIACVAAAYFWTDRQPRIYQATSKLIFHESRPNVFGKQFERVELVDPGGRWQFEQFWN
A0A5C6X8M3      LTSIACVAAAYFWTERQPRIYQATSKLMFHESRPNVFGKQFERVELVDPGGRWQFEQFWN
A0A3D8MRR7      LTSIACVAAAYFWTDRQPRIYQATSKLIFHESRPNVFGKQFERVELVDPGGRWQFEQFWN
A0A5C6UBJ7      LTSIACVAAAYFWTDRQPRIYQATSKLIFHESRPNVFGKQFERVELVDPGGRWQFEQFWN
A0A5C6XGM3      LTSIACVAAAYFWTERQPRIYQATSKLIFHESRPNVFGKQFERVELVDPGGRWQFEQFWN
A0A537NZJ1      ------------------------------------------------------------
A0A4Q4CVW6      ------------------------------------------------------------
A0A090R136      ------------------------------------------------------------
A0A661JU93      ------------------------------------------------------------
A0A2E2T3V8      VAISFFSPVYKSFASVGFVREEPATTQTDFPKAVWPNAAEFVETRMEMIIGNETLSTVMS
A0A367UAB4      VAISFFSPVYKSFASVGFVREEPATTQTDFPKAVWPNAAEFVETRMEMIVGNETLSTVMS
A0A377V641      ------------------------------------------------------------
A0A1F2YJ88      -----------------------------------------------------------V
A0A0J7XGZ1      RTYTATSALLLEPREAQPVKVNDRGFVAPADDNLIDTAVQIIRSPTLTLDVVRSLRLDRV
I4CBA7          SSPRHSLTGHVRTIFRKKWLFLGIVALALAGGVVVGLVRSPVYKSSAILRVELGGPSQRG
A3VE95          GPLIGGLAVGCALLLFVVTQFIPSTYTAYSKVMLDAREVRIMSSDEVVSNLSLSDPVIQS
A0A1G0NL95      ------------------------------------------------------------
A0A024KA69      -------------------------MALAVAAGLALASAALLVMPVSYSATALLYFDPSP
A0A0L1KFN4      -----MTPQYTAVSTIEISREADQVTNIEGVERETSVADQEFYQTQYGLLRARSLAERVA
A0A3P5DSS6      ------------------------------------------------------------
A0A483YEL5      ------------------------------------------------------------
A0A658GUJ0      -------------------------------------------------VKNDHQYSISG
A0A358L616      ------------------------------------------------------------
A0A3D5UYX7      ------------------------------------------------------------
A0A2N1WQN5      ------------------------------------------------------------
A0A352G2C2      ------------------------------------------------------------
A0A3C0PZN1      ------------------------------------------------------------
A0A524QFS4      LFRSLWIKKRLIMIVLAFALTSWMFYLSIATRVYRGESILELSLRRPRISGQQEAVIDDA
A0A520JSW4      RWLILAAIGTGIVAAMLMTMLTPLQYRSVTTLELNPPEVEILADEGSKGGRQNAARSDIN
A0A4Q3LTF3      ------------------------------------------------------------
A0A537UTP9      -------------------------------VDSQVEVLQSENVALAVIKDLHLTKDPQF
A0A1D2RNR5      ------------------------------------------------------------
A0A4V1TQ46      ------------------------------------------------------------
A0A3A0FZC0      -------------------------------------------------------MLEQP
A0A1N7JVZ7      ------------------------------------------------------------
A0A091C4A8      ------------------------------------------------------------
A0A4R3H6P6      GALAGIALTLVMPRQYASTARMEISRETARVVKIDSVERDTSIGDQEFYQTQYGLLRTQV
A0A3S1NQ09      ------------------------------------------------------------
A0A443GJ52      ------------------------------------------------------------
A0A2W6S588      IGFAIIVLMMVLAYGATKMMTPKYSASAQLSYSPQQALSRDGQPAPPTQTTDAARDAAIE
A0A483E0N4      ------------------------------------------------------------
A0A2J4YQQ6      ------------------------------------------------------------
A0A483THX4      ------------------------------------------------------------
A0A534MVS2      ------------------------------------------------------------
A0A444I5K6      ------------------------------------------------HELRIVDEFQLV
A0A154VE85      QLVFQDRSSGFGGSALLLDRGAIETEAAIVASRDLALRAVESLRLIDDPAFNPALQPSAS
A0A3S1MCW7      ------------------------------------------------------------
A0A434IGN6      ------------------------------------------------------------
A0A528AX40      -------------------------DIEVVSENADVRAFLTAREKLKSRALAQRVVFQLG
A0A528MV95      -------------LEVLVPSAKVFQDIEVVSESSDVRAFLTAREKLKSRALAQRVVFQLG
A0A3C1S9Y1      ---------------------------------------------------MPGTEDNMF
A0A353EH49      GEILEVAKLEVPDFLKGNALRLVVEHDSEYTLYDGDEYLLKGRVGQDAVISLKDVKKYNR
A0A1Y1Q9C1      ---------------EGMQVVNFGTVSSASPDMGEQDPFFRTQYEQLKSRKLAAQVIDGL
A0A3M7LJH0      ------------------------------------------------------------
A0A316KRG4      ------------------------------------------------------------
A0A1E4JHX8      ------------------------------------------------------------
M2U8P2          VPMAVAAALCALAVAALYFTSEPTYSASGQIGFERGADELLPGLSERRAEITDAASVETA
A0A1H7KZF8      MAAIVFASLAAALLAFVLIRPSFRADATLRIDAAAQRIVGTEDVAGPVQVADIDRQMETT
A0A0J5Q9T7      ------------------------------------------------------------
A0A257NG76      ------------------------------------------------------------
A0A1T4TW59      --------------------MHLILIKKYYQTQFEILRSSHIAESVIDELGLANLPEFNS
A0A1I5YYQ0      ------------------------------------------------------------
A0A5P9FE62      ------------------------------------------------------------
A0A1Q3MB35      ------------------------------------------------------------
A0A259LUN7      ------------------------------------------------------------
A0A2D7AVL1      ------------------------------------------------------------
A0A3B9KZE9      ------------------------------------------------------------
A0A2U0NMP8      ----------------GLARLFNKTKNTIQVHKLFISPNMYDDNFITLTVKNDHQYSISG
A0A4U9HNE9      ------------------------------------------------------------
A0A2G2CXY6      RRYDPYEAGEVAEPWLGLDSFAWGGEELAIFQLEVPPGYLGKTLILTAQDAGTFTLHDQD
A0A3M1D4H3      ------------------------------------------------------------
A0A5C8BYM7      ------------------------------------------------------------
A0A1J5ICP0      ------------------------------------------SYVLKFDGPDSYKIIEDK
A0A0M3GBT1      --------------------------MEDKSSSSDLLDAKSETERLLSRSIAERVVRELQ
B3Q577          --------------------------MEDKSSSSDLLDAKSETERLLSRSIAERVVRELQ
A0A379B9V4      TTQVEPIYPVPILGKLFASATGYSPQITISHFTPLNEAANTLILEIGEQRDSYTLFLEKT
A0A0Q6TS97      ------------------------------------------------------------
A0A0Q6UYB4      ------------------------------------------------------------
A0A484XS37      -------------------------------------------------------MLSNN
W7Q5J0          LSSGIPQPSFMQRQPYVWGGENLEVARFVLAEHRRSHVVVVERDSEERYRVMLNEQHIGD
A0A654AKT6      ------------------------------------------------------------
A0A0G9MZA5      ------------------------------------------------------------
H0T8B0          ----------------------MIGSKKDVWIRSDLTIENLLVDDAAVETEIETTVSEKV
A0A5C7N981      -------------------------------------MAFIDRQTFDQTQYELLKSDALA
A0A534TV22      ------------------------------------------------------------
A0A351CXR4      SLTLMVTENMPNMAMVGQGYVDPMSMLSLWSGGTLDTRIIQSRAITTKAAQALNLTEKEF
A0A2N6GLF5      ------------------------------------------------MAEDVIAKLELT
A0A1W9LJP0      ------------------------------------------------------------
A0A0W1ICB0      ----MTPQYTATSRIEIAREQANVTNVEGLKRDSNAPDQEFYLTQYSLLNARSLAERVER
A0A2E0UL88      ------------------------------------------------------------
A0A233IKJ2      ------------------------------------------------------------
A0A2T1JE00      ------------------------------------------------------------
A0A0T2QIS1      ------------------------------------------------------------
A0A376KYN0      ------------------------------------------------------------
A0A2X1JB05      ------------------------------------------------------------
A0A376RML0      ------------------------------------------------------------
A0A377E5P7      ------------------------------------------------------------
A0A0P7Y1D0      ------------------------------------------------MSELDLAADPEF
A0A2M7JRZ7      ------------------------------------------------------------
A0A167IR75      ------------------------------------------------------------
X7F6S5          ------------------------------------------------------------
A0A1G7CFZ2      ------------------------------------------------------------
A0A1P8USW9      ------------------------------------------------------------
A0A1I6U4V1      ------------------------------------------------------------
A0A1G8NKI0      ------------------------------------------------------------
A0A355QPE4      ------------------------------------------------------------
A0A357RN98      ------------------------------------------------------------
A0A3B8T2U6      ------------------------------------------------------------
A0A365PWR2      ------------------------------------------------------------
A0A2E9H5Z8      ------------------------------------------------------------
A0A2E2BR79      ------------------------------------------------------------
A0A0Q4Q524      ------------------------------------------------------------
A0A0Q4CFJ9      ------------------------------------------------------------
A0A0Q4FE58      ------------------------------------------------------------
A0A0Q4JWC8      ------------------------------------------------------------
A0A0Q4KFL8      ------------------------------------------------------------
A0A522R8R0      ------------------------------------------------------------
A0A2U9NDY5      ------------------------------------------------------------
A0A0Q4IGG1      ------------------------------------------------------------
A0A534RUJ5      ------------------------------------------------------------
A0A3M1CJM3      ------------------------------------------------------------
A0A2R7SVD4      ------------------------------------------------------------
A0A3C0PWB6      ------------------------------------------------------------
V4Q8B7          ------------------------------------------------------------
A0A0Q8XKK5      ------------------------------------------------------------
A0A2E0Q2W0      ------------------------------------------------------------
A0A660NIR6      -----------------------------------------------------MRSREVG
A0A142W0R3      ------------------------------METDVEGAREKTISNEIAFFNTQYSLLESR
A0A0S4XR18      ------------------------------------------------MAQNSTKPWEID
A0A2E0GW64      ------------------------------------------------------------
A0A1A7QJ97      ------------------------------------------------------------
A0A661LW70      ------------------------------------------------------------
W7Q8F9          --------------------------------------MVVERDSEERYRVMLNEQHIGD
A0A524PXH8      ------------------------------------------------------------
A0A4Q3P0E4      ---------------------------------------------HYLDILLANKWLIAA
A0A3M2BE89      ---------------------------------------LGQPLTLVAQASNHYRLLDEE
A0A4Q4A6K6      ------------------------------------------------------------
A0A257G674      ----------------------------------------------------------DI
A0A661M5M6      ------------------------------------------------------------
A0A1I1UM01      ------------------------------------------------------------
Q44573          --------------------------------------------------MIHSRDVAAA
A2W025          -----------------------------------MPALEGKKLTLTAGPNGTYSLVDEN
A0A534Z362      SPIQLRLEGNVLRLDDGDPSANGAATFLSTQVAALQSRDLAERVIRSRGLADSEAFLDPG
V4J283          ------------------------------------------------------------
A0A536T443      ------------------------------------------------------------
A0A0Q4UFQ5      ------------------------------------------------------------
A0A527W7E6      ------------------------------------------------------------
A0A432EMV7      ------------------------------------------------------------
A0A087LTV7      ------------------------------------------------------------
A0A534WLI3      ------------------------------------------------------------
A0A318KWA2      -------------------------------------------------MDGETPRALGE
A0A522MT86      ------------------------------------------------------------
A0A4Q3I221      ------------------------------------------------------------
A0A534SAL6      SPIQLQLQENVLHLDESDRSVNGTSSFLATQVAALKSRDIAERVIRREGLATDEAFLHPG
A0A534ZDB4      -----------------DRSVNGTSSFLATQVATLKSRDLAERVIRSERLATDEAFLHPG
A0A534X3M7      SPIQLRLEGNVLRLGESDRDANGAATFVGMQVAALRSRDLAERVIRGRGLAANDAFLDPR
A0A534SPC6      ------------------------------------------------------------
A0A535AD60      SPIQLRLEGNVLRLGDGDLSANGAATFLSTQVAALQSRDLAERVIRSRGLADSEAFLDPG
A0A4Q3SY08      ------------------------------------------------------------
A0A4Q3LG23      ------------------------------------------------------------
A0A522EX52      ------------------------------------------------------------
A0A1H3KC95      ------------------------------------------------------------
A0A5P8Z4P3      ----------------------------------------MTAERIFRRKNRPGARSDSS
A0A0B3RZC9      ------------------------------------------------------------
A0A2E9HXF7      ------------------------------------------------------------
A0A520HUH4      ------------------------------------------------------------
A0A2K8U7M6      ------------------------------------------------------------
A0A5B9DKL8      ------------------------------------------------------------
A0A238KJM1      ------------------------------------------------------------
A0A3A0FJZ4      ------------------------------------------------------------
W4HJV8          ------------------------------------------------------------
A0A0P1GDI0      ------------------------------------------------------------
A0A2R8ATV5      ------------------------------------------------------------
A0A1U7D3R6      ------------------------------------------------------------
A0A2D4UVV2      ------------------------------------------------------------
A0A0W7WHP4      ------------------------------------------------------------
A0A238J8F6      ------------------------------------------------------------
A0A238JQI6      ------------------------------------------------------------
A0A222E077      ------------------------------------------------------------
A0A239E3Y2      ------------------------------------------------------------
A0A1W9HS52      ------------------------------------------------------------
A0A2D5LFD8      ------------------------------------------------------------
A0A0N0XAV4      ------------------------------------------------------------
A0A0P9QD19      ------------------------------------------------------------
F3FHG4          ------------------------------------------------------------
F3GGI0          ------------------------------------------------------------
A0A0P9LE74      ------------------------------------------------------------
A0A3M4ZQ14      CAAAAPCRTPGQPRAAAPGRADPGDGTAAHARPAQVRARSTWQNFLDWPVARPARSRCSR
A0A3M5YLE8      CAAAAPCRTPGQPRAAAPGRADPGDGTAAHARPAQVRARSTWQNFLDWPVARPARSRCSR
A0A3M3RP89      CAAAAPCRTPGQPRAAAPGRADPGDGTAAHARPAQVRARSTWQNFLDWPVARPARSRCSR
A0A0P9QIY7      CAAAAPCRTPGQPRAAAPGRADPGDGTAAHARPAQVRARSTWQNFLDWPVARPARSRCSR
A0A0P9VVH7      CAAAAPCRTPGQPRAAAPGRADPGDGTAAHARPAQVRARSTWQNFLDWPVARPARSRCSR
A0A0Q0FJK6      CAAAAPCRTPGQPRAAAPGRADPGDGTAAHARPAQVRARSTWQNFLDWPVARPARSRCSR
A0A0Q0G2J0      CAAAAPCRTPGQPRAAAPGRADPGDGTAAHARPAQVRARSTWQNFLDWPVARPARSRCSR
A0A3M3LF66      CAAAAPCRTPGQPRAAAPGRADPGDGTAAHARPAQVRARSTWQNFLDWPVARPARSRCSR
A0A0P9WIR8      CAAAAPCRTPGQPRAAAPGRADPGDGTAAHARPAQVRARSTWQNFLDWPVARPARSRCSR
A0A3M3KPE5      ------------------------------------------------------------
A0A3M4C263      ------------------------------------------------------------
A0A3M5AD05      ------------------------------------------------------------
A0A0Q0D3D2      ------------------------------------------------------------
A0A0N0FS39      ------------------------------------------------------------
A0A3M6GHH2      ------------------------------------------------------------
A0A0P9R9W0      ------------------------------------------------------------
A0A0Q0B9T0      ------------------------------------------------------------
A0A3M6CFI7      ------------------------------------------------------------
A0A0P9JXN0      ------------------------------------------------------------
A0A3M6FIV7      ------------------------------------------------------------
A0A3M3PLW9      ------------------------------------------------------------
A0A3M4ENY1      ------------------------------------------------------------
A0A3M5EZK7      ------------------------------------------------------------
A0A0P9SPP5      ------------------------------------------------------------
A0A658KL17      ------------------------------------------------------------
A0A3M3NNF2      ------------------------------------------------------------
A0A3M4A0E8      ------------------------------------------------------------
A0A3M4PBZ2      ------------------------------------------------------------
A0A3M6AI26      ------------------------------------------------------------
A0A0P9IWP8      ------------------------------------------------------------
A0A0P9KZ49      ------------------------------------------------------------
A0A0P9V840      ------------------------------------------------------------
A0A0Q0AIE5      ------------------------------------------------------------
A0A3M2ZQH6      ------------------------------------------------------------
A0A0N8SQG2      ------------------------------------------------------------
A0A0W8HFU1      ------------------------------------------------------------
A0A3M5M873      ------------------------------------------------------------
A0A0P9VHH8      ------------------------------------------------------------
A0A0P9YV98      ------------------------------------------------------------
A0A3M3G2W8      ------------------------------------------------------------
A0A3M6C224      ------------------------------------------------------------
A0A3M5K254      ------------------------------------------------------------
A0A3M5JFB0      ------------------------------------------------------------
A0A3M3TQV3      ------------------------------------------------------------
A0A3M3EF92      ------------------------------------------------------------
A0A3M5J1E2      ------------------------------------------------------------
A0A3M5G7H9      ------------------------------------------------------------
A0A3M4A376      ------------------------------------------------------------
A0A0Q0A5T8      ------------------------------------------------------------
A0A0P9SCD7      ------------------------------------------------------------
A0A0P9T4G3      ------------------------------------------------------------
A0A0P9VKB0      ------------------------------------------------------------
A0A0Q0BM35      ------------------------------------------------------------
A0A3M3TPR7      ------------------------------------------------------------
A0A3M3U4Q3      ------------------------------------------------------------
A0A0P9UCX7      ------------------------------------------------------------
A0A0P9S1F1      ------------------------------------------------------------
A0A0P9QCJ2      ------------------------------------------------------------
A0A0P9Q329      ------------------------------------------------------------
A0A3M5GJ64      ------------------------------------------------------------
A0A0P9MPC7      ------------------------------------------------------------
A0A3M2XYQ3      ------------------------------------------------------------
A0A0P9XCE1      ------------------------------------------------------------
A0A3M3EFX7      ------------------------------------------------------------
A0A3M5B9D9      ------------------------------------------------------------
A0A0P9RRZ3      ------------------------------------------------------------
A0A3M2VEK7      ------------------------------------------------------------
A0A0N8R9B3      ------------------------------------------------------------
A0A0P9VA27      ------------------------------------------------------------
A0A3M4YBJ4      ------------------------------------------------------------
A0A0P9J470      ------------------------------------------------------------
A0A0Q0EVJ8      ------------------------------------------------------------
A0A3M5UI30      ------------------------------------------------------------
A0A3M5YQT8      ------------------------------------------------------------
A0A3M5F5X1      ------------------------------------------------------------
A0A3M5R8G1      ------------------------------------------------------------
A0A3M5V012      ------------------------------------------------------------
A0A3M3GA16      ------------------------------------------------------------
A0A3M3UCT3      ---------------------------------------------------MAGPARHHR
A0A3M3CJL0      ---------------------------------------------------MAGPARHHR
A0A3M3F6F5      ---------------------------------------------------MAGPARHHR
A0A3M3P9B7      ---------------------------------------------------MAGPARHHR
A0A0N8QB74      ---------------------------------------------------MAGPARHHR
A0A0Q0AUD0      ---------------------------------------------------MAGPARHHR
A0A3M5VR55      ---------------------------------------------------MAGPARHHR
A0A0Q0FK97      ---------------------------------------------------MAGPARHNR
A0A3M5KZ75      ------------------------------------------------------------
A0A3M5L3G5      ------------------------------------------------------------
A0A1V6FYJ1      ------------------------------------------------------------
A0A445MZQ4      ------------------------------------------------------------
A0A0M9E0E3      ------------------------------------------------------------
A0A0Q6QV61      ------------------------------------------------------------
A0A2Z3IKG4      ------------------------------------------------------------
A0A4Q3IRI1      ------------------------------------------------------------
A0A2W4RFS2      ------------------------------------------------------------
A0A1Y6DC43      ------------------------------------------------------------
A0A2S6HE06      ------------------------------------------------------------
G3J0M3          ------------------------------------------------------------
V5C6R5          ------------------------------------------------------------
A0A354EF47      ------------------------------------------------------------
A0A2G6MSP7      ------------------------------------------------------------
A0A1V4M8I1      ------------------------------------------------------------
A0A4Z0M4C7      ------------------------------------------------------------
A0A4U8YMP3      ------------------------------------------------------------
A0A1Q8QQ99      ------------------------------------------------------------
A0A3D5ZY44      ------------------------------------------------------------
A0A646J2A6      ------------------------------------------------------------
A0A1G5C236      ------------------------------------------------------------
A0A5Q2QDL1      ------------------------------------------------------------
A0A656PSQ6      ------------------------------------------------------------
A0A1I3XJ27      ------------------------------------------------------------
A0A1I7DCG1      ------------------------------------------------------------
A0A3A3H6D9      ------------------------------------------------------------
A0A562CGU2      ------------------------------------------------------------
A0A0Q6VA36      ------------------------------------------------------------
A0A1B2EQN1      ------------------------------------------------------------
A0A1E7HSL6      ------------------------------------------------------------
W9VVY5          ------------------------------------------------------------
A0A1E2URD3      ------------------------------------------------------------
A0A2T6MY81      ------------------------------------------------------------
A0A2T6NBQ8      ------------------------------------------------------------
A0A421K431      ------------------------------------------------------------
A0A2G2I5M1      ------------------------------------------------------------
A0A2G2M6F0      ------------------------------------------------------------
A0A1W9J9F8      ------------------------------------------------------------
A0A2S5LFJ9      ------------------------------------------------------------
A0A2D8R8F8      ------------------------------------------------------------
A0A010SNS0      ------------------------------------------------------------
A0A0C2I782      ------------------------------------------------------------
A0A2N8BYF5      ------------------------------------------------------------
A0A558FKX2      ------------------------------------------------------------
A0A1H1DBA0      ------------------------------------------------------------
J2TAD5          ------------------------------------------------------------
J3H699          ------------------------------------------------------------
A0A1H5J974      ------------------------------------------------------------
A0A0K1QRZ4      ------------------------------------------------------------
A0A560RJW9      ------------------------------------------------------------
A0A5E6TID7      ------------------------------------------------------------
A0A5E7CRU7      ------------------------------------------------------------
A0A5E7C564      ------------------------------------------------------------
A0A2W7MAV4      ------------------------------------------------------------
A0A4R3WQH5      ------------------------------------------------------------
W6VFG3          ------------------------------------------------------------
A0A1P8ENT1      ------------------------------------------------------------
A0A2N7XRV4      ------------------------------------------------------------
A0A0Q6QPG8      ------------------------------------------------------------
A0A0F4SWA7      ------------------------------------------------------------
A0A423J219      ------------------------------------------------------------
A0A4P6G9U8      ------------------------------------------------------------
A0A4Y8JE06      ------------------------------------------------------------
A0A502I1X9      ------------------------------------------------------------
A0A502J776      ------------------------------------------------------------
A0A5B0EZF6      ------------------------------------------------------------
A0A059L434      ------------------------------------------------------------
A0A0F4UWN2      ------------------------------------------------------------
A0A5E7WEF5      ------------------------------------------------------------
A0A1G0KSD0      ------------------------------------------------------------
A0A4P6WX84      ------------------------------------------------------------
A0A1D2S760      ------------------------------------------------------------
A0A5B8RW94      ------------------------------------------------------------
A0A258TN88      ------------------------------------------------------------
A0A4Q3ZDI7      ------------------------------------------------------------
A0A537PRC6      ------------------------------------------------------------
A0A2M7JX59      ------------------------------------------------------------
A0A3A4XVN3      ------------------------------------------------------------
A0A1E7JEV6      ------------------------------------------------------------
A0A2N2KDY5      ------------------------------------------------------------
A0A3N5YUD9      ------------------------------------------------------------
A0A0W1DLQ3      ------------------------------------------------------------
A0A246JVD8      ------------------------------------------------------------
A0A2N3BB54      ------------------------------------------------------------
A0A1H6G7A3      ------------------------------------------------------------
A0A0A7PGL6      ------------------------------------------------------------
A0A4Q2Z4L0      ------------------------------------------------------------
A0A5C4N0H6      ------------------------------------------------------------
A0A4R1HDF2      ------------------------------------------------------------
A0A1E7HFN0      ------------------------------------------------------------
A0A1M5GH86      ------------------------------------------------------------
A0A1W1XQZ5      ------------------------------------------------------------
A0A3D6C3I2      ------------------------------------------------------------
S0G1D4          ------------------------------------------------------------
A0A661T246      ------------------------------------------------------------
A0A2G6CSG7      ------------------------------------------------------------
A0A2G6NB59      ------------------------------------------------------------
A0A5K8A7T9      ------------------------------------------------------------
A0A1W9U045      ------------------------------------------------------------
A0A1F9L9G4      ------------------------------------------------------------
A0A328FD76      ------------------------------------------------------------
A0A348UX90      ------------------------------------------------------------
A0A357Z0N5      ------------------------------------------------------------
A0A0F2R2U0      ------------------------------------------------------------
A0A5K7ZK00      ------------------------------------------------------------
A0A5K7YCX8      ------------------------------------------------------------
A0A5K7Z388      ------------------------------------------------------------
A0A352B502      ------------------------------------------------------------
A0A2K8WHP8      ------------------------------------------------------------
A0A410V446      ------------------------------------------------------------
A0A0R3KGJ5      ------------------------------------------------------------
A0A0R3N604      ------------------------------------------------------------
A0A1B1UCM8      ------------------------------------------------------------
A0A1N6JQ20      ------------------------------------------------------------
A0A1M5TI07      ------------------------------------------------------------
A3X191          ------------------------------------------------------------
A0A1H4RKV5      ------------------------------------------------------------
A0A160UA87      ------------------------------------------------------------
A0A1Q5SFV5      ------------------------------------------------------------
A0A1J5N774      ------------------------------------------------------------
A0A2C8F781      ------------------------------------------------------------
A0A2E3R6G0      ------------------------------------------------------------
A0A1F8XMK2      ------------------------------------------------------------
A0A3M8EMP2      ------------------------------------------------------------
A0A2J6J6K6      ------------------------------------------------------------
A0A1G6EKK9      ------------------------------------------------------------
S7TK97          ------------------------------------------------------------
S7UE93          ------------------------------------------------------------
A0A3D5BR56      ------------------------------------------------------------
A0A2N2IB15      ------------------------------------------------------------
A0A1I3PSR2      ------------------------------------------------------------
A0A1I4GEK4      ------------------------------------------------------------
A0A0A8WSG4      ------------------------------------------------------------
A0A2T5R3J5      ------------------------------------------------------------
A0A661PSB9      ------------------------------------------------------------
A0A661QBT6      ------------------------------------------------------------
A0A1W7QPT7      ------------------------------------------------------------
A0A1L3GKM9      ------------------------------------------------------------
A0A0M4D373      ------------------------------------------------------------
A0A5J4MX76      ------------------------------------------------------------
A0A430DNP0      ------------------------------------------------------------
A0A3A0FQ32      ------------------------------------------------------------
A0A1E4UZA0      ------------------------------------------------------------
A0A1H9KL56      ------------------------------------------------------------
A0A1A9KEF8      ------------------------------------------------------------
A0A5E6PKN5      ------------------------------------------------------------
A0A0N9W1V6      ------------------------------------------------------------
A0A423GQ41      ------------------------------------------------------------
A0A423H7J2      ------------------------------------------------------------
A0A502HNM8      ------------------------------------------------------------
A0A4Q7H223      ------------------------------------------------------------
A0A1H4N2K9      ------------------------------------------------------------
A0A2K4KWF7      ------------------------------------------------------------
A0A3E0WXH2      ------------------------------------------------------------
A0A2N2TRC8      ------------------------------------------------------------
A0A1V4CIZ7      ------------------------------------------------------------
A0A1M3BXA5      ------------------------------------------------------------
A0A1Y2R3U6      ------------------------------------------------------------
A0A167HVD6      ------------------------------------------------------------
A0A1V3SCT6      ------------------------------------------------------------
L0H287          ------------------------------------------------------------
A0A495VG93      ------------------------------------------------------------
A0A4R3MYM4      ------------------------------------------------------------
G2E3C0          ------------------------------------------------------------
A0A534QGR3      ------------------------------------------------------------
A0A4U8YLL7      ------------------------------------------------------------
A0A655RNN3      ------------------------------------------------------------
A0A655R819      ------------------------------------------------------------
A0A655ZEY0      ------------------------------------------------------------
A0A0W1GMS6      ------------------------------------------------------------
A0A0Q8RMY3      ------------------------------------------------------------
A0A1A7QC21      ------------------------------------------------------------
A0A2M7WWF7      ------------------------------------------------------------
A0A351Z9A2      ------------------------------------------------------------
A0A3N5RNY4      ------------------------------------------------------------
A0A1E7H876      ------------------------------------------------------------
A0A0F2NF69      ------------------------------------------------------------
A0A1F9NFD0      ------------------------------------------------------------
A0A1M5YLH5      ------------------------------------------------------------
A0A4U1A4C7      ------------------------------------------------------------
A0A509L3P8      ------------------------------------------------------------
A0A3A4S038      ------------------------------------------------------------
A0A1F9N669      ------------------------------------------------------------
A0A1F9PFA7      ------------------------------------------------------------
A0A1H2EN09      ------------------------------------------------------------
K0NP00          ------------------------------------------------------------
A0A432HIS7      ------------------------------------------------------------
A0A127AL56      ------------------------------------------------------------
A0A1E7JCL5      ------------------------------------------------------------
A0A496YAH9      ------------------------------------------------------------
A0A1V4S7E4      ------------------------------------------------------------
A0A2N2H8D2      ------------------------------------------------------------
A0A2N2KC63      ------------------------------------------------------------
A0A3A4ZYW4      ------------------------------------------------------------
A0A1V4MCJ4      ------------------------------------------------------------
A0A661M0W4      ------------------------------------------------------------
A0A1X0YE57      ------------------------------------------------------------
A0A2K2H9Q8      ------------------------------------------------------------
A0A2N6BEI9      ------------------------------------------------------------
A0A318CT66      ------------------------------------------------------------
A0A3N5P205      ------------------------------------------------------------
A0A0D5N3E9      ------------------------------------------------------------
A0A2N2G716      ------------------------------------------------------------
A0A1F9EUS2      ------------------------------------------------------------
A0A3N9VAW3      ------------------------------------------------------------
A0A1H4B8T3      ------------------------------------------------------------
A0A1E7IQC3      ------------------------------------------------------------
A0A1M6KEN5      ------------------------------------------------------------
A0A353QLL3      ------------------------------------------------------------
A0A399I453      ------------------------------------------------------------
A0A651FBV9      ------------------------------------------------------------
A0A1G0LDK7      ------------------------------------------------------------
A0A562VHD2      ------------------------------------------------------------
A0A5C1MDH8      ------------------------------------------------------------
A0A5A9XE04      ------------------------------------------------------------
A0A643G9R1      ------------------------------------------------------------
A0A1G0M8Q7      ------------------------------------------------------------
A0A353MI14      ------------------------------------------------------------
A0A4S1CAW7      ------------------------------------------------------------
A0A534HBS8      ------------------------------------------------------------
A0A0F0T3Y9      ------------------------------------------------------------
A0A351B422      ------------------------------------------------------------
F2NEE9          ------------------------------------------------------------
B7RS54          ------------------------------------------------------------
A0A3N5FRH4      ------------------------------------------------------------
A0A1V4Y2C3      ------------------------------------------------------------
A0A2N2KTJ4      ------------------------------------------------------------
A0A2N2LQX0      ------------------------------------------------------------
A0A318D3U4      ------------------------------------------------------------
A0A401FQP5      ------------------------------------------------------------
A0A1Q6DMW3      ------------------------------------------------------------
A0A3A6P8F8      ------------------------------------------------------------
A0A2G2DSM4      ------------------------------------------------------------
A0A1F9NI02      ------------------------------------------------------------
A0A4U1ABX4      ------------------------------------------------------------
A0A351Z4H9      ------------------------------------------------------------
A0A2N2KML4      ------------------------------------------------------------
E1YJF1          ------------------------------------------------------------
A0A1J5EVZ6      ------------------------------------------------------------
A0A2G6FCC5      ------------------------------------------------------------
A0A1F9MR25      ------------------------------------------------------------
A0A2G6M7F1      ------------------------------------------------------------
A0A1I0R9R6      ------------------------------------------------------------
A0A443K010      ------------------------------------------------------------
A0A238IZI1      ------------------------------------------------------------
A0A316GHM6      ------------------------------------------------------------
A0A520ZTR8      ------------------------------------------------------------
A0A212AR83      ------------------------------------------------------------
A0A2E2P4I0      ------------------------------------------------------------
A0A2U2CM86      ------------------------------------------------------------
A0A1X7ACC1      ------------------------------------------------------------
A0A2N3BVE7      ------------------------------------------------------------
A0A2S5JE21      ------------------------------------------------------------
A0A2R8BKZ2      ------------------------------------------------------------
A0A2S8S361      ------------------------------------------------------------
A0A238KUF6      ------------------------------------------------------------
A0A095CTW3      ------------------------------------------------------------
A0A2E3UGD6      ------------------------------------------------------------
A0A2T0RFH0      ------------------------------------------------------------
A0A285D390      ------------------------------------------------------------
A0A497VHN4      ------------------------------------------------------------
A0A379GWF0      ------------------------------------------------------------
A0A536T0W8      ------------------------------------------------------------
A0A2G9XLE5      ------------------------------------------------------------
A0A3D2M6Y9      ------------------------------------------------------------
A0A3D2YAZ2      ------------------------------------------------------------
A0A350A102      ------------------------------------------------------------
A0A350L5D2      ------------------------------------------------------------
A0A1I6ENM4      ------------------------------------------------------------
A8LNM8          ------------------------------------------------------------
A0A0T5NSU3      ------------------------------------------------------------
A0A5P9I718      ------------------------------------------------------------
A0A2M8J3R9      ------------------------------------------------------------
A0A1I6X762      ------------------------------------------------------------
A0A0P1EFX8      ------------------------------------------------------------
A0A2G5KB39      ------------------------------------------------------------
A0A2N3CNV1      ------------------------------------------------------------
A0A257F1F4      ------------------------------------------------------------
A0A1G9FY29      ------------------------------------------------------------
A0A4Q3ZBK4      ------------------------------------------------------------
A0A2D5J8T8      ------------------------------------------------------------
A0A2E3P9W6      ------------------------------------------------------------
A0A2G2B1P9      ------------------------------------------------------------
A0A258GCD5      ------------------------------------------------------------
A0A2D9YR88      ------------------------------------------------------------
A0A443INY4      ------------------------------------------------------------
A0A372IH36      ------------------------------------------------------------
A0A540VW45      ------------------------------------------------------------
A0A1H9C241      ------------------------------------------------------------
A0A2E3FCR1      ------------------------------------------------------------
A0A4S3MG69      ------------------------------------------------------------
A0A1G8QZS5      ------------------------------------------------------------
A0A1V4QMH7      ------------------------------------------------------------
A0A496XZQ4      ------------------------------------------------------------
A0A1F9BJF7      ------------------------------------------------------------
F2NDF5          ------------------------------------------------------------
A0A1I3TTC3      ------------------------------------------------------------
A0A1H3IZW6      ------------------------------------------------------------
A0A0M6YG59      ------------------------------------------------------------
A0A1H7G8B0      ------------------------------------------------------------
A0A059IPK4      ------------------------------------------------------------
A0A1H2Y469      ------------------------------------------------------------
A0A497ZQU7      ------------------------------------------------------------
A0A520CSP5      ------------------------------------------------------------
A0A4Q2XLV7      ------------------------------------------------------------
A0A4Q5QYC4      ------------------------------------------------------------
A0A3B8SQ27      ------------------------------------------------------------
A0A3E0H727      ------------------------------------------------------------
A0A352Q5C1      ------------------------------------------------------------
A0A656BWB0      ------------------------------------------------------------
A0A3Y2RPN4      ------------------------------------------------------------
A0A0A0FHV8      ------------------------------------------------------------
A0A1X3IPU7      ------------------------------------------------------------
A0A0A0G0N2      ------------------------------------------------------------
A0A243TPR1      ------------------------------------------------------------
A0A2I8SDU4      ------------------------------------------------------------
A0A2I8SU55      ------------------------------------------------------------
S1EXJ6          ------------------------------------------------------------
A0A376UBS1      ------------------------------------------------------------
A0A4Q6G931      ------------------------------------------------------------
A0A4Q8R6L6      ------------------------------------------------------------
A0A2T0VBD8      ------------------------------------------------------------
A0A378APS2      ------------------------------------------------------------
A0A443VCQ6      ------------------------------------------------------------
A0A447RKQ7      ------------------------------------------------------------
W1DSK1          ------------------------------------------------------------
A0A0U2VAW2      ------------------------------------------------------------
A0A454CTF1      ------------------------------------------------------------
A0A1W9F5M9      ------------------------------------------------------------
A0A352MMI7      ------------------------------------------------------------
A0A379W6R2      ------------------------------------------------------------
A0A376RY66      ------------------------------------------------------------
A0A377K431      ------------------------------------------------------------
A0A379TA56      ------------------------------------------------------------
A0A4Z0LWV1      ------------------------------------------------------------
A0A620QD02      ------------------------------------------------------------
A0A5H3HSJ8      ------------------------------------------------------------
A0A655C5P0      ------------------------------------------------------------
A0A3C2BN18      ------------------------------------------------------------
A0A447LR75      ------------------------------------------------------------
A0A376D8L7      ------------------------------------------------------------
A0A1V2FV46      ------------------------------------------------------------
A0A376SB61      ------------------------------------------------------------
A0A3D1BYV9      ------------------------------------------------------------
A0A378G3G7      ------------------------------------------------------------
A0A2X5NHJ9      ------------------------------------------------------------
A0A2J4QEC3      ------------------------------------------------------------
A0A485ADM3      ------------------------------------------------------------
A0A4U9HGU4      ------------------------------------------------------------
A0A3S4JGG5      ------------------------------------------------------------
A0A377ZDH2      ------------------------------------------------------------
A0A3S4HTS8      ------------------------------------------------------------
A0A2N1XK22      ------------------------------------------------------------
A0A3D0KAC8      ------------------------------------------------------------
A0A3D2Y902      ------------------------------------------------------------
E1Y9C0          ------------------------------------------------------------
A0A1N6SH58      ------------------------------------------------------------
A0A4Q3AQN2      ------------------------------------------------------------
                                                                            

A0A1F9CFF0      ------------------------------------------------------------
A0A2M8B0G5      ------------------------------------------------------------
A0A363TNU9      ------------------------------------------------------------
A0A0C5VQ86      ------------------------------------------------------------
A0A1V8MBH1      ------------------------------------------------------------
A0A0R0BVC7      ------------------------------------------------------------
A0A3N5J7U8      ------------------------------------------------------------
A0A1S7S3I8      ------------------------------------------------------------
A0A519E8D7      ------------------------------------------------------------
A0A3S1NZ06      ------------------------------------------------------------
A0A3S1FD32      ------------------------------------------------------------
A0A434DUT4      ------------------------------------------------------------
A0A528D3U3      ------------------------------------------------------------
A0A3S3UPT3      ------------------------------------------------------------
A0A3S1E286      ------------------------------------------------------------
A0A531AC71      ------------------------------------------------------------
A0A436K268      ------------------------------------------------------------
A0A434IDQ0      ------------------------------------------------------------
A0A435IRM5      ------------------------------------------------------------
A0A3S2C404      ------------------------------------------------------------
A0A435F6C0      ------------------------------------------------------------
A0A435BMN6      ------------------------------------------------------------
A0A529XQ54      ------------------------------------------------------------
A0A530BJC1      ------------------------------------------------------------
Q44570          ------------------------------------------------------------
A0A655ZZQ1      ------------------------------------------------------------
A0A1S0ZAI3      ------------------------------------------------------------
A0A1W9M770      ------------------------------------------------------------
A0A1W9M7R6      ------------------------------------------------------------
A0A3C0L0A8      ------------------------------------------------------------
A0A176S762      ------------------------------------------------------------
A0A377ZC40      ------------------------------------------------------------
A0A378BPJ7      ------------------------------------------------------------
A0A2J5PAJ7      ------------------------------------------------------------
A0A377ZDN3      ------------------------------------------------------------
A0A1W9WUD9      ------------------------------------------------------------
A0A1W1ZQK0      ------------------------------------------------------------
A0A4U1ALN4      ------------------------------------------------------------
A0A4U1B1A8      ------------------------------------------------------------
A0A1M7Y300      ------------------------------------------------------------
A0A4U1A967      ------------------------------------------------------------
A0A3N5MZ53      ------------------------------------------------------------
A0A534E4H4      ------------------------------------------------------------
A0A534I2B6      ------------------------------------------------------------
A0A1C2JGD0      ------------------------------------------------------------
A0A259LQ70      ------------------------------------------------------------
A0A4V2SPR5      ------------------------------------------------------------
A0A3N5PM86      ------------------------------------------------------------
A0A2E5YSA4      ------------------------------------------------------------
A0A519ERR1      ------------------------------------------------------------
A0A4Q3Q1M2      ------------------------------------------------------------
A0A4Q3MHR1      ------------------------------------------------------------
A0A520GDZ4      ------------------------------------------------------------
A0A318DSU0      ------------------------------------------------------------
A0A538PF21      ------------------------------------------------------------
A0A1W1ZH10      ------------------------------------------------------------
A0A1W2FF24      ------------------------------------------------------------
A0A524JYQ6      ------------------------------------------------------------
A0A4Q3MA17      ------------------------------------------------------------
A0A0N0M5F7      ------------------------------------------------------------
A0A537M754      ------------------------------------------------------------
A0A1V1PDB4      ------------------------------------------------------------
A0A2M7C324      ------------------------------------------------------------
A0A4Q3HHG6      ------------------------------------------------------------
A0A3B7DTA4      ------------------------------------------------------------
A0A432ZK62      ------------------------------------------------------------
A0A1V5EEP4      ------------------------------------------------------------
A0A1V5EF48      ------------------------------------------------------------
A0A0S6X1X6      ------------------------------------------------------------
A0A537Y5L8      ------------------------------------------------------------
A0A4Q3L2X2      ------------------------------------------------------------
A0A4Q3T8J1      ------------------------------------------------------------
A0A4Q4ANM4      ------------------------------------------------------------
A0A4Q3UEC7      ------------------------------------------------------------
A0A1H5YYQ4      ------------------------------------------------------------
A0A1X4NLK2      ------------------------------------------------------------
A0A1X4NWB5      ------------------------------------------------------------
A0A1M5UQ38      ------------------------------------------------------------
A0A327YI48      ------------------------------------------------------------
A0A1B1PNL6      ------------------------------------------------------------
A0A2U8H9H9      ------------------------------------------------------------
A0A1X6YIC0      ------------------------------------------------------------
A0A1I5E9E9      ------------------------------------------------------------
A0A1X6Z7N7      ------------------------------------------------------------
A0A2E1DQ13      ------------------------------------------------------------
A0A1H8C800      ------------------------------------------------------------
A0A2N3EZ05      ------------------------------------------------------------
A0A1W9PMU6      ------------------------------------------------------------
A0A1G3VVY5      ------------------------------------------------------------
A0A2N6BZD5      ------------------------------------------------------------
A0A435NNF5      ------------------------------------------------------------
A0A3S2AQS7      ------------------------------------------------------------
A0A436XH86      ------------------------------------------------------------
A0A527ZPD6      ------------------------------------------------------------
A0A529KRW3      ------------------------------------------------------------
A0A530ZLX0      ------------------------------------------------------------
A0A355TB56      ------------------------------------------------------------
A0A524M660      ------------------------------------------------------------
A0A0C1TRU6      ------------------------------------------------------------
A0A2Z5SSF4      ------------------------------------------------------------
A0A327LYE6      ------------------------------------------------------------
A0A5A9ZTV3      ------------------------------------------------------------
A0A4Q4CIB1      ------------------------------------------------------------
A0A522ACJ9      ------------------------------------------------------------
A0A3N5Z7F8      ------------------------------------------------------------
A0A239HD34      ------------------------------------------------------------
A0A534V9L7      ------------------------------------------------------------
A0A0P7ZZE4      ------------------------------------------------------------
A0A369R0Q9      ------------------------------------------------------------
A5G4N9          ------------------------------------------------------------
A0A238LBD3      ------------------------------------------------------------
A0A0P1FRV5      ------------------------------------------------------------
A0A0P1FWI8      ------------------------------------------------------------
A0A1M7BLL7      ------------------------------------------------------------
A0A0H4KZM1      ------------------------------------------------------------
A0A1V1UJT2      ------------------------------------------------------------
A0A0L6CVX1      ------------------------------------------------------------
A0A1V0RR48      ------------------------------------------------------------
A0A0A0HJJ4      ------------------------------------------------------------
A0A5E7YA28      ------------------------------------------------------------
A0A348SRI7      ------------------------------------------------------------
A0A354EI73      ------------------------------------------------------------
A0A4P7EP83      ------------------------------------------------------------
A0A3A4NIE9      ------------------------------------------------------------
A0A3A4NUI9      ------------------------------------------------------------
A0A524I3Z6      ------------------------------------------------------------
A0A524PCL7      ------------------------------------------------------------
A0A356GQV1      ------------------------------------------------------------
A0A1J5DAY8      ------------------------------------------------------------
A0A524P237      ------------------------------------------------------------
A0A1G3JY11      ------------------------------------------------------------
A0A661N3U1      ------------------------------------------------------------
A0A3S1WTQ1      ------------------------------------------------------------
A0A440NX85      ------------------------------------------------------------
A0A530CUR9      ------------------------------------------------------------
A0A1M6N1X5      ------------------------------------------------------------
A0A561M3U0      ------------------------------------------------------------
A0A2W5J775      ------------------------------------------------------------
A0A1F9E324      ------------------------------------------------------------
A0A432SAI6      ------------------------------------------------------------
A0A4Q3LBH4      ------------------------------------------------------------
A0A4Q3LWP3      ------------------------------------------------------------
A0A2N6VGL1      ------------------------------------------------------------
A0A3M3H5V6      ------------------------------------------------------------
A0A2T4ZJZ6      ------------------------------------------------------------
A0A1T2KYM8      ------------------------------------------------------------
A0A2G9ZR82      ------------------------------------------------------------
A0A4U9I390      ------------------------------------------------------------
A0A534XP85      ------------------------------------------------------------
A0A2X3M011      ------------------------------------------------------------
I2WC85          ------------------------------------------------------------
A0A400JH80      ------------------------------------------------------------
A0A2H9EHM4      ------------------------------------------------------------
A0A380B3D7      ------------------------------------------------------------
F5NSX0          ------------------------------------------------------------
D8EEU7          ------------------------------------------------------------
A0A479JNB1      ------------------------------------------------------------
A0A5C9AF52      ------------------------------------------------------------
A0A0P1H2H0      ------------------------------------------------------------
A0A258WKV0      ------------------------------------------------------------
A0A377N8F8      ------------------------------------------------------------
A0A3C2DSE7      ------------------------------------------------------------
A0A2X1JBG5      ------------------------------------------------------------
A0A0B8PTA8      ------------------------------------------------------------
A0A0B8QF75      ------------------------------------------------------------
A0A4Q3LR91      ------------------------------------------------------------
A0A4V1TR68      ------------------------------------------------------------
A0A444IY46      ------------------------------------------------------------
A0A660AID0      ------------------------------------------------------------
A0A3E0WKI3      ------------------------------------------------------------
A0A1H3I2J1      ------------------------------------------------------------
A0A1V5DJV0      ------------------------------------------------------------
A0A520IUC4      ------------------------------------------------------------
A0A521LJG5      ------------------------------------------------------------
A0A531IBQ7      ------------------------------------------------------------
A0A377LY04      ------------------------------------------------------------
A0A5C9ABR5      ------------------------------------------------------------
A0A5J9WU72      ------------------------------------------------------------
A0A2X3K9R3      ------------------------------------------------------------
A0A3T9EHW9      ------------------------------------------------------------
A0A484X141      ------------------------------------------------------------
A0A5N9VWI6      ------------------------------------------------------------
A0A3D3PV27      ------------------------------------------------------------
A0A376LLF8      ------------------------------------------------------------
A0A444R390      ------------------------------------------------------------
A0A1V4WHZ7      ------------------------------------------------------------
A0A1E5AJN5      LTEKPNFYIQPVRFSLVGILKRAITGRAEQPFIPRTYDERERAAINRVLAGMQITTLRRS
A0A2N3D2J1      ------------------------------------------------------------
A0A2N2GVE1      IEVIKSRNIALLAARRLENVDLHQLLGQPQFAHREPTEEELQRAAGVMRGMIQVIPVPES
A0A2N2INV3      IEVIKSRNIALLAARRLENAELHQLLGQPQFAHREPTEEELQRAAGVMRGMIQVIPVPDS
A0A1Y5DXG5      ------GKVGEEVTNGTFTLTIKELVARAGTEFFVTRKDRLNTILDLQSSIGASEKGKDS
A0A0B8P2H5      ---------MARSENGEFLLFVSQLVGKQGQEYGLGKRSKLDAIQWLNGSLSVSERGKQS
A0A483QWI8      -------------------------------------------MKDLQESFTVTDQGKDT
A0A483UXD3      ---------------------------------------RLKAIKDLQESFTVSDQGKDT
A0A0A8J8L3      ------------------------------------------------------------
A0A660DJ38      ------------------------------------------------------------
A0A380AQW6      ------------------------------------------------------------
A0A2G2GD62      IEYKGIHKFGEDVISKYFQLKVIKVRELNSLEYFFSYIDNRNMVGYIQNNLSTEQDAKYS
A0A524P331      GSIAAQGKTGQRVRTQDLTLLLDEIQGKKGDLFRLQQQSFIGTVQGVMGSTNVSQVGKYT
A0A4V1SSM5      ------------------------------------------------------------
A0A4Q3K8G7      ------------------------------------------------------------
A0A1M7HC79      ------------------------------------------------------------
A0A1D3JZN6      ------------------------------------------------------------
A0A1V6ESG1      ------------------------------------------------------------
A0A1H7YHK3      ------------------------------------------------------------
A0A534SH66      ------------------------------------------------------------
A0A3M0ZZ99      ------------------------------------------------------------
A0A328C2K5      TQKEVLGSKWFARRVVEREGLLDAPGFLPASAQQLDEDERMKRAVNTLQSVAVYSLQRDS
A0A5C6X8M3      TQKEVLGSKWFAQRVIEREGLLDAPGFLPPSVQQLDEDERMKRAVNILQRVAVYSLQRDS
A0A3D8MRR7      TQKEVLGSKWFAQRVIEREGLLDAPGFLSPSVQQLDEDERMKRAVNTLQRVAVYSLQRDS
A0A5C6UBJ7      TQKEVLGSKWFAQRVIEREGLLDAPGFLSPSVQQLDEDERMKRAVNTLQRVAVYSLQRDS
A0A5C6XGM3      TQKEVLGSKWFAQRVIEREGLLDAPGFLPPSVQQLDEDERMKRAVNTLQRVAVYSLQRDS
A0A537NZJ1      ------------------------------------------------------------
A0A4Q4CVW6      ------------------------------------------------------------
A0A090R136      ------------------------------------------------------------
A0A661JU93      ------------------------------------------------------------
A0A2E2T3V8      VLRGQGVSFSQEANVQGNFLRRIFGNDQGFIASDAKVSDEIDKDVEALRRRIDVERIGNS
A0A367UAB4      ILRGQGIIFSQEANARGNFLRRIFGNDQGFIASDAKVSDEIDKDVEALRRRIDVERIGNS
A0A377V641      ------------------------------------------------------------
A0A1F2YJ88      ILTGKTNQANTLRTADGLWNISIYTQDQLNDVYLIQKQSLPSAVNNILANYSVAEKGKLT
A0A0J7XGZ1      PEFGGDSKSPSAKLTPPLATGTDGHGSTGDREQIATINPAERQAAGRLLTHSYVRRVGVT
I4CBA7          LQGALEFFAEFSIFYETQVQSLKEMAQSGSLSTPDRRGLEDAAKALPRWSDIRITENRGS
A3VE95          EVSVMTSNILIERLILEVGIERLETLYWGEVRGDRDEASRLADLTWAIRQDLNVSRESES
A0A1G0NL95      -------------------------------------------------MTTVREQGKQS
A0A024KA69      RGVLEDGRPGAGDGARVDSAVDLIASEPVLASAARALGLAGERAPDWLGSRVKVQRDGPT
A0A0L1KFN4      AELGLVDRPEFFEMFRFDGADDPAFEIVNGRYPAEGRAQRQREAAKILLDQVSIEPTRLS
A0A3P5DSS6      ------------------------------------------------------------
A0A483YEL5      ------------------------------------------------------------
A0A658GUJ0      ENIDFDGEIGRLIDKNGIRIQVDSINAEPGTRFLLTYTSRINAINYLRDSLLIADQGKDT
A0A358L616      ------------------------------------------------------------
A0A3D5UYX7      ------------------------------------------------------------
A0A2N1WQN5      ------------------------------------------------------------
A0A352G2C2      -------------------------------------------------------RGKQS
A0A3C0PZN1      ------------------------------------------------------------
A0A524QFS4      RYLSSSADQLNTQIMKLQGAGLRNLVLNKAKGTLALHGVTGDDAKQFLKGGVDINLVRRT
A0A520JSW4      FIGTQLGLLGSRALAERVAQNLNLAADTAIVGPGGDRSLNTASAAGFVQGGTQVRLQPLS
A0A4Q3LTF3      ------------------------------------------------------------
A0A537UTP9      LWPKLGLFSAIKGSVLGLVDSVLRLFQSSSTSTSDPEFALTRAAVERFQSQLIITRAGLT
A0A1D2RNR5      ------------------------------------------------------------
A0A4V1TQ46      ------------------------------------------------------------
A0A3A0FZC0      EIKSALFDTANQGFFGQLFGGDSESKQESDKLDQLAGYKSTVRQIKVYLSTIEIKPVRRT
A0A1N7JVZ7      ------------MTAERVFRRKNRPHARSEPEAQAQPAASRDDSADAHDSPSPKVFRRQK
A0A091C4A8      ------MTAPAPWKLLLGLAGETDDEELDAAHLAATESVRQTLRINSFLASLSIEPVRNS
A0A4R3H6P6      LAERVARDLGVVDDPAFFKLFGRRDLFQDGKADPTARAKRNEVAGKILLLHVGVAPVRGS
A0A3S1NQ09      ----------YVRPSSSMPGGADFSKLDPAARDALIATSRRDYAILKLQNEIRAERVGRS
A0A443GJ52      -------VIRYFRPNPAV-GTTDVAQLDPATRDAMIASSRRDYAILKLQNEVQAERIGRS
A0A2W6S588      SQLQIATSLPVAIRALQDPEVAKNPTILARAKAFDPSGKSSDAMAAALLSGVSAARVGTT
A0A483E0N4      ----INGYVGQLYENDDFSIKVDKMDAKPGSEYNIYYESRLKAISDLQNTLSVADQGKDT
A0A2J4YQQ6      --------------------------------FTIGYLSRLKAITDLQENLIVADQGKDT
A0A483THX4      --------------------------ALPGTKFKISYLPRLKAITDLQTNLVVADLGKDT
A0A534MVS2      ---------------------------------------------------MQQINSILG
A0A444I5K6      DNPFMGPKSSLFSVSTLKSFMNFRSWFADDAAVAPDPEMRRRGAAETVAGNIDVERVGRS
A0A154VE85      FAFGAWLRDHVLAPLGVAPSSGSGRASQGSAVIAPPPAVLAERAVDAYLDRLSVSPADNA
A0A3S1MCW7      ------------------------------------------------------------
A0A434IGN6      ------------------------------------------------------------
A0A528AX40      LSEKPDFLFPTSGFSLSNVFYRAFGISKSPSIEEKTPEEREAIAIGRILKDLTVNLVTNT
A0A528MV95      LSEKPDFLFPTPNFSLSNIFYRAFGISKSPSIEEKTPEQREAIAIGRVLNDLTVNLVSNT
A0A3C1S9Y1      SNLREWFKEKRQSWKDQMDSLLSSDKNKGNTVPKSDDPSQDSPLVSAFITRIKVSPIRNS
A0A353EH49      YYDQQYVLAREQEFSPYLKINIEYLKARVGTEFTLEKQHVYKSAEVLNGKLQVSESGKQS
A0A1Y1Q9C1      DLKTRLFERPAPFSVLSSFKVIIKGLIAPLLPAKIETVTEAADYTDLFSQHLYVEPIEKT
A0A3M7LJH0      -----------------------------------------------------------T
A0A316KRG4      ------------------------------------------------------------
A0A1E4JHX8      -----------------------------MRNTPAGREKRSREAARILLENIDIVPDRLS
M2U8P2          VQALRAPEIATAVARTVGPERILRAYMDPDQPIPTERQAATRRAAAFIRGGLSARREGTS
A0A1H7KZF8      LLMARSVPVAEAVMRALKLSADDTFLRQMHADPAPTPGERRQAVLDLLDRKRSAAIIPNS
A0A0J5Q9T7      ------------------------------------------------------------
A0A257NG76      --------------------------------------------------------GKKT
A0A1T4TW59      LVGKPSARDQLLTLLRQIDGLDGFLPKPIAPSTDPNSEVAKRAVLKKFKSHFAIEPIRYT
A0A1I5YYQ0      ------------------------------------------------------------
A0A5P9FE62      ------------------------------------------------------------
A0A1Q3MB35      --------------------------------MASAAQQRLELATDILLDNVSINPVRGS
A0A259LUN7      ------------------------------------------------------------
A0A2D7AVL1      ------------------------------------------------NSSIFSLDGETI
A0A3B9KZE9      ------------------------------------------------------------
A0A2U0NMP8      ENIDFDGEIGRLIDKNGIRIQVDSINAEPGTRFLLTYTSRINAINYLRDSLLIADQGKDT
A0A4U9HNE9      ---------------------MTTLSAEPGATFSVVKLARQQAIDDLRRTLSIALAGKES
A0A2G2CXY6      GMLLIEGNTLEQIDRDGFKIQVQALVARPGTEFLVTKHRMLNSILAYQEELGASEKGKDS
A0A3M1D4H3      ------------------------------------------------------------
A0A5C8BYM7      ------------------------------------------------------------
A0A1J5ICP0      SGALAGKGELNKPFLGPNFSILVEGDHARKGRKMKFSVLTPASAVEGLQGSLAVSPIKNT
A0A0M3GBT1      LNLRPEFNPALREVTFFESIRTNLRGLFDPRKPAEPVRDGIDAVIPEFYRALGVWHEDKS
B3Q577          LNLRPEFNPALREVTFFESIRTNLRGLFDPRKPAEPVRDGIDAVIPEFYRALGVWHEDKS
A0A379B9V4      TEPLLTGKVGEKYDTDLIQFSLSQINAKPKQRFLINKLPELTVISALQEQLSVHEIGKQT
A0A0Q6TS97      ------------------------------------------MAGKILLQHVGVAPVRGS
A0A0Q6UYB4      ------------------------------------------MAGKILLQHVGVAPVRGS
A0A484XS37      GTEIIKGKVGALESGHGISLLVSEISAEPGTVFEIAKLPRLVAINNLLDALTVEDKGKDT
W7Q5J0          GHIGQLHTFLDGEMELLIDEFNAAPGAQFRLAKRNRNGDIRSLGGRLQIAEVGGGRGSST
A0A654AKT6      ---MYSKIVSVLFYMFFTCVIFNPQINGATIYFYLFIPFLDPKFVRFLTATVRHWSVPLV
A0A0G9MZA5      ---------------------------------MPENADIEPALAGTLLNNVSITPIINS
H0T8B0          IATVVSRLRLDQNPEFECPDRGLFAIFSPSKTSLPPSEARIRCAVSTVASNLSIVRVGRS
A0A5C7N981      QRVIEQLSLVAPARTASKSTGWLDIFKSADQKEDNAPAPAATGLLSGLPGALSVMPVRNS
A0A534TV22      ------------------------------------------------------------
A0A351CXR4      NLPAPATPFADLTNDISQMLLGRKLIDTPQNEQPKLAFANTRQASAFIQAALTVEVESHD
A0A2N6GLF5      KHPEFQPEENKLISFDWKTWLKSYLPQQSGGAELDEAETFYDSVVEYYFERLKVTPVKNS
A0A1W9LJP0      ----MSKNWFAEPLRFWKEKLLSLRNTGKPEDKDKKDEDADAWLVNALIGRIKAEPVRNS
A0A0W1ICB0      RLRLARNPEFFAAHGETPEGEGLLSGLRSGPVSAADLRQRERQAVELLLDNVGISPLRGS
A0A2E0UL88      ------------------------------------------------------------
A0A233IKJ2      ------------------------------------------------------------
A0A2T1JE00      ------------------------------------------------------------
A0A0T2QIS1      ------------------------MDDSSAASSSEDRAGREKLAVDLLLSHVTISPITRS
A0A376KYN0      ------------------------------------------------------------
A0A2X1JB05      ----------------------------------------------MQETFTVSERSKES
A0A376RML0      ----------------------------------------------MQETFTVSERSKES
