BYKdb

Dataset for cluster orphancd of phylum planctomycetes

[Download (right click)] [Edit] [Sequences] [Repertoires]

209 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


M5S2L2          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A7C2VXA0      ------------------------------------------------------------
A0A7C3AA48      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A7C5PFV3      ------------------------------------------------------------
A0A7C3QGD2      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A7C2ZUK5      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
A0A7C2JY73      ------------------------------------------------------------
A0A356AE44      ------------------------------------------------------------
A0A1G2XSU7      ------------------------------------------------------------
A0A350KD81      ------------------------------------------------------------
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      ------------------------------------------------------------
A0A524HC32      ------------------------------------------------------------
A0A177PV03      ------------------------------------------------------------
A0A1G2YIM0      ------------------------------------------------------------
A0A7D8YCU5      ------------------------------------------------------------
A0A353BE27      ------------------------------------------------------------
A0A5C6BPW1      ----------------------------------------------------------MM
A0A1I3GSP0      ------------------------------------------------------------
A0A517QJV1      ------------------------------------------------------------
A0A3C1QS25      MRRHACPTLLLDPYVWVHRACLVGTTGTSCECRARISPTRLKLAPPNRCPGRGPRYTEGS
A0A5C6FX55      -----------------------------------------------------MNRQFSV
A0A5C6DS51      ------------------------------------------------------------
A0A5C6DSL6      ------------------------------------------------------------
A0A3M1VG27      -----------------------------------------------------MNDDVPF
A0A518GC22      ------------------------------------------------------------
A0A3L7Q373      ------------------------------------------------------------
A0A3E0PW54      -----------------------------------------------------MVGFRPP
A0A7C3TAH2      ------------------------------------------------------------
A0A1Z8MHR4      ------------------------------------------------------------
A0A5C6EHJ0      ------------------------------------------------------------
A0A5C6F1H9      ------------------------------------------------------------
A0A255QXY0      ------------------------------------------------------------
A0A517SYI0      ------------------------------------------------------------
A0A518HX54      ------------------------------------------------------------
A0A5B9MF59      ------------------------------------------------------------
A0A2A2WC24      ------------------------------------------------------------
A0A518KYW8      ------------------------------------------------------------
A0A5C5YZZ0      ------------------------------------------------------------
A0A518JLD2      ------------------------------------------------------------
A0A5M6DJ15      ------------------------------------------------------------
A0A3L7P7S7      ------------------------------------------------------------
A0A517N8M1      -----------------------------------------------------MKATPLP
A0A5C6CW01      -----------------------------------------------------MKQSSDR
A0A5C6BXS9      -----------------------------------------------------MQVIPEP
M5U569          -----------------------------------------------------MSILSEF
L7CND7          ------------------------------------------------------------
A0A0J1B8S4      ---------------------------------------------------------MTP
F2ARR3          -----------------------------------------------------MELPSNA
K5D8H6          -----------------------------------------------------MELPSNA
M2AKU0          -----------------------------------------------------MELPSNA
A0A5B1CKI2      ------------------------------------------------------------
A0A5C6EG84      ------------------------------------------------------------
A0A5C6F2X4      ------------------------------------------------------------
A0A5C5XTV6      ------------------------------------------------------------
A0A5C6AAB1      ------------------------------------------------------------
M5T8W8          ------------------------------------------------------------
M5SF00          ------------------------------------------------------------
A0A2G1WDS1      ---------------------------------------------------------MTP
Q7UVS9          ---------------------------------------------------------MTP
A0A5C6B601      ------------------------------------------------------------
A0A517PFU1      ------------------------------------------------------------
A0A5B9M8J9      ------------------------------------------------------------
A0A2A2WFP6      ------------------------------------------------------------
A0A518L8N2      ------------------------------------------------------------
A0A518HQN9      ------------------------------------------------------------
A0A5M6D8H8      ------------------------------------------------------------
A0A5B1CRW9      ------------------------------------------------------------
A0A5C6EI46      ------------------------------------------------------------
A0A1G2ZG92      ------------------------------------------------------------
A0A1G3A0W0      -------------------------------------------------MNPAEKEFQPQ
A0A2E7D3V4      ------------------------------------------------------------
A0A5B9PER9      ------------------------------------------------------------
A0A517QSM4      ------------------------------------------------------------
A0A355GJI7      ------------------------------------------------------------
A0A1Z8MCI4      ------------------------------------------------------------
A0A517SYL7      ------------------------------------------------------------
A0A3L7P0L2      ------------------------------------------------------------
A0A6M5YVJ1      ------------------------------------------------------------
A0A2E0SHG0      ------------------------------------------------------------
A0A518CQB8      ------------------------------------------------------------
A0A517SCC8      ------------------------------------------------------------
A0A3A0DR44      ------------------------------------------------------------
A0A358MY60      ------------------------------------------------------------
A0A517MNB1      ------------------------------------------------------------
A0A142YJ13      --------------------------------------------------------MGTP
A0A517Z7D3      ------------------------------------------------------------
A0A1N6KY57      ------------------------------------------------------------
L0DK20          ------------------------------------------------------------
A0A3L7UX05      -----------------------------------------------------------M
A0A517XRC2      ------------------------------------------------------------
A0A6M5YH47      ------------------------------------------------------------
A0A660UUK3      ------------------------------------------------------------
A0A517ZHG5      ----------------------------------------------------------MM
A0A1Z8MPL5      ------------------------------------------------------------
A0A7C1EH96      ------------------------------------------------------------
A0A5C1AGE3      --------------------------------------------------------MRRS
A0A2Z3HEL7      --------------------------------------------------------MARP
A0A142XAP8      --------------------------------------------------------MARP
A0A6P2DEK1      --------------------------------------------------------MARP
A0A5C6C1R5      ------------------------------------------------------------
A6BZU4          ------------------------------------------------------------
A0A2D5GZ77      ------------------------------------------------------------
A0A3D3R1Z6      ------------------------------------------------------------
A0A517XG00      ------------------------------------------------------------
A0A1G2YRE4      ------------------------------------------------------------
A0A353Z859      ------------------------------------------------------------
A0A2D6ST10      ------------------------------------------------------------
A0A177QX42      ------------------------------------------------------------
A0A517SHR0      ------------------------------------------------------------
A0A2E0AW64      ------------------------------------------------------------
A0A351FZ59      ------------------------------------------------------------
A0A660V239      ------------------------------------------------------------
A0A177Q3B7      ------------------------------------------------------------
A0A2E0X6Y6      ------------------------------------------------------------
A0A518GFD7      ------------------------------------------------------------
A0A5C5VZJ8      ------------------------------------------------------------
A0A518GE37      ------------------------------------------------------------
A0A5C6F3H8      ------------------------------------------------------------
A0A5C5X072      ------------------------------------------------------------
A0A5C5WUQ3      ------------------------------------------------------------
A0A5C6E697      ------------------------------------------------------------
A0A5C5Z1A3      ------------------------------------------------------------
A0A5C6D2P7      ------------------------------------------------------------
A0A5B9ML17      ------------------------------------------------------------
A0A518HFS8      ------------------------------------------------------------
A0A5Q3LBQ3      ------------------------------------------------------------
A0A517LX75      ------------------------------------------------------------
A0A7C5W7B3      ------------------------------------------------------------
A0A2S8F9B8      ------------------------------------------------------------
A0A354GX32      ------------------------------------------------------------
A0A142XL75      ------------------------------------------------------------
A0A6P2D5D5      ------------------------------------------------------------
A0A5C1AAF0      ------------------------------------------------------------
A0A7C7T8W8      ------------------------------------------------------------
A0A5C6B3S0      ------------------------------------------------------------
A0A368KP63      ------------------------------------------------------------
A0A518GIZ9      ------------------------------------------------------------
A0A1C3EBY9      ------------------------------------------------------------
D5SX64          ------------------------------------------------------------
A0A517Z0U7      ------------------------------------------------------------
A0A2S8FCC0      ------------------------------------------------------------
A0A1Z8MBT6      ------------------------------------------------------------
A0A517SXN9      ------------------------------------------------------------
A0A518HFL0      ------------------------------------------------------------
A0A3B8ZJM2      ------------------------------------------------------------
A0A1U7CLW1      -----------------------------------------------------MEPFRSS
A0A142WPR7      ------------------------------------------------------------
A0A3M1TFJ0      ------------------------------------------------------------
A0A517P477      ------------------------------------------------------------
A0A517T4K9      ------------------------------------------------------------
A0A7C6B2Q1      ------------------------------------------------------------
A0A7C4QPD3      ----------------------------------------------------------ME
A0A2Z3GZZ5      ------------------------------------------------------------
A0A4V0I6L6      ------------------------------------------------------------
A0A7C4QQT3      ------------------------------------------------------------
A0A255QXF5      ------------------------------------------------------------
A0A518KBI5      ------------------------------------------------------------
A0A5C5V6Q5      ------------------------------------------------------------
A0A517MY49      ------------------------------------------------------------
A0A2E6AG00      ------------------------------------------------------------
A0A1G3A880      ------------------------------------------------------------
A0A2E8ATT1      ------------------------------------------------------------
A0A7C2JZW2      ------------------------------------------------------------
A0A518KYQ0      ------------------------------------------------------------
A0A5B9QX47      ------------------------------------------------------------
M5T666          ------------------------------------------------------------
M5U6N6          ------------------------------------------------------------
A0A517M0G2      ------------------------------------------------------------
A0A5C6AST1      ------------------------------------------------------------
A0A5C6C951      ------------------------------------------------------------