A0A377E5P7      ------------------------------------------------------------
A0A0P7Y1D0      NSRLREPSGLGAVAGAVAGFLSALLPSQVADSQSGEAEQELEAVTSAVLDRLSARRSGMT
A0A2M7JRZ7      -----------------MTGLFTSSKKNAPSEKEISENKKDTALIDQFLSKLKVEPIRNS
A0A167IR75      --------------------------MTNERYSAEGRAERQREAADILLTNVTINPTRLS
X7F6S5          ------------------------------------------------------------
A0A1G7CFZ2      ------------------------------------------------------------
A0A1P8USW9      ------------------------------------------------------------
A0A1I6U4V1      ------------------------------------------------------------
A0A1G8NKI0      ------------------------------------------------------------
A0A355QPE4      ------------------------------------------------------------
A0A357RN98      ------------------------------------------------------------
A0A3B8T2U6      ------------KKLVKTAIPLFPDPQEVVLTDTEKQQNRLDFAIAKLQANIDIKPVFHT
A0A365PWR2      ----------------------------------MTKEPRLAALLRLQNQLQIDEVEEGS
A0A2E9H5Z8      ------------------------------------------------------------
A0A2E2BR79      ------------------------------------------LSSRLSVSETGSGFVGNA
A0A0Q4Q524      --------------------------MVNGRYPAAGRPIRQRTAGQILRDHLDVAPTRLS
A0A0Q4CFJ9      --------------------------MVNGRYPASGRATRQRVAGEILIDHLAIVPTRLS
A0A0Q4FE58      --------------------------MVNGRYPASGREIRQRVAGETLLKNLNIAPTRLS
A0A0Q4JWC8      --------------------------MVNGRYPASGREIRQRVAGETLLKNLNIAPTRLS
A0A0Q4KFL8      --------------------------MVNGRYPASGREIRQRVAGETLLKNLNIAPTRLS
A0A522R8R0      ------------------------------------------------------------
A0A2U9NDY5      ------------MEGQGGKGQSAERQAHPGTEGGRRRKRPQTTAREDQDRRKGGEAGKDA
A0A0Q4IGG1      --------------------------MVNGQYKAAGRAERQQLAGKILLDNISINPTRLS
A0A534RUJ5      --------------------------------------------------------VQRT
A0A3M1CJM3      ------------------------------------------------------------
A0A2R7SVD4      -------------AQDGVEVLVAQLAANPGTRFEVVRNPRIVTIQGYQDALDISEQGKES
A0A3C0PWB6      -------------------------------------------ALDYQDRLKVGEAGKDS
V4Q8B7          -------------------MQIAQLDARPGTEFALVRNRPQTTALDYQNRLKVGEAGKDS
A0A0Q8XKK5      -------------------------------MTAVERAKREKAAVQILQSNIAISPIRNS
A0A2E0Q2W0      ------------------------------------------------------------
A0A660NIR6      IRVIKALGLENNPYFNPELTPEGKEQAAEGNVKELSQEALEEQVLMRYKAGLDISPIKNS
A0A142W0R3      SLAARTVRAGNLLNDKDFLAQYDLTGGEEGTPNSAQRARMAERAEKILLDAVSIEPVRQS
A0A0S4XR18      GEYKFGQAIKTPYFTFVIKATKDFGLNDTSYKIIHQSNKNSFIDGFIRPNLNVAQISKQA
A0A2E0GW64      ------------------------------------MLSGQLKVSDQGDQTQKNSYLRET
A0A1A7QJ97      --------------------------MNNGRFPAQGRAQRQRVAGEVLLDHVSIEPTRLS
A0A661LW70      ---------------------------------------------------------TDF
W7Q8F9          GHIGQLHTFLDGEMELLIDEFNAAPGAQFRLAKRNRNGDIRSLGGRLQITEAAGGRGSPT
A0A524PXH8      ------------------------------------------------------------
A0A4Q3P0E4      ITGKVGTPLKTNTPNGPIDLLVSQLDGKPGAEFVVNRFAKLATIEGLQSRLVLTEKGKQS
A0A3M2BE89      GEMLLEGQIGRVAEDHGISLYVSELIARPGTRFDLKKTGWLTAVKTLQKTLKVSEKGKKT
A0A4Q4A6K6      ------------------------------------------------------------
A0A257G674      LKSRTLLERVAQKLRLIGNPRFYDAMGMRQPAGDLSRGELEDLTLQALEDARDVSMPRNS
A0A661M5M6      -----------------------------------------------------------T
A0A1I1UM01      -------------------------------------------------------MTNRP
Q44573          VMAQLPPPAAPPHVGLRDRLCHMGLGFLCHASTPVDPQVQREHEEDAFLNNLTVTPEPRT
A2W025          GTRLLAGRVGESAQGGGVTLLVQKLVARPGTQFTVVRYNDLDAISGFQAGIQVSEQGKQT
A0A534Z362      SRRRGLLSLSGTMLRLLRPRGLETAPAGPSEDGSAGRGSVDPALIDRYMRYLSVQEIRGT
V4J283          ------------------------------------KISLVAAAGALSGAFTAVEYPNYS
A0A536T443      -----------------------------------------------------MKRERLT
A0A0Q4UFQ5      -----------------------MFESGRPIQTAAARASRIKAAGNLILARMDVEPERMS
A0A527W7E6      --------------------IPGIQNVDAATREAMIKTATHDYAVLMLQTGLLADRVSRS
A0A432EMV7      ----------------------------------------------------------KS
A0A087LTV7      ------------------------------MHEDAWDLRGLEGAIRRQWRVVALAVAAGL
A0A534WLI3      ----------------------------------------------------SVETVPGT
A0A318KWA2      ARVGELARFAEGDIELRVAALEAPAEAEFTLVKHRRASAIRDLGDRLSVAEVGVGRGTST
A0A522MT86      ------------------------------------------------------------
A0A4Q3I221      ---------------------------------------------------------AKI
A0A534SAL6      SGRKGLLNLTGNLVNLLRPRGWDGAPAAGSGAERAVASEVDPMLLDRYMRYLSVQDVRGT
A0A534ZDB4      AERKGLLSLSGNLVNLLRPRGWDGAPAASGGAEHAMPGEVEPVLLDRYMRYLSVQDVRGT
A0A534X3M7      PRRHGLLSLGESMPRPVRPRGFETAPARSSAPEAATRTSIDPALIDRYMRYLAVEEVRGS
A0A534SPC6      ------------------------------------------------MRYLSVQEIRGT
A0A535AD60      PRRRGRLSLSGTTLRLLRPRGLETAPAGPSEDGSAGRGAVDPALIDRYMRYLSVQEIRGT
A0A4Q3SY08      ---------------------------------------------------------SYT
A0A4Q3LG23      --------SVAGRLERQRVAGK------LLRDNLSISPTRLSRLVDVAFTSPDPAFSAKI
A0A522EX52      -----------------------------------------------------ININDLD
A0A1H3KC95      ------------MNAGPRFRRR--------------------------------------
A0A5P8Z4P3      RDVQMSGSGETSGAEKPKVFRRHKRAETKRNAEAPDKSPAQA-----------PRIADRP
A0A0B3RZC9      ----------MNMMDSPKFRRK------RTSATGSAR----------------PVSEPPD
A0A2E9HXF7      -------------MDSPKFRRK------RTSATAHP-----------------PAADPAS
A0A520HUH4      -----------------------------------------------------PVAIAHR
A0A2K8U7M6      MTPLGNSRLVSVAFDSPN-----------------------------------PAEAAAV
A0A5B9DKL8      MQEDAWGFDSFEGLIRRQWRMIALIWVGIVAAAALALTLMPASFTATTWLFSDPTVRTIL
A0A238KJM1      ------------MMDDRKFRRK--------------------------------------
A0A3A0FJZ4      ----------MSDAPAPGFDLRDAVLCLRRRAGWLALALALGVAGGVAAHRLLPPRYVGE
W4HJV8          ----------MNMANRPKFRRR------HRPAATGWDDGARVPA---------RTTGPET
A0A0P1GDI0      ------------MTERRKFRRK------NRSADAVEDEMPPI-----------APLESRE
A0A2R8ATV5      ------------MSERRKFTRK------KTQGAASSAALAPESRPVVSEEERREQIVAEK
A0A1U7D3R6      ------------------------------------------------------------
A0A2D4UVV2      ------------MVERRKFQRK------KRPTAETDAP---------------EPAEVTS
A0A0W7WHP4      ------------MTDQRKFRRK------GKRVR--------------------DAAPTET
A0A238J8F6      ----------MNEMDNRKFRRK------YKSVDATAEQAAEEVLRQEELRAAAAEAKAAA
A0A238JQI6      ----------MNMMDGPKFRRK------HRSAAGKPRPAPESV----------PETLPET
A0A222E077      ----------MNMMDSPKFRRK------RTSATAHP-----------------PAAAPAS
A0A239E3Y2      ----------MNMMDSPKFKRK------RTSATAPH-----------------PAADAAS
A0A1W9HS52      ------------------------------------------------------------
A0A2D5LFD8      ------------------------------------------------------------
A0A0N0XAV4      ------------------------------------------------------------
A0A0P9QD19      ------------------------------------------------------------
F3FHG4          ------------------------------------------------------------
F3GGI0          ------------------------------------------------------------
A0A0P9LE74      ------------------------------------------------------------
A0A3M4ZQ14      PLSATPFSLRTDLCAALAVHRRLASSFSVRRDTINDRHEPCSFGSLPGFTGRSGNRSADV
A0A3M5YLE8      PLSATPFSLRTDLCAALAVHRRLASSFSVRRDTINDRHEPCSFGSLPGFTGRSGNRSADV
A0A3M3RP89      PLSATPFSLRTDLCAALAVHRRLASSFSVRRDTINDRHEPCSFGSLPGFTGRSGNRSADV
A0A0P9QIY7      PLSAPPFSLRTDLCAALAVHRRLASSFSVRRDTINDRHEPCSFGSLPGFTGRSGNRSADV
A0A0P9VVH7      PLSATPFSLRTDLCAALAVHRRLASSFSVRRDTINDRHEPCSFGSLPGFTGRSGNRSADV
A0A0Q0FJK6      PLSATPFSLRTDLCAALAVHRRLASSFSVRRDTINDRHEPCSFGSLPGFTGRSGNRSADV
A0A0Q0G2J0      PLSATPFSLRTDLCAALAVHRRLASSFSVRRDTINDRHEPCSFGSLPGFTGRSGNRSADV
A0A3M3LF66      PLSATPFSLRTDLCAALAVHRRLASSFSVRRDTINDRHEPCSFGSLPGFTGRSGNRSADV
A0A0P9WIR8      PLSAPPFSLRTDLCAALAVHRRLASSFSVRRDTINDRHEPCSFGSLPGFTGRSGNRSADV
A0A3M3KPE5      ------------------------------------------------------------
A0A3M4C263      ------------------------------------------------------------
A0A3M5AD05      ------------------------------------------------------------
A0A0Q0D3D2      ------------------------------------------------------------
A0A0N0FS39      ------------------------------------------------------------
A0A3M6GHH2      ------------------------------------------------------------
A0A0P9R9W0      ------------------MHRRLASSFSVRSNRINDRHEPSIPGFPTGLADRSGNCSADA
A0A0Q0B9T0      ------------------MHRRLASSFSVRSNRINDRHEPSIPGFPTGLADRSGNSSADA
A0A3M6CFI7      ------------------MHRRLASSFSVRSNRINDRHEPSIPGFPTGLADRSGNSSADA
A0A0P9JXN0      ------------------MHRRLASSFSVRSNRINDRHEPSIPGFPTGLADRSGNCSADA
A0A3M6FIV7      ------------------MHRRLASSFSVRSNRINDRHEPSIPGFPTGLADRSGNCSADA
A0A3M3PLW9      ------------------------------------------------------------
A0A3M4ENY1      ------------------------------------------------------------
A0A3M5EZK7      ------------------------------------------------------------
A0A0P9SPP5      ------------------------------------------------------------
A0A658KL17      ------------------------------------------------------------
A0A3M3NNF2      ------------------------------------------------------------
A0A3M4A0E8      ------------------------------------------------------------
A0A3M4PBZ2      ------------------------------------------------------------
A0A3M6AI26      ------------------------------------------------------------
A0A0P9IWP8      ------------------------------------------------------------
A0A0P9KZ49      ------------------------------------------------------------
A0A0P9V840      ------------------------------------------------------------
A0A0Q0AIE5      ------------------------------------------------------------
A0A3M2ZQH6      ------------------------------------------------------------
A0A0N8SQG2      ------------------------------------------------------------
A0A0W8HFU1      ------------------------------------------------------------
A0A3M5M873      ------------------------------------------------------------
A0A0P9VHH8      ------------------------------------------------------------
A0A0P9YV98      ------------------------------------------------------------
A0A3M3G2W8      ------------------------------------------------------------
A0A3M6C224      ------------------------------------------------------------
A0A3M5K254      ------------------------------------------------------------
A0A3M5JFB0      ------------------------------------------------------------
A0A3M3TQV3      ------------------------------------------------------------
A0A3M3EF92      ------------------------------------------------------------
A0A3M5J1E2      ------------------------------------------------------------
A0A3M5G7H9      ------------------------------------------------------------
A0A3M4A376      ------------------------------------------------------------
A0A0Q0A5T8      ------------------------------------------------------------
A0A0P9SCD7      ------------------------------------------------------------
A0A0P9T4G3      ------------------------------------------------------------
A0A0P9VKB0      ------------------------------------------------------------
A0A0Q0BM35      ------------------------------------------------------------
A0A3M3TPR7      ------------------------------------------------------------
A0A3M3U4Q3      ------------------------------------------------------------
A0A0P9UCX7      ------------------------------------------------------------
A0A0P9S1F1      ------------------------------------------------------------
A0A0P9QCJ2      ------------------------------------------------------------
A0A0P9Q329      ------------------------------------------------------------
A0A3M5GJ64      ------------------------------------------------------------
A0A0P9MPC7      ------------------------------------------------------------
A0A3M2XYQ3      ------------------------------------------------------------
A0A0P9XCE1      ------------------------------------------------------------
A0A3M3EFX7      ------------------------------------------------------------
A0A3M5B9D9      ------------------------------------------------------------
A0A0P9RRZ3      ------------------------------------------------------------
A0A3M2VEK7      ------------------------------------------------------------
A0A0N8R9B3      ------------------------------------------------------------
A0A0P9VA27      ------------------------------------------------------------
A0A3M4YBJ4      ------------------------------------------------------------
A0A0P9J470      ------------------------------------------------------------
A0A0Q0EVJ8      ------------------------------------------------------------
A0A3M5UI30      ------------------------------------------------------------
A0A3M5YQT8      ------------------------------------------------------------
A0A3M5F5X1      ------------------------------------------------------------
A0A3M5R8G1      ------------------------------------------------------------
A0A3M5V012      ------------------------------------------------------------
A0A3M3GA16      ------------------------------------------------------------
A0A3M3UCT3      PLPAARVSLRTDLRAALALHRRLAPSFSVRSNRINDRHEPSFPEFPSGLPDRSGNSPADA
A0A3M3CJL0      PLPAARVSLRTDLRAALALHRRLAPSFSVRSNRINDRHEPSFPEFPSGLPDRSGNSPADA
A0A3M3F6F5      PLPAARVSLRTDLRAALALHRRLAPSFSVRSNRINDRHEPSFPEFPSGLPDRSGNSPADA
A0A3M3P9B7      PLPAARVSLRTDLRAALALHRRLAPSFSVRSNRINDRHEPSFPEFPSGLPDRSGNSPADA
A0A0N8QB74      PLPAARVSLRTDLRAALALHRRLAPSFSVRSNRINDRHEPSFPEFPSGLPDRSGNSPADA
A0A0Q0AUD0      PLPAARVSLRTDLRAALALHRRLAPSFSVRSNRINDRHEPSFPEFPSGLPDRSGNSPADA
A0A3M5VR55      PLPAARVSLRTDLRAALALHRRLAPSFSVRSNRINDRHEPSFPEFPSGLPDRSGNSPADA
A0A0Q0FK97      PLPAARVSLRADLRAALALHRRLASPFSVRSNRINDRHEPSFPEFPSGLPDRSGNSPADA
A0A3M5KZ75      ------------------------------------------------------------
A0A3M5L3G5      ------------------------------------------------------------
A0A1V6FYJ1      ------------------------------------------------------------
A0A445MZQ4      ------------------------------------------------------------
A0A0M9E0E3      ------------------------------------------------------------
A0A0Q6QV61      ------------------------------------------------------------
A0A2Z3IKG4      ------------------------------------------------------------
A0A4Q3IRI1      ------------------------------------------------------------
A0A2W4RFS2      ------------------------------------------------------------
A0A1Y6DC43      ------------------------------------------------------------
A0A2S6HE06      ------------------------------------------------------------
G3J0M3          ------------------------------------------------------------
V5C6R5          ------------------------------------------------------------
A0A354EF47      ------------------------------------------------------------
A0A2G6MSP7      ------------------------------------------------------------
A0A1V4M8I1      ------------------------------------------------------------
A0A4Z0M4C7      ------------------------------------------------------------
A0A4U8YMP3      ------------------------------------------------------------
A0A1Q8QQ99      ------------------------------------------------------------
A0A3D5ZY44      ------------------------------------------------------------
A0A646J2A6      ------------------------------------------------------------
A0A1G5C236      ------------------------------------------------------------
A0A5Q2QDL1      ------------------------------------------------------------
A0A656PSQ6      ------------------------------------------------------------
A0A1I3XJ27      ------------------------------------------------------------
A0A1I7DCG1      ------------------------------------------------------------
A0A3A3H6D9      ------------------------------------------------------------
A0A562CGU2      ------------------------------------------------------------
A0A0Q6VA36      ------------------------------------------------------------
A0A1B2EQN1      ------------------------------------------------------------
A0A1E7HSL6      ------------------------------------------------------------
W9VVY5          ------------------------------------------------------------
A0A1E2URD3      ------------------------------------------------------------
A0A2T6MY81      ------------------------------------------------------------
A0A2T6NBQ8      ------------------------------------------------------------
A0A421K431      ------------------------------------------------------------
A0A2G2I5M1      ------------------------------------------------------------
A0A2G2M6F0      ------------------------------------------------------------
A0A1W9J9F8      ------------------------------------------------------------
A0A2S5LFJ9      ------------------------------------------------------------
A0A2D8R8F8      ------------------------------------------------------------
A0A010SNS0      ------------------------------------------------------------
A0A0C2I782      ------------------------------------------------------------
A0A2N8BYF5      ------------------------------------------------------------
A0A558FKX2      ------------------------------------------------------------
A0A1H1DBA0      ------------------------------------------------------------
J2TAD5          ------------------------------------------------------------
J3H699          ------------------------------------------------------------
A0A1H5J974      ------------------------------------------------------------
A0A0K1QRZ4      ------------------------------------------------------------
A0A560RJW9      ------------------------------------------------------------
A0A5E6TID7      ------------------------------------------------------------
A0A5E7CRU7      ------------------------------------------------------------
A0A5E7C564      ------------------------------------------------------------
A0A2W7MAV4      ------------------------------------------------------------
A0A4R3WQH5      ------------------------------------------------------------
W6VFG3          ------------------------------------------------------------
A0A1P8ENT1      ------------------------------------------------------------
A0A2N7XRV4      ------------------------------------------------------------
A0A0Q6QPG8      ------------------------------------------------------------
A0A0F4SWA7      ------------------------------------------------------------
A0A423J219      ------------------------------------------------------------
A0A4P6G9U8      ------------------------------------------------------------
A0A4Y8JE06      ------------------------------------------------------------
A0A502I1X9      ------------------------------------------------------------
A0A502J776      ------------------------------------------------------------
A0A5B0EZF6      ------------------------------------------------------------
A0A059L434      ------------------------------------------------------------
A0A0F4UWN2      ------------------------------------------------------------
A0A5E7WEF5      ------------------------------------------------------------
A0A1G0KSD0      ------------------------------------------------------------
A0A4P6WX84      ------------------------------------------------------------
A0A1D2S760      ------------------------------------------------------------
A0A5B8RW94      ------------------------------------------------------------
A0A258TN88      ------------------------------------------------------------
A0A4Q3ZDI7      ------------------------------------------------------------
A0A537PRC6      ------------------------------------------------------------
A0A2M7JX59      ------------------------------------------------------------
A0A3A4XVN3      ------------------------------------------------------------
A0A1E7JEV6      ------------------------------------------------------------
A0A2N2KDY5      ------------------------------------------------------------
A0A3N5YUD9      ------------------------------------------------------------
A0A0W1DLQ3      ------------------------------------------------------------
A0A246JVD8      ------------------------------------------------------------
A0A2N3BB54      ------------------------------------------------------------
A0A1H6G7A3      ------------------------------------------------------------
A0A0A7PGL6      ------------------------------------------------------------
A0A4Q2Z4L0      ------------------------------------------------------------
A0A5C4N0H6      ------------------------------------------------------------
A0A4R1HDF2      ------------------------------------------------------------
A0A1E7HFN0      ------------------------------------------------------------
A0A1M5GH86      ------------------------------------------------------------
A0A1W1XQZ5      ------------------------------------------------------------
A0A3D6C3I2      ------------------------------------------------------------
S0G1D4          ------------------------------------------------------------
A0A661T246      ------------------------------------------------------------
A0A2G6CSG7      ------------------------------------------------------------
A0A2G6NB59      ------------------------------------------------------------
A0A5K8A7T9      ------------------------------------------------------------
A0A1W9U045      ------------------------------------------------------------
A0A1F9L9G4      ------------------------------------------------------------
A0A328FD76      ------------------------------------------------------------
A0A348UX90      ------------------------------------------------------------
A0A357Z0N5      ------------------------------------------------------------
A0A0F2R2U0      ------------------------------------------------------------
A0A5K7ZK00      ------------------------------------------------------------
A0A5K7YCX8      ------------------------------------------------------------
A0A5K7Z388      ------------------------------------------------------------
A0A352B502      ------------------------------------------------------------
A0A2K8WHP8      ------------------------------------------------------------
A0A410V446      ------------------------------------------------------------
A0A0R3KGJ5      ------------------------------------------------------------
A0A0R3N604      ------------------------------------------------------------
A0A1B1UCM8      ------------------------------------------------------------
A0A1N6JQ20      ------------------------------------------------------------
A0A1M5TI07      ------------------------------------------------------------
A3X191          ------------------------------------------------------------
A0A1H4RKV5      ------------------------------------------------------------
A0A160UA87      ------------------------------------------------------------
A0A1Q5SFV5      ------------------------------------------------------------
A0A1J5N774      ------------------------------------------------------------
A0A2C8F781      ------------------------------------------------------------
A0A2E3R6G0      ------------------------------------------------------------
A0A1F8XMK2      ------------------------------------------------------------
A0A3M8EMP2      ------------------------------------------------------------
A0A2J6J6K6      ------------------------------------------------------------
A0A1G6EKK9      ------------------------------------------------------------
S7TK97          ------------------------------------------------------------
S7UE93          ------------------------------------------------------------
A0A3D5BR56      ------------------------------------------------------------
A0A2N2IB15      ------------------------------------------------------------
A0A1I3PSR2      ------------------------------------------------------------
A0A1I4GEK4      ------------------------------------------------------------
A0A0A8WSG4      ------------------------------------------------------------
A0A2T5R3J5      ------------------------------------------------------------
A0A661PSB9      ------------------------------------------------------------
A0A661QBT6      ------------------------------------------------------------
A0A1W7QPT7      ------------------------------------------------------------
A0A1L3GKM9      ------------------------------------------------------------
A0A0M4D373      ------------------------------------------------------------
A0A5J4MX76      ------------------------------------------------------------
A0A430DNP0      ------------------------------------------------------------
A0A3A0FQ32      ------------------------------------------------------------
A0A1E4UZA0      ------------------------------------------------------------
A0A1H9KL56      ------------------------------------------------------------
A0A1A9KEF8      ------------------------------------------------------------
A0A5E6PKN5      ------------------------------------------------------------
A0A0N9W1V6      ------------------------------------------------------------
A0A423GQ41      ------------------------------------------------------------
A0A423H7J2      ------------------------------------------------------------
A0A502HNM8      ------------------------------------------------------------
A0A4Q7H223      ------------------------------------------------------------
A0A1H4N2K9      ------------------------------------------------------------
A0A2K4KWF7      ------------------------------------------------------------
A0A3E0WXH2      ------------------------------------------------------------
A0A2N2TRC8      ------------------------------------------------------------
A0A1V4CIZ7      ------------------------------------------------------------
A0A1M3BXA5      ------------------------------------------------------------
A0A1Y2R3U6      ------------------------------------------------------------
A0A167HVD6      ------------------------------------------------------------
A0A1V3SCT6      ------------------------------------------------------------
L0H287          ------------------------------------------------------------
A0A495VG93      ------------------------------------------------------------
A0A4R3MYM4      ------------------------------------------------------------
G2E3C0          ------------------------------------------------------------
A0A534QGR3      ------------------------------------------------------------
A0A4U8YLL7      ------------------------------------------------------------
A0A655RNN3      ------------------------------------------------------------
A0A655R819      ------------------------------------------------------------
A0A655ZEY0      ------------------------------------------------------------
A0A0W1GMS6      ------------------------------------------------------------
A0A0Q8RMY3      ------------------------------------------------------------
A0A1A7QC21      ------------------------------------------------------------
A0A2M7WWF7      ------------------------------------------------------------
A0A351Z9A2      ------------------------------------------------------------
A0A3N5RNY4      ------------------------------------------------------------
A0A1E7H876      ------------------------------------------------------------
A0A0F2NF69      ------------------------------------------------------------
A0A1F9NFD0      ------------------------------------------------------------
A0A1M5YLH5      ------------------------------------------------------------
A0A4U1A4C7      ------------------------------------------------------------
A0A509L3P8      ------------------------------------------------------------
A0A3A4S038      ------------------------------------------------------------
A0A1F9N669      ------------------------------------------------------------
A0A1F9PFA7      ------------------------------------------------------------
A0A1H2EN09      ------------------------------------------------------------
K0NP00          ------------------------------------------------------------
A0A432HIS7      ------------------------------------------------------------
A0A127AL56      ------------------------------------------------------------
A0A1E7JCL5      ------------------------------------------------------------
A0A496YAH9      ------------------------------------------------------------
A0A1V4S7E4      ------------------------------------------------------------
A0A2N2H8D2      ------------------------------------------------------------
A0A2N2KC63      ------------------------------------------------------------
A0A3A4ZYW4      ------------------------------------------------------------
A0A1V4MCJ4      ------------------------------------------------------------
A0A661M0W4      ------------------------------------------------------------
A0A1X0YE57      ------------------------------------------------------------
A0A2K2H9Q8      ------------------------------------------------------------
A0A2N6BEI9      ------------------------------------------------------------
A0A318CT66      ------------------------------------------------------------
A0A3N5P205      ------------------------------------------------------------
A0A0D5N3E9      ------------------------------------------------------------
A0A2N2G716      ------------------------------------------------------------
A0A1F9EUS2      ------------------------------------------------------------
A0A3N9VAW3      ------------------------------------------------------------
A0A1H4B8T3      ------------------------------------------------------------
A0A1E7IQC3      ------------------------------------------------------------
A0A1M6KEN5      ------------------------------------------------------------
A0A353QLL3      ------------------------------------------------------------
A0A399I453      ------------------------------------------------------------
A0A651FBV9      ------------------------------------------------------------
A0A1G0LDK7      ------------------------------------------------------------
A0A562VHD2      ------------------------------------------------------------
A0A5C1MDH8      ------------------------------------------------------------
A0A5A9XE04      ------------------------------------------------------------
A0A643G9R1      ------------------------------------------------------------
A0A1G0M8Q7      ------------------------------------------------------------
A0A353MI14      ------------------------------------------------------------
A0A4S1CAW7      ------------------------------------------------------------
A0A534HBS8      ------------------------------------------------------------
A0A0F0T3Y9      ------------------------------------------------------------
A0A351B422      ------------------------------------------------------------
F2NEE9          ------------------------------------------------------------
B7RS54          ------------------------------------------------------------
A0A3N5FRH4      ------------------------------------------------------------
A0A1V4Y2C3      ------------------------------------------------------------
A0A2N2KTJ4      ------------------------------------------------------------
A0A2N2LQX0      ------------------------------------------------------------
A0A318D3U4      ------------------------------------------------------------
A0A401FQP5      ------------------------------------------------------------
A0A1Q6DMW3      ------------------------------------------------------------
A0A3A6P8F8      ------------------------------------------------------------
A0A2G2DSM4      ------------------------------------------------------------
A0A1F9NI02      ------------------------------------------------------------
A0A4U1ABX4      ------------------------------------------------------------
A0A351Z4H9      ------------------------------------------------------------
A0A2N2KML4      ------------------------------------------------------------
E1YJF1          ------------------------------------------------------------
A0A1J5EVZ6      ------------------------------------------------------------
A0A2G6FCC5      ------------------------------------------------------------
A0A1F9MR25      ------------------------------------------------------------
A0A2G6M7F1      ------------------------------------------------------------
A0A1I0R9R6      ------------------------------------------------------------
A0A443K010      ------------------------------------------------------------
A0A238IZI1      ------------------------------------------------------------
A0A316GHM6      ------------------------------------------------------------
A0A520ZTR8      ------------------------------------------------------------
A0A212AR83      ------------------------------------------------------------
A0A2E2P4I0      ------------------------------------------------------------
A0A2U2CM86      ------------------------------------------------------------
A0A1X7ACC1      ------------------------------------------------------------
A0A2N3BVE7      ------------------------------------------------------------
A0A2S5JE21      ------------------------------------------------------------
A0A2R8BKZ2      ------------------------------------------------------------
A0A2S8S361      ------------------------------------------------------------
A0A238KUF6      ------------------------------------------------------------
A0A095CTW3      ------------------------------------------------------------
A0A2E3UGD6      ------------------------------------------------------------
A0A2T0RFH0      ------------------------------------------------------------
A0A285D390      ------------------------------------------------------------
A0A497VHN4      ------------------------------------------------------------
A0A379GWF0      ------------------------------------------------------------
A0A536T0W8      ------------------------------------------------------------
A0A2G9XLE5      ------------------------------------------------------------
A0A3D2M6Y9      ------------------------------------------------------------
A0A3D2YAZ2      ------------------------------------------------------------
A0A350A102      ------------------------------------------------------------
A0A350L5D2      ------------------------------------------------------------
A0A1I6ENM4      ------------------------------------------------------------
A8LNM8          ------------------------------------------------------------
A0A0T5NSU3      ------------------------------------------------------------
A0A5P9I718      ------------------------------------------------------------
A0A2M8J3R9      ------------------------------------------------------------
A0A1I6X762      ------------------------------------------------------------
A0A0P1EFX8      ------------------------------------------------------------
A0A2G5KB39      ------------------------------------------------------------
A0A2N3CNV1      ------------------------------------------------------------
A0A257F1F4      ------------------------------------------------------------
A0A1G9FY29      ------------------------------------------------------------
A0A4Q3ZBK4      ------------------------------------------------------------
A0A2D5J8T8      ------------------------------------------------------------
A0A2E3P9W6      ------------------------------------------------------------
A0A2G2B1P9      ------------------------------------------------------------
A0A258GCD5      ------------------------------------------------------------
A0A2D9YR88      ------------------------------------------------------------
A0A443INY4      ------------------------------------------------------------
A0A372IH36      ------------------------------------------------------------
A0A540VW45      ------------------------------------------------------------
A0A1H9C241      ------------------------------------------------------------
A0A2E3FCR1      ------------------------------------------------------------
A0A4S3MG69      ------------------------------------------------------------
A0A1G8QZS5      ------------------------------------------------------------
A0A1V4QMH7      ------------------------------------------------------------
A0A496XZQ4      ------------------------------------------------------------
A0A1F9BJF7      ------------------------------------------------------------
F2NDF5          ------------------------------------------------------------
A0A1I3TTC3      ------------------------------------------------------------
A0A1H3IZW6      ------------------------------------------------------------
A0A0M6YG59      ------------------------------------------------------------
A0A1H7G8B0      ------------------------------------------------------------
A0A059IPK4      ------------------------------------------------------------
A0A1H2Y469      ------------------------------------------------------------
A0A497ZQU7      ------------------------------------------------------------
A0A520CSP5      ------------------------------------------------------------
A0A4Q2XLV7      ------------------------------------------------------------
A0A4Q5QYC4      ------------------------------------------------------------
A0A3B8SQ27      ------------------------------------------------------------
A0A3E0H727      ------------------------------------------------------------
A0A352Q5C1      ------------------------------------------------------------
A0A656BWB0      ------------------------------------------------------------
A0A3Y2RPN4      ------------------------------------------------------------
A0A0A0FHV8      ------------------------------------------------------------
A0A1X3IPU7      ------------------------------------------------------------
A0A0A0G0N2      ------------------------------------------------------------
A0A243TPR1      ------------------------------------------------------------
A0A2I8SDU4      ------------------------------------------------------------
A0A2I8SU55      ------------------------------------------------------------
S1EXJ6          ------------------------------------------------------------
A0A376UBS1      ------------------------------------------------------------
A0A4Q6G931      ------------------------------------------------------------
A0A4Q8R6L6      ------------------------------------------------------------
A0A2T0VBD8      ------------------------------------------------------------
A0A378APS2      ------------------------------------------------------------
A0A443VCQ6      ------------------------------------------------------------
A0A447RKQ7      ------------------------------------------------------------
W1DSK1          ------------------------------------------------------------
A0A0U2VAW2      ------------------------------------------------------------
A0A454CTF1      ------------------------------------------------------------
A0A1W9F5M9      ------------------------------------------------------------
A0A352MMI7      ------------------------------------------------------------
A0A379W6R2      ------------------------------------------------------------
A0A376RY66      ------------------------------------------------------------
A0A377K431      ------------------------------------------------------------
A0A379TA56      ------------------------------------------------------------
A0A4Z0LWV1      ------------------------------------------------------------
A0A620QD02      ------------------------------------------------------------
A0A5H3HSJ8      ------------------------------------------------------------
A0A655C5P0      ------------------------------------------------------------
A0A3C2BN18      ------------------------------------------------------------
A0A447LR75      ------------------------------------------------------------
A0A376D8L7      ------------------------------------------------------------
A0A1V2FV46      ------------------------------------------------------------
A0A376SB61      ------------------------------------------------------------
A0A3D1BYV9      ------------------------------------------------------------
A0A378G3G7      ------------------------------------------------------------
A0A2X5NHJ9      ------------------------------------------------------------
A0A2J4QEC3      ------------------------------------------------------------
A0A485ADM3      ------------------------------------------------------------
A0A4U9HGU4      ------------------------------------------------------------
A0A3S4JGG5      ------------------------------------------------------------
A0A377ZDH2      ------------------------------------------------------------
A0A3S4HTS8      ------------------------------------------------------------
A0A2N1XK22      ------------------------------------------------------------
A0A3D0KAC8      ------------------------------------------------------------
A0A3D2Y902      ------------------------------------------------------------
E1Y9C0          ------------------------------------------------------------
A0A1N6SH58      ------------------------------------------------------------
A0A4Q3AQN2      ------------------------------------------------------------
                                                                            

A0A1F9CFF0      ------------------------------------------------------------
A0A2M8B0G5      ------------------------------------------------------------
A0A363TNU9      ------------------------------------------------------------
A0A0C5VQ86      ------------------------------------------------------------
A0A1V8MBH1      ------------------------------------------------------------
A0A0R0BVC7      ------------------------------------------------------------
A0A3N5J7U8      ------------------------------------------------------------
A0A1S7S3I8      ------------------------------------------------------------
A0A519E8D7      ------------------------------------------------------------
A0A3S1NZ06      ------------------------------------------------------------
A0A3S1FD32      ------------------------------------------------------------
A0A434DUT4      ------------------------------------------------------------
A0A528D3U3      ------------------------------------------------------------
A0A3S3UPT3      ------------------------------------------------------------
A0A3S1E286      ------------------------------------------------------------
A0A531AC71      ------------------------------------------------------------
A0A436K268      ------------------------------------------------------------
A0A434IDQ0      ------------------------------------------------------------
A0A435IRM5      ------------------------------------------------------------
A0A3S2C404      ------------------------------------------------------------
A0A435F6C0      ------------------------------------------------------------
A0A435BMN6      ------------------------------------------------------------
A0A529XQ54      ------------------------------------------------------------
A0A530BJC1      ------------------------------------------------------------
Q44570          ------------------------------------------------------------
A0A655ZZQ1      ------------------------------------------------------------
A0A1S0ZAI3      ------------------------------------------------------------
A0A1W9M770      ------------------------------------------------------------
A0A1W9M7R6      ------------------------------------------------------------
A0A3C0L0A8      ------------------------------------------------------------
A0A176S762      ------------------------------------------------------------
A0A377ZC40      ------------------------------------------------------------
A0A378BPJ7      ------------------------------------------------------------
A0A2J5PAJ7      ------------------------------------------------------------
A0A377ZDN3      ------------------------------------------------------------
A0A1W9WUD9      ------------------------------------------------------------
A0A1W1ZQK0      ------------------------------------------------------------
A0A4U1ALN4      ------------------------------------------------------------
A0A4U1B1A8      ------------------------------------------------------------
A0A1M7Y300      ------------------------------------------------------------
A0A4U1A967      ------------------------------------------------------------
A0A3N5MZ53      ------------------------------------------------------------
A0A534E4H4      ------------------------------------------------------------
A0A534I2B6      ------------------------------------------------------------
A0A1C2JGD0      ------------------------------------------------------------
A0A259LQ70      ------------------------------------------------------------
A0A4V2SPR5      ------------------------------------------------------------
A0A3N5PM86      ------------------------------------------------------------
A0A2E5YSA4      ------------------------------------------------------------
A0A519ERR1      ------------------------------------------------------------
A0A4Q3Q1M2      ------------------------------------------------------------
A0A4Q3MHR1      ------------------------------------------------------------
A0A520GDZ4      ------------------------------------------------------------
A0A318DSU0      ------------------------------------------------------------
A0A538PF21      ------------------------------------------------------------
A0A1W1ZH10      ------------------------------------------------------------
A0A1W2FF24      ------------------------------------------------------------
A0A524JYQ6      ------------------------------------------------------------
A0A4Q3MA17      ------------------------------------------------------------
A0A0N0M5F7      ------------------------------------------------------------
A0A537M754      ------------------------------------------------------------
A0A1V1PDB4      ------------------------------------------------------------
A0A2M7C324      ------------------------------------------------------------
A0A4Q3HHG6      ------------------------------------------------------------
A0A3B7DTA4      ------------------------------------------------------------
A0A432ZK62      ------------------------------------------------------------
A0A1V5EEP4      ------------------------------------------------------------
A0A1V5EF48      ------------------------------------------------------------
A0A0S6X1X6      ------------------------------------------------------------
A0A537Y5L8      ------------------------------------------------------------
A0A4Q3L2X2      ------------------------------------------------------------
A0A4Q3T8J1      ------------------------------------------------------------
A0A4Q4ANM4      ------------------------------------------------------------
A0A4Q3UEC7      ------------------------------------------------------------
A0A1H5YYQ4      ------------------------------------------------------------
A0A1X4NLK2      ------------------------------------------------------------
A0A1X4NWB5      ------------------------------------------------------------
A0A1M5UQ38      ------------------------------------------------------------
A0A327YI48      ------------------------------------------------------------
A0A1B1PNL6      ------------------------------------------------------------
A0A2U8H9H9      ------------------------------------------------------------
A0A1X6YIC0      ------------------------------------------------------------
A0A1I5E9E9      ------------------------------------------------------------
A0A1X6Z7N7      ------------------------------------------------------------
A0A2E1DQ13      ------------------------------------------------------------
A0A1H8C800      ------------------------------------------------------------
A0A2N3EZ05      ------------------------------------------------------------
A0A1W9PMU6      ------------------------------------------------------------
A0A1G3VVY5      ------------------------------------------------------------
A0A2N6BZD5      ------------------------------------------------------------
A0A435NNF5      ------------------------------------------------------------
A0A3S2AQS7      ------------------------------------------------------------
A0A436XH86      ------------------------------------------------------------
A0A527ZPD6      ------------------------------------------------------------
A0A529KRW3      ------------------------------------------------------------
A0A530ZLX0      ------------------------------------------------------------
A0A355TB56      ------------------------------------------------------------
A0A524M660      ------------------------------------------------------------
A0A0C1TRU6      ------------------------------------------------------------
A0A2Z5SSF4      ------------------------------------------------------------
A0A327LYE6      ------------------------------------------------------------
A0A5A9ZTV3      ------------------------------------------------------------
A0A4Q4CIB1      ------------------------------------------------------------
A0A522ACJ9      ------------------------------------------------------------
A0A3N5Z7F8      ------------------------------------------------------------
A0A239HD34      ------------------------------------------------------------
A0A534V9L7      ------------------------------------------------------------
A0A0P7ZZE4      ------------------------------------------------------------
A0A369R0Q9      ------------------------------------------------------------
A5G4N9          ------------------------------------------------------------
A0A238LBD3      ------------------------------------------------------------
A0A0P1FRV5      ------------------------------------------------------------
A0A0P1FWI8      ------------------------------------------------------------
A0A1M7BLL7      ------------------------------------------------------------
A0A0H4KZM1      ------------------------------------------------------------
A0A1V1UJT2      ------------------------------------------------------------
A0A0L6CVX1      ------------------------------------------------------------
A0A1V0RR48      ------------------------------------------------------------
A0A0A0HJJ4      ------------------------------------------------------------
A0A5E7YA28      ------------------------------------------------------------
A0A348SRI7      ------------------------------------------------------------
A0A354EI73      ------------------------------------------------------------
A0A4P7EP83      ------------------------------------------------------------
A0A3A4NIE9      ------------------------------------------------------------
A0A3A4NUI9      ------------------------------------------------------------
A0A524I3Z6      ------------------------------------------------------------
A0A524PCL7      ------------------------------------------------------------
A0A356GQV1      ------------------------------------------------------------
A0A1J5DAY8      ------------------------------------------------------------
A0A524P237      ------------------------------------------------------------
A0A1G3JY11      ------------------------------------------------------------
A0A661N3U1      ------------------------------------------------------------
A0A3S1WTQ1      ------------------------------------------------------------
A0A440NX85      ------------------------------------------------------------
A0A530CUR9      ------------------------------------------------------------
A0A1M6N1X5      ------------------------------------------------------------
A0A561M3U0      ------------------------------------------------------------
A0A2W5J775      ------------------------------------------------------------
A0A1F9E324      ------------------------------------------------------------
A0A432SAI6      ------------------------------------------------------------
A0A4Q3LBH4      ------------------------------------------------------------
A0A4Q3LWP3      ------------------------------------------------------------
A0A2N6VGL1      ------------------------------------------------------------
A0A3M3H5V6      ------------------------------------------------------------
A0A2T4ZJZ6      ------------------------------------------------------------
A0A1T2KYM8      -----------------------------------------------QSRLVATGDYAPS
A0A2G9ZR82      ------------------------------------------------------------
A0A4U9I390      ------------------------------------------------------------
A0A534XP85      ------------------------------------------------------------
A0A2X3M011      ------------------------------------------------------------
I2WC85          ------------------------------------------------------------
A0A400JH80      ------------------------------------------------------------
A0A2H9EHM4      ------------------------------------------------------------
A0A380B3D7      ------------------------------------------------------------
F5NSX0          ------------------------------------------------------------
D8EEU7          ------------------------------------------------------------
A0A479JNB1      ------------------------------------------------------------
A0A5C9AF52      ------------------------------------------------------------
A0A0P1H2H0      ------------------------------------------------------------
A0A258WKV0      ------------------------------------------------------------
A0A377N8F8      ------------------------------------------------------------
A0A3C2DSE7      ------------------------------------------------------------
A0A2X1JBG5      ------------------------------------------------------------
A0A0B8PTA8      ------------------------------------------------------------
A0A0B8QF75      ------------------------------------------------------------
A0A4Q3LR91      ------------------------------------------------------------
A0A4V1TR68      ------------------------------------------------------------
A0A444IY46      ------------------------------------------------------------
A0A660AID0      ------------------------------------------------------------
A0A3E0WKI3      ------------------------------------------------------------
A0A1H3I2J1      ------------------------------MGER--------------------------
A0A1V5DJV0      ------------------------------------------------------------
A0A520IUC4      ------------------------------------------------------------
A0A521LJG5      ------------------------------------------------------------
A0A531IBQ7      ------------------------------------------------------------
A0A377LY04      ---------------------MKIKIKSAKFSTALPATTLSRTSNASRLKRRKAWPSSPD
A0A5C9ABR5      ------------------------------------------------------------
A0A5J9WU72      ------------------------------------------------------------
A0A2X3K9R3      ------------------------------------------------------------
A0A3T9EHW9      ------------------------------------------------------------
A0A484X141      ------------------------------------------------------------
A0A5N9VWI6      -------------------------------------------IERKSAEASKSLAFLAK
A0A3D3PV27      ------------------------------------------------------------
A0A376LLF8      ------------------------------------------------------------
A0A444R390      ------------------------------------------------------------
A0A1V4WHZ7      ------------------------------------------------------------
A0A1E5AJN5      PIVRIAFVHNERSYPHVVVNQIARSFIELSVDQK-------------AESANKIRLLLQG
A0A2N3D2J1      -----------------------TAYANARSKRL--------------------------
A0A2N2GVE1      RLVNISAVSTMPLMAKKVADAITEAFIDDNLERR-------------LSSTKSASTWLES
A0A2N2INV3      RLVNISAVSTNPLMAKKVADAVTEAFIDDNLERR-------------LSSTKSASTWLES
A0A1Y5DXG5      GIVNLSFQHESPEYSQMVLNEITEIYVRRNVDRN-------------SAEAKKSLDFLAV
A0A0B8P2H5      GILSFGFEGENKAQIIDLLNDIANNYFLQNVDRN-------------AAEAENSLEFLQE
A0A483QWI8      GLLVLSLTGDDPKAFEKILNTISNYYLAQNIARQ-------------AAQDAKSLDFLNE
A0A483UXD3      GMLVLSLTGDDPKALEKILNTISNNYLAQNIARQ-------------AAQDAKSLDFLNE
A0A0A8J8L3      ---------DNPILISNILDNISQNYLSQNVARQ-------------AAQDAKSLEFLNQ
A0A660DJ38      -MLGLTLTGTDPNLISKTLNSIANNYLEQNVERQ-------------AAQDAKSLDFLNQ
A0A380AQW6      ------------------------------------------------------------
A0A2G2GD62      SNIFVRFDDTVALRAKDIVDGITTAYIQDSVDQK-------------KSSTERSLAFIDK
A0A524P331      NVIQITCSDTDPVLASAMVNTLVQAYLGQTLSFR-------------TEEASNTVKFVEE
A0A4V1SSM5      ------------------------------------------------------------
A0A4Q3K8G7      ------------------------------------------------------------
A0A1M7HC79      ---------------------MAETFLTQNVERQ-------------SAEAQQSLEFLQE
A0A1D3JZN6      ---------------MRTLNEISSLYVRQNVDRT-------------SAEAAQSLAFLND
A0A1V6ESG1      --------------------------------------------------------MINQ
A0A1H7YHK3      ----------------------MEAYGRRKVDRN-------------SAEVSSQLKFVKD
A0A534SH66      ------------------------------------------------------------
A0A3M0ZZ99      ------------------------------------------------------------
A0A328C2K5      RVGLIQVRYEDPELAARIADGISETYVEYIREFQ-------------TGGLRQLANWFDD
A0A5C6X8M3      RVGLVQVRFEDPELAANIADGISETYVEYIREFQ-------------TGGLRQLANWFDD
A0A3D8MRR7      RVGLVQVRFKDPELAASIADGISETYVEYIREFQ-------------TGGLRQLANWFDD
A0A5C6UBJ7      RVGLVQVRFKDPELAASIADGISETYVEYIREFQ-------------TGGLRQLANWFDD
A0A5C6XGM3      RVGLVQVRFEDPELAASIADGISETYVEYIREFQ-------------TGGLRQLANWFDD
A0A537NZJ1      -----------------------------------------------MTRPASVRMRMKR
A0A4Q4CVW6      ------------------------------------------------------------
A0A090R136      ------------------------------------------------------MHFLSD
A0A661JU93      ------------------------------------------------------------
A0A2E2T3V8      TVIQIGVTDDDPERAYQIVSAVAESFVWLRNNEL-------------RRGMDNQLTVIQR
A0A367UAB4      TVIQIGVTDDDPERAYQIVSAVAESFVWLRNNEL-------------RRGMDNQLTVIQR
A0A377V641      --------------------------MAQNISRQ-------------AAQDEKSLEFLNK
A0A1F2YJ88      GILGLNYQGTDKTHITQVLNAILVSYSQQNIERR-------------SAETAQTLKFLDE
A0A0J7XGZ1      YLVEITASSEDPDLAARIANALARRYIGLDSAKK-------------QARNAQSAHYVES
I4CBA7          QLINVEASANDPFAAREKLRDYLEQYIRADRERL-------------ETLANSLLAKLQN
A3VE95          YVFEIQFSAAEPGIAQQIANGIADTYIALQLENR-------------RDSAVQATAWIQE
A0A1G0NL95      GVLQLSVRADSPQAAALAANAVAGAYLQQNVSRR-------------SREAGLTLAFIAR
A0A024KA69      YLVSVRANAPSPIEAASYANAVANSFIHEEVAAK--------------------------
A0A0L1KFN4      RLVDINFTSPDALFSAQVANAWAENFIEINLERK-------------VQSTSYGRTALQR
A0A3P5DSS6      ------------------------------------------------------------
A0A483YEL5      ---------------------ISDNYLEQNIARQ-------------AAQDAKSLDFLNQ
A0A658GUJ0      GMLTISLLGSDPDLIKRVIDSISDNYLEQNIARQ-------------AAQDAKSLDFLNQ
A0A358L616      ----------DPELISQVLDRVMSNYLMQNVERK-------------SAEAQKSLEFLQH
A0A3D5UYX7      --------------------------------------------------------ELNA
A0A2N1WQN5      ------------------------------------------------------------
A0A352G2C2      GIVNVTLEDPNPEHAIRVLEEVASRYVDQNVARN-------------AAEATQSLEFLNE
A0A3C0PZN1      --------------------------------------------------------FLNE
A0A524QFS4      SMVKITVDFPDPDVAAFLANTYASVALQDMLDVN-------------KSNSKSAVEWLES
A0A520JSW4      MIVSVSFVARDPQIAAKIVNGVADAYISTNLERR-------------YQSSSYAREFLQR
A0A4Q3LTF3      --------------------ATLNASLSQATAER--------------------------
A0A537UTP9      YIISVGFRAQDAQQAAKIANAVADAYIADQLEAK-------------YQAALRAGTWMQD
A0A1D2RNR5      ------------------------------------------------------------
A0A4V1TQ46      --------------------MVTASLVQLNTAYA--------------------------
A0A3A0FZC0      SLVTVEATVSDPRLAALIANRHSESYIDWVRQNR-------------IDQQARGLTFLRA
A0A1N7JVZ7      RSVAPGETQAEPTPEPQQPAPKPQLVHNERPRRSAEQAFPPLASDEPAPHPETSREALLA
A0A091C4A8      RLVRVHFDSPDAAFSQRVVNAVAEAYIASNLERR-------------FDASSYAKTFLEE
A0A4R3H6P6      SLVDIRAVTPDPVLSQKIAKAWSENYIASNLERR-------------FDASSYARKFLEG
A0A3S1NQ09      YVIALGYQATDPALANAITKAYADAYLADQLDAS-------------FDATERAAVWLQG
A0A443GJ52      YVISIAYQATDPVLATAVTKAYADAYLADQLDAS-------------FDATERAAVWLQG
A0A2W6S588      ALFSIGYSDGDPLAAARIANVVAGAYLAVQAQQK-------------LGQGSATSNQLKG
A0A483E0N4      GMLTISLTGEDPSIIERIVESISDNYLAQNIARQ-------------AAQDAKSLEFLNK
A0A2J4YQQ6      GMLTLSLTGDNPALIERIINSITENYLAQNISRQ-------------AAQDAKSLEFLSK
A0A483THX4      GMLNVSYTGDNADLIKNIVDSITRNYLEQNISRQ-------------AAQDAKSLEFLSQ
A0A534MVS2      QIRRLSEDRENGTLALCKGDQRVEVFYREGMIEA--------------------------
A0A444I5K6      YVLDVSYTAQSPDLARDIAAAIADVYLVDKLNSK-------------YEATRRAGQWLQE
A0A154VE85      RIVAVDFTAADPDLAAAAANRTAGLYVEDRVAQR-------------AAAARRADEWLGG
A0A3S1MCW7      ------------------------------------------------------------
A0A434IGN6      ------------------------------------------------------------
A0A528AX40      SLLTISFIDQKPKYASDIANQVAQSFIDQRLDQT-------------SETSDLARQFIQE
A0A528MV95      SLLSITFADQNPKYASDIANQVAQSFIDQRLDQT-------------SETSDLARQFIQE
A0A3C1S9Y1      RLVDVTAEAKNPALAARMANEVVKVYIDQNMETK-------------LAAAKDAVRWLTE
A0A353EH49      GMLTLAFTSIHQHQVADVLNQIVNSYVDQNLERS-------------AAEARLSLEFLER
A0A1Y1Q9C1      HLVKVFYESPDPVLSADIVNALVNAFIKDNISSQ-------------SETDTYAKEFLEQ
A0A3M7LJH0      GIVELSFTGENPSQIQAILDDISQNYFLQNVQRN-------------SAEAEKSLAFLKG
A0A316KRG4      --------------------------------------------------MTEQPKFQRR
A0A1E4JHX8      RLVTITFTSPDPKLSARVANAWTANFIESNLERR-------------FEATSYARKFLEE
M2U8P2          FVITIASEGPDPEIAAAAVNSVIDIYVGGQVSEK-------------SSQRQREISILRE
A0A1H7KZF8      RAASIAFTSPDPQLSALIANSFADHLVRRDVQQR-------------ADQSRYARAFLES
A0A0J5Q9T7      ------------------------------------------------------------
A0A257NG76      GILELTMESTSQDSVLQTLNEIANIYVRQNVEQK-------------SAEAQKTLEFLEK
A0A1T4TW59      QLVRIHFDSANPELAAKVANAVGNAYIESNLEAR-------------LLATQTASTWLTE
A0A1I5YYQ0      -------------------MSADRTFRRKNRPVR--------------------------
A0A5P9FE62      -------------------MSADRTFRRKNRPVR--------------------------
A0A1Q3MB35      RLVDVKFTSPSPKLSAQVADLWVSQFQQAALDRR-------------FLSTADAREFLEG
A0A259LUN7      ------------------------------MEEK-------------YNATRKATEWLQL
A0A2D7AVL1      VTLNKELATAESERIAAYQKYIEAENSPITLDVL--------------------------
A0A3B9KZE9      ------------------------------------------------------------
A0A2U0NMP8      GMLTISLLGSDPDLIKRVIDSISDNYLEQNIARQ-------------AAQDAKSLDFLNQ
A0A4U9HNE9      GIMTFKLESEDPQRAKRVLQSITENYLQQNIDRK-------------TEEAQRMLAFLAR
A0A2G2CXY6      GIISLSMQHESPAQATRILDEVSRLYVLQNVARN-------------SAEAAQSLEFIRE
A0A3M1D4H3      ------------------------------------------------------------
A0A5C8BYM7      ------------------------------------------------LTLDEKTNVINQ
A0A1J5ICP0      ELVTISATAPNPSMAATKVNVIVSEYKSLAVLKD-------------TQNAASALAFIDE
A0A0M3GBT1      DVVQVSFTTNDPQLAAAVPNRVISIYLDERKGSV-------------RSRLDAAEKWIVQ
B3Q577          DVVQVSFTTNDPQLAAAVPNRVISIYLDERKGSV-------------RSRLDAAEKWIVQ
A0A379B9V4      GIINIAIQGKDKKHIQDIVSSIAESYLLQNVARN-------------SAEASKSLEFLNQ
A0A0Q6TS97      SLVDVRAVTPDPALSQRIAQAWGEDFIASNLERR-------------FEASGYARKFLEG
A0A0Q6UYB4      SLVDVRAVTPDPALSQRIAQAWGEDFIASNLERR-------------FEASGYARKFLEG
A0A484XS37      GVLALSLVGDDPVLVRNILNSISKNYLLQNVERK-------------SEEAAKSLDFLKD
W7Q5J0          GVLRLSMTGPDTQEIVRSLDAVADTFLTQNVERQ-------------SAQAEQSLVFLEE
A0A654AKT6      LAVAVSLLGSPSVAARVVSIAICIGYLMYTMGRRISYLHHWMGINIVFAMVQFVLYYVDK
A0A0G9MZA5      TLVDISFSSPDPQVSARIANAWADAYIAENLDRR-------------FGATRDARSSLEE
H0T8B0          YIEEITYTSRDPVLAGEVANAIAQAYIEDQLQSY-------------FETSIRTNTWLEK
A0A5C7N981      QLARVHFDSPDPQMAARIANEVAVAYTKLNLERR-------------MEATSYARTFLQE
A0A534TV22      ------------------------------------------------------------
A0A351CXR4      GVLDLGFTSPNADLSADVLNVLAETYIDHKRSSK-------------TNRVSEASEWLNA
A0A2N6GLF5      QLVRVAFEANDRQLAADVANNLANIYIVNDLEAR-------------LSMTSKASDWLTQ
A0A1W9LJP0      RLVNVRVEAKDPALAAKIANAVVQAYIDQNLETK-------------LTAAKDAVKWLID
A0A0W1ICB0      ALVDVSYSSASPQLSRLIASTWVNEFVQQSMDRR-------------LASTADARIYLEG
A0A2E0UL88      --------------------SYQQTEGIVSLDQE-------------SEGLINQLSNFEA
A0A233IKJ2      ---------------------IGNVFMDSHIEDK-------------LQVELKANSWLNN
A0A2T1JE00      --------------------------------------------------ELKANSWLNN
A0A0T2QIS1      RLVDIGYTSGSADLSATIANTWAQQFVASSLDRR-------------FSSTADARKFLEG
A0A376KYN0      ------------------------------------------------------------
A0A2X1JB05      GMLELTMTGDDPQLITRILNSIANNYLQQNIARQ-------------AAQDSQSLEFLQR
A0A376RML0      GMLELTMTGDDPQLITRILNSIANNYLQQNIARQ-------------AAQDSQSLEFLQR
A0A377E5P7      ------MTGDDPQLITRILNSIANNYLQQNIARQ-------------AAQDSQSLEFLQR
A0A0P7Y1D0      FMLTIAFTSENAAKAARIANAFADQYLLSQLEAK-------------FDATERANTWLNE
A0A2M7JRZ7      RLVKVHFDSNYPELSAKVPNTLAVTYIQQSVESR-------------FIATEQVKEWLTK
A0A167IR75      RLVDISMTSPDPAFSAEVANSWAENFITTNLERK-------------VQATSYGRDALQR
X7F6S5          ------------------------MAAGPRFRRR-------------KGRAAPAEDDL--
A0A1G7CFZ2      ----------------------MTMTERRRFRRR-----------------NRPLDDLPD
A0A1P8USW9      ----------------------MNMVDRRKFRRK-------------FGRTEAPAPETQP
A0A1I6U4V1      ------------------------MVERRKFSRR-------------KRAEELPED----
A0A1G8NKI0      ----------------------MTMSERRPFRRR-------------NRPEDTPPP----
A0A355QPE4      ----------------------MTMSERRPFRRR-------------NRPEDTPAP----
A0A357RN98      ----------------------MTMSERRPFRRR-------------NRPEDTPAP----
A0A3B8T2U6      HVVEIEFVSEDPLLAATISDTVANVYIENYLEAK-------------LEMTAKATTWLNT
A0A365PWR2      GIFVLSITDADPERAVNILAEVMKAYVAQNIERA-------------AADASSGLEFLTT
A0A2E9H5Z8      -------------------MGQSEEYILKSAEMQ-------------QFGAEERKAELEN
A0A2E2BR79      GMLRLTLTGTDREEIRRLLDAISETFLMQNVERQ-------------SAQVDQSLAFISE
A0A0Q4Q524      RLVEIRFTSPDAAFSARIVNTWSDAFIQTNLERK-------------VQATSYGRNLLQR
A0A0Q4CFJ9      RLVDIRFTSPNPEFSAKIVNTWSDAFIQTNLERK-------------VQATSYGRNLLQR
A0A0Q4FE58      RLVDIRFTSPNPEFSAKIVNTWSEAFIQTNLERK-------------VEATSYGRNLLQR
A0A0Q4JWC8      RLVDIRFTSPNPEFSAKIVNTWSEAFIQTNLERK-------------VEATSYGRNLLQR
A0A0Q4KFL8      RLVDIRFTSPNPEFSAKIVNTWSEAFIQTNLERK-------------VEATSYGRNLLQR
A0A522R8R0      ----------------RAAHGLNSTSGNLLSDQQ-------------LSDLNKQLILAQA
A0A2U9NDY5      GSSDMAREEPDPQLASRVRDESSRRDGNQNSQRS-------------AAEAAQRLDGLRA
A0A0Q4IGG1      SLVDISFDSPDPILSTQIVNAWSDSFIQTNLERK-------------VQATSYGRNMLQR
A0A534RUJ5      RLVKVAFLTPDPALSARVANAHVESYIHKGLELR-------------TQANEEAQRFLEE
A0A3M1CJM3      -----------------------------------------------------AAAWLAS
A0A2R7SVD4      GIIRLALASADAAEAVKILNKIAALYVDQNVRRT-------------SAEAAQSLAFLQS
A0A3C0PWB6      GIIYMSLEDPDPQLASRVLDEISRLYVSQNIQRS-------------SAEAAQRLDFLRS
V4Q8B7          GIIYMSLEDPDPQLANQVLDEISRLYVSQNIQRS-------------SAEAAQRLDFLRS
A0A0Q8XKK5      ALVDIKYTSGSPELAAQIANTWAQQFIEASMDRR-------------FASTADARKFLES
A0A2E0Q2W0      ------------------------------------------------------------
A0A660NIR6      QLVEIRFESPDPVLAAKIANQTAESYITADLDAR-------------FDMQQTASRWLND
A0A142W0R3      SLVDVSFSTPSATLSAKLTNLWVQQFVAANLDRR-------------FSATSDARRFLEQ
A0A0S4XR18      SIVKITFEDAIPQRGVDIVNNLVKVYFAQKLDYQ-------------REEVEKKLKFVND
A0A2E0GW64      GVVQASFTWGKPQQAQEILNAIINTTQEKDIQKK-------------SQQAAQALQFINS
A0A1A7QJ97      RLVDIRFTSPDPAFSASVANAWAENFIESNLERK-------------LQSTSYGRDALQR
A0A661LW70      SSDVENITAQKLAHLNTQVVEAESNRVEAETRYK-------------QAMALTGTPDMLD
W7Q8F9          GVLRLTMTGPDPQEIVRSLDAVADTFLTQNVERQ-------------SAQAEQSLAFLEE
A0A524PXH8      ----MKFSSPDPRQAASIADTVTREYIDLTLDQR-------------IQSVSQGRKFIAK
A0A4Q3P0E4      SVINASLQDIDAIKVTEVLNAIGAQYVRQNVERK-------------AAEAQKTLAFLDV
A0A3M2BE89      GVFLLTLEDPDADRAVAILNAIANVYLRQNVERK-------------SEEAQKALEFLQG
A0A4Q4A6K6      -------------------NNIVVSDGKLIDDQQ-------------ISELNSRLVAARA
A0A257G674      RLASVSFTSPQPELAARISNTLAAEFIQANLQRR-------------FDSSAYARDFISG
A0A661M5M6      RLVRIHARDVNPERARLIADAVADSYVQKTIEDR-------------LESTDRAKDWLER
A0A1I1UM01      KFRRRRRTQPEQEPAEDDLRPIPPLDTRQERLAR-------------REAEAEAERQREE
Q44573          QILDINVVDGNPERAAALANAVVTNYQRIALARQ-------------TADINRVATWLDN
A2W025          GVVQISLEGKDPDQTAAIANALAQSYLNQHVVAK-------------QAEATKMLDFLKG
A0A534Z362      DLVAVRFTTPSPSLSAFLAAAHTQAYLEANEEAR-------------RADDVTAKEFLGR
V4J283          GILNVGFSAGEPEQAATILNAILDNYQRRNVERK-------------GEEADKTLEFLEK
A0A536T443      ELSSILREQRDRAQANLRSAEAALTQFRVHHAVR-------------ASEGPAQGPDGRR
A0A0Q4UFQ5      RLVEISFTSPDPELSKRVVDAWSTNFIQSTLERR-------------YSATSYARNFLEE
A0A527W7E6      NVISIGYQATNPALATAITKAYADAYLADQLNAS-------------FDATERAAVWLQG
A0A432EMV7      LIAYLSYVSKDPQLSADAANAISEAFIEVGLETQ-------------LDETRQAKQWLLS
A0A087LTV7      ALASAALLVMPVSYSATALLYFDPSPRGVLEDGR-------------PGA----------
A0A534WLI3      DLVEVRFTTPSPTLSAFLAATHAEAYVDANEEAR-------------LASNLSTRDFVDR
A0A318KWA2      GMLRLTLTGPDRDEIRRSLDAVAETFLTQNVRRQ-------------SAEIEQSLAFLEE
A0A522MT86      ---------------AEVANAISQQYMLTAVAAK-------------QRNDSSTLAFINK
A0A4Q3I221      ANAIGEAYLVDKLNSKYEATRRASGWLQDRIAEL-------------RQKALDSDLAVQK
A0A534SAL6      DLVEVSFTTPSPTLSAFLAAAHTQAYIESNEEAR-------------RATDVTAKDFLGR
A0A534ZDB4      DLVEVSFTTPSPALSAFLAAAHTEAYIEANEEAR-------------RATDVTAKDFLGR
A0A534X3M7      DVVEVRFTTPDPSLSAFLAAAHTQAYLEANEEAR-------------RANDVTAQEFLGR
A0A534SPC6      DLVAVRFTTPSPSLSAFLAAAHTQAYLEANEEAR-------------RADDVTAKEFLGR
A0A535AD60      DLVAVRFTTPSPSLSAFLAAAHTQAYLEANEEAR-------------RADDVTAKEFLGR
A0A4Q3SY08      SSDPRKAALIADTFAKTYVSEQLAAKASANRQAS-------------GLL-------GER
A0A4Q3LG23      ANAWADSFIQTNLERKVQATSYGRNLLQRQLGQA-------------KERLDGSQRQLVN
A0A522EX52      RKNNIGIFDISVRHEDPALATRIANEIASVTVKK-------------NAK-------KKS
A0A1H3KC95      ------WPLHDGAEDYREAPLVLGPETRSCDRFA-------------PQE----------
A0A5P8Z4P3      PQDIAGETTEPGTAAAQLPPLEPSETPAPAQTSR-------------EALMALAEDLTAP
A0A0B3RZC9      PVRPLDETAREAARKRDAAAEQARSEAEARRIAE-------------AAD-------KAK
A0A2E9HXF7      PYAAVKAASQEAARLRVEADERARAEAETQRIAK-------------AAE-------RAK
A0A520HUH4      IETATSAVVQRLTVTQQERSYVLAIGFRARDAAK-------------AAR-------IAN
A0A2K8U7M6      AQTLAENFVNSGLERRYEASVPARAFLDERLRAA-------------QAALADAERRLAA
A0A5B9DKL8      PGESRGSAPLNDTARLESAVELIGSERTLQAVVR-------------DLGLAVGMPGATA
A0A238KJM1      ----------------------HRSPTETVSVLK-------------SKR-------ESE
A0A3A0FJZ4      STLLVESSWVRDGFIDTPVASSLRSQVQTLRHRL-------------TSDRALAGIVAAL
W4HJV8          SFDVQGTDAAEAGADTDTAFDPVRDGGRSTAKAS-------------GET-------PSN
A0A0P1GDI0      ERLARRRAEQEAEQARLAAEEAARVEAERLEQAR-------------LEE-------QAR
A0A2R8ATV5      RRRAEESRQQRVAMRQAEAEARRQAEAEARRQAE-------------EEEARQQAAAQAK
A0A1U7D3R6      ---------------------------MTAERTR-------------SES-------ASD
A0A2D4UVV2      AAPPAAAPTHRRKRRRTDAAQTPPTEAVTAERTR-------------SES-------ASD
A0A0W7WHP4      DMTPVPPLEPRARRSEDTLPETGGTSARETEEAR-------------EAE-------EAR
A0A238J8F6      QKAALEAQRREVAKR--AAAERARQQAEAEQRAR-------------EEA-------EKT
A0A238JQI6      LPESVPKNLPEIAPE--TAPEPPVPDPEAGARRT-------------AEA-------QAR
A0A222E077      PYAAVKAASQEAAHLRVEADERARAEAETQRIAK-------------AAE-------RAK
A0A239E3Y2      PYAAVKAASQEAARL--------RAEAEAQRIAK-------------AAE-------QAK
A0A1W9HS52      ----------------------------------MNDRGRTSRALAHSGFDNGDYIFINP
A0A2D5LFD8      ---MAAPIKLLVELLEKNMAPSKSPLDIEKKRDHATDQSSGNEGESLEGGASYSEFRQII
A0A0N0XAV4      ------------------------------------------------------------
A0A0P9QD19      ------------------------------------------------------------
F3FHG4          ------------------------------------------------------------
F3GGI0          ------------------------------------------------------------
A0A0P9LE74      ------------------------------------------------------------
A0A3M4ZQ14      VRSQSLDSLDRRAVLPDRAGLRDSGDALLPGQCHDPDRAQKNWHRGHARG----------
A0A3M5YLE8      VRSQSLDSLDRRAVLPDRAGLRDSGDALLPGQCHDPDRAQKNWHRGHARG----------
A0A3M3RP89      VRSQSLDSLDRRAVLPDRAGLRDSGDALLPGQCHDPDRAQKNWHRGHARG----------
A0A0P9QIY7      VRSQSLDSLDRRAVLPYRAGLRDSGDALLPGQCHDPDRAQKNRHRGHARG----------
A0A0P9VVH7      VRSQSLDSLDRRAVLPDRAGLRDSGDALLPGQCHDPDRAQKNWHRGHARG----------