A0A5C6C5T3      ------------------------------------------------------------
A0A2A2W6A9      ------------------------------------------------------------
A0A518HQS9      ------------------------------------------------------------
A0A5M6DFE6      ------------------------------------------------------------
A0A5C6F286      ------------------------------------------------------------
A0A517NGN1      ------------------------------------------------------------
M5RUI3          ------------------------------------------------------------
A0A660VT66      ------------------------------------------------------------
A0A7C2VEF7      ------------------------------------------------------------
A0A0S8H0S8      ------------------------------------------------------------
A0A7C2ZTD2      ------------------------------------------------------------
A0A2E3Z6T8      ------------------------------------------------------------
A0A257WQ92      ------------------------------------------------------------
A0A7C1U6X6      ------------------------------------------------------------
A0A7C7UXI5      ------------------------------------------------------------
A0A7C3SFJ0      ------------------------------------------------------------
A0A7C7WWF7      ------------------------------------------------------------
A0A356ETW1      ------------------------------------------------------------
A0A3L7NJY1      ------------------------------------------------------------
A0A523CME0      ------------------------------------------------------------
A0A354PCV3      ------------------------------------------------------------
A0A354PHB4      ------------------------------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A538RV31      ------------------------------------------------------------
                                                                            

M5S2L2          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A7C2VXA0      ------------------------------------------------------------
A0A7C3AA48      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A7C5PFV3      ------------------------------------------------------------
A0A7C3QGD2      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A7C2ZUK5      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
A0A7C2JY73      ------------------------------------------------------------
A0A356AE44      ------------------------------------------------------------
A0A1G2XSU7      ------------------------------------------------------------
A0A350KD81      ------------------------------------------------------------
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      ------------------------------------------------------------
A0A524HC32      ------------------------------------------------------------
A0A177PV03      ------------------------------------------------------------
A0A1G2YIM0      ----------------------MNDIEKISAGRIISTELAGYGTMASNASNSEG------
A0A7D8YCU5      ----------MPFVARFIQSATNKMQNPVQRASADSQGQPGTQTMSQPRQPAGG------
A0A353BE27      -------------------------MSDVVLDQRNVNGQPSPVPGGAPEAQSEGS-----
A0A5C6BPW1      QSNQEPNHYRNGNAGVPAYTNGGGGGGGALVPVGNGMDPSPAPMAGNEGAGQV-------
A0A1I3GSP0      ----------------------MTAPQKQPNAAAEFDFAPFGFHKATAGRSID-------
A0A517QJV1      ----------------------------------------MSGNSASSRASID-------
A0A3C1QS25      DISTGIHHGSTPGDGPLFPRFGWSTFVAQMPVEGRPAWAEMGPPMGTEPESQ--------
A0A5C6FX55      LSPPSERTPSCGGILYYFNEIRMSTNELSNRPYSNSPAMMQAPIAMMDRDGADGGKNE--
A0A5C6DS51      ----------------------------------------MPSNSSEQNVGHQS------
A0A5C6DSL6      ----------------------------------------MRPQSSEQAVGNQS------
A0A3M1VG27      RFADGVAGAPAVSTDRITTVQRPGDVATPGAPSPPIELMRRQ------------------
A0A518GC22      -------------------------MSDVAMDQPRTNGQLAIPGAPEAAPQEGS------
A0A3L7Q373      ------------MWWRLPETSDVTQRSQLPVVAPSIDFAPLGFQKSNDGRSID-------
A0A3E0PW54      GESGTAFALTVSRPPVAPSARHSHERTDMPAPQHNVDFAPLGYRQPDEGK----------
A0A7C3TAH2      ---------MSDLEQYIDKVIEPRPAQQALPRPGVPAAYAVPAVHAGTGDQQLE------
A0A1Z8MHR4      ---------------------------MLDMPPSTPVGFDTSGAYGSQNQSPAN------
A0A5C6EHJ0      -----------------------MNQQAKPREVTSREMSDKRPPQQPMPQSALA------
A0A5C6F1H9      -----------------------MNQMQSQDETRSPDLADRRGREMAASPVGGG------
A0A255QXY0      ---------------------------MLPLHSSTSSNDLRSIADGS---QDEH------
A0A517SYI0      ------------------------------MPPSTPVGFDTSGAYGSQNQSPAN------
A0A518HX54      ---------------------------MLEPSPPHVHADTFHARQPD-DIGRLQ------
A0A5B9MF59      ---------------------------MLDQTTTQPGNYEASVSLGP-SQEHHH------
A0A2A2WC24      -----------------------MYSSMLDQTSPQPVNYDSSVTLDP-AQEQHH------
A0A518KYW8      ---------------------------MLDQTSPQPVNYDSSVTLDP-AQEQHH------
A0A5C5YZZ0      ------------------------------MQPAPPSSTNRSGSELMNNMQSAS------
A0A518JLD2      ------------------------------------------------------------
A0A5M6DJ15      MEFINGNGSGDGDDRGLLTEPRSLRTSRPRVNGSSPVMPPPVVQGTIDDDEPQF------
A0A3L7P7S7      --------------------------------------------MSQEGGRLPE------
A0A517N8M1      EPRFSDSRLSDPSTAFGSSAQPE----------------------------QQ-------
A0A5C6CW01      GLAYSQAPAITGADRSMSDTS------------------------------AD-------
A0A5C6BXS9      ESDRST-------------------------AVGSYPTHAPAWEGGK----HE-------
M5U569          QSDRSGSYQTLGSPATGVGMPEGPSG-------------------------DS-------
L7CND7          --------------------------------------MNEGWRSGGSAEPAD-------
A0A0J1B8S4      NSNSTDPTAGKRGPNSFASYPSQNAGTMGLAATGSYPAMNEGWGSADQG---D-------
F2ARR3          SSDSRSQGASTRGKEAFASYPSPNPGAMGLAAQGSYPAMNTGWQPTHQAA-NE-------
K5D8H6          SSDSRSQGASTRGKEAFASYPSPNPGAMGLAAQGSYPAMNTGWQPTHQAT-NE-------
M2AKU0          SSDSRSQGASTRGKEAFASYPSPNPGAMGLAAQGSYPAMNTGWQPTHQAT-NE-------
A0A5B1CKI2      -------------------------MQATAPPSPQLAQKLDPF--STAPGTNAQ------
A0A5C6EG84      -------------------------MKVQQLTEPRFSDPSGAF--AAPSEAEDK------
A0A5C6F2X4      -------------------------MKAQQLTEPRFSDPNQGL--TASAQTENQ------
A0A5C5XTV6      ------------------MQVIPESESDRPTPVGAYPAPAPSWQGGKP-----E------
A0A5C6AAB1      ------------------MQANPDSDFERPVVMGAYPAQNPGWQGDSAAAAGGD------
M5T8W8          --------------------------------------------MSTPDGPSVD------
M5SF00          ---------------------------MGQAAMGSYPAMNEGW-GSSGSSQTAE------
A0A2G1WDS1      NSNSTDSTAGKRGPNSFVSYPSQNAGTMGQAAMGSYPAMNEGW-GSSGSAQTAE------
Q7UVS9          NSNSTEPSAGKRGPNSFASYPSQNAGTMGQAAMGSYPAMNEGW-GSSGSAQTAE------
A0A5C6B601      --------------------------------MLEQDIHQINDAAAGEDLPGLS------
A0A517PFU1      --------------------MPSFAASGSSFPGEDPQAEGYGRGGDGPNAPRSHAVTGYD
A0A5B9M8J9      -----------------------------MLDHSTPHLHSHAGRLMDQDVELPQ------
A0A2A2WFP6      -----------------------------MLEQLPPHVHSDTGHAMERDGGRLQ------
A0A518L8N2      ---------------------------------------------MERDGGRLQ------
A0A518HQN9      -----------------------------MLDQASPHSAIQDANGSADLLPEHH------
A0A5M6D8H8      -----------------------------MLDQTSPSQQTHEISGAIDSVQDVQ------
A0A5B1CRW9      ------------------------------------------MTKPSKTISMVT------
A0A5C6EI46      ------------------------------------------MADANKSMGLSP------
A0A1G2ZG92      ----------------------------------------------------ME------
A0A1G3A0W0      TDPIVQERDYSNGPGKESRSSEIVLSAEEIINPPHVTPWPNRLMRAGGSGPSVP------
A0A2E7D3V4      -----------------------------MDNSENRPVERPFEFAVLSENSDKP------
A0A5B9PER9      ---------------------MEPNNNQIGQYQNPNQMGSPMGMPPVMMAQDDD------
A0A517QSM4      -------------METQLTSDSSSSLTSVNPVHEVAQPRATSVGPHPNQGNEAI------
A0A355GJI7      ------------------------------------------------------------
A0A1Z8MCI4      -----------------------------------------MDDLDKIETSQAI------
A0A517SYL7      -----------------------------------------MDDLDKIETSQAI------
A0A3L7P0L2      ----------------------------MNKRSSLPVAEPDVDFAPLGYHKSQE------
A0A6M5YVJ1      ------------------------------------------------------------
A0A2E0SHG0      --------------------------------------MPTAPLPETLSSQSPL------
A0A518CQB8      --------------------------------------MPTTPPPEQQTSQSPL------
A0A517SCC8      -----------------------MNEVEPVNMPQNARSSESVEFAPLGVVSGNK------
A0A3A0DR44      -----------MSSPHVSESALIAQTAGPPALLRPPPIQFGGPPKPAPQTGAGI------
A0A358MY60      ----------------MDKVKSIIDQQAV--PALPRSGAGQPMPQPAADSVNFD------
A0A517MNB1      ----------------MDNRITPSNEYRVDRSAAPRGPVERRVEPPAAKGQEFD------
A0A142YJ13      GPNALHAEELPTVLPRREEAVAHGEMMIPVDRIAQRSVAVPSNLEPAPGTTDAP------
A0A517Z7D3      ------------------------------MSTQTPTHESDIEFAPLGHASSSP------
A0A1N6KY57      -------------MMLNSNPGSRPDSVNLPATIPPHRKDSFADSSAVMGSSTSL------
L0DK20          -------------MMSNSNFGPQPNSANLPAVVPPHRAEVFSVSSPPAGPVAGL------
A0A3L7UX05      IGPKIPMNNHQNEAMNQSLSPQLPVHQQGYGQGAALWNAHQHDSHEPENQSKGM------
A0A517XRC2      --MARSNNGENPPTGPLQPYNNPPGGM--LAPGGGP--YGPSVTIPGGTGKTPP------
A0A6M5YH47      --MARPIAGDPPAGSPPAPFPTGSGGLPPVQAGASPFNYTNQPSLPGSAVQTTP------
A0A660UUK3      --------------------------MADLERYENRMVQQEVVQFDGPPDGHEG------
A0A517ZHG5      QSNQEPNHYRNGNAGVPAYTNGGGGGGGGALVPVGNGMEPSPASMGGNEGAGQV------
A0A1Z8MPL5      ------------------------------------------------------------
A0A7C1EH96      ------------------------------------------------------------
A0A5C1AGE3      PEGDQQGNAALAQYSAPTYSIP--GG-AYSAAPSPV------SLPSPVGNRNVP------
A0A2Z3HEL7      IAGD-------PPASPPPAPFPTPGGVPAPVAPSPFSYTNQPSLPGPT-VSSAP------
A0A142XAP8      IAGD-------PPMMQPPYQVPQSGG-PVPVALSPFNYTNQPNIPGPA-VAATP------
A0A6P2DEK1      IAGD-------SPMIQPPYQAPQSGV-PVPVVTSPFNYTNQPNIPGPV-VVGTP------
A0A5C6C1R5      MDNHHLNGTGVPAVLEPSRGQRSSSSGQSISYADNSSGWSESPRAEVESQENFD------
A6BZU4          --------------------------MNTDFQPLDQQSDFAIDGMEENAEVNSS------
A0A2D5GZ77      --------------------------MNTDFQPLDQQSDFGIDGMEENAEVNSS------
A0A3D3R1Z6      --------------------------MNTDFQPLDQQSDFGIDGMEENAEVNSS------
A0A517XG00      --------------------------MNTDFQPLDQQSDFGIDGMEENAEVNSS------
A0A1G2YRE4      --------------------------MNNLEKYADRLLEQKLVNTGTPPEFNGQ------
A0A353Z859      ----------------MSTDQMNGQGAMVPVRRNEVGMPGPAVGGAPANSGIVV------
A0A2D6ST10      ---MDHTTRTSDTSAPAAGNETNGANDNGTLSVPAPLVLPLSVVNAADGEEATV------
A0A177QX42      ---------------------MFHLEIRVSTTTTDWQAP---NNPALEEQPNEK------
A0A517SHR0      ----------------------------MSTTTTDWQAPTPITPSATEEQPTDK------
A0A2E0AW64      -------------------------------MNLSTSQPPPLNSSTESESAAQL------
A0A351FZ59      -------------------------------MNLSTSQPPPLNSSTESESAAQL------
A0A660V239      --------------------------MDELQRYQPQPLGQEVVQFEGPVEDQSD------
A0A177Q3B7      -----------------------------------------MSGPDSGRATAPS------
A0A2E0X6Y6      ----------------------------------MNSELDSNLAQEGPASSEIV------
A0A518GFD7      -------------------MVTDRVNGTNGQRTNAQQQIVVARPVKGGPEPSGP------
A0A5C5VZJ8      -------------MSESEVHDTTQPVRALAKAGPIGPAGALAAPLIIDADAGAA------
A0A518GE37      --------------------------------------MQNPATAKNASPPAFD------
A0A5C6F3H8      ----MTTSRKKNAKPTHSKPTHSKLSGTVPSAAPRSSSKARAHAPVDSESSSFD------
A0A5C5X072      ------------------MTQHLNHQGSRTSIVGPPRAKAAANSPSNDAAKAFD------
A0A5C5WUQ3      ---------------------------MNTNYISSERATETSYRPSARPENQFD------
A0A5C6E697      ---------------MNDTQQLTKTSPHAREETTKAVPSRTVSTPPKDAAAAFD------
A0A5C5Z1A3      ---------------------------------------MTASN--SGASTQFD------
A0A5C6D2P7      --------------MNDHKATSGHAGRIAPPPLPTAVPSKSIAA--TSSAGQFD------
A0A5B9ML17      ------------------------------MNQSVVVSAPIARNQPKTEAKAFD------
A0A518HFS8      ----------------------------------MPALLRA-------------------
A0A5Q3LBQ3      ----------------------------MATKAILPAIRQAPALPAETNPAQPI------
A0A517LX75      -----------------------------------------MNESETHRIAEQD------
A0A7C5W7B3      ------------MSRQPPAPPFDMGNILRAQRKLLLGGGQHVSPQPHAEPPERS------
A0A2S8F9B8      ------------------MTNGNLVIPSDRDRHASKADVPGAVIGMRPPEENGM------
A0A354GX32      ------------MMPHDPNAMKTKTASPAGPITPAAASTEQAAPAPPGLSAPPG------
A0A142XL75      -----------------------------------------------------M------
A0A6P2D5D5      -----------------------------------MTQISGNGQAPPEKRATTL------
A0A5C1AAF0      -----------MALNEQLTPVAKSVDVVVHRAELIGGTGAGSAPAVGAPGLALT------
A0A7C7T8W8      ------------------MHSQNGTHVNDTSGTPHNGMPVNTLPAPQSVFRGLS------
A0A5C6B3S0      ------------------MSTDPLPNGQSQMIVLPHDLDWGDDQDAGNRDSSGG------
A0A368KP63      ------------------MSNGNLVIPSDNNRQAASVNVPGRVVDVRSSDEDSN------
A0A518GIZ9      ----------------------------------MRQTPQDSELASSFETEGEG------
A0A1C3EBY9      ----------------------------------MRQTPQDSELASSFETEGEG------
D5SX64          ----------------------------------MRQTPQDSELASSFETEGEG------
A0A517Z0U7      --MDRNGDPQYVPEPGTPGNGHMVEPPVPAHAPPQPVQVMGGNPAGEEQQEGGI------
A0A2S8FCC0      ------MSTDQTSLPVERTNREIRFDSPIDLTPGSSNEFPHINDVVEMDDTGGT------
A0A1Z8MBT6      ------------MPSERFWTPLQIVLMTTESTSNIASRQSSHSNASTGEGAPID------
A0A517SXN9      ------------MPSERFWTPLQIVLMTTESTSNIASRQSSHSNASTGEGASID------
A0A518HFL0      -----------MDTADSPRPGHELARLTELPPALRVPPPPASRTSSPGGGLPIN------
A0A3B8ZJM2      ------------------------------------------------------------
A0A1U7CLW1      SFINGIPTVLSQEQGASAPTPVELLPVDRIVPGYGASLKAVEPPPGLSEMPDLD------
A0A142WPR7      --------------------------------------MGIRGDFEDELSEKSD------
A0A3M1TFJ0      -----------------------------------MDSRESQLGRLEDEDELHE------
A0A517P477      --------------------------------MAAARTPRPPVSQPVADEHFQI------
A0A517T4K9      ----------------------------MLPALPAGQVPAITTAMMPAESRPID------
A0A7C6B2Q1      -------MSQHERLPEPSSGVPVGLPPSLSAGQSGPLYVDAEWHPLAGGQGTNE------
A0A7C4QPD3      TGDNDNTSASVNGALRVVPEGTASRGAAKVRAKAAPSLSARAFRAPEGDPQGYL------
A0A2Z3GZZ5      --------------------------------MADTDKNTAAPPDDDEPASGLN------
A0A4V0I6L6      -----------------------MATLNPLLDPASQSSASIILPPVAAEPPAEQ------
A0A7C4QQT3      -------------------------------MTRELEFHPGRLPSHVHPDEEAD------
A0A255QXF5      -------------------------MQQHTPRQHQGAPYHFNGPSSGPDSGGFD------
A0A518KBI5      --------MSDHTKTDETQLPIRRVD-NGIVKHDAYHRHPRPVNNSGPAPSHFT------
A0A5C5V6Q5      --------MSKHEHPTEPNFMLQRVDQSGSPQPIATQSNSRHWSAPQNAPQQFT------
A0A517MY49      MNIDQDPAHREDNDSTSTSELLKTFM----------------------------------
A0A2E6AG00      -MTRQSTSSVSNLLPTTGSHVLHNAM----------------------------------
A0A1G3A880      --------------------MVYAVL----------------------------------
A0A2E8ATT1      -MSRDSHYNEQN----STSEAVRAVL----------------------------------
A0A7C2JZW2      MGGDSVLSPSEVAARSPMSTGMSAADAPQAKANGRPSASSQAATRPREAHTGPH------
A0A518KYQ0      ------MDHQSNQLQPYHAG------------------PVVRVPASSEPTNSFD------
A0A5B9QX47      ------MTTHAPPKGIP---------------------GYSAGSPGAAPPFQFD------
M5T666          ------------------------------------------------------------
M5U6N6          ------------------------------------------------------------
A0A517M0G2      ------MQKTPTSSPQAASQFRNHARP-----------PVRAAHGAPSGSTDLD------
A0A5C6AST1      ------MNPG-SGP---RSNGVRTYE------------GLRRPDEKPNSGYEFD------
A0A5C6C951      ------MSPHPNGPDSRRQNSSGRAK------------VKRSAHGNDKSNIEFD------
A0A5C6C5T3      ------MSHNHNNLGGHASVPGTQG-------------RTLPAPSGDAAAKAFD------
A0A2A2W6A9      ------MDHQSNQLQPYHTG------------------PVGRMPVSNEPPNAFD------
A0A518HQS9      ------MDHQSNQLQPYHNG------------------PVVRMSASSESPNAFD------
A0A5M6DFE6      --------MVAQNSTGTHSMTLHTNQPGHGHPGHGPGHHRPGHPGHGHSSNAFD------
A0A5C6F286      ------MATSRKKTTTPNRNPETGADRDQARPRRKGPVMTGPPSRAATDETSFD------
A0A517NGN1      --------------MHPSRS------------------ASSASIGDAASGASFD------
M5RUI3          ------MQSNANRVNGNDRP------------------IGRLSGPSAGANSQFD------
A0A660VT66      ------------------------------------------------------------
A0A7C2VEF7      ------------------------------------------------------------
A0A0S8H0S8      ------------------------------------------------------------
A0A7C2ZTD2      ------------------------------------------------------------
A0A2E3Z6T8      ------------------------------------------------------------
A0A257WQ92      ------------------------------------------------------------
A0A7C1U6X6      ------------------------------------------------------------
A0A7C7UXI5      ------------------------------------------------------------
A0A7C3SFJ0      ------------------------------------------------------------
A0A7C7WWF7      ------------------------------------------------------------
A0A356ETW1      ------------------------------------------------------------
A0A3L7NJY1      ------------------------------------------------------------
A0A523CME0      ------------------------------------------------------------
A0A354PCV3      ------------------------------------------------------------
A0A354PHB4      ------------------------------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A538RV31      ------------------------------------------------------------
                                                                            

M5S2L2          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A7C2VXA0      ------------------------------------------------------------
A0A7C3AA48      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A7C5PFV3      ------------------------------------------------------------
A0A7C3QGD2      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A7C2ZUK5      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
A0A7C2JY73      ------------------------------------------------------------
A0A356AE44      ------------------------------------------------------------
A0A1G2XSU7      ------------------------------------------------------------
A0A350KD81      ------------------------------------------------------------
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      ---------------------------------------------------MDYKDSPE-
A0A524HC32      -----------------------------------------------------MPGDKD-
A0A177PV03      ---------------------------------------MVLGDAASALAT--KGLSSL-
A0A1G2YIM0      ------------------ASMNLWPAICRHW-RALLVTFMIAAGMGTPLIW--FAVKPM-
A0A7D8YCU5      ------------------DSKFLGILWRWKK-LFVFCILC--GLGGGYFHF--TRQPES-
A0A353BE27      ------------------NFDFVQILWRWKW-LPILGSIV--GACLGFLYF--SRLPET-
A0A5C6BPW1      ------------------DPKALLNAFRRRW-FLAVTVGLFCGGSAAAAVY--LLVPPN-
A0A1I3GSP0      ------------------IVSFVLSLWK----PMAIGLFL--GLLVGVGLY--LMMGPV-
A0A517QJV1      ------------------IGRFLLSIWK----PLILGGCL--GGMAGIGMY--LFLGPI-
A0A3C1QS25      ------------------RFDFLAMAWRRKW-LIAFGLMV--GLGLGFLAY--KQQTPI-
A0A5C6FX55      ------------------MPNIGAAMWRYRW-AVALPTML--GMVAGFLLF--LRTNET-
A0A5C6DS51      ------------------VELDIIGLIRRRWYHLVLGTVF--GVGVGLLYF--YATTPM-
A0A5C6DSL6      ------------------IELDFIGLFRRRWHHLLIGICV--GIAIGLLYF--YSTTPM-
A0A3M1VG27      ------------------QFDPLEIGLRYRV-WIGLAILA--GLLLGGLAY--WKFGPT-
A0A518GC22      ------------------SFDIVQILWRWKW-LPILGSIV--GACLGFLYF--SRQPAT-
A0A3L7Q373      ------------------IVRFAMSIWK----SLAIGLMA--GCGLGVLAY--LYSGPT-
A0A3E0PW54      ------------------SIDILKFTMSIRN-MLIAGLAV--GLLVGVGVY--MCLGPA-
A0A7C3TAH2      ------------------QPNVLKGILR-RWYIALGVFILLAGLGIPAIWL--LVEPK--
A0A1Z8MHR4      ------------------GESVLTILWRYKW-LIGMLLLA--GLIIGYWNY--KRTPTT-
A0A5C6EHJ0      ------------------SIDFAKIAWNSKY-LLILGMLL--GLGCGYFYF--SRTPAT-
A0A5C6F1H9      ------------------HLDYAKVAWNARY-LLALGTLI--GLAVGYFHF--TRQPAM-
A0A255QXY0      ------------------GQAVLSILWRFRY-LVAICVVI--GVGVGHWYH--RQKPAQ-
A0A517SYI0      ------------------GESVLTILWRYKW-LIGMLLLA--GLIIGYWNY--KRTPTT-
A0A518HX54      ------------------GEPIGTVLWRYKW-LIGVLLPI--GTLLGYWVN--RQKPMT-
A0A5B9MF59      ------------------GETILTVLWRFKW-LLTAFVAV--GTSVGYWMY--KQKPTT-
A0A2A2WC24      ------------------GETILTVLWRFKW-LLAAFVAI--GTSIGYWMY--KQKPTT-
A0A518KYW8      ------------------GETILTVLWRFKW-LLAAFVAI--GTSIGYWMY--KQKPTT-
A0A5C5YZZ0      ------------------DVSVGGVLWRRKG-LILFLILC--GLGGGYWFF--TQQEET-
A0A518JLD2      -----------------MQIDWVKLIWGGRW-LLLLGLLV--GLGAGYFHF--KTLPPE-
A0A5M6DJ15      ------------------DPAVIRHSVRRRWPLALIFGLMLAPLLAGAAWI--ALKPKD-
A0A3L7P7S7      ------------------DAMNIFRMLQQRMGLIAVLAVL--GLVAGGLFT--LRMLPA-
A0A517N8M1      ------------------AINVAAAVWRYRW-AVAIPVLI--GAVCGLMIY--LQLPET-
A0A5C6CW01      ------------------STNLLASLWRYRW-AVILPAIV--GATAGFLLY--LKTPET-
A0A5C6BXS9      ------------------TTDMLAAVWRYRW-AVLIPAVL--GLVGGLLMY--LKTPET-
M5U569          ------------------GPDMLAAIWRYRW-AVIIPAIL--GAAGGFIAF--LKTPET-
L7CND7          ------------------AGDLMGAIWRYRW-AAFVPAIL--GAVIGFLVF--VKTPET-
A0A0J1B8S4      ------------------ASDLLGAIWRYRW-AAMGPTIL--GAMIGFLVF--IKTPET-
F2ARR3          ------------------TADIAAAIWRYRW-AVLIPTIL--GLVAGFLAF--VKTPET-
K5D8H6          ------------------TADIAAAIWRYRW-AVLIPTIL--GLVAGFLVF--VKTPET-
M2AKU0          ------------------TADIAAAIWRYRW-AVLIPTIL--GLVAGFLVF--VKTPET-
A0A5B1CKI2      ------------------PVNVAEVLWRYRW-AVALPVVV--GAVVGLLIY--LQLPET-
A0A5C6EG84      ------------------AVNIADAVWRYRW-AVAIPVVV--GAVCGLLIY--LQLPET-
A0A5C6F2X4      ------------------AVNIADAVWRYRW-AVALPVIV--GAVCGLLIY--LQLPET-
A0A5C5XTV6      ------------------TTDMLSAIWRYRW-AVLIPTVI--GFVCGLLLY--LKTPET-
A0A5C6AAB1      ------------------SADLVAAIWRYRW-AVIVPGIL--GLLFGFLFY--IKTPET-
M5T8W8          ------------------SADMVASIWRYRW-AVIIPAIL--GAAGGFIAF--LKTPET-
M5SF00          ------------------SADLMGAIWRYRW-AALVPTIL--GAVIGFLVF--VKTPET-
A0A2G1WDS1      ------------------SADLMGAIWRYRW-AALVPTIL--GAVIGFLVF--VKTPET-
Q7UVS9          ------------------SADLMGAIWRYRW-AALVPTIL--GAVIGFLVF--VKTPES-
A0A5C6B601      ------------------GESMLTVLWRFKW-LLVIFTAV--GLGVGYWVY--QRKPTT-
A0A517PFU1      ANGGWGAQSAGGDAATEEGFQLGRLLRRRWW-VLLLGLAS--GLGGGYLYD--LYQPPV-
A0A5B9M8J9      ------------------GETIATVLWRYKW-LIGILLPL--GTLLGYWVN--CQKPTT-
A0A2A2WFP6      ------------------GEAIGTVLWRYKW-LIGILLPI--GTLLGYWVN--RHKPVT-
A0A518L8N2      ------------------GEAIGTVLWRYKW-LIAILLPI--GTLLGYWVN--RQKTVT-
A0A518HQN9      ------------------GESILAVFWRFKP-LILVLVII--GTGVGYWRY--HEKPTT-
A0A5M6D8H8      ------------------GESILTVLWRFKW-LLGVFLAA--GTGVGYWIY--KQKPTT-
A0A5B1CRW9      ------------------GEIDPIGMIRRRWRLLTFGAVM--GVLLSGLYF--QTAKKS-
A0A5C6EI46      ------------------NELDISGMIRRRWRLLVFGMVV--GVGLSILYF--KTAPRV-
A0A1G2ZG92      ------------------FLKIWEILSRRKW-IFISAFLGFFGIVVIGTIL----ITPT-
A0A1G3A0W0      ------------------LANDILGSFLRFK-WTVLFVFLLVSAPAIAIIW--MQIVPK-
A0A2E7D3V4      ------------------KVEFDVVQIALRH-KKIISIGVICGLVIGHLAY--KQAGPE-
A0A5B9PER9      ------------------EAAFDFWGVLNRR-KWLVFLGLVTGLALGALVY--AKSETI-
A0A517QSM4      ------------------DTRALLNSVRRNW-FVATLLGLIFGTGAAVATW---VYVPAP
A0A355GJI7      ------------------------------------------------------------
A0A1Z8MCI4      ------------------GLGLILQTARRHL-LWVLPTGFVLCALVFLLLH--DWKVDR-
A0A517SYL7      ------------------GLGLILQTARRHL-LWVLPTGFVLCTLVFLLLH--DWKVDR-
A0A3L7P0L2      ------------------GRSIDIVRFAISM-WKYLIAGLVLGCGMGGLAY--LYMGPV-
A0A6M5YVJ1      --------------------------------------MFLLALAAGAAAWCLLALPKTS
A0A2E0SHG0      ------------------HGILDVLSILRRR-IGIILFFVVVGVALGTLGI--LQLKEK-
A0A518CQB8      ------------------QGVLDVLSIIRRR-KGIILFGIIVGAALGTLAI--LKLPEK-
A0A517SCC8      ------------------GRSIDIARFALSL-WKPMVLGLVAGCLMGLGAY--SYLGPT-
A0A3A0DR44      ------------------TIGFVYRSFQHWW-RVAIPAGLVCALLAGAAVW--LTWTPK-
A0A358MY60      ------------------PRVLVS-TWRHCW-FWATPLGVALGCAAAFTVY--ASFVPM-
A0A517MNB1      ------------------PRLIWV-TFRRCW-LWAVPLGLALASVAAYAVF--ATFVPM-
A0A142YJ13      ------------------DLIGLLRALRRRW-RLAFLGGLSCASLAAAAAF--YYLPSPK
A0A517Z7D3      ------------------GKSIDIINFTLSI-WKPLALGIVAGGILGVLMY--LRMGPV-
A0A1N6KY57      ------------------DPFMLLKALRRRW-AMALGIGLVGAGVIGFTTY--LLVPAAK
L0DK20          ------------------DPVAMLKALRRRW-PLALGAGLLGGAVLAFATY--FLVPPAK
A0A3L7UX05      ------------------NLATVWRSIRRYW-WQAGLLWVISSGVLMFLAF--TSVKPT-
A0A517XRC2      ------------------TPLGLLNALRRRW-VLATFLGLLVGSALGTGVW--FILPGGK
A0A6M5YH47      ------------------TAMGLFNAFRRRW-VLSTFIGGLVAAAVAVGAW--VALPGGK
A0A660UUK3      ------------------SVTELIVPILRRW-YVIMATFIVVCGIGVPAIW--FGMEQK-
A0A517ZHG5      ------------------DPKALLNAFRRRW-FLAVTVGLFCGGSAAAAVY--LLVPPN-
A0A1Z8MPL5      ------------------------------M-LFAIPAGLGT-----------WFLVPVN
A0A7C1EH96      -------------------------------------------------------FMPDK
A0A5C1AGE3      ------------------TFMGLLNALKRRW-VLASFLGLLVAAAAAVALW--IAAPQGK
A0A2Z3HEL7      ------------------TPSGLWNAFRRRW-VLSTFVGALVAAAVAVGAW--LAMPAGK
A0A142XAP8      ------------------TPLGLLNAFRRRW-VLGTFIGGLVAVAVAVGIW--LALPTGK
A0A6P2DEK1      ------------------TPLGLLNAFRRRW-VLSTFIGGLVAVAVAVGIW--LALPAGK
A0A5C6C1R5      ------------------PLSVFH-SLRRHW-PVALLTGLLLAPPMAVVGW--FLLAPK-
A6BZU4          ------------------GPGVDIVRLLLRN-KYLLVLGLATGLLLGQAAY--MKLGPI-
A0A2D5GZ77      ------------------GPGVDIVRLLLRN-KYLLVLGLATGLLLGQAAY--MKLGPI-
A0A3D3R1Z6      ------------------GPGVDIVRLLLRN-KYLLVLGLATGLLLGQAAY--MKLGPI-
A0A517XG00      ------------------GPGVDIVRLLLRN-KYLLVLGLATGLLLGQAAY--MKLGPI-
A0A1G2YRE4      ------------------GSPDLIKGILHRW-YILLLGFSIMCAIGLPAIW--LSIKPQ-
A0A353Z859      ------------------DQNTVLAAMRRRW-LIATALGLTGALVGAATTW--LLIPVT-
A0A2D6ST10      ------------------NFHVLWGAFRRRW-LLASVLGLIFGVAAAAAAW--ELLPAP-
A0A177QX42      ------------------GLDFFTAIMGRKF-LVVAFIGIGLGLGHLH-----FTRQPPV
A0A517SHR0      ------------------GLDVFNAIMGRKF-LVVAFIGIGIALGHLY-----YTRQPPV
A0A2E0AW64      ------------------SPMLVLEAARRWW-AIATPVGLLAGLIVAAILY--LQFEPL-
A0A351FZ59      ------------------SPMLVLEAARRWW-AIATPVGLLAGLIVAAILY--LQFEPL-
A0A660V239      ------------------STMNLAAAILRRW-PVLVATFVVVCAVGVPAIW--FLVEKK-
A0A177Q3B7      ------------------PWELLR-AFRRCW-FPATSLGLLVALLAAGAVW--YLLPNR-
A0A2E0X6Y6      ------------------SAAMRFLRLIRRR-QNVLLVALALCSAVGAAVY---IAAPRY
A0A518GFD7      ------------------NLSAALGSLRRWW-WIGLPLGVLLGVAGAVAGW--LAMVPK-
A0A5C5VZJ8      ------------------PSTPVSLAMLWRF-KWTIAGTFMLCAAAGLGLI-WTAIRPA-
A0A518GE37      ------------------PWLLWI-AFRKHW-GWVLPMGFLFASAAGLAVW--SQFVPE-
A0A5C6F3H8      ------------------PWILWV-TFRRCW-PWAVPAGMVLAGVAAMFVL--QGFVPR-
A0A5C5X072      ------------------PWIIWV-TFRRCW-PWAVPVGAALAGIAAFVVM--QGFVPE-
A0A5C5WUQ3      ------------------PWILWV-TFRQCW-PWAVPCGAILSAITAFVVL--QNFTPT-
A0A5C6E697      ------------------PWILWV-TFRRCW-FWALPLGILLGGFSVYYVN--RTFVPT-
A0A5C5Z1A3      ------------------PWILWV-TFRRCW-FWVLPIGAVLAALASFGVL--STFVPT-
A0A5C6D2P7      ------------------PWLIWH-TFRRCW-PWALPIGIILAGAAALAVQ--RTFVPE-
A0A5B9ML17      ------------------PWLLWV-TLRRCW-YWAVPVGLVLACLAAFSVL--ATFEPR-
A0A518HFS8      --------------------------LRLRW-KLAVSGAILLGAAAGAVAF--VAMPPAE
A0A5Q3LBQ3      ------------------TATFVANSLRQWW-WAFVPAALGLALASATAIM--MFFEPV-