A0A0Q0FJK6      VRSQSLDSLDRRAVLPDRAGLRDSGDALLPGQCHDPDRAQKNRHRGHARG----------
A0A0Q0G2J0      VRSQSLDSLDRRAVLPDRAGLRDSGDALLPGQCHDPDRAQKNWHRGHARG----------
A0A3M3LF66      VRSQSLDSLDRRAVLPDRAGLRDSGDALLPGQCHDPDRAQKNWHRGHARG----------
A0A0P9WIR8      VRSQSLDSLDRRAVLPYRAGLRDSGDALLPGQCHDPDRAQKNRHRGHARG----------
A0A3M3KPE5      ------------------------------------------------------------
A0A3M4C263      ------------------------------------------------------------
A0A3M5AD05      ------------------------------------------------------------
A0A0Q0D3D2      --------FQR-------------------------------------------------
A0A0N0FS39      ------------------------------------------------------------
A0A3M6GHH2      ------------------------------------------------------------
A0A0P9R9W0      VRPQDPDRVDRRPVFSGGSGLCHSRHAGVSGHRHDSDRAQKNRHRRHSGG----------
A0A0Q0B9T0      VRPQDPDRVDRRPVFSGGSGLCHSRHAGVSGHRHDSDRAQKNRHRRHSGG----------
A0A3M6CFI7      VRPQDPDRVDRRPVFSGGSGLCHSRHAGVSGHRHDSDRAQKNRHRRHSGG----------
A0A0P9JXN0      VRPQDPDRVDRRPVFSGGSGVCHSRHAGVSGHRHDSDRAQKNRHRRHSGG----------
A0A3M6FIV7      VRPQDPDRVDRRPVFSGGSGVCHSRHAGVSGHRHDSDRAQKNRHRRHSGG----------
A0A3M3PLW9      --------------------------------------------MPSHSR----------
A0A3M4ENY1      ------------------------------------------------------------
A0A3M5EZK7      ------------------------------------------------------------
A0A0P9SPP5      ------------------------------------------------------------
A0A658KL17      ------------------------------------------------------------
A0A3M3NNF2      ------------------------------------------------------------
A0A3M4A0E8      --------MDRQPVFSDRPGLRHSGHAGVSGHRHDSDRAPKNRHRGHPGG----------
A0A3M4PBZ2      --------MDRQPVFSDRPGLRHSGHAGVSGHRHDSDRAPKNRHRGHPGG----------
A0A3M6AI26      --------MDRQPVFSDRSGLCHSGHSGVSGHRHDPDRAPKNRHRGHPGG----------
A0A0P9IWP8      --------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGG----------
A0A0P9KZ49      --------MDRQPVFSDRSGLCHSGHSGVSGHRHDPDRAPKNRHRGHPGG----------
A0A0P9V840      --------MDRQPVFSDRSGLCHSGHSGVSGHRHDPDRAPKNRHRGHPGG----------
A0A0Q0AIE5      --------MDRQPVFSDRSGLCHSGHSGVSGHRHDPDRAPKNRHRGHPGG----------
A0A3M2ZQH6      --------MDRQPVFSDRSGLCHSGHSGVSGHRHDPDRAPKNRHRGHPGG----------
A0A0N8SQG2      --------MDRQPVFSDRSGLCHSGHSGVSGHRHDPDRAPKNRHRGHPGG----------
A0A0W8HFU1      --------MDRQPVFSDRSGLCHSGHSGVSGHRHDPDRAPKNRHRGHPGG----------
A0A3M5M873      --------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHSRG----------
A0A0P9VHH8      --------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGG----------
A0A0P9YV98      --------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGG----------
A0A3M3G2W8      --------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGG----------
A0A3M6C224      --------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGG----------
A0A3M5K254      --------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGG----------
A0A3M5JFB0      --------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGG----------
A0A3M3TQV3      --------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGG----------
A0A3M3EF92      --------MDRQPVFSDRSGLCHSGHAGVSDHRHDSDRAPKNRHRGHPGG----------
A0A3M5J1E2      --------MDRQPVFSDRSGLCHSGHAGVSGHRHDSDRAPKNRHRGHPGG----------
A0A3M5G7H9      --------MDRQPVFSDLSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGG----------
A0A3M4A376      --------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGG----------
A0A0Q0A5T8      --------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGG----------
A0A0P9SCD7      --------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGG----------
A0A0P9T4G3      --------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGG----------
A0A0P9VKB0      --------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGG----------
A0A0Q0BM35      --------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGG----------
A0A3M3TPR7      --------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGG----------
A0A3M3U4Q3      --------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGG----------
A0A0P9UCX7      --------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGG----------
A0A0P9S1F1      --------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHSRG----------
A0A0P9QCJ2      --------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGG----------
A0A0P9Q329      --------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGG----------
A0A3M5GJ64      --------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGG----------
A0A0P9MPC7      --------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGG----------
A0A3M2XYQ3      --------MDRRPVFSARPGLRHSGHAGVSGHRHDSDRTPKNRHRGYAGS----------
A0A0P9XCE1      --------MDRRPVFSARPGLRHSGHAGVSGHRHDSDRTPKNRHRGYTGS----------
A0A3M3EFX7      --------MDRRPVFSARHGLRHSGHAGVSGHRHDSDRTPKNRHRGYAGS----------
A0A3M5B9D9      --------MDCRPVFSARPGLRHSGHAGVSGHRHDSDRTPKNRHRGYAGS----------
A0A0P9RRZ3      --------MDSQPVFSDRPGLCHSGHAGLSGHRHDSDRAEKNRHRGYPRG----------
A0A3M2VEK7      --------MDRRRVFPDRPGLCHSGHTGVSGHRHDSDRASENRHRGHARS----------
A0A0N8R9B3      --------MDRRRVFSDRPGLCHSCHAGVSGHRHDSDRASENRHRGHAGS----------
A0A0P9VA27      --------MDRRRVFSDRPGLCHSCHAGVSGHRHDSDRASKNRHRGHAGS----------
A0A3M4YBJ4      --------MDRRRVFPDRPGLCHSGHTGVSGHRHDSDRASENRHRGHAGS----------
A0A0P9J470      --------MDRRRVFSDRPGLCHSCHAGVSGHRHDSDRAPENRHRGHAGG----------
A0A0Q0EVJ8      --------MDRRRVFSDRPGLCHSGHAGVSGHRHDSDRAPENRHRGHAGG----------
A0A3M5UI30      --------MDRQPVFSDRSGLCHSGHSGVSGHRHDPDRAPKNRHRGHPGG----------
A0A3M5YQT8      --------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGG----------
A0A3M5F5X1      --------MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHSRG----------
A0A3M5R8G1      ------------------------------------------------------------
A0A3M5V012      ------------------------------------------------------------
A0A3M3GA16      ------------------------------------------------------------
A0A3M3UCT3      VRSQDPDPVDRRRVFPDRPGLCHSGHTGVPGYRHDSDRASENRHRGHAGS----------
A0A3M3CJL0      VRSQDPDPVDRRRVFPDRPGLCHSGHTGVSGHRHDSDRASKNRHRGHTGS----------
A0A3M3F6F5      VRSQDPDPVDRRRVFPDRPGLCHSGHTGVSGHRHDSDRASENRHRGHAGS----------
A0A3M3P9B7      VRSQDPDPVDRRRVFPDRPGLCHSGHTGVSGHRHDSDRASENRHRGHAGS----------
A0A0N8QB74      VRSQDPDPVDRRRVFPDRPGLCHSGHTGVSGHRHDSDRASENRHRGHAGS----------
A0A0Q0AUD0      VRSQDPDPVDRRRVFPDRPGLCHSGHTGVSGHRHDSDRASENRHRGHAGS----------
A0A3M5VR55      VRSQDPDPVDRRRVFPDRPGLCHSGHTGVSGHRHDSDRASENRHRGHARS----------
A0A0Q0FK97      VRSQDPDPVDRRRVFPDRPGLCHSGHTGVSGHRHDSDRASENRHRGHAGS----------
A0A3M5KZ75      -----------------------------------------MPSHSRCRR----------
A0A3M5L3G5      ------------------------------------------------------------
A0A1V6FYJ1      ------------------------------------------------------------
A0A445MZQ4      ------------------------------------------------------------
A0A0M9E0E3      ------------------------------------------------------------
A0A0Q6QV61      ------------------------------------------------------------
A0A2Z3IKG4      ------------------------------------------------------------
A0A4Q3IRI1      ------------------------------------------------------------
A0A2W4RFS2      ------------------------------------------------------------
A0A1Y6DC43      ------------------------------------------------------------
A0A2S6HE06      ------------------------------------------------------------
G3J0M3          ------------------------------------------------------------
V5C6R5          ------------------------------------------------------------
A0A354EF47      ------------------------------------------------------------
A0A2G6MSP7      ------------------------------------------------------------
A0A1V4M8I1      ------------------------------------------------------------
A0A4Z0M4C7      ------------------------------------------------------------
A0A4U8YMP3      ------------------------------------------------------------
A0A1Q8QQ99      ------------------------------------------------------------
A0A3D5ZY44      ------------------------------------------------------------
A0A646J2A6      ------------------------------------------------------------
A0A1G5C236      ------------------------------------------------------------
A0A5Q2QDL1      ------------------------------------------------------------
A0A656PSQ6      ------------------------------------------------------------
A0A1I3XJ27      ------------------------------------------------------------
A0A1I7DCG1      ------------------------------------------------------------
A0A3A3H6D9      ------------------------------------------------------------
A0A562CGU2      ------------------------------------------------------------
A0A0Q6VA36      ------------------------------------------------------------
A0A1B2EQN1      ------------------------------------------------------------
A0A1E7HSL6      ------------------------------------------------------------
W9VVY5          ------------------------------------------------------------
A0A1E2URD3      ------------------------------------------------------------
A0A2T6MY81      ------------------------------------------------------------
A0A2T6NBQ8      ------------------------------------------------------------
A0A421K431      ------------------------------------------------------------
A0A2G2I5M1      ------------------------------------------------------------
A0A2G2M6F0      ------------------------------------------------------------
A0A1W9J9F8      ------------------------------------------------------------
A0A2S5LFJ9      ------------------------------------------------------------
A0A2D8R8F8      ------------------------------------------------------------
A0A010SNS0      ------------------------------------------------------------
A0A0C2I782      ------------------------------------------------------------
A0A2N8BYF5      ------------------------------------------------------------
A0A558FKX2      ------------------------------------------------------------
A0A1H1DBA0      ------------------------------------------------------------
J2TAD5          ------------------------------------------------------------
J3H699          ------------------------------------------------------------
A0A1H5J974      ------------------------------------------------------------
A0A0K1QRZ4      ------------------------------------------------------------
A0A560RJW9      ------------------------------------------------------------
A0A5E6TID7      ------------------------------------------------------------
A0A5E7CRU7      ------------------------------------------------------------
A0A5E7C564      ------------------------------------------------------------
A0A2W7MAV4      ------------------------------------------------------------
A0A4R3WQH5      ------------------------------------------------------------
W6VFG3          ------------------------------------------------------------
A0A1P8ENT1      ------------------------------------------------------------
A0A2N7XRV4      ------------------------------------------------------------
A0A0Q6QPG8      ------------------------------------------------------------
A0A0F4SWA7      ------------------------------------------------------------
A0A423J219      ------------------------------------------------------------
A0A4P6G9U8      ------------------------------------------------------------
A0A4Y8JE06      ------------------------------------------------------------
A0A502I1X9      ------------------------------------------------------------
A0A502J776      ------------------------------------------------------------
A0A5B0EZF6      ------------------------------------------------------------
A0A059L434      ------------------------------------------------------------
A0A0F4UWN2      ------------------------------------------------------------
A0A5E7WEF5      ------------------------------------------------------------
A0A1G0KSD0      ------------------------------------------------------------
A0A4P6WX84      ------------------------------------------------------------
A0A1D2S760      ------------------------------------------------------------
A0A5B8RW94      ------------------------------------------------------------
A0A258TN88      ------------------------------------------------------------
A0A4Q3ZDI7      ------------------------------------------------------------
A0A537PRC6      ------------------------------------------------------------
A0A2M7JX59      ------------------------------------------------------------
A0A3A4XVN3      ------------------------------------------------------------
A0A1E7JEV6      ------------------------------------------------------------
A0A2N2KDY5      ------------------------------------------------------------
A0A3N5YUD9      ------------------------------------------------------------
A0A0W1DLQ3      ------------------------------------------------------------
A0A246JVD8      ------------------------------------------------------------
A0A2N3BB54      ------------------------------------------------------------
A0A1H6G7A3      ------------------------------------------------------------
A0A0A7PGL6      ------------------------------------------------------------
A0A4Q2Z4L0      ------------------------------------------------------------
A0A5C4N0H6      ------------------------------------------------------------
A0A4R1HDF2      ------------------------------------------------------------
A0A1E7HFN0      ------------------------------------------------------------
A0A1M5GH86      ------------------------------------------------------------
A0A1W1XQZ5      ------------------------------------------------------------
A0A3D6C3I2      ------------------------------------------------------------
S0G1D4          ------------------------------------------------------------
A0A661T246      ------------------------------------------------------------
A0A2G6CSG7      ------------------------------------------------------------
A0A2G6NB59      ------------------------------------------------------------
A0A5K8A7T9      ------------------------------------------------------------
A0A1W9U045      ------------------------------------------------------------
A0A1F9L9G4      ------------------------------------------------------------
A0A328FD76      ------------------------------------------------------------
A0A348UX90      ------------------------------------------------------------
A0A357Z0N5      ------------------------------------------------------------
A0A0F2R2U0      ------------------------------------------------------------
A0A5K7ZK00      ------------------------------------------------------------
A0A5K7YCX8      ------------------------------------------------------------
A0A5K7Z388      ------------------------------------------------------------
A0A352B502      ------------------------------------------------------------
A0A2K8WHP8      ------------------------------------------------------------
A0A410V446      ------------------------------------------------------------
A0A0R3KGJ5      ------------------------------------------------------------
A0A0R3N604      ------------------------------------------------------------
A0A1B1UCM8      ------------------------------------------------------------
A0A1N6JQ20      ------------------------------------------------------------
A0A1M5TI07      ------------------------------------------------------------
A3X191          ------------------------------------------------------------
A0A1H4RKV5      ------------------------------------------------------------
A0A160UA87      ------------------------------------------------------------
A0A1Q5SFV5      ------------------------------------------------------------
A0A1J5N774      ------------------------------------------------------------
A0A2C8F781      ------------------------------------------------------------
A0A2E3R6G0      ------------------------------------------------------------
A0A1F8XMK2      ------------------------------------------------------------
A0A3M8EMP2      ------------------------------------------------------------
A0A2J6J6K6      ------------------------------------------------------------
A0A1G6EKK9      ------------------------------------------------------------
S7TK97          ------------------------------------------------------------
S7UE93          ------------------------------------------------------------
A0A3D5BR56      ------------------------------------------------------------
A0A2N2IB15      ------------------------------------------------------------
A0A1I3PSR2      ------------------------------------------------------------
A0A1I4GEK4      ------------------------------------------------------------
A0A0A8WSG4      ------------------------------------------------------------
A0A2T5R3J5      ------------------------------------------------------------
A0A661PSB9      ------------------------------------------------------------
A0A661QBT6      ------------------------------------------------------------
A0A1W7QPT7      ------------------------------------------------------------
A0A1L3GKM9      ------------------------------------------------------------
A0A0M4D373      ------------------------------------------------------------
A0A5J4MX76      ------------------------------------------------------------
A0A430DNP0      ------------------------------------------------------------
A0A3A0FQ32      ------------------------------------------------------------
A0A1E4UZA0      ------------------------------------------------------------
A0A1H9KL56      ------------------------------------------------------------
A0A1A9KEF8      ------------------------------------------------------------
A0A5E6PKN5      ------------------------------------------------------------
A0A0N9W1V6      ------------------------------------------------------------
A0A423GQ41      ------------------------------------------------------------
A0A423H7J2      ------------------------------------------------------------
A0A502HNM8      ------------------------------------------------------------
A0A4Q7H223      ------------------------------------------------------------
A0A1H4N2K9      ------------------------------------------------------------
A0A2K4KWF7      ------------------------------------------------------------
A0A3E0WXH2      ------------------------------------------------------------
A0A2N2TRC8      ------------------------------------------------------------
A0A1V4CIZ7      ------------------------------------------------------------
A0A1M3BXA5      ------------------------------------------------------------
A0A1Y2R3U6      ------------------------------------------------------------
A0A167HVD6      ------------------------------------------------------------
A0A1V3SCT6      ------------------------------------------------------------
L0H287          ------------------------------------------------------------
A0A495VG93      ------------------------------------------------------------
A0A4R3MYM4      ------------------------------------------------------------
G2E3C0          ------------------------------------------------------------
A0A534QGR3      ------------------------------------------------------------
A0A4U8YLL7      ------------------------------------------------------------
A0A655RNN3      ------------------------------------------------------------
A0A655R819      ------------------------------------------------------------
A0A655ZEY0      ------------------------------------------------------------
A0A0W1GMS6      ------------------------------------------------------------
A0A0Q8RMY3      ------------------------------------------------------------
A0A1A7QC21      ------------------------------------------------------------
A0A2M7WWF7      ------------------------------------------------------------
A0A351Z9A2      ------------------------------------------------------------
A0A3N5RNY4      ------------------------------------------------------------
A0A1E7H876      ------------------------------------------------------------
A0A0F2NF69      ------------------------------------------------------------
A0A1F9NFD0      ------------------------------------------------------------
A0A1M5YLH5      ------------------------------------------------------------
A0A4U1A4C7      ------------------------------------------------------------
A0A509L3P8      ------------------------------------------------------------
A0A3A4S038      ------------------------------------------------------------
A0A1F9N669      ------------------------------------------------------------
A0A1F9PFA7      ------------------------------------------------------------
A0A1H2EN09      ------------------------------------------------------------
K0NP00          ------------------------------------------------------------
A0A432HIS7      ------------------------------------------------------------
A0A127AL56      ------------------------------------------------------------
A0A1E7JCL5      ------------------------------------------------------------
A0A496YAH9      ------------------------------------------------------------
A0A1V4S7E4      ------------------------------------------------------------
A0A2N2H8D2      ------------------------------------------------------------
A0A2N2KC63      ------------------------------------------------------------
A0A3A4ZYW4      ------------------------------------------------------------
A0A1V4MCJ4      ------------------------------------------------------------
A0A661M0W4      ------------------------------------------------------------
A0A1X0YE57      ------------------------------------------------------------
A0A2K2H9Q8      ------------------------------------------------------------
A0A2N6BEI9      ------------------------------------------------------------
A0A318CT66      ------------------------------------------------------------
A0A3N5P205      ------------------------------------------------------------
A0A0D5N3E9      ------------------------------------------------------------
A0A2N2G716      ------------------------------------------------------------
A0A1F9EUS2      ------------------------------------------------------------
A0A3N9VAW3      ------------------------------------------------------------
A0A1H4B8T3      ------------------------------------------------------------
A0A1E7IQC3      ------------------------------------------------------------
A0A1M6KEN5      ------------------------------------------------------------
A0A353QLL3      ------------------------------------------------------------
A0A399I453      ------------------------------------------------------------
A0A651FBV9      ------------------------------------------------------------
A0A1G0LDK7      ------------------------------------------------------------
A0A562VHD2      ------------------------------------------------------------
A0A5C1MDH8      ------------------------------------------------------------
A0A5A9XE04      ------------------------------------------------------------
A0A643G9R1      ------------------------------------------------------------
A0A1G0M8Q7      ------------------------------------------------------------
A0A353MI14      ------------------------------------------------------------
A0A4S1CAW7      ------------------------------------------------------------
A0A534HBS8      ------------------------------------------------------------
A0A0F0T3Y9      ------------------------------------------------------------
A0A351B422      ------------------------------------------------------------
F2NEE9          ------------------------------------------------------------
B7RS54          ------------------------------------------------------------
A0A3N5FRH4      ------------------------------------------------------------
A0A1V4Y2C3      ------------------------------------------------------------
A0A2N2KTJ4      ------------------------------------------------------------
A0A2N2LQX0      ------------------------------------------------------------
A0A318D3U4      ------------------------------------------------------------
A0A401FQP5      ------------------------------------------------------------
A0A1Q6DMW3      ------------------------------------------------------------
A0A3A6P8F8      ------------------------------------------------------------
A0A2G2DSM4      ------------------------------------------------------------
A0A1F9NI02      ------------------------------------------------------------
A0A4U1ABX4      ------------------------------------------------------------
A0A351Z4H9      ------------------------------------------------------------
A0A2N2KML4      ------------------------------------------------------------
E1YJF1          ------------------------------------------------------------
A0A1J5EVZ6      ------------------------------------------------------------
A0A2G6FCC5      ------------------------------------------------------------
A0A1F9MR25      ------------------------------------------------------------
A0A2G6M7F1      ------------------------------------------------------------
A0A1I0R9R6      ------------------------------------------------------------
A0A443K010      ------------------------------------------------------------
A0A238IZI1      ------------------------------------------------------------
A0A316GHM6      ------------------------------------------------------------
A0A520ZTR8      ------------------------------------------------------------
A0A212AR83      ------------------------------------------------------------
A0A2E2P4I0      ------------------------------------------------------------
A0A2U2CM86      ------------------------------------------------------------
A0A1X7ACC1      ------------------------------------------------------------
A0A2N3BVE7      ------------------------------------------------------------
A0A2S5JE21      ------------------------------------------------------------
A0A2R8BKZ2      ------------------------------------------------------------
A0A2S8S361      ------------------------------------------------------------
A0A238KUF6      ------------------------------------------------------------
A0A095CTW3      ------------------------------------------------------------
A0A2E3UGD6      ------------------------------------------------------------
A0A2T0RFH0      ------------------------------------------------------------
A0A285D390      ------------------------------------------------------------
A0A497VHN4      ------------------------------------------------------------
A0A379GWF0      ------------------------------------------------------------
A0A536T0W8      ------------------------------------------------------------
A0A2G9XLE5      ------------------------------------------------------------
A0A3D2M6Y9      ------------------------------------------------------------
A0A3D2YAZ2      ------------------------------------------------------------
A0A350A102      ------------------------------------------------------------
A0A350L5D2      ------------------------------------------------------------
A0A1I6ENM4      ------------------------------------------------------------
A8LNM8          ------------------------------------------------------------
A0A0T5NSU3      ------------------------------------------------------------
A0A5P9I718      ------------------------------------------------------------
A0A2M8J3R9      ------------------------------------------------------------
A0A1I6X762      ------------------------------------------------------------
A0A0P1EFX8      ------------------------------------------------------------
A0A2G5KB39      ------------------------------------------------------------
A0A2N3CNV1      ------------------------------------------------------------
A0A257F1F4      ------------------------------------------------------------
A0A1G9FY29      ------------------------------------------------------------
A0A4Q3ZBK4      ------------------------------------------------------------
A0A2D5J8T8      ------------------------------------------------------------
A0A2E3P9W6      ------------------------------------------------------------
A0A2G2B1P9      ------------------------------------------------------------
A0A258GCD5      ------------------------------------------------------------
A0A2D9YR88      ------------------------------------------------------------
A0A443INY4      ------------------------------------------------------------
A0A372IH36      ------------------------------------------------------------
A0A540VW45      ------------------------------------------------------------
A0A1H9C241      ------------------------------------------------------------
A0A2E3FCR1      ------------------------------------------------------------
A0A4S3MG69      ------------------------------------------------------------
A0A1G8QZS5      ------------------------------------------------------------
A0A1V4QMH7      ------------------------------------------------------------
A0A496XZQ4      ------------------------------------------------------------
A0A1F9BJF7      ------------------------------------------------------------
F2NDF5          ------------------------------------------------------------
A0A1I3TTC3      ------------------------------------------------------------
A0A1H3IZW6      ------------------------------------------------------------
A0A0M6YG59      ------------------------------------------------------------
A0A1H7G8B0      ------------------------------------------------------------
A0A059IPK4      ------------------------------------------------------------
A0A1H2Y469      ------------------------------------------------------------
A0A497ZQU7      ------------------------------------------------------------
A0A520CSP5      ------------------------------------------------------------
A0A4Q2XLV7      ------------------------------------------------------------
A0A4Q5QYC4      ------------------------------------------------------------
A0A3B8SQ27      ------------------------------------------------------------
A0A3E0H727      ------------------------------------------------------------
A0A352Q5C1      ------------------------------------------------------------
A0A656BWB0      ------------------------------------------------------------
A0A3Y2RPN4      ------------------------------------------------------------
A0A0A0FHV8      ------------------------------------------------------------
A0A1X3IPU7      ------------------------------------------------------------
A0A0A0G0N2      ------------------------------------------------------------
A0A243TPR1      ------------------------------------------------------------
A0A2I8SDU4      ------------------------------------------------------------
A0A2I8SU55      ------------------------------------------------------------
S1EXJ6          ------------------------------------------------------------
A0A376UBS1      ------------------------------------------------------------
A0A4Q6G931      ------------------------------------------------------------
A0A4Q8R6L6      ------------------------------------------------------------
A0A2T0VBD8      ------------------------------------------------------------
A0A378APS2      ------------------------------------------------------------
A0A443VCQ6      ------------------------------------------------------------
A0A447RKQ7      ------------------------------------------------------------
W1DSK1          ------------------------------------------------------------
A0A0U2VAW2      ------------------------------------------------------------
A0A454CTF1      ------------------------------------------------------------
A0A1W9F5M9      ------------------------------------------------------------
A0A352MMI7      ------------------------------------------------------------
A0A379W6R2      ------------------------------------------------------------
A0A376RY66      ------------------------------------------------------------
A0A377K431      ------------------------------------------------------------
A0A379TA56      ------------------------------------------------------------
A0A4Z0LWV1      ------------------------------------------------------------
A0A620QD02      ------------------------------------------------------------
A0A5H3HSJ8      ------------------------------------------------------------
A0A655C5P0      ------------------------------------------------------------
A0A3C2BN18      ------------------------------------------------------------
A0A447LR75      ------------------------------------------------------------
A0A376D8L7      ------------------------------------------------------------
A0A1V2FV46      ------------------------------------------------------------
A0A376SB61      ------------------------------------------------------------
A0A3D1BYV9      ------------------------------------------------------------
A0A378G3G7      ------------------------------------------------------------
A0A2X5NHJ9      ------------------------------------------------------------
A0A2J4QEC3      ------------------------------------------------------------
A0A485ADM3      ------------------------------------------------------------
A0A4U9HGU4      ------------------------------------------------------------
A0A3S4JGG5      ------------------------------------------------------------
A0A377ZDH2      ------------------------------------------------------------
A0A3S4HTS8      ------------------------------------------------------------
A0A2N1XK22      ------------------------------------------------------------
A0A3D0KAC8      ------------------------------------------------------------
A0A3D2Y902      ------------------------------------------------------------
E1Y9C0          ------------------------------------------------------------
A0A1N6SH58      ------------------------------------------------------------
A0A4Q3AQN2      ------------------------------------------------------------
                                                                            

A0A1F9CFF0      ------------------------------------------------------------
A0A2M8B0G5      ------------------------------------------------------------
A0A363TNU9      ------------------------------------------------------------
A0A0C5VQ86      ------------------------------------------------------------
A0A1V8MBH1      ------------------------------------------------------------
A0A0R0BVC7      ------------------------------------------------------------
A0A3N5J7U8      ------------------------------------------------------------
A0A1S7S3I8      ------------------------------------------------------------
A0A519E8D7      ------------------------------------------------------------
A0A3S1NZ06      ------------------------------------------------------------
A0A3S1FD32      ------------------------------------------------------------
A0A434DUT4      ------------------------------------------------------------
A0A528D3U3      ------------------------------------------------------------
A0A3S3UPT3      ------------------------------------------------------------
A0A3S1E286      ------------------------------------------------------------
A0A531AC71      ------------------------------------------------------------
A0A436K268      ------------------------------------------------------------
A0A434IDQ0      ------------------------------------------------------------
A0A435IRM5      ------------------------------------------------------------
A0A3S2C404      ------------------------------------------------------------
A0A435F6C0      ------------------------------------------------------------
A0A435BMN6      ------------------------------------------------------------
A0A529XQ54      ------------------------------------------------------------
A0A530BJC1      ------------------------------------------------------------
Q44570          ------------------------------------------------------------
A0A655ZZQ1      ------------------------------------------------------------
A0A1S0ZAI3      ------------------------------------------------------------
A0A1W9M770      ------------------------------------------------------------
A0A1W9M7R6      ------------------------------------------------------------
A0A3C0L0A8      ------------------------------------------------------------
A0A176S762      ------------------------------------------------------------
A0A377ZC40      ------------------------------------------------------------
A0A378BPJ7      ------------------------------------------------------------
A0A2J5PAJ7      ------------------------------------------------------------
A0A377ZDN3      ------------------------------------------------------------
A0A1W9WUD9      ------------------------------------------------------------
A0A1W1ZQK0      ------------------------------------------------------------
A0A4U1ALN4      ------------------------------------------------------------
A0A4U1B1A8      ------------------------------------------------------------
A0A1M7Y300      ------------------------------------------------------------
A0A4U1A967      ------------------------------------------------------------
A0A3N5MZ53      ------------------------------------------------------------
A0A534E4H4      ------------------------------------------------------------
A0A534I2B6      ------------------------------------------------------------
A0A1C2JGD0      ------------------------------------------------------------
A0A259LQ70      ------------------------------------------------------------
A0A4V2SPR5      ------------------------------------------------------------
A0A3N5PM86      ------------------------------------------------------------
A0A2E5YSA4      ------------------------------------------------------------
A0A519ERR1      ------------------------------------------------------------
A0A4Q3Q1M2      ------------------------------------------------------------
A0A4Q3MHR1      ------------------------------------------------------------
A0A520GDZ4      ------------------------------------------------------------
A0A318DSU0      ------------------------------------------------------------
A0A538PF21      ------------------------------------------------------------
A0A1W1ZH10      ------------------------------------------------------------
A0A1W2FF24      ------------------------------------------------------------
A0A524JYQ6      ------------------------------------------------------------
A0A4Q3MA17      ------------------------------------------------------------
A0A0N0M5F7      ------------------------------------------------------------
A0A537M754      ------------------------------------------------------------
A0A1V1PDB4      ------------------------------------------------------------
A0A2M7C324      ------------------------------------------------------------
A0A4Q3HHG6      ------------------------------------------------------------
A0A3B7DTA4      ------------------------------------------------------------
A0A432ZK62      ------------------------------------------------------------
A0A1V5EEP4      ------------------------------------------------------------
A0A1V5EF48      ------------------------------------------------------------
A0A0S6X1X6      ------------------------------------------------------------
A0A537Y5L8      ------------------------------------------------------------
A0A4Q3L2X2      ------------------------------------------------------------
A0A4Q3T8J1      ------------------------------------------------------------
A0A4Q4ANM4      ------------------------------------------------------------
A0A4Q3UEC7      ------------------------------------------------------------
A0A1H5YYQ4      ------------------------------------------------------------
A0A1X4NLK2      ------------------------------------------------------------
A0A1X4NWB5      ------------------------------------------------------------
A0A1M5UQ38      ------------------------------------------------------------
A0A327YI48      ------------------------------------------------------------
A0A1B1PNL6      ------------------------------------------------------------
A0A2U8H9H9      ------------------------------------------------------------
A0A1X6YIC0      ------------------------------------------------------------
A0A1I5E9E9      ------------------------------------------------------------
A0A1X6Z7N7      ------------------------------------------------------------
A0A2E1DQ13      ------------------------------------------------------------
A0A1H8C800      ------------------------------------------------------------
A0A2N3EZ05      ------------------------------------------------------------
A0A1W9PMU6      ------------------------------------------------------------
A0A1G3VVY5      ------------------------------------------------------------
A0A2N6BZD5      ------------------------------------------------------------
A0A435NNF5      ------------------------------------------------------------
A0A3S2AQS7      ------------------------------------------------------------
A0A436XH86      ------------------------------------------------------------
A0A527ZPD6      ------------------------------------------------------------
A0A529KRW3      ------------------------------------------------------------
A0A530ZLX0      ------------------------------------------------------------
A0A355TB56      ------------------------------------------------------------
A0A524M660      ------------------------------------------------------------
A0A0C1TRU6      ------------------------------------------------------------
A0A2Z5SSF4      ------------------------------------------------------------
A0A327LYE6      ------------------------------------------------------------
A0A5A9ZTV3      ------------------------------------------------------------
A0A4Q4CIB1      ------------------------------------------------------------
A0A522ACJ9      ------------------------------------------------------------
A0A3N5Z7F8      ------------------------------------------------------------
A0A239HD34      ------------------------------------------------------------
A0A534V9L7      ------------------------------------------------------------
A0A0P7ZZE4      ------------------------------------------------------------
A0A369R0Q9      ------------------------------------------------------------
A5G4N9          ------------------------------------------------------------
A0A238LBD3      ------------------------------------------------------------
A0A0P1FRV5      ------------------------------------------------------------
A0A0P1FWI8      ------------------------------------------------------------
A0A1M7BLL7      ------------------------------------------------------------
A0A0H4KZM1      ------------------------------------------------------------
A0A1V1UJT2      ------------------------------------------------------------
A0A0L6CVX1      ------------------------------------------------------------
A0A1V0RR48      ------------------------------------------------------------
A0A0A0HJJ4      ------------------------------------------------------------
A0A5E7YA28      ------------------------------------------------------------
A0A348SRI7      ------------------------------------------------------------
A0A354EI73      ------------------------------------------------------------
A0A4P7EP83      ------------------------------------------------------------
A0A3A4NIE9      ------------------------------------------------------------
A0A3A4NUI9      ------------------------------------------------------------
A0A524I3Z6      ------------------------------------------------------------
A0A524PCL7      ------------------------------------------------------------
A0A356GQV1      ------------------------------------------------------------
A0A1J5DAY8      ------------------------------------------------------------
A0A524P237      ------------------------------------------------------------
A0A1G3JY11      ------------------------------------------------------------
A0A661N3U1      ------------------------------------------------------------
A0A3S1WTQ1      ------------------------------------------------------------
A0A440NX85      ------------------------------------------------------------
A0A530CUR9      ------------------------------------------------------------
A0A1M6N1X5      ------------------------------------------------------------
A0A561M3U0      --------------------------------------MLKKQLEDAEVRYTLLRNKRGS
A0A2W5J775      ------------------------------------------------------------
A0A1F9E324      -----------------------------------------MKLSEN-------------
A0A432SAI6      ------------------------------------------------------------
A0A4Q3LBH4      ------------------------------------------------------------
A0A4Q3LWP3      ------------------------------------------------------------
A0A2N6VGL1      ------------------------------------------------------------
A0A3M3H5V6      ------------------------------------------------------------
A0A2T4ZJZ6      ----------------------------------------KEQMEASIVALNEYKNQKGS
A0A1T2KYM8      ILSPWR------------------------------------------------------
A0A2G9ZR82      ------------------------------------------------------------
A0A4U9I390      ------------------------------------------------------------
A0A534XP85      ------------------------------------------------------------
A0A2X3M011      ------------------------------------------------------------
I2WC85          ------------------------------------------------------------
A0A400JH80      ------------------------------------------------------------
A0A2H9EHM4      ------------------------------------------------------------
A0A380B3D7      ------------------------------------------------------------
F5NSX0          ------------------------------------------------------------
D8EEU7          ------------------------------------------------------------
A0A479JNB1      ------------------------------------------------------------
A0A5C9AF52      ------------------------------------------------------------
A0A0P1H2H0      ------------------------------------------------------------
A0A258WKV0      -----------------------------------------GKIGLSGAARNQFITEV--
A0A377N8F8      ------------------------------------------------------------
A0A3C2DSE7      ------------------------------------------------------------
A0A2X1JBG5      ------------------------------------------------------------
A0A0B8PTA8      ------------------------------------------------------------
A0A0B8QF75      ------------------------------------------------------------
A0A4Q3LR91      --------------------------------------------MLAESRLHTGDVAKEQ
A0A4V1TR68      ---MVQ------------------------------------------------------
A0A444IY46      ------------------------------------------------------------
A0A660AID0      ------------------------------------------------------------
A0A3E0WKI3      ------------------------------------------------------------
A0A1H3I2J1      -----------------------------------------RSFSRTPRKALSREARQQL
A0A1V5DJV0      ------------------------------------------------------------
A0A520IUC4      ------------------------------------------------------------
A0A521LJG5      ------------------------------------------------------------
A0A531IBQ7      ------------------------------------------------------------
A0A377LY04      SSRKYA-----------------------------------HVWDDAENKLNAFRQDKDS
A0A5C9ABR5      ------------------------------------------------------------
A0A5J9WU72      ------------------------------------------------------------
A0A2X3K9R3      ------------------------------------------------------------
A0A3T9EHW9      ------------------------------------------------------------
A0A484X141      --------------------------------------------------MNAFRQDKDS
A0A5N9VWI6      QLPEVR-----------------------------------SRLDVAENKLNAFRQDKDS
A0A3D3PV27      ------------------------------------------------------------
A0A376LLF8      ------------------------------------------------------------
A0A444R390      ------------------------------------------------------------
A0A1V4WHZ7      ------------------------------------------------------------
A0A1E5AJN5      QADLVK-----------------------------------QQLTSAERELNDYAKSISF
A0A2N3D2J1      ------------------------------------------------EAEQRWQQARGS
A0A2N2GVE1      QLLSLR-----------------------------------KKLDEDEKRLYEFKLKNNI
A0A2N2INV3      QLLSLR-----------------------------------KKLDEDEKRLYDFKLKNNI
A0A1Y5DXG5      QLPEIK-----------------------------------KQLEVSEALFNDYQKNQKS
A0A0B8P2H5      KLPEIK-----------------------------------AELTANEDALNKYRQDNES
A0A483QWI8      QLPKVR-----------------------------------ADLDVAEDKLNQYRRQKDS
A0A483UXD3      QLPKVR-----------------------------------ADLDVAEDKLNQYRRQKDS
A0A0A8J8L3      QLPKVR-----------------------------------AELDQAEDKLNVYRKQKDS
A0A660DJ38      QLPKVR-----------------------------------ADLDIAEDKLNSYRKEKDS
A0A380AQW6      ------------------------------------------------------------
A0A2G2GD62      QLDNIN-----------------------------------KTLSKSEKVLQGFKQKNNL
A0A524P331      QLKGTR-----------------------------------EELDRAEQNLQTYKSTSGM
A0A4V1SSM5      ------------------------------------------------------------
A0A4Q3K8G7      ------------------------------------------------------------
A0A1M7HC79      QSPELR-----------------------------------AQLADAEERLNQYRVAMDS
A0A1D3JZN6      QLPQVR-----------------------------------RDLEKAESALNSFQTRSKS
A0A1V6ESG1      TFTDYS-----------------------------------AALSKAEQERVKAESQYRE
A0A1H7YHK3      QLLEVR-----------------------------------KQVEAAQAAMNAYQTKAKS
A0A534SH66      ------------------------------------------------------------
A0A3M0ZZ99      ------------------------------------------------------------
A0A328C2K5      YVSTKR-----------------------------------EELDQASSELQKYQRDNNI
A0A5C6X8M3      YVSTKR-----------------------------------EELDEARSELQKYQRDNNI
A0A3D8MRR7      YVSTKR-----------------------------------EELDESRSELQKYQRDNNI
A0A5C6UBJ7      YVSTKR-----------------------------------EELDESRSELQKYQRDNNI
A0A5C6XGM3      YVSTKR-----------------------------------EELDESRSELQKYQRDNNI
A0A537NZJ1      RCNCAS------------------------------------------------------
A0A4Q4CVW6      -----------------------------------------SQ-----------------
A0A090R136      HLPNIK-----------------------------------SQLTIAEDLLNAYRQENES
A0A661JU93      ------------------------------------------------------------
A0A2E2T3V8      QLDEAR-----------------------------------KRLETVEQRHADWEKSSGN
A0A367UAB4      QLDEAR-----------------------------------KRLETVEQRHADWEKSSGN
A0A377V641      QLPMVR-----------------------------------SDLDSAEDKLNDFRKRNDS
A0A1F2YJ88      QLPELK-----------------------------------QQLDVAEREFNKFRQQYNT
A0A0J7XGZ1      QAAALR-----------------------------------KHAVADDATLQQYMIRNNL
I4CBA7          ELRQAE-----------------------------------ERMRKSQEELVNFAREHGM
A3VE95          QVNEAR-----------------------------------ATVEAAEAALAEYRSDALT
A0A1G0NL95      QLPQVR-----------------------------------ARLETAEDALNRYRLASSS
A0A024KA69      ------------------------------------------------------------
A0A0L1KFN4      QLAEYK-----------------------------------DRLDESQRQLVTYASNQEI
A0A3P5DSS6      ----MR-----------------------------------NDLDLAEDKLNEYRRKSDS
A0A483YEL5      QLPKVR-----------------------------------TELNESEDKLNAYRRQKDS
A0A658GUJ0      QLPKVR-----------------------------------TELNESEDKLNAYRRQKDS
A0A358L616      QLPQVR-----------------------------------GKLDEAEDKLNTYRRNNES
A0A3D5UYX7      QLILAR-----------------------------------ASLAEAQAKYNRARQLRAQ
A0A2N1WQN5      ------------------------------------------------------------
A0A352G2C2      QVPAVR-----------------------------------KKLEAAQTALNKYQTGSGS
A0A3C0PZN1      QVPAVR-----------------------------------RNLEAAQTALNKYQTGSRS
A0A524QFS4      QMEVQR-----------------------------------GALNEMEQRILGFKRTHPL
A0A520JSW4      QIATTR-----------------------------------RDLERSERQLTAYAQAQRL
A0A4Q3LTF3      -----------------------------------------IQAEARYEQAGRAGASTEA
A0A537UTP9      RIKELR-----------------------------------VQATNAERAVEDFKAKNNI
A0A1D2RNR5      ------------------------------------------------------------
A0A4V1TQ46      -----------------------------------------GALGAKLAAQKGWEQAAKA
A0A3A0FZC0      QADELR-----------------------------------EKVADLERELADYAEANSI
A0A1N7JVZ7      FAEDLAFPDLTVEDDAPPARSEKPTPEAAPAAWDDTKMEGHAEADEEKPSVPPTASEPDA
A0A091C4A8      RLEQLR-----------------------------------IQLEDSESRLVEFAQRERI
A0A4R3H6P6      RIEQLR-----------------------------------EKLEVSERDVVAYAAQQGI
A0A3S1NQ09      RLTELR-----------------------------------QSSQAASLAVEKFRAEHGL
A0A443GJ52      RLTELR-----------------------------------ESSQAAALAVEKFRAEHGL
A0A2W6S588      QVEKLR-----------------------------------QQALEADAAVAAYRLKHNI
A0A483E0N4      QLPQVR-----------------------------------SDLDIAEDKLNQYRRKNDS
A0A2J4YQQ6      QLPQVR-----------------------------------SDLDQAEDKLNQYRRQSDS
A0A483THX4      QLPKVR-----------------------------------SELDFAEDKLNLYRQQNDS
A0A534MVS2      -----------------------------------------VSSNVDLHRLGHYLVKEGW
A0A444I5K6      RIEELR-----------------------------------QQALDTDLAVQKFRSEHGL
A0A154VE85      RLERLR-----------------------------------EEAAAAQQRLDAYRRETGM
A0A3S1MCW7      ------------------------------------------------------------
A0A434IGN6      ------------------------------------------------------------
A0A528AX40      QVLQVK-----------------------------------QKLQESEENLVAYAKDVGI
A0A528MV95      QVLQVK-----------------------------------QKLQKSEEDLVAYAKDVGI
A0A3C1S9Y1      RIEDER-----------------------------------KKVETAENALLQYKQEQGI
A0A353EH49      QLPPLK-----------------------------------EQLDAAENAYNKYRVQHGS
A0A1Y1Q9C1      EMEKAR-----------------------------------QRLTLQEAKLIEYAKQNNI
A0A3M7LJH0      HLPTIK-----------------------------------TELDSAEDVLNRYRQANDS
A0A316KRG4      KRRGAD-----------------------------------APVDTPDHRPSNAQKP---
A0A1E4JHX8      RLRQWR-----------------------------------ERLEESERVLVAYASDEKI
M2U8P2          RIAELK-----------------------------------TDLQDAETQVANYRARTNL
A0A1H7KZF8      ELANIR-----------------------------------TRLSESERRANDYARRAAI
A0A0J5Q9T7      ------------------------------------------------------------
A0A257NG76      QLPQLK-----------------------------------EQLEAATTALNDYRTRHGS
A0A1T4TW59      RLAVLE-----------------------------------DSLEAAEFALTDFLRQEGL
A0A1I5YYQ0      -----------------------------------------AREEDDMRPVAPLERPKDR
A0A5P9FE62      -----------------------------------------AREEDDMRPVAPLERPKDR
A0A1Q3MB35      RLAELR-----------------------------------GRLEDAQRQLVAYAADKQI
A0A259LUN7      RVSALQ-----------------------------------EEVEEKERRVETFRAETGL
A0A2D7AVL1      ------------------------------------------------------------
A0A3B9KZE9      ------------------------------------------------------------
A0A2U0NMP8      QLPKVR-----------------------------------TELNESEDKLNAYRRQKDS
A0A4U9HNE9      QLPQIR-----------------------------------ASLNQAENRLNQFRRQNDS
A0A2G2CXY6      QLPVVR-----------------------------------QELERYEQALNEYQISTQS
A0A3M1D4H3      -IQETR-----------------------------------ARLARARAFQGRESVDQVA
A0A5C8BYM7      TFVDFS-----------------------------------AALAKAEQERFKAESEYEA
A0A1J5ICP0      QIGILE-----------------------------------KSLRSSEGRLMSFKEKEKL
A0A0M3GBT1      RISEQK-----------------------------------ARADTAREAARSYQESMDV
B3Q577          RISEQK-----------------------------------ARADTAREAARSYQESMDV
A0A379B9V4      QLPDVR-----------------------------------QKLSDSENRLNEFRLKNES
A0A0Q6TS97      RIEQLR-----------------------------------EKLEMSERQVVAYAVQQGI
A0A0Q6UYB4      RIEQLR-----------------------------------EKLEMSERQVVAYAVQQGI
A0A484XS37      QLPEVR-----------------------------------SFLDSAEDKLNRFRQANDS
W7Q5J0          QTPELR-----------------------------------HQLTTAEERLNRYRAELDS
A0A654AKT6      GLAWQL-----------------------------------GPTQLAETIWGPYATRTYT
A0A0G9MZA5      QLQQYR-----------------------------------QRLEEAERAVIAYATAQGL
H0T8B0          RVAELH-----------------------------------KQVQESLQAVQDFKFQNAI
A0A5C7N981      HLAQIK-----------------------------------VKLEDSEKNLNAFMRKEGI
A0A534TV22      --MENK-----------------------------------STLSLSQVI----------
A0A351CXR4      QMTEIK-----------------------------------VDLKLAENALQDYRTEQGE
A0A2N6GLF5      RIEDLG-----------------------------------EKLKASEIALQSYREREKL
A0A1W9LJP0      QMDEER-----------------------------------KKVEISENALLNYKEMQGI
A0A0W1ICB0      RLQGLR-----------------------------------DRLEKSERDLVNYAARQGI
A0A2E0UL88      QREQAK-----------------------------------IELQAARRVMEEYESKVAS
A0A233IKJ2      RMGDLR-----------------------------------EKLKESEVQLQTFLKSEGL
A0A2T1JE00      RMGDLR-----------------------------------EKLKESEVQLQTFLKSEGL
A0A0T2QIS1      RLAELA-----------------------------------QRLEESERLAVNYAARNDI
A0A376KYN0      ------------------------------------------------------------
A0A2X1JB05      QLPEVR-----------------------------------SELDQAEEKLNVYRQQRDS
A0A376RML0      QLPEVR-----------------------------------SELDQAEEKLNVYRQQRDS
A0A377E5P7      QLPEVR-----------------------------------SELDQAEEKLNVYRQQRDS
A0A0P7Y1D0      RLETLR-----------------------------------EEVRTDEQAVEMYRAENGL
A0A2M7JRZ7      QLEDLK-----------------------------------AKVERADEALQAFGSKHDI
A0A167IR75      QLTEYK-----------------------------------ERLDESQRQLVAYASDQEI
X7F6S5          ---RPV-----------------------------------PPLASREERLARRAEDMSA
A0A1G7CFZ2      EDISPV-----------------------------------EPLATRAERLARRETKTSA
A0A1P8USW9      ED-PPI-----------------------------------EPLESRETRLARRKAETEA
A0A1I6U4V1      ---PPI-----------------------------------LPLERREERLARRR-----
A0A1G8NKI0      ---APT-----------------------------------PRPDPQAEALAKAQ----A
A0A355QPE4      ---APA-----------------------------------PRPDPQAEALAKAQAEAEA
A0A357RN98      ---APA-----------------------------------PRPDPQAEALAKAQAEAEA
A0A3B8T2U6      SLAGLK-----------------------------------NNLIKSEQALNAFYEKEKL
A0A365PWR2      ELPAMR-----------------------------------AKLEQSELALNRFQTQAGS
A0A2E9H5Z8      QIQ--------------------------------------QLLTLRDDELIDFAEGLKL
A0A2E2BR79      QAPDLR-----------------------------------TQLSSAEDKLNEYRVKMDS
A0A0Q4Q524      QLAQQK-----------------------------------ERLDESQRQLVAYASQERI
A0A0Q4CFJ9      QLAQQK-----------------------------------ERLDESQRQLVTYASQERI
A0A0Q4FE58      QLAQQK-----------------------------------ERLDESQRQLVGYASQERI
A0A0Q4JWC8      QLAQQK-----------------------------------ERLDESQRQLVGYASQERI
A0A0Q4KFL8      QLAQQK-----------------------------------ERLDESQRQLVGYASQERI
A0A522R8R0      DTANAR-----------------------------------ARYFQFKAIVDSGPDNAVR
A0A2U9NDY5      QRPQVR-----------------------------------KELEKAEAALHDYQTSAKA
A0A0Q4IGG1      QLALQK-----------------------------------SRLDDSQRQLVAYASAQQI
A0A534RUJ5      KLVELK-----------------------------------ERVEKSEAALNRYRRDKGI
A0A3M1CJM3      QAAELK-----------------------------------TRMEQAEYQLYEYKRKQHI
A0A2R7SVD4      QLPQVK-----------------------------------RDLAKASDALNAYQTHGKT
A0A3C0PWB6      QLPQVR-----------------------------------KELEKAEAALHDYQTSSKS
V4Q8B7          QLPQVR-----------------------------------KELEKAEAALNAYQTSSKS
A0A0Q8XKK5      RLADLR-----------------------------------TRLETSERDLVNYAAEKGI
A0A2E0Q2W0      -MAEQR-----------------------------------ERLEXSEAALISXANEXGI
A0A660NIR6      RLNQLR-----------------------------------TDLENAEANLQAYREEIGL
A0A142W0R3      RIGSLR-----------------------------------RNLEDSERELITYAANNDI
A0A0S4XR18      QLTITH-----------------------------------DNLSKSQLEIKDFKQSNTV
A0A2E0GW64      QLPKVK-----------------------------------TDLNHSEKQLNDYRSQSNI
A0A1A7QJ97      QLTDYK-----------------------------------QRLDESQRQLVTYASNQEI
A0A661LW70      SIPEVL------------------------------------------------------
W7Q8F9          QTPELR-----------------------------------SQLTAAEERLNSYRAELDS
A0A524PXH8      QLDVTK-----------------------------------ARLEDSEQLLQQFARGRNI
A0A4Q3P0E4      QLPQYK-----------------------------------KQLEESEEVYNRYRNQKGT
A0A3M2BE89      QLPKLK-----------------------------------AQLETSESRLNDYRLQRGS
A0A4Q4A6K6      LTSDSL-----------------------------------ARLNRFDEVINAIAPDSLS
A0A257G674      QLAEAR-----------------------------------AKLEKSERELNAYARQAGL
A0A661M5M6      QLATLR-----------------------------------QELDEAELALHNFKKGHNV
A0A1I1UM01      ARQQAE-----------------------------------EDARRQAQEDRLRAEEEAR
Q44573          RTAALRQRWLDAV----------------------------QKANTFDNVHGLTNTSEGS
A2W025          EEPRLK-----------------------------------ADLERAEAALTQYQRTSGS
A0A534Z362      QLRESR-----------------------------------DQVDRAEAALSRFAAEHPN
V4J283          QLPPLK-----------------------------------ARLEAAESAYNDYLREHGT
A0A536T443      ITADPTYASYVDLQVAI------------------------EALARDRAAITQVVARARD
A0A0Q4UFQ5      RLKQLR-----------------------------------IRIDESERALVNYASQQNI
A0A527W7E6      RLTELR-----------------------------------ESSQAASLAVEKFRAEHGL
A0A432EMV7      NLDSLR-----------------------------------EKLSQSEARLREYKDKEGL
A0A087LTV7      -----------------------------------------GDGARVDSAVDLIASEPVL
A0A534WLI3      QLRDAR-----------------------------------AQVERAEGELDHFATDHPS
A0A318KWA2      QAPELR-----------------------------------TQLRAAEDSLNEYRAAQHS
A0A522MT86      ELPRLH-----------------------------------AELDKAEQALSSFQTKAQS
A0A4Q3I221      FRSSNG---LVAAGSVLVAD---------------------QQLSELNSALIVAQSDTAK
A0A534SAL6      QLLESR-----------------------------------QQLEKAQDTLGRFAADHPN
A0A534ZDB4      QLLESR-----------------------------------QQLEKAQDALGRFAADHPN
A0A534X3M7      QLDESR-----------------------------------QQVERGEAALSRFAAEHPN
A0A534SPC6      QLRESR-----------------------------------DQVDRAEAALSRFAAEHPN
A0A535AD60      QLRESR-----------------------------------EHAERAEAALSRFAAEHPN
A0A4Q3SY08      LQELQR---QAVADAAAVQQYRIQNDLLSTSGATLTEQEISTYNQRVAEARVEAAADQAR
A0A4Q3LG23      YASAEQ---IINLPAQSNGDGRVTSERSIVA----------DDLATINSALSQAIADRIQ
A0A522EX52      LEASKS---LEFLHYQLPTVK--------------------QSLEVAEMKLNRYRAQSGK
A0A1H3KC95      ---------DPPPPSAESDDV--------------------PRPRRPRLVRKHRKAVPSA
A0A5P8Z4P3      EDDPER---EAEQETDPDTDDDAAEVQNFWGSDVDRDEANDEALDTADASTDVADSDVAE
A0A0B3RZC9      AREKAQEKLRRRAELEELARA--------------------EALRRVMAARARREAEARK
A0A2E9HXF7      FEEKA----RRKAEFEERAQT--------------------EALRRVKAAREQRAADAMK
A0A520HUH4      AVALAY---I-------------------------------DSTADFQASTATRQTETGQ
A0A2K8U7M6      YADEHR---IIDLDGQRTLLL--------------------ERLKALGRQETAAFAAQLA
A0A5B9DKL8      MEREHQ---AIRWLGERIKAQ--------------------RRGQTYLISVRASAGDPLM
A0A238KJM1      EEIQAR---LEA----------------------------------------EREAELRR
A0A3A0FJZ4      GDAPLA---ALPAAGREGALR--------------------KHLELEVVDGASPEAAVVR
W4HJV8          RESGPP---DTTSDEPDRGAL--------------------AESEAPPPASVETGVPAGR
A0A0P1GDI0      QEALAR---KAEADARAKAEAEARAAAEERARIEAEAEQRRERARRAREALARQAAEKQR
A0A2R8ATV5      ADLQRR---KAAAAARRRAEE--------------------RRAAEEQARQAAEAAEERA
A0A1U7D3R6      AQEAAR---VAA--------A--------------------RRAERAREAMAQRKAEEAR
A0A2D4UVV2      AQEAAR---VAP--------A--------------------RRAERAREAMAQRKAEEAR
A0A0W7WHP4      AAETQR---ATEEQAKRDAEA--------------------Q-----RAADAKRAADAKR
A0A238J8F6      AAEAKR---LAALEAQKMAAE--------------------EARQKAFAEERAREAERVK
A0A238JQI6      AEEKAR---RKA-EFERIARE--------------------EALRRVAAARARREAEARQ
A0A222E077      FEEKAR---RKA-EFEERAQT--------------------EALRRVKAAREQRAADAMK
A0A239E3Y2      SEEKAR---RKA-EFEERAQV--------------------EALRRVKAAREQRAADALK
A0A1W9HS52      RQVVRVLKANK------NFIIMCTLSALLLAFLHQSFLYVPIFVSESKLKVEPKSDSMSI
A0A2D5LFD8      YRRKKLIAIS-------AIAITSAITGQLI------------------------------
A0A0N0XAV4      ------------------------------------------------------------
A0A0P9QD19      ------------------------------------------------------------
F3FHG4          ------------------------------------------------------------
F3GGI0          ------------------------------------------------------------
A0A0P9LE74      ------------------------------------------------------------
A0A3M4ZQ14      -QRQADVSVP-------ELIKSRALLGKVVDDLKLNVLQTPDFF----------------
A0A3M5YLE8      -QRQADVSVP-------ELIKSRALLGKVVDDLKLNVLQTPDFF----------------
A0A3M3RP89      -QRQADVSVP-------ELIKSRALLGKVVDDLKLNVLQTPDFF----------------
A0A0P9QIY7      -QRQADVSVP-------ELIKSRALLGKVVDDLKLNVLQTPDFF----------------
A0A0P9VVH7      -QRQADVSVP-------ELIKSRALLGKVVDDLKLNVLQTPDFF----------------
A0A0Q0FJK6      -QRQADVSVP-------ELIKSRALLGKVVDDLKLNVLQTPDFF----------------
A0A0Q0G2J0      -QRQADVSVP-------ELIKSRALLGKVVDDLKLNVLQTPDFF----------------
A0A3M3LF66      -QRQADVSVP-------ELIKSRALLGKVVDDLKLNVLQTPDFF----------------
A0A0P9WIR8      -QRQADVSVP-------ELIKSRALLGKVVDDLKLNVLQTPDFF----------------
A0A3M3KPE5      ------------------MIKSRALLGKVVDDLKLNVLQTPDFF----------------
A0A3M4C263      ------------------MIKSRALLGKVVDDLKLNVLQTPDFF----------------
A0A3M5AD05      ------------------MIKSRALLGKVVDDLKLNVLQTPDFF----------------
A0A0Q0D3D2      ------------------------------------------------------------
A0A0N0FS39      ------------------------------------------------------------
A0A3M6GHH2      ------------------------------------------------------------
A0A0P9R9W0      -QRQTTLSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF----------------
A0A0Q0B9T0      -QRQTTLSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF----------------
A0A3M6CFI7      -QRQTTLSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF----------------
A0A0P9JXN0      -QRQTTLGVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF----------------
A0A3M6FIV7      -QRQTTLGVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF----------------
A0A3M3PLW9      -CRRXXTTEI-------ELIKSRALLGKVVDDLKLNRLQTPDLF----------------
A0A3M4ENY1      ------------------MIKSRALLGKVVDDLQLNRLQTPDLF----------------
A0A3M5EZK7      ------------------MIKSRALLGKVVDDLKLNRLQTPDLF----------------
A0A0P9SPP5      -----MVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF----------------
A0A658KL17      -----MVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF----------------
A0A3M3NNF2      -----MVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF----------------
A0A3M4A0E8      -QRQAIVSVT-------ELIKSRALLGKVVDDLKLSTLQTPDFF----------------
A0A3M4PBZ2      -QRQAIVSVT-------ELIKSRALLGKVVDDLKLSTLQTPDFF----------------
A0A3M6AI26      -QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF----------------
A0A0P9IWP8      -QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF----------------
A0A0P9KZ49      -QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF----------------
A0A0P9V840      -QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF----------------
A0A0Q0AIE5      -QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF----------------
A0A3M2ZQH6      -QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF----------------
A0A0N8SQG2      -QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF----------------
A0A0W8HFU1      -QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF----------------
A0A3M5M873      -QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDLF----------------
A0A0P9VHH8      -QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF----------------
A0A0P9YV98      -QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF----------------
A0A3M3G2W8      -QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF----------------
A0A3M6C224      -QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF----------------
A0A3M5K254      -QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF----------------
A0A3M5JFB0      -QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF----------------
A0A3M3TQV3      -QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF----------------
A0A3M3EF92      -QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF----------------
A0A3M5J1E2      -QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF----------------
A0A3M5G7H9      -QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF----------------
A0A3M4A376      -QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF----------------
A0A0Q0A5T8      -QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF----------------
A0A0P9SCD7      -QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF----------------
A0A0P9T4G3      -QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF----------------
A0A0P9VKB0      -QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF----------------
A0A0Q0BM35      -QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF----------------
A0A3M3TPR7      -QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF----------------
A0A3M3U4Q3      -QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF----------------
A0A0P9UCX7      -QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF----------------
A0A0P9S1F1      -QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF----------------
A0A0P9QCJ2      -QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF----------------
A0A0P9Q329      -QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF----------------
A0A3M5GJ64      -QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF----------------
A0A0P9MPC7      -QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF----------------
A0A3M2XYQ3      -QCQATLGVA-------ELIKSRALLGKVVDDLRLNRLQTPDLF----------------
A0A0P9XCE1      -QCQATLGVA-------ELIKSRALLGKVVDDLKLNRLQTPDLF----------------
A0A3M3EFX7      -QCQATLGVA-------ELIKSRALLGKVVDDLKLNRLQTPDLF----------------
A0A3M5B9D9      -QCQATLGVA-------ELIKSRALLGKVVDDLKLNRLQTPDLF----------------
A0A0P9RRZ3      -QRQATLGVA-------ELIKSRALLGKVVDDLKLSTLQTPDFF----------------
A0A3M2VEK7      -QCQATLGVA-------ELIKSRALLGKVVDDLQLNRLQTPDLF----------------
A0A0N8R9B3      -QCQATLGVA-------ELIKSRALLGKVVDDLQLNRLQTPDLF----------------
A0A0P9VA27      -QCQATLGVA-------ELIKSRALLGKVVDDLQLNRLQTPDLF----------------
A0A3M4YBJ4      -QCQATLGVA-------ELIKSRALLGKVVDDLQLNRLQTPDLF----------------
A0A0P9J470      -QCQATLGVA-------ELIKSRALLGKVVDDLQLNRLQTPDLF----------------
A0A0Q0EVJ8      -QCQATLGVA-------ELIKSRALLGKVVDDLQLNRLQTPDLF----------------
A0A3M5UI30      -QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF----------------
A0A3M5YQT8      -QRQAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF----------------
A0A3M5F5X1      -QRQAIVSVAXXXXXXXELIKSRALLGKVVDDLKLNTLQTPDLF----------------
A0A3M5R8G1      ----AIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF----------------
A0A3M5V012      ----AIVNVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF----------------
A0A3M3GA16      --RKAIVSVA-------ELIKSRALLGKVVDDLKLNTLQTPDFF----------------
A0A3M3UCT3      -QCQATLGVA-------ELIKSRALLGKVVDDLQLNRLQTPDLF----------------
A0A3M3CJL0      -QRQATLGVA-------ELIKSRALLGKVVDDLQLNRLQTPDLF----------------
A0A3M3F6F5      -QCQATLGVA-------ELIKSRALLGKVVDDLQLNRLQTPDLF----------------
A0A3M3P9B7      -QCQATLGVA-------ELIKSRALLGKVVDDLQLNRLQTPDLF----------------
A0A0N8QB74      -QCQATLGVA-------ELIKSRALLGKVVDDLQLNRLQTPDLF----------------
A0A0Q0AUD0      -QCQATLGVA-------ELIKSRALLGKVVDDLQLNRLQTPDLF----------------
A0A3M5VR55      -QCQATLGVA-------ELIKSRALLGKVVDDLQLNRLQTPDLF----------------
A0A0Q0FK97      -QCQATLGVA-------ELIKSRALLGKVVDDLQLNRLQTPDLF----------------
A0A3M5KZ75      -RPXXXTTEI-------ELIKSRALLGKVVDDLQLNRLQTPDLF----------------
A0A3M5L3G5      -----------------ELIKSRALLGKVVDDLQLNRLQTPDLF----------------
A0A1V6FYJ1      ------------------------------------------------------------
A0A445MZQ4      ------------------------------------------------------------
A0A0M9E0E3      ------------------------------------------------------------
A0A0Q6QV61      ------------------------------------------------------------
A0A2Z3IKG4      ------------------------------------------------------------
A0A4Q3IRI1      ------------------------------------------------------------
A0A2W4RFS2      ------------------------------------------------------------
A0A1Y6DC43      ------------------------------------------------------------
A0A2S6HE06      ------------------------------------------------------------
G3J0M3          ------------------------------------------------------------
V5C6R5          ------------------------------------------------------------
A0A354EF47      ------------------------------------------------------------
A0A2G6MSP7      ------------------------------------------------------------
A0A1V4M8I1      ------------------------------------------------------------
A0A4Z0M4C7      ------------------------------------------------------------
A0A4U8YMP3      ------------------------------------------------------------
A0A1Q8QQ99      ------------------------------------------------------------
A0A3D5ZY44      ------------------------------------------------------------
A0A646J2A6      ------------------------------------------------------------
A0A1G5C236      ------------------------------------------------------------
A0A5Q2QDL1      ------------------------------------------------------------
A0A656PSQ6      ------------------------------------------------------------
A0A1I3XJ27      ------------------------------------------------------------
A0A1I7DCG1      ------------------------------------------------------------
A0A3A3H6D9      ------------------------------------------------------------
A0A562CGU2      ------------------------------------------------------------
A0A0Q6VA36      ------------------------------------------------------------
A0A1B2EQN1      ------------------------------------------------------------
A0A1E7HSL6      ------------------------------------------------------------
W9VVY5          ------------------------------------------------------------
A0A1E2URD3      ------------------------------------------------------------
A0A2T6MY81      ------------------------------------------------------------
A0A2T6NBQ8      ------------------------------------------------------------
A0A421K431      ------------------------------------------------------------
A0A2G2I5M1      ------------------------------------------------------------
A0A2G2M6F0      ------------------------------------------------------------
A0A1W9J9F8      ------------------------------------------------------------
A0A2S5LFJ9      ------------------------------------------------------------
A0A2D8R8F8      ------------------------------------------------------------
A0A010SNS0      ------------------------------------------------------------
A0A0C2I782      ------------------------------------------------------------
A0A2N8BYF5      ------------------------------------------------------------
A0A558FKX2      ------------------------------------------------------------
A0A1H1DBA0      ------------------------------------------------------------
J2TAD5          ------------------------------------------------------------
J3H699          ------------------------------------------------------------
A0A1H5J974      ------------------------------------------------------------
A0A0K1QRZ4      ------------------------------------------------------------
A0A560RJW9      ------------------------------------------------------------
A0A5E6TID7      ------------------------------------------------------------
A0A5E7CRU7      ------------------------------------------------------------
A0A5E7C564      ------------------------------------------------------------
A0A2W7MAV4      ------------------------------------------------------------
A0A4R3WQH5      ------------------------------------------------------------
W6VFG3          ------------------------------------------------------------
A0A1P8ENT1      ------------------------------------------------------------
A0A2N7XRV4      ------------------------------------------------------------
A0A0Q6QPG8      ------------------------------------------------------------
A0A0F4SWA7      ------------------------------------------------------------
A0A423J219      ------------------------------------------------------------
A0A4P6G9U8      ------------------------------------------------------------
A0A4Y8JE06      ------------------------------------------------------------
A0A502I1X9      ------------------------------------------------------------
A0A502J776      ------------------------------------------------------------
A0A5B0EZF6      ------------------------------------------------------------
A0A059L434      ------------------------------------------------------------
A0A0F4UWN2      ------------------------------------------------------------
A0A5E7WEF5      ------------------------------------------------------------
A0A1G0KSD0      ------------------------------------------------------------
A0A4P6WX84      ------------------------------------------------------------
A0A1D2S760      ------------------------------------------------------------
A0A5B8RW94      ------------------------------------------------------------
A0A258TN88      ------------------------------------------------------------
A0A4Q3ZDI7      ------------------------------------------------------------
A0A537PRC6      ------------------------------------------------------------
A0A2M7JX59      ------------------------------------------------------------
A0A3A4XVN3      ------------------------------------------------------------
A0A1E7JEV6      ------------------------------------------------------------
A0A2N2KDY5      ------------------------------------------------------------
A0A3N5YUD9      ------------------------------------------------------------
A0A0W1DLQ3      ------------------------------------------------------------
A0A246JVD8      ------------------------------------------------------------
A0A2N3BB54      ------------------------------------------------------------
A0A1H6G7A3      ------------------------------------------------------------
A0A0A7PGL6      ------------------------------------------------------------
A0A4Q2Z4L0      ------------------------------------------------------------
A0A5C4N0H6      ------------------------------------------------------------
A0A4R1HDF2      ------------------------------------------------------------
A0A1E7HFN0      ------------------------------------------------------------
A0A1M5GH86      ------------------------------------------------------------
A0A1W1XQZ5      ------------------------------------------------------------
A0A3D6C3I2      ------------------------------------------------------------
S0G1D4          ------------------------------------------------------------
A0A661T246      ------------------------------------------------------------
A0A2G6CSG7      ------------------------------------------------------------
A0A2G6NB59      ------------------------------------------------------------
A0A5K8A7T9      ------------------------------------------------------------
A0A1W9U045      ------------------------------------------------------------
A0A1F9L9G4      ------------------------------------------------------------
A0A328FD76      ------------------------------------------------------------
A0A348UX90      ------------------------------------------------------------
A0A357Z0N5      ------------------------------------------------------------
A0A0F2R2U0      ------------------------------------------------------------
A0A5K7ZK00      ------------------------------------------------------------
A0A5K7YCX8      ------------------------------------------------------------
A0A5K7Z388      ------------------------------------------------------------
A0A352B502      ------------------------------------------------------------
A0A2K8WHP8      ------------------------------------------------------------
A0A410V446      ------------------------------------------------------------
A0A0R3KGJ5      ------------------------------------------------------------
A0A0R3N604      ------------------------------------------------------------
A0A1B1UCM8      ------------------------------------------------------------
A0A1N6JQ20      ------------------------------------------------------------
A0A1M5TI07      ------------------------------------------------------------
A3X191          ------------------------------------------------------------
A0A1H4RKV5      ------------------------------------------------------------
A0A160UA87      ------------------------------------------------------------
A0A1Q5SFV5      ------------------------------------------------------------
A0A1J5N774      ------------------------------------------------------------
A0A2C8F781      ------------------------------------------------------------
A0A2E3R6G0      ------------------------------------------------------------
A0A1F8XMK2      ------------------------------------------------------------
A0A3M8EMP2      ------------------------------------------------------------
A0A2J6J6K6      ------------------------------------------------------------
A0A1G6EKK9      ------------------------------------------------------------
S7TK97          ------------------------------------------------------------
S7UE93          ------------------------------------------------------------
A0A3D5BR56      ------------------------------------------------------------
A0A2N2IB15      ------------------------------------------------------------
A0A1I3PSR2      ------------------------------------------------------------
A0A1I4GEK4      ------------------------------------------------------------
A0A0A8WSG4      ------------------------------------------------------------
A0A2T5R3J5      ------------------------------------------------------------
A0A661PSB9      ------------------------------------------------------------
A0A661QBT6      ------------------------------------------------------------
A0A1W7QPT7      ------------------------------------------------------------
A0A1L3GKM9      ------------------------------------------------------------
A0A0M4D373      ------------------------------------------------------------
A0A5J4MX76      ------------------------------------------------------------
A0A430DNP0      ------------------------------------------------------------
A0A3A0FQ32      ------------------------------------------------------------
A0A1E4UZA0      ------------------------------------------------------------
A0A1H9KL56      ------------------------------------------------------------
A0A1A9KEF8      ------------------------------------------------------------
A0A5E6PKN5      ------------------------------------------------------------
A0A0N9W1V6      ------------------------------------------------------------
A0A423GQ41      ------------------------------------------------------------
A0A423H7J2      ------------------------------------------------------------
A0A502HNM8      ------------------------------------------------------------
A0A4Q7H223      ------------------------------------------------------------
A0A1H4N2K9      ------------------------------------------------------------
A0A2K4KWF7      ------------------------------------------------------------
A0A3E0WXH2      ------------------------------------------------------------
A0A2N2TRC8      ------------------------------------------------------------
A0A1V4CIZ7      ------------------------------------------------------------
A0A1M3BXA5      ------------------------------------------------------------
A0A1Y2R3U6      ------------------------------------------------------------
A0A167HVD6      ------------------------------------------------------------
A0A1V3SCT6      ------------------------------------------------------------
L0H287          ------------------------------------------------------------
A0A495VG93      ------------------------------------------------------------
A0A4R3MYM4      ------------------------------------------------------------
G2E3C0          ------------------------------------------------------------
A0A534QGR3      ------------------------------------------------------------
A0A4U8YLL7      ------------------------------------------------------------
A0A655RNN3      ------------------------------------------------------------
A0A655R819      ------------------------------------------------------------
A0A655ZEY0      ----------------------------------------------------------MK
A0A0W1GMS6      ------------------------------------------------------------
A0A0Q8RMY3      ------------------------------------------------------------
A0A1A7QC21      ------------------------------------------------------------
A0A2M7WWF7      ------------------------------------------------------------
A0A351Z9A2      ------------------------------------------------------------
A0A3N5RNY4      ------------------------------------------------------------
A0A1E7H876      ------------------------------------------------------------
A0A0F2NF69      ------------------------------------------------------------
A0A1F9NFD0      ------------------------------------------------------------
A0A1M5YLH5      ------------------------------------------------------------
A0A4U1A4C7      ------------------------------------------------------------
A0A509L3P8      ------------------------------------------------------------
A0A3A4S038      ------------------------------------------------------------
A0A1F9N669      ------------------------------------------------------------
A0A1F9PFA7      ------------------------------------------------------------
A0A1H2EN09      ------------------------------------------------------------
K0NP00          ------------------------------------------------------------
A0A432HIS7      ------------------------------------------------------------
A0A127AL56      ------------------------------------------------------------
A0A1E7JCL5      ------------------------------------------------------------
A0A496YAH9      ------------------------------------------------------------
A0A1V4S7E4      ------------------------------------------------------------
A0A2N2H8D2      ------------------------------------------------------------
A0A2N2KC63      ------------------------------------------------------------
A0A3A4ZYW4      ------------------------------------------------------------
A0A1V4MCJ4      ------------------------------------------------------------
A0A661M0W4      ------------------------------------------------------------
A0A1X0YE57      ------------------------------------------------------------
A0A2K2H9Q8      ------------------------------------------------------------
A0A2N6BEI9      ------------------------------------------------------------
A0A318CT66      ------------------------------------------------------------
A0A3N5P205      ------------------------------------------------------------
A0A0D5N3E9      ------------------------------------------------------------
A0A2N2G716      ------------------------------------------------------------
A0A1F9EUS2      ------------------------------------------------------------
A0A3N9VAW3      ------------------------------------------------------------
A0A1H4B8T3      ------------------------------------------------------------
A0A1E7IQC3      ------------------------------------------------------------
A0A1M6KEN5      ------------------------------------------------------------
A0A353QLL3      ------------------------------------------------------------
A0A399I453      ------------------------------------------------------------
A0A651FBV9      ------------------------------------------------------------
A0A1G0LDK7      ------------------------------------------------------------
A0A562VHD2      ------------------------------------------------------------
A0A5C1MDH8      ------------------------------------------------------------
A0A5A9XE04      ------------------------------------------------------------
A0A643G9R1      ------------------------------------------------------------
A0A1G0M8Q7      ------------------------------------------------------------
A0A353MI14      ------------------------------------------------------------
A0A4S1CAW7      ------------------------------------------------------------
A0A534HBS8      ------------------------------------------------------------
A0A0F0T3Y9      ------------------------------------------------------------
A0A351B422      ------------------------------------------------------------
F2NEE9          ------------------------------------------------------------
B7RS54          ------------------------------------------------------------
A0A3N5FRH4      ------------------------------------------------------------
A0A1V4Y2C3      ------------------------------------------------------------
A0A2N2KTJ4      ------------------------------------------------------------
A0A2N2LQX0      ------------------------------------------------------------
A0A318D3U4      ------------------------------------------------------------
A0A401FQP5      ------------------------------------------------------------
A0A1Q6DMW3      ------------------------------------------------------------
A0A3A6P8F8      ------------------------------------------------------------
A0A2G2DSM4      ------------------------------------------------------------
A0A1F9NI02      ------------------------------------------------------------
A0A4U1ABX4      ------------------------------------------------------------
A0A351Z4H9      ------------------------------------------------------------
A0A2N2KML4      ------------------------------------------------------------
E1YJF1          ------------------------------------------------------------
A0A1J5EVZ6      ------------------------------------------------------------
A0A2G6FCC5      ------------------------------------------------------------
A0A1F9MR25      ------------------------------------------------------------
A0A2G6M7F1      ------------------------------------------------------------
A0A1I0R9R6      ------------------------------------------------------------
A0A443K010      ------------------------------------------------------------
A0A238IZI1      ------------------------------------------------------------
A0A316GHM6      ------------------------------------------------------------
A0A520ZTR8      ------------------------------------------------------------
A0A212AR83      ------------------------------------------------------------
A0A2E2P4I0      ------------------------------------------------------------
A0A2U2CM86      ------------------------------------------------------------
A0A1X7ACC1      ------------------------------------------------------------
A0A2N3BVE7      ------------------------------------------------------------
A0A2S5JE21      ------------------------------------------------------------
A0A2R8BKZ2      ------------------------------------------------------------
A0A2S8S361      ------------------------------------------------------------
A0A238KUF6      ------------------------------------------------------------
A0A095CTW3      ------------------------------------------------------------
A0A2E3UGD6      ------------------------------------------------------------
A0A2T0RFH0      ------------------------------------------------------------
A0A285D390      ------------------------------------------------------------
A0A497VHN4      ------------------------------------------------------------
A0A379GWF0      ------------------------------------------------------------
A0A536T0W8      ------------------------------------------------------------
A0A2G9XLE5      ------------------------------------------------------------
A0A3D2M6Y9      ------------------------------------------------------------
A0A3D2YAZ2      ------------------------------------------------------------
A0A350A102      ------------------------------------------------------------
A0A350L5D2      ------------------------------------------------------------
A0A1I6ENM4      ------------------------------------------------------------
A8LNM8          ------------------------------------------------------------
A0A0T5NSU3      ------------------------------------------------------------
A0A5P9I718      ------------------------------------------------------------
A0A2M8J3R9      ------------------------------------------------------------
A0A1I6X762      ------------------------------------------------------------
A0A0P1EFX8      ------------------------------------------------------------
A0A2G5KB39      ------------------------------------------------------------
A0A2N3CNV1      ------------------------------------------------------------
A0A257F1F4      ------------------------------------------------------------
A0A1G9FY29      ------------------------------------------------------------
A0A4Q3ZBK4      ------------------------------------------------------------
A0A2D5J8T8      ------------------------------------------------------------
A0A2E3P9W6      ------------------------------------------------------------
A0A2G2B1P9      ------------------------------------------------------------
A0A258GCD5      ------------------------------------------------------------
A0A2D9YR88      ------------------------------------------------------------
A0A443INY4      ------------------------------------------------------------
A0A372IH36      ------------------------------------------------------------
A0A540VW45      ------------------------------------------------------------
A0A1H9C241      ------------------------------------------------------------
A0A2E3FCR1      ------------------------------------------------------------
A0A4S3MG69      ------------------------------------------------------------
A0A1G8QZS5      ------------------------------------------------------------
A0A1V4QMH7      ------------------------------------------------------------
A0A496XZQ4      ------------------------------------------------------------
A0A1F9BJF7      ------------------------------------------------------------
F2NDF5          ------------------------------------------------------------
A0A1I3TTC3      ------------------------------------------------------------
A0A1H3IZW6      ------------------------------------------------------------
A0A0M6YG59      ------------------------------------------------------------
A0A1H7G8B0      ------------------------------------------------------------
A0A059IPK4      ------------------------------------------------------------
A0A1H2Y469      ------------------------------------------------------------
A0A497ZQU7      ------------------------------------------------------------
A0A520CSP5      ------------------------------------------------------------
A0A4Q2XLV7      ------------------------------------------------------------
A0A4Q5QYC4      ------------------------------------------------------------
A0A3B8SQ27      ------------------------------------------------------------
A0A3E0H727      ------------------------------------------------------------
A0A352Q5C1      ------------------------------------------------------------
A0A656BWB0      ------------------------------------------------------------
A0A3Y2RPN4      ------------------------------------------------------------
A0A0A0FHV8      ------------------------------------------------------------
A0A1X3IPU7      ------------------------------------------------------------
A0A0A0G0N2      ------------------------------------------------------------
A0A243TPR1      ------------------------------------------------------------
A0A2I8SDU4      ------------------------------------------------------------
A0A2I8SU55      ------------------------------------------------------------
S1EXJ6          ------------------------------------------------------------
A0A376UBS1      ------------------------------------------------------------
A0A4Q6G931      ------------------------------------------------------------
A0A4Q8R6L6      ------------------------------------------------------------
A0A2T0VBD8      ------------------------------------------------------------
A0A378APS2      ------------------------------------------------------------
A0A443VCQ6      ------------------------------------------------------------
A0A447RKQ7      ------------------------------------------------------------
W1DSK1          ------------------------------------------------------------
A0A0U2VAW2      ------------------------------------------------------------
A0A454CTF1      ---------------------------------------------------------MMV
A0A1W9F5M9      ------------------------------------------------------------
A0A352MMI7      ------------------------------------------------------------
A0A379W6R2      ------------------------------------------------------------
A0A376RY66      ----------------------------MDVAENKLNAFRQDKDSVDLPLEAKAVLDSMV
A0A377K431      ----------------------------------------------------------MV
A0A379TA56      ------------------------------------------------------------
A0A4Z0LWV1      ----------------------------------------------------------RV
A0A620QD02      ----------------------------------KLNAFRQDKDSVDLPLEAKAVLDSMV
A0A5H3HSJ8      ------------------------------------------------------------
A0A655C5P0      ------------------------------------------------------------
A0A3C2BN18      ------------------------------------------------------------
A0A447LR75      ------------------------------------------------------------
A0A376D8L7      ------------------------------------------------------------
A0A1V2FV46      ------------------------------------------------------------
A0A376SB61      ------------------------------------------------------------
A0A3D1BYV9      ------------------------------------------------------------
A0A378G3G7      -------------------------------------------------MEAKSLLDTMV
A0A2X5NHJ9      -----------------------------------------------------------M
A0A2J4QEC3      ------------------------------------------------------------
A0A485ADM3      ------------------------------------------------------------
A0A4U9HGU4      -------------------MQLPKVRASLDGAEDKLSHYRQQKDSVDLTMEAKSILDSIV
A0A3S4JGG5      ---------------------MPEVRSSLDSAEDKLNRFRQANDSVDLSLEAKSVLDTIV
A0A377ZDH2      ------------------------------------------------------------
A0A3S4HTS8      ------------------------------------------------------------
A0A2N1XK22      ------------------------------------------------------------
A0A3D0KAC8      -----------------LNEQVPAVRRNLEAAQTALNKYQTGSRSVDITAETQSVLDRIV
A0A3D2Y902      ------------------------------------------------------------
E1Y9C0          ------------------------------------------------------------
A0A1N6SH58      ------------------------------------------------------------
A0A4Q3AQN2      ------------------------------------------------------------
                                                                            

A0A1F9CFF0      ------------------------------------------------------------
A0A2M8B0G5      ------------------------------------------------------------
A0A363TNU9      ------------------------------------------------------------
A0A0C5VQ86      ------------------------------------------------------------
A0A1V8MBH1      ------------------------------------------------------------
A0A0R0BVC7      ------------------------------------------------------------
A0A3N5J7U8      ------------------------------------------------------------
A0A1S7S3I8      ------------------------------------------------------------
A0A519E8D7      ------------------------------------------------------------
A0A3S1NZ06      --------------------------AEHGLSASSDGQLMSAKQLADLNAQLIVAQADTA
A0A3S1FD32      ------------------------------------------------------------
A0A434DUT4      ------------------------------------------------------------
A0A528D3U3      ------------------------------------------------------------
A0A3S3UPT3      ------------------------------------------------------------
A0A3S1E286      ------------------------------------------------------------
A0A531AC71      ------------------------------------------------------------
A0A436K268      ------------------------------------------------------------
A0A434IDQ0      ------------------------------------------------------------
A0A435IRM5      ------------------------------------------------------------
A0A3S2C404      ------------------------------------------------------------
A0A435F6C0      ------------------------------------------------------------
A0A435BMN6      ------------------------------------------------------------
A0A529XQ54      ------------------------------------------------------------
A0A530BJC1      ------------------------------------------------------------
Q44570          ------------------------------------------------------------
A0A655ZZQ1      ------------------------------------------------------------
A0A1S0ZAI3      ------------------------------------------------------------
A0A1W9M770      ------------------------------------------------------------
A0A1W9M7R6      ------------------------------------------------------------
A0A3C0L0A8      ------------------------------------------------------------
A0A176S762      ------------------------------------------------------------
A0A377ZC40      ------------------------------------------------------------
A0A378BPJ7      ------------------------------------------------------------
A0A2J5PAJ7      ------------------------------------------------------------
A0A377ZDN3      ------------------------------------------------------------
A0A1W9WUD9      ------------------------------------------------------------
A0A1W1ZQK0      ------------------------------------------------------------
A0A4U1ALN4      ------------------------------------------------------------
A0A4U1B1A8      ------------------------------------------------------------
A0A1M7Y300      ------------------------------------------------------------
A0A4U1A967      ------------------------------------------------------------
A0A3N5MZ53      ------------------------------------------------------------
A0A534E4H4      ------------------------------------------------------------
A0A534I2B6      ------------------------------------------------------------
A0A1C2JGD0      ------------------------------------------------------------
A0A259LQ70      ------------------------------------------------------------
A0A4V2SPR5      ------------------------------------------------------------
A0A3N5PM86      ------------------------------------------------------------
A0A2E5YSA4      ------------------------------------------------------------
A0A519ERR1      ------------------------------------------------------------
A0A4Q3Q1M2      ------------------------------------------------------------
A0A4Q3MHR1      ------------------------------------------------------------
A0A520GDZ4      ------------------------------------------------------------
A0A318DSU0      ------------------------------------------------------------
A0A538PF21      ------------------------------------------------------------
A0A1W1ZH10      ------------------------------------------------------------
A0A1W2FF24      ------------------------------------------------------------
A0A524JYQ6      ------------------------------------------------------------
A0A4Q3MA17      ------------------------------------------------------------
A0A0N0M5F7      ------------------------------------------------------------
A0A537M754      ------------------------------------------------------------
A0A1V1PDB4      ------------------------------------------------------------
A0A2M7C324      ------------------------------------------------------------
A0A4Q3HHG6      ------------------------------------------------------------
A0A3B7DTA4      ------------------------------------------------------------
A0A432ZK62      ------------------------------------------------------------
A0A1V5EEP4      ------------------------------------------------------------
A0A1V5EF48      ------------------------------------------------------------
A0A0S6X1X6      ------------------------------------------------------------
A0A537Y5L8      ------------------------------------------------------------
A0A4Q3L2X2      ------------------------------------------------------------
A0A4Q3T8J1      ------------------------------------------------------------
A0A4Q4ANM4      ------------------------------------------------------------
A0A4Q3UEC7      ------------------------------------------------------------
A0A1H5YYQ4      ------------------------------------------------------------
A0A1X4NLK2      ------------------------------------------------------------
A0A1X4NWB5      ------------------------------------------------------------
A0A1M5UQ38      ------------------------------------------------------------
A0A327YI48      ------------------------------------------------------------
A0A1B1PNL6      ------------------------------------------------------------
A0A2U8H9H9      ------------------------------------------------------------
A0A1X6YIC0      ------------------------------------------------------------
A0A1I5E9E9      ------------------------------------------------------------
A0A1X6Z7N7      ------------------------------------------------------------
A0A2E1DQ13      ------------------------------------------------------------
A0A1H8C800      ------------------------------------------------------------
A0A2N3EZ05      ------------------------------------------------------------
A0A1W9PMU6      ------------------------------------------------------------
A0A1G3VVY5      ------------------------------------------------------------
A0A2N6BZD5      ------------------------------------------------------------
A0A435NNF5      ------------------------------------------------------------
A0A3S2AQS7      ------------------------------------------------------------
A0A436XH86      ------------------------------------------------------------
A0A527ZPD6      ------------------------------------------------------------
A0A529KRW3      ------------------------------------------------------------
A0A530ZLX0      ------------------------------------------------------------
A0A355TB56      ------------------------------------------------------------
A0A524M660      ------------------------------------------------------------
A0A0C1TRU6      ------------------------------------------------------------
A0A2Z5SSF4      ------------------------------------------------------------
A0A327LYE6      ------------------------------------------------------------
A0A5A9ZTV3      ------------------------------------------------------------
A0A4Q4CIB1      ------------------------------------------------------------
A0A522ACJ9      ------------------------------------------------------------
A0A3N5Z7F8      ------------------------------------------------------------
A0A239HD34      ------------------------------------------------------------
A0A534V9L7      ------------------------------------------------------------
A0A0P7ZZE4      ------------------------------------------------------------
A0A369R0Q9      ------------------------------------------------------------
A5G4N9          ------------------------------------------------------------
A0A238LBD3      ------------------------------------------------------------
A0A0P1FRV5      ------------------------------------------------------------
A0A0P1FWI8      ------------------------------------------------------------
A0A1M7BLL7      ------------------------------------------------------------
A0A0H4KZM1      ------------------------------------------------------------
A0A1V1UJT2      ------------------------------------------------------------
A0A0L6CVX1      ------------------------------------------------------------
A0A1V0RR48      ------------------------------------------------------------
A0A0A0HJJ4      ------------------------------------------------------------
A0A5E7YA28      ------------------------------------------------------------
A0A348SRI7      ------------------------------------------------------------
A0A354EI73      ------------------------------------------------------------
A0A4P7EP83      ------------------------------------------------------------
A0A3A4NIE9      ------------------------------------------------------------
A0A3A4NUI9      ------------------------------------------------------------
A0A524I3Z6      ------------------------------------------------------------
A0A524PCL7      ------------------------------------------------------------
A0A356GQV1      ------------------------------------------------------------
A0A1J5DAY8      ------------------------------------------------------------
A0A524P237      ------------------------------------------------------------
A0A1G3JY11      ------------------------------------------------------------
A0A661N3U1      ------------------------------------------------------------
A0A3S1WTQ1      ------------------------------------------------------------
A0A440NX85      ------------------------------------------------------------
A0A530CUR9      ------------------------------------------------------------
A0A1M6N1X5      ------------------------------------------------------------
A0A561M3U0      VDLTEEAKI---------------------------------------------------
A0A2W5J775      ------------------------------------------------------------
A0A1F9E324      ------------------------------------------------------------
A0A432SAI6      ------------------------------------------------------------
A0A4Q3LBH4      ------------------------------------------------------------
A0A4Q3LWP3      ------------------------------------------------------------
A0A2N6VGL1      ------------------------------------------------------------
A0A3M3H5V6      ------------------------------------------------------------
A0A2T4ZJZ6      VNLDIETQN---------------------------------------------------
A0A1T2KYM8      ------------------------------------------------------------
A0A2G9ZR82      ------------------------------------------------------------
A0A4U9I390      ------------------------------------------------------------
A0A534XP85      ------------------------------------------------------------
A0A2X3M011      ------------------------------------------------------------
I2WC85          ------------------------------------------------------------
A0A400JH80      ------------------------------------------------------TRILNS
A0A2H9EHM4      ------------------------------------------------------------
A0A380B3D7      ------------------------------------------------------------
F5NSX0          ------------------------------------------------------------
D8EEU7          ------------------------------------------------------------
A0A479JNB1      ------------------------------------------------------------
A0A5C9AF52      ------------------------------------------------------------
A0A0P1H2H0      ------------------------------------------------------------
A0A258WKV0      ------------------------------------------------------------
A0A377N8F8      ------------------------------------------------------------
A0A3C2DSE7      ------------------------------------------------------------
A0A2X1JBG5      ------------------------------------------------------------
A0A0B8PTA8      ------------------------------------------------------------
A0A0B8QF75      ------------------------------------------------------------
A0A4Q3LR91      L-----------------------------------------------------------
A0A4V1TR68      ------------------------------------------------------------
A0A444IY46      ------------------------------------------------------------
A0A660AID0      ------------------------------------------------------------
A0A3E0WKI3      ------------------------------------------------------------
A0A1H3I2J1      ISDMLDEE----------------------------------------------------
A0A1V5DJV0      ------------------------------------------------------------
A0A520IUC4      ------------------------------------------------------------
A0A521LJG5      ------------------------------------------------------------
A0A531IBQ7      ------------------------------------------------------------
A0A377LY04      VDLPLEAKS---------------------------------------------------
A0A5C9ABR5      ------------------------------------------------------------
A0A5J9WU72      ------------------------------------------------------------
A0A2X3K9R3      MDLPLEAKA---------------------------------------------------
A0A3T9EHW9      ------------------------------------------------------------
A0A484X141      VDLPLEAKA---------------------------------------------------
A0A5N9VWI6      VDLPLEAKA---------------------------------------------------
A0A3D3PV27      ------------------------------------------------------------
A0A376LLF8      ------------------------------------------------------------
A0A444R390      ------------------------------------------------------------
A0A1V4WHZ7      ------------------------------------------------------------
A0A1E5AJN5      TDLEEQPAILASRLSAVNDALNAAVQDRLELGLIVQQIT------------EGKAPSLSA
A0A2N3D2J1      AIFSLPDVL---------------------------------------------------
A0A2N2GVE1      LAVSLEARI-----QSTTGLILSRSNSVETLDGMARELRAKIQQVRRMRTTDPTLDPSAD
A0A2N2INV3      LAVSLEARI-----QSTTGLILSRSNAVETLDGMARELRAKIQQVRRMRTTDPTLDPSAD
A0A1Y5DXG5      VNISLETQG---------------------------------------------------
A0A0B8P2H5      VDLGLEAQS---------------------------------------------------
A0A483QWI8      VDLSLEAKS---------------------------------------------------
A0A483UXD3      VDLSLEAKS---------------------------------------------------
A0A0A8J8L3      VDLSMEAKT---------------------------------------------------
A0A660DJ38      VDLSMEAKS---------------------------------------------------
A0A380AQW6      ------------------------------------------------------------
A0A2G2GD62      LSLDIKAAMVSKNVEKIGTEISSLSSEESILENLKEYIDENDDLTGLTVQSLET------
A0A524P331      IKLDAEAEELVRKLSGIEKERAAVAMQRNQVEFALAALKKARRRGGVYSPAAFR------
A0A4V1SSM5      ------------------------------------------------------------
A0A4Q3K8G7      ------------------------------------------------------------
A0A1M7HC79      VDLSSESQA---------------------------------------------------
A0A1D3JZN6      IDISLEAKA---------------------------------------------------
A0A1V6ESG1      MERSPENSAQVL------------------------------------------------
A0A1H7YHK3      VDITMQTKG---------------------------------------------------
A0A534SH66      ------------------------------------------------------------
A0A3M0ZZ99      ------------------------------------------------------------
A0A328C2K5      LSHSFEDRR-----EMAAEGLASVSEQHREVQARLFAEEALLNQLENMESSGEDLRALGD
A0A5C6X8M3      LSHTFEDRR-----EMAAEGLAAVSTQLREVQARLFAEEALLNQLETMESRGDDLRALGD
A0A3D8MRR7      LSHTFEDRR-----EMAAEGLAAVSTQLRDVQARLFAEEALLNQLETMESRGDDLRALGD
A0A5C6UBJ7      LSHTFEDRR-----EMAAEGLAAVSTQLRDVQARLFAEEALLNQLETMESRGDDLRALGD
A0A5C6XGM3      LSHTFEDRR-----EMAAEGLAAVSTQLREVQARLFAEEALLNQLETMESRGDDLRALGD
A0A537NZJ1      ------------------------------------------------------------
A0A4Q4CVW6      ------------------------------------------------------------
A0A090R136      IDLGLEAKS---------------------------------------------------
A0A661JU93      ------------------------------------------------------------
A0A2E2T3V8      IADRERELILERIYDLNAELDTAFQEREAARMLFEKRQAVKSSEELLALPDIA-------
A0A367UAB4      IADRERELILERIYDLNAELDTAFQEKEAARMLFEKRQAVKSSEELLALPDIA-------
A0A377V641      VDLSLEAKS---------------------------------------------------
A0A1F2YJ88      VDVTKESEL---------------------------------------------------
A0A0J7XGZ1      MSAEGATMA--------EQEVSELNRQIADAQAQLAEQRGKLGAAQAQIARGGGGADIGS
I4CBA7          VLLDDEPELESSLLETAGKTFLDIRNERLNLETLTLHKQMILPKYI--------------
A3VE95          REGGTYETSTQQLGNLSSQLVVARSERVTAEAQYEQLRNLLENQGLDALAKAV-------
A0A1G0NL95      ADLEIETQG---------------------------------------------------
A0A024KA69      ------------------------------------------------------------
A0A0L1KFN4      INLPSQSVGDGSTTQERSIVVDNLAALNAALNEATADRIAAEARFRQAGGSGSSAEAL--
A0A3P5DSS6      VDLSLEAKS---------------------------------------------------
A0A483YEL5      VDLSLEAKS---------------------------------------------------
A0A658GUJ0      VDLSLEAKS---------------------------------------------------
A0A358L616      VDMSLEAKS---------------------------------------------------
A0A3D5UYX7      ---------------------------------------------------GGSVESVAD
A0A2N1WQN5      ------------------------------------------------------------
A0A352G2C2      VDITAETQS---------------------------------------------------
A0A3C0PZN1      VDITAETQS---------------------------------------------------
A0A524QFS4      ETLEARRDA---------------------------------------------------
A0A520JSW4      ISTSSSDEGGDTNSLTGSSLVALNTALATTQARRIAAEQRYREAALGGATTE--------
A0A4Q3LTF3      L-----------------------------------------------------------
A0A537UTP9      VAASGRLMNEQQLSELNTSLIQARALTAETKAKLDRIDEILRTGVEVPDATVTDSL----
A0A1D2RNR5      ------------------------------------------------------------
A0A4V1TQ46      PLLSIPEVQ---------------------------------------------------
A0A3A0FZC0      VAVNKDENITAQKMSQLNRLLTDATAKRIEAENLYKEAEAALSNPSAGF-----------
A0A1N7JVZ7      PNSSGPGADTRSDAATAPDAPLVLQDTQRADAPEPAPK----------------------
A0A091C4A8      VDAIDGSSLSTQSLSELNSTLAAAQDQRIRAEARWKHAE------------SASGMGLSA
A0A4R3H6P6      INLPSPIDPNTGGAAGGGGRSLLTDDLIALNSALEVATAERIVAESRLNE-AKRPDASSI
A0A3S1NQ09      AANSDGQLMSDKQLSDLNAQLIVAQADTARASARYQQYKAIVDSGSENA--FKDAAISSD
A0A443GJ52      AVN-DGQLISDKKLGDLNGQLIEAQADTARASARYQQYKSIVESGSDNA--FRDAAISAD
A0A2W6S588      LTDPNATLPDNELSNIGVQLSDARGA----------------AAQAETRSAASGSTVISG
A0A483E0N4      VDLSLEAKS---------------------------------------------------
A0A2J4YQQ6      VDLSLEAKS---------------------------------------------------
A0A483THX4      VDLSLEAKS---------------------------------------------------
A0A534MVS2      LQS---------------------------------------------------------
A0A444I5K6      VEAGSGTLISDQQLSEINTQLINAQAETAKAEARYARVKSIIDAKQTDAIVTDVL-----
A0A154VE85      LEIGGGSIYRDQLTQVNAQLVAARGSRTEAEARAAQARRLIGQGSNTGTNTGGGLETAAA
A0A3S1MCW7      -----------------------------------------------------------P
A0A434IGN6      -----------------NTALATAIQERLDAGRMVDQID------------KGRGASLGP
A0A528AX40      TITGDDKSLIGSNIEALNTALATAIQERLDAGRMVDQID------------KGRGSSLGP
A0A528MV95      TITGDEKSLIGSNIETLNTALATAIQERLDAGRMVDQID------------KGRGSSLGP
A0A3C1S9Y1      ITGFSNDAEKITAEKLAKLNNQVVEFESKRVETETRYQQALALEKT-----PDLLDSIPE
A0A353EH49      IDLGAETTG---------------------------------------------------
A0A1Y1Q9C1      LEVNNSQSSQERKLDELYSALGEAERARIQAESQMIQ--------------GRKRTNAHA
A0A3M7LJH0      IDLSLEAKS---------------------------------------------------
A0A316KRG4      ------------------------------------------------------------
A0A1E4JHX8      INLPAAGATRDGPTVERSIVADDLASLNAELSAAKGEMVRAHSRVTEVGANGAVEEAL--
M2U8P2          VDIKDDSTAAQQILSQLGAELAQAEAEQAVAESRAASPAAAIQ-----------------
A0A1H7KZF8      IAVPARKNQRTDATLTSDTLDRVNQQLSDAAQRRIRAQADWRAVA------ARPPLSIPE
A0A0J5Q9T7      ------------------------------------------------------------
A0A257NG76      IDLDLETQS---------------------------------------------------
A0A1T4TW59      IELDDIDELAGTELTNLTIRVSEAKERRVAAEAIYSLLQSSGSSAASLLSVPEIS-----
A0A1I5YYQ0      VPQDAAPPAALE------------------------------------------------
A0A5P9FE62      VPQDAAPPASVE------------------------------------------------
A0A1Q3MB35      ITLANGQDESGRTDTAETLVSNDLKVLNGALADATRARITAESTVRQTSSASEGSL----
A0A259LUN7      LEAQGTTLT--------EQQIAYLTSQRSELQIELDRARARYEAMRRQIDSGAGVEGVSE
A0A2D7AVL1      ------------------------------------------------------------
A0A3B9KZE9      ------------------------------------------------------------
A0A2U0NMP8      VDLSLEAKS---------------------------------------------------
A0A4U9HNE9      VDLSLEAKS---------------------------------------------------
A0A2G2CXY6      VDITIETQA---------------------------------------------------
A0A3M1D4H3      ATTSA-------------------------------------------------------
A0A5C8BYM7      VRRTPDTARQVL------------------------------------------------
A0A1J5ICP0      VSLSDDARATLQQLMNFDTELKQAEGLRKQAEFIAENIMQSDGMPDKSIVALGAST----
A0A0M3GBT1      ISKEDAQDERLKSLIELTGREGKIEETRVEVKAVISTLEAADSASVAVQNIA--------
B3Q577          ISKEDAQDERLKSLIELTGREGKIEETRVEVKAVISTLEAADSASVAVQNIA--------
A0A379B9V4      VDLSLEAKA---------------------------------------------------
A0A0Q6TS97      INLPSSVDASTSGAAVGGRSLLTDDLIALNSALEVATAERIVAESRLNE--IKRPDASSI
A0A0Q6UYB4      INLPSSVDASTSGAAVGGRSLLTDDLIALNSALEVATAERIVAESRLNE--IKRPDASSI
A0A484XS37      VDLSLEAKS---------------------------------------------------
W7Q5J0          VDLSSEAQA---------------------------------------------------
A0A654AKT6      NFFEIFYFARVSGFSREAGFFSSLLVASLIAYLLTEK-----------------------
A0A0G9MZA5      VSIDVPREDGDSAGTASQTLVATELAAFNSALQQATTQRIAAEAALAARSGANAGSTE--
H0T8B0          ILGSQGRLASEVELDKLAKELAKSRAETIQAQAKLEQITHVLVQRSKSQDFDVSSPAVPD
A0A5C7N981      VRPDDKQQSPDAQVLGEFTSALAKSQGERIRAETLYQQAKAGDVATLQA--VV-------
A0A534TV22      ------------------------------------------------------------
A0A351CXR4      TTTRSLESS---------------------------------------------------
A0A2N6GLF5      IEVGGVSTLTAQQLQDLGGQLVMAEQRRATAESSLRQINALKGQPVERL--ASIPAVL--
A0A1W9LJP0      ITNFSNDAENITAEKLAKLNAQVVESESQRVEAETRYRQALAAQNSPDM--LDSISQVL-
A0A0W1ICB0      VRLSEIQGEDGRTRTTQTLASSDLEQLNRLLVQATAERAEAESKLSAAR--APGATQLGL
A0A2E0UL88      IEPTLSTKITETADPMIQQLAREKAQVDLEIQKAEFGRDNALAARPELE--EY-------
A0A233IKJ2      VDIQGVESLASQELEELTSQLNKTRDRRVAAETLYLVAQTYSRQDSDLS--ALASIPEIS
A0A2T1JE00      VDIQGVESLASQELEELTSQLNKTRDRRVAAETLYLVAQTYSRQDSDLS--ALASIPEIS
A0A0T2QIS1      VLLGRTITPDGRTLVDRTLTSSDLEALNTALAQATAE-----RVAAESR--ARTAGPSEL
A0A376KYN0      ------------------------------------------------------------
A0A2X1JB05      VDLNLEAKA---------------------------------------------------
A0A376RML0      VDLNLEAKA---------------------------------------------------
A0A377E5P7      VDLNLEAKA---------------------------------------------------
A0A0P7Y1D0      LDTGGSTLTEQQISDLNAQLAIQRAELSAAESSLRN------VQTQLER--GASLDTIGE
A0A2M7JRZ7      ISLEEKENVTMQRLTELNEVLTKAESERMAKE----------ALYRQTK--DKHFDALPS
A0A167IR75      VNLPSEGGNDGTNTQERPIVVDNLASLNAALNEATADRIA--AEARFRR--AGGGGSSAE
X7F6S5          T-----------------------------------------------------------
A0A1G7CFZ2      AQAT--------------------------------------------------------
A0A1P8USW9      AAAAEEAARKAQ------------------------------------------------
A0A1I6U4V1      ---A--------------------------------------------------------
A0A1G8NKI0      QAEA--------------------------------------------------------
A0A355QPE4      QAEV--------------------------------------------------------
A0A357RN98      QAEA--------------------------------------------------------
A0A3B8T2U6      VNIDGVIGLASEELQRYTALFVDAQNNLARVRSIFEQVNGQESKQDLAS--LQEVQ----
A0A365PWR2      VDISLEIEG---------------------------------------------------
A0A2E9H5Z8      ------------------------------------------------------------
A0A2E2BR79      VDLDSESQS---------------------------------------------------
A0A0Q4Q524      INLPAQQNGDGTTSERSIVADDLASLNTALSQATAERIAAEARYREGGR--AGASSEAL-
A0A0Q4CFJ9      INLPAQSNADGSTAERSIVADDLASLNTALSQATAERIAAESRYREGSR--AGASSEAL-
A0A0Q4FE58      INLPAQSNADGSTSERSIVADDLASLNTALSQATAERIAVEARYREGGR--AGASSEAL-
A0A0Q4JWC8      INLPAQSNADGSTSERSIVADDLASLNTALSQATAERIAVEARYREGGR--AGASSEAL-
A0A0Q4KFL8      INLPAQSNADGSTSERSIVADDLASLNTALSQATAERIAVEARYREGGR--AGASSEAL-
A0A522R8R0      NATIPVNKDSGTGT----------------------------------------------
A0A2U9NDY5      VDSSSETKG---------------------------------------------------
A0A0Q4IGG1      INLPAQGAGSGGSTTVERSIVADDLAALNATLSQATAERIQAQARAQQS--GRAGASTEA
A0A534RUJ5      ISLDDKENIVVARLTDLNARLTDAEAERIGLE----------AQMRSVS--QTDYDSLPA
A0A3M1CJM3      LSVSLEDRQNIISQRLQDLNQTLNKVQAERIALEARRQKILDIKEHRLA--LDAVDKVI-
A0A2R7SVD4      VNISLETQS---------------------------------------------------
A0A3C0PWB6      VDISIETKG---------------------------------------------------
V4Q8B7          VDISIETKG---------------------------------------------------
A0A0Q8XKK5      TALGTSKSADGRTEVERTLVSSDLEALNAALASATADRLAAESRSVRQR--GASPQAL--
A0A2E0Q2W0      VVLQRGASGDSEGGGQQTLVETRLSQLNEALA----------EATARRI--EAEGASRAA
A0A660NIR6      VATPTSALGGNERQLDNSSDRLIAARVERQRLEQVYHQVQRGSRNRYEV--PEVF-----
A0A142W0R3      ITLETRSDPGTGRTIGDRTLVAADVEKISTALSVARDARIAAESQLSSS--VSSTDLS--
A0A0S4XR18      ATIPNSASTLLNAMVDIDTQLQQANMKLSVLEGLIRQMKTGNGINFVSI--DVLGA----
A0A2E0GW64      LDISAESKM---------------------------------------------------
A0A1A7QJ97      INLPATSEGAQERPIVADNLAALNSALSEAIADRIA------AESRFRQ--AGSAGSTAA
A0A661LW70      ------------------------------------------------------------
W7Q8F9          VDLSSEAQA---------------------------------------------------
A0A524PXH8      YALEQEELVIHEKLADLNARLTEAESQRITVE----------SLYQQSQ--GASRDSLPI
A0A4Q3P0E4      VAFDEEAKL---------------------------------------------------
A0A3M2BE89      VDVGLEAEA---------------------------------------------------
A0A4Q4A6K6      LAGIDTPGSEVL------------------------------------------------
A0A257G674      IRDRNPSNTIDKGSTSGSVTTASLLQVNTAANQAQATRIAAQQRWNLVS--RSDPLNSPD
A0A661M5M6      LSVSMEDRQNLVASDVQTTHAKLTEIRNRRIELEARLKRLNASLGEAPK--QIDPAVVA-
A0A1I1UM01      RQAEQDR-----------------------------------------------------
Q44573          TSTPLIERQIADTSANLSQAEGRLAAAQARAD----------ALQDAAA--RGDARAAVA
A2W025          INASDEAKVYLEGSVQ--------------------------------------------
A0A534Z362      VAINEEQKTVAQRIADVSSLLSKAEGARLALH----------SRYEFLT--RPHGDALAY
V4J283          IDITRETEN---------------------------------------------------
A0A536T443      GGVPVDELTMIGAVQ---------------------------------------------
A0A0Q4UFQ5      VNIPGSTDSNGQTTGERSLVVDDLANLNRELAQATAE-----RVAAESR--LNSGGATKE
A0A527W7E6      SANSDGQLLSDKQLADLNAQLIVAQADTARASARYQQYKAIVDSGSETA--FNDSAIAAD
A0A432EMV7      VDSESFAAQTSDKLGELTSELVKAKAKRAEAEVLFKQ-----VKAAEKR--GDDYGSLAA
A0A087LTV7      ASAARALGLAGEQAPDW-------------------------------------------
A0A534WLI3      VAVNQEQRLVAQRTAELSDLLTKAEADRVG----LES-----RNEFLSH--AD-SEPLAY
A0A318KWA2      VDLTSEAQA---------------------------------------------------
A0A522MT86      MQPTSEAQAYLQGGID--------------------------------------------
A0A4Q3I221      AEARLQRIAQIIASGQGDAIVTDVL-----------------------------------
A0A534SAL6      VAINQEQKTVAQRIGEVSSLLTKVEGTRLN----LES-----RYQFLTT--PG-SDPLAF
A0A534ZDB4      VAINEEQKTVAQRIGEVSSLLTKVEGTRLN----LET-----RYEFLTT--PG-SEALAY
A0A534X3M7      VAVNEEQKTVAQRITDVSSLLTRAEGTRVE----LQT-----QNDSLAK--KQYGDLLAF
A0A534SPC6      VAINEEQKTVAQRIADVSSLLSKAEGARLA----LHS-----RYEFLTR--PH-GDALAY
A0A535AD60      VAINEEQKTVAQRISDVSSLLSKAEGTRLA----LHS-----RYEFLTR--PD-GDALAY
A0A4Q3SY08      LNTARQQLATG-------------------------S-----TGEDVGE--AL-------
A0A4Q3LG23      AEARF------------------------R----QVG-----AAGASTE--AL-------
A0A522EX52      LDIKL------------------------------------------QT--EN-------
A0A1H3KC95      PEERH-------------------------------------DVPSTPR--AT-------
A0A5P8Z4P3      MDQDFAPGGHPPKSAQPATVEASDMSEPLA----DEP-----NARDAES--LP-------
A0A0B3RZC9      AAERA-------------------------------------EAEAALQ--AE-------
A0A2E9HXF7      AREDA-------------------------------------ERQESAR--QH-------
A0A520HUH4      TALLRLSREAEAAAASVARYRADSGIVQGG----GVG-----TINDQQV--GP-------
A0A2K8U7M6      AQTEA-------------------------------R-----QAGTDAA--AT-------
A0A5B9DKL8      AARLANGVANA-----------------------FLR-----IEVEGKV--DD-------
A0A238KJM1      IALERIAARKE----------------------------------------RE-------
A0A3A0FJZ4      IAFRSPDRALA-----------------LG----VVR-----ASAEQLI--AE-------
W4HJV8          VNATSLSSDSD-------------------------S-----DSDSDSD--SD-------
A0A0P1GDI0      LAEEQAKAEAEEKARLAAEAEAQAEAARLA----KLA-----EERAAEA--KR-------
A0A2R8ATV5      QAKAAALARQK-------------------------A-----EAIKRAK--AE-------
A0A1U7D3R6      LAEEQ---RQA-------------------------A-----AQREAER--LR-------
A0A2D4UVV2      LAEEQ---RQA-------------------------A-----AQREAER--LR-------
A0A0W7WHP4      AAEEQ----------------------------------------------AR-------
A0A238J8F6      AAEQAEKDRQR-------------------------V-----EAE------KR-------
A0A238JQI6      KAEAEAAEKAR-------------------------T-----EAEDAAR--KA-------
A0A222E077      AREDA-------------------------------------ERQESAR--QH-------
A0A239E3Y2      ASEDA-------------------------------------ERQERER--QH-------
A0A1W9HS52      TPLLERFQQNEQLFTRTSAVLEEVQSEPFLNLVVANYLKEGNKISFIVPAERVRGLILFI
A0A2D5LFD8      ------------FQRLFHPVYEGTFS-------------------------LLIKDPINN
A0A0N0XAV4      ------------------------------------------------------------
A0A0P9QD19      ------------------------------------------------------------
F3FHG4          ------------------------------------------------------------
F3GGI0          ------------------------------------------------------------
A0A0P9LE74      ------------------------------------------------------------
A0A3M4ZQ14      -PVIGPY-----LHRTFTPGSQRTLAEPLFGLNRYAWGGEKIDVFQLDVPESLLGENLTL
A0A3M5YLE8      -PVIGPY-----LHRTFTPGSQRTLAEPLFGLNRYAWGGEKIDVFQLDVPESLLGENLTL
A0A3M3RP89      -PVIGPY-----LHRTFTPGSQRTLAEPLFGLNRYAWGGEKIDVFQLDVPESLLGENLTL
A0A0P9QIY7      -PVIGPY-----LHRTFTPGSQRTLAEPLFGLNRYAWGGEKIDVFQLDVPESLLGENLTL
A0A0P9VVH7      -PVIGPY-----LHRTFTPGSQRTLAEPLFGLNRYAWGGEKIDVFQLDVPESLLGENLTL
A0A0Q0FJK6      -PVIGPY-----LHRTFTPGSQRTLAEPLFGLNRYAWGGEKIDVFQLDVPESLLGENLTL
A0A0Q0G2J0      -PVIGPY-----LHRTFTPGSQRTLAEPLFGLNRYAWGGEKIDVFQLDVPESLLGENLTL
A0A3M3LF66      -PVIGPY-----LHRTFTPGSQRTLAEPLFGLNRYAWGGEKIDVFQLDVPESLLGENLTL
A0A0P9WIR8      -PVIGPY-----LHRTFTPGSQRTLAEPLFGLNRYAWGGEKIDVFQLDVPESLLGENLTL
A0A3M3KPE5      -PVIGPY-----LHRTFTPGSQRTLAEPLFGLNRYAWGGEKIDVFQLDVPESLLGENLTL
A0A3M4C263      -PVIGPY-----LHRTFTPGSQRTLAEPLFGLNRYAWGGEKIDVFQLDVPESLLGENLTL
A0A3M5AD05      -PVIGPY-----LHRTFTPGSQRTLAEPLFGLNRYAWGGEKIDVFQLDVPESLLGENLTL
A0A0Q0D3D2      ------------------------LPKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTL
A0A0N0FS39      ------------------------------------------------------------
A0A3M6GHH2      ------------------------------------------------------------
A0A0P9R9W0      -PVIGPY-----LYRTFKPLRDGELAEPLFGLTHYAWGGEKIDVFQLEVPEYLLGEKLTL
A0A0Q0B9T0      -PVIGPY-----LYRTFKPLRDGELAEPLFGLTHYAWGGEKIDVFQLEVPEYLLGEKLTL
A0A3M6CFI7      -PVIGPY-----LYRTFKPLRDGELAEPLFGLTHYAWGGEKIDVFQLEVPEYLLGEKLTL
A0A0P9JXN0      -PVIGPY-----LYRTFKPVRDGELAEPLFGLTHYAWGGEKIDVFQLEVPEHLLGEKLTL
A0A3M6FIV7      -PVIGPY-----LYRTFKPVRDGELAEPLFGLTHYAWGGEKIDVFQLEVPEHLLGEKLTL
A0A3M3PLW9      -PVIGPY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTL
A0A3M4ENY1      -PVIGPY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTL
A0A3M5EZK7      -PVIGPY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTL
A0A0P9SPP5      -PVIGPY-----LYRTFKPVRDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGKKLTL
A0A658KL17      -PVIGPY-----LYRTFKPVRDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTL
A0A3M3NNF2      -PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTL
A0A3M4A0E8      -PVIGPY-----LYRTFKPVRDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTL
A0A3M4PBZ2      -PVIGPY-----LYRTFKPVRDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTL
A0A3M6AI26      -PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTL
A0A0P9IWP8      -PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTL
A0A0P9KZ49      -PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTL
A0A0P9V840      -PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGENIEVFQLEVPEHLLGEKLTL
A0A0Q0AIE5      -PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGENIEVFQLEVPEHLLGEKLTL
A0A3M2ZQH6      -PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGENIEVFQLEVPEHLLGEKLTL
A0A0N8SQG2      -PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTL
A0A0W8HFU1      -PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTL
A0A3M5M873      -PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTL
A0A0P9VHH8      -PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTL
A0A0P9YV98      -PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTL
A0A3M3G2W8      -PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTL
A0A3M6C224      -PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTL
A0A3M5K254      -PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTL
A0A3M5JFB0      -PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTL
A0A3M3TQV3      -PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTL
A0A3M3EF92      -PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTL
A0A3M5J1E2      -PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTL
A0A3M5G7H9      -PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTL
A0A3M4A376      -PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTL
A0A0Q0A5T8      -PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTL
A0A0P9SCD7      -PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTL
A0A0P9T4G3      -PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTL
A0A0P9VKB0      -PVIGPY-----LYRTFKPVREGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTL
A0A0Q0BM35      -PVIGPY-----LYRTFKPVREGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTL
A0A3M3TPR7      -PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTL
A0A3M3U4Q3      -PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTL
A0A0P9UCX7      -PVIGPY-----LYRTFKPVRDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTL
A0A0P9S1F1      -PVIGPY-----LYRTFKPVRDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTL
A0A0P9QCJ2      -PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTL
A0A0P9Q329      -PVIGPY-----LYRTFKPVRDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTL
A0A3M5GJ64      -PVIGPY-----LYRTFKPVRDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTL
A0A0P9MPC7      -PVIGPY-----LYRTFKPVRDGELSKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTL
A0A3M2XYQ3      -PVIGPY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPENLLGEKLTL
A0A0P9XCE1      -PVIGPY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTL
A0A3M3EFX7      -PVIGPY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTL
A0A3M5B9D9      -PVIGPY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTL
A0A0P9RRZ3      -PVIGPY-----LYRTFKPARDGELAQPLFGLTHYAWGGEKIELFQLEVPEHLLGEKLTL
A0A3M2VEK7      -PVIGPY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGERLTL
A0A0N8R9B3      -PVIGPY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGERLTL
A0A0P9VA27      -PVIGPY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTL
A0A3M4YBJ4      -PVIGPY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTL
A0A0P9J470      -PVIGPY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTL
A0A0Q0EVJ8      -PVIGPY-----LYRTFKPAREGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTL
A0A3M5UI30      -PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGENIEVFQLEVPEHLLGEKLTL
A0A3M5YQT8      -SVIGPY-----LYRTFKPVREGELSKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTL
A0A3M5F5X1      -PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTL
A0A3M5R8G1      -PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTL
A0A3M5V012      -PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTL
A0A3M3GA16      -PVIGPY-----LYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTL
A0A3M3UCT3      -PVIGPY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTL
A0A3M3CJL0      -PVIGPY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTL
A0A3M3F6F5      -PVIGPY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGERLTL
A0A3M3P9B7      -PVIGPY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGERLTL
A0A0N8QB74      -PVIGPY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGERLTL
A0A0Q0AUD0      -PVIGAY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGERLTL
A0A3M5VR55      -PVIGPY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGERLTL
A0A0Q0FK97      -PVIGPY-----LYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTL
A0A3M5KZ75      -PVIGPY-----LYRTFKPAREGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTL
A0A3M5L3G5      -PVIGPY-----LYRTFKPAREGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTL
A0A1V6FYJ1      ------------------------------------------------------------
A0A445MZQ4      ------------------------------------------------------------
A0A0M9E0E3      ------------------------------------------------------------
A0A0Q6QV61      ------------------------------------------------------------
A0A2Z3IKG4      ------------------------------------------------------------
A0A4Q3IRI1      ------------------------------------------------------------
A0A2W4RFS2      ------------------------------------------------------------
A0A1Y6DC43      ------------------------------------------------------------
A0A2S6HE06      ------------------------------------------------------------
G3J0M3          ------------------------------------------------------------
V5C6R5          ------------------------------------------------------------
A0A354EF47      ------------------------------------------------------------
A0A2G6MSP7      ------------------------------------------------------------
A0A1V4M8I1      ------------------------------------------------------------
A0A4Z0M4C7      ------------------------------------------------------------
A0A4U8YMP3      ------------------------------------------------------------
A0A1Q8QQ99      ------------------------------------------------------------
A0A3D5ZY44      ------------------------------------------------------------
A0A646J2A6      ------------------------------------------------------------
A0A1G5C236      ------------------------------------------------------------
A0A5Q2QDL1      ------------------------------------------------------------
A0A656PSQ6      ------------------------------------------------------------
A0A1I3XJ27      ------------------------------------------------------------
A0A1I7DCG1      ------------------------------------------------------------
A0A3A3H6D9      ------------------------------------------------------------
A0A562CGU2      ------------------------------------------------------------
A0A0Q6VA36      ------------------------------------------------------------
A0A1B2EQN1      ------------------------------------------------------------
A0A1E7HSL6      ------------------------------------------------------------
W9VVY5          ------------------------------------------------------------
A0A1E2URD3      ------------------------------------------------------------
A0A2T6MY81      ------------------------------------------------------------
A0A2T6NBQ8      ------------------------------------------------------------
A0A421K431      ------------------------------------------------------------
A0A2G2I5M1      ------------------------------------------------------------
A0A2G2M6F0      ------------------------------------------------------------
A0A1W9J9F8      ------------------------------------------------------------
A0A2S5LFJ9      ------------------------------------------------------------
A0A2D8R8F8      ------------------------------------------------------------
A0A010SNS0      ------------------------------------------------------------
A0A0C2I782      ------------------------------------------------------------
A0A2N8BYF5      ------------------------------------------------------------
A0A558FKX2      ------------------------------------------------------------
A0A1H1DBA0      ------------------------------------------------------------
J2TAD5          ------------------------------------------------------------
J3H699          ------------------------------------------------------------
A0A1H5J974      ------------------------------------------------------------
A0A0K1QRZ4      ------------------------------------------------------------
A0A560RJW9      ------------------------------------------------------------
A0A5E6TID7      ------------------------------------------------------------
A0A5E7CRU7      ------------------------------------------------------------
A0A5E7C564      ------------------------------------------------------------
A0A2W7MAV4      ------------------------------------------------------------
A0A4R3WQH5      ------------------------------------------------------------
W6VFG3          ------------------------------------------------------------
A0A1P8ENT1      ------------------------------------------------------------
A0A2N7XRV4      ------------------------------------------------------------
A0A0Q6QPG8      ------------------------------------------------------------
A0A0F4SWA7      ------------------------------------------------------------
A0A423J219      ------------------------------------------------------------
A0A4P6G9U8      ------------------------------------------------------------
A0A4Y8JE06      ------------------------------------------------------------
A0A502I1X9      ------------------------------------------------------------
A0A502J776      ------------------------------------------------------------
A0A5B0EZF6      ------------------------------------------------------------
A0A059L434      ------------------------------------------------------------
A0A0F4UWN2      ------------------------------------------------------------
A0A5E7WEF5      ------------------------------------------------------------
A0A1G0KSD0      ------------------------------------------------------------
A0A4P6WX84      ------------------------------------------------------------
A0A1D2S760      ------------------------------------------------------------
A0A5B8RW94      ------------------------------------------------------------
A0A258TN88      ------------------------------------------------------------
A0A4Q3ZDI7      ------------------------------------------------------------
A0A537PRC6      ------------------------------------------------------------
A0A2M7JX59      ------------------------------------------------------------
A0A3A4XVN3      ------------------------------------------------------------
A0A1E7JEV6      ------------------------------------------------------------
A0A2N2KDY5      ------------------------------------------------------------
A0A3N5YUD9      ------------------------------------------------------------
A0A0W1DLQ3      ------------------------------------------------------------
A0A246JVD8      ------------------------------------------------------------
A0A2N3BB54      ------------------------------------------------------------
A0A1H6G7A3      ------------------------------------------------------------
A0A0A7PGL6      ------------------------------------------------------------
A0A4Q2Z4L0      ------------------------------------------------------------
A0A5C4N0H6      ------------------------------------------------------------
A0A4R1HDF2      ------------------------------------------------------------
A0A1E7HFN0      ------------------------------------------------------------
A0A1M5GH86      ------------------------------------------------------------
A0A1W1XQZ5      ------------------------------------------------------------