A0A517LX75      ------------------SFEIDILRLLRRR-WPLLLFGLLVGVGVAVAYQ--MNARVS-
A0A7C5W7B3      ------------------LWEHMKTILMFRW-PWGLASLVIVFAMTLAFD---SMTPLQ-
A0A2S8F9B8      ------------------QFGQVLHSLRRQW-LAAVVLGLLCAAPIAVGAW--LLQSPT-
A0A354GX32      ------------------ATAVWY-AIRRRW-LTILVLGLGLGSLGAAAAW--YIMPAK-
A0A142XL75      ------------------TGRAILNAVKRRP-FTLLGVALLAAGTGAAVWL--FLPLPK-
A0A6P2D5D5      ------------------SGRAILNAVKRRP-FTLLGVAILAAGVGATVWL--FLPLPK-
A0A5C1AAF0      ------------------PGALLR-ALRRRL-ILALAVGVVLAAVAATAVW-VYLPPPK-
A0A7C7T8W8      ------------------PAIVVH-TVKRSL-WWTLPVGVLLSIAAGAAVW--YGVPYR-
A0A5C6B3S0      ------------------GLTSVLHAFRRRW-LLATALGICGGLMASFTAW--RLTAPT-
A0A368KP63      ------------------RMGQVVHSLRRQW-LASVVLGVLLAVPIGVGVW--LLQAPK-
A0A518GIZ9      ------------------GLSIDWMNLVFRY-RWWLCAGVVLGLGLGIAAY--MKLGPE-
A0A1C3EBY9      ------------------GLSIDWMNLVFRY-RWWLCAGVVLGLGLGIAAY--IKLGPE-
D5SX64          ------------------GLSIDWMNLVFRY-RWWLCAGVVLGLGLGIAAY--IKLGPE-
A0A517Z0U7      ------------------QISAVLAAFRRRW-FTAISLGLVLGAAAAATVW--YVTPVT-
A0A2S8FCC0      ------------------GISHVFHAVRRRW-LPAFSIGVLLAAVAATSVW--LLDVPE-
A0A1Z8MBT6      ------------------PWIIWV-TFRRCW-VWAVPIGLVIGTIGAVMVL--KSFQPE-
A0A517SXN9      ------------------PWIIWV-TFRRCW-VWAVPIGLVIGTIGAVMVL--KSFQPE-
A0A518HFL0      ------------------PRLVLR-GLARHW-WQALALWVVGTAALATLVY--LRYEPT-
A0A3B8ZJM2      ------------------------------------------------------------
A0A1U7CLW1      ------------------GLLR---ALRRRW-LFALLGGLLCSSLSAAAVY-LYLPPPK-
A0A142WPR7      ------------------ERTVNFLALTWRY-LWLLILFGGVGTGAAYLHF--LKQPPI-
A0A3M1TFJ0      ------------------DLWVYLQTLRRQL-PLVLVVA---GACTLLATLRTLRLPAV-
A0A517P477      ------------------DWRPAVAGLKRFW-YVAVLVGLPLGAGGAYAAW--IYIPAP-
A0A517T4K9      ------------------HRGLWS-AFRRRW-LWATLGGGIVGLCAAAVVY--FMMETP-
A0A7C6B2Q1      ------------------GLTAYLHAFRRRW-FPAVFLGIVLAAAAAVAVW--FLYIPQ-
A0A7C4QPD3      ------------------SLLSVLHALRLRW-PWVIVLGLPLAAALAVAAY--VTVPAP-
A0A2Z3GZZ5      ------------------PLHLVM----RRW-QF-LAVGLIIGGVLGALIY--STSAPQ-
A0A4V0I6L6      ------------------PNVLF--AVLRRW-PWLV-LGLAVGCVLGLLFH--MQRTPV-
A0A7C4QQT3      ------------------RKPINYAELAFRY-RFWLAAGAVAGLLLGELAY--LKLGPE-
A0A255QXF5      ------------------PWLIWV-TFRRCW-HWAVPAGLVLGSIAAFGVL--STFEPQ-
A0A518KBI5      ------------------PKFLLW-VFSRSW-KVVVPVGVLLAAATAAVLL--YTYVPQ-
A0A5C5V6Q5      ------------------PKFLVW-VFLRHW-KLVVPSGLVLAAAAVSALL--WTYQPD-
A0A517MY49      -------------------RFARILRLRQKT-VLATLVLSCLLGGCYYTFA--TRYFQS-
A0A2E6AG00      -------------------WLVRSVRYRKHY-LIGALVASGLVGAVYFFTA--DRIYEA-
A0A1G3A880      -------------------YFLRVVRYRRSV-MVTALLITGLLGGLYFTTA--TRYYEA-
A0A2E8ATT1      -------------------RFLRVIRYRKSY-LIVALTTAVLLGSVYYFTA--ARIYEA-
A0A7C2JZW2      ------------------PWVCALHAMRLQW-PWIVFLGIPLSAVLAYTAW--TTVPTP-
A0A518KYQ0      ------------------PWLLWI-TLRRCW-FWAIPIGIVLATVAAFLVL--QTFVPM-
A0A5B9QX47      ------------------PWLIWV-TFRRCW-MWALPCGLVLAGIAAYVVQ--RDFVPR-
M5T666          ------------------------------------------------------------
M5U6N6          --------------------------------------------------M--LGFVPR-
A0A517M0G2      ------------------PKLLWV-TIRHCW-IWATPIGLALAAAAAFAVF--SGFVPV-
A0A5C6AST1      ------------------PRLIWV-TIRRCW-LWATPIGLALAALAAYGVY--ATFVPI-
A0A5C6C951      ------------------PKLLWV-TVRRCW-LWATPIGLSLAAAAAFIVY--SRFVPI-
A0A5C6C5T3      ------------------PWILWV-TFRRCW-PWAIPLGAALAGIAAFVVI--RGFVPR-
A0A2A2W6A9      ------------------PWLLWI-TLRRCW-YWAFPVGIVLGVIAAFVVL--QSFVPR-
A0A518HQS9      ------------------PWLLWI-TLRRCW-YWAIPVGVVLAVIAAFAVL--QSFVPQ-
A0A5M6DFE6      ------------------PWLIWV-TLRRTW-YWAVPVGLVLASVAAFAVL--KQFVPR-
A0A5C6F286      ------------------PWIIWV-TFRRCW-AWAIPAGAVLAGLTAMAVL--RGFVPR-
A0A517NGN1      ------------------PWMLWV-TVRRCW-FWAVPIGLVLASLAGFVVL--KTFVPR-
M5RUI3          ------------------PWILWV-TFRRNW-LWAVPVGMVLASLAAFGVF--KSFVPV-
A0A660VT66      -------------------------------------------VCRSLRER--GKLSPD-
A0A7C2VEF7      ------------------------------------------------------------
A0A0S8H0S8      --------------------------------VLQAALERCGGAGLKILQG--RP-NPV-
A0A7C2ZTD2      ---------------------------------------------MSFFEN--KAINPA-
A0A2E3Z6T8      ------------------------------------------------------------
A0A257WQ92      ------------------------------------------------------------
A0A7C1U6X6      ------------------------------------------------------------
A0A7C7UXI5      ------------------------------------------------------------
A0A7C3SFJ0      ------------------------------------------------------------
A0A7C7WWF7      ------------------------------------------------------------
A0A356ETW1      ------------------------------------------------------------
A0A3L7NJY1      ------------------------------------------------------------
A0A523CME0      ------------------------------------------------------------
A0A354PCV3      ------------------------------------------------------------
A0A354PHB4      ------------------------------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A538RV31      ------------------------------------------------------------
                                                                            

M5S2L2          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A7C2VXA0      ------------------------------------------------------------
A0A7C3AA48      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A7C5PFV3      ------------------------------------------------------------
A0A7C3QGD2      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A7C2ZUK5      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
A0A7C2JY73      ------------------------------------------------------------
A0A356AE44      ------------------------------------------------------------
A0A1G2XSU7      ------------------------------------------------------------
A0A350KD81      ------------------------------------------------------------
A0A2D6SRY7      FELVGLLR----------------------------------------------------
A0A1G3C300      FNPVKKANIFSI-----------------------------------------KELTRGN
A0A524HC32      ------------------------------------------------------------
A0A177PV03      -----------------------------------------------------EGLSQSE
A0A1G2YIM0      YESAGAIRISPIVPSILFSDRD--------------------------------------
A0A7D8YCU5      FSSSSTISVVQPRTGPG------------------------------------NGSPMEG
A0A353BE27      FEAAARVQV---ISSIPAPVK--------------------------------NPYFSGG
A0A5C6BPW1      YVASSIIYI---DATPGSVLQDN------------------------------SSF----
A0A1I3GSP0      YSATTSVLV---SKKASVPANNG------------------------------EANRYGE
A0A517QJV1      YSANTQVLV---SKKASVPINDG------------------------------EANRFGD
A0A3C1QS25      YTSVAKVMI---TPKNPATV---------------------------------IIPGFEG
A0A5C6FX55      FRATTQIMI---ESNRPAVMDTM------------------------------TGEMVGG
A0A5C6DS51      YESHIEILV---GQRSSEMAS--------------------------------NGTMSNA
A0A5C6DSL6      YESRIEILV---GQRSSEMAN--------------------------------SGTMSNA
A0A3M1VG27      YDAKAQILV---SRKASIHLKSD------------------------------DLRTYGE
A0A518GC22      YEAAALVQV---VSSTPTQTRMD------------------------------FYDPRGS
A0A3L7Q373      YVAETQIMV-----SKKASISDQ------------------------------EARRYGD
A0A3E0PW54      YQADTRIEV---SQKSAIPMDER------------------------------SINFSGE
A0A7C3TAH2      YTVSGYIRV------APAMQDLL------------------------------TGQPDRG
A0A1Z8MHR4      FLSSTQLMF---KSETPLSLDTA------------------------------TGLVQGG
A0A5C6EHJ0      YRSAAQVQI---VESTARNLPVD------------------------------S--LDAG
A0A5C6F1H9      YRSAAQVQI---VESLARNLPVD------------------------------G--LDTG
A0A255QXY0      YQATSKLMF---RSDAPMALDTS------------------------------TGLIRGG
A0A517SYI0      FLSSTQLMF---KSETPLSLDTA------------------------------TGLVQGG
A0A518HX54      YRATTRLMF---KSDTPLTLDTS------------------------------TGMVRGG
A0A5B9MF59      YRATTQLMF---KSDTPISLDSN------------------------------TGIVRGG
A0A2A2WC24      YRATTQLMF---KSDTPISLDSN------------------------------TGIVRGG
A0A518KYW8      YRATTQLMF---KSDTPISLDSN------------------------------TGIVRGG
A0A5C5YZZ0      FRAGATIEVY--SQNVQTNTGSV------------------------------VENLTES
A0A518JLD2      FLSSSDVQIIESTTNKNMAVDGV-------------------------------------
A0A5M6DJ15      MAVAVLKID---SVAAPLIFQT-------------------------------ADQSGGG
A0A3L7P7S7      YAASVDVMV---VKKKGAMASDFRTAMLDDYVAIQVTIIKSDRVLREAAQLLQQGEIAGG
A0A517N8M1      YRSTTRLMI---ESDKSTMLDSM------------------------------TGEIVGG
A0A5C6CW01      FRASTRLIV---ESDRPAILDSM------------------------------TGDVIGG
A0A5C6BXS9      FQSSTRLMF---EANRPAVINTM------------------------------TGDIVGG
M5U569          FKSATRLMF---ESDRPAVLDTM------------------------------TGDVLGG
L7CND7          FQSGTLLMF---ESDRAAVIDTM------------------------------TGDLIGG
A0A0J1B8S4      FQSATLLMF---ESDRPAVIDTM------------------------------TGDRIGG
F2ARR3          YQSATRLMF---ESDRPAVMDTM------------------------------TGDVLGG
K5D8H6          YQSATRLMF---ESDRPAVMDTM------------------------------TGDVVGG
M2AKU0          YQSATRLMF---ESDRPAVMDTM------------------------------TGDVVGG
A0A5B1CKI2      YRSTTRLMI---ESDQAAVLDPI------------------------------NGDMVGG
A0A5C6EG84      YRSTTRLMI---ESDNQAVLESK------------------------------SGDVVGG
A0A5C6F2X4      YRSTTRLMI---ESDNKAMLESM------------------------------SGEVIGG
A0A5C5XTV6      YQSSTRLMF---ESHRPAVIDTM------------------------------TGDIVGG
A0A5C6AAB1      FQASTRLMF---ESDRPVVLDSM------------------------------TGDVMGG
M5T8W8          FKSATRLMF---ESDRPAVLDTM------------------------------TGDVLGG
M5SF00          FQSGTLLMF---ESDRPAVIDTM------------------------------TGDLIGG
A0A2G1WDS1      FQSGTLLMF---ESDRPAVIDTM------------------------------TGDLIGG
Q7UVS9          FQSGTLLMF---ESDRPAVIDTM------------------------------TGDLIGG
A0A5C6B601      YMASSKLMF---RSDKPLILNSQ------------------------------TGVMEGG
A0A517PFU1      YQSVAELTV---SARRTALPGSE------------------------------GG---GG
A0A5B9M8J9      YRATTKLML---KSDTPLTLDTA------------------------------TGVVRGG
A0A2A2WFP6      YRATTRLMF---KTDTPLTLDTS------------------------------TGLVRGG
A0A518L8N2      YRATTRLMF---KTDTPLTLDTS------------------------------TGLVRGG
A0A518HQN9      YRATSQLMF---KSDTPISLDSN------------------------------TGIVRGG
A0A5M6D8H8      YRATTQLMF---KSDTPLTLDAA------------------------------SGSIRGG
A0A5B1CRW9      YQSSVEVLV---GQRSSEMTNRG------------------------------TISDGSA
A0A5C6EI46      YESSIEVLV---GQRSSEMTNRG------------------------------TISSTSG
A0A1G2ZG92      YKAKAKLIIETSDTISSLLSSLGTKGTKI------------------------GGVIPPK
A0A1G3A0W0      YRARAEVRVRPIVPHLVFRTDENGAIPFY------------------------DSFV---
A0A2E7D3V4      YEATVKILV-----------SKKADVMDK------------------------DNLADTK
A0A5B9PER9      YESVASVKI----------EPRNKPSIRN------------------------HRQVEYG
A0A517QSM4      YQAFFEFHI----------NSVESKILFE------------------------TSEAQSN
A0A355GJI7      ------------------------------------------------------------
A0A1Z8MCI4      YQASHWVEI---------------------------------------------APNHVA
A0A517SYL7      YQASHWVEI---------------------------------------------APNHVA
A0A3L7P0L2      YVAGTKI----------------------------------------------TVSKKAT
A0A6M5YVJ1      VAVAFHI------------STQAPALLDA------------------------TSESRID
A0A2E0SHG0      WKSEAQIHI-----------IRRDPNLAT------------------------EAAESTS
A0A518CQB8      WESQAQIHI-----------IRHDPNLAT------------------------EGSENSS
A0A517SCC8      FEANTQVKV---------------------------------------------SQKASL
A0A3A0DR44      YRAYAIIEI----------PDRGGVLLPT------------------------SPDTSPR
A0A358MY60      FKASHML------------EANQDYIVFE------------------------NVLAESS
A0A517MNB1      YQATHLL------------EKNQDYVVFE------------------------GVMPTSA
A0A142YJ13      YTTSSLVHV----------AEKRPREIFE------------------------TRESDVG
A0A517Z7D3      YEANTRILV--------------------------------------------SQRAAVA
A0A1N6KY57      YTARSMLHV----------NSVQPRILLT------------------------TGEVHTE
L0DK20          YTARSMLHV----------SSTQPRILLK------------------------VGENETD
A0A3L7UX05      FLSFALLR-----------VEPPRASILG------------------------PSMNTLG
A0A517XRC2      HTARATVQL-------------RPSTVES------------------------GKGQVED
A0A6M5YH47      HEARALVQL-------------RPKAIEF------------------------VNRNTEN
A0A660UUK3      YETTGSIRI----------SPIVSRILFN------------------------DSDSDRP
A0A517ZHG5      YVASSIVYI----------DATPGTVLQD------------------------SSSFSSD
A0A1Z8MPL5      YTAHSLM------------QSRRNTLIFD------------------------VQNAEES
A0A7C1EH96      YETQGSVLV----------SSVVVPIMYE------------------------TTAQGGV
A0A5C1AGE3      HQVKALLEIT---------PENVGLMPGA------------------------NQQNDSN
A0A2Z3HEL7      HQVRALVQLQ---------PQHAYIT----------------------------NKGQED
A0A142XAP8      HQVRALVQLQ---------PKQVEFV----------------------------NKTQED
A0A6P2DEK1      HQARALVQLQ---------PKQVEFV----------------------------NKTQED
A0A5C6C1R5      DTAMAYLRI----------DSVDSLLVFQ------------------------TADRLNA
A6BZU4          FSANTKIQV--------------------------------------------SQKNPVP
A0A2D5GZ77      FSANTKIQV--------------------------------------------SQKNPVP
A0A3D3R1Z6      FSANTKIQV--------------------------------------------SQKNPVP
A0A517XG00      FSANTKIQV--------------------------------------------SQKNPVP