A0A3D6C3I2      ------------------------------------------------------------
S0G1D4          ------------------------------------------------------------
A0A661T246      ------------------------------------------------------------
A0A2G6CSG7      ------------------------------------------------------------
A0A2G6NB59      ------------------------------------------------------------
A0A5K8A7T9      ------------------------------------------------------------
A0A1W9U045      ------------------------------------------------------------
A0A1F9L9G4      ------------------------------------------------------------
A0A328FD76      ------------------------------------------------------------
A0A348UX90      ------------------------------------------------------------
A0A357Z0N5      ------------------------------------------------------------
A0A0F2R2U0      ------------------------------------------------------------
A0A5K7ZK00      ------------------------------------------------------------
A0A5K7YCX8      ------------------------------------------------------------
A0A5K7Z388      ------------------------------------------------------------
A0A352B502      ------------------------------------------------------------
A0A2K8WHP8      ------------------------------------------------------------
A0A410V446      ------------------------------------------------------------
A0A0R3KGJ5      ------------------------------------------------------------
A0A0R3N604      ------------------------------------------------------------
A0A1B1UCM8      ------------------------------------------------------------
A0A1N6JQ20      ------------------------------------------------------------
A0A1M5TI07      ------------------------------------------------------------
A3X191          ------------------------------------------------------------
A0A1H4RKV5      ------------------------------------------------------------
A0A160UA87      ------------------------------------------------------------
A0A1Q5SFV5      ------------------------------------------------------------
A0A1J5N774      ------------------------------------------------------------
A0A2C8F781      ------------------------------------------------------------
A0A2E3R6G0      ------------------------------------------------------------
A0A1F8XMK2      ------------------------------------------------------------
A0A3M8EMP2      ------------------------------------------------------------
A0A2J6J6K6      ------------------------------------------------------------
A0A1G6EKK9      ------------------------------------------------------------
S7TK97          ------------------------------------------------------------
S7UE93          ------------------------------------------------------------
A0A3D5BR56      ------------------------------------------------------------
A0A2N2IB15      ------------------------------------------------------------
A0A1I3PSR2      ------------------------------------------------------------
A0A1I4GEK4      ------------------------------------------------------------
A0A0A8WSG4      ------------------------------------------------------------
A0A2T5R3J5      ------------------------------------------------------------
A0A661PSB9      ------------------------------------------------------------
A0A661QBT6      ------------------------------------------------------------
A0A1W7QPT7      ------------------------------------------------------------
A0A1L3GKM9      ------------------------------------------------------------
A0A0M4D373      ------------------------------------------------------------
A0A5J4MX76      ------------------------------------------------------------
A0A430DNP0      ------------------------------------------------------------
A0A3A0FQ32      ------------------------------------------------------------
A0A1E4UZA0      ------------------------------------------------------------
A0A1H9KL56      ------------------------------------------------------------
A0A1A9KEF8      ------------------------------------------------------------
A0A5E6PKN5      ------------------------------------------------------------
A0A0N9W1V6      ------------------------------------------------------------
A0A423GQ41      ------------------------------------------------------------
A0A423H7J2      ------------------------------------------------------------
A0A502HNM8      ------------------------------------------------------------
A0A4Q7H223      ------------------------------------------------------------
A0A1H4N2K9      ------------------------------------------------------------
A0A2K4KWF7      ------------------------------------------------------------
A0A3E0WXH2      ------------------------------------------------------------
A0A2N2TRC8      ------------------------------------------------------------
A0A1V4CIZ7      ------------------------------------------------------------
A0A1M3BXA5      ------------------------------------------------------------
A0A1Y2R3U6      ------------------------------------------------------------
A0A167HVD6      ------------------------------------------------------------
A0A1V3SCT6      ------------------------------------------------------------
L0H287          ------------------------------------------------------------
A0A495VG93      ------------------------------------------------------------
A0A4R3MYM4      ------------------------------------------------------------
G2E3C0          ------------------------------------------------------------
A0A534QGR3      ------------------------------------------------------------
A0A4U8YLL7      ------------------------------------------------------------
A0A655RNN3      ------------------------------------------------------------
A0A655R819      ------------------------------------------------------------
A0A655ZEY0      SASAQLE-----AVRKNLRAELRQLLNGINNELQAAKQSERSLQTEFNQRKSEFQTLTVK
A0A0W1GMS6      ------------------------------------------------------------
A0A0Q8RMY3      ------------------------------------------------------------
A0A1A7QC21      ------------------------------------------------------------
A0A2M7WWF7      ------------------------------------------------------------
A0A351Z9A2      ------------------------------------------------------------
A0A3N5RNY4      ------------------------------------------------------------
A0A1E7H876      ------------------------------------------------------------
A0A0F2NF69      ------------------------------------------------------------
A0A1F9NFD0      ------------------------------------------------------------
A0A1M5YLH5      ------------------------------------------------------------
A0A4U1A4C7      ------------------------------------------------------------
A0A509L3P8      ------------------------------------------------------------
A0A3A4S038      ------------------------------------------------------------
A0A1F9N669      ------------------------------------------------------------
A0A1F9PFA7      ------------------------------------------------------------
A0A1H2EN09      ------------------------------------------------------------
K0NP00          ------------------------------------------------------------
A0A432HIS7      ------------------------------------------------------------
A0A127AL56      ------------------------------------------------------------
A0A1E7JCL5      ------------------------------------------------------------
A0A496YAH9      ------------------------------------------------------------
A0A1V4S7E4      ------------------------------------------------------------
A0A2N2H8D2      ------------------------------------------------------------
A0A2N2KC63      ------------------------------------------------------------
A0A3A4ZYW4      ------------------------------------------------------------
A0A1V4MCJ4      ------------------------------------------------------------
A0A661M0W4      ------------------------------------------------------------
A0A1X0YE57      ------------------------------------------------------------
A0A2K2H9Q8      ------------------------------------------------------------
A0A2N6BEI9      ------------------------------------------------------------
A0A318CT66      ------------------------------------------------------------
A0A3N5P205      ------------------------------------------------------------
A0A0D5N3E9      ------------------------------------------------------------
A0A2N2G716      ------------------------------------------------------------
A0A1F9EUS2      ------------------------------------------------------------
A0A3N9VAW3      ------------------------------------------------------------
A0A1H4B8T3      ------------------------------------------------------------
A0A1E7IQC3      ------------------------------------------------------------
A0A1M6KEN5      ------------------------------------------------------------
A0A353QLL3      ------------------------------------------------------------
A0A399I453      ------------------------------------------------------------
A0A651FBV9      ------------------------------------------------------------
A0A1G0LDK7      ------------------------------------------------------------
A0A562VHD2      ------------------------------------------------------------
A0A5C1MDH8      ------------------------------------------------------------
A0A5A9XE04      ------------------------------------------------------------
A0A643G9R1      ------------------------------------------------------------
A0A1G0M8Q7      ------------------------------------------------------------
A0A353MI14      ------------------------------------------------------------
A0A4S1CAW7      ------------------------------------------------------------
A0A534HBS8      ------------------------------------------------------------
A0A0F0T3Y9      ------------------------------------------------------------
A0A351B422      ------------------------------------------------------------
F2NEE9          ------------------------------------------------------------
B7RS54          ------------------------------------------------------------
A0A3N5FRH4      ------------------------------------------------------------
A0A1V4Y2C3      ------------------------------------------------------------
A0A2N2KTJ4      ------------------------------------------------------------
A0A2N2LQX0      ------------------------------------------------------------
A0A318D3U4      ------------------------------------------------------------
A0A401FQP5      ------------------------------------------------------------
A0A1Q6DMW3      ------------------------------------------------------------
A0A3A6P8F8      ------------------------------------------------------------
A0A2G2DSM4      ------------------------------------------------------------
A0A1F9NI02      ------------------------------------------------------------
A0A4U1ABX4      ------------------------------------------------------------
A0A351Z4H9      ------------------------------------------------------------
A0A2N2KML4      ------------------------------------------------------------
E1YJF1          ------------------------------------------------------------
A0A1J5EVZ6      ------------------------------------------------------------
A0A2G6FCC5      ------------------------------------------------------------
A0A1F9MR25      ------------------------------------------------------------
A0A2G6M7F1      ------------------------------------------------------------
A0A1I0R9R6      ------------------------------------------------------------
A0A443K010      ------------------------------------------------------------
A0A238IZI1      ------------------------------------------------------------
A0A316GHM6      ------------------------------------------------------------
A0A520ZTR8      ------------------------------------------------------------
A0A212AR83      ------------------------------------------------------------
A0A2E2P4I0      ------------------------------------------------------------
A0A2U2CM86      ------------------------------------------------------------
A0A1X7ACC1      ------------------------------------------------------------
A0A2N3BVE7      ------------------------------------------------------------
A0A2S5JE21      ------------------------------------------------------------
A0A2R8BKZ2      ------------------------------------------------------------
A0A2S8S361      ------------------------------------------------------------
A0A238KUF6      ------------------------------------------------------------
A0A095CTW3      ------------------------------------------------------------
A0A2E3UGD6      ------------------------------------------------------------
A0A2T0RFH0      ------------------------------------------------------------
A0A285D390      ------------------------------------------------------------
A0A497VHN4      ------------------------------------------------------------
A0A379GWF0      ------------------------------------------------------------
A0A536T0W8      ------------------------------------------------------------
A0A2G9XLE5      ------------------------------------------------------------
A0A3D2M6Y9      ------------------------------------------------------------
A0A3D2YAZ2      ------------------------------------------------------------
A0A350A102      ------------------------------------------------------------
A0A350L5D2      ------------------------------------------------------------
A0A1I6ENM4      ------------------------------------------------------------
A8LNM8          ------------------------------------------------------------
A0A0T5NSU3      ------------------------------------------------------------
A0A5P9I718      ------------------------------------------------------------
A0A2M8J3R9      ------------------------------------------------------------
A0A1I6X762      ------------------------------------------------------------
A0A0P1EFX8      ------------------------------------------------------------
A0A2G5KB39      ------------------------------------------------------------
A0A2N3CNV1      ------------------------------------------------------------
A0A257F1F4      ------------------------------------------------------------
A0A1G9FY29      ------------------------------------------------------------
A0A4Q3ZBK4      ------------------------------------------------------------
A0A2D5J8T8      ------------------------------------------------------------
A0A2E3P9W6      ------------------------------------------------------------
A0A2G2B1P9      ------------------------------------------------------------
A0A258GCD5      ------------------------------------------------------------
A0A2D9YR88      ------------------------------------------------------------
A0A443INY4      ------------------------------------------------------------
A0A372IH36      ------------------------------------------------------------
A0A540VW45      ------------------------------------------------------------
A0A1H9C241      ------------------------------------------------------------
A0A2E3FCR1      ------------------------------------------------------------
A0A4S3MG69      ------------------------------------------------------------
A0A1G8QZS5      ------------------------------------------------------------
A0A1V4QMH7      ------------------------------------------------------------
A0A496XZQ4      ------------------------------------------------------------
A0A1F9BJF7      ------------------------------------------------------------
F2NDF5          ------------------------------------------------------------
A0A1I3TTC3      ------------------------------------------------------------
A0A1H3IZW6      ------------------------------------------------------------
A0A0M6YG59      ------------------------------------------------------------
A0A1H7G8B0      ------------------------------------------------------------
A0A059IPK4      ------------------------------------------------------------
A0A1H2Y469      ------------------------------------------------------------
A0A497ZQU7      ------------------------------------------------------------
A0A520CSP5      ------------------------------------------------------------
A0A4Q2XLV7      ------------------------------------------------------------
A0A4Q5QYC4      ------------------------------------------------------------
A0A3B8SQ27      ------------------------------------------------------------
A0A3E0H727      ------------------------------------------------------------
A0A352Q5C1      ------------------------------------------------------------
A0A656BWB0      ------------------------------------------------------------
A0A3Y2RPN4      ------------------------------------------------------------
A0A0A0FHV8      ------------------------------------------------------------
A0A1X3IPU7      ------------------------------------------------------------
A0A0A0G0N2      ------------------------------------------------------------
A0A243TPR1      ------------------------------------------------------------
A0A2I8SDU4      ------------------------------------------------------------
A0A2I8SU55      ------------------------------------------------------------
S1EXJ6          ------------------------------------------------------------
A0A376UBS1      ------------------------------------------------------------
A0A4Q6G931      ------------------------------------------------------------
A0A4Q8R6L6      ------------------------------------------------------------
A0A2T0VBD8      ------------------------------------------------------------
A0A378APS2      ------------------------------------------------------------
A0A443VCQ6      ------------------------------------------------------------
A0A447RKQ7      ------------------------------------------------------------
W1DSK1          ------------------------------------------------------------
A0A0U2VAW2      ----MLT-----DWHY-------------PTYQGLVEQIAAVKEQRKALVGEVGNLPETQ
A0A454CTF1      ALEAQLN-----ELTFKESEISQKFTQDHPAYKSLLDKRQTLLQEKARLNRQVQKLPKTQ
A0A1W9F5M9      ------------------------------------------------------------
A0A352MMI7      ---------------FKEAEISKLYTKAHPAYRTLLEKRRALEDEKDRLSGRVSAMPKTQ
A0A379W6R2      ------------------------------------------------------------
A0A376RY66      NIDAQLN-----ELTFKEAEISKLYTKVHPAYRTLLEKRQALEDEKAKLNGRVTAMPKTQ
A0A377K431      NIDAQLN-----ELTFKEAEISKLYTKVHPAYRTLLEKRQALEDEKAKLNGRVTAMPKPS
A0A379TA56      -------------------------------------------------------MPKTQ
A0A4Z0LWV1      HLDAPLN-----DLTVNEAEISKLFTKAHPAYRTLLEKRKALEDEKAKLNGRVTAMPKTQ
A0A620QD02      NIDAQLN-----ELTFKEAEISKLFTKAHPAYRTLLEKRKALEDEKAKLNGRVTAMPKTQ
A0A5H3HSJ8      -----------------------------------LEKRKALEDEKAKLNGRVTAMPKTQ
A0A655C5P0      -------------------------------------------------------MPKTQ
A0A3C2BN18      ------------------------------------------------------------
A0A447LR75      ------------------------------------------------------------
A0A376D8L7      ------------------------------------------------------------
A0A1V2FV46      ------------------------------------------------------------
A0A376SB61      ------------------------------------------------------------
A0A3D1BYV9      ------------------------------------------------------------
A0A378G3G7      QLDAQIN-----QLTFSEAEVSKLYTKEHPTYRALLEKRKTLEEEKNNLKKKINNLPETQ
A0A2X5NHJ9      NVDNQLN-----QLTFREAEVSQLFTKDHPTYKALLEKRKVLQQEKAKLNQQVSGMPATQ
A0A2J4QEC3      ------------------------------------------------------------
A0A485ADM3      -----------------------------------MEKRKTLQDEKAKLNKRVSAMPETQ
A0A4U9HGU4      AVEGQLN-----ELTFKEADISKLYTKEHPAYRSLLEKRKTLEEERDRLNKRVNAMPETQ
A0A3S4JGG5      GVEAQLN-----ELTFKEAEISKLYTKEHPAYRALMEKRATLQQEKDKLNKRVSGMPKTQ
A0A377ZDH2      ------------------------------------------------------------
A0A3S4HTS8      ------------------------------------------------------------
A0A2N1XK22      ------------------------------------------------------------
A0A3D0KAC8      DLEKQIS-----EQNLKRTEMERRFTRQHPNFQALMNQINQLQMQKDQLEKQIDTLPSTQ
A0A3D2Y902      ----------------------------------------------------------TQ
E1Y9C0          ------------------------------------------------------------
A0A1N6SH58      ------------------------------------------------------------
A0A4Q3AQN2      ------------------------------------------------------------
                                                                            

A0A1F9CFF0      ------------------------------------------------------------
A0A2M8B0G5      ------------------------------------------------------------
A0A363TNU9      ------------------------------------------------------------
A0A0C5VQ86      ------------------------------------------------------------
A0A1V8MBH1      ------------------------------------------------------------
A0A0R0BVC7      ------------------------------------------------------------
A0A3N5J7U8      ------------------------------------------------------------
A0A1S7S3I8      ------------------------------------------------------------
A0A519E8D7      ------------------------------------------------------------
A0A3S1NZ06      RASARYQQYKSIVDSGSENAFKDAAISSDQPSSSVIAALKTRYLTVAKRQQDVEANFGPQ
A0A3S1FD32      ------------------------------------------------------------
A0A434DUT4      ------------------------------------------------------------
A0A528D3U3      ------------------------------------------------------------
A0A3S3UPT3      ------------------------------------------------------------
A0A3S1E286      ------------------------------------------------------------
A0A531AC71      ------------------------------------------------------------
A0A436K268      ------------------------------------------------------------
A0A434IDQ0      ------------------------------------------------------------
A0A435IRM5      ------------------------------------------------------------
A0A3S2C404      ------------------------------------------------------------
A0A435F6C0      ------------------------------------------------------------
A0A435BMN6      ------------------------------------------------------------
A0A529XQ54      ------------------------------------------------------------
A0A530BJC1      ------------------------------------------------------------
Q44570          ------------------------------------------------------------
A0A655ZZQ1      ------------------------------------------------------------
A0A1S0ZAI3      ------------------------------------------------------------
A0A1W9M770      ------------------------------------------------------------
A0A1W9M7R6      ------------------------------------------------------------
A0A3C0L0A8      ------------------------------------------------------------
A0A176S762      ------------------------------------------------------------
A0A377ZC40      ------------------------------------------------------------
A0A378BPJ7      ------------------------------------------------------------
A0A2J5PAJ7      ------------------------------------------------------------
A0A377ZDN3      ------------------------------------------------------------
A0A1W9WUD9      ------------------------------------------------------------
A0A1W1ZQK0      ------------------------------------------------------------
A0A4U1ALN4      ------------------------------------------------------------
A0A4U1B1A8      ------------------------------------------------------------
A0A1M7Y300      ------------------------------------------------------------
A0A4U1A967      ------------------------------------------------------------
A0A3N5MZ53      ------------------------------------------------------------
A0A534E4H4      ------------------------------------------------------------
A0A534I2B6      ---------------------------------------------MIAAQNELAQATENL
A0A1C2JGD0      ------------------------------------------------------------
A0A259LQ70      ------------------------------------------------------------
A0A4V2SPR5      ------------------------------------------------------------
A0A3N5PM86      ---------------------------------------------MVRLSAAMKGINEKI
A0A2E5YSA4      ------------------------------------------------------------
A0A519ERR1      ------------------------------------------------------------
A0A4Q3Q1M2      ------------------------------------------------------------
A0A4Q3MHR1      ------------------------------------------------------------
A0A520GDZ4      ------------------------------------------------------------
A0A318DSU0      ------------------------------------------------------------
A0A538PF21      ------------------------------------------------------------
A0A1W1ZH10      ------------------------------------------------------------
A0A1W2FF24      ------------------------------------------------------------
A0A524JYQ6      --------------------------------------------------QQLAELGVKL
A0A4Q3MA17      ------------------------------------------------------------
A0A0N0M5F7      ------------------------------------------------------------
A0A537M754      ------------------------------------------------------------
A0A1V1PDB4      ------------------------------------------------------------
A0A2M7C324      ------------------------------------------------------------
A0A4Q3HHG6      ------------------------------------------------------------
A0A3B7DTA4      ------------------------------------------------------------
A0A432ZK62      ------------------------------------------------------------
A0A1V5EEP4      ------------------------------------------------------------
A0A1V5EF48      ------------------------------------------------------------
A0A0S6X1X6      ------------------------------------------------------------
A0A537Y5L8      ------------------------------------------------------------
A0A4Q3L2X2      ------------------------------------------------------------
A0A4Q3T8J1      ------------------------------------------------------------
A0A4Q4ANM4      ------------------------------------------------------------
A0A4Q3UEC7      ------------------------------------------------------------
A0A1H5YYQ4      ------------------------------------------------------------
A0A1X4NLK2      ------------------------------------------------------------
A0A1X4NWB5      ------------------------------------------------------------
A0A1M5UQ38      ------------------------------------------------------------
A0A327YI48      ------------------------------------------------------------
A0A1B1PNL6      ------------------------------------------------------------
A0A2U8H9H9      ------------------------------------------------------------
A0A1X6YIC0      ------------------------------------------------------------
A0A1I5E9E9      ------------------------------------------------------------
A0A1X6Z7N7      ------------------------------------------------------------
A0A2E1DQ13      ------------------------------------------------------------
A0A1H8C800      ------------------------------------------------------------
A0A2N3EZ05      ------------------------------------------------------------
A0A1W9PMU6      ------------------------------------------------------------
A0A1G3VVY5      ------------------------------------------------------------
A0A2N6BZD5      ------------------------------------------------------------
A0A435NNF5      ------------------------------------------------------------
A0A3S2AQS7      ------------------------------------------------------------
A0A436XH86      ------------------------------------------------------------
A0A527ZPD6      ------------------------------------------------------------
A0A529KRW3      ------------------------------------------------------------
A0A530ZLX0      ------------------------------------------------------------
A0A355TB56      ------------------------------------------------------------
A0A524M660      ------------------------------------------------------------
A0A0C1TRU6      ------------------------------------------------------------
A0A2Z5SSF4      ------------------------------------------------------------
A0A327LYE6      ------------------------------------------------------------
A0A5A9ZTV3      ------------------------------------------------------------
A0A4Q4CIB1      ------------------------------------------------------------
A0A522ACJ9      ------------------------------------------------------------
A0A3N5Z7F8      ------------------------------------------------------------
A0A239HD34      ------------------------------------------------------------
A0A534V9L7      ------------------------------------------------------------
A0A0P7ZZE4      ------------------------------------------------------------
A0A369R0Q9      ------------------------------------------------------------
A5G4N9          ------------------------------------------------------------
A0A238LBD3      ------------------------------------------------------------
A0A0P1FRV5      ------------------------------------------------------------
A0A0P1FWI8      ------------------------------------------------------------
A0A1M7BLL7      ------------------------------------------------------------
A0A0H4KZM1      ------------------------------------------------------------
A0A1V1UJT2      ------------------------------------------------------------
A0A0L6CVX1      ------------------------------------------------------------
A0A1V0RR48      ------------------------------------------------------------
A0A0A0HJJ4      ------------------------------------------------------------
A0A5E7YA28      ------------------------------------------------------------
A0A348SRI7      ------------------------------------------------------MLATSQ
A0A354EI73      ------------------------------------------------------------
A0A4P7EP83      ------------------------------------------------------------
A0A3A4NIE9      ---------------MGGDDPMKIPFLDTLLKENTKRPEHESGPLFSTGEED--------
A0A3A4NUI9      -----------------------MIQFPFFKRNGRPHVKRGPYDIFAVGKED--------
A0A524I3Z6      -----------------------MTRFPFYRKNDALPASHHSVDLFSVGKED--------
A0A524PCL7      -----------------------MIKFPFFRRNGHLPAGRRPFDLFAIAKED--------
A0A356GQV1      ------------------------------------------------------------
A0A1J5DAY8      -----------------------MKIFTMGGGRPGTESPSGRIGILNLRSID--------
A0A524P237      -----------------------MLL------PKEADMPSDRKAVFDPRDID--------
A0A1G3JY11      ------------------------------------------------------------
A0A661N3U1      ------------------------------------------------------------
A0A3S1WTQ1      ------------------------------------------------------------
A0A440NX85      ------------------------------------------------------------
A0A530CUR9      ------------------------------------------------------------
A0A1M6N1X5      ------------------------------------------------------------
A0A561M3U0      --ALQQTADAKTRMLELQQKRDELSSR-FTGSHPEVIALNAQIATLRAQESV--------
A0A2W5J775      ---------------------------------------NQAKDSVRGKFRQ--------
A0A1F9E324      ----------------------------YKSEYPEMKRLRNQMETIQKRLTL--EGNRII
A0A432SAI6      ------------------------------------------------------------
A0A4Q3LBH4      ------VQLLLERRADIQGQYQQQLAT-RQEDYPTVAAAKAQLRELDRQIGS--LAGNIR
A0A4Q3LWP3      ----MNRQWLLVLRS--------QLSI-HREDFPAVVEITAQMRELARQINL--IGGNIR
A0A2N6VGL1      ------------------------------------------------------------
A0A3M3H5V6      ------------------------------------------------------PGKNSR
A0A2T4ZJZ6      --TLTGVVEMKTQITLLQQKRDELRQK-FTESHPNVIAVDKQIARLQSQLQS--HNQMIK
A0A1T2KYM8      -----AAKEAKREELDSELEIAQLAKR-YGPKHPKMIAAKAAHQARISRMKK--EVDIVL
A0A2G9ZR82      -------THLKNEYAKLYAKYEEMSTT-FHDAYPPVNALKSNMASISEQIKT--EENKIF
A0A4U9I390      ------------------------------------------------------------
A0A534XP85      ------------------------------------------------------------
A0A2X3M011      ------------------------------------------------------------
I2WC85          ------------------------------------------------------------
A0A400JH80      IANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSELDQAEEKLNVYRQQRDSVDLNLEAKA
A0A2H9EHM4      ------------------------------------------------------------
A0A380B3D7      ------------------------------------------------------------
F5NSX0          ------------------------------------------------------------
D8EEU7          ------------------------------------------------------------
A0A479JNB1      ------------------------------------------------------------
A0A5C9AF52      ------------------------------------------------------------
A0A0P1H2H0      ----------------------------MVEQSKKVLRQKRQARRAARAARA--------
A0A258WKV0      ----------------------------FRLRSIEASSAVDTLVEQDKRVRY--------
A0A377N8F8      -------MAVTTQLNGLRFEEAELSKR-YTSAHPIYRALDEKRKTLLANKAA--LELKIN
A0A3C2DSE7      ----------QADRAHARSRVEELSRR-YGDRYPAMQSARSDLNAATASLRQ--QVEQVV
A0A2X1JBG5      ------MVGLEKQLNELTFREAELQQL-YTRQHPAYIALLEKRQTLLNTKNA--INKSIK
A0A0B8PTA8      ------------------------------------------------------------
A0A0B8QF75      ------------------------------------------------------------
A0A4Q3LR91      --DNGASSTLRARRAELSGDYARMMQQ-FDAGYPPAKALQAQIRALDASLRS--EDNRVS
A0A4V1TR68      ----------------------------FAPDYPPAKALREQRKQIDASIER--EQARVT
A0A444IY46      ------------------------------------------------------------
A0A660AID0      ---------------------------------PAYKSLLDKRQTLLQEKER--LNKQVQ
A0A3E0WKI3      --MLNQVVEVEQRLAEMDLERSQLRMS-YASQHPNIIALDEQMERLRERRRE--FDSRIR
A0A1H3I2J1      --FGTSTVEVTEIGEPARAAPAPVARDTLADSFDALDALDAQPLALEDELRS--------
A0A1V5DJV0      --------------------------------------MMQQLPVAERELAQ--------
A0A520IUC4      ------VQALRAERAKLEADYRERLAT-FKPDFPDMVALRNRIQEIDISLRR--ETGEVS
A0A521LJG5      ----------RIQDVELTRKGAELASQ-LGDNHPKIQAVRSELNAVRARFIT--ETQRIT
A0A531IBQ7      ---------------------------------------------VSKQIFD--QLNQLT
A0A377LY04      --VLDSMVNIDAQLNELTFKEAEISKL-YTKRHPAYRTLLEKRRTLEEEKAK--LNDRVT
A0A5C9ABR5      ------------------------------------------------------------
A0A5J9WU72      ------------------------------------------------------------
A0A2X3K9R3      --VLDSMVNIDAQLNELTFKEAEISKL-FTKAHPAYRTLLEKRQALEDEKSK--LNGRVT
A0A3T9EHW9      ------------------------------KVHPAYRTLLEKRQALEDEKAK--LNGRVT
A0A484X141      --VLDSMVNIDAQLNELTFKEAEISKL-YTKVHPAYRTLLEKRQALEDEKAK--LNGRVT
A0A5N9VWI6      --VLDSMVNIDAQLNELTFKEAEISKL-YTKVHPAYRTLLEKRQALEDEKAK--LNGRVT
A0A3D3PV27      ------------------------------------------------------------
A0A376LLF8      ------------------------------------------------------------
A0A444R390      ------------------------------------------------------------
A0A1V4WHZ7      ------------------------------------------------------MVNAIK
A0A1E5AJN5      VLESQAIEGLKQRLATLRADYQDKLSI-YKPDFPEMVRLAGQIEDTQNQLAK--EISIIS
A0A2N3D2J1      --NNGTIQQLTQRRAQLQAEYQEKGRL-FRSDYPVMVQLAAQIAEVNRQIDR--EAGNVR
A0A2N2GVE1      FLNKPAIVSLRSRYHSAQEKLKEVQVE-VMERHEEVIRQERILDVVRGQLTS--ELALSE
A0A2N2INV3      FLNKPTIVSLRSRYHAAQEKLKEVQVE-VMERHEEVIRQERILDVVRGQLTS--ELALSE
A0A1Y5DXG5      --VLEQIVELDTKLQELDLERLAMSRK-FKRNHPNYQGIVEQISAVQKQRDA--LAQKIA
A0A0B8P2H5      --TLKVMVELEAQLNELTFKESELAQR-FTKQHPAYVAVLEKRKTLEAQKRR--LEGQIK
A0A483QWI8      --VLEQIVNVDNQLNELTFRESEISQL-YTKEHPTYKALIEKRETLKEERAK--LNKKVT
A0A483UXD3      --VLEQIVNVDNQLNELTFRESEISQL-YTKEHPTYKALIEKRETLKEERAK--LNKKVT
A0A0A8J8L3      --VLDQIVNVDNQLNELTFREAEVSQL-YTKEHPTYKALMEKQQTLQTEKIK--LNKKVS
A0A660DJ38      --VLDQIVNVDNQLNELTFREAEISQL-YTKEHPTYKALIEKRQTLQQEKTK--LNKRVS
A0A380AQW6      --MLDTQVQLEGQLNELTFKEAEISKL-YTRVHPAYRALLEKRATLEAEKAR--LGKQVQ
A0A2G2GD62      --TATNLNELIINYQTALTNRRSMLVS-VTEFHPEVIKLNEEVFNLRKNIQA-----TVV
A0A524P331      --DDPLIGTMASKLTELEMQRRALVAE-NTERHPQVKAVQGQIDQLQGKIQSTFETARLN
A0A4V1SSM5      ------------------HDQTQILER-YGPRYPDAIRVTQQLEQIDRQIAD--ESRRIV
A0A4Q3K8G7      -------------------------------------RARDELAKVDGEIQA--EIRRVM
A0A1M7HC79      --TIQQFIALEQQLNELEFQEAEMAQR-FTPRHPNYKTLQRKKRQLQQERAE--LNERVN
A0A1D3JZN6      --VLDQVVALDTGISELKLQQAEMDRK-FTRQHPAYRALLAKLDELTGKQAQ--LTKRIE
A0A1V6ESG1      --ENKTVQTIKEQKAKLEAEYLVNLGT-YKPDFPKMLQTKAQIAELDLRIKA--EIAAVL
A0A1H7YHK3      --LLEQQVAVETSIQQLHMQQAEMDRS-FTREHPAYRALMKQIGELESRKAG--FNKQVG
A0A534SH66      ------------------------------------------------------------
A0A3M0ZZ99      ----------------------------MEALRGELAAIEGREAEVTAELRRALQQGNLS
A0A328C2K5      LVDSPALKRGLDRESELLERRAELTTR-YLDEYPEVRAVDEQLAVVRQSIDE--EIGRIR
A0A5C6X8M3      LVDNPALKRGLDRESELLERRAELKTR-YLDAHPEVRAVDEQLEVVRRSIED--EIGRIR
A0A3D8MRR7      LVDNPALKRGLDRESELLERRAELKTR-YLDAHPEVRAVDEQLEVVRRSIEE--EIGRIR
A0A5C6UBJ7      LVDNPALKRGLDRESELLERRAELKTR-YLDAHPEVRAVDEQLEVVRRSIEE--EIGRIR
A0A5C6XGM3      LVDNPALKRGLDRESELLERRAELKTR-YLDAHPEVRAVDEQLEVVRRSIED--EIGRIR
A0A537NZJ1      ------------------------------------------------------SSARLT
A0A4Q4CVW6      ------------------------------------------------------EIGKVG
A0A090R136      --TLDMMVKIESQLNELTFKESEISQR-FTKEHPAYIALLDKKSVLISERKK--INKQVQ
A0A661JU93      ------MRSLKEKLTSLEIQKAMLLEK-YTELHPEVVAVNREIAKTKEELNR--AVANAL
A0A2E2T3V8      --KDDQVRDLQVKYEVLQQNYAELEQR-YQPAHPSMVRITGEIWSVQQTLAK--ALERSA
A0A367UAB4      --KDDQVRDLQVKYEVLQQNYAELEQR-YQPAHPSMVRISGEIWSVQQTLAK--ALERSA
A0A377V641      --VLDQIVNVDNQLNELTFRESEISQL-YTKEHPTYKALMEKRKTLQDERGK--LNKRVA
A0A1F2YJ88      --FLTQSVTLETQKAQLEQQVAEAGAK-YTAEHPVMQQMNAQLGAINKKIGE--------
A0A0J7XGZ1      ALASDTIRQLRQQEAQASARLAQLDAR-YGALHPDVVQARDELADVRAQLGA--ELGRIV
I4CBA7          --DNEFLSTLKKNSAALKADYVSAASV-LGSGHFQHSLAQGKLYAMEKAISE-VEQSEIA
A3VE95          --TSPLLERLNQDKLALERQDAQWGAS-FGPDHPQRVRIANEIAGVEAEMQT--EAERII
A0A1G0NL95      --RLTRLLEVDKQITELRQKRDETAQQ-FAPGHPRMLALAQQEARLQTAARS--LNDWVK
A0A024KA69      ----------------------------IDGVLADVAALRAQVTVAGEAVRAAQQALGLR
A0A0L1KFN4      --SNYAINNLRQKRAELESEYRELMVR-FEPGYPQAQSLQSRIDELSRAIER--EEARVS
A0A3P5DSS6      --VLDQIVNVDNQLNELTFRESEISQL-YTKEHPTYKALMEKRKTLQDEKAK--LNKRVS
A0A483YEL5      --VLDQIVNVDNQLNELTFKESEISQL-YTQEHPTYKALMEKRKILQDERAK--LNKRVS
A0A658GUJ0      --VLDQIVNVDNQLNELTFKESEISQL-YTQEHPTYKALMEKRKILQDERAK--LNKRVS
A0A358L616      --ALDSSVSVQSQLNELTFREAEVSQL-FTKDHPTYRALLEKRKTLEDEQKK--LNHKIG
A0A3D5UYX7      VLASGTISGLRQKQAELAREKANLSAK-YGPRHPAIVNIEAQQSDIGSQISA--EVSRII
A0A2N1WQN5      ------------------------------------------------------------
A0A352G2C2      --VLDRIVDLEKQISEQNLKRTEMERR-FTRQHPNFQALMNQINQLQMQKEE--LEKQIG
A0A3C0PZN1      --VLDRIVDLEKQISEQNLKRTEMERR-FTRQHPNFQALMNQINQLQMQKDQ--LEKQID
A0A524QFS4      --IRQSLAAHSKDLTESNAERDRLLSL-YTDQHPEVITQDQLILAARRQYEEAIENAESL
A0A520JSW4      --SSVNAAPLRAQIAALDAEYQQKLQG-FRPDYPEMIALKARIDALRTSVIR--ETHTAN
A0A4Q3LTF3      --RNVAINNLRQRRAELAAEYQRLMIQ-FEPGYPAAKAIQSQIDQLDRSIGR--EEGRVS
A0A537UTP9      --KSEVINKLRSQYLDFSRQAAELSAK-YGARHLAVVDLRARMQEIRKVIID--ELNRIA
A0A1D2RNR5      ------------------------------------------MDELKARINA--EVQSVL
A0A4V1TQ46      --SDPSYQGLSQQRARAVAQYEQDAKH-WTPDYPEMVQQTAQIRGLDRQINA--VANRVK
A0A3A0FZC0      --DDPSTQHMRGELAKLEAEYQQLSAK-FTSSYPRMVQLKAQISGLKQSIEG--QRRQVV
A0A1N7JVZ7      --EADPVTPPVAQKPDQTPETHPLPPQAIAPTREPEKPLPTAMPPADTTRDAQELDEADE
A0A091C4A8      VLGSEIVQALQERRADLQAQYQDKLSI-FKPAFPEMQQLQAQIDELDRQIQT--EVGNIK
A0A4R3H6P6      ALGNDAIASMRQRRADAAAEYAKLMVQ-FRPDYPQAQALASQVQALDVSIAQ--EENRVR
A0A3S1NQ09      QPSSSVISALKTRYLTVAKRLQDVEAN-FGPEHPQAVALSKEKADISTQIFG--ELKQLT
A0A443GJ52      QPSNSVISTLKTRYLTVAKRQQDVEAN-FGAEHPQAVALAKEKADISAQIFG--ELKQLT
A0A2W6S588      GVDTTALSTLREQRAEASRDLAGLTSR-YGDRNPQVIDARQKVADLDTAIGR--EMASMS
A0A483E0N4      --VLDQIVNVDNQLNELTFRESEISQL-YTKEHPTYKALMEKRKTLQEEKAK--LNKKVS
A0A2J4YQQ6      --VLDQIVNVDNQLNELTFRESEISQL-YTKEHPTYKALMEKRKTLQDERGK--LNKRVS
A0A483THX4      --VLDQIVNVDNQLNELTFRESEISQL-YTKEHPTYKALMEKRKTLQDEKAK--LNKRVS
A0A534MVS2      --RDLDALLSESRRNNMLLGEAAIWKKFLESAEVAEAVRLQAMDLLKHVVENDFSIDVFT
A0A444I5K6      --DSSISNDLRKKYLEASKLETEIEAR-LGPDHVQAVRLRAEMEEYKRLMFD--ELNRIA
A0A154VE85      VLNADLVRELRLQEAALQRRIAELRVE-YRDDHPRLQEALSESEGLRRTIAG--EVEKIG
A0A3S1MCW7      VLESAGLQKLSDKLADLTSQYQQKLGI-LKPGFPEMQQLQSQIKELQRLYNN--GVLTIT
A0A434IGN6      VLESEGLQKITDKLADLTSQYQQKLGI-LKPGFPEMQQLQAQIKELQRLYNN--GVLTIT
A0A528AX40      VLESEGLQKITEKLADLTSQYQQKLGI-LKPGFPEMQQLQAQIKELQRLYNN--GVLTIT
A0A528MV95      VLESEGLQKITEKLSDLTSQYQQKLGI-LKPGFPEMQQLQAQIKELQRLYDN--GVLTIT
A0A3C1S9Y1      VLSNDIIKEIKKMEVNLYNKMSELSKK-YGSNHPQMVAIQSELAELHQRKAT--EGKRIV
A0A353EH49      --LLTEMSHLGAAILELEQERKELRNL-YKPEHSVIKALDEKIQLLKIEQRKLEIDADVL
A0A1Y1Q9C1      VLNSPVVESLKQNLATLEAEYREKLKL-FKPAFPDMVSLQGRIDEVRGQLNR--EMSSLR
A0A3M7LJH0      --TLEVMVKLEAQLNELTFKESEVSQR-FTTDHPAYKSLLDKRQVLLGEKER--LNQQVQ
A0A316KRG4      --DFAGDRASKPEPAAPAPRKSKIKAIKKHPAPKAAAPVSAKRISADSDSRP--EPARDH
A0A1E4JHX8      --TNNAITGIRQKRAEVAAEYARLLSQ-FEPEYPEVKALATQLSQLDRSIAS--EENRIR
M2U8P2          --SSSLLRELRAREAALSAERADLAGR-YGERHPSLANIDRQLSDLNERISE--EIARER
A0A1H7KZF8      VIGNAAVQSLVSQSTDVQARLNAAAAR-HGPEHPEVRQLTAQATALHRELTR--LADGIK
A0A0J5Q9T7      --MAERRKFHRRHGPTQDATGTQPAED-LAPISPLETRAERQARRTAERIRANAAQSIVE
A0A257NG76      --VLKGVVEIQTQITLLQQKRDELRQK-FTESHPSVVAIDKQISRLQGQMNS--NDKKIE
A0A1T4TW59      --NHPQVRDVKSAEIDAERKVSELAKR-YGPKHDKMIQARAQLDAVRARSRAVIRELGIG
A0A1I5YYQ0      --SGEARDKPRTFRRKNPPRRTPEAQRPAGPPEARPDPADKEPDVPRKTLTE--PPVRLE
A0A5P9FE62      --SGEARDKPRTFRRKNPPRRTPEAQRPAGAPEARPDPADKEPDVPRKTLTK--PPVRLE
A0A1Q3MB35      --NNQALNLMRDRRAQYASELASSLAV-FEPEYPQVQALQSQLSELDRNIAR--EEARVR
A0A259LUN7      VINSALINQLKSQRAEILRRVAELETR-VGDRHPDLISARNEVADIDRQMMA--EMNRIA
A0A2D7AVL1      --DSPDLKKLREQRFQLDTEYQNKLEI-YRPEYSEMTELKRRIELTDREIEA--ERTRIV
A0A3B9KZE9      --------------------YQNKLEI-YRPEYSEMTELKRRIELTDREIEA--ERTRIV
A0A2U0NMP8      --VLDQIVNVDNQLNELTFKESEISQL-YTQEHPTYKALMEKRKILQDERAK--LNKRVS
A0A4U9HNE9      --VLDTQVQLEAQLNELTFRESEISKL-YTRAHPAYRALLEKRATLQQEKAR--LGKQVQ
A0A2G2CXY6      --ILDQIVELDTMISELNLRRAEMERR-FTREHPNYQAMLQQMQQLERQKAA--LEARVG
A0A3M1D4H3      --ANKLVARLQDDLTNLRQKRANELTD-KTPEHPDIQNLDKLIAETEAQLAEALAAQHAL
A0A5C8BYM7      --ESKTIQDYKAQRSKLDLEYEQSAKV-YKEDFPKMQQLKAQMNDLDAKIQS--EVASIL
A0A1J5ICP0      --KSERLNALAQKLSELQSRMITLKIN-YKEKHPLVVEAVEQIKETKKGIMA--ELSSII
A0A0M3GBT1      --LPDDITSKQRDLHAQEDDLARLLEL-YDGNAEAVVDLRGKIEKSRADLSF--ATKQYL
B3Q577          --LPDDITSKQRDLHAQEDDLARLLEL-YDGNAEAVVDLRGKIEKSRADLSF--ATKQYL
A0A379B9V4      --TLDTIIQIEADLSELSIQESEISRK-FTLKHPSYVALIDKRNVLNAEKER--LNKQLE
A0A0Q6TS97      ALGNDAIASMRQRRADAAAEYAKLMVQ-FRPDYPQAKALASQIQALDAAIGQ--EEGRVR
A0A0Q6UYB4      ALGNDAIASMRQRRADAAAEYAKLMVQ-FRPDYPQAKALASQIQALDAAIGQ--EEGRVR
A0A484XS37      --VLDTVVGVEAQLNELTLKEAEISKL-YTKEHPAYRALMEKRATLQQEKDK--LNKRVS
W7Q5J0          --AVQRYIDIERRINELEFQEAELAQR-YTTSHPSYQTLLRQKRHLQAEKTQ--LNNRVN
A0A654AKT6      --VNKKVVALYAVGLFISFSKSSLILFIFLALFPLRHKLRLIHPLV--------------
A0A0G9MZA5      --ASATADALRARRAELQVELAELRSR-FSPSYPPVQALQVQIDELERAIRE--EQAGAQ
H0T8B0          ALNSPVINGLRDDFLKDKSKEAELSAR-YGTDHQAAVQLRERMAARQQAIWD--EIGRLA
A0A5C7N981      --DNKLIAEYKARLSKLEGDYQEGLTT-YKPGYPKMQQMESQIKELQAKISQ--ETKGAI
A0A534TV22      --NQGLVPQLRSTLLSLEAEKVKSSTV-FKPDHPRMIELNQQITEARRSLNA--EISSVV
A0A351CXR4      --TENRLVQLSEALQLAKEDYARLAQR-YGPRHPKMIEAESEIQRTQASLKM--GGGQAV
A0A2N6GLF5      --SDSLVSSLREAEAEAQRKVSSFSKR-YGPKHPKMIEAQADLTEARLNVQR--QIESVI
A0A1W9LJP0      --NNPLVQDIKKMEVELYNRMSELSKK-YGAKHPQITAITSELATLQERKMG--EAKRVV
A0A0W1ICB0      --SNQSLSTLRQRRAEANAAYQELLVQ-FEPEYPQAQAAREKVAALDRAISA--EETRVR
A0A2E0UL88      --SQKSLKDLRARSKELEMRINKLASD---------AMESGDLTTSPLQLSR--DLRRSI
A0A233IKJ2      --NHPTIRDVKLAEVQAERKVSELSKR-YGDKHPKLKAAQAELASVKRNLNS--ELKQLL
A0A2T1JE00      --NHPTIRDVKLAEVQAERKVSELSKR-YGDKHPKLKAAQAELASVKRNLNF--ELKQLL
A0A0T2QIS1      SITNPTIVALRDRRAQAAADYAKLMVQ-FEPGYPAAQALQEQIASLDSAIAR--EDARIV
A0A376KYN0      -------MNVDNQLNELTFREAEISQL-YKKDHPTYRALLEKRQTLEQERKR--LNKRVS
A0A2X1JB05      --VLEQIVNVDNQLNELTFREAEISQL-YKKDHPTYRALLEKRQTLEQERKR--LNKRVS
A0A376RML0      --VLEQIVNVDNQLNELTFREAEISQL-YKKDHPTYRALLEKRQTLEQERKR--LNKRVS
A0A377E5P7      --VLEQIVNVDNQLNELTFREAEISQL-YKKDHPTYRALLEKRQTLEQERKR--LNKRVS
A0A0P7Y1D0      VLRSETIRALRAQQTDTSRRRSDLTSR-YGPRHPEILAVEREAADLEEQVNR--EIQRIV
A0A2M7JRZ7      ILENKLVMDLKQAYIQLEAQYMKLSET-FKPEYPEMVRLKNQMQSIQRRMDV--ETNKII
A0A167IR75      ALSNNAINNLRQRRAELNAEYQDLMIR-FEPGYPQARAIQSQIEALDQAIAR--EESRVS
X7F6S5          -------------------------------------------ESRSAAAEE--ARARDG
A0A1G7CFZ2      -------RRAEAERV------------------AEAARLQQQVEKEARRQRE--AERRRT
A0A1P8USW9      --EDDARRKAEAKRKAEDARRAAERLEAVQRQRAEAARRKREAEEQARKQAE--DAAREA
A0A1I6U4V1      -------------------------------------------DREAEEARA--AEQRRA
A0A1G8NKI0      -------------------------------------------QREAEADAE--DQRRRA
A0A355QPE4      -------------------------------------------QREAEAAAE--DQRRRA
A0A357RN98      -------------------------------------------QREAEAAAE--DQRRRA
A0A3B8T2U6      --NHPTVQNVKKQQLNAQSRVSELAKV-YGPRHPKMIAANAELESIDDSLAR--QVRALV
A0A365PWR2      --YLNQLVALDSKISALRLQQTELASR-FTSEHPAYQTLVNQIESLTLEQQS--LARKIG
A0A2E9H5Z8      --PGSQVPFLRSRIQESQLNMEAMQASGLGRKHPSMEMALIAQNKMQENLET--AVTVLR
A0A2E2BR79      --VIAQLIDVEKKLSEVEFQEAEMAQR-FTRNHPAYQALMRQKSFLRNERDR--LNARVE
A0A0Q4Q524      --RNQAINTLRQRRAEFAAEYQKLLIQ-FEPEYPAVKALKSQIDQLDRSIAN--EERRVS
A0A0Q4CFJ9      --RNQAINSLRQRRAEYAAEYQKLLTQ-FEPEYPAAKALKSQIDQLDRSITN--EERRVS
A0A0Q4FE58      --RNQAINALRQRRAEYAADYQKLLTQ-FEPEYPAARALKSQIDQLDRSISN--EERRVS
A0A0Q4JWC8      --RNQAINALRQRRAEYAADYQKLLTQ-FEPEYPAARALKSQIDQLDRSISN--EERRVS
A0A0Q4KFL8      --RNQAINALRQRRAEYAADYQKLLTQ-FEPEYPAARALKSQIDQLDRSISN--EERRVS
A0A522R8R0      --NTNIINDLRVRYLDVTRREQQIESQ-FGKDHPQAVALRHQQEELAGQIYQ--ELKQLT
A0A2U9NDY5      --VRDQSVQRETQLAERARKRVEDDRR-YTREHPTYRTLMTQMNELQAQKAQ--LLKKVD
A0A0Q4IGG1      L-RNQAINTLRQRRAELAADYQRLMVQ-FEPGYPAARAIQTQIDQLDRSISR--EESRVT
A0A534RUJ5      VVNNTLIQALKEQLTTLQGQYAQLSTQ-FKPAYPRLAQLKAQVVDTEQRVQK--EIQRVV
A0A3M1CJM3      --SNPLIQQLKANYVKLKEEHTELSTK-YLPDHPKMKVVENKLKLLQRSINR--EIDNVL
A0A2R7SVD4      --VLGQSVALETRISELKMQQAEMDRK-FTSQHPAYRALMSQIGELTQQQKS--LAGKVQ
A0A3C0PWB6      --VLDQIVQLETQLSELTLKRVDYDRL-YTREHPTYRTLMSQMNELQAQKAQ--LLKKVD
V4Q8B7          --VLDQIVALETQISELSLKRVEYDRL-YTREHPTYRTLITQMNELQAQKAQ--LLKKVD
A0A0Q8XKK5      --TNPAISSLRQRRAEVASELAKLSVQ-FEPGYPASRALAEQLQSLDSAISR--EEARVD
A0A2E0Q2W0      SVANAGAATIRSRIAXVEATLARLRTT-LGPENSQVEASEAELRSLRSALSK--ESGITG
A0A660NIR6      --NNPAVVAARAAEANAEKRMAEVAGS-MGASHPAYKQAQSELELARSSLRK--QSEAVI
A0A142W0R3      --SNAAVSALRQRRAELMADLARLRKI-FGEEYPEIVAKKEQLAALNQSVST--ETQRSR
A0A0S4XR18      --PNSSINNIITALQQKNAARTALLAE-YTPKHPDVIEISEEISALEVSLRG--SIKSLY
A0A2E0GW64      --MLTQLVKSQNDLEALKLEKTQLQQG-FTEKHPIVIAINEKIHKQQAALSA--LESEAK
A0A1A7QJ97      ALGNTAINNLRQRRAELAADYQQLMVR-FEPGYPAAQAIQQQIDALDSAITR--EESRVS
A0A661LW70      --NNELIRQIKSMEIGLYKRMSELSKK-YGQKHPRMVAIESELNTLQKRRTQ--EVSRVI
W7Q8F9          --AVQRYIDIERRINELEFQEAEMAQR-YTHSHPSYRTLLRQKRHLQNEKSQ--LNDRVN
A0A524PXH8      IVNSPLLKSLVEQLAQAEGERAELADR-FTSEFPKLRALDARLSQARGRVMH--EEGRLV
A0A4Q3P0E4      --VLGTAVDRQTKLLDAQQRRRELEAL-FTPNHPLMQTLDAQIAALSRDIGD--VQGRIK
A0A3M2BE89      --LLDQSAKLEQQISELKLKKLELRRR-FTDNHPVIQSLEDKLGRLQTEQQT--LEQRIK
A0A4Q4A6K6      --LSPIINNLRQQYLDYSRRESELSLK-VGKNHIAVINLRNRMRDIRTSIMD--EVRRLA
A0A257G674      VLANPAISQLLSERARVQSELQKQRAN-HLEDYPAVAQLRAQVGVIDNQLQS--VARSIR
A0A661M5M6      --DDPTLGDLVTELRNKEQEHEALAVK-YGGEHPTMKTLAHELEALAKQVTK--EKAAII
A0A1I1UM01      --QRAEAEAQRQAEAERLRVEAETRRR-AEEVRLREETEARQQAEEDRQRAR--ARADQV
Q44573          LSQEPILVATANALMQLQSTRQEEAAT-YGPQHPRLRALDQQIATTRASLEA--ETQAAL
A2W025          --YEQQIAAQRLQLASLAQRFTDSHPM-VIAAKQQLAELQGEKDKFSNRFRS--LPATEV
A0A534Z362      FLDRPGIQKLHLALLDLRAQRAGLGQR-LGPKHPQILELGRQQAEIEQQLGA--EVAQEV
V4J283          --VLTSIMEIENELFTLQQERETLRSR-FKPTHPKIRSLDGLMATLTGKLRT--LEQQTE
A0A536T443      --RSSALSAALKELADRQAELRVLRFR-YADTHPPVRRLAQQVDTLARFVIP--ELGG--
A0A0Q4UFQ5      QLDNTANSTLRTKRAELAADYARMLQQ-FDPAYPPAKALQAQIRSIDAALRG--EGSRVD
A0A527W7E6      QPSSSVIIGLKTRYLAIAKRLQDVENN-FGKDHPQAVALAKEKADVSAQIFG--QLKQIT
A0A432EMV7      VLNNTLIQALKQEQSQLQRKVSELSGR-YLDKHPKMIAAKADLEEAISRVEL--ETAKVV
A0A087LTV7      --LGSRVKVQREGPTYLVSVRANAPSP-IEAASYANAVANSFIHEEVAAKID--GVLADV
A0A534WLI3      LLDRPAIAKLHGTLLDLETQEAPLTHR-LGPNHPQMLELRRQQAAVQRQLAT--EVAGEI
A0A318KWA2      --AIEQFVALDSQLNELEFREAELAQR-YTPNHPAYQSLLRQKRHLEAERAA--LNARVD
A0A522MT86      --FDRRIADLQIQRTQLLDRYTPDSRW-VRNIDEQLGQLRAQKAEFDSRFAA--MPSSER
A0A4Q3I221      --DSSISNELRQKYLDASKREAQISDR-LGVNHIQAIRLRSEMTEYNRLMFE--EVNRIA
A0A534SAL6      FLDRPGVQKLHLALLDLRAQRAGLGQR-LGQSHPQMLELARNEAELERQLDA--EVAAET
A0A534ZDB4      FLDRPGVQKLHLALLDMRAQRAGLAQR-LGQNHPQMLELARNEAELERQLGA--EVAEET
A0A534X3M7      FLDRPGIQKLHLALLELRAQRAGLEGR-LGPKHPQTLELRRQQAEIEDQLRA--EVTQEV
A0A534SPC6      FLDRPGIQKLHLALLDLRAQRAGLGQR-LGPKHPQILELGRQQAEIEQQLGA--EVAQEV
A0A535AD60      FLGRPGIQKLHLAILDLRAQRAGLGQR-LGPRHPQILELRRQEDEIEHQLRA--EVGQEV
A0A4Q3SY08      --DSGVIQSLRGQRVAVSAKVADMQGR-YGARHPEILKAQRELADIDAQIQG--EVTRVI
A0A4Q3LG23      --RNSAINNLRQRRAELAAEYQRLMVQ-FKPEYPAAEAIQSQIGQLDRSIAR--EEGRVS
A0A522EX52      --FLRQLAELDKKLAELRISKIDMLQR-YTEEHPAFIALSRQIQEIKEDKKN--L-----
A0A1H3KC95      --EPTVANTGDASAPPDTGPSREAFDA-QLPKAAGKAEAHPTPPDMEPAPAA--SPASGA
A0A5P8Z4P3      --PQAIAPAHHPERPLRKSAEPVSRPV-TADDELDDIEDIEAAPSVSTASPD--TVAAPP
A0A0B3RZC9      --KEAEERRIQAERA-----------------------------DEERAAEA--RRKAAE
A0A2E9HXF7      --REAEEARSRQEAAAKAAQDAEDHRQ---------QVEKRAAEEAARREKA--KRDAEA
A0A520HUH4      --ISQQLASAKAEAAALRSNVAAAERQ-IAAGGSDAVSAVLSAPVITDLRRQ--RTEAER
A0A2K8U7M6      --DSPVIQRLQARKAELSADYQQQLKV-FKPGYPKMQQLRRALAELERQLRQ--EATAIG
A0A5B9DKL8      --ILAEQAALRDR-VIAAGVAVDRTQG-ILDATAEPGYEARQEAQAAQAQYQ--MLLGRL
A0A238KJM1      --AEKQIATERAQAEAEARKAEDDTKR-LTAEQARLTEEKQVAEAAAA------------
A0A3A0FJZ4      --REAERASQAQATEALLASQLRDLQA-ELASQARELDEIELARSGAALGAS--GDGGEV
W4HJV8          --SDSDSDSPEEDRSPEQATALAASDP-SVPTPSAAPENAAPAHDATVPAPN--LAYATP
A0A0P1GDI0      --KQAELAAQRKA-EAEAAERAEKQRK-QAEADRRAQEKAKEAQRQAERAAA--QRQAEE
A0A2R8ATV5      --EAEEQARLKAE-AAKRAQAEEAARL-QAEAKARAAEDARKQHEAEQAARE--EAEAQA
A0A1U7D3R6      --LEQTRAAEEAE-AARRAEDAERARL---------ADEARRQQEAEHRAQE--QREAEA
A0A2D4UVV2      --LEQTRAAEEAE-AARRAEDAERARL---------ADEARRQQEAEHRAQE--QREAEA
A0A0W7WHP4      --REAEEQARREA-AEHARREEQAQRE---------AQAQRAAEEQAHREAE--EQ----
A0A238J8F6      --RQAEIEAQRQA-ELAAREKAEAVRR---------AEEARQIAEAEEARQK--AEAEEA
A0A238JQI6      --EEARLAEERRK-AEDAARKAEEARL---------AEERRKVEDAARKAEE--ARLAEE
A0A222E077      --REAEEARSRQEAAAKAAQDAEDHRQ---------QVEKRAAEEAARREKA--KR----
A0A239E3Y2      --REAEEARTRQE-ATKAAQDAAEIRQ---------QAEKRAAKEAARRARA--ERDAED
A0A1W9HS52      KAALKKGAKLEDIQKHRDWIELRGYFRAAIESFANFETGIITIRIRTRHKDTSFNLAHVA
A0A2D5LFD8      SSSSNNSQSANTNFQN---LALNSISNDLPTL-ISV-MRSPLILSPIA-ESFDLSELQLA
A0A0N0XAV4      ------------------------------------------------------------
A0A0P9QD19      ------------------------------------------------------------
F3FHG4          ------------------------------------------------------------
F3GGI0          ------------------------------------------------------------
A0A0P9LE74      ------------------------------------------------------------
A0A3M4ZQ14      TAGQPGQFSLYDDEHR---LLLRGATNRVVEG-SGVTIQVAALQARPG-TDFTVSRQRTF
A0A3M5YLE8      TAGQPGQFSLYDDEHR---LLLRGATNRVVEG-SGVTIQVAALQARPG-TDFTVSRQRTF
A0A3M3RP89      TAGQPGQFSLYDDEHS---LLLRGATNRVVEG-SGVTIQVAALQARPG-TDFTVSRQRTF
A0A0P9QIY7      TAGQPGQFSLYDDERR---LLLRGATNRVVEG-SGVTIQVAALQARPG-TDFTVSRQRTF
A0A0P9VVH7      TAGQPGQFSLYDDEHR---LLLRGATNRVVEG-SGVTIQVAALQARPG-TDFTVSRQRTF
A0A0Q0FJK6      TAGQPGQFSLYDDERR---LLLRGATNRVVEG-SGVTIQVAALQARPG-TDFTVSRQRTF
A0A0Q0G2J0      TAGQPGQFSLYDDEHR---LLLRGATNRVVEG-SGVTIQVAALQARPG-TDFTVSRQRTF
A0A3M3LF66      TAGQPGQFSLYDDEHR---LLLRGATNRVVEG-SGVTIQVAALQARPG-TDFTVSRQRTF
A0A0P9WIR8      TAGQPGQFSLYDDERR---LLLRGATNRVVEG-SGVTIQVAALQARPG-TDFTVSRQRTF
A0A3M3KPE5      TAGQPGQFSLYDDEHR---LLLRGATNRVVEG-SGVTIQVAALQARPG-TDFTVSRQRTF
A0A3M4C263      TAGQPGQFSLYDDEHR---LLLRGATNRVVEG-SGVTIQVAALQARPG-TDFTVSRQRTF
A0A3M5AD05      TAGQPGQFSLYDDEHR---LLLRGATNRVVEG-SGVTIQVAALQARPG-TDFTVSRQRTF
A0A0Q0D3D2      TAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRAHPG-TDFSVSRQRTL
A0A0N0FS39      ------------------------------------------------------------
A0A3M6GHH2      ------------------------------------------------------------
A0A0P9R9W0      TAGRPGQFSLYDNEHN---LLLGGTTNRVVEG-NGIRIQVATLLARPG-TNFSLSRQRTL
A0A0Q0B9T0      TAGRPGQFSLYDNEHN---LLLGGTTNRVVEG-NGIRIQVATLLARPG-TNFSLSRQRTL
A0A3M6CFI7      TAGRPGQFSLYDNEHN---LLLGGTTNRVVEG-NGIRIQVATLLARPG-TNFSLSRQRTL
A0A0P9JXN0      TAGRPGQFSLYDNEHN---LLLGGTTNRVVEG-NGIRIQVATLLARPG-TNFSLSRQRTL
A0A3M6FIV7      TAGRPGQFSLYDNEHN---LLLGGTTNRVVEG-NGIRIQVATLLARPG-TNFSLSRQRTL
A0A3M3PLW9      TAGKPGQFSLYDSEHN---LLLGGAINRVVEG-HGIKIQVATLQARPG-TDFTVSRQRTL
A0A3M4ENY1      TAGKPGQFSLYDSEHN---LLLGGALNRVVEG-HGIKIQVATLQARPG-TDFTVSRQRTL
A0A3M5EZK7      TAGKPGQFSLYDSEHN---LLLGGAINRVVEG-QGIKIQVATLQARPG-TDFTVSRQRTL
A0A0P9SPP5      TAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGIKIQVAALRARPG-TDFSVSRQRTL
A0A658KL17      TAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGIKIQVATLRARPG-TDFSVSRQRTL
A0A3M3NNF2      TAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-TDFSVSRQRTL
A0A3M4A0E8      TAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRAHPG-TDFSVSRQRTL
A0A3M4PBZ2      TAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRAHPG-TDFSVSRQRTL
A0A3M6AI26      TAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-TDFSVSRQHTL
A0A0P9IWP8      TAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRAHPG-TDFSVSRQRTL
A0A0P9KZ49      TAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-TDFSVSRQRTL
A0A0P9V840      TAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-TDFSVSRQRTL
A0A0Q0AIE5      TAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-TDFSVSRQRTL
A0A3M2ZQH6      TAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-TDFSVSRQRTL
A0A0N8SQG2      TAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-TDFSVSRQRTL
A0A0W8HFU1      TAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-TDFSVSRQRTL
A0A3M5M873      TAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRAHPG-TDFSVSRQRTL
A0A0P9VHH8      TAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRAHPG-TDFSVSRQRTL
A0A0P9YV98      IAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-TDFSVSRQRTL
A0A3M3G2W8      IAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-TDFSVSRQRTL
A0A3M6C224      IAGKPGQFSLYDNEHK---LLLGGTINRIVEG-NGVKIQVAALRARPG-TDFSVSRQRTL
A0A3M5K254      IAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-TDFSVSRQRTL
A0A3M5JFB0      IAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-TDFSVSRQRTL
A0A3M3TQV3      TAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRAHPG-TDFSVSRQRTL
A0A3M3EF92      TAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRAHPG-TDFSVSRQRTL
A0A3M5J1E2      TAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRAHPG-TDFSVSRQRTL
A0A3M5G7H9      TAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-TDFSVSRQRTL
A0A3M4A376      TAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRAHPG-TDFSVSRQRTL
A0A0Q0A5T8      TAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-TDFSVSRQRTL
A0A0P9SCD7      IAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-TDFSVSRQRTL
A0A0P9T4G3      IAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-TDFSVSRQRTL
A0A0P9VKB0      IAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-TDFSVSRQRTL
A0A0Q0BM35      IAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-TDFSVSRQRTL
A0A3M3TPR7      IAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-TDFSVSRQRTL
A0A3M3U4Q3      IAGKPGQLSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-TDFSVSRQRTL
A0A0P9UCX7      TAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGIKIQVATLRARHG-TDFSVSRQRTL
A0A0P9S1F1      TAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGIKIQVATLRARPG-TDFSVSRQRTL
A0A0P9QCJ2      TAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-TDFSVSRQRTL
A0A0P9Q329      TAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGIKIQVATLRARPG-TDFSVSRQRTL
A0A3M5GJ64      TAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGIKIQVATLRARPG-TDFSVSRQRTL
A0A0P9MPC7      TAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-TDFSVSRQRTL
A0A3M2XYQ3      TAGKPGQFSLYDSEHN---LLLGGAINRVVEG-HGIKIQVATLQARPG-TDFTVSRQRTL
A0A0P9XCE1      TAGKPGQFSLYDSEHN---LLLGGAINRVVEG-HGIKIQVATLQARPG-TDFTVSRQRTL
A0A3M3EFX7      TAGKPGQFSLYDSEHN---LLLGGAINRVVEG-HGIKIQVATLQARPG-TDFTVSRQRTL
A0A3M5B9D9      TAGKPGQFSLYDSEHN---LLLGGAINRVVEG-QGIKIQVATLQARPG-TDFTVSRQRTL
A0A0P9RRZ3      TAGKPGQFSLYDNEHN---LLLGGAVNRVVEG-KGIKIQVATLQARPG-TDFTVSRQRTL
A0A3M2VEK7      TAGKPGQFSLYDSEHN---LLLGGAINRVVEG-HGIKIQVATLQARPG-TDFTVSRQRTL
A0A0N8R9B3      TAGKPGQFSLYDSEHT---LLLGGAINRVVEG-HGIKIQVATLQARPG-TDFTVSRQRTL
A0A0P9VA27      TAGKPGQFSLYDSEHT---LLLGGAINRVVEG-HGIKIQVATLQARPG-TDFTVSRQRTL
A0A3M4YBJ4      TSGKPGQFSLYDSEHN---LLLGGALNRVVEG-HGIKIQVATLQARPG-TDFTVSRQRTL
A0A0P9J470      TAGKPGQFSLYDSEHT---LLLGGAINRVVEG-HGIKIQVATLQARPG-TDFTVSRQRTL
A0A0Q0EVJ8      TAGKPGQFSLYDSEHT---LLLGGAINRVVEG-HGIKIQVATLQARPG-TDFTVSRQRTL
A0A3M5UI30      TAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-TDFSVSRQRTL
A0A3M5YQT8      TAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-TDFSVSRQRTL
A0A3M5F5X1      TAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRAHPG-TDFSVSRQRTL
A0A3M5R8G1      IAGKPGQLSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-TDFSVSRQRTL
A0A3M5V012      IAGKPGQLSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-TDFSVSRQRTL
A0A3M3GA16      IAGKPGQFSLYDNEHN---LLLGGTINRIVEG-NGVKIQVAALRARPG-TDFSVSRQRTL
A0A3M3UCT3      TAGKPGQFSLYDSEHN---LLLGGALNRVVEG-HGIKIQVATLQARPG-TDFTVSRQRTL
A0A3M3CJL0      TAGKPGQFSLYDSEHN---LLLGGAINRVVEG-HGIKIQVATLQARPG-TDFTVSRQRTL
A0A3M3F6F5      TAGKPGQFSLYDSEHN---LLLGGAINRVVEG-HGIKIQVATLQARPG-TDFTVSRQRTL
A0A3M3P9B7      TAGKPGQFSLYDSEHN---LLLGGAINRVVEG-HGIKIQVATLQARPG-TDFTVSRQRTL
A0A0N8QB74      TAGKPGQFSLYDSEHN---LLLGGAINRVVEG-HGIKIQVATLQARPG-TDFTVSRQRTL
A0A0Q0AUD0      TAGKPGQFSLYDSEHN---LLLGGAINRVVEG-HGIKIQVATLQARPG-TDFTVSRQRTL
A0A3M5VR55      TAGKPGQFSLYDSEHN---LLLGGAINRVVEG-HGIKIQVATLQARPG-TDFTVSRQRTL
A0A0Q0FK97      TAGKPGQFSLYDSEHN---LLLGGALNRVVEG-HGIKIQVATLQARPG-TDFTISRQRTL
A0A3M5KZ75      TAGKPGQFSLYDSEHT---LLLGGAINRVVEG-HGIKIQVATLQARPG-TDFTVSRQRTL
A0A3M5L3G5      TAGKPGQFSLYDSEHT---LLLGGAINRVVEG-HGIKIQVATLQARPG-TDFTVSRQRTL
A0A1V6FYJ1      -----------------------------------------------M------------
A0A445MZQ4      ----------------------------------------------MG------------
A0A0M9E0E3      --------------------------------------LGTALAFTFE------------
A0A0Q6QV61      ------------------------------------------------------------
A0A2Z3IKG4      ----------------------------------------------ME------------
A0A4Q3IRI1      ----------------------------------------------TR------------
A0A2W4RFS2      ------------------------------------------------------------
A0A1Y6DC43      ------------------------------------------------------------
A0A2S6HE06      ------------------------------------------------------------
G3J0M3          ------------------------------------------------------------
V5C6R5          ------------------------------------------------------------
A0A354EF47      --------------------------------------------MAVG------------
A0A2G6MSP7      -----------------------------------------------M------------
A0A1V4M8I1      ----------------------------------------------MG------------
A0A4Z0M4C7      ----------------------------------------------ME------------
A0A4U8YMP3      ---------------------------------------------MMG------------
A0A1Q8QQ99      ----------------------------------------------MG------------
A0A3D5ZY44      -------------------------------------MAGAGTIVLLE------------
A0A646J2A6      ------------------------------------------------------------
A0A1G5C236      ----------------------------------------------MG------------
A0A5Q2QDL1      ----------------------------------------------MS------------
A0A656PSQ6      ------------------------------------LALGLLLVGARH------------
A0A1I3XJ27      -----------------------------MSGSEASAQKTPEGPGVLD------------
A0A1I7DCG1      ----------------------------------------------ME------------
A0A3A3H6D9      ----------------------------------------------ME------------
A0A562CGU2      ----------------------------------------------ME------------
A0A0Q6VA36      ------------------------------------------------------------
A0A1B2EQN1      ----------------------------------------------ME------------
A0A1E7HSL6      ----------------------------------------------MG------------
W9VVY5          ----------------------------------------------MD------------
A0A1E2URD3      ----------------------------------------------ME------------
A0A2T6MY81      ----------------------------------------------ME------------
A0A2T6NBQ8      ----------------------------------------------ME------------
A0A421K431      ----------------------------------------------ME------------
A0A2G2I5M1      ----------------------------------------------MD------------
A0A2G2M6F0      ----------------------------------------------MD------------
A0A1W9J9F8      -----------------------------------------MEKIKDA------------
A0A2S5LFJ9      -----------------------------------------MEKIKDA------------
A0A2D8R8F8      ----------------------------------------------ME------------
A0A010SNS0      ----------------------------------------------ME------------
A0A0C2I782      ----------------------------------------------ME------------
A0A2N8BYF5      ----------------------------------------------ME------------
A0A558FKX2      ----------------------------------------------ME------------
A0A1H1DBA0      ----------------------------------------------ME------------
J2TAD5          ----------------------------------------------ME------------
J3H699          ----------------------------------------------ME------------
A0A1H5J974      ----------------------------------------------ME------------
A0A0K1QRZ4      ----------------------------------------------ME------------
A0A560RJW9      ----------------------------------------------ME------------
A0A5E6TID7      ----------------------------------------------ME------------
A0A5E7CRU7      ----------------------------------------------ME------------
A0A5E7C564      ----------------------------------------------ME------------
A0A2W7MAV4      ----------------------------------------------ME------------
A0A4R3WQH5      ----------------------------------------------ME------------
W6VFG3          ----------------------------------------------ME------------
A0A1P8ENT1      ----------------------------------------------ME------------
A0A2N7XRV4      ----------------------------------------------ME------------
A0A0Q6QPG8      ----------------------------------------------ME------------
A0A0F4SWA7      ----------------------------------------------ME------------
A0A423J219      ----------------------------------------------ME------------
A0A4P6G9U8      ----------------------------------------------ME------------
A0A4Y8JE06      ----------------------------------------------ME------------
A0A502I1X9      ----------------------------------------------ME------------
A0A502J776      ----------------------------------------------ME------------
A0A5B0EZF6      ----------------------------------------------ME------------
A0A059L434      ----------------------------------------------ME------------
A0A0F4UWN2      ----------------------------------------------ME------------
A0A5E7WEF5      ----------------------------------------------ME------------
A0A1G0KSD0      ----------------------------------------------ME------------
A0A4P6WX84      ----------------------------------------------ME------------
A0A1D2S760      ----------------------------------------------ME------------
A0A5B8RW94      ----------------------------------------------ME------------
A0A258TN88      ----------------------------------------------ME------------
A0A4Q3ZDI7      ------------------------------------------------------------
A0A537PRC6      ----------------------------------------------MT------------
A0A2M7JX59      ----------------------------------MRSALCPMRGFVMS------------
A0A3A4XVN3      -----------------------------------------------M------------
A0A1E7JEV6      -----------------------------------------------M------------
A0A2N2KDY5      -----------------------------------------------M------------
A0A3N5YUD9      -----------------------------------------------M------------
A0A0W1DLQ3      ----------------------------------------------MA------------
A0A246JVD8      ----------------------------------------------MA------------
A0A2N3BB54      ----------------------------------------------MA------------
A0A1H6G7A3      ----------------------------------------------MA------------
A0A0A7PGL6      ----------------------------------------------MA------------
A0A4Q2Z4L0      ----------------------------------------------MA------------
A0A5C4N0H6      --------------------------------------------MEAD------------
A0A4R1HDF2      --------------------------------------------MSMD------------
A0A1E7HFN0      ----------------------------------------------MS------------
A0A1M5GH86      ----------------------------------------------MG------------
A0A1W1XQZ5      ----------------------------------------------MG------------
A0A3D6C3I2      ------------------------------------------------------------
S0G1D4          ----------------------------------------------MG------------
A0A661T246      ----------------------------------------------MG------------
A0A2G6CSG7      ----------------------------------------------MG------------
A0A2G6NB59      ----------------------------------------------MG------------
A0A5K8A7T9      ----------------------------------------------MG------------
A0A1W9U045      ----------------------------------------------MG------------
A0A1F9L9G4      ----------------------------------------------MG------------
A0A328FD76      ----------------------------------------------MG------------
A0A348UX90      ----------------------------------------------MG------------
A0A357Z0N5      ----------------------------------------------MG------------
A0A0F2R2U0      ----------------------------------------------MG------------
A0A5K7ZK00      ----------------------------------------------MG------------
A0A5K7YCX8      ----------------------------------------------MG------------
A0A5K7Z388      ----------------------------------------------MG------------
A0A352B502      ----------------------------------------------MS------------
A0A2K8WHP8      ----------------------------------------------MP------------
A0A410V446      ----------------------------------------------MD------------
A0A0R3KGJ5      ----------------------------------------------MD------------
A0A0R3N604      ----------------------------------------------MD------------
A0A1B1UCM8      ----------------------------------------------MD------------
A0A1N6JQ20      ----------------------------------------------MD------------
A0A1M5TI07      ----------------------------------------------MD------------
A3X191          ----------------------------------------------MD------------
A0A1H4RKV5      ----------------------------------------------MD------------
A0A160UA87      ----------------------------------------------MD------------
A0A1Q5SFV5      ----------------------------------------------ME------------
A0A1J5N774      ----------------------------------------------MS------------
A0A2C8F781      ----------------------------------------------MS------------
A0A2E3R6G0      ----------------------------------------------MS------------
A0A1F8XMK2      ----------------------------------------------MS------------
A0A3M8EMP2      ----------------------------------------------MS------------
A0A2J6J6K6      ----------------------------------------------MS------------
A0A1G6EKK9      ----------------------------------------------MS------------
S7TK97          ----------------------------------------------MS------------
S7UE93          ----------------------------------------------MS------------
A0A3D5BR56      ----------------------------------------------MS------------
A0A2N2IB15      ----------------------------------------------MS------------
A0A1I3PSR2      ----------------------------------------------MS------------
A0A1I4GEK4      ----------------------------------------------MS------------
A0A0A8WSG4      ----------------------------------------------MS------------
A0A2T5R3J5      ----------------------------------------------MS------------
A0A661PSB9      ----------------------------------------------MS------------
A0A661QBT6      ----------------------------------------------MS------------
A0A1W7QPT7      ----------------------------------------------MS------------
A0A1L3GKM9      ----------------------------------------------MS------------
A0A0M4D373      ----------------------------------------------MS------------
A0A5J4MX76      ----------------------------------------------MS------------
A0A430DNP0      ----------------------------------------------MA------------
A0A3A0FQ32      ----------------------------------------------MG------------
A0A1E4UZA0      ----------------------------------------------ME------------
A0A1H9KL56      ----------------------------------------------ME------------
A0A1A9KEF8      ----------------------------------------------MD------------
A0A5E6PKN5      ----------------------------------------------MD------------
A0A0N9W1V6      ------------------------------------------------------------
A0A423GQ41      ------------------------------------------------------------
A0A423H7J2      ------------------------------------------------------------
A0A502HNM8      ----------------------------------------------ME------------
A0A4Q7H223      ----------------------------------------------ME------------
A0A1H4N2K9      ----------------------------------------------ME------------
A0A2K4KWF7      ----------------------------------------------ME------------
A0A3E0WXH2      ----------------------------------------------ME------------
A0A2N2TRC8      ----------------------------------------------ME------------
A0A1V4CIZ7      ------------------------------------------------------------
A0A1M3BXA5      ----------------------------------------------ME------------
A0A1Y2R3U6      ----------------------------------------------ME------------
A0A167HVD6      ----------------------------------------------ME------------
A0A1V3SCT6      ----------------------------------------------ME------------
L0H287          ----------------------------------------------MH------------
A0A495VG93      ----------------------------------------------ME------------
A0A4R3MYM4      ----------------------------------------------ME------------
G2E3C0          ----------------------------------------------ME------------
A0A534QGR3      ------------------------------------------------------------
A0A4U8YLL7      ----------------------------------------------MG------------
A0A655RNN3      ------------------------------------------------------------
A0A655R819      ------------------------------------------------------------
A0A655ZEY0      NAKYSELKREVQTNRELFDLFLARQKETSASGDFNTTIARFTDQASAP------------
A0A0W1GMS6      ------------------------------------------------------------
A0A0Q8RMY3      ------------------------------------------------------------
A0A1A7QC21      ------------------------------------------------------------
A0A2M7WWF7      ------------------------------------------------------------
A0A351Z9A2      ------------------------------------------------------------
A0A3N5RNY4      ---------------------------------------------MNS------------
A0A1E7H876      ------------------------------------------------------------
A0A0F2NF69      ----------------------------------------------ME------------
A0A1F9NFD0      ----------------------------------------------ME------------
A0A1M5YLH5      ----------------------------------------------MG------------
A0A4U1A4C7      ----------------------------------------------MG------------
A0A509L3P8      ----------------------------------------------MG------------
A0A3A4S038      ----------------------------------------------MG------------
A0A1F9N669      ----------------------------------------------MG------------
A0A1F9PFA7      ----------------------------------------------MG------------
A0A1H2EN09      ----------------------------------------------MG------------
K0NP00          ----------------------------------------------MG------------
A0A432HIS7      ----------------------------------------------MG------------
A0A127AL56      ----------------------------------------------MG------------
A0A1E7JCL5      ----------------------------------------------MG------------
A0A496YAH9      --------------------MTKDDVERSRCAFFEAAMNLRKKGRGMG------------
A0A1V4S7E4      ----------------------------------------------MG------------
A0A2N2H8D2      ----------------------------------------------MG------------
A0A2N2KC63      ----------------------------------------------MG------------
A0A3A4ZYW4      ----------------------------------------------MG------------
A0A1V4MCJ4      ----------------------------------------------MG------------
A0A661M0W4      ----------------------------------------------MG------------
A0A1X0YE57      ----------------------------------------------MS------------
A0A2K2H9Q8      ----------------------------------------------MS------------
A0A2N6BEI9      ----------------------------------------------MS------------
A0A318CT66      ----------------------------------------------MS------------
A0A3N5P205      ----------------------------------------------MS------------
A0A0D5N3E9      ----------------------------------------------MS------------
A0A2N2G716      ----------------------------------------------MS------------
A0A1F9EUS2      ----------------------------------------------MS------------
A0A3N9VAW3      ----------------------------------------------MS------------
A0A1H4B8T3      ----------------------------------------------MS------------
A0A1E7IQC3      ----------------------------------------------MS------------
A0A1M6KEN5      ----------------------------------------------MS------------
A0A353QLL3      ----------------------------------------------MS------------
A0A399I453      ----------------------------------------------MS------------
A0A651FBV9      ----------------------------------------------MS------------
A0A1G0LDK7      ----------------------------------------------MS------------
A0A562VHD2      ----------------------------------------------MS------------
A0A5C1MDH8      ----------------------------------------------MS------------
A0A5A9XE04      ----------------------------------------------MS------------
A0A643G9R1      ----------------------------------------------MS------------
A0A1G0M8Q7      ----------------------------------------------MS------------
A0A353MI14      ----------------------------------------------MS------------
A0A4S1CAW7      ----------------------------------------------MS------------
A0A534HBS8      ------------------------------------------------------------
A0A0F0T3Y9      ------------------------------------------------------------
A0A351B422      ----------------------------------------------MS------------
F2NEE9          ----------------------------------------------MS------------
B7RS54          ------------------------------------------------------------
A0A3N5FRH4      ----------------------------------------------MG------------
A0A1V4Y2C3      ----------------------------------------------MG------------
A0A2N2KTJ4      ----------------------------------------------MG------------
A0A2N2LQX0      ----------------------------------------------MG------------
A0A318D3U4      ----------------------------------------------MG------------
A0A401FQP5      --------------------------------MTPTLPKVSQQLYCRG------------
A0A1Q6DMW3      ----------------------------------------------MG------------
A0A3A6P8F8      ----------------------------------------------MG------------
A0A2G2DSM4      ----------------------------------------------MG------------
A0A1F9NI02      -----------------------------------------------M------------
A0A4U1ABX4      ----------------------------------------------MA------------
A0A351Z4H9      ------------------------MGXKGVPKDNVFDRQEAQPEQYQE------------
A0A2N2KML4      ----------------------------------------------MG------------
E1YJF1          ----------------------------------MNKKQEYIGWIFMG------------
A0A1J5EVZ6      ----------------------------------------------MG------------
A0A2G6FCC5      ------------------------------------------MGETVG------------
A0A1F9MR25      ----------------------------------------------MG------------
A0A2G6M7F1      ----------------------------------------------MG------------
A0A1I0R9R6      ----------------------------------------------ME------------
A0A443K010      ----------------------------------------------ME------------
A0A238IZI1      ----------------------------------------------ME------------
A0A316GHM6      ----------------------------------------------ME------------
A0A520ZTR8      ----------------------------------------------ME------------
A0A212AR83      ----------------------------------------------ME------------
A0A2E2P4I0      ----------------------------------------------MD------------
A0A2U2CM86      ----------------------------------------------MD------------
A0A1X7ACC1      ----------------------------------------------MD------------
A0A2N3BVE7      ----------------------------------------------ME------------
A0A2S5JE21      ----------------------------------------------ME------------
A0A2R8BKZ2      ----------------------------------------------ME------------
A0A2S8S361      ----------------------------------------------ME------------
A0A238KUF6      ----------------------------------------------ME------------
A0A095CTW3      ------------------------------------------------------------
A0A2E3UGD6      ----------------------------------------------ME------------
A0A2T0RFH0      ----------------------------------------------ME------------
A0A285D390      ----------------------------------------------ME------------
A0A497VHN4      ----------------------------------------------ME------------
A0A379GWF0      ------------------------------------------------------------
A0A536T0W8      ------------------------------------------------------------
A0A2G9XLE5      ------------------------------------------------------------
A0A3D2M6Y9      --------------------------QDILRAGTIGNVRIIDNAYAVV------------
A0A3D2YAZ2      ------------------------------------------------------------
A0A350A102      ------------------------------------------------------------
A0A350L5D2      ------------------------------------------------------------
A0A1I6ENM4      ----------------------------------------------ME------------
A8LNM8          ----------------------------------------------ME------------
A0A0T5NSU3      ------------------------------------------------------------
A0A5P9I718      ----------------------------------------------ME------------
A0A2M8J3R9      ----------------------------------------------MD------------
A0A1I6X762      ---------------------------------------------MTD------------
A0A0P1EFX8      ----------------------------------------------ME------------
A0A2G5KB39      ----------------------------------------------ME------------
A0A2N3CNV1      ----------------------------------------------ME------------
A0A257F1F4      ----------------------------------------------MD------------
A0A1G9FY29      ----------------------------------------------MD------------
A0A4Q3ZBK4      ----------------------------------------------MD------------
A0A2D5J8T8      ----------------------------------------------ME------------
A0A2E3P9W6      ----------------------------------------------ME------------
A0A2G2B1P9      ----------------------------------------------ME------------
A0A258GCD5      ----------------------------------------------ME------------
A0A2D9YR88      ----------------------------------------------ME------------
A0A443INY4      ----------------------------------------------ME------------
A0A372IH36      --------------------------------MSSNSRDTGPDGGLSD------------
A0A540VW45      -----------------------------------------MELGSKQ------------
A0A1H9C241      ------------------------------MAEHVVRRRGQKRLGRED------------
A0A2E3FCR1      ------------------------------MVNYVLRRNRRKEIEQEK------------
A0A4S3MG69      ------------------------------MVKYVLRRN-RTETEQPK------------
A0A1G8QZS5      ----------------------------------------------ME------------
A0A1V4QMH7      ----------------------------------------------MG------------
A0A496XZQ4      ----------------------------------------------MG------------
A0A1F9BJF7      ----------------------------------------------MS------------
F2NDF5          ----------------------------------------------MS------------
A0A1I3TTC3      ----------------------------------------------MD------------
A0A1H3IZW6      ----------------------------------------------MD------------
A0A0M6YG59      ----------------------------------------------MD------------
A0A1H7G8B0      ----------------------------------------------MD------------
A0A059IPK4      ----------------------------------------------ME------------
A0A1H2Y469      ----------------------------------------------ME------------
A0A497ZQU7      ----------------------------------------------ME------------
A0A520CSP5      -----------------------------------------------P------------
A0A4Q2XLV7      ------------------------------------------------------------
A0A4Q5QYC4      ------------------------------------------------------------
A0A3B8SQ27      ------------------------------------------------------------
A0A3E0H727      -------------------------------------------MVALQ------------
A0A352Q5C1      -------------------------------------MRVIDHAVI-P------------
A0A656BWB0      ------------------------------------------------------------
A0A3Y2RPN4      ------------------------------------------------------------
A0A0A0FHV8      ------------------------------------------------------------
A0A1X3IPU7      ------------------------------------------------------------
A0A0A0G0N2      ------------------------------------------------------------
A0A243TPR1      ------------------------------------------------------------
A0A2I8SDU4      ------------------------------------------------------------
A0A2I8SU55      ------------------------------------------------------------
S1EXJ6          ------------------------------------------------------------
A0A376UBS1      ------------------------------------------------------------
A0A4Q6G931      ------------------------------------------------------------
A0A4Q8R6L6      --------------------------------------------AITQ------------
A0A2T0VBD8      ------------------------------------------------------------
A0A378APS2      ------------------------------------------------------------
A0A443VCQ6      ------------------------------------------------------------
A0A447RKQ7      ------------------------------------------------------------
W1DSK1          ------------------------------------------------------------
A0A0U2VAW2      QELLRLKRDVEVSNQIYTLLLGKTQELDIVRAGTVGNVRIIDYAEVNT------------
A0A454CTF1      REVLRMTRDVEVNQQIYIQLLNKVQELNIIKAGTVGNVRIIDSAQ-SY------------
A0A1W9F5M9      ------------------------------------------------------------
A0A352MMI7      QEIVRLTRDVESGQQVYMQLLNKQQELKITEASTVGDVRIVDPAID-Q------------
A0A379W6R2      ------------------------------------------------------------
A0A376RY66      QEIVRLTRDVESGQQVYMQLLNKEQELKITEASTVGDVRIVDPAIT-Q------------
A0A377K431      RKLCVLTRDVESGQQVYMQLLNKEQELKITEASTVGDVRIVDPAIT-Q------------
A0A379TA56      QEIVRLTRDVESGQQVYMQLLNKQQELKITEASTVGDVRIVDPAIT-Q------------
A0A4Z0LWV1      QEIVRLTRDVESGQQVYMQLLNKQQELKITEASTVGDVRIVDPAIT-Q------------
A0A620QD02      QEIVRLTRDVESGQQVYMQLLNKQQELKITEASTVGDVRIVDPAIT-Q------------
A0A5H3HSJ8      QEIVRLTRDVESGQQVYMQLLNKQQELKITEASTVGDVRIVDPAIT-Q------------
A0A655C5P0      QEIVRLTRDVESGQQVYMQLLNKQQELKITEASTVGDVRIVDPAIT-Q------------
A0A3C2BN18      ------------------------------------------------------------
A0A447LR75      ------------------------------------------------------------
A0A376D8L7      ------------------------------------------------------------
A0A1V2FV46      ------------------------------------------------------------
A0A376SB61      ------------------------------------------------------------
A0A3D1BYV9      ------------------------------------------------------------
A0A378G3G7      QEVLRLTRDVQVGQDVYLQLLNKEQELSIAKASTVGNVRIIDNAVT-Q------------
A0A2X5NHJ9      QEVLRLSRNVESGQAVYMQLLNRQQELNIAKNSAIGNVRIIDSAIT-E------------
A0A2J4QEC3      --------------AVYMQLLNRQQELSIAKSSAIGNVRIIDTAVT-E------------
A0A485ADM3      QEILRLSRDVESGRAVYMQLLNRQQELSISKSSAIGNVRIIDNAVT-E------------
A0A4U9HGU4      QEVVRLSRDVDSGKEVYMQLLNREQELNISKASTIGNVRIVDRAMT-G------------
A0A3S4JGG5      QEILRLTRDVQAGQEIYMQLLNKQQELGITKASTVGNVRIVDPAVT-Q------------
A0A377ZDH2      ---------------------------------MVTYVSWILPLRS-L------------
A0A3S4HTS8      ------------------------------------------------------------
A0A2N1XK22      ------------------------------------------------------------
A0A3D0KAC8      QELLRLTRDVEVSSETYSMLLNKTQELDIIRAGTVGNVRIIDHAAADL------------
A0A3D2Y902      QELLRLTRDVEVSSETYSMLLNKTQELDIIRAGTVGNVRIIDHAAADL------------
E1Y9C0          ------------------------------------------------------------
A0A1N6SH58      ------------------------------------------------------------
A0A4Q3AQN2      ------------------------------------------------------------
                                                                            

A0A1F9CFF0      ------------------------------------------------------------
A0A2M8B0G5      ------------------------------------------------------------
A0A363TNU9      ------------------------------------------------------------
A0A0C5VQ86      ------------------------------------------------------------
A0A1V8MBH1      ------------------------------------------------------------
A0A0R0BVC7      ------------------------------------------------------------
A0A3N5J7U8      ------------------------------------------------------------
A0A1S7S3I8      ------------------------------------------------------------
A0A519E8D7      ------------------------------------------------------------
A0A3S1NZ06      HPQAVALAKEKADISAQIFGELKQLTESYRNEYEVALARETALRANVAAAQGKSSIDNQS
A0A3S1FD32      ------------------------------------------------AAQGKSSVDNQT
A0A434DUT4      ---------------------------------------------NVALAAGKSSIDNQT
A0A528D3U3      ------------------------------------------------------------
A0A3S3UPT3      ------------------------------------------------------------
A0A3S1E286      ------------------------------------------------------------
A0A531AC71      ------------------------------------------------------------
A0A436K268      ------------------------------------------------------------
A0A434IDQ0      ------------------------------------------------------------
A0A435IRM5      ------------------------------------------------------------
A0A3S2C404      ------------------------------------------------------------
A0A435F6C0      ------------------------------------------------------------
A0A435BMN6      ------------------------------------------------------------
A0A529XQ54      ------------------------------------------------------------
A0A530BJC1      ------------------------------------------------------------
Q44570          ------------------------------------------------------------
A0A655ZZQ1      ------------------------------------------------------------
A0A1S0ZAI3      ------------------------------------------------------------
A0A1W9M770      ------------------------------------------------------------
A0A1W9M7R6      ------------------------------------------------------------
A0A3C0L0A8      ------------------------------------------------------------
A0A176S762      ------------------------------------------------------------
A0A377ZC40      ------------------------------------------------------------
A0A378BPJ7      ------------------------------------------------------------
A0A2J5PAJ7      ------------------------------------------------------------
A0A377ZDN3      ------------------------------------------------------------
A0A1W9WUD9      ------------------------------------------------------------
A0A1W1ZQK0      ------------------------------------------------------------
A0A4U1ALN4      ------------------------------------------------------MGKTSK
A0A4U1B1A8      ------------------------------------------------------MGNIAD
A0A1M7Y300      ------------------------------------------------------MGNIAD
A0A4U1A967      ------------------------------------------------------MGNIAD
A0A3N5MZ53      ------------------------------------------------------------
A0A534E4H4      -------------------------------------------------------DR---
A0A534I2B6      NNQARSVIEGIRKRYEAAKSEEAAIVAALNRAGQQYQQVGRKEAKLESLQRAVDTNR---
A0A1C2JGD0      ------------------------------------------------------------
A0A259LQ70      ------------------------------------------------------------
A0A4V2SPR5      ------------------------------------------------------------
A0A3N5PM86      AQEVKKILQSVETEYRVALAEEKSIREAMEEKKREALYLNEKQIGYNSLKRDTDTSR---
A0A2E5YSA4      -----------------------------------------------------------M
A0A519ERR1      ------------------------------------------------------------
A0A4Q3Q1M2      ------------------------------------------------------------
A0A4Q3MHR1      ------------------------------------------------------------
A0A520GDZ4      ------------------------------------------------------------
A0A318DSU0      ------------------MSQIGQLQAQKGDIDKQVGDLPDTQQELLRLTRDVEVTN---
A0A538PF21      ------------------------------------------------------------
A0A1W1ZH10      ------------------------------------------------------------
A0A1W2FF24      ------------------------------------------------------------
A0A524JYQ6      DKACQLAAEGVSSRLAMAQSKEDAIRREFSEQQKKAFELDRKLLTYEELLRNVEADQ---
A0A4Q3MA17      -----------------------------------VTTLPNVEQDMVRLTRDVKVNS---
A0A0N0M5F7      ------------------------MQGEVERLRNATLSEQDRSIRYTILRREVRTNR---
A0A537M754      ------------------------MNG----IKGQLLNLREKSIAYTILQREVDTNR---
A0A1V1PDB4      ------------------------------------MELNQKSIQYGVLQREAESAR---
A0A2M7C324      -MQVADVVSGFEREYEMARANESALAGSVAEAKQSIQGSNRKEYELSALERDVKTNQ---
A0A4Q3HHG6      ------------------------------------------------------------
A0A3B7DTA4      -----------------------------------------------MLKRVAETNR---
A0A432ZK62      ----MVACLGLDLCWFDRRLSLRLVIKQINAQVSTLLETQQEVLRLARDVEVSQ------
A0A1V5EEP4      ------------------------------------------------------------
A0A1V5EF48      ------------------------------------------------------------
A0A0S6X1X6      ------------------------------------MDEQNSGVQYNLLKRVADTNR---
A0A537Y5L8      ------------------------------------------------LDSNAQTYR---
A0A4Q3L2X2      -------------------------------------------------QQEVDTNR---
A0A4Q3T8J1      ------------------------------------------------------------
A0A4Q4ANM4      ----------------------------------------QSQVRLRELETASNTYR---
A0A4Q3UEC7      ----------------------------------------MAEVRLRELERQAESAK---
A0A1H5YYQ4      ----MTQRPKFTRKKRAGAQSLPEIEPAVPAPQIDDTERKQAEIRARQAEEAAAAAK---
A0A1X4NLK2      ----MTEQPKFQRRKRRGANT--------AAEQAQPVAVNAPDSRVAELEALLAEKEALL
A0A1X4NWB5      ----MTEQPKFQRRKRREEAS--------ADVQPKRTPERNDTPTLDEIDALIAEKEALL
A0A1M5UQ38      ----MTEQPKFQRRKRRGAVD--------DVPTPTPKAPKKATPPRKDINALLAEKE---
A0A327YI48      ----MTDDRKFRRRNPLSAEI--------AAGEQAAKLARAEDARRMAAAEEQSRIA---
A0A1B1PNL6      ----MVERRRFRRRKRSEETP--------EDPPILPLERREERLARRRADRDAEEAR---
A0A2U8H9H9      ----MVERRKFQRRKRVDETP--------EDPPIFPLERRADRLARREAEREAEDAR---
A0A1X6YIC0      ------------------------------------MADRPKFRRRRGRTPERTEDDDLR
A0A1I5E9E9      ----------------------------------MKLSRYEAYMRRRAARRDALENA---
A0A1X6Z7N7      ----------------------------------MKLSRYEAYMRRRAARRDALESP---
A0A2E1DQ13      ---------MAGDPAMKQAPE--------AAAEDVTLSRHEAYMRRRAARQAEAPET---
A0A1H8C800      ----------------------------------MKLQRHDAYMRRREARHTAEEAGDVA
A0A2N3EZ05      ---------------MRQAPE--------AEAEDATLSRHEAYMRRRAARLEAEAAA---
A0A1W9PMU6      ------------------------------------------------------------
A0A1G3VVY5      ------------------------------------------------------------
A0A2N6BZD5      ---------------------------------------------------MARSIRVGK
A0A435NNF5      ------------------------------------------------------------
A0A3S2AQS7      -------------------------------------NKETDLKSKLAEMERQQVVFNDK
A0A436XH86      ------------------------------------------------------------
A0A527ZPD6      ------------------------------------------------------------
A0A529KRW3      ------------------------------------------------------------
A0A530ZLX0      ------------------------------------------------------------
A0A355TB56      ------------------------------------------------------------
A0A524M660      ------------------------------------------------------------
A0A0C1TRU6      ------------------------------------------------------------
A0A2Z5SSF4      ------------------------------------------------------------
A0A327LYE6      ------------------------------------------------------------
A0A5A9ZTV3      ------------------------------------------------------------
A0A4Q4CIB1      ------------------------------------------------------------
A0A522ACJ9      ------------------------------------------------MDRGQDCAWIIV
A0A3N5Z7F8      ------------------------------------------------------------
A0A239HD34      ------------------------------------------------------------
A0A534V9L7      ------------------------------------------------------------
A0A0P7ZZE4      ------------------------------------------------------------
A0A369R0Q9      ------------------------------------------------------------
A5G4N9          -----------------------MEAMEPHTEVLEPPMDVLEPHMEVLEPHMEVLEPHDE
A0A238LBD3      -------------------------MNAKYSRRTGRPRLDASERARLLAEIAKLGAPATT
A0A0P1FRV5      ------------------------MVEQSKRFRRGMRQRPAKAPEEAPVDPPVEASVEVP
A0A0P1FWI8      ------------------------MVEQNKRYRRKTRQQPPKSPGFLGPKNLSEADIEAE
A0A1M7BLL7      -----MPWRATSLWALSGDGAMKLSRYEAHMRRRAARRDALENPHSHSPDQEDILSPEAD
A0A0H4KZM1      -------------------------MEKRWTRKKRASREAGGPAPKPALTGPIHLAPERE
A0A1V1UJT2      ---------------------MNLSRHDAYMRRREARRAAEEAGEMPEPVYEESCGESAI
A0A0L6CVX1      ------------------------------------------------------------
A0A1V0RR48      ------------------------------------------------------------
A0A0A0HJJ4      ---------------------MTLKRHEEYMRRRAARRAEMEA----------EADDEVP
A0A5E7YA28      ---------------------MSLTRHEEYMRRRAARRAALEA----------EAEENAA
A0A348SRI7      PS----------------------------------------------------------
A0A354EI73      ------------------------------------------------------------
A0A4P7EP83      ------------------------------------------------------------
A0A3A4NIE9      ------------------------------------------------------------
A0A3A4NUI9      ------------------------------------------------------------
A0A524I3Z6      ------------------------------------------------------------
A0A524PCL7      ------------------------------------------------------------
A0A356GQV1      ------------------------------------------------------------
A0A1J5DAY8      ------------------------------------------------------------
A0A524P237      ------------------------------------------------------------
A0A1G3JY11      ------------------------------------------------------------
A0A661N3U1      ------------------------------------------------------------
A0A3S1WTQ1      ------------------------------------------------------------
A0A440NX85      ------------------------------------------------------------
A0A530CUR9      ------------------------------------------------------------
A0A1M6N1X5      ------------------------------------------------------------
A0A561M3U0      -------------------------------------------------FAQQIERLPDV
A0A2W5J775      ------------------------------------------------------------
A0A1F9E324      AG------------------IRSE--------YESGLRKESLLRAAFEEQKGKAVEMKQK
A0A432SAI6      ------------------------------------------------------------
A0A4Q3LBH4      SG------------------IRNA--------YQISNAREQQLANEIDKLKNSTLSEQNQ
A0A4Q3LWP3      SG------------------IKNQ--------YDVARARSEQLRREIDTLKSDTLSEQNQ
A0A2N6VGL1      ------------------------------------------------------------
A0A3M3H5V6      AT------------------LEPK------------------------------------
A0A2T4ZJZ6      TL------------------PATQ------------------------------------
A0A1T2KYM8      NN------------------IDKE--------FERAQWLEKKLQKQFDDLKLQAQAIDSK
A0A2G9ZR82      QS------------------IASD--------YKTALKKLEALKERVELQKKLAMELNER
A0A4U9I390      ---------------------------------------------------------MPP
A0A534XP85      ------------------------------------------------------------
A0A2X3M011      ------------------------------------------------------------
I2WC85          ------------------------------------------------------------
A0A400JH80      VLEQIVNVDNQLNELTFREAEISQLYKKDHPTYRALLEKRQTLEQERKRLNKRVSAMPST
A0A2H9EHM4      ------------------------------------------------------------
A0A380B3D7      ------------------------------------------------------------
F5NSX0          ------------------------------------------------------------
D8EEU7          ------------------------MYKKDHPTYRALLEKRQTLEQERKRLNKRVSAMPST
A0A479JNB1      ------------------------------------------------------------
A0A5C9AF52      ------------------------------------------------------------
A0A0P1H2H0      --------------------AEGT--------QANVMADVEAPAPVKDDAPQATGFLGLS
A0A258WKV0      ------------------------------------------------------------
A0A377N8F8      AM------------------PKTQ------------------------------------
A0A3C2DSE7      AS------------------IERS--------YQLAVANENSLRASFNDNKEQIQDISRK
A0A2X1JBG5      RL------------------PKTQ------------------------------------
A0A0B8PTA8      ------------------------------------------------------------
A0A0B8QF75      ------------------------------------------------------------
A0A4Q3LR91      NV------------------LSQN--------YQASLRREQQLQSQVKQLTGRVLDFRRR
A0A4V1TR68      GA------------------LTEN--------YTAAVSRERALRERVSALKSGVLDFRQR
A0A444IY46      --------------------MEVQ----------------------AQDQKQKAIELNDK
A0A660AID0      KL------------------PKTQ------------------------------------
A0A3E0WKI3      EL------------------PQSQ------------------------------------
A0A1H3I2J1      --------------------PERD-------------------ETEHDTQDHQPELQDED
A0A1V5DJV0      ------------------------------------------------------------
A0A520IUC4      SS------------------LRSA--------YLAALGREAELRGQVSALRSNVLDLRGR
A0A521LJG5      LA------------------VRAE--------LDAAKSEEDELKELLDKASVVSGTASQY
A0A531IBQ7      ES------------------YRND--------YEVALQRETALRQNVAAAAGKSSIDNQS
A0A377LY04      AM------------------PKTQ------------------------------------
A0A5C9ABR5      ------------------------------------------------------------
A0A5J9WU72      ------------------------------------------------------------
A0A2X3K9R3      AM------------------PKTQ------------------------------------
A0A3T9EHW9      AM------------------PKTQ------------------------------------
A0A484X141      AM------------------PKTQ------------------------------------
A0A5N9VWI6      AM------------------PKTQ------------------------------------
A0A3D3PV27      ------------------------------------------------------------
A0A376LLF8      ------------------------------------------------------------
A0A444R390      ------------------------------------------------------------
A0A1V4WHZ7      ND------------------------------YAIARAKENSARSAVEGQKAEAQKLSEH
A0A1E5AJN5      DS------------------FVLR--------LAQAQQREETLRQELALVTASSREYREK
A0A2N3D2J1      SA------------------IRTE--------FEVARDQEGALQQEVSALKSTTLDEQRR
A0A2N2GVE1      DA------------------LVAE--------YQLKERNLQESRALMLQAQEEALALAAL
A0A2N2INV3      DA------------------LVAE--------YQLKERNLTESRALMLQAQEEALALAAL
A0A1Y5DXG5      NL------------------PETQ------------------------------------
A0A0B8P2H5      QL------------------PKTQ--------REVLR-----------------------
A0A483QWI8      AM------------------PKTQ--------QEILR-----------------------
A0A483UXD3      AM------------------PKTQ--------QEILR-----------------------
A0A0A8J8L3      AM------------------PSTQ--------QEVLR-----------------------
A0A660DJ38      GM------------------PSTQ--------QEVLR-----------------------
A0A380AQW6      SL------------------PKTQ--------QEILR-----------------------
A0A2G2GD62      LG------------------------------IKTIKTRKEYLRRELKVRQASLTKLPEQ
A0A524P331      LT-----------------------------------KQEASINEQIAEYEAKLGKLPEA
A0A4V1SSM5      SG------------------LQAN--------AQAASARAGSLRGELSRLRGEQAGNTRA
A0A4Q3K8G7      SN------------------LEAR--------VQVAGQRASAASGIASASRGELAANTSA
A0A1M7HC79      QL------------------PAEQ--------QEVVR-----------------------
A0A1D3JZN6      GL------------------PSTQ------------------------------------
A0A1V6ESG1      AS------------------VKSQ--------YDAAKRQEDLVRMRLQETRKEVIQTQDK
A0A1H7YHK3      EL------------------PDTQ------------------------------------
A0A534SH66      ------------------------------------------------------------
A0A3M0ZZ99      AE---------------------------------------------------------A
A0A328C2K5      SA------------------VANR--------AAVTRRNTESLQDEIERHKAEIAELNQI
A0A5C6X8M3      TA------------------VANR--------AAVTRRNAANLQEEIERHKAEIAELNQI
A0A3D8MRR7      TA------------------VANR--------AAVTRRNTANLQEEIERHKAEIAELNQI
A0A5C6UBJ7      TA------------------VANR--------AAVTRRNTANLQEEIERHKAEIAELNQI
A0A5C6XGM3      TA------------------VANR--------AAVTRRNAANLQEEIERHKAEIAELNQI
A0A537NZJ1      TT----------------------------------------------------------
A0A4Q4CVW6      EA------------------LRSE--------LAVLDRNGESLEARYVTLRQQTERANSD
A0A090R136      DL------------------PKTQ--------REVLR-----------------------
A0A661JU93      KSGPSAGDPIFQNLIAGIIESETK--------IQSTEGRINALEQLIKKYEAQMKLLPQK
A0A2E2T3V8      RQ------------------IDFG--------NANAQARYELVLKQLVRWKKELVKKHEA
A0A367UAB4      RQ------------------IDFG--------NANAQARYELVLKQLVRWKKELVKKHEA
A0A377V641      TM------------------PETQ--------QEILR-----------------------
A0A1F2YJ88      -------------------------------------------------LNSTLKELPDL
A0A0J7XGZ1      SG------------------LRAD--------VQIAESRLASLLDSRAQAKGSLVQNGSA
I4CBA7          SS------------------------------LEAAKKRESAALQAYELAKEAAIRAGSN
A3VE95          EL------------------RRNE--------VEVARLREQSLADGIQQLEDRLAGMSAN
A0A1G0NL95      KL------------------PETQ--------RNILR-----------------------
A0A024KA69      SG------------------FEER------------------------------------
A0A0L1KFN4      AS------------------VQAE--------YQQALAREEALQQRVSALKGDYLDLRRR
A0A3P5DSS6      AM------------------PETQ--------QEILR-----------------------
A0A483YEL5      TM------------------PETQ--------QEVLR-----------------------
A0A658GUJ0      TM------------------PETQ--------QEVLR-----------------------
A0A358L616      QM------------------PQTQ--------QEILR-----------------------
A0A3D5UYX7      ES------------------LANN--------VSVAKTRVSALRDNLNQIKGETGADNQA
A0A2N1WQN5      ------------------------------------------------------------
A0A352G2C2      TL------------------PSTQ------------------------------------
A0A3C0PZN1      TL------------------PSTQ------------------------------------
A0A524QFS4      EKSIA--------------EARTE------------------------------------
A0A520JSW4      TDRLG--------------TLRQD--------FQAARAEEDRLRAQVAGLSGAVLEQRGR
A0A4Q3LTF3      NS------------------LQAD--------YREALERERALQAKVNQLKSSYLDLRRR
A0A537UTP9      QT------------------YRSD--------YEIAKAREESISKSLTEIVSVSQTTNQA
A0A1D2RNR5      AS------------------VRNQ--------ALMAKRQENLIRTRLQQTRAEIMAAQDR
A0A4V1TQ46      GA------------------IQQR--------YLVAAAQERALSENLDQFKTQTLSEQER
A0A3A0FZC0      TG------------------LKAK--------MLAAQQEEKNLHEELEQQKSQAFELSKR
A0A1N7JVZ7      IAAIE--------------ATPSISARAPEDAGDRARTEPDPLMAQHPEPETSPEAERIA
A0A091C4A8      AA------------------IRGE--------YESALAQEQMLRAQIDALKDEVLDLRNR
A0A4R3H6P6      VS------------------LRQA--------YESSVMRERSLLARVQDLKGGLTDLRRR
A0A3S1NQ09      ES------------------YRNE--------YEVAQARETALRANVAAAQGKSSVDNQT
A0A443GJ52      ES------------------YRNE--------YEVALARETALRANVALAAGKSSIDNQS
A0A2W6S588      RS------------------ARAE--------SAAAAARSASLQASLAQAQSKLAGAVNA
A0A483E0N4      TM------------------PETQ--------QEILR-----------------------
A0A2J4YQQ6      SM------------------PETQ--------QEILR-----------------------
A0A483THX4      SM------------------PETQ--------QEILR-----------------------
A0A534MVS2      SGLHS--------------FHVPAKINFSHLLLELFRSDATPFQPDPAQWLRIASDTNLS
A0A444I5K6      ES------------------YQSE--------LQVAKSRENSLRDSVTQATGVAATAGET
A0A154VE85      IG------------------LANE--------VEVARARERALQQEVDRLQVLVDDRNDA
A0A3S1MCW7      DS------------------LRQK--------YQEAQNKEADLKSKLAEMEMQQDIFNDK
A0A434IGN6      DS------------------LRQK--------YQEAQNKEADLRSKLAEMEKQQVIFNDK
A0A528AX40      DS------------------LRQK--------YQEAQSKEADLRSKLAEMEKQQVIFNDK
A0A528MV95      DS------------------LRQK--------YQEAQNKEADLKSKLAEMETQQVIFNDK
A0A3C1S9Y1      SS------------------LRNE--------YRMAVAKEDSLKKSFEEQKGESLNMNKK
A0A353EH49      PN------------------VQKD------------------------------------
A0A1Y1Q9C1      QS------------------LQTEDATIRQADYISARKLEDDLRAEVESYKGELVDLRDR
A0A3M7LJH0      KL------------------PKTQ--------REILR-----------------------
A0A316KRG4      DT----------------------------------------------------------
A0A1E4JHX8      TS------------------LQQS--------YQASVARVGDLEGRVSNLKSSFLDLRRR
M2U8P2          DA------------------ARRE--------AQTASRRTASIRSSLNDAQSELLEGNNA
A0A1H7KZF8      AG------------------LHTP--------LDSATRDEAELASRFARLQTSRLSEQDN
A0A0J5Q9T7      EQTQR--------------RADAQ--------AKAQAPRAAAAAQAVLRAEETQASERLK
A0A257NG76      VL------------------PETQ--------QVILR-----------------------
A0A1T4TW59      IG------------------IQKE--------LDNAIKQEAALVADLENKKGDYQNITGK
A0A1I5YYQ0      PEMRQ--------------DAPTD--------AAPEETPPPMAEAQEPAALMRADEPKDG
A0A5P9FE62      PEMRQ--------------DAPTD--------AAPEETPPSMAEAQEPAALTRADELNDG
A0A1Q3MB35      QA------------------AQTT--------YQEALARENSLNREVAALKRRMLDERRD
A0A259LUN7      AN------------------LESE--------LRVAESQINSIQGQIGQSSSQLRGNNIN
A0A2D7AVL1      DA------------------LETS--------FRAAEAKEASLRERIGELKTKLIELRTQ
A0A3B9KZE9      DA------------------LETS--------FRAAEAKEASLRERIGELKTKLIELRTQ
A0A2U0NMP8      TM------------------PETQ--------QEVLR-----------------------
A0A4U9HNE9      NL------------------PKTQ--------QEVLR-----------------------
A0A2G2CXY6      DL------------------PSTQ--------QELLR-----------------------
A0A3M1D4H3      DPTVE--------------QYEAQ--------LAGLVKKGAEIDASIQRTTEQFSTYPDK
A0A5C8BYM7      AS------------------VSNT--------LEMTKRQEALLRSRLETTRRQIVQGQDQ
A0A1J5ICP0      AS---------------------------------LKVNERSIKGNISSYEKRINALPAA
A0A0M3GBT1      QT------------------MRAK--------LAALDHEAAAVQSILDVAHEKRARDALV
B3Q577          QT------------------MRAK--------LAALDHEAAAVQSILDVAHEKRARDALV
A0A379B9V4      KL------------------PNTQ--------KEMIR-----------------------
A0A0Q6TS97      VS------------------LQQA--------YDSSQTRERALTARVEGLKDGLADLRRR
A0A0Q6UYB4      VS------------------LQQA--------YDSSQTRERALTARVEGLKDGLADLRRR
A0A484XS37      VM------------------PKTQ--------QVILR-----------------------
W7Q5J0          EL------------------PTAQ--------QEVLR-----------------------
A0A654AKT6      --------------------ILTA--------FIGVVGLIAVYLGNHAFFGSTTFAHRLG
A0A0G9MZA5      SGSQS--------------RLRAN--------YNEALAAEQRLQAQVNRLQANYTDQRQD
H0T8B0          EG------------------YKSQ--------VQIAKAHEDELNKKLDEVFQQSAATRQL
A0A5C7N981      GG------------------LKAN--------YEAALAQEQLIAAKLKESKQTVLGSQDN
A0A534TV22      RG------------------IQES--------YGAARAKEAALEAEAQKQQKAALDLKEI
A0A351CXR4      SD------------------REKE--------FELAR-----------------------
A0A2N6GLF5      KG------------------VEKE--------YQVARENEQSIKRSLGSAKGEMQQINRK
A0A1W9LJP0      SS------------------LRNE--------YNLALAREQSLKQALNRQKTESLDMNKK
A0A0W1ICB0      GA------------------YSAD--------YNAAVQRETDLRARVDRLLGRLDTENRS
A0A2E0UL88      VT------------------QQIE--------IEALKAKIISLDETIQDFSKKFEDIPEQ
A0A233IKJ2      NG------------------INNE--------LQAAKQAESSLHRELEKRKSEFQSLSVK
A0A2T1JE00      NG------------------INNE--------LQAAKQAESSLHRELEKRKSEFQSLSVK
A0A0T2QIS1      NS------------------RTAE--------FRNVATRESDLRRRVADLKAQLNTQQRA
A0A376KYN0      AM------------------PSTQ--------QEVLR-----------------------
A0A2X1JB05      AM------------------PSTQ--------QEVLR-----------------------
A0A376RML0      AM------------------PSTQ--------QEVLR-----------------------
A0A377E5P7      AM------------------PSTQ--------QEVLR-----------------------
A0A0P7Y1D0      AG------------------LETE--------VNVARQRVGSLQSTLSGVRDELVTNNRA
A0A2M7JRZ7      AG------------------IKND--------YESNLRRESLIRQAFEQQKAKVMEMKEQ
A0A167IR75      GS------------------VRAE--------YQQAEAREQALRQRVNALTDEYLDVRRR
X7F6S5          QA------------------AEAE--------RARHAAEAEAETERLRIERDAERARIAR
A0A1G7CFZ2      EA------------------RQAE--------AAARMAQTTRQTGAEHRVETGRV-----
A0A1P8USW9      EL------------------RAQQ--------EAAREAESARAAEKARQEDETRR-----
A0A1I6U4V1      EQ-------------------QRL--------EDQRLEERRLEEHR-AEMDTARR-----
A0A1G8NKI0      EA-------------------AGD--------QARRQAEAAAQAQADAEAEEQQR-----
A0A355QPE4      EA-------------------AGD--------QARRQAEAAAQAQADAEAEEQRR-----
A0A357RN98      EA-------------------AGD--------QARRQAEAAAQAQADAEAEEQRR-----
A0A3B8T2U6      DG------------------IYQE--------YQAAESKVNSLKVEVESAKQNYRKLSNL
A0A365PWR2      TL------------------PETQ--------QELVR-----------------------
A0A2E9H5Z8      DL------------------LKTQ--------LRLVNGQLVKIKERVEERRFDAVDKALQ
A0A2E2BR79      KM------------------PAAQ--------QEVVR-----------------------
A0A0Q4Q524      GS------------------LETD--------YRGAVERERALQARVEQLKSSYLDLRRR
A0A0Q4CFJ9      GS------------------IETD--------YRGAVERERALQARVEQLKSSYLDLRRR
A0A0Q4FE58      GS------------------LETE--------YRGAVERERALKARVEQLKGSYLDLRRR
A0A0Q4JWC8      GS------------------LETE--------YRGAVERERALKARVEQLKGSYLDLRRR
A0A0Q4KFL8      GS------------------LETE--------YRGAVERERALKARVEQLKGSYLDLRRR
A0A522R8R0      ES------------------YRNE--------YEVAKAREDSLRTNVDQMTGQNTKNSQA
A0A2U9NDY5      AL------------------PMTQ--------QELLR-----------------------
A0A0Q4IGG1      GS------------------IQAE--------YREALQREGALQARVNQLKSSYLDNRRR
A0A534RUJ5      EG------------------VKTS--------YLDAEAKEKELRAKMEEQKAITLSLKDD
A0A3M1CJM3      ES------------------LEAE--------YQVKLDSEKRLRRELERVKAEAQELNKK
A0A2R7SVD4      DL------------------PATQ--------QELLN-----------------------
A0A3C0PWB6      AL------------------PMTQ--------QELLR-----------------------
V4Q8B7          AL------------------PMTQ--------QELLR-----------------------
A0A0Q8XKK5      SS------------------RSTE--------YREAQMREEGLRRQVETLRLQLGKQSRD
A0A2E0Q2W0      AA------------------SDAQ--------LRGARQVEAELQARFDRAKAEYLAQQNQ
A0A660NIR6      SS------------------ISKA--------YEVARETERALEQEVASSKGNIQEINRK
A0A142W0R3      AL------------------NQES--------YASALKREKELQAELDRLTGKYRDQQRR
A0A0S4XR18      NS------------------VQKQ--------KNDLETTKKSYEYSLGGMPSSELGLMN-
A0A2E0GW64      KL------------------PHSD--------QKALS-----------------------
A0A1A7QJ97      GS------------------VQAE--------YRQAVQRESALEMRVNSLKDEYLDLRRR
A0A661LW70      NS------------------LKNE--------YKVALAKENALRAALAKQKKETLELNQK
W7Q8F9          EL------------------PAAQ--------QEVLR-----------------------
A0A524PXH8      AS------------------IETE--------YRGAVDREMMLRDQLDRQRAIVSAYEEK
A0A4Q3P0E4      SL------------------PAVQ--------QDAVR-----------------------
A0A3M2BE89      AL------------------PSTE--------QEVLR-----------------------
A0A4Q4A6K6      ET------------------SRSD--------HEIAKQKQKQIEDQLASAVSRSRGSNSA
A0A257G674      AS------------------VKQQ--------FDAAVETEQNLKQQVAELKGSSLEEQDR
A0A661M5M6      AS------------------AEHD--------VQQIKTVEEGLRSAAGDAHSAGLNLNLR
A0A1I1UM01      AH------------------GDAG--------PDGADEQRTD------------------
Q44573          ST------------------IRED--------QISARAEVQRLNENLDLLRQKAGGQSAP
A2W025          KA------------------VQ--------------------------------------
A0A534Z362      AA------------------VRSR--------DEAAQLREEELRRKLAHLGATAVELRDL
V4J283          AL------------------PEVQ--------QTVLR-----------------------
A0A536T443      ----------------------AL--------IAGLAAREHALQQRIDSIAGDLRGAPPV
A0A0Q4UFQ5      AV------------------LRAT--------YQASLSREQQLTSQVNKLTGRVLDFRRR
A0A527W7E6      ES------------------YRND--------FEVAQTREQALRDKISTAAGKSSIDNQS
A0A432EMV7      DG------------------IKRD--------YEAARAQEKEIKRFIREQKSEMRAFSGK
A0A087LTV7      AA------------------LRAR--------VTVAGEAVRAAQQALALRSGFE------
A0A534WLI3      EA------------------VRAR--------YDAARLREAGLRRKLAQQERTAVALREL
A0A318KWA2      DL------------------PEAQ--------QEVVR-----------------------
A0A522MT86      KN------------------VD--------------------------------------
A0A4Q3I221      ES------------------YKSD--------LNVAKAREKSLTDSVAQATGISATASET
A0A534SAL6      AS------------------VRAR--------YDAARLREEALRHKTAHLEEVAIDLHAL
A0A534ZDB4      TS------------------VRAR--------YDAARLREEALRHKMAHLEEVAIDLHAL
A0A534X3M7      EA------------------IRAR--------YDAARLHEEDLRRKLARLGATAIQLRDL
A0A534SPC6      AA------------------VRSR--------DEAAQLREEELRRKLAHLGATAVELRDL
A0A535AD60      AS------------------VRSR--------NDAAQLREEELRRKLAHLGATAVELRDL
A0A4Q3SY08      SN------------------LEAK--------AEVSRQRLASISGSLSTARGTLTDNNRA
A0A4Q3LG23      SS------------------LEAD--------YREAAERERGLQRKVDALKTGYLDLRRR
A0A522EX52      ------------------------------------------------------------
A0A1H3KC95      RR------------------VRLA--------ALPKAELARVLRRVRGQGPAIAAPPQEE
A0A5P8Z4P3      TK------------------VEDL--------RADTPEQSPTPPQRSYIRMPAQAA----
A0A0B3RZC9      EK------------------AEAE--------RLAEEEKRAE------------------
A0A2E9HXF7      RA------------------ASAL--------RAAETERIAD------------------
A0A520HUH4      QR------------------AQLA--------ARYGEKFPALVQSKQQIEALDQQIRLEQ
A0A2K8U7M6      SA------------------ARAA--------AAARAHQEARLAERGDEVRAQLRDLQVF
A0A5B9DKL8      KQ------------------VETE--------AFLQVPSTRIVVEATAPLYAAAPR----
A0A238KJM1      ------------------------------------------------------------
A0A3A0FJZ4      HT------------------LRSS--------ALASIQELQSQLSRAEAVYTRRHP---S
W4HJV8          DA------------------LASE--------TSEEALPATDLRDAKPDARTAETSGHTP
A0A0P1GDI0      AA------------------RHKA--------KAAAEQQARMQAEAAQRAEEARRAAHQA
A0A2R8ATV5      RA------------------KALA--------DE-----------RAKIEAEAKAA----
A0A1U7D3R6      RA------------------AE--------------------------------------
A0A2D4UVV2      RA------------------AE--------------------------------------
A0A0W7WHP4      ---------------------------------------------REARARSAAAV----
A0A238J8F6      RK------------------KADA--------EKKRLAEEQAALRAEKEARQRAEA----
A0A238JQI6      RR------------------KAED---------------------AARKAQEARQA----
A0A222E077      ------------------------------------------------------------
A0A239E3Y2      R--------------------------------------------AASALRDAEMA----
A0A1W9HS52      SEALVDRNFERLKEKVYRLKDFVGRQTSERKKILEDLEQHRVELQRKHEVGNTQEYRREV
A0A2D5LFD8      GRITI--TPVGEGR--------TGQGAGILNVKLKGKDPDNDK--ILLDQLADVYLEIAQ
A0A0N0XAV4      ------------------------------------------------------------
A0A0P9QD19      ------------------------------------------------------------
F3FHG4          ------------------------------------------------------------
F3GGI0          --------RLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQNV
A0A0P9LE74      ------------------------------------------------------------
A0A3M4ZQ14      STALSYQNRLKITE--------AGRDSGIIYLSIEDPDAQKAN--RILEEVSHLYVRQNV
A0A3M5YLE8      STALSYQNRLKITE--------AGRDSGIIYLSIEDPDAQKAN--RILEEVSHLYVRQNV
A0A3M3RP89      STALSYQNRLKITE--------AGRDSGIIYLSIEDPDAQKAN--RILEEVSHLYVRQNV
A0A0P9QIY7      STALSYQNRLKITE--------AGRDSGIIYLSIEDPDAQKAN--RILEEVSHLYVRQNV
A0A0P9VVH7      STALSYQNRLKITE--------AGRDSGIIYLSIEDPDAQKAN--RILEEVSHLYVRQNV
A0A0Q0FJK6      STALSYQNRLKITE--------AGRDSGIIYLSIEDPDAQKAN--RILEEVSHLYVRQNV
A0A0Q0G2J0      STALSYQNRLKITE--------AGRDSGIIYLSIEDPDAQKAN--RILEEVSHLYVRQNV
A0A3M3LF66      STALSYQNRLKITE--------AGRDSGIIYLSIEDPDAQKAN--RILEEVSHLYVRQNV
A0A0P9WIR8      STALSYQNRLKITE--------AGRDSGIIYLSIEDPDAQKAN--RILEEVSHLYVRQNV
A0A3M3KPE5      STALSYQNRLKITE--------AGRDSGIIYLSIEDPDAQKAN--RILEEVSHLYVRQNV
A0A3M4C263      STALSYQNRLKITE--------AGRDSGIIYLSIEDPDAQKAN--RILEEVSHLYVRQNV
A0A3M5AD05      STALSYQNRLKITE--------AGRDSGIIYLSIEDPDAQKAN--RILEEVSHLYVRQNV
A0A0Q0D3D2      STALVYQNRLKIAE--------AGRDSGIIYLSIEDQEAQRAN--RILDEVSHIYVRQNV
A0A0N0FS39      ------------------------------------------------------------
A0A3M6GHH2      ------------------------------------------------------------
A0A0P9R9W0      STALVYQNRLKIAE--------AGRDSGIIYLSIEDQNAQRAN--RILDEVSHLYVRQNV
A0A0Q0B9T0      STALVYQNRLKIAE--------AGRDSGIIYLSIEDQNAQRAN--RILDEVSHLYVRQNV
A0A3M6CFI7      STALVYQNRLKIAE--------AGRDSGIIYLSIEDQNAQRAN--RILDEVSHLYVRQNV
A0A0P9JXN0      STALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQNV
A0A3M6FIV7      STALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQNV
A0A3M3PLW9      STALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQNV
A0A3M4ENY1      STALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQNV
A0A3M5EZK7      STALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQNV
A0A0P9SPP5      STALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQNV
A0A658KL17      STALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQNV
A0A3M3NNF2      STALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDGVSHLYVRQNV
A0A3M4A0E8      STALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQNV
A0A3M4PBZ2      STALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQNV
A0A3M6AI26      STALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQNV
A0A0P9IWP8      STALVYQNRLKIAE--------AGRDSGIIYLSIEDQEAQRAN--RILDEVSHIYVRQNV
A0A0P9KZ49      STALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQNV
A0A0P9V840      STALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDGVSHLYVRQNV
A0A0Q0AIE5      STALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDGVSHLYVRQNV
A0A3M2ZQH6      STALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDGVSHLYVRQNV
A0A0N8SQG2      STALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDGVSHLYVRQNV
A0A0W8HFU1      STALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDGVSHLYVRQNV
A0A3M5M873      STALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQNV
A0A0P9VHH8      STALVYQNRLKIAE--------AGRDSGIIYLSIEDQEAQRAN--RILDEVSHLYVRQNV
A0A0P9YV98      STALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQNV
A0A3M3G2W8      STALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQNV
A0A3M6C224      STALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQNV
A0A3M5K254      STALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--QILDEVSHLYVRQNV
A0A3M5JFB0      STALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--QILDEVSHLYVRQNV
A0A3M3TQV3      STALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQNV
A0A3M3EF92      STALVYQNRLKIAE--------AGRDSGIIYLSIEDQNAQRAN--RILDEVSHLYVRQNV
A0A3M5J1E2      STALVYQNRLKIAE--------AGRDSGIIYLSIEDQNAQRAN--RILDEVSHLYVRQNV
A0A3M5G7H9      STALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQNV
A0A3M4A376      STALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQNV
A0A0Q0A5T8      STALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQNV
A0A0P9SCD7      STALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQNV
A0A0P9T4G3      STALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQNV
A0A0P9VKB0      STALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQNV
A0A0Q0BM35      STALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQNV
A0A3M3TPR7      STALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQNV
A0A3M3U4Q3      STALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQNV
A0A0P9UCX7      STALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQNV
A0A0P9S1F1      STALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQNV
A0A0P9QCJ2      STALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQNV
A0A0P9Q329      STALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQNV
A0A3M5GJ64      STALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQNV
A0A0P9MPC7      STALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQNV
A0A3M2XYQ3      STALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQNV
A0A0P9XCE1      STALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQNV
A0A3M3EFX7      STALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQNV
A0A3M5B9D9      STALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQNV
A0A0P9RRZ3      STALLYQNRLKIIE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQNV
A0A3M2VEK7      STALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQNV
A0A0N8R9B3      STALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQNV
A0A0P9VA27      STALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQNV
A0A3M4YBJ4      STALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQNV
A0A0P9J470      STALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQNV
A0A0Q0EVJ8      STALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQNV
A0A3M5UI30      STALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDGVSHLYVRQNV
A0A3M5YQT8      STALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--QILDEVSHLYVRQNV
A0A3M5F5X1      STALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQNV
A0A3M5R8G1      STALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQNV
A0A3M5V012      STALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQNV
A0A3M3GA16      STALVYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQNV
A0A3M3UCT3      STALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQNV
A0A3M3CJL0      STALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQNV
A0A3M3F6F5      STALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQNV
A0A3M3P9B7      STALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQNV
A0A0N8QB74      STALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQNV
A0A0Q0AUD0      STALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQNV
A0A3M5VR55      STALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQNV
A0A0Q0FK97      STALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQNV
A0A3M5KZ75      STALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQNV
A0A3M5L3G5      STALIYQNRLKIAE--------AGRDSGIIYLSIEDQDAQRAN--RILDEVSHLYVRQNV
A0A1V6FYJ1      ---------------------------------------------HILKALEKQDHEFLK
A0A445MZQ4      ---------------------------------------------KLSDALDRHQSERAV
A0A0M9E0E3      ---------------------------------------------ILDNTLKNPEDI---
A0A0Q6QV61      ------------------------------------------------------------
A0A2Z3IKG4      ---------------------------------------------RIQSTLEKLERE---
A0A4Q3IRI1      ---------------------------------------------RRDAG----------
A0A2W4RFS2      ------------------------------------------------------------
A0A1Y6DC43      ------------------------------------------------------------
A0A2S6HE06      ------------------------------------------------------------
G3J0M3          ------------------------------------------------------------
V5C6R5          ------------------------------------------------------------
A0A354EF47      ---------------------------------------------KVSRALNKAESGFTP
A0A2G6MSP7      ---------------------------------------------VLNLLIGLALGLVSG
A0A1V4M8I1      ---------------------------------------------KIADALKKAGKE---
A0A4Z0M4C7      ---------------------------------------------HGQGAGEAA------
A0A4U8YMP3      ---------------------------------------------HFSKALEKRGLERS-
A0A1Q8QQ99      ---------------------------------------------RIEEALEKAVRRIVP
A0A3D5ZY44      ---------------------------------------------VFDNGVRTEADVER-
A0A646J2A6      ------------------------------------------------------------
A0A1G5C236      ---------------------------------------------HFSKALEKRDSE---
A0A5Q2QDL1      ---------------------------------------------RLYDAVQKSKGNLTA
A0A656PSQ6      ---------------------------------------------AFDDAVTSAETLA--
A0A1I3XJ27      ---------------------------------------------RIQTAMQKAREEH--
A0A1I7DCG1      ---------------------------------------------HIHAALQKAKQQR--
A0A3A3H6D9      ---------------------------------------------HIHAALQKAKQQR--
A0A562CGU2      ---------------------------------------------HIRTALQKAREQQ--
A0A0Q6VA36      ----------------------------------------------MEQTVVSAQNPA--
A0A1B2EQN1      ---------------------------------------------QIHDVLLNSENET--
A0A1E7HSL6      ---------------------------------------------KISSAIEKSNRENWS
W9VVY5          ---------------------------------------------RARAERQAALSGS--
A0A1E2URD3      ---------------------------------------------KIKDALDKAKKIQ--
A0A2T6MY81      ---------------------------------------------KLKKALDRARDQK--
A0A2T6NBQ8      ---------------------------------------------KIKQALERARDAK--
A0A421K431      ---------------------------------------------KIKQALDRARDNR--
A0A2G2I5M1      ---------------------------------------------RIQKALDKAKAKH--
A0A2G2M6F0      ---------------------------------------------RIQKALDKAKARH--
A0A1W9J9F8      ---------------------------------------------LAKAKIENTESKS--
A0A2S5LFJ9      ---------------------------------------------LAKAKIENTESKS--
A0A2D8R8F8      ---------------------------------------------KFDNIITRLREQQ--
A0A010SNS0      ---------------------------------------------IIKPDTENSEQQP--
A0A0C2I782      ---------------------------------------------IIKPDTEDSEQQP--
A0A2N8BYF5      ---------------------------------------------IIKPDTENSEQQP--
A0A558FKX2      ---------------------------------------------IIKPDTENSEQQP--
A0A1H1DBA0      ---------------------------------------------IIKPASDKGEPQA--
J2TAD5          ---------------------------------------------INKPDTEGDVQQS--
J3H699          ---------------------------------------------FNKTDTEDDEKQS--
A0A1H5J974      ---------------------------------------------IIKPDTENTEPKN--
A0A0K1QRZ4      ---------------------------------------------IIKPDTENTEPKN--
A0A560RJW9      ---------------------------------------------IIKPDTENTEPKN--
A0A5E6TID7      ---------------------------------------------IIKPDTENTEPKN--
A0A5E7CRU7      ---------------------------------------------IIKPDTENTEPKN--
A0A5E7C564      ---------------------------------------------IIKPDTEKSEPQT--
A0A2W7MAV4      ---------------------------------------------MFNPDTEKTEQQT--
A0A4R3WQH5      ---------------------------------------------MFNPDTEKTEQQT--
W6VFG3          ---------------------------------------------MFNPDTEKTEQQT--
A0A1P8ENT1      ---------------------------------------------IINSDTEKAEQQT--
A0A2N7XRV4      ---------------------------------------------IINSDTEKAEQQT--
A0A0Q6QPG8      ---------------------------------------------IFNPDTENAEQQT--
A0A0F4SWA7      ---------------------------------------------ISNPDTENAEQQT--
A0A423J219      ---------------------------------------------IINSDTEKAEQQT--
A0A4P6G9U8      ---------------------------------------------IINLDTEKAEQQT--
A0A4Y8JE06      ---------------------------------------------IINLDTEKAEQQT--
A0A502I1X9      ---------------------------------------------IINPDTEKAEQQT--
A0A502J776      ---------------------------------------------IINPDTEKAEQQT--
A0A5B0EZF6      ---------------------------------------------IINLDTEKAEQQT--
A0A059L434      ---------------------------------------------MFNPDTEKAEQQT--
A0A0F4UWN2      ---------------------------------------------MFNPDTEKAEQQT--
A0A5E7WEF5      ---------------------------------------------MFNPDTEKAEQQT--
A0A1G0KSD0      ---------------------------------------------RIKEAIERAKRER-V
A0A4P6WX84      ---------------------------------------------RIKLAIEKAKASRTD
A0A1D2S760      ---------------------------------------------RIKQALEKARQQS--
A0A5B8RW94      ---------------------------------------------RIKQALEKARAQA--
A0A258TN88      ---------------------------------------------RIKQAVEKARRLQ--
A0A4Q3ZDI7      ---------------------------------------------------AALAGMLIG
A0A537PRC6      ---------------------------------------------PRERDARPRTVRAYP
A0A2M7JX59      ---------------------------------------------RVFRALEKAEEEKKQ
A0A3A4XVN3      ---------------------------------------------RMKIEKAVDKMKMQW
A0A1E7JEV6      ---------------------------------------------YLRKSVEKVKKMPNI
A0A2N2KDY5      ---------------------------------------------NLKNYFPRTKKV--E
A0A3N5YUD9      ---------------------------------------------SLKQALEKAKKMRSE
A0A0W1DLQ3      ---------------------------------------------DADPTTLNSRDTLRL
A0A246JVD8      ---------------------------------------------DAELTTAINPEFVTL
A0A2N3BB54      ---------------------------------------------EADPPPSNDIKMLTL
A0A1H6G7A3      ---------------------------------------------DADMPLSRDQQLLTL
A0A0A7PGL6      ---------------------------------------------DADLPLSRDQKLLTL
A0A4Q2Z4L0      ---------------------------------------------DADLPLSRDHKLLTL
A0A5C4N0H6      ---------------------------------------------IVRKPKQPLKPQV--
A0A4R1HDF2      ---------------------------------------------YIKDAVAMLDR----
A0A1E7HFN0      ---------------------------------------------MIKKALQRARKDRHE
A0A1M5GH86      ---------------------------------------------KIYEALERAKKSPKR
A0A1W1XQZ5      ---------------------------------------------KIYEALERAKRSPKQ
A0A3D6C3I2      ------------------------------------------------------------
S0G1D4          ---------------------------------------------KLFDALEKARQDHRV
A0A661T246      ---------------------------------------------KIFDALEKSKVTNKK
A0A2G6CSG7      ---------------------------------------------KIHDALEKAERSKEL
A0A2G6NB59      ---------------------------------------------KIHDALEKAERSKEL
A0A5K8A7T9      ---------------------------------------------KIHEALEKSGRVKEL
A0A1W9U045      ---------------------------------------------KIFDALEKA-NKENN
A0A1F9L9G4      ---------------------------------------------KIFEALEKS-KHIRS
A0A328FD76      ---------------------------------------------KIFRALEKAGNKLTP
A0A348UX90      ---------------------------------------------KIFKALEKAGNNVTP
A0A357Z0N5      ---------------------------------------------KIFKALEKAGNNVTA
A0A0F2R2U0      ---------------------------------------------KIFDALEKSNTQAAK
A0A5K7ZK00      ---------------------------------------------KIHEALEKSGRAKDM
A0A5K7YCX8      ---------------------------------------------KIHDALEKSGRSKGL
A0A5K7Z388      ---------------------------------------------KIHDALEKSGRVNDL
A0A352B502      ---------------------------------------------KIEEALEKATRERQG
A0A2K8WHP8      ---------------------------------------------PLSLTPEQRSHPAPA
A0A410V446      ---------------------------------------------SIKHAVELARSAEQG
A0A0R3KGJ5      ---------------------------------------------SIKQAVELARAAD-V
A0A0R3N604      ---------------------------------------------SIKQAVELARAAE-V
A0A1B1UCM8      ---------------------------------------------SIKQAVELARAAEVV
A0A1N6JQ20      ---------------------------------------------SIKQAVELARATENM
A0A1M5TI07      ---------------------------------------------SIKQAIDLARATEGG
A3X191          ---------------------------------------------SIRQAVERARAAEST
A0A1H4RKV5      ---------------------------------------------SIKQAVELARAAESA
A0A160UA87      ---------------------------------------------SIKQAVELARSGDRL
A0A1Q5SFV5      ---------------------------------------------SIKQAVELARSGDSL
A0A1J5N774      ---------------------------------------------RIEEALKKATQLRGR
A0A2C8F781      ---------------------------------------------RIEEALKKASQMRNS
A0A2E3R6G0      ---------------------------------------------RIEEALKKASQMRNS
A0A1F8XMK2      ---------------------------------------------RIEEAIEKALRMRES
A0A3M8EMP2      ---------------------------------------------RIEEILEKATRLREK
A0A2J6J6K6      ---------------------------------------------RIEQALEKSSKLRER
A0A1G6EKK9      ---------------------------------------------RIEQALEKAAKMRLG
S7TK97          ---------------------------------------------RIEEALSKAAGMKPA
S7UE93          ---------------------------------------------RIEEALAKAANLNTN
A0A3D5BR56      ---------------------------------------------RIEDAMAKAAGLHSS
A0A2N2IB15      ---------------------------------------------RIEDALAKAAGMQAG
A0A1I3PSR2      ---------------------------------------------RIEEALAKAAGMQSG
A0A1I4GEK4      ---------------------------------------------RIEEALAKAAGMQSG
A0A0A8WSG4      ---------------------------------------------RIEKALEKASQLRQR
A0A2T5R3J5      ---------------------------------------------RIEKALEKAVQMRQE
A0A661PSB9      ---------------------------------------------RIEQALKKVS--RDR
A0A661QBT6      ---------------------------------------------RIEQALKKVS--RDR
A0A1W7QPT7      ---------------------------------------------RIEEAMEKAARMRQG
A0A1L3GKM9      ---------------------------------------------RIEKAIEKANQLRQG
A0A0M4D373      ---------------------------------------------RIEKALEKASLLREN
A0A5J4MX76      ---------------------------------------------RIEKAIEKATRLRQG
A0A430DNP0      ---------------------------------------------EPPLAPSSPKLALNL
A0A3A0FQ32      ---------------------------------------------KVYEALQRAEAERGR
A0A1E4UZA0      ---------------------------------------------RIKQAIEKAKK--QA
A0A1H9KL56      ---------------------------------------------RIKQAIEKAKK--QA
A0A1A9KEF8      ---------------------------------------------RNTPAHDDSQQQSPP
A0A5E6PKN5      ---------------------------------------------IIKPDADKAEQ--PT
A0A0N9W1V6      ----------------------------------------------------------MT
A0A423GQ41      ----------------------------------------------------------MT
A0A423H7J2      ----------------------------------------------------------MT
A0A502HNM8      ---------------------------------------------IIKPASDENEP--TT
A0A4Q7H223      ---------------------------------------------IIKPAGDKAEQ--PA
A0A1H4N2K9      ---------------------------------------------IIKPAGDKAEQ--PA
A0A2K4KWF7      ---------------------------------------------IIKPTGDKAEQ--PA
A0A3E0WXH2      ---------------------------------------------RIKQALEKAKSQAAG
A0A2N2TRC8      ---------------------------------------------RIKLAIEKAKTGGQS
A0A1V4CIZ7      ------------------------------------------------MPVDQETTARDG
A0A1M3BXA5      ---------------------------------------------RIKQALEKARQQSVG
A0A1Y2R3U6      ---------------------------------------------RIKEAVEKAKSQRVG
A0A167HVD6      ---------------------------------------------RIKLAIKKAKDGEAD
A0A1V3SCT6      ---------------------------------------------RIKLAIEKAKAAEAD
L0H287          ---------------------------------------------RLRKAGKRPLAEPAD
A0A495VG93      ---------------------------------------------RIKQAIDRARAER--
A0A4R3MYM4      ---------------------------------------------RLKKAMELARAQRES
G2E3C0          ---------------------------------------------RLKKAMERARAERQA
A0A534QGR3      ------------------------------------------------------------
A0A4U8YLL7      ---------------------------------------------IFRKAVPRKGAGQGG
A0A655RNN3      ------------------------------------------------------------
A0A655R819      ------------------------------------------------------MIVLLA
A0A655ZEY0      ---------------------------------------------LTPSKPNKKLIVLLA
A0A0W1GMS6      ------------------------------------------------------------
A0A0Q8RMY3      ------------------------------------------------------------
A0A1A7QC21      ------------------------------------------------------------
A0A2M7WWF7      ------------------------------------------------------------
A0A351Z9A2      ------------------------------------------------------------
A0A3N5RNY4      ---------------------------------------------TEQVSVKRIKIDAAV
A0A1E7H876      ------------------------------------------------------------
A0A0F2NF69      ---------------------------------------------SFNEQH---------
A0A1F9NFD0      ---------------------------------------------SFTEQH---------
A0A1M5YLH5      ---------------------------------------------KLADVLEKAGYGTEG
A0A4U1A4C7      ---------------------------------------------KFSKTLEKANQHKNV
A0A509L3P8      ---------------------------------------------KIYDALEKAQKEKTP
A0A3A4S038      ---------------------------------------------KVFDALEKSNQKI--
A0A1F9N669      ---------------------------------------------KMFEALEKSKNVIAD
A0A1F9PFA7      ---------------------------------------------KMFEALEKSKNVIAD
A0A1H2EN09      ---------------------------------------------KIYNAFKKKESEVFD
K0NP00          ---------------------------------------------KIYSAFEKKRSEERG
A0A432HIS7      ---------------------------------------------KIYDALEKSQQY---
A0A127AL56      ---------------------------------------------KIHDALEKAERE---
A0A1E7JCL5      ---------------------------------------------KFFEALRKSETT---
A0A496YAH9      ---------------------------------------------KIAEALEKHKKE---
A0A1V4S7E4      ---------------------------------------------KIFNALERHKKE---
A0A2N2H8D2      ---------------------------------------------KISEALERHNKE---
A0A2N2KC63      ---------------------------------------------KISEALERHNKE---
A0A3A4ZYW4      ---------------------------------------------KISEALERHNKE---
A0A1V4MCJ4      ---------------------------------------------KISDALDKYQSE---
A0A661M0W4      ---------------------------------------------KISDALERRRKE---
A0A1X0YE57      ---------------------------------------------RIDRAIEIAADIQAR
A0A2K2H9Q8      ---------------------------------------------RIDRAIEIAADIQAR
A0A2N6BEI9      ---------------------------------------------RLEKAVEEALKRKGG
A0A318CT66      ---------------------------------------------KLEKAMERAKQARGI
A0A3N5P205      ---------------------------------------------RLEKALKRAKQDR--
A0A0D5N3E9      ---------------------------------------------RIEQALEKAAMLRGT
A0A2N2G716      ---------------------------------------------RRTQTQKVAAVDDKP
A0A1F9EUS2      ---------------------------------------------RIYRALEKAEEEKRQ
A0A3N9VAW3      ---------------------------------------------RIEEALEKAAQLRNN
A0A1H4B8T3      ---------------------------------------------RIEEALKKVSSQRTR
A0A1E7IQC3      ---------------------------------------------RIQDALNKAASRRKS
A0A1M6KEN5      ---------------------------------------------RIEEALKKAASQRST
A0A353QLL3      ---------------------------------------------RIDQAIEKAARLREQ
A0A399I453      ---------------------------------------------RIEKALEKAAQLRNT
A0A651FBV9      ---------------------------------------------RIEEALEKAARLRGD
A0A1G0LDK7      ---------------------------------------------RIEEALEKAEKLRSA
A0A562VHD2      ---------------------------------------------RIERALEKASQMRGS
A0A5C1MDH8      ---------------------------------------------RIEKAMERAAQLREG
A0A5A9XE04      ---------------------------------------------RIEKAMEKAAQLRDG
A0A643G9R1      ---------------------------------------------RIEKAMEKAAQLRDG
A0A1G0M8Q7      ---------------------------------------------RIEMAMEKAARLREE
A0A353MI14      ---------------------------------------------RIEMAMEKAARLREE
A0A4S1CAW7      ---------------------------------------------RIEMAMEKAARLREE
A0A534HBS8      ------------------------------------------------------------
A0A0F0T3Y9      ------------------------------------------------------------
A0A351B422      ---------------------------------------------FIDKALERAQAARQK
F2NEE9          ---------------------------------------------FIDKALERAQAARQK
B7RS54          ------------------------------------------------------------
A0A3N5FRH4      ---------------------------------------------KMYEALQKAEKERIP
A0A1V4Y2C3      ---------------------------------------------KMYEALQKVEREKFG
A0A2N2KTJ4      ---------------------------------------------KMFDVLQKLEREKTA
A0A2N2LQX0      ---------------------------------------------KMFDVLQKLEREKNI
A0A318D3U4      ---------------------------------------------KIADALDKARRE---
A0A401FQP5      ---------------------------------------------QRVKLFRRKQKS---
A0A1Q6DMW3      ---------------------------------------------KVFDALSKSGAD---
A0A3A6P8F8      ---------------------------------------------KVAEALSKAGAD---
A0A2G2DSM4      ---------------------------------------------KFSTTLAKGEQQ---
A0A1F9NI02      ---------------------------------------------KISEALEKAGYG---
A0A4U1ABX4      ---------------------------------------------KISEVLKKAQYD---
A0A351Z4H9      ---------------------------------------------SERATYKDAPKD---
A0A2N2KML4      ---------------------------------------------KMYDALQKVERE---
E1YJF1          ---------------------------------------------KMFEALQKAEDE---
A0A1J5EVZ6      ---------------------------------------------KIHTALSKAGAE---
A0A2G6FCC5      ---------------------------------------------KVLRALSKAAES---
A0A1F9MR25      ---------------------------------------------KFFNVLAKAKKN---
A0A2G6M7F1      ---------------------------------------------KVYKILNRAEQNRNF
A0A1I0R9R6      ---------------------------------------------KLQAAIEKARRQRDG
A0A443K010      ---------------------------------------------KLQIAIEKARASRLA
A0A238IZI1      ---------------------------------------------KLQAALAKARAQRDG
A0A316GHM6      ---------------------------------------------KLQAALARAREKREG
A0A520ZTR8      ---------------------------------------------KLQAALARAREKRED
A0A212AR83      ---------------------------------------------RLQAAIEKARAQREE
A0A2E2P4I0      ---------------------------------------------RLQQAISKARKEREA
A0A2U2CM86      ---------------------------------------------RLQMALEKARAKREQ
A0A1X7ACC1      ---------------------------------------------RLQQAIQKARVERAS
A0A2N3BVE7      ---------------------------------------------KLEAALNKAREMRQT
A0A2S5JE21      ---------------------------------------------KLEAALAKARQMRQQ
A0A2R8BKZ2      ---------------------------------------------KLEAALAKAREMRKS
A0A2S8S361      ---------------------------------------------KLEAALAKAREMRKS
A0A238KUF6      ---------------------------------------------RLQAAIKQAREMREG
A0A095CTW3      ------------------------------------------------------------
A0A2E3UGD6      ---------------------------------------------KLQAALEQARRQRTE
A0A2T0RFH0      ---------------------------------------------KLQAALAKAREKRES
A0A285D390      ---------------------------------------------KLQKALQKARESREG
A0A497VHN4      ---------------------------------------------KLQKALGKARKQRGD
A0A379GWF0      --------------------------------------------------------MVLA
A0A536T0W8      ------------------------------------------------------------
A0A2G9XLE5      ------------------------------------------------------------
A0A3D2M6Y9      ---------------------------------------------EKPAKPIKPLVVLVA
A0A3D2YAZ2      ------------------------------------------------------------
A0A350A102      ------------------------------------------------------------
A0A350L5D2      ------------------------------------------------------------
A0A1I6ENM4      ---------------------------------------------KLQKALSKARQDRAA
A8LNM8          ---------------------------------------------KLQAALDKARERREG
A0A0T5NSU3      ------------------------------------------------------------
A0A5P9I718      ---------------------------------------------RLQAAIEKARAQRDK
A0A2M8J3R9      ---------------------------------------------RLQQAISKARTQRED
A0A1I6X762      ---------------------------------------------RLQQAIKKARSERES
A0A0P1EFX8      ---------------------------------------------KLQKAIEKARSQRRK
A0A2G5KB39      ---------------------------------------------RLQAAINKARAQRKT