A0A1G2YRE4      YTVTGALRFSPVLMNILTGEQNSAQISM--------------------------------
A0A353Z859      YTTRAELRV--------------KAVNYT------------------------PGGGLKQ
A0A2D6ST10      FTATAQVRI----------NSFDPFFFFK------------------------VDNQTPR
A0A177QX42      FASFAKVMVLRPQSVLPNEDPER------------------------------GTKKSAN
A0A517SHR0      YASFAKVMVLRPQTSMSTGRDDR-------------------------------TTNSIN
A0A2E0AW64      YEAKALLRITTPISFDGSKNKADRSFL---------------------------------
A0A351FZ59      YEAKALLRITTPISFDGSKNKADRSFL---------------------------------
A0A660V239      YDTEGAIQI----------SPVESPILFE------------------------TEERLPN
A0A177Q3B7      FTATTLLH-----------VSAQEPTILA------------------------TSEAHTD
A0A2E0X6Y6      YASTAKL------------------LIIE------------------------QKSDQLA
A0A518GFD7      YAASAYLRID---------SDNRPLLFET------------------------VDQAGGG
A0A5C5VZJ8      YSASGVIHI----------KPVRDDLLSG------------------------RQDVMPM
A0A518GE37      FEATHIM------------EANRDYVL--------------------------AQSLHNT
A0A5C6F3H8      YEATHLL------------VANDEYVVF-------------------------DNVMKYS
A0A5C5X072      YRASYLL------------ESNEDYVVF-------------------------KGVMPQV
A0A5C5WUQ3      YRASHLL------------EANDDFVVF-------------------------KGVMPTV
A0A5C6E697      YRASHLL------------EANEDFVVF-------------------------KGVMPTI
A0A5C5Z1A3      YRANALL------------QANQDWIVF-------------------------KGVMPTL
A0A5C6D2P7      YRAQHLL------------EANEDYVVF-------------------------QGVMPMV
A0A5B9ML17      FRAQHLI------------EANQDYILY--------------------------------
A0A518HFS8      YSSRSLVHV----------AEKRPRDLFE------------------------TRESGVS
A0A5Q3LBQ3      YEASAWIQI----------AEREPYIAFD------------------------TPLESHR
A0A517LX75      YESNMEIL-----------IALRSSELTN------------------------SGTSSDG
A0A7C5W7B3      YRARGQMLLVQNVTGASGMDQVFAWRLYF------------------------SNVALAR
A0A2S8F9B8      YTSSAYLRI----------SASEQPLAF-------------------------RTVEQAG
A0A354GX32      YTATATLRL--------------------------------------------NPQSPRG
A0A142XL75      ATAATVFH-----------VSAQAPSVLG------------------------QADGQAN
A0A6P2D5D5      ATAATVFH-----------ISSQTPSVLG------------------------QTDGQTN
A0A5C1AAF0      PRVSAKLYV----------DYSQRGTLFE------------------------HPDSPLN
A0A7C7T8W8      YEAKAWIRI----------KSTRPKVAFE------------------------LEESKLW
A0A5C6B3S0      YSTASLLRV----------ASQDAPLVF-------------------------KTVDQAS
A0A368KP63      YSSSAYLRI----------SANDQPLAF-------------------------KTVEQAA
A0A518GIZ9      YMAIGQV------------------MVSR------------------------RNAVPLK
A0A1C3EBY9      YMAIGQV------------------MVSR------------------------RNAVPLK
D5SX64          YMAIGQV------------------MVSR------------------------RNAVPLK
A0A517Z0U7      YTSYAELQFDLTPFYFGDRE---------------------------------TGEANGD
A0A2S8FCC0      YTARALLRI----------SSRHGTLLKQ------------------------NGEANGD
A0A1Z8MBT6      YTARYIV------------AANQDWVIY-------------------------KGINEAP
A0A517SXN9      YTARYIV------------AANQNWVLY-------------------------KGINEAP
A0A518HFL0      YRSSSMLRI----------ETDPANPYVT------------------------NGGPPVR
A0A3B8ZJM2      ------------------------------------------------------------
A0A1U7CLW1      YTARALVHV----------AEKRPRELFE------------------------TRESEVG
A0A142WPR7      YQSSSTVLVTGDR------QQQANPLGTE------------------------SGFAQGI
A0A3M1TFJ0      YAATASLRL----------------VREP------------------------PDPIQAK
A0A517P477      YVASAELYM----------RSYVDRVAFS------------------------TSEQQAS
A0A517T4K9      YHAFAEIRM----------KSVQERLLFN------------------------TAEAQTS
A0A7C6B2Q1      YTATALIRV----------AASSQSVLFP------------------------ANDRGGA
A0A7C4QPD3      YTGYAELFCQPRRFFWKTNEDDPQFAVYK-------------------------------
A0A2Z3GZZ5      YQSTAQV------------LVVKKGVEVT------------------------KEGDGRI
A0A4V0I6L6      YQSTAELMVVKSRPDMVAGGAGDARVQY--------------------------------
A0A7C4QQT3      Y------------------EATGQILVYR------------------------RNVVPLK
A0A255QXF5      FEAGYRL------------EANKDWLLD-------------------------RGVMPTP
A0A518KBI5      FAASGLIKI----------EDIQPYVAFQ------------------------QAAVGSN
A0A5C5V6Q5      YLATGLVRI----------EDTQPYIAFE------------------------KASVGSA
A0A517MY49      SAELLII------------EQYRDQLS--------------------------SAGNHRS
A0A2E6AG00      SSQLLVQ------------QMSPVVASG-------------------------PIGQVGX
A0A1G3A880      DASLLIL------------QTGGDVLTP-------------------------SLSVDGA
A0A2E8ATT1      KASLLIT------------QSSPDVWNG-------------------------AASSEVG
A0A7C2JZW2      FTAYVELLCQPRRFFWETKEDEAQFSVY-------------------------KQTMMRR
A0A518KYQ0      YRASHHL------------AANKDWLID-------------------------RGVLPAP
A0A5B9QX47      YRASHLL------------EASQDYVLF-------------------------KNLLPTA
M5T666          -----ML------------EANEDFVVF-------------------------KGVMPVV
M5U6N6          YQATHLL------------EANEDFVVF-------------------------KGVMPVV
A0A517M0G2      YKASHLL------------EVNQDFVVF-------------------------KGIMPTP
A0A5C6AST1      YQATHLM------------EANQDFVVF-------------------------RGVMPTS
A0A5C6C951      YQATHLL------------EANQDYVVF-------------------------QGVMPTS
A0A5C6C5T3      YQASYLL------------EANEDFVVF-------------------------KGVMPVM
A0A2A2W6A9      FRATHQL------------AANKDWLID-------------------------RGVMPTP
A0A518HQS9      FQATHHL------------AANKDWLID-------------------------SGVMPTP
A0A5M6DFE6      YESSALL------------EASRDYVAF-------------------------KGVMPAL
A0A5C6F286      YEASHLL------------VANDEYVVF-------------------------NNVMKVS
A0A517NGN1      YKAIHLL------------EANQDYVVF-------------------------KGVMPMV
M5RUI3          YRASHLL------------EANSQWVVF-------------------------KDVIPVI
A0A660VT66      ------------------------------------------------------------
A0A7C2VEF7      ------------------------------------------------------------
A0A0S8H0S8      ------------------------------------------------------------
A0A7C2ZTD2      ------------------------------------------------------------
A0A2E3Z6T8      ------------------------------------------------------------
A0A257WQ92      ------------------------------------------------------------
A0A7C1U6X6      ------------------------------------------------------------
A0A7C7UXI5      ------------------------------------------------------------
A0A7C3SFJ0      ------------------------------------------------------------
A0A7C7WWF7      ------------------------------------------------------------
A0A356ETW1      ------------------------------------------------------------
A0A3L7NJY1      ------------------------------------------------------------
A0A523CME0      ------------------------------------------------------------
A0A354PCV3      ------------------------------------------------------------
A0A354PHB4      ------------------------------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A538RV31      ------------------------------------------------------------
                                                                            

M5S2L2          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A7C2VXA0      ------------------------------------------------------------
A0A7C3AA48      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A7C5PFV3      ------------------------------------------------------------
A0A7C3QGD2      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A7C2ZUK5      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
A0A7C2JY73      ------------------------------------------------------------
A0A356AE44      -----------------------------------------------NI-----HHQRVD
A0A1G2XSU7      -----------------------------------------------MV-----------
A0A350KD81      -----------------------------------MAQQFLMG-----------------
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      -----------------------------------SSPTVRKP-----------EPGKES
A0A524HC32      -----------------------------------KTDAVVSR-----------------
A0A177PV03      -----------------------------------------------IL-----------
A0A1G2YIM0      ---------------SEQAMPNYMNFMNTQAELI-ASFQVLNR-----------AADDLK
A0A7D8YCU5      -----------IVDSAPSVGQIQA--E------M-ASEPVLHK----AI-----EDGGLL
A0A353BE27      ----------------QEVNRIDESMI------I-RSQAVLRL----AV-----SLGRLG
A0A5C6BPW1      ---------------SSDFDTFKRTQMFRALSRV-VLDTALNE----PVRNQTLKKYGFK
A0A1I3GSP0      --------------------------RGDHVQLI-QTDLIVER----AF-----KDHGLN
A0A517QJV1      --------------------------RGDHVELI-KSDLIIEP----AF-----KKHGLN
A0A3C1QS25      ---------------MPSGPGVKQ--DHEHDAVL-TSTTFIRD----SVVSNPELDQQVP
A0A5C6FX55      ---------------VPSIEIVQA--Q------L-FSDEVIRG----AF-----ENPEMI
A0A5C6DS51      ---------------QASGDSIHEDLLATHMRLF-LSRKNVAN----AI-----ETGNLK
A0A5C6DSL6      ---------------QASGDTIHEDLLATHMRLF-LSRKNIAN----AI-----ETANLK
A0A3M1VG27      --------------------------RSEHVALI-MSPMIVRK----AV-----ALRRLD
A0A518GC22      -----------------AITRVDESMV------I-RSQTVLRR----AV-----QLGRLT
A0A3L7Q373      --------------------------RGEHVRVI-ATDIIARI----AY-----EKYGLN
A0A3E0PW54      --------------------------RTEHVHLI-KSDAIVSR----AV-----RDHGLG
A0A7C3TAH2      DIGTYESFVNTQAMAITQPQVLER---------V-LDELLPRN----LTFFSGQNRGRLA
A0A1Z8MHR4      ---------------VPSGNLMES--L------V-ISDAIVKR----VA-----MSPQLR
A0A5C6EHJ0      ---------------LKSRNLSDEALV------M-RSEQILRR----AA-----EIGELS
A0A5C6F1H9      ---------------LKGRNLGDEAIV------M-RSEQILRR----AA-----ELGELS
A0A255QXY0      ---------------LPSGQLLKS--L------I-NSRAIVGR----VK-----NDRQLR
A0A517SYI0      ---------------VPSGNLMES--L------V-ISDAIVKR----VA-----MSPQLR
A0A518HX54      ---------------IPSGNLMQS--L------I-SSDAIAGR----VH-----LNEQLR
A0A5B9MF59      ---------------IPSGNLMQS--L------V-TSDAIVNR----VA-----SNPELK
A0A2A2WC24      ---------------IPSGKLMQS--L------I-TSDAIVRR----VA-----ANPELK
A0A518KYW8      ---------------IPSGKLMQS--L------I-TSDAIVRR----VA-----ANPELK
A0A5C5YZZ0      ---------------APSLAFIQA--E------M-TSDEVLKS----AI-----EIGQLT
A0A518JLD2      -----------------EVAASRS--LADEALVM-RSEFILRR----AA-----ELPEIV
A0A5M6DJ15      ---------------RGSYELYKN--TQSQL--I-KTSEVLAT----AL-----KNEEVR
A0A3L7P7S7      ---------------VAQATDTAG--APKTDAPT-GTVSATVN----RF-----QGKEIQ
A0A517N8M1      ---------------VPGLDIVES--Q------L-FSDRVMEA----AF-----ENPKLH
A0A5C6CW01      ---------------VPSVDILSS--H------L-YSDRVVKM----AF-----DNPEMV
A0A5C6BXS9      ---------------VPSVEILRS--Q------L-FSDTVMEN----AF-----RNPSFE
M5U569          ---------------VPSIDILRS--Q------L-FSDTVTKN----AF-----EDDSFD
L7CND7          ---------------VPSIEILRS--Q------L-FSDKVTEY----AF-----ENENMV
A0A0J1B8S4      ---------------VPSIEIIRA--Q------L-FSDEVNRS----AL-----SDGNMN
F2ARR3          ---------------VPSIDILRS--Q------L-FSDIVLAK----TF-----ADENMR
K5D8H6          ---------------VPSIDILRS--Q------L-FSDTVLNK----TF-----NDENMR
M2AKU0          ---------------VPSIDILRS--Q------L-FSDTVLNK----TF-----NDENMR
A0A5B1CKI2      ---------------VPSLDIVQS--Q------L-FSDRVMQM----TF-----NAPRLR
A0A5C6EG84      ---------------VPGLDIVES--Q------L-FSDRVMAT----AF-----GNERMR
A0A5C6F2X4      ---------------VPGLDIVES--Q------L-FSDRVLAA----TF-----ANPRMR
A0A5C5XTV6      ---------------VPSVDILRS--Q------L-FSDSVVKR----AF-----EDPHFE
A0A5C6AAB1      ---------------VPSIDILRS--Q------L-FSDSVTRN----AF-----QHAAFE
M5T8W8          ---------------VPSIDILRS--Q------L-FSDTVTKN----AF-----EDESFE
M5SF00          ---------------VPSIDILRS--Q------L-LSDKVTRN----AF-----ENESME
A0A2G1WDS1      ---------------VPSIDILRS--Q------L-LSDKVTRN----AF-----ENESME
Q7UVS9          ---------------VPSIDILRS--Q------L-LSDKVTRN----AF-----ENESME
A0A5C6B601      ---------------IPSGNIMQS--V------I-TSDSIMAS----VA-----QDPALT
A0A517PFU1      ---------------EPEELAGEA--LGNYLYRA-QTGPLVAR----AV-----RERRLD
A0A5B9M8J9      ---------------IPSGNLMQS--L------I-SSDAISGR----VE-----LDDQLR
A0A2A2WFP6      ---------------IPSGNLMQS--L------I-SSDAIAGR----VH-----LSEQLR
A0A518L8N2      ---------------IPSGNLMQS--L------I-SSDAIAGR----VH-----LNEQLR
A0A518HQN9      ---------------IPSGKLMQS--L------I-TSDAIVGR----VA-----SNPEVK
A0A5M6D8H8      ---------------IPSGNLMQS--L------I-TSDGIVSR----VA-----SHHELK
A0A5B1CRW9      ---------------GSDSLGEDQ--LATHMRLF-VARKVVAK----AI-----EMGELN
A0A5C6EI46      ---------------GTEGMGEDE--LATHMRLF-VARKVLTE----AI-----KLGSLD
A0A1G2ZG92      ---------------TGKTGSTDY---ETDIALAKIRPLIEKLISLLNI-----KDRHGK
A0A1G3A0W0      ---------------------------NTQVSYM-RSSTVLQR----VL-----DQPAIR
A0A2E7D3V4      ---------------GAGGR-------GEHIALI-MSPLIVGA----AI-----EEAGLD
A0A5B9PER9      ---------------PEVAQ-------VAHDKLI-VQRLMVEQ----CL-----NDDGGK
A0A517QSM4      ---------------FNTYK-------QTQMRKV-TGEYVLNA----AL-----RDPEIS
A0A355GJI7      ------------------------------------------------------------
A0A1Z8MCI4      ---------------FSDVRARGGSDAKGEEALL-KSPMVLES----VL-----AQPFIK
A0A517SYL7      ---------------FSDVRARGGSDAKGEEALL-KSPMVLES----VL-----AQPFIK
A0A3L7P0L2      ---------------VGETEARLYGGRSEHISAI-KSDEVVRI----AY-----EKYGLK
A0A6M5YVJ1      ---------------FGSYR-------QAQIALV-KRRQTLAA----VL-----SSPAVQ
A0A2E0SHG0      ---------------PGDFR-RMEDELANQMKIM-SSYKIVSAGLESGL-----E-EDGK
A0A518CQB8      ---------------PNDFR-RMEDELANQMKIM-SSHKIVKAALEAGL-----KNEDGT
A0A517SCC8      ---------------PSSDQARRYGDRGEHVYLI-KSDAICQR----AL-----DEFGLN
A0A3A0DR44      ---------------FA----------QTQLRSI-ASSVVLTP----AL-----ADPEIA