A0A2N3CNV1      ---------------------------------------------RLQEALARAREQRRH
A0A257F1F4      ---------------------------------------------RLSEAISKARAARGD
A0A1G9FY29      ---------------------------------------------RLQTAIEKAREQRAE
A0A4Q3ZBK4      ---------------------------------------------RLQQAIEKAREQRAA
A0A2D5J8T8      ---------------------------------------------RLQTAIQKARMQRAG
A0A2E3P9W6      ---------------------------------------------RLQDAIHKARAQRSG
A0A2G2B1P9      ---------------------------------------------RLEAALEKARQDRQT
A0A258GCD5      ---------------------------------------------KLEAALAKAREMRKA
A0A2D9YR88      ---------------------------------------------RLQAAIERAREQR-D
A0A443INY4      ---------------------------------------------KLQIAIEKARASRLA
A0A372IH36      ---------------------------------------------RDRQRRALERRLREA
A0A540VW45      ---------------------------------------------TSRVDVVDTPGNDSP
A0A1H9C241      ---------------------------------------------KTK---LLERVARYS
A0A2E3FCR1      ---------------------------------------------PTERPVLMERVAQQA
A0A4S3MG69      ---------------------------------------------EAKSAPLLERVARHA
A0A1G8QZS5      ---------------------------------------------RIQAALKKAREERSQ
A0A1V4QMH7      ---------------------------------------------FIDKALEKAKTVKPT
A0A496XZQ4      ---------------------------------------------FIDKALEKAKTVKPT
A0A1F9BJF7      ---------------------------------------------FIDKALEKAKALHKK
F2NDF5          ---------------------------------------------FIEKAVELAKSSRRQ
A0A1I3TTC3      ---------------------------------------------RLHAAIAQARKAREA
A0A1H3IZW6      ---------------------------------------------RIQAAIARARTAREA
A0A0M6YG59      ---------------------------------------------RIQAAIARARTERDA
A0A1H7G8B0      ---------------------------------------------RLQAAIAQARAARQA
A0A059IPK4      ---------------------------------------------RLEAAMAKARAARK-
A0A1H2Y469      ---------------------------------------------RIQAAIQKARESRQD
A0A497ZQU7      ---------------------------------------------RIQTAIQKAREARRV
A0A520CSP5      ---------------------------------------------KIPVKPQKPLIVALG
A0A4Q2XLV7      ------------------------------------------------------------
A0A4Q5QYC4      ------------------------------------------------------------
A0A3B8SQ27      --------------------------------------------------------MLGG
A0A3E0H727      ---------------------------------------------EVLLNLDNPLYRAYV
A0A352Q5C1      ---------------------------------------------DRPIKPKSMLIIALS
A0A656BWB0      ------------------------------------------------------------
A0A3Y2RPN4      ------------------------------------------------------------
A0A0A0FHV8      ------------------------------------------------------------
A0A1X3IPU7      ------------------------------------------------------------
A0A0A0G0N2      ------------------------------------------------------------
A0A243TPR1      ------------------------------------------------------------
A0A2I8SDU4      ------------------------------------------------------------
A0A2I8SU55      ------------------------------------------------------------
S1EXJ6          ------------------------------------------------------------
A0A376UBS1      ------------------------------------------------------------
A0A4Q6G931      ------------------------------------------------------------
A0A4Q8R6L6      ---------------------------------------------PKPVEPKKILIVLIG
A0A2T0VBD8      ------------------------------------------------------------
A0A378APS2      ------------------------------------------------------------
A0A443VCQ6      ------------------------------------------------------------
A0A447RKQ7      ------------------------------------------------------------
W1DSK1          ------------------------------------------------------------
A0A0U2VAW2      ---------------------------------------------SKPVKPKKALIVVMA
A0A454CTF1      ---------------------------------------------AIPVKPKKPLIVVLA
A0A1W9F5M9      ------------------------------------------------------------
A0A352MMI7      ---------------------------------------------PGVLKPKKALIILGS
A0A379W6R2      ------------------------------------------------------------
A0A376RY66      ---------------------------------------------PGVLKPKKGLIILGA
A0A377K431      ---------------------------------------------PGVLKPKKGLIILGA
A0A379TA56      ---------------------------------------------PGVLKPKKALIILGS
A0A4Z0LWV1      ---------------------------------------------PGVLKPKKALIILGS
A0A620QD02      ---------------------------------------------PGVLKPKKALIILGS
A0A5H3HSJ8      ---------------------------------------------PGVLKPKKALIILGS
A0A655C5P0      ---------------------------------------------PGVLKPKKALIILGS
A0A3C2BN18      ------------------------------------------------------------
A0A447LR75      ------------------------------------------------------------
A0A376D8L7      ------------------------------------------------------------
A0A1V2FV46      ------------------------------------------------------------
A0A376SB61      ------------------------------------------------------------
A0A3D1BYV9      ------------------------------------------------------------
A0A378G3G7      ---------------------------------------------PDPIKPKKLLVIVVL
A0A2X5NHJ9      ---------------------------------------------PKPVKPKKSLILLIG
A0A2J4QEC3      ---------------------------------------------TKPVKPKKMLIVLAG
A0A485ADM3      ---------------------------------------------LKPVKPKKVLIVLIG
A0A4U9HGU4      ---------------------------------------------DSPVQPRKAIIMLLS
A0A3S4JGG5      ---------------------------------------------PRPVKPQKTIIVLIV
A0A377ZDH2      ---------------------------------------------VR-LNRKKTIIVLIA
A0A3S4HTS8      --------------------------------------------------------MLIV
A0A2N1XK22      ------------------------------------------------------------
A0A3D0KAC8      ---------------------------------------------ENPVKPNKPLVVIVA
A0A3D2Y902      ---------------------------------------------ENPVKPNKPLVVIVA
E1Y9C0          ------------------------------------------------------------
A0A1N6SH58      ------------------------------------------------------------
A0A4Q3AQN2      ------------------------------------------------------------
                                                                            

A0A1F9CFF0      ------------------------------------------------------------
A0A2M8B0G5      ------------------------------------------------------------
A0A363TNU9      ------------------------------------------------------------
A0A0C5VQ86      ------------------------------------------------------------
A0A1V8MBH1      ------------------------------------------------------------
A0A0R0BVC7      ------------------------------------------------------------
A0A3N5J7U8      ------------------------------------------------------------
A0A1S7S3I8      ----------------MENAKAGTSAATPGGEHATLDESGQVSFQKMLRLAVDSPR----
A0A519E8D7      ------------------------------------------------------------
A0A3S1NZ06      QVQLRDLDQKATALTTLYQTFLGRYEEAAQQQSFPVGKIRIISDASTP-LAASSPR----
A0A3S1FD32      QVKLRELDQQATALTTLYQTFLGRYEEAAQQQSFPVGKIRIISDASMP-MAASSPR----
A0A434DUT4      QVQLRELEQKATALSTLYQTFLGRYEEASQQQSFPVGKIRVISDATLP-QSAATPR----
A0A528D3U3      ------------------------------------------------------------
A0A3S3UPT3      ------------------------------------------------------PR----
A0A3S1E286      ------------------------------------------------------------
A0A531AC71      ----------------------------------------------LP-KSAATPR----
A0A436K268      ------------------------------------------------------------
A0A434IDQ0      ------------------------------------------------------------
A0A435IRM5      ------------------------------------------------------------
A0A3S2C404      ------------------------------------------------------------
A0A435F6C0      ------------------------------------------------------------
A0A435BMN6      ------------------------------------------------------------
A0A529XQ54      ------------------------------------------------------------
A0A530BJC1      ------------------------------------------------------------
Q44570          ------------------------------------------------------------
A0A655ZZQ1      ---------------------------------MVRKQRGKLDAKAYF------------
A0A1S0ZAI3      --------------------------------------MPTLEIAHKKLEQARKAE----
A0A1W9M770      ------------------MFGSKNTTTAPNDAGAQGAPAGPRPLEQTHARQPVPPS----
A0A1W9M7R6      ----------------------------------------------MPLRTPVPPS----
A0A3C0L0A8      ------------------------------------------------------------
A0A176S762      ------------------------------------------------------------
A0A377ZC40      ------------------------------------------------------------
A0A378BPJ7      ------------------MQLLNRQQELNIAKSSAIGNVRIIDDAITQ-PKPVKPK----
A0A2J5PAJ7      ----------------------------------------------TQ-PNPVKPK----
A0A377ZDN3      ------------------------------------------------------------
A0A1W9WUD9      ---------------------------------MKTGNIRVIDKAEIP-TVPISPN----
A0A1W1ZQK0      ------MGKFFTALQKSKTPIHERDKKDKVRLVSTQSQKKVEKKTSASLLNPVAPT----
A0A4U1ALN4      ALKKSGYSLEVPLQSTTDTQTERLVRSADNAATGGNEEKPFLVREPQRTEIYSPQ-----
A0A4U1B1A8      ALKKAG--VDL-------GAKDDDIQEPTEKQEVAVSESEKLDAVVPIREMVRELP----
A0A1M7Y300      ALKKAG--VELPDHAPVEVRRDDEVVAAEEPSSYQESTYTVTNKRAPAVDASQPL-----
A0A4U1A967      ALEKAG--VELIDKG---VASEGENFRVDNERETRNDNHNFSDDSNSPSDHLTNL-----
A0A3N5MZ53      ---------------------------------LASAQARVIESAVPP-QVPYKPK----
A0A534E4H4      ---------------QLYDLFLKRLSETSATGDLASARARIVEHAVVP-RLPAKPN----
A0A534I2B6      ---------------QLYDLFFKRLSETSATGDLATARARIVEPAVVP-RLPAKPH----
A0A1C2JGD0      ------------------MFLLEKQKEAAISRASTITKNRILDTALVH-SVPVSPK----
A0A259LQ70      -----------------------------MAGGVGSSQVSIVDRAIVP-PLPFEPN----
A0A4V2SPR5      ------------------------------------------------------------
A0A3N5PM86      ---------------SLYESLLKRVKEAGLTEGLEATNIVVVDPARVP-DHPVKPR----
A0A2E5YSA4      GSRSGCRFAREFQSGDEIESMGEIAEALRRADGANPIGQKERSAENLPRATPGPRD----
A0A519ERR1      --------RDVRVNNELYKSLLNSSLQLRLVKEGKVGNVRLLDRAVPS-KIPVKPQ----
A0A4Q3Q1M2      ------------------------------------------------------------
A0A4Q3MHR1      ------------------------------------------------------------
A0A520GDZ4      ------------------------------------------------------------
A0A318DSU0      ---------------ATYTSLLNQAQQLDIARAGTVGNVRVIDKAAVDISKPAKPK----
A0A538PF21      ---------------------------MTGSLSSIISNVRGLDKAQLP-TKPVSPN----
A0A1W1ZH10      ---------------TQYQTLLQRLRELDTKAQLQLADSRVVNAALVP-AQPSFPN----
A0A1W2FF24      ---------------TQYQTLLQRLRELDTKAQLQLADSRVVNAALVP-AQPSFPN----
A0A524JYQ6      ---------------ALYNSMLARMKETSVAGKLETNNIRLVDTAAVP-GAPFNIN----
A0A4Q3MA17      ---------------ESYATLLNSLQQLRLVKEGKVGNVRVVDPPAVP-EEPVKPK----
A0A0N0M5F7      ---------------ELYDGLLQRFKEVSAAAGVSANNISIVDLASTP-VRPVAPN----
A0A537M754      ---------------SLYDALLQRFKEVGVAGGVGENLVSVVDRAQTP-GAPFSPN----
A0A1V1PDB4      ---------------HMYELLIKRFKETSLTEDMKTGNVRVVDPAEVP-KSPIRPR----
A0A2M7C324      ---------------ELYDVFMGELKGTAAVSGMQTVVARVVDPAIVN-DTPIKPR----
A0A4Q3HHG6      --------------------------------SLPIAKARVISEAGVP-ISPSSPR----
A0A3B7DTA4      ---------------SSYDALLERYNQLTATAGASANNVSVVDVAEVP-SEPTSPS----
A0A432ZK62      ---------------EIYVQLLNRMQELNVLKAGTVGNVRILDEAVTN-PIPVAPK----
A0A1V5EEP4      -----MGKLYKALEKAEKERIGGQALKVPKEEPLPEIPEPRFASAAAP-VSITVPDEAEI
A0A1V5EF48      -----MGKLYKALEKAEKERSQAKGVEAVQEETIAQSPEPKFAGAAAP-VSIAMPEEVEA
A0A0S6X1X6      ---------------SLYDTLLARFNQLNAASGAVSNNITVVDYAEVP-TTPSSPK----
A0A537Y5L8      ---------------ALHDAFVQRYMESLQQQSFPFTDARVITHAVRP-LAKTQPN----
A0A4Q3L2X2      ---------------ALYDGLLQRFKEIGVANGVGVNNISIVDQADTP-EKPSSPR----
A0A4Q3T8J1      --------------RTLYEGLLQRYKEVSVTGGVASNNISIVDAADAP-AEPSKPD----
A0A4Q4ANM4      ---------------GIYETFLSRFTQSVQQQSFPSTEARVVTFASPP-NSPSSPKVALT
A0A4Q3UEC7      ---------------TLYENFLNRAKETREQVGIQTPDARIVGVANVP-LVASYPR----
A0A1H5YYQ4      --------------ARAAEEEAERQRLAEQLRRVEEERKAEARRQAEA-EQAAAAQSAQP
A0A1X4NLK2      QRQAELEAERLQEVARK----KDAERAERLESERKLAAELESRKQR---------E-AEL
A0A1X4NWB5      RQRAELEALRKKEAARDAERVRAAEEAEEQARKEKAARDAELKAQRAA-EREARLE-AEL
A0A1M5UQ38      --------ALLQRKAALKAEVARKKAQATQVSERPAPTVTTTDAKPRT-KSRPLVLASPP
A0A327YI48      -------------AAQEAERQHKLTAERQAEADRRAAAERQGEVERLA-EVERRAK-AEQ
A0A1B1PNL6      ---AAAQVRVRRQAEEAEREQAERERAAQEQAEREQAEMEAARRELAS-LRP--TA-PAA
A0A2U8H9H9      ---T--------EQGRADQMRTDQIRVAQIQTEQHRAEVETARRQPAA-TRARTVT-PLP
A0A1X6YIC0      PVPPLETRAERLERREAERRTDDRREFDRGETDRRTAERRAADPDPAP-AVAKAPEAASP
A0A1I5E9E9      QSDTPVQEDIPIPDAEAATPEADEAPLALN-PENIEPPLAEKPLAPEP-AAQQLPE-PEP
A0A1X6Z7N7      HSHSPDQVDALSLDAEAATQEADEAPFALR-PEMIAPPLDQEPLAPEA-DGQQLPE-PEP
A0A2E1DQ13      ---------------GDAAPADPEAALEPV-LARPRGSSTIPEPEPEP-SAATHAE----
A0A1H8C800      ETSLEERGDERAFPLDPEMRAEPEEAFAVT-PESLDSPEPEPEPEPEP-EPEPEPE-PEP
A0A2N3EZ05      ---------------PDETEPEPEAALEKG-LARRGDPVTLSEPEPEP-EPEPEPE-PEP
A0A1W9PMU6      -MKNLLASCQPRSVSLPTLRENPKRAETAILSSSTVSKTRIIDEALLP-TRPIKPK----
A0A1G3VVY5      -------------------------------------MGKMFDALQKA-EKERYRE----
A0A2N6BZD5      VFKALNKGASTDEADLPWDADSSHEPLAGDSSLPEAEPAGLTDHQAPP-TPPLPPS----
A0A435NNF5      ------------------------------------------------------------
A0A3S2AQS7      NIKYTILKREVDSNRSQYDSLIAKLNEVGVSSELKTQSAAIVDFASLP-TAPYSPR----
A0A436XH86      -----------------------------------------------P-TAPYSPR----
A0A527ZPD6      ------------------------------------------------------------
A0A529KRW3      -----------------------------------------------P-SSPYSPR----
A0A530ZLX0      ---------------SQYDSLIGKLNEVGVSSELKTQSAAIVDFATQP-DRPYSPR----
A0A355TB56      ----------------------------SEQQDMQLPDTRIIARADVP-VVPAFPQ----
A0A524M660      -----------------RVTKAGTVGDIRIIDYAVLSNKAIRPDKPLI-FGSAFIL----
A0A0C1TRU6      ---------------MSRIEQALEKAAMLRGTTTESGPVAVPRQTDDV-PPRERAG----
A0A2Z5SSF4      ---------------MSRIEQALEKAAMLRGTTTDRGPAVAPRQMEDV-QPRERAE----
A0A327LYE6      ------------------MPDISTDMASTDDDDVARPPGPEDAASTQT-SPEPPRA----
A0A5A9ZTV3      ------------------MPDISTDMASTDDDDVARPPGPEDAASTQT-SPEPPRA----
A0A4Q4CIB1      --------------------MLERSQQTVSQTAIEKPDARVLSPATKP-GMPSFPK----
A0A522ACJ9      MTDDKARFDLVGRVAARLAHGTSGVEPDSNSPSSPPDQIAAHRATDQP-TSSDDTE----
A0A3N5Z7F8      --------------------NALVTKIKEQRITEKIQPVNVWVIDAAE-TPEYPAK----
A0A239HD34      -------MDRLHAAIEKARAEREKALAGQPSRPLSPPPLPTGATQDPL-LGPAAAP----
A0A534V9L7      --------MHQGALPMSRVFEALNKASNEKKRDGQTAPTSTEMNVTAY-APAPEKE----
A0A0P7ZZE4      -------------------MERLKAALDKARETRAATAASAPATAARA-NPAAKPA----
A0A369R0Q9      -------------------MERLKAALDKARETRAATAAPAPASGARP-EPAANPA----
A5G4N9          SSTGERLVLKPRVHHLKKTPPTEKHIRLPEHKRHVPEAPQYEFTTRPA-EMEKLGW----
A0A238LBD3      ELDAQSAALRAALSESVEPPADEPEAAQDAVTPTDREATAAAPIEQPK-APAEPAE----
A0A0P1FRV5      AEVTDAAPVQRRGL---LSGSGRSAEEIAREDRALRSAFPFLDLDDVE-ADASELA----
A0A0P1FWI8      EKALREAFLWFDPD------------EVTQQDYDTSEPLSEAATAEQP-EPEPEPE----
A0A1M7BLL7      EATQEADEAPFALSPEMIAPPLDEKPLVAEADGQLPEPEPEPDVEDAP-NVADAAE----
A0A0H4KZM1      TPLEPEELTPPETP---TTADVRSEAERTSEAAPSPEAKPRAPAKDAR-PAVAPPE----
A0A1V1UJT2      EEIADEFALPLDPG---MRADPEEALAVTPESQDVPEPEPEPEPEPEP-EPEPEPE----
A0A0L6CVX1      ------------------------------------------------------------
A0A1V0RR48      ------------------------------------------------------------
A0A0A0HJJ4      QVVDTPEPEAPAQD---EIAQEETALAAPPESLELSEPEPEPEPEPEP-EPEPEPE----
A0A5E7YA28      HFPEMPVAEP---------TEEEAPLALSPESLNIPEPEPEPEPEPEP-EPEPEPE----
A0A348SRI7      ------------------------------------------------------------
A0A354EI73      ------------------------------------------------------------
A0A4P7EP83      ---------------MLFPAIMRYGADKPL------------------------------
A0A3A4NIE9      ------------------------------------------------------------
A0A3A4NUI9      ------------------------------------------------------------
A0A524I3Z6      ------------------------------------------------------------
A0A524PCL7      ------------------------------------------------------------
A0A356GQV1      ------------------------------------------------------------
A0A1J5DAY8      ------------------------------------------------------------
A0A524P237      ------------------------------------------------------------
A0A1G3JY11      ------------------------------------------------------------
A0A661N3U1      ------------------------------------------------------------
A0A3S1WTQ1      ----IGGKLGKEEKPGETQVDAKTTQSLSSAEKRARMRVSIDSPA---------------
A0A440NX85      ----------------------------------------IDAPA---------------
A0A530CUR9      ------------------------------------------------------------
A0A1M6N1X5      ------------------------------------------------------------
A0A561M3U0      QQDAVRLMLDVKVNTDLYAALLNNVQQLKLVKAGKTGSVRLVDSP-VVPEKIAFPN----
A0A2W5J775      --------------------------------DGNLHLLAVKDPA---------------
A0A1F9E324      AIQYNILKRESDTNKELYRGLLQRMKEAGVSAGITASNIQVVDQA-EPPTRPYRPN----
A0A432SAI6      ------------------------------------------------------------
A0A4Q3LBH4      GIELSILRREADTNRQQYEALLRRFNSLNAESGIQTNNLSIVDRA-NVPDRSSWPR----
A0A4Q3LWP3      GIELSILRREADTNRQQYEALLRRYNALNAESGVQTNNLSIIDRA-NVPGFPSWPK----
A0A2N6VGL1      ------------------------------------------------------------
A0A3M3H5V6      ------------------------------------------------------------
A0A2T4ZJZ6      -QVILELSGDVKVSTNLYSTLLNNAQTLRVAKAGTVGDVRIIDHA-VLPNNAIKPN----
A0A1T2KYM8      QSEYRALERNLEADQKLYDTFLTRFKETNISSGNNTPNARIIDEA-RVPGGHYWPN----
A0A2G9ZR82      ATQYKIMEREVETNKQIYNSLLERSKEIESMVGVSASNIHIVDRA-DLPVLPFKPK----
A0A4U9I390      CRHSEWLSNKTSLGGKSFLRYYIRHKTTRVPFLPVVRPM---------------------
A0A534XP85      ------------------------------------------------------------
A0A2X3M011      ------------------------------------------------------------
I2WC85          ------------------------------------------------------------
A0A400JH80      QQEVLRLSRDVEAGRAVYLQLLNRQQELSISKSSAIGNVRIIDPA-VTQPQPVKPK----
A0A2H9EHM4      ------------------------------------------------------------
A0A380B3D7      ------------------------------------------------------------
F5NSX0          ------------------------------------------------------------
D8EEU7          QQEVLRLSRDVEAGRAVYLQLLNRQQELSISKSSAIGNVRIIDPA-VTQPQPVKPK----
A0A479JNB1      --------------------------------------MRIIDPA-VTQPQPVKPK----
A0A5C9AF52      ------------------------------------------DPA-VTQPQPVKPK----
A0A0P1H2H0      GRSADDIAQEDRALRAAFPQWDGDEMQDAASDTTEMDAPHSHNDE-ALPDEPAAEP----
A0A258WKV0      ----NMLDREATALRAQLSSLLARYNEISAAANLNSGTSTKLDAA-RVPGGPVSPS----
A0A377N8F8      -QNILRLTRDVQTAQEMHSLLISKQREMEIKKVSTVGNVHIIDPA-QTLPSPVGPN----
A0A3C2DSE7      EFKVRDLQREVEANRALYDTFMTRLQETTATSDLSSTNARIVDEA-IPPAQASEPN----
A0A2X1JBG5      -QEILRLTRDVQVDQEIFVQLLNKQQELSVMKAGTISNVRIIDEA-AVATQAVKPK----
A0A0B8PTA8      ------MTRDVEVNQQIYLQLLNKSQELAIVKASTVGNVRILDGA-ESYSAPVKPK----
A0A0B8QF75      ------------MNQQIYLQLLNKSQELAIVKASTVGNVRILDGA-ESYSAPVKPK----
A0A4Q3LR91      NIQYDILQREVDTNRQLYDALLQRYKEIGVAGGVGVNNIAIVDSA-ETPSRPASPR----
A0A4V1TR68      SIQYNILQRDVDTNRQLYDALLQRYKEIGVAGGVGVNNISIVDTA-ELPGAPSSPR----
A0A444IY46      ASQYRILLRETETNKSIYETLLQRAKEIEATLGAAVTNITLVDRS-RVPLYPSSPK----
A0A660AID0      -REVLRMTRDVEVNQQIYIQLLNKVQELNIIKAGTVGNVRIIDNA-QSYAVPIKPK----
A0A3E0WKI3      -QELLRLRREAEVNSALYTAMLNNAQELRVVRAGMVGNVRVVDEA-ITGHRPVRPN----
A0A1H3I2J1      DAAFDALLAEFEASDDHDDDDLDETVALTPPYELEASEALALEESYRAPSEPAQQA----
A0A1V5DJV0      ------LMRHTKVNSELYTFLLQKREEARIAKTSTINNINIIDPA-ITPLTPVKPQ----
A0A520IUC4      GIGYTILQREVETNRTLYDALLQRFKEVGVAGGLGESQAGVVDAA-IQPASPFRPS----
A0A521LJG5      EAELKQLEREAQSNRTLYEGFLTRFKELREQQDIQRADARILAYA-QPSGAPSSPN----
A0A531IBQ7      QVKLRELDQQATALSTLYQTFLGRYEEATQQQTFPVGKVRIISDA-AMPLSAASPS----
A0A377LY04      -QEIVRLTRDVESGQQVYMQLLNKQQELKITEASTVGDVRIVDPA-ITQPGVLKPK----
A0A5C9ABR5      ------------------------------------------------QPGVLKPK----
A0A5J9WU72      ---IVRLTRDVESGQQVYMQLLNKEQELKITEASTVGDVRIVDPA-ITQPGVLKPK----
A0A2X3K9R3      -QEIVRLTRDVESGQQVYMQLLNKQQELKITEASTVGDVRIVDPA-IAQPGVLKPK----
A0A3T9EHW9      -QEIVRLTRDVESGQQVYMQLLNKEQELKITEASTVGDVRIVDPA-ITQPGVLKPK----
A0A484X141      -QEIVRLTRDVESGQQVYMQLLNKEQELKITEASTVGDVRIVDPA-ITQPGVLKPK----
A0A5N9VWI6      -QEIVRLTRDVESGQQVYMQLLNKEQELKITEASTVGDVRIVDPA-ITQPGVLKPK----
A0A3D3PV27      ------------------------------------------------------------
A0A376LLF8      ------------------------------------------------------------
A0A444R390      ------------------------------------------------------------
A0A1V4WHZ7      SIQYGVFLREVEKNRELYENLLKRLKETSVEHEFGATNIKIIDSA-TAPIHPAKPK----
A0A1E5AJN5      SVEFIILRREVDSKRSQFEALIEKLNNIGVGAELRSENVAVLDYA-VRTPDFFSPR----
A0A2N3D2J1      SIQYNILRREADTNRTLYDALLQRFKEISTIAGSQSNNITIVDPA-VVPGSPTSPK----
A0A2N2GVE1      DIEHSKLLRERNETAKLYELVLSRLKETGLAEELKTNNIRLLDAA-QIPLAPFKPV----
A0A2N2INV3      DIEHSKLLRERNETAKLYELVLSRLKETGLAEELKTNNIRLLDAA-QVPLAPFKPV----
A0A1Y5DXG5      -QKLLGLTRDVEVGNEIYMMLLGKVQELDIVRAGTVGNVRIIDVAEVNTTKPVKPK----
A0A0B8P2H5      ------LTRDVEVNQQIYLQLLNKSQELAIVKASTVGNVRILDGA-ESYSAPVKPK----
A0A483QWI8      ------LSRDVDSGQAVYMQLLNRQQELNIAKSSAIGNVRIIDNA-ISQPKPIKPN----
A0A483UXD3      ------LSRDVDSGQAVYMQLLNRQQELNIAKSSAIGNVRIIDNA-ISQPKPIKPN----
A0A0A8J8L3      ------LSRDVESGRAVYLQLLNRQQELNIAKSSAIGNVRIIDTA-ITEHKPVKPK----
A0A660DJ38      ------LSRDVESGRAVYLQLLNRQQELSIAKSSAIGNVRIVDDS-ITDPKPIKPK----
A0A380AQW6      ------LTRDVQVDQQVYMQLMNKQQELSISKAGTVGNIRIIDEA-ETGLRPVQPQ----
A0A2G2GD62      ERELGELTRNSSVNQEIYSFLLKRRVETAILNSSTLSQARLMDPA-TLPMRPYAPK----
A0A524P331      ERTQARLMRHSKVNADIYTFLLQKHEEARIAKASTISNINIVDPA-IVPEDPVKPQ----
A0A4V1SSM5      SAVASSLKRQAEARSSVYTQTSEAAQKMVSRQQGAMPMASIVEPA-VIPERATFPN----
A0A4Q3K8G7      SVELNELERRADALRTNYNALLQRQTIVASQAIVADADARPLSPA-LPPEQPSSPN----
A0A1M7HC79      ------LTRDVEVTQAIYVNVLNKAQELKLARAGTVGNVRIIDEA-LVGSGPIEPK----
A0A1D3JZN6      -QELLSLTRDVQVGTEIYTQLLNRSQELDVMRAGTVGNVRLIDSADANISKPVEPR----
A0A1V6ESG1      GVDLSLLKRELDTNRQIYDNLLQRLKEVGVTSGVAANNISVVDEA-KAPLFPFKPD----
A0A1H7YHK3      -QELLRLTRDLQVSNELYTALLNQAQQLDVARAGTVGNVRIIDPAAVDVTSPVKPR----
A0A534SH66      ----------METGHALHASLLKQQMETAVNSELAASNVRVIERA-EVPLHASRPN----
A0A3M0ZZ99      LARFYELRQEAEIARSQYAALLARQRQLEAQAPIQLADARIVSEA-LAPGTPSFPN----
A0A328C2K5      GFRYTEMRDSTETLRLHYESVLGRTNELDLNALYESEIIQVLENA-DVPSSPISPQ----
A0A5C6X8M3      GFRYTEMRDSTETLRQHYETVLGRTNELDLNALYESEIIQILENA-DVPGAPISPQ----
A0A3D8MRR7      GFRYTEMRDSTETLRQHYETVLGRTNELDLNALYESEIIQILENA-DVPGAPISPQ----
A0A5C6UBJ7      GFRYTEMRDSTETLRQHYETVLGRTNELDLNALYESEIIQILENA-DVPGAPISPQ----
A0A5C6XGM3      GFRYTEMRDSTETLRQHYETVLGRTNELDLNALYESEIIQILENA-DVPGAPISPQ----
A0A537NZJ1      ----------------------QRYQDSVQQESFPVTEARIITEA-AVPQEPSGPK----
A0A4Q4CVW6      DVEARALAREAEAERNLLQALLARRQEVSASLALLQPDARVISAA-DRPLTPIFPR----
A0A090R136      ------LTRDVEVNQQIYIQLLNKVQELNIMKASTVGNVRVLDEA-QIYPNAVKPN----
A0A661JU93      EVQLAELTRNVEANRAVYSMLINKLEETKIAEAQKSTDAKVIEYA-TKPLDPIKPR----
A0A2E2T3V8      LAGQGVLERDVEEAKRTVELLGAREQEILSSIAELKPDTLLLQLP-SVPLYPEFPG----
A0A367UAB4      LAGQGVLERDVEEAKRTVELLGAREQELLSSIAELKPDTLLLQLP-SVPLYPEFPR----
A0A377V641      ------LSRDVESGRAVYMQLLNRQQELNIAKSSAIGNVRIIDSA-VTQHKPVKPN----
A0A1F2YJ88      QRRYLQLYREVEVKQQLYTALLNSYQQLRIAKAGEIGNVRIVDTA-IEPVEPIKPK----
A0A0J7XGZ1      QVGRLELERRAEASRAIYSAYLTRAKETAQAGELPNADASIATLA-RPPGGPSSPN----
I4CBA7          ATRLSILKRAAAADAQVYLTLTQKIKQMALFSRLAPHTLGIEGPP-TLPTKPVFPD----
A3VE95          SIGRTQLEREAAAARENYEALLARLGAASGQENLQRPEARVIERA-TFPAVPSAPR----
A0A1G0NL95      ------LSREVQVNTQLYTSLLDSLQEQRVEQGGSLGTARIVDSS-IPPAAPAGPS----
A0A024KA69      --------QALASAQSHYRMLLDRLTRLEAEAFLQVPSARIAAVA-SPPVAPSSPK----
A0A0L1KFN4      SIQYNIFQQEVDTNRALYDGLLQRFKEIGVAAGVGVNNVAIVDTA-AVPELPSSPR----
A0A3P5DSS6      ------LSRDVESGRAVYMQLLNRQQELNIAKSSAIGNVRIIDDA-VVQPKPVKPK----
A0A483YEL5      ------LSRDVESGRAVYMQLLNRQQELNIAKSSAIGNVRIIDNA-VTQPKPVKPK----
A0A658GUJ0      ------LSRDVESGRAVYMQLLNRQQELNIAKSSAIGNVRIIDNA-VTQPKPVKPK----
A0A358L616      ------LTRDVQAGQEIYMQLLNRQQELSISKASTVGDVRIIDHA-ETASKPVAPK----
A0A3D5UYX7      LIQLRELEREADATRAVYEAFLNRFKETTGQQGLQTPDTRIISQA-VVPQAASYPR----
A0A2N1WQN5      ----------------------NKTQELDIIRAGTVGNVRIIDHAAADLENPVKPN----
A0A352G2C2      -QELLRLTRDVEVSSETYSMLLNKTQELDIIRAGTVGNVRIIDHAAADLENPVKPN----
A0A3C0PZN1      -QELLRLTRDVEVSSETYSMLLNKTQELDIIRAGTVGNVRIIDHAAADLENPVKPN----
A0A524QFS4      ---LTGLDREREALEVAYKGMLKRIEEARLAADENTATIKIVEPA-VAPSVPVKPN----
A0A520JSW4      LIQYNILHRDVDTNRTLYDALLQRYKEIGVAGGIGTAVASVVDRG-IVPGGAFSPR----
A0A4Q3LTF3      SIQYNIYQQEVDTNRALYDGLLQRFKEIGVAGGVGVNNVAIVDPA-DVPQRPSSPR----
A0A537UTP9      QIVLRDLESRAQTYRQLHDNFLQRYMETVQQQSFPISEARVITSA-TPPLRPSNPR----
A0A1D2RNR5      SVDFNLLKREVDTNRELYNGLLQQVKEVGVAGGVETNNIQVVDKA-EVPLFPYKPR----
A0A4V1TQ46      AVQYNILHRELDTNRALYDALLQRYKEVTAAAGLASSNVSIVDRA-EAPRSAVWPR----
A0A3A0FZC0      QVQFNVLNRELTSSRELLQNVLRQIKETSLAVESNASNVSIVDYA-VTPIEPSFPR----
A0A1N7JVZ7      VEAEPSPHVGGEESSDIENLFADEPTTESVEPDHHLGD--------RIEDGPVAPR----
A0A091C4A8      SIEYNILRREVDTNRQQYDALLQRYKEIGVAGGVGTNNISIVDPA-ELPISKYKPR----
A0A4R3H6P6      SIQYNIYQREADTNRELYNALLQRYKEIGVAGGIENNNVAIVDPA-RLPDRPSSPK----
A0A3S1NQ09      QVKLRELDQQATALTTLYQTFLGRYEEAAQQQSFPVGKIRIISDA-SMPMTASSPR----
A0A443GJ52      QVKLRELEQKATALSTLYQTFLGRYEEASQQQSFPVGKIRVISDA-TLPQSAATPR----
A0A2W6S588      SVQLAELQRRADNAHTLYTNLLTASGQQNANSALIQPDAQMVTPA-VVPLAPTSPR----
A0A483E0N4      ------LSRDVESGRAVYMQLLNRQQELSIAKSSAIGNVRIIDNA-VTQPKPVKPK----
A0A2J4YQQ6      ------LSRDVESGRAVYMQLLNRQQELNIAKSSAIGNVRIIDSA-VTQPKPVKPK----
A0A483THX4      ------LSRDVESGRAVYMQLLNRQQELNIAKSSAIGNVRIIDEA-VTQPKPVKPK----
A0A534MVS2      QMPWYPQELSVLNELRRLSTFTELLESVRMQEDSLKKILGVFDRLGLLEITSAGP-----
A0A444I5K6      QVELRELERTRDTYKNLYQSFLTRYQEAIQQQSFPITAARIITTA-ETPTKPSAPK----
A0A154VE85      LLSLRALEGDLRSRTQLYEVMLARFNEAKLQDERLVGPEARVISAAVPPAEPLFPG----
A0A3S1MCW7      NIKYTILKREVDSNRSQYDSLITKLNEVGVSSELKSQSAAIVDFA-AQPGSPYSPR----
A0A434IGN6      NIKYTILKREVDSNRSQYDNLIAKLNEVGVSSELKSQNAAIVDFA-TQPGSPYSPR----
A0A528AX40      NIQYTILKREVDSNRSQYDNLIAKLNEVGVSSELKTQSAAIVDFA-TPPNNPYSPR----
A0A528MV95      NIKYTILKREVDSNRSQYDNLIAKLNEVGVSSELKTQSAAIVDFA-TPPNAPYSPR----
A0A3C1S9Y1      AIQYGVLYRQAESSKHMYELLIKRFKETSLTEEMKTGNIRVIDRA-EIPNTPVSPN----
A0A353EH49      ---ILRLKRDVEMNTILYSKLLNTTQELKVAQAGDIGYVRVVDYA-FMPEEPFKPN----
A0A1Y1Q9C1      SIEYNALKREVETSRNLYDGLLQRMKEVSVASNVTSSNIRVVDAA-APDNEIFRPK----
A0A3M7LJH0      ------MTRDVQVNQQIYIQLLNKVQELNIIKAGTVGNVRILDSA-ATYAKAVKPK----
A0A316KRG4      ----------------------------------------------PVPGQPVKPR----
A0A1E4JHX8      SIQYNIYQREADTNRQLYDALLQRYKEIGVAGGVGTNNVSVVDVA-RIPERPSRPS----
M2U8P2          SVRLAELERNAEAARALYESFLSRLRENVAAAGTEQTNAYPLSRA-SAPRVPASPS----
A0A1H7KZF8      NVALAILQREADTNRNQYDALLARLNQLNAEAGVQVSNLSILDRA-VPPDRAYFPS----
A0A0J5Q9T7      REATERAEAERVTRDEAVRVKAERLKQLASERRAHMVAEASRKRVEVAPPDPGAPQ----
A0A257NG76      ------LARDVKVNTELYTALLNNTQTLRVSKAGTVGNVRIIDYA-VLPTEPIKPK----
A0A1T4TW59      RAQYDALKRDVDSNRQLYEMFLNRQKETTATSDFESLNARFTDKA-KSPQDPFRPQ----
A0A1I5YYQ0      PATAPAMAPPAERTATPVTPSLSESAADQDANWRALDTFRVDERL---------------
A0A5P9FE62      PATAPAMAPPAERTATPVTRSLSESAADQDANWRALDTFRVDERL---------------
A0A1Q3MB35      SIQYAIYQREVDTTRELYQGLLQRYKEIGVA-GVGANNVTVVDRA-VVPLEPSSPN----
A0A259LUN7      LVRLRELERDAETSRVMLEEFLARSKQTREQDSLITADSSVLSAA-SVPRAPAAPR----
A0A2D7AVL1      SVXYGILERQVETNRSQYDALLTRLKELTTAEGIGASQASVVDRA-IAPTHPFQPS----
A0A3B9KZE9      SVQYGILERQVETNRSQYDALLTRLKELTTAEGIGASQASVVDRA-IAPTHPFQPS----
A0A2U0NMP8      ------LSRDVESGRAVYMQLLNRQQELNIAKSSAIGNVRIIDNA-VTQPKPVKPK----
A0A4U9HNE9      ------LTRDVQVDQQVYMQLLNKQQELNISKAGTVGNIRIIDAA-ETAIKPIKPQ----
A0A2G2CXY6      ------LKRDVAVTTEIYTALLNSSQELDVLRAGTVGNVRIIDEAAANVEETVKPK----
A0A3M1D4H3      MRHMSQLELAAEAAENVYKSLQEQNYQVGVAESMLVSDMQLVEPA-VAPERHYSPK----
A0A5C8BYM7      SVDYNLLKREVDTNRELYNGLLQQVKEVGVAGGVETNNIQVVDKA-EVPLFPYKPK----
A0A1J5ICP0      EKRLAELTRGAEVQQSAYSSLLRNKQEFEIMKAGEIGNVWVVDSA--ASAKIIKPK----
A0A0M3GBT1      QTELTRLQRISDKEQTALEKLEDQRRDLADKAKLPGAELEVLSPA-SVPLAAQGRG----
B3Q577          QTELTRLQRISDKEQTALEKLEDQRRDLADKAKLPGAELEVLSPA-SVPLAAQGRG----
A0A379B9V4      ------FTRDLEVNQHIYIQLLNKMQELDVVKASTIGNVRILDHA-QVFPNPVAPK----
A0A0Q6TS97      SIQYNIYQRDADTNRELYNALLQRYKEIGVAGGAENNNVAIVDPA-RLPDRPASPK----
A0A0Q6UYB4      SIQYNIYQRDADTNRELYNALLQRYKEIGVAGGAENNNVAIVDPA-RLPDRPASPK----
A0A484XS37      ------LTRDVQAAQEIYMQLLNKQQKLGITKASTVGNVRIVDPA-ITQPRPVKPQ----
W7Q5J0          ------LTRDVEVTQAIYVNVLNKVQELQVAKAGTIGNVRIIDRA--EIRGMVAPQ----
A0A654AKT6      GYPFLLDARLEDLLAGVTADDVRSHYMYMPSLRLVETEIAAGIPFAGLPASVADMG----
A0A0G9MZA5      SVEYNILQREVDTNREIYAGLLQRYREIGVV-GVGESNVLVVDPA-QVPGGPYTPS----
H0T8B0          QAKLRELESTAKVYQSNYATFLARFTQTAQQQPVPANSSRIVHEA--GPGFRIAPI----
A0A5C7N981      NFQYNLFKREVDTNRELYDSLLQRYKEIGVAGGVGVNNITVIDKA-KVPTLPIKPN----
A0A534TV22      GVAYAVYEEEVKVNRALYEGVLKRLSETSVANDLAISNMQISQFA-ERPNWPSSPD----
A0A351CXR4      ------LEKDVENARTLHDMFLRRYQEANVSTDTGMVDVQIIEAA-LPANGPIWAN----
A0A2N6GLF5      SQELRVLEREVEANRQLYSQFLEKMKEAKETTGLERVRARVSDPA-VPAVKPIKPK----
A0A1W9LJP0      AIRYGVLQRDAESSRNMYELLVKRFKEASLTEEMKTGNIRIIDRA-EVPKAPVSPN----
A0A0W1ICB0      SIQYNIYQREVDTNRELYDGLLQRYKEIGVA-GVGTNNISVVDDA-VNPVKPSSPR----
A0A2E0UL88      SIEFARLERERLSNEKLFMILDERYQEARINEQTTMGNVDVVDDA-TPPGRPISPD----
A0A233IKJ2      NARYSELKREVQTNRELFDLFLSRQKETSASSDFNATIARFTDFA-NPPLAPSKPN----
A0A2T1JE00      NARYSELKREVQTNRELFDLFLSRQKETSASSDFNATIARFTDFA-NPPLAPSKPN----
A0A0T2QIS1      SIQYNIYQREADTNRQLYDSLLQRYKEIGVA-GVSISNIAIVDGA-QVPDSPTSPD----
A0A376KYN0      ------LSRDVEAGRAVYLQLLNRQQELSISKSSAIGNVRIIDPA-VTQPQPVKPK----
A0A2X1JB05      ------LSRDVEAGRAVYLQLLNRQQELSISKSSAIGNVRIIDPA-VTQPQPVKPK----
A0A376RML0      ------LSRDVEAGRAVYLQLLNRQQELSISKSSAIGNVRIIDPA-VTQPQPVKPK----
A0A377E5P7      ------LSRDVEAGRAVYLQLLNRQQELSISKSSAIGNVRIIDPA-VTQPQPVKPK----
A0A0P7Y1D0      LVQLRELEREAEASRTLFESFLNRFRQTSEQNDLATADARIVARA-PVPVTPSSPN----
A0A2M7JRZ7      GIQYNILKREADTNKELYKGLLQRMKEAGVSAGLTVSNIQVVYQA-EIPTGSYKPN----
A0A167IR75      SIQYNIYQQEVDTNRALYDGLLQRFQELGVAAGVGVNNIAIVDTA-NVPERPSSPR----
X7F6S5          ELAEAREAERARAAEAERPLLLRAAEPAREPAPAPEAPPSV---PGDGSAAAWERL----
A0A1G7CFZ2      ---STEPARPEARRG--------QTAPRPAAPAVATRTAQS---PAPLQQRGWDDL----
A0A1P8USW9      ---AAIAERREERRKAREDALRRAQEDTETVPAAAAAPEPK---PAPQATPLWDAL----
A0A1I6U4V1      ---QLAAARPRAAAAVAAPVNASAAPAHPAPETAPAFRRPITHRTAPQAEALWDRL----
A0A1G8NKI0      ---QAEAAARTRAQAAAEARAAREAENARAQVEADAASAPI-----PGTDQRWSAL----
A0A355QPE4      ---QAEAAARTRAKAAAEARAAREAENARAQVEADAASAPI-----PATDQRWSAL----
A0A357RN98      ---QAEAAARTRAKAAAEARAAREAENARAQVEADAASAPI-----PATDQRWSAL----
A0A3B8T2U6      ENQHLALQREVEINNQLYSSFFTRLKETNEIGGFERANARILDAA-KPALVPFKPR----
A0A365PWR2      ------LSRDVKVNNEIYLLMLNRAQELEVMRNGIAGNVHVLDQPVADTISPAWPN----
A0A2E9H5Z8      SQDYVEAKQDYETAKAMLSQMKLTNSARRIALKIPKNPITILEDP-KLAKDPVYPK----
A0A2E2BR79      ------LTRDVEVTQAIYVNLLNRSQELNLAKAGTIGNVRIIDSA-QVSPSPIAPK----
A0A0Q4Q524      SIQYNIYQQEVDTNRALYEGLLQRFKEIGVAGGVGVNNVSVVDQA-DVPQKPSSPR----
A0A0Q4CFJ9      SIQYNIFQQEVDTNRALYEGLLQRFKEIGVAGGVGVNNVAVVDQA-DVPQHPSSPR----
A0A0Q4FE58      SIQYNIFQQEVDTNRALYEGLLQRFKEIGVAGGVGVNNISIVDQA-DIPQKPSSPR----
A0A0Q4JWC8      SIQYNIFQQEVDTNRALYEGLLQRFKEIGVAGGVGVNNISIVDQA-DIPQKPSSPR----
A0A0Q4KFL8      SIQYNIFQQEVDTNRALYEGLLQRFKEIGVAGGVGVNNISIVDQA-DIPQKPSSPR----
A0A522R8R0      MVHLRELEQKADALSSLYQAFLSRHAEALQQRSFPIAKARVISQA-DDPTSPSSPR----
A0A2U9NDY5      ------RKRDMEVTTQTYTLLMNQAQEQDILRAGTIGNVRIIDNAYSMIEKPSKPV----
A0A0Q4IGG1      SIQYNIYQQEVDTNRALYDGLLQRYKEIGVAGNIGVNNISVVDAA-NVPQRPSSPR----
A0A534RUJ5      SVQYAILDREADTNRQLYDSVLQRMKEMGVAADVRASNVSVIDEA-EPPLKPSSPK----
A0A3M1CJM3      EIEYNRLKRVADNYAALYQHILKRQKEATLAAHQETNNVYKLDSA-VEPLRPVYPR----
A0A2R7SVD4      ------LTRDVEVASQIYTQLLNKSQELDIVRAGAVGNVRLVDTADVDLSSPVKPK----
A0A3C0PWB6      ------LKRDMEVTTQTYTLLMNQAQEQDVLRAGTIGNVRIIDNAYSMTEKPSKPV----
V4Q8B7          ------LQRDMEVTTQTYTLLMNQAQEQDILRAGTIGNVRIIDNAYSMIEKPSKPV----
A0A0Q8XKK5      SIQYNIYQREADTNRQLYDGLLQRYKEIGVA-GVGANNIALVDVA-KVPDRQSSPR----
A0A2E0Q2W0      GVQYGILDREVNTNRQLYDALLQRYKELDVVGG-GRNNIALVERA-EQPGGPYSPS----
A0A660NIR6      EGKLNVLQREVATNQQIYQTFLAKVKETDATADFQNPIARVVDPA-VPPLLAAKPP----
A0A142W0R3      SIEYAILQREVDTNRQLYDGLLQRYKEIG-AAGVGTNNIAVVDTA-TPSPGPSSPK----
A0A0S4XR18      ------LSRNFEVNQKMYSYLLEKKAEFEIMNAATISKNRILDNA-IVYPQPIKPK----
A0A2E0GW64      ------LMREVKVKETLYSNLLSKIQELSVLRAGTTGDVRILDYA-TLPLSPLPTH----
A0A1A7QJ97      SIQYNIFEQEVDTNQALYDGLLQRFEEIGIAGGVGVNNIAIVDLA-DVPQIPSSPR----
A0A661LW70      AIQYGVLRREAESARYMYELLIKRFKETSLTEDMRTGNIRIVDGA-EVPRYPVKPK----
W7Q8F9          ------LTRDVEVTQAIYINVLNKVQELQVAKAGTIGNIRIIDRA-EI-RGMVAPQ----
A0A524PXH8      AIDFKIMRREVDTNRDIYESLLRRMKEVEVAETIRASNITLLDNP-EVPLTPSSPK----
A0A4Q3P0E4      ------MQRDVTVNTGLYQSLLNQALQLRLVKEGKVGNVRLLDSA-TVPEIPVKPQ----
A0A3M2BE89      ------LMRDVKVQTELYTLLLNKTQELEVARAGTIGNVRVLDYA-VRPDRPVKPK----
A0A4Q4A6K6      ELTMRELETSAKSYRSLYESFLQRYMGSVQQESFPSADARIIASA-SPPPGKSKPK----
A0A257G674      LVQYNLLAREADTSRTVYEGLLQRYKELNAAAGINASNIAIIDSA-IPPIRPSSPN----
A0A661M5M6      EIEYRRLNHDRDSKAKLYEIVLQRLTETELTRMLKTTHVRVLDRA-LLPVTPVSPN----
A0A1I1UM01      -------------------------------------RRPHIERA-PVPASGRAVA----
Q44573          QAEYRTLDQEAQSARAVYETFLEHAKEVVDRAALLQPPISVVSHA-SPPDVPSFPN----
A2W025          ------LQRDAKVAEDIYVLLLNRVQELSVQKAGTGGNIHLIDSA-LRPGAPVKPK----
A0A534Z362      GARYQLLKNDVETGHALHASLLKQQMETAVNSELAASNVRVIERA-EVPLHASRPN----
V4J283          ------LSRDVEVNSSLYSRLINAMQELRIAKAGTVGNARIIDYA-LPPTFPSAPN----
A0A536T443      ALEEVRLSRDQANATELFSNLDQRYNETRLAEVSTLPDVRILEHA-IRPTRPVVNA----
A0A0Q4UFQ5      SIQYNILQREVDTNRQLYDALLQRYKEIGVAGGVGVNNIAVVDDA-ELPVAPDRPR----
A0A527W7E6      QVKLKELEQQAQALTTLYQTFLSRYEEASQQQSFPVGKVRIISDA-TMPLAASGPR----
A0A432EMV7      SSDLTELEREVQANKDLYDAFLKRLKELDVSGFNSKTRVHIIDKA-VAPEEVYKPD----
A0A087LTV7      ------ERQALASAQSHYRMLLDRLTRLEAEAFLQVPSARIAAAA-SPPVAPSSPK----
A0A534WLI3      GSRYDLLKSDADSARALRESLLKQRMATEVNAQLAAFTVRMVERS-EVPRRPSRPS----
A0A318KWA2      ------RTRDVEVTQAIYVNVLNRLQELQVARAGTIGNVRIIDDA-EVGAAPIEPR----
A0A522MT86      ------LTRDAKVAEQVYLGMMQKAEELSVRRASTTGGAHIVDEA-AAPFRPVKPD----
A0A4Q3I221      QVQLRELEREADTYKNMYQTFLQRYQEAIQQQSFPVTEARIITRA-AAPDSPSHPR----
A0A534SAL6      GARYDLLKNDVDTAHALHDSLLKQQMETSVNSELVASNVRVIERP-EVPQGPSKPR----
A0A534ZDB4      GARYDLLKNDVDSAHALHDSLLKQQMETSVNSELAASNVRVVERP-EVPQSPSKPR----
A0A534X3M7      GARYQLLKNNVEGAHALHASLLKQRNETAVNAELVASNVRVIERA-EVPRRPSKPN----
A0A534SPC6      GARYQLLKNDVETGHALHASLLKQQMETAVNSELAASNVRVIERA-EVPLHASRPN----
A0A535AD60      GARYQLLKSDEENAYALHASLLKQQMETAVNSELAASNVRVVERA-EVPLHASRPN----
A0A4Q3SY08      MVGLSELEQKAAASQALYESYLNQYKQTNAQEGTEQPDSRLISEA-RVPSKPSSPN----
A0A4Q3LG23      SIQYNIYQQEVDTNRALYDGLLQRFKEIGVAGGVGINNVSVVDAA-DIPQKPSSPR----
A0A522EX52      -------------------------------------EYKLKTIP-EADQIAVNLM----
A0A1H3KC95      RPEYPPRASPTPGERPSAAGARGPVTAAEPQHPQPADAPPATTPA-AADDDPGDAS----
A0A5P8Z4P3      ------QPPEHKEDVPSQDTDDMPEHDAPEPLVLSADSKLVTDPP-EAQDAAPLDE----
A0A0B3RZC9      -------------------------------------QVRLAEAR-AAEDAARRAE----
A0A2E9HXF7      -------------------------------------EVREAEQR-KADAEARDAD----
A0A520HUH4      TRIIEGLRSEARSASAKATDLAQQLTALKQEIALNNQAAVRADGL-QRKADAATTA----
A0A2K8U7M6      GGGYRVLEREVADHQERHDALLARMKSLESAAGPGINPIAIVDRA-QVPRAPYRPD----
A0A5B9DKL8      --------------SNLALALAAGFATVLGLLVALVRERTTTGFV-DEQEAVRTLG----
A0A238KJM1      -------------------------------------ELAEIEAK-TRADADRRAE----
A0A3A0FJZ4      VKQLRAELARRRAQLVAPAATAAGVAAVSDEPSARYRSLLRAYDT-NVQSYARLLG----
W4HJV8          TSATETNIPHATPDAPAETSEDETSSEGLSGPDLSRSAADATARR-TPADVAREVR----
A0A0P1GDI0      DIDLARESERVRREKAERLAAKQVAQAEADRLAAEQAAQAEADRL-AAEQAAQAKA----
A0A2R8ATV5      ------EQTRQSQVARARTLKEEKAKALLVAAEKAEQDAAAEEDA-LNEAKERLIA----
A0A1U7D3R6      -------------------------------------AARKAEQL-RLAEAAREAE----
A0A2D4UVV2      -------------------------------------AARKAEQL-RLAEAAREAE----
A0A0W7WHP4      ------EALRRAEA-----------------------ERQAAAAR-KAELEERAAE----
A0A238J8F6      ------EKRAQEREAARKAEEQARREKARLEEARKEKERLAAEKA-AAEQAKREAE----
A0A238JQI6      ------EERRKAEDAARKAQE----------------ARLAEERR-KAEDAARKAQ----
A0A222E077      ------------------------------------------------DAEARDAD----
A0A239E3Y2      ------KAKRLADEHQRAAEAEAK-------------RLAEAAQR-KADAEARDAE----
A0A1W9HS52      YQRYGDVQSRLTEIERAVEINRHMEKHTESELKKIKENIVNPQLSSSELFLSQNQH----
A0A2D5LFD8      RQRQQSLRDGLAFLDQQKPALEAKSTALLTELENFRKQNLLIDAS---------------
A0A0N0XAV4      ------------------------------------------------------------
A0A0P9QD19      ------------------------------------------------------------
F3FHG4          ------------------------------------------------------------
F3GGI0          ERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS---------------
A0A0P9LE74      --------------------------------------VRGAD-----------------
A0A3M4ZQ14      ERSSAEAAQRLEFLRSQLPAVRKQLEESEVALNNFQTSAKSVDLS---------------
A0A3M5YLE8      ERSSAEAAQRLEFLRSQLPAVRKQLEESEVALNNFQTSAKSVDLS---------------
A0A3M3RP89      ERSSAEAAQRLEFLRSQLPAVRKQLEESEVALNNFQTSAKSVDLS---------------
A0A0P9QIY7      ERSSAEAAQRLEFLRSQLPAVRKQLEESEVALNNFQTSAKSVDLS---------------
A0A0P9VVH7      ERSSAEAAQRLEFLRSQLPAVRKQLEESEVALNNFQTSAKSVDLS---------------
A0A0Q0FJK6      ERSSAEAAQRLEFLRSQLPAVRKQLEESEVALNNFQTSAKSVDLS---------------
A0A0Q0G2J0      ERSSAEAAQRLEFLRSQLPAVRKQLEESEVALNNFQTSAKSVDLS---------------
A0A3M3LF66      ERSSAEAAQRLEFLRSQLPAVRKQLEESEVALNNFQTSAKSVDLS---------------
A0A0P9WIR8      ERSSAEAAQRLEFLRSQLPAVRKQLEESEVALNNFQTSAKSVDLS---------------
A0A3M3KPE5      ERSSAEAAQRLEFLRSQLPAVRKQLEESEVALNNFQTSAKSVDLS---------------
A0A3M4C263      ERSSAEAAQRLEFLRSQLPAVRKQLEESEVALNNFQTSAKSVDLS---------------
A0A3M5AD05      ERSSAEAAQRLEFLRSQLPAVRKQLEESEVALNNFQTSAKSVDLS---------------
A0A0Q0D3D2      ERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS---------------
A0A0N0FS39      -----------------MPAVRKQLEDAETALNNFQTSARSVDLS---------------
A0A3M6GHH2      -----------------------------------------MDLS---------------
A0A0P9R9W0      ERSSAEAAQRLQFLRSQLPAVRKQLEESEAALNTFQTSARSVDLS---------------
A0A0Q0B9T0      ERSSAEAAQRLQFLRSQLPAVRKQLEESEAALNTFQTSARSVDLS---------------
A0A3M6CFI7      ERSSAEAAQRLQFLRSQLPAVRKQLEESEAALNTFQTSARSVDLS---------------
A0A0P9JXN0      ERSSAEAAQRLQFLRSQLPAVRKQLEESEAALNTFQTSARSVDLS---------------
A0A3M6FIV7      ERSSAEAAQRLQFLRSQLPAVRKQLEESEAALNTFQTSARSVDLS---------------
A0A3M3PLW9      ERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS---------------
A0A3M4ENY1      ERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS---------------
A0A3M5EZK7      ERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS---------------
A0A0P9SPP5      ERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS---------------
A0A658KL17      ERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS---------------
A0A3M3NNF2      ERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS---------------
A0A3M4A0E8      ERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS---------------
A0A3M4PBZ2      ERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS---------------
A0A3M6AI26      ERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS---------------
A0A0P9IWP8      ERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS---------------
A0A0P9KZ49      ERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS---------------
A0A0P9V840      ERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS---------------
A0A0Q0AIE5      ERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS---------------
A0A3M2ZQH6      ERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS---------------
A0A0N8SQG2      ERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS---------------
A0A0W8HFU1      ERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS---------------
A0A3M5M873      ERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS---------------
A0A0P9VHH8      ERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS---------------
A0A0P9YV98      ERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNNFQTSARSVDLS---------------
A0A3M3G2W8      ERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNNFQTSARSVDLS---------------
A0A3M6C224      ERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNNFQTSARSVDLS---------------
A0A3M5K254      ERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS---------------
A0A3M5JFB0      ERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS---------------
A0A3M3TQV3      ERSSAEAAQRLQFLRSQLPAVRKQLEEAETALNTFQTSARSVDLS---------------
A0A3M3EF92      ERSSAEAAQRLQFLRSQLPAVRKQLEEAETALNTFQTSARSVDLS---------------
A0A3M5J1E2      ERSSAEAAQRLQFLRSQLPAVRKQLEEAETALNTFQTSARSVDLS---------------
A0A3M5G7H9      ERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS---------------
A0A3M4A376      ERSSAEAAQRLQFLRSQLPAVRKQLEEAETALNTFQTSARSVDLS---------------
A0A0Q0A5T8      ERSSAEAAQRLQFLRSQLPAVRKQLEEAETALNTFQTSARSVDLS---------------
A0A0P9SCD7      ERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS---------------
A0A0P9T4G3      ERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS---------------
A0A0P9VKB0      ERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS---------------
A0A0Q0BM35      ERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS---------------
A0A3M3TPR7      ERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS---------------
A0A3M3U4Q3      ERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS---------------
A0A0P9UCX7      ERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS---------------
A0A0P9S1F1      ERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS---------------
A0A0P9QCJ2      ERSSAEAAQRLQFLRSQLPAVRKQLEEAETALNTFQTSARSVDLS---------------
A0A0P9Q329      ERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS---------------
A0A3M5GJ64      ERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS---------------
A0A0P9MPC7      ERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS---------------
A0A3M2XYQ3      ERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS---------------
A0A0P9XCE1      ERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS---------------
A0A3M3EFX7      ERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS---------------
A0A3M5B9D9      ERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS---------------
A0A0P9RRZ3      ERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS---------------
A0A3M2VEK7      ERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS---------------
A0A0N8R9B3      ERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS---------------
A0A0P9VA27      ERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS---------------
A0A3M4YBJ4      ERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS---------------
A0A0P9J470      ERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS---------------
A0A0Q0EVJ8      ERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS---------------
A0A3M5UI30      ERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS---------------
A0A3M5YQT8      ERSSAEAAQRLQFLRSQLPAVRKQLEEAETALNTFQTSARSVDLS---------------
A0A3M5F5X1      ERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS---------------
A0A3M5R8G1      ERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS---------------
A0A3M5V012      ERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS---------------
A0A3M3GA16      ERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLS---------------
A0A3M3UCT3      ERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS---------------
A0A3M3CJL0      ERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS---------------
A0A3M3F6F5      ERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS---------------
A0A3M3P9B7      ERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS---------------
A0A0N8QB74      ERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS---------------
A0A0Q0AUD0      ERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS---------------
A0A3M5VR55      ERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS---------------
A0A0Q0FK97      ERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS---------------
A0A3M5KZ75      ERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS---------------
A0A3M5L3G5      ERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLS---------------
A0A1V6FYJ1      EG----------------------------------------------------------
A0A445MZQ4      KTLMFRPETDHGLGTV--------------------------------------------
A0A0M9E0E3      -----------------------------------------REYL---------------
A0A0Q6QV61      --------------------------------------MRSREEE---------------
A0A2Z3IKG4      --------------------------IALVAYRDNGMPPLPPSQA---------------
A0A4Q3IRI1      ------------------------------------------------------------
A0A2W4RFS2      -----------------------------------MSQETDQQPL---------------
A0A1Y6DC43      -----------------------------------MHEITRIQPL---------------
A0A2S6HE06      -----------------------------------MIRNTDKYPL---------------
G3J0M3          -----------------------------------MIKNTDKYPL---------------
V5C6R5          -----------------------------------MVDSSESDSL---------------
A0A354EF47      DDSP----------------------LLTSDNEDAVSVSVTAEPI---------------
A0A2G6MSP7      IGAAFIAEFFDNTIKNPDEMADRFGIPVLGLIPFDKE-----------------------
A0A1V4M8I1      --------------------------QVPIRHDRGVKPVYQDRIL---------------
A0A4Z0M4C7      -----------------------------------------AGQS---------------
A0A4U8YMP3      --------------------------DKPEVSTAEAPVPEVPEDL---------------
A0A1Q8QQ99      DTPP-------------------------------------PPLR---------------
A0A3D5ZY44      -----------------------------------------ELGV---------------
A0A646J2A6      ------------------------------------------------------------
A0A1G5C236      --------------------------RGDKPVVSTPDKVKNEVPA---------------
A0A5Q2QDL1      PVVA----------------------PAPAPIVEGAR----DRAQ---------------
A0A656PSQ6      ------------------------------------------------------------
A0A1I3XJ27      --------------------------SPVRLP---ERSIPSVHSV---------------
A0A1I7DCG1      --------------------------GSDPAND--QTATTVARMG---------------
A0A3A3H6D9      --------------------------GSDPAND--QTTTTVARMG---------------
A0A562CGU2      --------------------------GRPWVEEVLPPPLHAHQIE---------------
A0A0Q6VA36      --------------------------AHRDGD---RMPVSRSQEL---------------
A0A1B2EQN1      --------------------------SVTFAE---SRASSFPPD----------------
A0A1E7HSL6      TSINK------------------------------------KSET---------------
W9VVY5          ------------AAPQRQD-------KIATVSRLEPAQPKPPATD---------------
A0A1E2URD3      ------------SSSRNIK-------GQNIISSDNRN----YLDL---------------
A0A2T6MY81      ------------NATVTEN-------RHKKTVSQSPE----SVDL---------------
A0A2T6NBQ8      ------------TSTQHRG-------NYQKVVRKSPE----PEFT---------------
A0A421K431      ------------ISKTSLD-------KDRVVMSKDPE----SDFT---------------
A0A2G2I5M1      ------SEQAIIDVPSTNE-------ENAISSPIDPL----KSPI---------------
A0A2G2M6F0      ------SEQAAVGLSDAKK-------EKTISQLEDPL----KSPI---------------
A0A1W9J9F8      -QFKAETKASSTLLQSGVV-------SQKEIKSFPNT----ENEL---------------
A0A2S5LFJ9      -QFKAETKASSTLLQSGVV-------SQKEIKGFPNT----ENEL---------------
A0A2D8R8F8      ----------------NAP-------RRQHVPMDIDE----RYEP---------------
A0A010SNS0      --------------SSSLV-------TMPKAMTVTGQ----SAGL---------------
A0A0C2I782      --------------STSLV-------TVPKAMTETGQ----SAGL---------------
A0A2N8BYF5      --------------SSSLV-------TMPKAMTVTGQ----SAGL---------------
A0A558FKX2      --------------SSSLV-------TIPKAMTVTGQ----SASL---------------
A0A1H1DBA0      --------------SSSLV-------T--TSSGQPAP----APTL---------------
J2TAD5          --------------SSALV-------TTPKAMTATGH----SAGL---------------
J3H699          --------------SSALV-------ATPKAMTATGH----SAGL---------------
A0A1H5J974      --------------SS-------------KAMTATAQ----SSSL---------------
A0A0K1QRZ4      --------------SS-------------KAMTPTAH----SSGL---------------
A0A560RJW9      --------------SS-------------KAMTATAH----SSGL---------------
A0A5E6TID7      --------------SS-------------KAMTPTAQ----STGL---------------
A0A5E7CRU7      --------------SS-------------KAMTPTAQ----STGL---------------
A0A5E7C564      --------------SS-------------RAMTPTAQ----STSL---------------
A0A2W7MAV4      --------------SS-------------KAMTPTAQ----STGL---------------
A0A4R3WQH5      --------------SS-------------KAMTPTAQ----STGL---------------
W6VFG3          --------------SS-------------KAMTPTAQ----STGL---------------
A0A1P8ENT1      --------------SS-------------KAMTPTAQ----STSL---------------
A0A2N7XRV4      --------------SS-------------KAMTPTAQ----STSL---------------
A0A0Q6QPG8      --------------SS-------------KAMTPTAQ----STGL---------------
A0A0F4SWA7      --------------SS-------------KAMTPTAQ----STGL---------------
A0A423J219      --------------SS-------------KAMTPTAQ----STGL---------------
A0A4P6G9U8      --------------SS-------------KAMTPTAQ----STGL---------------
A0A4Y8JE06      --------------SS-------------KAMTPTAQ----STGL---------------
A0A502I1X9      --------------SS-------------KAMTPTAQ----STGL---------------
A0A502J776      --------------SS-------------KAMTPTAQ----STGL---------------
A0A5B0EZF6      --------------SS-------------KAMTPTAQ----STGL---------------
A0A059L434      --------------SS-------------KAMTPTVQ----STGL---------------
A0A0F4UWN2      --------------SS-------------KAMTPTAQ----STGL---------------
A0A5E7WEF5      --------------SS-------------KAMTPTAQ----STGL---------------
A0A1G0KSD0      SVPPPPQDAKADASRDGGG-------RAAEDPDSRPK----DSSL---------------
A0A4P6WX84      LLSPNSSSSHHPGDAGIFI-------EHDSPERDEDT----PDDL---------------
A0A1D2S760      --AGAAPHPAHPSAPALTA-------PAAAAQQADAL----ASGA---------------
A0A5B8RW94      --GSNTQHV--QPGPRRAA-------PATLQPAAPPL----GDGG---------------
A0A258TN88      ----------QGANASSTA-------PAARTRPVPAQ----FTDI---------------
A0A4Q3ZDI7      AALGGLREFQERFFRTGHQVSETLGLEFLGSVPLVTS----ALPL---------------
A0A537PRC6      IAAKSASTYRAVIFWTRELVSPIIIAEACGEVSRSYP----AVAL---------------
A0A2M7JX59      KEKEK---------------------PSLKVFEEKTV----LKKE---------------
A0A3A4XVN3      RKADKTEPA-----------------VQKKNFRYDSS----IKQW---------------
A0A1E7JEV6      AKQSNLSEN-----------------L------PERE----EAGW---------------
A0A2N2KDY5      PREANASKN-----------------FMPLIMPADKE----KIGW---------------
A0A3N5YUD9      TPAHSGPPE-----------------VQTAVSDSPQR----PAEW---------------
A0A0W1DLQ3      ADLPVFTP----------------------------------------------------
A0A246JVD8      ASLTEFTP----------------------------------------------------
A0A2N3BB54      DALPVFTP----------------------------------------------------
A0A1H6G7A3      SALASFAP----------------------------------------------------
A0A0A7PGL6      SGLASFTP----------------------------------------------------
A0A4Q2Z4L0      SSLAAFTP----------------------------------------------------
A0A5C4N0H6      --------------------------GPTAPIPQPQH----AIDT---------------
A0A4R1HDF2      --------------------------AHPSYGLVDSK----PEMT---------------
A0A1E7HFN0      EGHR----------------------IPVEQAASEMP----GLAE---------------
A0A1M5GH86      ETGPRRGVVVP-------------------------------------------------
A0A1W1XQZ5      DVPSPQRVVTP-------------------------------------------------
A0A3D6C3I2      ------------------------------------------------------------
S0G1D4          QEDEVPV-------------------HTVKTGEIPAN----DRQI---------------
A0A661T246      THGTVVTAKAENQAYVNMPVTSNKDMNATDVSYKRVE----KVAK---------------
A0A2G6CSG7      KVVPDIK-------------------PAPALRKPAAS----TVEV---------------
A0A2G6NB59      KVVPDIK-------------------PAPALRKPAAS----TVEV---------------
A0A5K8A7T9      NRLASVE-------------------ERVHPAREPGN----EIKI---------------
A0A1W9U045      VSASTEK-------------------ASRFKVYDRKV----MEKE---------------
A0A1F9L9G4      SDTVENQ-------------------ENPFSGDDQRQ----MDTI---------------
A0A328FD76      GEKSASS-------------------DDTAMVSDDSD----TQVS---------------
A0A348UX90      EKESELR-------------------DNTALVCDDPD----NQVY---------------
A0A357Z0N5      EKESELR-------------------DNTALVCDNPD----SQVY---------------
A0A0F2R2U0      SVPLPHV-------------------RTDIVNGKGAD----RIVP---------------
A0A5K7ZK00      KVAATLS-------------------QPHPARQANSE----IEIK---------------
A0A5K7YCX8      KVAPAV--------------------RSTPVDDQAGG----NSIK---------------
A0A5K7Z388      KVVTAV--------------------DSEPAEAQAVK----KEAK---------------
A0A352B502      GGHE------------------------AGGVPQRSS----VREA---------------
A0A2K8WHP8      PGPA----------------------PAPAPAPRPEA----RRPQ---------------
A0A410V446      ARIV------------------------QPHSVGPQ------------------------
A0A0R3KGJ5      HHPG------------------------TLSGPPLAA----DGSL---------------
A0A0R3N604      HRPG------------------------ALSGSALAA----EGPL---------------
A0A1B1UCM8      HRPG------------------------VLSGSALAA----NGPL---------------
A0A1N6JQ20      PRQG------------------------ERAPGLSAG----VRP----------------
A0A1M5TI07      ARRA--------------------------AVSVPDP----ARP----------------
A3X191          LRND------------------------ASGLADLAG----MTR----------------
A0A1H4RKV5      PRND------------------------TGLAGAFGI----SRQ----------------
A0A160UA87      AHQE--------------------------FIGGSKP----IAT----------------
A0A1Q5SFV5      AQQE--------------------------LIGGSKP----IAR----------------
A0A1J5N774      EEQR-----QDRAIPTGPHGG-----ESA-------------NDL---------------
A0A2C8F781      TR---------RTETFDPPSE-----EAI-------------NR----------------
A0A2E3R6G0      TR---------RTETFDPPSE-----EAI-------------NR----------------
A0A1F8XMK2      GAAV-----KERAPLDPKHSP-----VVP-------------------------------
A0A3M8EMP2      GPAP-----GTESSASAPLKV-----DLA-------------SRP---------------
A0A2J6J6K6      QGEV-----HPPLPVAPVLGT-----DPD-------------------------------
A0A1G6EKK9      VTEN-----QVGYVSAARLKP-----TPP-------------------------------
S7TK97          VDGP-----RPSQAKSVAASK-----CCP-------------------------------
S7UE93          SGPG-----LERSGRHGRKVG-----RSP-------------------------------
A0A3D5BR56      SSKG-----GGKKKKRAKGSD-----RHP-------------------------------
A0A2N2IB15      FYSK-----GNMAA--GPGIV-----RVP-------------------------------
A0A1I3PSR2      LHSK-----GNRAE--VSGIA-----RAP-------------------------------
A0A1I4GEK4      LHSK-----GNRAG--VSGIA-----RAP-------------------------------
A0A0A8WSG4      M---------PDVQPEPVEFP-----PST--SNVQAS----SEYP---------------
A0A2T5R3J5      KAPE-----RAPEKREPDAPA-----PKV-------------------------------
A0A661PSB9      LETS-----RVMVDVPDKKVS-----PGS-SINSKGL----DRRN---------------
A0A661QBT6      LETS-----RVMVDVPDKKVS-----PGS-SNNSKGL----DRRN---------------
A0A1W7QPT7      MDQS-----PPASARQPMESP-----VLP---------------P---------------
A0A1L3GKM9      ----------APADISPVKVT-----PLP----AAAS----TIQP---------------
A0A0M4D373      QALE-----KASLRREYQERP-----PVP----LEAG----PRAP---------------
A0A5J4MX76      ----------ADSKSPSSAES-----PLPAAAFMNDR----QGRP---------------
A0A430DNP0      VVAL----ALGLILAGAAVLV-----REQFDDAVRAP----DEVE---------------
A0A3A0FQ32      RGAG-------AVPGVTAPAA-----QPIARAPGGAP----AGRL---------------
A0A1E4UZA0      SSGF---------------IA-----KPQASSAVAQP----LAEL---------------
A0A1H9KL56      SSGF---------------IA-----KPQASSAVAQP----LAEL---------------
A0A1A9KEF8      APSH---------------AV-----SPAVRP----------DVP---------------
A0A5E6PKN5      ASKA---------------MT-----P-TGQP-----------GL---------------
A0A0N9W1V6      MPKA---------------MT-----V-TGQS----------AGL---------------
A0A423GQ41      IPKA---------------MT-----V-TGQS----------ASL---------------
A0A423H7J2      IPKA---------------MT-----V-TGQS----------ASL---------------
A0A502HNM8      SSSL---------------VT-----TSNGDS----------ATL---------------
A0A4Q7H223      TSSL---------------VT-----TSTGHS----------ATL---------------
A0A1H4N2K9      SSSL---------------VT-----TSTGQS----------ATL---------------
A0A2K4KWF7      SSSL---------------VT-----TSTGHS----------ATL---------------
A0A3E0WXH2      STTG---------WSGVSPGA-----FVAAESKASAD----TGDV---------------
A0A2N2TRC8      ALAV-------AIEPVGESNQ-----VSETAAAPEVP----HLSP---------------
A0A1V4CIZ7      DTPD---------------------------------------DL---------------
A0A1M3BXA5      AAPA---APAHPQTAPVAATA-----PAAVAQQADAL----ASGV---------------
A0A1Y2R3U6      LQPPLHVAAVRTAAKP------------ASEVVQESL----PGTD---------------
A0A167HVD6      SKKS-DSRLLRGGRAPD-----------PSTAGRKAE----SGDL---------------
A0A1V3SCT6      SARP-DVPLLRKVSDSETPAG-----ESSSAIRREAS----PGDA---------------
L0H287          GAGA---TRVASLAELPDHQQ-----STRGGADAPND----PAGA---------------
A0A495VG93      --GN---A--PTPPVKPEHAE-----RHRDSPPQTSA----KPVA---------------
A0A4R3MYM4      IVGP---S--PGAPG--DTAG-----KVRAIRAQTPK----PLVD---------------
G2E3C0          SLAG---S--AGRPERQKAGG-----SRFAHRTQPRP----PASD---------------
A0A534QGR3      ------------------------------------------------------------
A0A4U8YLL7      ------------------------------------------------------------
A0A655RNN3      ------------------------------------------------------------
A0A655R819      FVVSFGFACVVAFIADAMTDTFADIKQVEKQLALSLLGVVPVVRK---------------
A0A655ZEY0      FVVSFGFACVVAFIADAMTDTFADIKQVEKQLALSLLGVVPVVRK---------------
A0A0W1GMS6      -----------------------------------MNSFPNLPQP---------------
A0A0Q8RMY3      ------------------------------------------MVI---------------
A0A1A7QC21      --------------------------------MQDADTAFIGSDQ---------------
A0A2M7WWF7      ------------------------------------------------------------
A0A351Z9A2      ------------------------------------------------------------
A0A3N5RNY4      VLPDRPRSKIPDHFALSIWQGTEAETLPA-------------------------------
A0A1E7H876      -------------MSGQPAAEPVRKKTIKHQTLS--------------------------
A0A0F2NF69      ------------------------------------------RLA---------------
A0A1F9NFD0      ------------------------------------------RPA---------------
A0A1M5YLH5      TE-----------KQKPSQSEQPKNRSAKPVERAAPAPRTKLVRS---------------
A0A4U1A4C7      QN-----------NAESWLEPETVNLPTASITDTLTAGTS--LSS---------------
A0A509L3P8      SIETGKGPAAHFHDSAHAKDESLELMESLHMAE---------------------------
A0A3A4S038      ----SIEPLASDERKNQDRDDSAQVEGRSQSNTA--------------------------
A0A1F9N669      NVGQTKRSLSGDDQIQRSFSEPSVITSDKEKKKSISEIDPNLPQ----------------
A0A1F9PFA7      NVGQTKRSLSGDDQIQRSFSEPSVITSDKEKKKSISEIDPNLPQ----------------
A0A1H2EN09      SV--------MDDGTEPVPEETEYEFCISDADTSISEPYEEIPEK---------------
K0NP00          LI--------TDLETEYVSEEPKNDFYVSNSDISMAEPYEEIPE----------------
A0A432HIS7      -------------TPNKSSSIDRAHLEAVEDTDVKKTSSPFPLRL---------------
A0A127AL56      -------------RYLINRSLPKSTPKRESGVENIEVQAPTLPKA---------------
A0A1E7JCL5      -------------KRQTSARLLPKNVVNISPQTIE----KSPLPQ---------------
A0A496YAH9      -------------KVIETEKLPFQKPEKLPPKRAAAEIPKDLVPE---------------
A0A1V4S7E4      -------------SSIMTEYLVNKHSEGLIPHKDELALARKITRE---------------
A0A2N2H8D2      -------------NSVKKSTVPPMFVSETLSGPEARL--KPLGPL---------------
A0A2N2KC63      -------------NSVKKSTPPPMFVSETLSGPEARL--KPLGPL---------------
A0A3A4ZYW4      -------------NSVKKSGSPSMFVSQTLSGPETAL--KSLGPL---------------
A0A1V4MCJ4      -------------KKEYFYRKSSLSDQPIRAEEREIVSSQDLVQD---------------
A0A661M0W4      -------------TALKSEKHPLAVPERIVEERSPKIISKPLLDF---------------
A0A1X0YE57      RVPESAGSRVAAERTADRVGCYPVVA----------------------------------
A0A2K2H9Q8      RVPESAGSRVAAERTADRAGCYPAVA----------------------------------
A0A2N6BEI9      VSVASTEDEEGTPLNSPPVETPGEGDAAL-------------------------------
A0A318CT66      ETSPAGAATIPTPVNKGRRLEPIDPVYTQ-------------------------------
A0A3N5P205      --DDKGASVVET------RQRLTDLEYTQ-------------------------------
A0A0D5N3E9      TDRGPAVAPRQMEDVQPLERAELPPLPAE-------------------------------
A0A2N2G716      EVVQESASAMTG------------------------------------------------
A0A1F9EUS2      KVREEPSVQIFEEKAVLKKEEPTLIFPEE-------------------------------
A0A3N9VAW3      KRGFDVPGKISAPAPSMVSP------TTQ-------------------------------
A0A1H4B8T3      ----VNQNKSTLRNKVDDAAPIRPKTVKN-------------------------------
A0A1E7IQC3      PV--ESAAEINHAAAQKNELVSESQLPEK-------------------------------
A0A1M6KEN5      PSGEEEGNATSSALKKVDSKISPSPDAGE-------------------------------
A0A353QLL3      RSPEKAHKEPPAGRP-----------VAE-------------------------------
A0A399I453      TTTVVEQITNYPEN------------SNY-------------------------------
A0A651FBV9      HGNTGPNEPELPPRAPSAPTKPLPASELP-------------------------------
A0A1G0LDK7      MFPVSEEKKSPR--------------EHV-------------------------------
A0A562VHD2      GG------VAPSNSQQQRQGAPSNIIETL-------------------------------
A0A5C1MDH8      GGVAPAPAPAPAPAGHQQKHVFKAI-PSQ-------------------------------
A0A5A9XE04      --------VAPPSEGHPQKRVFRAI-PAQ-------------------------------
A0A643G9R1      --------VAPPPEGHPQKRVFRAI-PSQ-------------------------------
A0A1G0M8Q7      GKGAQPAAPEQPNQPASNRPVPGA--VHT-------------------------------
A0A353MI14      GKGAQPAAPEQPNQPASNRPVPGA--VHT-------------------------------
A0A4S1CAW7      GAPREAAEGSGTTEVATAAPPGNATRVAT-------------------------------
A0A534HBS8      ------------------------------------------------------------
A0A0F0T3Y9      ------------------------------------------------------------
A0A351B422      D-------------KPKVEEDIKAPWAENSRKPLPVAGSVGYAGP---------------
F2NEE9          D-------------KPKVEEDIKAPWAENSRKPLPVAGSVGYAGP---------------
B7RS54          ---------------------------MVPEAGHKGAPTMQEINT---------------
A0A3N5FRH4      EQK---------------------------------------------------------
A0A1V4Y2C3      EPT---------------------------------------------------------
A0A2N2KTJ4      DQK---------------------------------------------------------
A0A2N2LQX0      DQK---------------------------------------------------------
A0A318D3U4      ------PARKMDQLRPSGETGSREQKQARVQHEVSPKPVPDTITS---------------
A0A401FQP5      --------------DKRPIPRKHGGFTFDSDPSNGEATSGKADEQ---------------
A0A1Q6DMW3      --------------NKPVE-----RKSPASVKSEGENVPSGEFPK---------------
A0A3A6P8F8      --------------IKRVTEGIDGNNQGNTALSEGKNDKAGKKIK---------------
A0A2G2DSM4      --------------DSTTQKNDSDWLSPENVENRDKETADRPHPP---------------
A0A1F9NI02      --------------EDLEKRAEE---GPEKEFDHDRIAVSQTRAG---------------
A0A4U1ABX4      --------------QDFERQVAERKIQQLKQYPAEPIPVSSQEKV---------------
A0A351Z4H9      --------------NIFDKQKVQPSKPAPKD-----------------------------
A0A2N2KML4      --------------KF-TEQRDEAPKTSSED-----------------------------
E1YJF1          --------------NVRTPQAETVEPSLDND-----------------------------
A0A1J5EVZ6      --------------EPTTRQMEETPAPPLPMPGSARPTAKERRPE---------------
A0A2G6FCC5      --------------DKSQMLSDESTLQGLDKELFNEASNRQSDNQ---------------
A0A1F9MR25      --------------EAIEQEISQSRAAEGREVMPGPSSTEPQDNQ---------------
A0A2G6M7F1      QGKEKAEATSSGDHQAADAVTSKLLASSGRKVSAG---EEPRSKK---------------
A0A1I0R9R6      KPRARRSQERSSKPPASMPEA---------------------------------------
A0A443K010      QR--GVTSHEDSAPEAPVVTLAEQVGA---------------------------------
A0A238IZI1      EP--ISRGGRPELSARAKSRRIAESEAKDSV-----------------------------
A0A316GHM6      GT--DRPLRTTDVTARNRARRAAKDGAIGER-----------------------------
A0A520ZTR8      GD--GGRATRPELSARNRSRRMAQAEAVDDA-----------------------------
A0A212AR83      TR--PDTPPPPAFAAQGAQAYADADGTEAA------------------------------
A0A2E2P4I0      SGDVATSPAQSPRGVTAAQAVARQAVPPAG--------------D---------------
A0A2U2CM86      AG--APGPETRPFGDGSKPSAVEPAKPEPPR------EKQATPVE---------------
A0A1X7ACC1      RQ--QEPPDRTAPEPQPIPIQKDEV-----------------------------------
A0A2N3BVE7      AL--GAPQGPGGRPAPGAAAAVVAAVPDQF------------------------------
A0A2S5JE21      AM--GTRRPVTPGEADKSRPESRADA----------------------------------
A0A2R8BKZ2      AL--GPPDGTGDRVAMPRGAEPVI-V----------------------------------
A0A2S8S361      AV--GGGDVVRSRTVAAAAPVATT-G----------------------------------
A0A238KUF6      TA--GRR--VRAAQGGFQSASLPTQDA---------------------------------
A0A095CTW3      ---------------MVRPLQQNVVEA---------------------------------
A0A2E3UGD6      SA--SER--GPAKAALVRPLQQNVVEA---------------------------------
A0A2T0RFH0      LG--VDT--TRGVKSHRASTDHEIADR---------------------------------
A0A285D390      QA--LDA--RPAVTAARAPVSTEGP-----------------------------------
A0A497VHN4      VT--SDASGRKASDTLKGGVLLPVPPV---------------------------------
A0A379GWF0      TILGFIVGCAYVIAREFFNNKIKGTEDIDAL-GVNVYATIPFSTH---------------
A0A536T0W8      --------------------------DYLDD--------TVKTPE---------------
A0A2G9XLE5      ------------------------------------------------------------
A0A3D2M6Y9      IFVGLLVSAMVILLRQVFYRGVESPETIEHL--------GIPVYA---------------
A0A3D2YAZ2      ------------------------------------------------------------
A0A350A102      -------------------RGVESPDVIEKL--------GVPVYA---------------
A0A350L5D2      -------------------RGVESPDVIEKL--------GVPVYA---------------
A0A1I6ENM4      QGAAPRRAAPDTPAASAAARAPAPSAT---------------------------------
A8LNM8          SVPPSGLSSQRPSQRAPL------------------------------------------
A0A0T5NSU3      -------------MPPKTGQSDTD------------------------------------
A0A5P9I718      TETGAPRFRKKPAAPPKTGQSDTD------------------------------------
A0A2M8J3R9      VETGAYRDPGAARTAPRTGRDRARRGAAS-------------ATE---------------
A0A1I6X762      RVGAS-RPQMPQSVSSRAPQKR---------------------TP---------------
A0A0P1EFX8      RAPAQLAVAADKAIQEEVPSNR---------------------T----------------
A0A2G5KB39      ------GVAATEHVQSKTTDKK---------------------L----------------
A0A2N3CNV1      SERATPGQADAATPEKERPAPARQAPAGP-------------RA----------------
A0A257F1F4      SPAQAQSLP-AVTTKAPVRR-----WHPE-------------DI----------------
A0A1G9FY29      VLKQRPTNG-PLTDVGFLPETV---EHLP-------------SR----------------
A0A4Q3ZBK4      ALRGNPTAG-PLAEDGTRPQPAAAPEELP--------------R----------------
A0A2D5J8T8      SGPEQYAPA-HAPSARAGLSDP---RPRP-------------GL----------------
A0A2E3P9W6      SAR----PA-HRPSGPA--EAH---QPSP-------------GV----------------
A0A2G2B1P9      A------QI-AAVADVEVVEPV---VKPA-------------PI----------------
A0A258GCD5      A------LG-APETVREH--VV---QKDG-------------RG----------------
A0A2D9YR88      T------RG-ATARPQPRGTVQ---DKSG-------------A-----------------
A0A443INY4      Q------RG-LTIDVEESVSVA---APTE-------------QR----------------
A0A372IH36      LMQPAEADDAAPAPDDAPPAPADAATAPR------------PQA----------------
A0A540VW45      PENPSLQNKLRAAYKEAPGCEPVEE-----------------------------------
A0A1H9C241      DEIEKQEKAVRAAMVSSERAPTVAAVPSA------------PEVK---------------
A0A2E3FCR1      AQTDAQEDAVREALRADIPA----------------------------------------
A0A4S3MG69      AEAEAQERVVRAALRTPEPAP---------------------------------------
A0A1G8QZS5      PKSSEPPEQVQTHERKPDPLILEQSHSVG---------------D---------------
A0A1V4QMH7      TEESQIHPVPKVTPVESHSLFTGMEMPVE-------------------------------
A0A496XZQ4      TEESQIHPVPKVTPVESHSLFTGMEMPVE-------------------------------
A0A1F9BJF7      EDKRVISSRPEKVPADTPSVQAAIPTERE-------------VIP---------------
F2NDF5          EEGSHRSELEKLLEQQPLSDLEEAPYPEE-------------I-----------------
A0A1I3TTC3      VLAGAGPAMEAEAHAPAYSDPSMFQAPKPRRPVAPVEDATVTTSD---------------
A0A1H3IZW6      VLAGHTAPGPQPAAQPAVSPRPADPVPEP------------AKST---------------
A0A0M6YG59      LLAGH-------RPEPSAVAPQPDAIVTP------------TPGA---------------
A0A1H7G8B0      VLSTQ-------AGVPATTPEQAVSL------------------P---------------
A0A059IPK4      --ATKDGEAPDHRPRQAPQPDSGRPIKDV---------------R---------------
A0A1H2Y469      QDEPEKAKGGTSPALAFEHDQQDQILPHS---------------S---------------
A0A497ZQU7      SDADKKEQTSAPTPVETLQPEGS---PAS---------------L---------------
A0A520CSP5      GVLGLLAGVALAIVRSLFMGGIRNPQEIEAHTGLSVYSVVPFTQE---------------
A0A4Q2XLV7      -------GSLLAFALEQIDEAIADPAEVERRLGLPLLGSVPKLED---------------
A0A4Q5QYC4      -VIGCSLGAIAAFLLEQADEAISDPAEVERMVGLPLLGSVPKLVG---------------
A0A3B8SQ27      LVVGFGLALAIVFIRRKLFPSIESIDEIERL-GLPVLAAVPMFSA---------------
A0A3E0H727      SHPSQWLASIAGNVNIFVFAQLTLRPIEPKKSLIVVLATIPASDA---------------
A0A352Q5C1      IVAGAVCGVILSFCHKLIKGGIEDPDELEQKFDIPVYASVMHSEN---------------
A0A656BWB0      ------------------------------------------------------------
A0A3Y2RPN4      ------------------------------------------------------------
A0A0A0FHV8      ------------------------------------------------------------
A0A1X3IPU7      ------------------------------------------------------------
A0A0A0G0N2      ------------------------------------------------------------
A0A243TPR1      ------------------------------------------------------------
A0A2I8SDU4      ------------------------------------------------------------
A0A2I8SU55      ------------------------------------------------------------
S1EXJ6          ------------------------------------------------------------
A0A376UBS1      ------------------------------------------------------------
A0A4Q6G931      ------------------------------------------------------------
A0A4Q8R6L6      LVVGMIFSILLVLLRVFLRRGIESPDQLEEL-GINVYASIPVSEW---------------
A0A2T0VBD8      ------------------------------------------------------------
A0A378APS2      ------------------------------------------------------------
A0A443VCQ6      ------------------------------------------------------------
A0A447RKQ7      ---------------------MKTPEQLEEL-GINVYASIPVSES---------------
W1DSK1          ------------------------------------------------------------
A0A0U2VAW2      TMLGGMLGVAIVLVQKAMHKGVEDPSEIEAL-GIPVYASVPHSEH---------------
A0A454CTF1      TLLGGMVAVAFVLVKTAFHRGVTSPDEIEQT-GISVYASVPKSVQ---------------
A0A1W9F5M9      ------------------------------------------------------------
A0A352MMI7      IILGLMLSIVGVLLRSLFNRGIESPQVLEEN-GISVYASIPLSEW---------------
A0A379W6R2      -----MLSIVGVLLRSLFNRGIESPQALEEH-GISVYASIPLSEW---------------
A0A376RY66      IILGLMLSIVGVLLRSLFNRGIESPQVLEEH-GISVYASIPLSEW---------------
A0A377K431      IILGLMLSIVGVLLRSLFNRGIESPQVLEEH-GISVYASIPLSEW---------------
A0A379TA56      IILGLLLSVIGVLLRSLFNRGIESPQALEEH-GSASMPVFRCRNG---------------
A0A4Z0LWV1      IILGLMLSIVGVLLRSLFNRGIESPQALEEH-GISVYASIPLSEW---------------
A0A620QD02      IILGLMLSIVGVLLRSLFNRGIESPQALEEH-GISVYASIPLSEW---------------
A0A5H3HSJ8      IILGLMLSIVGVLLRSLFNRGIESPQVLEEH-GISVYASIPLSEW---------------
A0A655C5P0      IILGLMLSIVGVLLRSLFNRGIESPQALEEH-GISVYASIPLSEW---------------
A0A3C2BN18      ------------------------------------------------------------
A0A447LR75      ------------------------------------------------------------
A0A376D8L7      ------------------------------------------------------------
A0A1V2FV46      ------------------------------------------------------------
A0A376SB61      ------------------------------------MPASPLSEW---------------
A0A3D1BYV9      ----------------------------------SVYASIPLSEW---------------
A0A378G3G7      TVFGTMLSLMYVIVKVAFNKGVQSAEQLEEN-GLNVYASIPLSDC---------------
A0A2X5NHJ9      IVLGGVISVGLVLLRVFLRRGIESPEQLEEL-GINVYASVPVSEW---------------
A0A2J4QEC3      IALGLMVSIGLVLLRVFLRQGIESPEQLEER-GINVYASIPVSEA---------------
A0A485ADM3      IIFGGIVSIGLVLLRVFLRRGIETPEQLEEL-GINVYASIPVAEA---------------
A0A4U9HGU4      LVLGGMVSCGYVLARSYLHRGIESPEQLEEM-GINVYASVPLSEW---------------
A0A3S4JGG5      TLLGGLFSTGFVLLKTMLHRGIESPEQLEQQ-GINVYASIPLSEW---------------
A0A377ZDH2      TLLGGLFSTGFVLLKTMLHRGIESPEQLEQL-GINVYACIPLSEL---------------
A0A3S4HTS8      TLLGGLFSTGFVLLKTMLHRGIESPEQLEQQ-GINVYASIPLSEW---------------
A0A2N1XK22      ------------------------------------------------------------
A0A3D0KAC8      TLLGALLATAFVYVREALKRGVENPEDIERT-GTPVYASIPFTEK---------------
A0A3D2Y902      TLLGALLATAFVYVREALKRGVENPEDIERT-GTPVYASIPFTEK---------------
E1Y9C0          ------------------------------------------------------------
A0A1N6SH58      ------------------------------------------------------------
A0A4Q3AQN2      ------------------------------------------------------------
                                                                            

A0A1F9CFF0      ------------------------------------------------------------
A0A2M8B0G5      ------------------------------------------------------------
A0A363TNU9      ------------------------------------------------------------
A0A0C5VQ86      ------------------------------------------------------------
A0A1V8MBH1      ------------------------------------------------------------
A0A0R0BVC7      ------------------------------------------------------------
A0A3N5J7U8      ------------------------------------------------------------
A0A1S7S3I8      ------------------------------------------------------------
A0A519E8D7      ------------------------------------------------------------
A0A3S1NZ06      -----------------------------------------------------------T
A0A3S1FD32      -----------------------------------------------------------T
A0A434DUT4      -----------------------------------------------------------T
A0A528D3U3      ------------------------------------------------------------
A0A3S3UPT3      -----------------------------------------------------------T
A0A3S1E286      ------------------------------------------------------------
A0A531AC71      -----------------------------------------------------------T
A0A436K268      ------------------------------------------------------------
A0A434IDQ0      ------------------------------------------------------------
A0A435IRM5      ------------------------------------------------------------
A0A3S2C404      ------------------------------------------------------------
A0A435F6C0      ------------------------------------------------------------
A0A435BMN6      ------------------------------------------------------------
A0A529XQ54      ------------------------------------------------------------
A0A530BJC1      ------------------------------------------------------------
Q44570          ------------------------------------------------------------
A0A655ZZQ1      ------------------------------------------------------------
A0A1S0ZAI3      ------------------------------------------------------------
A0A1W9M770      ------------------------------------------------------------
A0A1W9M7R6      ------------------------------------------------------------
A0A3C0L0A8      ------------------------------------------------------------
A0A176S762      ------------------------------------------------------------
A0A377ZC40      ------------------------------------------------------------
A0A378BPJ7      -----------------------------------------------------------K
A0A2J5PAJ7      -----------------------------------------------------------K
A0A377ZDN3      ------------------------------------------------------------
A0A1W9WUD9      -----------------------------------------------------------K
A0A1W1ZQK0      ------------------------------------------------------------
A0A4U1ALN4      ------------------------------------------------------------
A0A4U1B1A8      ------------------------------------------------------------
A0A1M7Y300      ------------------------------------------------------------
A0A4U1A967      ------------------------------------------------------------
A0A3N5MZ53      -----------------------------------------------------------R
A0A534E4H4      -----------------------------------------------------------K
A0A534I2B6      -----------------------------------------------------------K
A0A1C2JGD0      -----------------------------------------------------------A
A0A259LQ70      -----------------------------------------------------------L
A0A4V2SPR5      ------------------------------------------------------------
A0A3N5PM86      -----------------------------------------------------------K
A0A2E5YSA4      ------------------------------------------------------------
A0A519ERR1      -----------------------------------------------------------K
A0A4Q3Q1M2      ------------------------------------------------------------
A0A4Q3MHR1      ------------------------------------------------------------
A0A520GDZ4      ------------------------------------------------------------
A0A318DSU0      -----------------------------------------------------------K
A0A538PF21      -----------------------------------------------------------I
A0A1W1ZH10      -----------------------------------------------------------R
A0A1W2FF24      -----------------------------------------------------------R
A0A524JYQ6      -----------------------------------------------------------R
A0A4Q3MA17      -----------------------------------------------------------R
A0A0N0M5F7      -----------------------------------------------------------L
A0A537M754      -----------------------------------------------------------L
A0A1V1PDB4      -----------------------------------------------------------K
A0A2M7C324      -----------------------------------------------------------K
A0A4Q3HHG6      -----------------------------------------------------------K
A0A3B7DTA4      -----------------------------------------------------------F
A0A432ZK62      -----------------------------------------------------------K
A0A1V5EEP4      TAAKVPEPQPLKTPAPISIPLPDE------------------------------------
A0A1V5EF48      PPAKAPDPQPARVAPPIPLPVPDE------------------------------------
A0A0S6X1X6      -----------------------------------------------------------M
A0A537Y5L8      -----------------------------------------------------------S
A0A4Q3L2X2      -----------------------------------------------------------L
A0A4Q3T8J1      ----------------------------------------LLLNILLAAIFGLGLGIVCA
A0A4Q4ANM4      LALAVVCGLGLGIATAFAREQMSR-----------------------------------Q
A0A4Q3UEC7      -----------------------------------------------------------K
A0A1H5YYQ4      EPEYVPDAPTLSD-----------------------------------------------
A0A1X4NLK2      EAERAREVRQEAKRQAAKTTEPKT----------------------------------PL
A0A1X4NWB5      VAKREAELETQRKGDVEQTAKLTS----------------------------------PL
A0A1M5UQ38      RPKAPKTPEPKHDPEA--------------------------------------------
A0A327YI48      QAEAEHQAQAERQAGADRQAKDDA------------------------------------
A0A1B1PNL6      SAEQLAPAQTVPPAAEAPARPPRR------------------------------------
A0A2U8H9H9      APEPLAP----RAEAADPAPAPRR------------------------------------
A0A1X6YIC0      GAIETPAPSTADAAHAPAHATTRAVAHDAQDTARQTLP----------------------
A0A1I5E9E9      EPEPDDAPDVADESEGAP----------------------------EVVVVPVPDVAAVN
A0A1X6Z7N7      EPEPEPEPEPEPEPEPEPEPEPEPTDTDMLDIEDAPFVEEAREDESEVIVVPVPEVTLTN
A0A2E1DQ13      ------------------------------------------------------------
A0A1H8C800      EPEPEPEPEPEPEPEPEPEPEPEP------------------------------------
A0A2N3EZ05      EPEPEPEPELSPEMEADAPPDSGA------------------------------------
A0A1W9PMU6      -----------------------------------------------------------R
A0A1G3VVY5      -----------------------------------------------------------S
A0A2N6BZD5      ------------------------------------------------------------
A0A435NNF5      ------------------------------------------------------------
A0A3S2AQS7      -----------------------------------------------------------L
A0A436XH86      -----------------------------------------------------------L
A0A527ZPD6      ------------------------------------------------------------
A0A529KRW3      -----------------------------------------------------------L
A0A530ZLX0      -----------------------------------------------------------L
A0A355TB56      -----------------------------------------------------------T
A0A524M660      -----------------------------------------------------------G
A0A0C1TRU6      ------------------------------------------------------------
A0A2Z5SSF4      ------------------------------------------------------------
A0A327LYE6      -----------------------------------------------------------R
A0A5A9ZTV3      -----------------------------------------------------------R
A0A4Q4CIB1      -----------------------------------------------------------V
A0A522ACJ9      -----------------------------------------------------------P
A0A3N5Z7F8      -----------------------------------------------------------P
A0A239HD34      -----------------------------------------------------------Q
A0A534V9L7      -----------------------------------------------------------L
A0A0P7ZZE4      -----------------------------------------------------------P
A0A369R0Q9      -----------------------------------------------------------R
A5G4N9          -----------------------------------------------------------V
A0A238LBD3      -----------------------------------------------------------P
A0A0P1FRV5      -----------------------------------------------------------E
A0A0P1FWI8      -----------------------------------------------------------M
A0A1M7BLL7      -----------------------------------------------------------D
A0A0H4KZM1      -----------------------------------------------------------P
A0A1V1UJT2      -----------------------------------------------------------P
A0A0L6CVX1      ------------------------------------------------------------
A0A1V0RR48      ------------------------------------------------------------
A0A0A0HJJ4      -----------------------------------------------------------P
A0A5E7YA28      -----------------------------------------------------------P
A0A348SRI7      ------------------------------------------------------------
A0A354EI73      ------------------------------------------------------------
A0A4P7EP83      ------------------------------------------------------------
A0A3A4NIE9      ------------------------------------------------------------
A0A3A4NUI9      ------------------------------------------------------------
A0A524I3Z6      ------------------------------------------------------------
A0A524PCL7      ------------------------------------------------------------
A0A356GQV1      ------------------------------------------------------------
A0A1J5DAY8      ------------------------------------------------------------
A0A524P237      ------------------------------------------------------------
A0A1G3JY11      ------------------------------------------------------------
A0A661N3U1      ------------------------------------------------------------
A0A3S1WTQ1      ------------------------------------------------------------
A0A440NX85      ------------------------------------------------------------
A0A530CUR9      ------------------------------------------------------------
A0A1M6N1X5      ------------------------------------------------------------
A0A561M3U0      -----------------------------------------------------------R
A0A2W5J775      ------------------------------------------------------------
A0A1F9E324      -----------------------------------------------------------K
A0A432SAI6      ------------------------------------------------------------
A0A4Q3LBH4      -----------------------------------------------------------L
A0A4Q3LWP3      -----------------------------------------------------------L
A0A2N6VGL1      ------------------------------------------------------------
A0A3M3H5V6      ------------------------------------------------------------
A0A2T4ZJZ6      -----------------------------------------------------------K
A0A1T2KYM8      -----------------------------------------------------------L
A0A2G9ZR82      -----------------------------------------------------------V
A0A4U9I390      ------------------------------------------------------------
A0A534XP85      ------------------------------------------------------------
A0A2X3M011      ------------------------------------------------------------
I2WC85          ------------------------------------------------------------
A0A400JH80      -----------------------------------------------------------K
A0A2H9EHM4      ------------------------------------------------------------
A0A380B3D7      ------------------------------------------------------------
F5NSX0          ------------------------------------------------------------
D8EEU7          -----------------------------------------------------------K
A0A479JNB1      -----------------------------------------------------------K
A0A5C9AF52      -----------------------------------------------------------K
A0A0P1H2H0      -----------------------------------------------------------L
A0A258WKV0      -----------------------------------------------------------L
A0A377N8F8      -----------------------------------------------------------K
A0A3C2DSE7      -----------------------------------------------------------T
A0A2X1JBG5      -----------------------------------------------------------K
A0A0B8PTA8      -----------------------------------------------------------K
A0A0B8QF75      -----------------------------------------------------------K
A0A4Q3LR91      -----------------------------------------------------------P
A0A4V1TR68      -----------------------------------------------------------L
A0A444IY46      -----------------------------------------------------------V
A0A660AID0      -----------------------------------------------------------K
A0A3E0WKI3      -----------------------------------------------------------R
A0A1H3I2J1      -----------------------------------------------------------A
A0A1V5DJV0      -----------------------------------------------------------K
A0A520IUC4      -----------------------------------------------------------P
A0A521LJG5      -----------------------------------------------------------Y
A0A531IBQ7      -----------------------------------------------------------T
A0A377LY04      -----------------------------------------------------------K
A0A5C9ABR5      -----------------------------------------------------------K
A0A5J9WU72      -----------------------------------------------------------K
A0A2X3K9R3      -----------------------------------------------------------T
A0A3T9EHW9      -----------------------------------------------------------K
A0A484X141      -----------------------------------------------------------K
A0A5N9VWI6      -----------------------------------------------------------K
A0A3D3PV27      ------------------------------------------------------------
A0A376LLF8      ------------------------------------------------------------
A0A444R390      ------------------------------------------------------------
A0A1V4WHZ7      -----------------------------------------------------------K
A0A1E5AJN5      -----------------------------------------------------------R
A0A2N3D2J1      -----------------------------------------------------------P
A0A2N2GVE1      -----------------------------------------------------------L
A0A2N2INV3      -----------------------------------------------------------L
A0A1Y5DXG5      -----------------------------------------------------------K
A0A0B8P2H5      -----------------------------------------------------------K
A0A483QWI8      -----------------------------------------------------------K
A0A483UXD3      -----------------------------------------------------------K
A0A0A8J8L3      -----------------------------------------------------------K
A0A660DJ38      -----------------------------------------------------------K
A0A380AQW6      -----------------------------------------------------------K
A0A2G2GD62      -----------------------------------------------------------K
A0A524P331      -----------------------------------------------------------K
A0A4V1SSM5      -----------------------------------------------------------K
A0A4Q3K8G7      -----------------------------------------------------------R
A0A1M7HC79      -----------------------------------------------------------K
A0A1D3JZN6      -----------------------------------------------------------K
A0A1V6ESG1      -----------------------------------------------------------M
A0A1H7YHK3      -----------------------------------------------------------R
A0A534SH66      -----------------------------------------------------------M
A0A3M0ZZ99      -----------------------------------------------------------R
A0A328C2K5      -----------------------------------------------------------V
A0A5C6X8M3      -----------------------------------------------------------V
A0A3D8MRR7      -----------------------------------------------------------V
A0A5C6UBJ7      -----------------------------------------------------------V
A0A5C6XGM3      -----------------------------------------------------------V
A0A537NZJ1      -----------------------------------------------------------K
A0A4Q4CVW6      -----------------------------------------------------------T
A0A090R136      -----------------------------------------------------------K
A0A661JU93      -----------------------------------------------------------K
A0A2E2T3V8      -----------------------------------------------------------K
A0A367UAB4      -----------------------------------------------------------K
A0A377V641      -----------------------------------------------------------K
A0A1F2YJ88      -----------------------------------------------------------K
A0A0J7XGZ1      -----------------------------------------------------------Y
I4CBA7          -----------------------------------------------------------W
A3VE95          -----------------------------------------------------------P
A0A1G0NL95      -----------------------------------------------------------R
A0A024KA69      -----------------------------------------------------------V
A0A0L1KFN4      -----------------------------------------------------------L
A0A3P5DSS6      -----------------------------------------------------------K
A0A483YEL5      -----------------------------------------------------------K
A0A658GUJ0      -----------------------------------------------------------K
A0A358L616      -----------------------------------------------------------K
A0A3D5UYX7      -----------------------------------------------------------V
A0A2N1WQN5      -----------------------------------------------------------K
A0A352G2C2      -----------------------------------------------------------K
A0A3C0PZN1      -----------------------------------------------------------K
A0A524QFS4      -----------------------------------------------------------K
A0A520JSW4      -----------------------------------------------------------L
A0A4Q3LTF3      -----------------------------------------------------------L
A0A537UTP9      -----------------------------------------------------------T
A0A1D2RNR5      -----------------------------------------------------------L
A0A4V1TQ46      -----------------------------------------------------------P
A0A3A0FZC0      -----------------------------------------------------------K
A0A1N7JVZ7      -----------------------------------------------------------T
A0A091C4A8      -----------------------------------------------------------L
A0A4R3H6P6      -----------------------------------------------------------L
A0A3S1NQ09      -----------------------------------------------------------T
A0A443GJ52      -----------------------------------------------------------T
A0A2W6S588      -----------------------------------------------------------M
A0A483E0N4      -----------------------------------------------------------K
A0A2J4YQQ6      -----------------------------------------------------------K
A0A483THX4      -----------------------------------------------------------K
A0A534MVS2      ------------------------------------------------------------
A0A444I5K6      -----------------------------------------------------------R
A0A154VE85      -----------------------------------------------------------K
A0A3S1MCW7      -----------------------------------------------------------L
A0A434IGN6      -----------------------------------------------------------L
A0A528AX40      -----------------------------------------------------------L
A0A528MV95      -----------------------------------------------------------L
A0A3C1S9Y1      -----------------------------------------------------------K
A0A353EH49      -----------------------------------------------------------K
A0A1Y1Q9C1      -----------------------------------------------------------K
A0A3M7LJH0      -----------------------------------------------------------K
A0A316KRG4      ------------------------------------------------------------
A0A1E4JHX8      -----------------------------------------------------------L
M2U8P2          -----------------------------------------------------------L
A0A1H7KZF8      -----------------------------------------------------------L
A0A0J5Q9T7      -----------------------------------------------------------S
A0A257NG76      -----------------------------------------------------------K
A0A1T4TW59      -----------------------------------------------------------T
A0A1I5YYQ0      ------------------------------------------------------------
A0A5P9FE62      ------------------------------------------------------------
A0A1Q3MB35      -----------------------------------------------------------L
A0A259LUN7      -----------------------------------------------------------K
A0A2D7AVL1      -----------------------------------------------------------L
A0A3B9KZE9      -----------------------------------------------------------L
A0A2U0NMP8      -----------------------------------------------------------K
A0A4U9HNE9      -----------------------------------------------------------K
A0A2G2CXY6      -----------------------------------------------------------K
A0A3M1D4H3      -----------------------------------------------------------L
A0A5C8BYM7      -----------------------------------------------------------I
A0A1J5ICP0      -----------------------------------------------------------V
A0A0M3GBT1      -----------------------------------------------------------R
B3Q577          -----------------------------------------------------------R
A0A379B9V4      -----------------------------------------------------------K
A0A0Q6TS97      -----------------------------------------------------------L
A0A0Q6UYB4      -----------------------------------------------------------L
A0A484XS37      -----------------------------------------------------------K
W7Q5J0          -----------------------------------------------------------Q
A0A654AKT6      -----------------------------------------------------------L
A0A0G9MZA5      -----------------------------------------------------------L
H0T8B0          -----------------------------------------------------------S
A0A5C7N981      -----------------------------------------------------------L
A0A534TV22      -----------------------------------------------------------V
A0A351CXR4      -----------------------------------------------------------Q
A0A2N6GLF5      -----------------------------------------------------------K
A0A1W9LJP0      -----------------------------------------------------------K
A0A0W1ICB0      -----------------------------------------------------------L
A0A2E0UL88      -----------------------------------------------------------R
A0A233IKJ2      -----------------------------------------------------------R
A0A2T1JE00      -----------------------------------------------------------R
A0A0T2QIS1      -----------------------------------------------------------L
A0A376KYN0      -----------------------------------------------------------K
A0A2X1JB05      -----------------------------------------------------------K
A0A376RML0      -----------------------------------------------------------K
A0A377E5P7      -----------------------------------------------------------K
A0A0P7Y1D0      -----------------------------------------------------------W
A0A2M7JRZ7      -----------------------------------------------------------K
A0A167IR75      -----------------------------------------------------------L
X7F6S5          -----------------------------------------------------------A
A0A1G7CFZ2      -----------------------------------------------------------A
A0A1P8USW9      -----------------------------------------------------------P
A0A1I6U4V1      -----------------------------------------------------------P
A0A1G8NKI0      -----------------------------------------------------------T
A0A355QPE4      -----------------------------------------------------------T
A0A357RN98      -----------------------------------------------------------T
A0A3B8T2U6      -----------------------------------------------------------K
A0A365PWR2      -----------------------------------------------------------R
A0A2E9H5Z8      -----------------------------------------------------------V
A0A2E2BR79      -----------------------------------------------------------K
A0A0Q4Q524      -----------------------------------------------------------L
A0A0Q4CFJ9      -----------------------------------------------------------L
A0A0Q4FE58      -----------------------------------------------------------L
A0A0Q4JWC8      -----------------------------------------------------------L
A0A0Q4KFL8      -----------------------------------------------------------L
A0A522R8R0      -----------------------------------------------------------K
A0A2U9NDY5      -----------------------------------------------------------R
A0A0Q4IGG1      -----------------------------------------------------------L
A0A534RUJ5      -----------------------------------------------------------K
A0A3M1CJM3      -----------------------------------------------------------V
A0A2R7SVD4      -----------------------------------------------------------K
A0A3C0PWB6      -----------------------------------------------------------R
V4Q8B7          -----------------------------------------------------------K
A0A0Q8XKK5      -----------------------------------------------------------L
A0A2E0Q2W0      -----------------------------------------------------------L
A0A660NIR6      -----------------------------------------------------------K
A0A142W0R3      -----------------------------------------------------------L
A0A0S4XR18      -----------------------------------------------------------R
A0A2E0GW64      -----------------------------------------------------------K
A0A1A7QJ97      -----------------------------------------------------------L
A0A661LW70      -----------------------------------------------------------K
W7Q8F9          -----------------------------------------------------------R
A0A524PXH8      -----------------------------------------------------------L
A0A4Q3P0E4      -----------------------------------------------------------R
A0A3M2BE89      -----------------------------------------------------------R
A0A4Q4A6K6      -----------------------------------------------------------S
A0A257G674      -----------------------------------------------------------L
A0A661M5M6      -----------------------------------------------------------L
A0A1I1UM01      -----------------------------------------------------------R
Q44573          -----------------------------------------------------------R
A2W025          -----------------------------------------------------------K
A0A534Z362      -----------------------------------------------------------M
V4J283          -----------------------------------------------------------L
A0A536T443      -----------------------------------------------------------T
A0A0Q4UFQ5      -----------------------------------------------------------P
A0A527W7E6      -----------------------------------------------------------T
A0A432EMV7      -----------------------------------------------------------K
A0A087LTV7      -----------------------------------------------------------V
A0A534WLI3      -----------------------------------------------------------V
A0A318KWA2      -----------------------------------------------------------K
A0A522MT86      -----------------------------------------------------------P
A0A4Q3I221      -----------------------------------------------------------K
A0A534SAL6      -----------------------------------------------------------V
A0A534ZDB4      -----------------------------------------------------------V
A0A534X3M7      -----------------------------------------------------------V
A0A534SPC6      -----------------------------------------------------------M
A0A535AD60      -----------------------------------------------------------M
A0A4Q3SY08      -----------------------------------------------------------L
A0A4Q3LG23      -----------------------------------------------------------L
A0A522EX52      -----------------------------------------------------------L
A0A1H3KC95      -----------------------------------------------------------G
A0A5P8Z4P3      -----------------------------------------------------------P
A0A0B3RZC9      -----------------------------------------------------------E
A0A2E9HXF7      -----------------------------------------------------------A
A0A520HUH4      -----------------------------------------------------------Y
A0A2K8U7M6      -----------------------------------------------------------L
A0A5B9DKL8      -----------------------------------------------------------V
A0A238KJM1      -----------------------------------------------------------A
A0A3A0FJZ4      -----------------------------------------------------------R
W4HJV8          -----------------------------------------------------------G
A0A0P1GDI0      -----------------------------------------------------------E
A0A2R8ATV5      -----------------------------------------------------------A
A0A1U7D3R6      -----------------------------------------------------------I
A0A2D4UVV2      -----------------------------------------------------------I
A0A0W7WHP4      -----------------------------------------------------------E
A0A238J8F6      -----------------------------------------------------------A
A0A238JQI6      -----------------------------------------------------------E
A0A222E077      -----------------------------------------------------------A
A0A239E3Y2      -----------------------------------------------------------V
A0A1W9HS52      -----------------------------------------------------------R
A0A2D5LFD8      ------------------------------------------------------------
A0A0N0XAV4      ------------------------------------------------------------
A0A0P9QD19      ------------------------------------------------------------
F3FHG4          ------------------------------------------------------------
F3GGI0          ------------------------------------------------------------
A0A0P9LE74      ------------------------------------------------------------
A0A3M4ZQ14      ------------------------------------------------------------
A0A3M5YLE8      ------------------------------------------------------------
A0A3M3RP89      ------------------------------------------------------------
A0A0P9QIY7      ------------------------------------------------------------
A0A0P9VVH7      ------------------------------------------------------------
A0A0Q0FJK6      ------------------------------------------------------------
A0A0Q0G2J0      ------------------------------------------------------------
A0A3M3LF66      ------------------------------------------------------------
A0A0P9WIR8      ------------------------------------------------------------
A0A3M3KPE5      ------------------------------------------------------------
A0A3M4C263      ------------------------------------------------------------
A0A3M5AD05      ------------------------------------------------------------
A0A0Q0D3D2      ------------------------------------------------------------
A0A0N0FS39      ------------------------------------------------------------
A0A3M6GHH2      ------------------------------------------------------------
A0A0P9R9W0      ------------------------------------------------------------
A0A0Q0B9T0      ------------------------------------------------------------
A0A3M6CFI7      ------------------------------------------------------------
A0A0P9JXN0      ------------------------------------------------------------
A0A3M6FIV7      ------------------------------------------------------------
A0A3M3PLW9      ------------------------------------------------------------
A0A3M4ENY1      ------------------------------------------------------------
A0A3M5EZK7      ------------------------------------------------------------
A0A0P9SPP5      ------------------------------------------------------------
A0A658KL17      ------------------------------------------------------------
A0A3M3NNF2      ------------------------------------------------------------
A0A3M4A0E8      ------------------------------------------------------------
A0A3M4PBZ2      ------------------------------------------------------------
A0A3M6AI26      ------------------------------------------------------------
A0A0P9IWP8      ------------------------------------------------------------
A0A0P9KZ49      ------------------------------------------------------------
A0A0P9V840      ------------------------------------------------------------
A0A0Q0AIE5      ------------------------------------------------------------
A0A3M2ZQH6      ------------------------------------------------------------
A0A0N8SQG2      ------------------------------------------------------------
A0A0W8HFU1      ------------------------------------------------------------
A0A3M5M873      ------------------------------------------------------------
A0A0P9VHH8      ------------------------------------------------------------
A0A0P9YV98      ------------------------------------------------------------
A0A3M3G2W8      ------------------------------------------------------------
A0A3M6C224      ------------------------------------------------------------
A0A3M5K254      ------------------------------------------------------------
A0A3M5JFB0      ------------------------------------------------------------
A0A3M3TQV3      ------------------------------------------------------------
A0A3M3EF92      ------------------------------------------------------------
A0A3M5J1E2      ------------------------------------------------------------
A0A3M5G7H9      ------------------------------------------------------------
A0A3M4A376      ------------------------------------------------------------
A0A0Q0A5T8      ------------------------------------------------------------
A0A0P9SCD7      ------------------------------------------------------------
A0A0P9T4G3      ------------------------------------------------------------
A0A0P9VKB0      ------------------------------------------------------------
A0A0Q0BM35      ------------------------------------------------------------
A0A3M3TPR7      ------------------------------------------------------------
A0A3M3U4Q3      ------------------------------------------------------------
A0A0P9UCX7      ------------------------------------------------------------
A0A0P9S1F1      ------------------------------------------------------------
A0A0P9QCJ2      ------------------------------------------------------------
A0A0P9Q329      ------------------------------------------------------------
A0A3M5GJ64      ------------------------------------------------------------
A0A0P9MPC7      ------------------------------------------------------------
A0A3M2XYQ3      ------------------------------------------------------------
A0A0P9XCE1      ------------------------------------------------------------
A0A3M3EFX7      ------------------------------------------------------------
A0A3M5B9D9      ------------------------------------------------------------
A0A0P9RRZ3      ------------------------------------------------------------
A0A3M2VEK7      ------------------------------------------------------------
A0A0N8R9B3      ------------------------------------------------------------
A0A0P9VA27      ------------------------------------------------------------
A0A3M4YBJ4      ------------------------------------------------------------
A0A0P9J470      ------------------------------------------------------------
A0A0Q0EVJ8      ------------------------------------------------------------
A0A3M5UI30      ------------------------------------------------------------
A0A3M5YQT8      ------------------------------------------------------------
A0A3M5F5X1      ------------------------------------------------------------
A0A3M5R8G1      ------------------------------------------------------------
A0A3M5V012      ------------------------------------------------------------
A0A3M3GA16      ------------------------------------------------------------
A0A3M3UCT3      ------------------------------------------------------------
A0A3M3CJL0      ------------------------------------------------------------
A0A3M3F6F5      ------------------------------------------------------------
A0A3M3P9B7      ------------------------------------------------------------
A0A0N8QB74      ------------------------------------------------------------
A0A0Q0AUD0      ------------------------------------------------------------
A0A3M5VR55      ------------------------------------------------------------
A0A0Q0FK97      ------------------------------------------------------------
A0A3M5KZ75      ------------------------------------------------------------
A0A3M5L3G5      ------------------------------------------------------------
A0A1V6FYJ1      ------------------------------------------------------------
A0A445MZQ4      ------------------------------------------------------------
A0A0M9E0E3      ------------------------------------------------------------
A0A0Q6QV61      ------------------------------------------------------------
A0A2Z3IKG4      ------------------------------------------------------------
A0A4Q3IRI1      ------------------------------------------------------------
A0A2W4RFS2      ------------------------------------------------------------
A0A1Y6DC43      ------------------------------------------------------------
A0A2S6HE06      ------------------------------------------------------------
G3J0M3          ------------------------------------------------------------
V5C6R5          ------------------------------------------------------------
A0A354EF47      ------------------------------------------------------------
A0A2G6MSP7      ------------------------------------------------------------
A0A1V4M8I1      ------------------------------------------------------------
A0A4Z0M4C7      ------------------------------------------------------------
A0A4U8YMP3      ------------------------------------------------------------
A0A1Q8QQ99      ------------------------------------------------------------
A0A3D5ZY44      ------------------------------------------------------------
A0A646J2A6      ------------------------------------------------------------
A0A1G5C236      ------------------------------------------------------------
A0A5Q2QDL1      ------------------------------------------------------------
A0A656PSQ6      ------------------------------------------------------------
A0A1I3XJ27      ------------------------------------------------------------
A0A1I7DCG1      ------------------------------------------------------------
A0A3A3H6D9      ------------------------------------------------------------
A0A562CGU2      ------------------------------------------------------------
A0A0Q6VA36      ------------------------------------------------------------
A0A1B2EQN1      ------------------------------------------------------------
A0A1E7HSL6      ------------------------------------------------------------
W9VVY5          ------------------------------------------------------------
A0A1E2URD3      ------------------------------------------------------------
A0A2T6MY81      ------------------------------------------------------------
A0A2T6NBQ8      ------------------------------------------------------------
A0A421K431      ------------------------------------------------------------
A0A2G2I5M1      ------------------------------------------------------------
A0A2G2M6F0      ------------------------------------------------------------
A0A1W9J9F8      ------------------------------------------------------------
A0A2S5LFJ9      ------------------------------------------------------------
A0A2D8R8F8      ------------------------------------------------------------
A0A010SNS0      ------------------------------------------------------------
A0A0C2I782      ------------------------------------------------------------
A0A2N8BYF5      ------------------------------------------------------------
A0A558FKX2      ------------------------------------------------------------
A0A1H1DBA0      ------------------------------------------------------------
J2TAD5          ------------------------------------------------------------
J3H699          ------------------------------------------------------------
A0A1H5J974      ------------------------------------------------------------
A0A0K1QRZ4      ------------------------------------------------------------
A0A560RJW9      ------------------------------------------------------------
A0A5E6TID7      ------------------------------------------------------------
A0A5E7CRU7      ------------------------------------------------------------
A0A5E7C564      ------------------------------------------------------------
A0A2W7MAV4      ------------------------------------------------------------
A0A4R3WQH5      ------------------------------------------------------------
W6VFG3          ------------------------------------------------------------
A0A1P8ENT1      ------------------------------------------------------------
A0A2N7XRV4      ------------------------------------------------------------
A0A0Q6QPG8      ------------------------------------------------------------
A0A0F4SWA7      ------------------------------------------------------------
A0A423J219      ------------------------------------------------------------
A0A4P6G9U8      ------------------------------------------------------------
A0A4Y8JE06      ------------------------------------------------------------
A0A502I1X9      ------------------------------------------------------------
A0A502J776      ------------------------------------------------------------
A0A5B0EZF6      ------------------------------------------------------------
A0A059L434      ------------------------------------------------------------
A0A0F4UWN2      ------------------------------------------------------------
A0A5E7WEF5      ------------------------------------------------------------
A0A1G0KSD0      ------------------------------------------------------------
A0A4P6WX84      ------------------------------------------------------------
A0A1D2S760      ------------------------------------------------------------
A0A5B8RW94      ------------------------------------------------------------
A0A258TN88      ------------------------------------------------------------
A0A4Q3ZDI7      ------------------------------------------------------------
A0A537PRC6      ------------------------------------------------------------
A0A2M7JX59      ------------------------------------------------------------
A0A3A4XVN3      ------------------------------------------------------------
A0A1E7JEV6      ------------------------------------------------------------
A0A2N2KDY5      ------------------------------------------------------------
A0A3N5YUD9      ------------------------------------------------------------
A0A0W1DLQ3      ------------------------------------------------------------
A0A246JVD8      ------------------------------------------------------------
A0A2N3BB54      ------------------------------------------------------------
A0A1H6G7A3      ------------------------------------------------------------
A0A0A7PGL6      ------------------------------------------------------------
A0A4Q2Z4L0      ------------------------------------------------------------
A0A5C4N0H6      ------------------------------------------------------------
A0A4R1HDF2      ------------------------------------------------------------
A0A1E7HFN0      ------------------------------------------------------------
A0A1M5GH86      ------------------------------------------------------------
A0A1W1XQZ5      ------------------------------------------------------------
A0A3D6C3I2      ------------------------------------------------------------
S0G1D4          ------------------------------------------------------------
A0A661T246      ------------------------------------------------------------
A0A2G6CSG7      ------------------------------------------------------------
A0A2G6NB59      ------------------------------------------------------------
A0A5K8A7T9      ------------------------------------------------------------
A0A1W9U045      ------------------------------------------------------------
A0A1F9L9G4      ------------------------------------------------------------
A0A328FD76      ------------------------------------------------------------
A0A348UX90      ------------------------------------------------------------
A0A357Z0N5      ------------------------------------------------------------
A0A0F2R2U0      ------------------------------------------------------------
A0A5K7ZK00      ------------------------------------------------------------
A0A5K7YCX8      ------------------------------------------------------------
A0A5K7Z388      ------------------------------------------------------------
A0A352B502      ------------------------------------------------------------
A0A2K8WHP8      ------------------------------------------------------------
A0A410V446      ------------------------------------------------------------
A0A0R3KGJ5      ------------------------------------------------------------
A0A0R3N604      ------------------------------------------------------------
A0A1B1UCM8      ------------------------------------------------------------
A0A1N6JQ20      ------------------------------------------------------------
A0A1M5TI07      ------------------------------------------------------------
A3X191          ------------------------------------------------------------
A0A1H4RKV5      ------------------------------------------------------------
A0A160UA87      ------------------------------------------------------------
A0A1Q5SFV5      ------------------------------------------------------------
A0A1J5N774      ------------------------------------------------------------
A0A2C8F781      ------------------------------------------------------------
A0A2E3R6G0      ------------------------------------------------------------
A0A1F8XMK2      ------------------------------------------------------------
A0A3M8EMP2      ------------------------------------------------------------
A0A2J6J6K6      ------------------------------------------------------------
A0A1G6EKK9      ------------------------------------------------------------
S7TK97          ------------------------------------------------------------
S7UE93          ------------------------------------------------------------
A0A3D5BR56      ------------------------------------------------------------
A0A2N2IB15      ------------------------------------------------------------
A0A1I3PSR2      ------------------------------------------------------------
A0A1I4GEK4      ------------------------------------------------------------
A0A0A8WSG4      ------------------------------------------------------------
A0A2T5R3J5      ------------------------------------------------------------
A0A661PSB9      ------------------------------------------------------------
A0A661QBT6      ------------------------------------------------------------
A0A1W7QPT7      ------------------------------------------------------------
A0A1L3GKM9      ------------------------------------------------------------
A0A0M4D373      ------------------------------------------------------------
A0A5J4MX76      ------------------------------------------------------------
A0A430DNP0      ------------------------------------------------------------
A0A3A0FQ32      ------------------------------------------------------------
A0A1E4UZA0      ------------------------------------------------------------
A0A1H9KL56      ------------------------------------------------------------
A0A1A9KEF8      ------------------------------------------------------------
A0A5E6PKN5      ------------------------------------------------------------
A0A0N9W1V6      ------------------------------------------------------------
A0A423GQ41      ------------------------------------------------------------
A0A423H7J2      ------------------------------------------------------------
A0A502HNM8      ------------------------------------------------------------
A0A4Q7H223      ------------------------------------------------------------
A0A1H4N2K9      ------------------------------------------------------------
A0A2K4KWF7      ------------------------------------------------------------
A0A3E0WXH2      ------------------------------------------------------------
A0A2N2TRC8      ------------------------------------------------------------
A0A1V4CIZ7      ------------------------------------------------------------
A0A1M3BXA5      ------------------------------------------------------------
A0A1Y2R3U6      ------------------------------------------------------------
A0A167HVD6      ------------------------------------------------------------
A0A1V3SCT6      ------------------------------------------------------------
L0H287          ------------------------------------------------------------
A0A495VG93      ------------------------------------------------------------
A0A4R3MYM4      ------------------------------------------------------------
G2E3C0          ------------------------------------------------------------
A0A534QGR3      ------------------------------------------------------------
A0A4U8YLL7      ------------------------------------------------------------
A0A655RNN3      ------------------------------------------------------------
A0A655R819      ------------------------------------------------------------
A0A655ZEY0      ------------------------------------------------------------
A0A0W1GMS6      ------------------------------------------------------------
A0A0Q8RMY3      ------------------------------------------------------------
A0A1A7QC21      ------------------------------------------------------------
A0A2M7WWF7      ------------------------------------------------------------
A0A351Z9A2      ------------------------------------------------------------
A0A3N5RNY4      ------------------------------------------------------------
A0A1E7H876      ------------------------------------------------------------
A0A0F2NF69      ------------------------------------------------------------
A0A1F9NFD0      ------------------------------------------------------------
A0A1M5YLH5      ------------------------------------------------------------
A0A4U1A4C7      ------------------------------------------------------------
A0A509L3P8      ------------------------------------------------------------
A0A3A4S038      ------------------------------------------------------------
A0A1F9N669      ------------------------------------------------------------
A0A1F9PFA7      ------------------------------------------------------------
A0A1H2EN09      ------------------------------------------------------------
K0NP00          ------------------------------------------------------------
A0A432HIS7      ------------------------------------------------------------
A0A127AL56      ------------------------------------------------------------
A0A1E7JCL5      ------------------------------------------------------------
A0A496YAH9      ------------------------------------------------------------
A0A1V4S7E4      ------------------------------------------------------------
A0A2N2H8D2      ------------------------------------------------------------
A0A2N2KC63      ------------------------------------------------------------
A0A3A4ZYW4      ------------------------------------------------------------
A0A1V4MCJ4      ------------------------------------------------------------
A0A661M0W4      ------------------------------------------------------------
A0A1X0YE57      ------------------------------------------------------------
A0A2K2H9Q8      ------------------------------------------------------------
A0A2N6BEI9      ------------------------------------------------------------
A0A318CT66      ------------------------------------------------------------
A0A3N5P205      ------------------------------------------------------------
A0A0D5N3E9      ------------------------------------------------------------
A0A2N2G716      ------------------------------------------------------------
A0A1F9EUS2      ------------------------------------------------------------
A0A3N9VAW3      ------------------------------------------------------------
A0A1H4B8T3      ------------------------------------------------------------
A0A1E7IQC3      ------------------------------------------------------------
A0A1M6KEN5      ------------------------------------------------------------
A0A353QLL3      ------------------------------------------------------------
A0A399I453      ------------------------------------------------------------
A0A651FBV9      ------------------------------------------------------------
A0A1G0LDK7      ------------------------------------------------------------
A0A562VHD2      ------------------------------------------------------------
A0A5C1MDH8      ------------------------------------------------------------
A0A5A9XE04      ------------------------------------------------------------
A0A643G9R1      ------------------------------------------------------------
A0A1G0M8Q7      ------------------------------------------------------------
A0A353MI14      ------------------------------------------------------------
A0A4S1CAW7      ------------------------------------------------------------
A0A534HBS8      ------------------------------------------------------------
A0A0F0T3Y9      ------------------------------------------------------------
A0A351B422      ------------------------------------------------------------
F2NEE9          ------------------------------------------------------------
B7RS54          ------------------------------------------------------------
A0A3N5FRH4      ------------------------------------------------------------
A0A1V4Y2C3      ------------------------------------------------------------
A0A2N2KTJ4      ------------------------------------------------------------
A0A2N2LQX0      ------------------------------------------------------------
A0A318D3U4      ------------------------------------------------------------
A0A401FQP5      ------------------------------------------------------------
A0A1Q6DMW3      ------------------------------------------------------------
A0A3A6P8F8      ------------------------------------------------------------
A0A2G2DSM4      ------------------------------------------------------------
A0A1F9NI02      ------------------------------------------------------------
A0A4U1ABX4      ------------------------------------------------------------
A0A351Z4H9      ------------------------------------------------------------
A0A2N2KML4      ------------------------------------------------------------
E1YJF1          ------------------------------------------------------------
A0A1J5EVZ6      ------------------------------------------------------------
A0A2G6FCC5      ------------------------------------------------------------
A0A1F9MR25      ------------------------------------------------------------
A0A2G6M7F1      ------------------------------------------------------------
A0A1I0R9R6      ------------------------------------------------------------
A0A443K010      ------------------------------------------------------------
A0A238IZI1      ------------------------------------------------------------
A0A316GHM6      ------------------------------------------------------------
A0A520ZTR8      ------------------------------------------------------------
A0A212AR83      ------------------------------------------------------------
A0A2E2P4I0      ------------------------------------------------------------
A0A2U2CM86      ------------------------------------------------------------
A0A1X7ACC1      ------------------------------------------------------------
A0A2N3BVE7      ------------------------------------------------------------
A0A2S5JE21      ------------------------------------------------------------
A0A2R8BKZ2      ------------------------------------------------------------
A0A2S8S361      ------------------------------------------------------------
A0A238KUF6      ------------------------------------------------------------
A0A095CTW3      ------------------------------------------------------------
A0A2E3UGD6      ------------------------------------------------------------
A0A2T0RFH0      ------------------------------------------------------------
A0A285D390      ------------------------------------------------------------
A0A497VHN4      ------------------------------------------------------------
A0A379GWF0      ------------------------------------------------------------
A0A536T0W8      ------------------------------------------------------------
A0A2G9XLE5      ------------------------------------------------------------
A0A3D2M6Y9      ------------------------------------------------------------
A0A3D2YAZ2      ------------------------------------------------------------
A0A350A102      ------------------------------------------------------------
A0A350L5D2      ------------------------------------------------------------
A0A1I6ENM4      ------------------------------------------------------------
A8LNM8          ------------------------------------------------------------
A0A0T5NSU3      ------------------------------------------------------------
A0A5P9I718      ------------------------------------------------------------
A0A2M8J3R9      ------------------------------------------------------------
A0A1I6X762      ------------------------------------------------------------
A0A0P1EFX8      ------------------------------------------------------------
A0A2G5KB39      ------------------------------------------------------------
A0A2N3CNV1      ------------------------------------------------------------
A0A257F1F4      ------------------------------------------------------------
A0A1G9FY29      ------------------------------------------------------------
A0A4Q3ZBK4      ------------------------------------------------------------
A0A2D5J8T8      ------------------------------------------------------------
A0A2E3P9W6      ------------------------------------------------------------
A0A2G2B1P9      ------------------------------------------------------------
A0A258GCD5      ------------------------------------------------------------
A0A2D9YR88      ------------------------------------------------------------
A0A443INY4      ------------------------------------------------------------
A0A372IH36      ------------------------------------------------------------
A0A540VW45      ------------------------------------------------------------
A0A1H9C241      ------------------------------------------------------------
A0A2E3FCR1      ------------------------------------------------------------
A0A4S3MG69      ------------------------------------------------------------
A0A1G8QZS5      ------------------------------------------------------------
A0A1V4QMH7      ------------------------------------------------------------
A0A496XZQ4      ------------------------------------------------------------
A0A1F9BJF7      ------------------------------------------------------------
F2NDF5          ------------------------------------------------------------
A0A1I3TTC3      ------------------------------------------------------------
A0A1H3IZW6      ------------------------------------------------------------
A0A0M6YG59      ------------------------------------------------------------
A0A1H7G8B0      ------------------------------------------------------------
A0A059IPK4      ------------------------------------------------------------
A0A1H2Y469      ------------------------------------------------------------
A0A497ZQU7      ------------------------------------------------------------
A0A520CSP5      ------------------------------------------------------------
A0A4Q2XLV7      ------------------------------------------------------------
A0A4Q5QYC4      ------------------------------------------------------------
A0A3B8SQ27      ------------------------------------------------------------
A0A3E0H727      ------------------------------------------------------------
A0A352Q5C1      ------------------------------------------------------------
A0A656BWB0      ------------------------------------------------------------
A0A3Y2RPN4      ------------------------------------------------------------
A0A0A0FHV8      ------------------------------------------------------------
A0A1X3IPU7      ------------------------------------------------------------
A0A0A0G0N2      ------------------------------------------------------------
A0A243TPR1      ------------------------------------------------------------
A0A2I8SDU4      ------------------------------------------------------------
A0A2I8SU55      ------------------------------------------------------------
S1EXJ6          ------------------------------------------------------------
A0A376UBS1      ------------------------------------------------------------
A0A4Q6G931      ------------------------------------------------------------
A0A4Q8R6L6      ------------------------------------------------------------
A0A2T0VBD8      ------------------------------------------------------------
A0A378APS2      ------------------------------------------------------------
A0A443VCQ6      ------------------------------------------------------------
A0A447RKQ7      ------------------------------------------------------------
W1DSK1          ------------------------------------------------------------
A0A0U2VAW2      ------------------------------------------------------------
A0A454CTF1      ------------------------------------------------------------
A0A1W9F5M9      ------------------------------------------------------------
A0A352MMI7      ------------------------------------------------------------
A0A379W6R2      ------------------------------------------------------------
A0A376RY66      ------------------------------------------------------------
A0A377K431      ------------------------------------------------------------
A0A379TA56      ------------------------------------------------------------
A0A4Z0LWV1      ------------------------------------------------------------
A0A620QD02      ------------------------------------------------------------
A0A5H3HSJ8      ------------------------------------------------------------
A0A655C5P0      ------------------------------------------------------------
A0A3C2BN18      ------------------------------------------------------------
A0A447LR75      ------------------------------------------------------------
A0A376D8L7      ------------------------------------------------------------
A0A1V2FV46      ------------------------------------------------------------
A0A376SB61      ------------------------------------------------------------
A0A3D1BYV9      ------------------------------------------------------------
A0A378G3G7      ------------------------------------------------------------
A0A2X5NHJ9      ------------------------------------------------------------
A0A2J4QEC3      ------------------------------------------------------------
A0A485ADM3      ------------------------------------------------------------
A0A4U9HGU4      ------------------------------------------------------------
A0A3S4JGG5      ------------------------------------------------------------
A0A377ZDH2      ------------------------------------------------------------
A0A3S4HTS8      ------------------------------------------------------------
A0A2N1XK22      ------------------------------------------------------------
A0A3D0KAC8      ------------------------------------------------------------
A0A3D2Y902      ------------------------------------------------------------
E1Y9C0          ------------------------------------------------------------
A0A1N6SH58      ------------------------------------------------------------
A0A4Q3AQN2      ------------------------------------------------------------
                                                                            

A0A1F9CFF0      ------------------------------------------------------------
A0A2M8B0G5      ------------------------------------------------------------
A0A363TNU9      ------------------------------------------------------------
A0A0C5VQ86      ------------------------------------------------------------
A0A1V8MBH1      ------------------------------------------------------------
A0A0R0BVC7      ------------------------------------------------------------
A0A3N5J7U8      --------------------------MSESRDPAGSGQMFDIE-----------------
A0A1S7S3I8      ------------------------------------------------------------
A0A519E8D7      ------------------------------------------------------------
A0A3S1NZ06      IIVLGLSLVLGVLMGAGFGGLNEFNERFFRTGEE-VRDRVGLKFLGYLPTIGSKPTKEDK
A0A3S1FD32      IVVLGLSLVLGLLMGAGFGGLNEFNERFFRTGED-VRDRVNLKFLGYLPTIGGKLGKEEK
A0A434DUT4      SIVLGLSLVLGLMMGAGVGGLNEFRERFFRTGED-VRDRVGLKFLGYLPVIGSKVAKND-
A0A528D3U3      ------------------------------------------------------------
A0A3S3UPT3      MRVLALSLVLGLMLGAGFGGLNEFNERFFRTGED-IRDRAGLKFLGYLPTIGGGRAKDSK
A0A3S1E286      ------------------------------------------------------------
A0A531AC71      SIVLGLSLVLGVMLGAGAGGLNEFRERFFRTGED-VRDRVGLKFLGYLPIIGSKAAKDDK
A0A436K268      --------------------LNEFNERFFRTGED-VRDRVNLKFLGYLPTIGGKLGKEEK
A0A434IDQ0      ------------------------------------------------------------
A0A435IRM5      ------------------------------------------------------------
A0A3S2C404      ---------------------------------------------------------EEK
A0A435F6C0      ------------------------------------------------------------
A0A435BMN6      ------------------------------------------------------------
A0A529XQ54      ------------------------------------------------------------
A0A530BJC1      ------------------------------------------------------------
Q44570          ---KLGIGLIAVALAAGAVRCCCAITSRRALPRSSACAAIPLPLLAVVPKVGGRTEQTV-
A0A655ZZQ1      ------------------------------------------------------------
A0A1S0ZAI3      ------------------------------------------------------------
A0A1W9M770      ----------------------------FPSPHATTGGKQGREPRGENWDERLKVIHND-
A0A1W9M7R6      ----------------------------FSSPNPTTGGPQGNEQRPRNWDERLNIIQGD-
A0A3C0L0A8      ------------------------------------------------------------
A0A176S762      ------------------------------------------------------------
A0A377ZC40      ------------------------------MPNN--LKKMVLNVYASIPLSDWQLK----
A0A378BPJ7      VLVVIIGLVLGFMISVGLVLIRVFLRRGIESPEQ--LEEIGISVYASIPVSESFTK----
A0A2J5PAJ7      VIILLVGFILGGMVSIGLVLLRVFLRQGIESPEQ--LEERGINVYASIPISEAFTK----
A0A377ZDN3      ------------MASISIVLLRMLLRRGIESPEQ--LEEVGINVYASIPVSDTLSN----
A0A1W9WUD9      KRMVLISMILGIALGIGFAFVLEYLDNTIRFPEE-ISDYLGIPYMGLVPAFDTDEVLDG-
A0A1W1ZQK0      ----------------------------QLDDDSFIEKKSAFPVQGNVKSAMGDLTESS-
A0A4U1ALN4      ---------------------------------------------------------WD-
A0A4U1B1A8      -----------------------------------TTDSPRDVERGHITDEAGYADNWD-
A0A1M7Y300      --------------------------------------------------QSGP---WN-
A0A4U1A967      --------------------------------------------------NTNSFDDWD-
A0A3N5MZ53      ARIVAISVLLALLFGVGAALLLASLDATIKNSSD-VAEKLKRPLLGIVPLLKGNALSVV-
A0A534E4H4      RRIVSIAVLLTLLFGVGVAFLLASLDNTVRSSRD-VEEKLKRPLLGIEPLLGNEALRAV-
A0A534I2B6      LLIVSIAVLLTLLFGVGVAFLLASLDDTVKSARD-VEEKLKRPLLGIEPRLADPALSAA-
A0A1C2JGD0      SKAVLIGAFLGLLLGLAVVFARFLLHKGFHSDEGILSRYPSIPLFGKLPEYEAFQSVGD-
A0A259LQ70      PRSLIQALILSLAAGIGLAFGLSYIDDTIKTPED-VKQKLGLAAVGVIPKVKASKADSI-
A0A4V2SPR5      --------MLGLVSGLSAVIVLEVLSSTVRSGDD-LEKRLSVPYLGAVPRLTSAQLQST-
A0A3N5PM86      ARNFLLAIIVSLALGVGMAFFFEYLDNTINTPDE-LERYFKVPFLGVVSKFKIDAPGEE-
A0A2E5YSA4      --------DRADAVGSADHPPHSPLPTGVTKETR-IGRSI--------------------
A0A519ERR1      PLVAALGLVLGLLAGVALAIVRSLFMGGIRNPQE-IEAHTGLNVYSVVPFTQEQLAIEQ-
A0A4Q3Q1M2      ------------------------IEQRIKDPHE-VESQTALPVFSTIPLSTAQNEIAQ-
A0A4Q3MHR1      ----------------------SLFMGGVRNPQE-IEAHTGLNVYSVVPFTSEQIQIEQ-
A0A520GDZ4      ------------------------------------------------------------
A0A318DSU0      VLAVLGSTFFGGFLAVAFVLVRQMLHRGVEDPSV-IEE-LGLSVYASIPSSAAEKKNFR-
A0A538PF21      KTNVSLAAIMALVVGVGIIFLIVFLDRSIKSITD-ATQAADAPVLGVIPQLTSADLDGK-
A0A1W1ZH10      KLMFFVSVAFALVLGGAIAVLREHFVGGFTSEEQ-IEPVLRAKLATVIPKQTPDANLTT-
A0A1W2FF24      KLMFFVSVAFALVLGGAIAVLREHFVGGFTSEEQ-IEPVLRAKLATVIPKQAVDANLTT-
A0A524JYQ6      RRETMQAAGLALFLGIGLSFLLHFADDRIRRSED-LEQGVGLPVLAIVPRISGRTETLR-
A0A4Q3MA17      KQVVAIAGILGLLLGIGLAFLRNSLRPGIKEPGQ-IEAVTGLNVFATIPLSAAQKKLGN-
A0A0N0M5F7      PVNLGLSLLAAFVAAIGVIYLRENLDDMLRTVDD-AERKLGVTGLGMVPRLDAGVTFRD-
A0A537M754      PLNILLGLFAGMVLGFGTAFAIEFIDDTIKTPDD-LTERLGVTPLGLIPMAPKGTNVTD-
A0A1V1PDB4      RLNIFLGIVFGLFVGIAVAFAFEFLDNTLKSPED-IRNFLNIPYLGPVPTFDLERDNTD-
A0A2M7C324      FLVVSTAFVLSLLLAIAIAFLMEYLDNSVRSAED-AERKLGLPLLAAVPMVELAGGISA-
A0A4Q3HHG6      TLTMALSVVLGLLLGGALAALLEFRERFFRTGAD-VQDKLGVRFLGYLPKIGSAQTDDNG
A0A3B7DTA4      PKNIAIALLLGMGTAAAFVFLKDHFDDTIRSPLD-VEGKLGVPMLGLIPHVGSDAE--G-
A0A432ZK62      ALIVVLATMLGGMASVGYVFVMAAFNRGVEPAEQ-IEELGINVYASVPESPLQQSMNEK-
A0A1V5EEP4      -------------------VVFPDF---------------------------------D-
A0A1V5EF48      -------------------VVFPDF---------------------------------D-
A0A0S6X1X6      LINLVIALLIGLVVSALVILLREYFDDAIRSPED-VERKLGIPLLALVPNSEDV----Q-
A0A537Y5L8      MLVMASAGAGGLLLAFGVAILIDISERGFRTSEQ-VEQELNASCLAVVPTVGAEPETPL-
A0A4Q3L2X2      LLNLLLALFGGLGLGAVLALALEQMDDAIADPDE-IQRQLGLPLLGSIPKVEGTE---P-
A0A4Q3T8J1      VLLEALDETVATPDDAEAKLGVPVLGVVPLLDKG-ETT--------------------A-
A0A4Q4ANM4      VHTRAQLEKLLGTSCLAVLPAFAKKKSAARKPGA-LPT-------------------SD-
A0A4Q3UEC7      LIIVGVAFGLSLLAGFGIVLLIEQLENTLRDPDR-LEKLTGRPLLSLIPMEKSVGPVPE-
A0A1H5YYQ4      ---------------------WDSLGTVSLDAAT-LDR--------------------H-
A0A1X4NLK2      VLATAPKPHVAPEPVFDPESVWHELDRFELDAKR-LAQ--------------------R-
A0A1X4NWB5      VLTSQPDAAPGKTEVFDREAAWNAIDRFPLDPQR-LAD--------------------R-
A0A1M5UQ38      --------------------VWSQLDRFALNPKR-LAK--------------------H-
A0A327YI48      ----------------SPDMVWSRLPVFSVNARH-LDR--------------------N-
A0A1B1PNL6      --------AVTRRPAPQATLLWDQLPVFEIDSDH-LER--------------------N-
A0A2U8H9H9      --------PITRRATPQAGALWDRLPVLEIDSVH-LER--------------------N-
A0A1X6YIC0      -------------AADDPERLWASMPSFAVDDRA-LER--------------------N-
A0A1I5E9E9      EPAKAASGDAADTALAPVPLLWPNLRQVPLDARH-LAR--------------------N-
A0A1X6Z7N7      DPAE----DAADEAPAPLPLLWPNLRSVPLDARH-LTR--------------------N-
A0A2E1DQ13      ---------------TSIAGAWAALRETPLDARH-LTR--------------------N-
A0A1H8C800      -------------VASTQQPLWDDLRAVPLDTRH-LIR--------------------N-
A0A2N3EZ05      -------------RIAAT---WAALRPVPLDARH-LTR--------------------N-
A0A1W9PMU6      VLIIIVGFVLGFIVGIALAFLRELLDDTVKSAEE-IERLTNIPLYGTIPLIKGKKF----
A0A1G3VVY5      ERVSYKGVPKDNVFDRQEAQPEQYQESERATYKD-APKDNIFDKQKVQPSKPAPKDIAL-
A0A2N6BZD5      ---------------------------------------QAIPPPFRENLDTGAMVDNW-
A0A435NNF5      ------------------------------------------------------------
A0A3S2AQS7      SINLAVALALFMALAASIIYIIELLNNTFTNPEQ-IEKELGLTMLGILPLV------GD-
A0A436XH86      SINLAVALALFMALAASIIYIIELLNNTFTNPEQ-IEKELGLAMLGILPLV------GD-
A0A527ZPD6      ---LAVALALFLALSASIIYIIELLNNTFTNPEQ-IEKELGLAMLGILPLV------DD-
A0A529KRW3      SINLALSLALFLSLSASIIYIIELLNNTFTNPEQ-IEKELGLAMLGILPLV------DD-
A0A530ZLX0      SINLAVSLALFLALSASIIYIIELLNNTFTNPEQ-VEKELGLAMLGILPHV------DD-
A0A355TB56      WLFVLVGLILGGVLGLLAAYLAEFFDRGFRTAPQ-LEEGTGIPVIGQVP-SLKTIS-DR-
A0A524M660      LLLGVVAVFMRKALHRGMEDPDLIEKLLYVPVYA-AIAHSKIQELLSKEITKTHKSNKK-
A0A0C1TRU6      --------------------------------------------LPPFPAEPLDGIRHD-
A