A0A358MY60      ---------------NLE---------ATEKQII-LSDIVLDD----VV-----SKADIQ
A0A517MNB1      ---------------NLA---------GSERQLI-YTDMVLDE----VL-----AKPEIQ
A0A142YJ13      ---------------YRTYQ-------ETQLILV-KSRKVLEA----AI-----APPAIA
A0A517Z7D3      ---------------DSPRETNLTGERSEHVDLI-MSDDIVQR----AM-----DKFGLR
A0A1N6KY57      ---------------YGAYQ-------RTQLALL-HSRLVLSS----AL-----KQPEVA
L0DK20          ---------------FVAYQ-------RTQLALL-KSRLVLGT----AL-----KDPEVA
A0A3L7UX05      ---------------IDQIK-------RTHMQLI-KAPDVLSD----AV-----SEYPEI
A0A517XRC2      ---------------FDSFR-------RSQMYLV-KSRDLINR----TI-----AEPKVA
A0A6M5YH47      ---------------FAEYR-------GRQVFLL-KSRDLITK----TL-----AEPAVS
A0A660UUK3      ---------------MPNYA----NFMTTEAERI-AGPTVLNR----VA-----DELSGK
A0A517ZHG5      ---------------FDTFK-------RTQMFRA-LQRVVLDTALSEPV-----RNSELK
A0A1Z8MPL5      ---------------GW----------EAQEQLI-RGYRVLNTALNDGL-----MELEYI
A0A7C1EH96      ---------------GAYQT-----FKNTQAGVM-TSDVILNR----VA-----DAVKDR
A0A5C1AGE3      ---------------TSNFK-------ENQMVLI-KTRTILTR----VV-----QNEKLK
A0A2Z3HEL7      ---------------FEWYR-------RRQIYLLTKDRDLFNR----VL-----ADPAVS
A0A142XAP8      ---------------FEAYR-------RHQMFLL-KSRDVFTR----AL-----ADPAVS
A0A6P2DEK1      ---------------FEAYR-------RHQMFLL-KTRDVLTR----VL-----ADPAVS
A0A5C6C1R5      ---------------GRDSF---SMYKNTQAQLI-KTPFVLNE----AL-----AVPEVR
A6BZU4          ---------------IKDGEIQTFGELTAHIDVI-KSPRIVGE----AV-----KEAKLN
A0A2D5GZ77      ---------------IKDGEIQTFGELTAHIDVI-KSPRIVGE----AV-----KEAKLN
A0A3D3R1Z6      ---------------IKDGEIQTFGELTAHIDVI-KSPRIVGE----AV-----KEAKLN
A0A517XG00      ---------------IKDGEIQTFGELTAHIDVI-KSPRIVGE----AV-----KEAKLN
A0A1G2YRE4      ---------------------------LTEAELI-TSERVIQR----VA-----DNLANR
A0A353Z859      ---------------GEELR--GEVYRQTLGRMV-QGPIVLKQ----VV-----RREEVA
A0A2D6ST10      ---------------FETYK-------QTQMILV-RSPLVLMA----AL-----RSPELA
A0A177QX42      ---------------AVNLL-------ENHQYLL-TQPKILKGAVDPPI-----KDDASE
A0A517SHR0      ---------------SVDLL-------ENHQYLL-TQPTIIKGAVDPTL-----PEGATD
A0A2E0AW64      ---------------------------ANQFAVL-YSVVTLEP----LL-----ADKEIA
A0A351FZ59      ---------------------------ANQFAVL-YSVVTLEP----LL-----ADKEIA
A0A660V239      ---------------YQNFM-------NTQAQLF-RRNNVLNQ----VA-----DELADM
A0A177Q3B7      ---------------FGLYQ-------KAQAALI-SSRLVLNA----VL-----KRDAIA
A0A2E0X6Y6      ---------------SVNDADGSDNTMATQREIV-VSPVVLRR----AI-----ERLAPE
A0A518GFD7      ---------------VSGFK----LYKSTQQQIM-LTPFVLNA----AL-----RDGELS
A0A5C5VZJ8      ---------------YESFR-------QTQASFV-TNAEVRNG----VL-----EDSAVK
A0A518GE37      ---------------SRDLA-------RSERQLI-TNALVLDP----VL-----ADPALK
A0A5C6F3H8      ----------------KDLA-------RTETALI-LNPIVLVP----AL-----ADPSLH
A0A5C5X072      ----------------ENLA-------RTEKSLF-QNSIVLDP----VL-----ADPTLR
A0A5C5WUQ3      ----------------DDLA-------NTEKSLF-FNPIVIDP----VL-----ADPEIR
A0A5C6E697      ----------------NDLA-------RTEKPLF-FNPIILDP----VL-----SDPEFR
A0A5C5Z1A3      ----------------TDLA-------RTEKSLF-FNPIVIDP----VL-----ADPDLR
A0A5C6D2P7      ----------------KDLA-------RTETSLF-FNPIVLDP----VL-----ADPENR
A0A5B9ML17      ----------------RDVFNTVRDLAGTEKTIF-FDEIVLRP----VL-----SDPELR
A0A518HFS8      ---------------YAIYQ-------HTQTTLI-RSNKVLEA----AL-----KKSGIG
A0A5Q3LBQ3      ---------------FV----------ETQVGLM-RSPLILGP----VV-----SKPEVA
A0A517LX75      ---------------GIDSTVLHSDMLATHIELL-TSPLILNDAIK-VG-----RFDELE
A0A7C5W7B3      ---------------LGTLP------ATGQKAHT-HLNAWLEGAENRPE-----HLPEVD
A0A2S8F9B8      ---------------RDDYR----TFKSTQRQLM-ITPFVLNK----AL-----SREDIM
A0A354GX32      ---------------VNETSEDYTNLRSYLAGWV-KSDPVLDA----TL-----KKQEVG
A0A142XL75      ---------------FVSYR-------ASQIATI-KRQRTLNN----VI-----KVPAVE
A0A6P2D5D5      ---------------FASYR-------ASQIALI-KRRLTLNN----VI-----KEPAVD
A0A5C1AAF0      ---------------Q-----------QTQINVL-KSEAVITA----AL-----RNPEVN
A0A7C7T8W8      ---------------T-----------RTQVELI-RSPLILRE----VL-----LRPTVA
A0A5C6B3S0      ---------------VSSFD----IYKRTQRELL-KSDFVLAA----AL-----RKKDVM
A0A368KP63      ---------------RNDFR----TFKNTQVQLM-ITPFVLSK----AL-----GKDGII
A0A518GIZ9      ---------------EQSAM-GDWGERSEHIALI-MSPMIASE----AV-----RLGQLD
A0A1C3EBY9      ---------------EQSAI-GDWGERSEHIALI-MSPMIASE----AV-----RLGKLD
D5SX64          ---------------EQSAI-GDWGERSEHIALI-MSPMIASE----AV-----RLGQLD
A0A517Z0U7      ---------------LRSFK-------GTMMRLA-TYPFVLVA----AL-----REPGVH
A0A2S8FCC0      ---------------FEVYK-------LTQRQLI-RGSFVINA----AL-----RDTEVL
A0A1Z8MBT6      ---------------RDLAA-------SEKTWVI-DHPGVIQA----VM-----GDQTVC
A0A517SXN9      ---------------RDLAA-------SEKTWVI-DHPGVIQA----VM-----GDQTVC
A0A518HFL0      ---------------SDL---------QTQIQLI-TSANVLTS----AV-----SDPDVS
A0A3B8ZJM2      ------------------------------------------------------------
A0A1U7CLW1      ---------------FRTYQ-------ETQVILV-KSRKVLEA----AL-----NPPAIA
A0A142WPR7      ---------------TQTMP---------HQMLI-GSPLVVRK----AV-----ETHDLR
A0A3M1TFJ0      ---------------YAYRW-------DG------IPQEYLNS----EI-----RDMTSL
A0A517P477      ---------------FRTRK-------QTNQKLL-RSREVLTA----AL-----RNAEVA
A0A517T4K9      ---------------FQTFK-------QTQMKLV-KSPFVLNA----AL-----RRPEVA
A0A7C6B2Q1      ---------------SFDIYK------ATQLEYL-RSRFVLVA----AL-----RQPEVA
A0A7C4QPD3      ---------------------------QTTMRLL-KDPFVLEAALRETI-----SQEPPL
A0A2Z3GZZ5      ---------------VEDHV-------ATQVTLI-KSEKIRLA----AA-----AKARAA
A0A4V0I6L6      ---------------LEDYI-------GPQVILL-GSEAILKVAAERRL-----DEQKPF
A0A7C4QQT3      ---------------EDQRALHDWGERSEHIALI-MSPMILNK----AV-----EIGKLM
A0A255QXF5      ----------------DDLA-------KSEGPII-ASPIVLSS----IL-----ANDTLH
A0A518KBI5      ---------------NGSFI-------RTQIELM-RSPVVLRE----VL-----SDQRVG
A0A5C5V6Q5      ---------------NSAFV-------RTQIELM-RSPLVIRE----VL-----SEASVG
A0A517MY49      ---------------SENTM-------ATHSKIV-RSPKVIQGA---IE-----RLPQKY
A0A2E6AG00      ---------------XXGML-------PTYEKLF-ASAVVLNGAIXRIV-----EMPTDL
A0A1G3A880      ---------------KQEII-------PTYCQLI-ESAVVLQGA---IA-----RLGPQH
A0A2E8ATT1      ---------------RHGLI-------PTYEQLF-SSAVILNGATQRLA-----RLPAAL
A0A7C2JZW2      ---------------------------------I-KDPQVIAA----AM-----RKEDVA
A0A518KYQ0      ----------------EDLA-------KSERLLL-TSPIVLSQ----VI-----NNPELQ
A0A5B9QX47      ---------------GSNLS-------GTERTIL-LNSIVLDP----VL-----EDASLR
M5T666          ----------------KDLA-------RTENSLF-FNPIVLDP----VL-----ADPSLR
M5U6N6          ----------------KDLA-------RNEKSLF-FNPIVLDP----VL-----ADPQLR
A0A517M0G2      ----------------RNLV-------ASERPLV-LNALVLEE----VK-----NDPEVQ
A0A5C6AST1      ----------------SNLA-------ATEKQLI-TTDLVLDN----VL-----TDPEIQ
A0A5C6C951      ----------------RNLA-------ATERQLI-TTDLVLDS----VL-----ADAEVQ
A0A5C6C5T3      ----------------ENMA-------RTEKNLF-TNPIVLDP----VL-----ADPSLR
A0A2A2W6A9      ----------------DNLS-------SSERMLI-TSPIVLSQ----VL-----DNPEFQ
A0A518HQS9      ----------------DDLA-------RSEKTLI-TSPIVLSQ----VI-----DKPELQ
A0A5M6DFE6      ----------------DDIA-------RTEKPLI-VNPVVLDP----IL-----QDPELR
A0A5C6F286      ----------------KDLA-------RTETALI-LNPIVLDP----VL-----ADSSLH
A0A517NGN1      ----------------DDLV-------RTERALF-LNPIVLDP----VL-----SDPDLR
M5RUI3          ----------------EDIA-------ATEKPLF-FNSIILDP----VL-----ADPALR
A0A660VT66      -----------------------------------------------LA-----TPDDLL
A0A7C2VEF7      ------------------------------------------------------------
A0A0S8H0S8      -----------------------------------------------AY-----LKEALK
A0A7C2ZTD2      -----------------------------------------------AK-----LKRAIS
A0A2E3Z6T8      ------------------------------------------------------------
A0A257WQ92      ------------------------------------------------------------
A0A7C1U6X6      ------------------------------------------------------------
A0A7C7UXI5      ------------------------------------------------------------
A0A7C3SFJ0      ------------------------------------------------------------
A0A7C7WWF7      -----------------------------------------------YN-----------
A0A356ETW1      ------------------------------------------------------------
A0A3L7NJY1      ------------------------------------------------------------
A0A523CME0      --------------------------------------MSKIEGALRKS-----------
A0A354PCV3      --------------------------------------RINQTLSRNQL-----------
A0A354PHB4      --------------------------------------RINQTLSRNQL-----------
A0A356ESF4      ------------------------------------------------------------
A0A538RV31      -----------------------------------REKQGKDGERLRML-----------
                                                                            

M5S2L2          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A7C2VXA0      ------------------------------------------------------------
A0A7C3AA48      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A7C5PFV3      ------------------------------------------------------------
A0A7C3QGD2      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A7C2ZUK5      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
A0A7C2JY73      ------------------------------------------------------------
A0A356AE44      AIA----------TERVKVELLYEEISSRLSTLKAAI-----------------------
A0A1G2XSU7      ------------------------------------------------------------
A0A350KD81      -------------QTRGQ----------------------------------------AA
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      QEP----------ETPVK-------YDVDDALINNYL-----------------SKLTVQ
A0A524HC32      -------------ELLKQ--------QKLFDYMAENL-----------------Q---AS
A0A177PV03      -------------AVLKG-------GFGANRVFKDGV-----------------------
A0A1G2YIM0      TKN----------VAMVG--------RDPFTFLRDAA-----------------SNGRLI
A0A7D8YCU5      EYP----------GAPG----------NLASMASWIR-----SRLGV-------SSPRDH
A0A353BE27      EQP----------EFVGL---------ASEDIVSALQ-----DVGSPL------VIEPAD
A0A5C6BPW1      TIG----------DLPLL------------------------KGQTFEIDWLEARLSASG
A0A1I3GSP0      EIP----------ALANA-------YDPLREVT---------EGLSVS------RSAGQE
A0A517QJV1      SVP----------ALATA-------YDPYKNIR---------EGMAVS------RSAGQE
A0A3C1QS25      SIA----------GL------------SPEMKLFQIQ-----EGLEVD------LEKDSE
A0A5C6FX55      QYH----------ESLDE---------GDGPWARFVEMVKKDEVLELE------PEVSDV
A0A5C6DS51      ATE----------TIRQV-------LSEDGNPIDYII-----EQMEVG------R-GGEG
A0A5C6DSL6      KIA----------SIGTV-------LADGGSPIDYIV-----EQMEVG------R-GGEG
A0A3M1VG27      RLP----------SLA-----------TKKDPVAAII-----TELKAK------RVAGTD
A0A518GC22      EQS----------EFLGM---------QTDEVVATLM-----DEESPL------IIEPAD
A0A3L7Q373      QIS----------NFAGA-----------YDPLKAVW-----EDLQVK------RVAGQE
A0A3E0PW54      ELP----------AFQ-----------KSKDPVMDII-----DSLTVK------RSAGSD
A0A7C3TAH2      WLK----------NWIAS-------LQGPMTPMDRLK-----DAISSG------DISAQA
A0A1Z8MHR4      QSP----------SMRGR---------SEAQVVSAIR-----GSVRFH------TITAVK
A0A5C6EHJ0      TTP----------EFAGY---------SSEQIAAVVG-----GLD--L------VVGSAD
A0A5C6F1H9      TAP----------EFAGM---------APEQIAAAIG-----DAS--L------SIGSAG
A0A255QXY0      EVA----------AVRGL---------TDREVMRLVR-----QRIRFD------SVTDLK
A0A517SYI0      QSP----------SMRGR---------SEAQVVSAIR-----GSVRFH------TITAVK
A0A518HX54      SIP----------ALREL---------TNDQFIALVR-----RGIRFQ------TITDLK
A0A5B9MF59      SIP----------SLQSN---------TDQQIVSMVR-----GGIRFQ------TLTDQS
A0A2A2WC24      SIP----------SLESS---------SETQIVSMVR-----SGIRFQ------TLTDQG
A0A518KYW8      SIP----------SLESS---------TETQIVSLVR-----SGIRFQ------TLTDQS
A0A5C5YZZ0      AFE----------ETPA----------DVGALIALIR-----KNLRLQ------APFDGA
A0A518JLD2      ESA----------EFAGL---------GPEQIAGLMG-----GR---A------LTIGPA
A0A5M6DJ15      RLS----------LIRSK-------PDPEQWLAE-----------ELQ------VDFPGR
A0A3L7P7S7      DLI----------DYLRA------------------------GVGIIK------AKEAGS
A0A517N8M1      PFH----------KQFEN---------ESKAFTSQAL-----RSMELE------PEVDDV
A0A5C6CW01      PLQ----------ERFGG---------DPTRYNGTAR-----GGLSLT------VEGTGG
A0A5C6BXS9      IFR----------DRFQN---------RSGSFAGMSA-----SALKFH------TDLQDA
M5U569          AFR----------AKFND---------DPRAFAGMSS-----KALQFS------PDVQGT
L7CND7          VFQ----------ESLGG---------RPSGLAGLAF-----ESLKFE------TDIEDA
A0A0J1B8S4      VFR----------EQFHG---------SPVELAALAS-----KMLEFE------TDLKDE
F2ARR3          PFR----------DRFEN---------NPNLFAGLAN-----GALEFE------TDLQGV
K5D8H6          PFR----------DRFEN---------NANLFAGLAN-----GALEFE------TDLQGV
M2AKU0          PFR----------DRFEN---------NANLFAGLAN-----GALEFE------TDLQGV
A0A5B1CKI2      PFQ----------EEFEG---------RVGAFVEESL-----ESLELE------PEVEDV
A0A5C6EG84      PFQ----------VEFES---------NLREFNEVAI-----KSLELE------PEVDDL
A0A5C6F2X4      PFQ----------SEFES---------HQAMFNDIAL-----NSLELE------PEVDDL
A0A5C5XTV6      IFQ----------DQFSG----------PGAFGGMSA-----GALRFQ------TDLQDG
A0A5C6AAB1      VFR----------GQFEN---------QPGVFGGTAS-----KSLKFN------TDLQDV
M5T8W8          VFR----------SKFGD---------NPAGFAGASG-----EALQFN------ADVQDT
M5SF00          VFR----------ESLGG---------HPSALLGLAN-----KALKFE------TDIQDA
A0A2G1WDS1      VFR----------ESLGG---------HPSALLGLAN-----KALKFE------TDIQDA
Q7UVS9          VFR----------ESLGG---------HPSALLGLAN-----NALKFE------TNIQDA
A0A5C6B601      LLP----------SMTGK---------SVAQIAATIR-----SGVRFQ------TITNAA
A0A517PFU1      ELP----------AFKGA---------GSP--VGRIL-----KGLEGG------QVPGTR
A0A5B9M8J9      SIP----------KLRDL---------SDDQFVALVR-----GGIRFQ------TMTDLK
A0A2A2WFP6      SIP----------ALREL---------TDDQFVALVR-----RGIQFQ------TITDLK
A0A518L8N2      SIP----------ALREL---------TNDQFIAMVR-----GGIQFQ------TITDLK
A0A518HQN9      SIP----------SLESS---------TEKQIAAMVR-----SGIHFQ------TLTDQS
A0A5M6D8H8      SIP----------SMQGK---------DAKSVASMIR-----KGIKFQ------TLTDVS
A0A5B1CRW9      QFK----------SFAQI-------ARNGGSAVDHII-----QNIEVE------R-GGEG
A0A5C6EI46      ELD----------TFRKA-------RENDQSLVDHIL-----ENIEVE------R-GGEG
A0A1G2ZG92      TIRPDKLTELSLISKLKN-------KVLPRPYIE------------------------VN
A0A1G3A0W0      QTQWYKNPRSSLMQRFYG------NKAPPLERLRDTL-----------------S---VR
A0A2E7D3V4      G-L----------PSMLT-------SGDPEEDIVDGL-----------------KVERSA
A0A5B9PER9      L------------RLLNS------FDEIPKDDIAEYV-----------------INNLVV
A0A517QSM4      N-L----------PTLKE-------QQHPTDWLEKNL-----------------K---VT
A0A355GJI7      -------------MLIQK------------------------------------------
A0A1Z8MCI4      ELK----------PTTDG-------GPRNLAYLVENV-----------------A---LT
A0A517SYL7      ELK----------PTTDG-------GPRNLAYLVENV-----------------A---LT
A0A3L7P0L2      -------------EIFGN-------DKDPLKSIWENL-----------------VVVRES
A0A6M5YVJ1      Q-L----------GVIQK-------QPNPQDWLSDAL-----------------K---VD
A0A2E0SHG0      PVNLLTCPSLL--EEVKE-------GETVVDYVIQHL-----------------F---LS
A0A518CQB8      PINMMNLPSIM--EELAD-------DQNPIDYVIDNL-----------------Y---LS
A0A517SCC8      K-L----------PAFEG-------ADDAAKEISERL-----------------TVKRTS
A0A3A0DR44      K-I----------PEIKR-------QVAPLEFLEETL-----------------K---VS
A0A358MY60      A-V-----------GFSD-------PVQSVNTIRDGL-----------------G---IE
A0A517MNB1      S-L----------PAFAD-------TQLAKDTMRKYM-----------------R---VS
A0A142YJ13      A-L----------PIVRN-------SVDPIEWLSQQV-----------------Q---VE
A0A517Z7D3      E-L----------PAFKT-------AYDPLMDVLDSL-----------------SAQRSA
A0A1N6KY57      K-L----------PILTK-------VSDPIEWLENEL-----------------K---VD
L0DK20          K-L----------EVITK-------AVDPIEWLEKEL-----------------Q---VD
A0A3L7UX05      VQL----------PELKN-------SASPEYVMDKKI-----------------N---VI
A0A517XRC2      S-L----------QTIRE-------ADDPVALLETGV-----------------R---VD
A0A6M5YH47      S-L----------DSVKQ-------TPDPVSIVEDQI-----------------K---VT
A0A660UUK3      K-L----------TLLEG-------SVDPVLTLRQAA-----------------NNGGIE
A0A517ZHG5      RYGFKTIGDL---PLIKA-------QAFPIDWLEARL-----------------S----A
A0A1Z8MPL5      K------------EAQED-------GIDPIDYLANVL-----------------I---IE
A0A7C1EH96      R-L----------AFFEP-------GQNLLQALRSMV-----------------SKGDIE
A0A5C1AGE3      D-T----------QLVKT-------SDDPAKVIEDML-----------------R---LR
A0A2Z3HEL7      S-L----------ALVKT-------ADDPVAMLEDAV-----------------R---VS
A0A142XAP8      S-L----------DTVKQ-------SEDPVAMLEDTI-----------------R---VA
A0A6P2DEK1      S-L----------DTIKQ-------SEDPVSMLEDTI-----------------R---VT
A0A5C6C1R5      D-L----------PEIKE-------KPSPLQWLSESL-----------------R---VE
A6BZU4          Q-L----------STLAG-------EKDPTQDIIDSL-----------------KVKRIS
A0A2D5GZ77      Q-L----------STLAG-------EKDPTQDIIDSL-----------------KVKRIS
A0A3D3R1Z6      Q-L----------STLAG-------EKDPTQDIIDSL-----------------KVKRIS
A0A517XG00      Q-L----------STLAG-------EKDPTQDIIDSL-----------------KVKRIS
A0A1G2YRE4      NLSFFEAESTDLAGKMKQKLTGDNTKLDAVTKLKRAI-----------------SSGVIS
A0A353Z859      K-L----------PTITD-------QEDPLIFFEKNM-----------------R---VT
A0A2D6ST10      GLS----------EWTDP-------GQNTQEWLEENL-----------------E---VS
A0A177QX42      E------------EKKHA-------KEASLSRLASL----------------------AA
A0A517SHR0      E------------EKLAS-------KESGLLKLPTL----------------------AG
A0A2E0AW64      T-I----------PDLVE-------ADDPIAELKRNL-----------------S---IK
A0A351FZ59      T-I----------PDLVE-------ADDPIAELKRNL-----------------S---IK
A0A660V239      D-I----------VFFRD-------TGDLVLALREAI-----------------LDGVII
A0A177Q3B7      SLA----------ILPRD-------PEKQIAWLQAEL-----------------K---VD
A0A2E0X6Y6      D------------RIDLV-------DEAPHEWIDRLA-----------------ALSSSS
A0A518GFD7      S-L----------PIIAQ-------HDDPVSWLQEKL-----------------E---VT
A0A5C5VZJ8      GLSWFAARPLTFWDRLIS-------ADPVEQRFDDDV-----------------N---VI
A0A518GE37      K-A----------PSLSN-------PLTAERQIRKRL-----------------S---IG
A0A5C6F3H8      D-V----------PSLSN-------PATAEAHLRSNL-----------------T---IK
A0A5C5X072      S-A----------PSLSD-------PNSAEGKLRKNL-----------------S---IS
A0A5C5WUQ3      R-A----------PSLAD-------PDTAEVNLRKNL-----------------T---VG
A0A5C6E697      I-A----------PSLSD-------PGKAEAAMRKNL-----------------T---VA
A0A5C5Z1A3      R-A----------PSLSD-------PDTAEVNLRKNL-----------------K---IS
A0A5C6D2P7      M-A----------PSLSD-------PESAEQSLQRNL-----------------S---VA
A0A5B9ML17      A-A----------PSLSD-------PEEAERNIRKNL-----------------N---IS
A0A518HFS8      S-L----------EMVRS-------RTDPVAWLRERL-----------------R---TE
A0A5Q3LBQ3      Q-M----------PEILQ-------EEAPIEWLSERI-----------------H---VK
A0A517LX75      SYI----------EARRE-------GTSALSLLQKNL-----------------L---VE
A0A7C5W7B3      E-A----------AAEKL-------QALTPSHILSLV-----------------S---VT
A0A2S8F9B8      N-L----------PVVRE-------NENPLEWLQEAL-----------------V---VS
A0A354GX32      DLS----------EIKAQ-------GEGRVAWMKSAA-----------------L---VD
A0A142XL75      N-L----------AIVRK-------SPNPVAWLDHAI-----------------K---ID
A0A6P2D5D5      N-L----------ATVRK-------QPDPIAWLEHAI-----------------K---ID
A0A5C1AAF0      K-T----------ELISQ-------QADPVDWLAKEL-----------------M---VD
A0A7C7T8W8      K-L----------PEIQK-------TISPLELIEKSL-----------------T---VK
A0A5C6B3S0      E-S----------RVIQS-------QIDPAEWLKANL-----------------G---VG
A0A368KP63      N-L----------PVIAE-------NENPLEWLQKEL-----------------Q---VR
A0A518GIZ9      K-L----------QTFAG-------ESDPTQMVLDDL-----------------KVKRVA
A0A1C3EBY9      K-L----------KTFAG-------ESDPTQMVLDDL-----------------KVKRVA
D5SX64          K-L----------KTFAG-------ESDPTQMVLDDL-----------------KVKRVA
A0A517Z0U7      Q-C----------PTIRE-------QRDPEAWLEDAI-----------------E---VS
A0A2S8FCC0      R-L----------PMVEQ-------EPDPVAWLQSAL-----------------S---VN
A0A1Z8MBT6      K-A----------PSLAD-------PTTRETNLRKNL-----------------S---VA
A0A517SXN9      K-A----------PSLAD-------PTTRETNLRKNL-----------------S---VA
A0A518HFL0      K-L----------PSVIQ-------SEDAVGYIREAI-----------------K---VS
A0A3B8ZJM2      -MD----------PKKGV-------DVSPAEKSERTI-----------------T-----
A0A1U7CLW1      S-L----------PTVRK-------LLDPIDWLSGVL-----------------M---VD
A0A142WPR7      K-H----------PAFAG-------ESDPASRIVRGL-----------------NV--LA
A0A3M1TFJ0      S-L----------ARAVI-------ESNSVIARQLAE-----------------D---IG
A0A517P477      N-T----------PTLQE-------VPDPVVHLQKHL-----------------S---VG
A0A517T4K9      R-L----------TTVRG-------ENHPVDWLEQEV-----------------E---VS
A0A7C6B2Q1      R-L----------PSIQE-------QLDPVQWVAQNL-----------------N---VR
A0A7C4QPD3      T-V----------ADLPF-------FAKGDDQLRVAL-----------------LSDALR
A0A2Z3GZZ5      GGA----------GLPAD-------DRAVADMIGTGL-----------------TVVRDK
A0A4V0I6L6      Q-N----------PPPDG-------VAERVAYMKARF-----------------AVARVK
A0A7C4QQT3      E-L----------PAFRE-------SEDIVEDLLDGL-----------------Q---VK
A0A255QXF5      Q------------FSLAD-------PESREQHLKQRL-----------------K---IH
A0A518KBI5      A-A----------SHLNK-------TPDRLSHLRKNL-----------------Q---IK
A0A5C5V6Q5      K-A----------EHLVA-------KPDKLKHIKENL-----------------S---IR
A0A517MY49      RGD----------LKNKA-------SKDWVSAISANL-----------------S---TS
A0A2E6AG00      QCD----------LKNYP-------REDWVRXLREQX-----------------T---VR
A0A1G3A880      QVD----------FRGQP-------RDQWIEILEDNL-----------------T---AV
A0A2E8ATT1      RVD----------FLSVP-------RDKWIDVLRANV-----------------S---AR
A0A7C2JZW2      K-T----------KYARE-------SIDILEQINQDL-----------------V---VS
A0A518KYQ0      AFS----------LNDPD-------PDVREQALLSNL-----------------T---IG
A0A5B9QX47      K-A----------PSLSD-------PLIAEQNLRRNI-----------------S---IS
M5T666          N-V----------PTLVD-------PATAEANLRKNL-----------------S---VS
M5U6N6          S-A----------PSLSD-------AETAEAQLRENL-----------------S---VS
A0A517M0G2      AFY----------GSETP-------LNVGQ--LRSSV-----------------G---LS
A0A5C6AST1      A-T----------GHFVN-------MDDAKHSLRKNL-----------------G---IG
A0A5C6C951      A-T----------GLFQN-------SEAAKNALRAGL-----------------S---IG
A0A5C6C5T3      T-A----------PSLSN-------PETAEANLRKNL-----------------S---IG
A0A2A2W6A9      AFS----------LQDPD-------PDVRDQKLRSSL-----------------S---IG
A0A518HQS9      AYG----------LQDPD-------PDVREQTLISNL-----------------S---IR
A0A5M6DFE6      N-A----------PSLSD-------PEQAEQNLRDNL-----------------S---IR
A0A5C6F286      D-V----------PSLSD-------PATAEANLRANL-----------------K---IK
A0A517NGN1      S-A----------PSLSD-------PETAEAQLRKNL-----------------S---VQ
M5RUI3          K-A----------PSLAD-------PEYAEVSLRENL-----------------K---VT
A0A660VT66      ------------------------------------------------------DAVEVQ
A0A7C2VEF7      ------------------------------------------------------------
A0A0S8H0S8      ----------------------------------------------------------IE
A0A7C2ZTD2      D-----------------------------------------------------DIITAA
A0A2E3Z6T8      ------------------------------------------------------------
A0A257WQ92      ---------------------------SLQWKAPVGS-----------------------
A0A7C1U6X6      -----------------------------MDVSFTCA-----------------------
A0A7C7UXI5      ------------------------------------L-----------------------
A0A7C3SFJ0      -----------------------KRKTTQYEQLANEL-----------------------
A0A7C7WWF7      -------------IIQKENLYSKKRQLRVLKEQVGDL-----------------------
A0A356ETW1      -----------------------------------ML-----------------------
A0A3L7NJY1      ----------------------------------DLV-----------------------
A0A523CME0      ------------------------------------------------------------
A0A354PCV3      ------------------------------------------------------------
A0A354PHB4      ------------------------------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A538RV31      ------------------------------------------------------------
                                                                            

M5S2L2          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A7C2VXA0      ------------------------------------------------------------
A0A7C3AA48      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A7C5PFV3      ------------------------------------------------------------
A0A7C3QGD2      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A7C2ZUK5      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
A0A7C2JY73      ----------------------------------EVKLVRESIATAMDFY----------
A0A356AE44      ----------------------------------ERGESHEALMLLVKTF----LQKDQT
A0A1G2XSU7      -----------------------------------------------------------Q
A0A350KD81      NGNTS-------------------------------------------------EGQIAS
A0A2D6SRY7      ----------------------------------KSEVNQDLYTRLLQKY----------
A0A1G3C300      MTGNS------------------DIISISFTGT-HPETLAKMCNMHAKKF----LETHLE
A0A524HC32      PSRKS------------------MLIEVSFTSP-DPKLSQVVVNTLVDEF----IGWKME
A0A177PV03      ---TN------------------NVLYLSFRGT-NRDDCQVILDAIMQKY----DTYLKS
A0A1G2YIM0      IEPAK----------------KSELIRIVMSSK-NPREGEQVVNAIIRAY----MAVEVS
A0A7D8YCU5      STRNQ------------------TIVQVHVESP-NPDLSGAVINAVVASY----ASHLGG
A0A353BE27      KDDQT------------------TLIRIAYVSE-DAETAAKVVHAVVEGY----EKYLAD
A0A5C6BPW1      RDEEF------------------FAIKMEYSEK-PEELAEIVNAITQVYY----RDIANE
A0A1I3GSP0      SSFDN------------------VL-SITYLHP-DKRIARAVVQAMVEAY----RDYLED
A0A517QJV1      NSFDN------------------VF-DISFDHP-DKEIAKTVVQAIVESY----RDYLHE
A0A3C1QS25      N-----------------------LYLVSFSSP-NQEDCDRVLWGVLNGY----QEYLNR
A0A5C6FX55      KTAQS------------------VVALLHFDSP-NPDLSTAAVTAFSQSL----QQYYNK
A0A5C6DS51      AAENA------------------MVLSASFRAP-HPDDAAMILAAVYSSY----QTYVES
A0A5C6DSL6      SAENA------------------MVLSATYRDP-NPDDAATILAAVFASY----EDYVES
A0A3M1VG27      QSFLN------------------II-ELTYSNR-YAQDAVAVLDAIVAAY----SQYLQE
A0A518GC22      KDDST------------------TLIEISYISQ-DAEVAAKVVSAIVDGY----EGYLAE
A0A3L7Q373      SSFDN------------------IL-SIAYQSK-DPKLAKQVVESIVAAY----GDWLEA
A0A3E0PW54      QSFVN------------------LI-DISYLHP-DKNAAGAVVRGLVAAY----EDYLEA
A0A7C3TAH2      RRGSE------------------LIV-VTMVST-KPDEARQIVDSLIRNY----MAVSAY
A0A1Z8MHR4      DSRDR------------------MIVGLNYQSQ-DPYACVAAINGFYSAI----RQHFDA
A0A5C6EHJ0      ENIDS------------------SVFQIRYDST-SATTTQRVVQSIVDAY----ASHLQD
A0A5C6F1H9      SSIGS------------------SVFQIQFNST-SPSTSQRVVQAVTDAY----ASHLKE
A0A255QXY0      DSHDR------------------LIAVLSFEHD-DPQVCEAAVDAVSRAI----GAHFQE
A0A517SYI0      DSRDR------------------MIVGLNYQSQ-DPYACVAAINGFYSAI----RQHFDA
A0A518HX54      DSRDR------------------LIAAVHFDGH-DPEVCVAAVNAVSDAI----RSHFQE
A0A5B9MF59      DSRDR------------------MIAALNFDGR-DPQVCVAAVKAVSQAI----SEHFER
A0A2A2WC24      DSRDR------------------MIAALNFDGR-DPQVCVATVNAVSQAI----SQHFER
A0A518KYW8      DSRDR------------------MIAALNFDGR-DPQVCVATVNAVSQAI----SQHFER
A0A5C5YZZ0      ESRDR------------------TMVEVTFESG-DATVATAIVNAVVEAY----NEYVNG
A0A518JLD2      TEESN------------------SVFRVQFVSD-SPVISKLVVQALVDAY----GLHLQD
A0A5M6DJ15      SELMA------------------VSLSADDAKA-AAVVLDAVVQAYMSEV----ANGERK
A0A3L7P7S7      TTASN------------------NVLKVSFQSG-SSTECVQALKAVIKGY----KNYLDK
A0A517N8M1      RTAQS------------------VVALLHFESE-NRELCQPVVQAFSESL----QAFYNE
A0A5C6CW01      RVAQS------------------FVAVLSFEHS-DAELCEASVKAFSDAM----QTFFNE
A0A5C6BXS9      RSASS------------------LVATLSFEGT-DPDLCEAAVKSFSSSL----QKMFAE
M5U569          RSASS------------------LVATLAFESS-DRELCLGAVKAYSSAL----QRLFAE
L7CND7          RSASS------------------LVATLTFDHS-DPELCEAAVKAYSAAV----QQLFSE
A0A0J1B8S4      RSASS------------------LVAQMTFENT-DPELCEAAIKAYSAAL----QKLFAD
F2ARR3          RGASS------------------IVANMTFEHT-DPELCEAAIRAFSSSF----QQFFAD
K5D8H6          RGASS------------------IVANMTFEHT-DPELCEAAIRAFSASF----QQFFAD
M2AKU0          RGASS------------------IVANMTFEHT-DPELCEAAIRAFSASF----QQFFAD
A0A5B1CKI2      KTAQS------------------VVTLMHFESE-NEELCKAAVESFSESL----QSFYNE
A0A5C6EG84      RTAQS------------------VVALLHFESD-VEELCQPVVQSFSESL----QAYYNE
A0A5C6F2X4      RTAQS------------------VVALLHFESD-VEELCQPVVQSFSESL----QDYYNE
A0A5C5XTV6      RMASS------------------LVATLSFHGA-DPDLCEGAVEAYSAAL----QEMFAE
A0A5C6AAB1      RSGSS------------------LVASMSFEHT-DPELCEAAVKAYSAAI----QQLFAE
M5T8W8          RSASS------------------LVATLAFEST-DSELCVGAVKAYSAAL----QKLFAE
M5SF00          RSASS------------------LVASLSFEHS-DPELCEAAVKAYSAAL----QQLFAE
A0A2G1WDS1      RSASS------------------LVASLTFEHS-DPELCEASVKAYSAAL----QQLFAE
Q7UVS9          RSASS------------------LVASLSFEHS-DPELCEAAVKAYSAAL----QQLFAE
A0A5C6B601      DSRDR------------------MIASLSFEGG-DPALCVAAVNVMSAAI----SDHFDA
A0A517PFU1      ------------------------VLQLTYSGG-SPEETGAVLDAVVATF----VEEVRE
A0A5B9M8J9      DSRDR------------------MIAALHFDGN-DPQVCVAAVNAVCDAI----GDHFQE
A0A2A2WFP6      DSRDR------------------LIAAVHFDGH-DPEVCVAAVNAVSDSI----RSHFQE
A0A518L8N2      DSRDR------------------LIAAVHFDGH-DPEVCVAAVNAVSDSI----RSHFQE
A0A518HQN9      DSRDR------------------MIAALNFDGR-DPQLCVATVNAVSQAI----SQHFER
A0A5M6D8H8      DSRDR------------------MIAALHFDGP-DPQVCVAVVNAASEAI----GEHFEA
A0A5B1CRW9      SAQDA------------------MVLRVFYRAE-EPEEAALVLSAVYNSY----KAYIDS
A0A5C6EI46      AAADA------------------MVLRVFYHAS-NPEESATVLAAVFQSY----KRYIDS
A0A1G2ZG92      QYKDA------------------DMLEIAAYSP-NPFEAANMSNKLATLY----IEDRLE
A0A1G3A0W0      PRQRT------------------EIIDVDFVDP-SANEAKLIVDTVLEQY----IRYIAE
A0A2E7D3V4      GHDRS----------------LLNVLDITYKNR-NKDDARQILEAVVDAY----EAYLKN
A0A5B9PER9      TPDPE----------------APYIYEIRYTSP-DKSDAPTVVNNLLQTYEETLIRQYET
A0A517QSM4      SPASE-------------------FFRLELEGD-RPKDLAMIVNAVADAFLTEVVNKERT
A0A355GJI7      -----------------------NRLERDFQKN---------------------------
A0A1Z8MCI4      SKGAQ------------------GRYAISFIDN-DPVAAKQLSDAIAESF----MAVRTL
A0A517SYL7      SKGAQ------------------GRYAISFIDN-DPVAAKQLSDAIAESF----MAVRTL
A0A3L7P0L2      GQETS----------------FDNILNISFTSA-DKVEAKKVVSAVIDAY----ADWLEA
A0A6M5YVJ1      TKGGE-------------------LMVVSIEGD-NPEELFTILEALCRAY----LAEVDE
A0A2E0SHG0      TQGEE----------GNVAVSGGHWIYATFEHT-NKEDTPRVLQAILNAY----QDHVEE
A0A518CQB8      LQGEE----------GNIAVNGGHWIYVTFEHT-NEADTPRVLKAILAAY----QEHITE
A0A517SCC8      GQDSS----------------FDNLIDITYLYP-DPNVAKAVVEAIVKAY----DAYLKA
A0A3A0DR44      GEGGS------------------ELYRIEYVGE-NAKDAATIVNGVIRVY----LGKLVA
A0A358MY60      TAGTQ------------------TLLRITYADP-DPNIAALVCNEVAASF----LEQRER
A0A517MNB1      GAGSA------------------S-LTISYQDP-DPQHAALICNEIVEAY----LARREQ
A0A142YJ13      FPRGS------------------EILSISITANGPPSDLSMLVNSVTEAY----LSQIVE
A0A517Z7D3      GRDSS----------------FVNLIDLKYAHP-DKDVAKKVIAAMVAAY----DDYLEE
A0A1N6KY57      FAPGS------------------EILRISISAE-KPDLPMLLVNAVTQAY----LDEIVD
L0DK20          FASGS------------------EILRISINGE-KPHEPMLLVNAVTQAY----IDEIVD
A0A3L7UX05      DRVNS------------------ELIEVQMVGT-SPQNATDIVNAVVRSY----LKQAGR
A0A517XRC2      GSIAP------------------DLMQVSFNGN-NRDDLVKIVDALVGKY----VDDANN
A0A6M5YH47      -VVAD------------------DILQVTLTGN-NLDDMKVVLDHLVKRY----VDDATA
A0A660UUK3      IATQR----------------HSELITIKMISR-FPREAEQIVDAFIRSY----MNIVRA
A0A517ZHG5      SGRQE------------------EFFAIKMEYSEKPEELAEIVNAITQVYYRDIANESKL
A0A1Z8MPL5      VPDSE----------KEMKGYGGQILRISMRGD-DPDQLKQILEAVTDAYLEEVVTEERA
A0A7C1EH96      VIPDR----------------QTEFLHVRMKTE-HAADAEVLIDAFLRSY----EAVVRT
A0A5C1AGE3      WEAPD-------------------LMAVTMNGD-RPDELKEVLDVLVQTF----KAESSA
A0A2Z3HEL7      VAAPE-------------------MLEVTLTGN-HLDDMKVLLDRLIKRY----LDDTNA
A0A142XAP8      VAAPE-------------------ILEVTLTGN-NIEDMKVILDHVVRRY----VDDATV
A0A6P2DEK1      VAAPE-------------------ILEVTLTGN-NIEDMKVILDHVVRRY----VDDATA
A0A5C6C1R5      FPGKG------------------EVMTIALETE-DPKASTIIVDAVVKAYMNEAVLDERN
A6BZU4          GNDRA----------------FLNILTLTYENP-NAKDARLVTQAVVDAY----KRYLHE
A0A2D5GZ77      GNDRA----------------FLNILTLTYENP-NAKDARVVTQAIVDAY----KRYLHE
A0A3D3R1Z6      GNDRA----------------FLNILTLTYENP-NAKDARVVTQAIVDAY----KRYLHE
A0A517XG00      GNDRA----------------FLNILTLTYENP-NAKDARLVTQAVVDAY----KRYLHE
A0A1G2YRE4      AKAVR----------------NTELLKLTMVSK-KSEEAQQIINAFINAY----MAVEVS
A0A353Z859      NPATE-------------------FLQMSLTGN-NPADLAPILNAVVEVFLREVAQREAQ
A0A2D6ST10      SRASE-------------------FISISLSGE-RPTELKDTVNAVMGAYLQEEVAGAAA
A0A177QX42      SSNPA--ATIATGLRVIRSEVSEDVLEISYVGP-NAGDCKKILDSVLASY----KRWLES
A0A517SHR0      QSKPSVISTIAGGMRVQRSEVSEDVLEISYSGP-NAGDCKRILIAVLDSY----KTWLQS
A0A2E0AW64      SAYRD-----------------SNQWYLTYRST-DPQVAAMLANRIYESF----IRTKGD
A0A351FZ59      SAYRD-----------------SNQWYLTYRST-DPQVAAMLANRIYESF----IRTKGD
A0A660V239      IEPER----------------NTELIKIKMTTQ-YPDQAEKVIDALIRAY----KARAVT
A0A177Q3B7      YKTGP------------------EFMRLSLTAE-RAADVKTLVGEITDVYLKEVVYKERT
A0A2E0X6Y6      VTRRT------------------NLIDVKFRSK-RPDTAAAVVRAIIDSY----LEWVRD
A0A518GFD7      FPGDG------------------EVMQVTLETQ-SPADCVKIVNGVVDAYMKEVVGNERS
A0A5C5VZJ8      VPPGK------------------QLIEVSISTP-WPGEAAVLVNKILENY----KRNYED
A0A518GE37      NAGTD------------------NLLTISYRDT-DKVMAAAVCNAVAESY----LQVRRR
A0A5C6F3H8      SGGDP------------------KSLEIRYEDT-DPEVAKNVCNAVAKSY----LRQRDS
A0A5C5X072      SGGTD------------------SRLVVSYTDT-DREAAAMVCNAIVDSY----LRQRDS
A0A5C5WUQ3      NGGTR------------------ARLVVSYEDS-DREAAAMVCNAVVDSY----LRQRDA
A0A5C6E697      SAGTA------------------ARLIVSYEDT-DPEAAALICNAIVESY----LRQRDS
A0A5C5Z1A3      SDGTP------------------TQLLVSYEDT-DREAAANVCNAVVESY----LRQRDD
A0A5C6D2P7      SGGTS------------------TRLVVSYKDT-DPEAAALVCNAVVESY----LRQRDS
A0A5B9ML17      HGGSR------------------ARMIVSYEDA-NREYAAKVCNAIVEAY----MMQRKA
A0A518HFS8      -FGNS------------------EILTISMSGG-NPEAVATVVNAVTEAY----LEQIVR
A0A5Q3LBQ3      SVGDS------------------ELFEVRFEGP-NAAHAQLITNEVVNTY----LKMRNE
A0A517LX75      RGGEG-------------DARGASVLNASYRNP-NPADAEHVLTVVYERY----CHYVES
A0A7C5W7B3      PDTEN------------------VAVEINGWHE-DEAFIHYVVQAVLEGLIDTLVDHELA
A0A2S8F9B8      FPGDA------------------EILQVSLTNA-DRQAAMKLVNAVVGAYKDEVIESERL
A0A354GX32      DKTGL------------------QVLRLSLSGD-QPDEMAKVVNEWAATCDSLYTASEEA
A0A142XL75      APANS------------------EYMRVSLEGD-DATESKIILEHLKTAY----LADVDL
A0A6P2D5D5      APVNS------------------EYMRVSLEGN-DPTESKIILEHLRTAY----LADVDL
A0A5C1AAF0      YPSGD------------------EIVRISLVTM-QTDDGVKIVDAVKTAYLDEFVNKSAK
A0A7C7T8W8      SVGGS------------------ELYTIAYNTK-FKASAPIVANAILQAY----LEKQPE
A0A5C6B3S0      FPGEA------------------EIMQVSLASQ-EPKGLNTVVNAVVNAYLEEIVQKERD
A0A368KP63      FPGDA------------------EILQVSMSSA-DPTTAMKIVNAVVGAYQEEVIESERM
A0A518GIZ9      GQDRS----------------YLNVLDVTFQSA-SADDARHVVKAVIDAY----ASYLNE
A0A1C3EBY9      GQDRS----------------YLNVLDVTFQSA-SADDARHVVKAVIDAY----ASYLNE
D5SX64          GQDRS----------------YLNVLDVTFQSA-SADDARHVVKAVIDAY----ASYLNE
A0A517Z0U7      AVGEQ-------------------FMRISLTGE-RPADLKTIVEAVTNAFVTQVVDQQLQ
A0A2S8FCC0      FPDNA------------------EIMEVRLSGE-NSKAISKIVNAVVQAYMDEVVDAEAI
A0A1Z8MBT6      GAGTK------------------DKMMIKYTDT-DRDAAAAVCNAVVAEY----LQRRAE
A0A517SXN9      GAGTK------------------DKMMIKYTDT-DRDAAAAVCNAVVAEY----LQRRAE
A0A518HFL0      PLPGG------------------SLIEVSAESR-LRHEAATIVNAVVDAF----LKEDAT
A0A3B8ZJM2      -----------------------DQLKISYIAG-DPDTAMAVVNAIVLGY----QKFLDE
A0A1U7CLW1      FPRGS------------------EILSISMTASCPPLDLSTLVNAIADSYLTEIVDKERL
A0A142WPR7      DSKTP------------------DVIRMSFRDS-DPEVCQVALEAVLDGY----RSYLGE
A0A3M1TFJ0      SEDPNALAMAFLAGVDVHPEETTYVVDVTYTSS-HEERCALYANALAEAY----TRQRKS
A0A517P477      SPGAE-------------------FISVGLSGE-HAEDLPVIINGVVDAY----MKEVVV
A0A517T4K9      SPATE-------------------FIRISLRGE-HPADLAAIVNAVTTCYMEEIVNSEEN
A0A7C6B2Q1      FPGNS------------------EFMNVSFSSP-RAEETAVLVNAIVDAYMREVVDTEQR
A0A7C4QPD3      VTSPA-----------------EEFIRVELTSP-HKEEVDDIVNAVINAFVREVVAKEVQ
A0A2Z3GZZ5      DSAGP--------------TIGSGVLNLTLREP-DPELCKRLLEAVIAAYQAELYSIYEK
A0A4V0I6L6      EAGSN---------------TPSNVLQLSFKSL-HPADAPKYLRAIIAAY----KDELTG
A0A7C4QQT3      RSSGQ-------------DRSHTNVLNISYSHR-DAAVARAVVQAVISAY----AAYLED
A0A255QXF5      GGGTK------------------STMVVTYTDA-DKNFSAEVCNAIVGAY----LQKRDE
A0A518KBI5      QVGGS------------------ELYEVSYSAP-SPQEASDVVGAVIQQY----FARQSD
A0A5C5V6Q5      QIGGS------------------ELYDVSYTSP-SAQESQDIVAAVIKKY----FVLQSD
A0A517MY49      ITRKT------------------NFIDVRYRSK-QAESAAAVVQAVVNSY----LEFVRQ
A0A2E6AG00      SFRST------------------HIIEIRYRSQ-RADAAEAVVGAIVDAC----LEFMDE
A0A1G3A880      AIRRT------------------NIIRVSYQSR-SASAAVAVIRAVMQSY----FDFIEK
A0A2E8ATT1      SVRNT------------------NIIELSCRSR-DPAAGEAVVGAVVDSY----LEFIER
A0A7C2JZW2      SP-AQ------------------EFIRIELRGP-DPKELNVLLKAIVDSFQVEVIDREQA
A0A518KYQ0      NSGTR------------------STLSISYRDI-DKRFAADVCNAIVEAY----LQKRDE
A0A5B9QX47      SGGAA------------------TRMVVSYTDT-DQQAAAMVCNAIVDSY----LRQRNA
M5T666          SGGTE------------------SRLVVSYTDT-DREAAAVVCNAVVDSY----LRQRDS
M5U6N6          SGGTE------------------ARLVVGYTDT-DREAAAMVCNAVVESY----LRQRDS
A0A517M0G2      NAGSS------------------TLLSIQFEHE-DPVAAATICNKITHSF----LSIRDR
A0A5C6AST1      NAGTN------------------SLLSISFKHP-DPQTAALVCNKVTEAY----LTQRDR
A0A5C6C951      NAGVD------------------SLLTISFKHA-DPEVAALVCNKVTEAY----LVQRDR
A0A5C6C5T3      SGGTD------------------SRLVVSYTDT-DREAAAQVCNAIVESY----LRQRDS
A0A2A2W6A9      SAGSR------------------STLTVSYTDT-DKQFAADVCNAIVESY----LQKRDE
A0A518HQS9      GGGTR------------------SAMSISYIDS-DKKFAADVCNAVVEAY----LQKRDE
A0A5M6DFE6      SAGSK------------------SRMEVSYTDT-DREYAQKICTAIVVSY----LSQRDS
A0A5C6F286      GGGDP------------------KSLEVRYQDT-DRDAAARVCNAVVESY----LRQRDS
A0A517NGN1      SAGAK------------------TQMLVSYEDS-DRDMAAKVCNAVVNAY----LRQRDA
M5RUI3          SGGNR------------------RHLVVSYEDS-DGVAAATVCNAVVDSY----LRQRDA
A0A660VT66      PRPRS------------------RIVELSVYST-DPEAAAEYANTIARTF----IEFYSR
A0A7C2VEF7      VGKKD------------------DIISVAFDSP-YPQEAAGVVNTVVDSY----IKYHSL
A0A0S8H0S8      AGKKD------------------DIICVSLDSP-YPSEADLLVNNIVEAF----VSSSPG
A0A7C2ZTD2      PANRT------------------ELIKVVVKST-NGEEAKQIVDAFISAY----MAIEVS
A0A2E3Z6T8      ------------------------------------------------------------
A0A257WQ92      ----------------------------------AAADGQTTTNVHQERV----------
A0A7C1U6X6      ----------------------------------SASDAVVIANAVLDQY----------
A0A7C7UXI5      ----------------------------------VIRDAQDGLSVVVKRA----------
A0A7C3SFJ0      ----------------------------------GAPDSE----AMRLKS----------
A0A7C7WWF7      ----------------------------------GISDDDDLVHPILQRV----------
A0A356ETW1      ----------------------------------PSGDGKEILDPATKRA----------
A0A3L7NJY1      ----------------------------------DTGDKTNSLSVVSETI----------
A0A523CME0      ------------------------------------------------------------
A0A354PCV3      ------------------------------------------------------------
A0A354PHB4      ------------------------------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A538RV31      ------------------------------------------------------------
                                                                            

M5S2L2          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A7C2VXA0      ------------------------------------------------------------
A0A7C3AA48      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A7C5PFV3      ------------------------------------------------------------
A0A7C3QGD2      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A7C2ZUK5      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
A0A7C2JY73      ------------------------------------------------------------
A0A356AE44      SNSQTVVSGATERQQLDTQLIPLLLEEQTALKRYGS------------------------
A0A1G2XSU7      TTTSNVANLEQVLITAKQHLAP--------------------------------------
A0A350KD81      PGTSQVDRARTALETHLMPLLIQKNRLERDFQK---------------------------
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      LRFAASQDAVKWLQDQLVDKKLKVEEAEEALILYKEKQNIVGL-----------------
A0A524HC32      QKFEASRMARDFLMMQIDQAKIHLEKAEEDLNRFAKKAGIVSL-----------------
A0A177PV03      KYERLNDKTVREVLNIIKELKKGMDETKQKEDAWLAKNPPPTE-----------------
A0A1G2YIM0      NSVRGGDEKLSVLEDEYRTLTDKLQRQRKIVRQMAEEFGTSAL-----------------
A0A7D8YCU5      RHRKTISDLVDFFQEARDTVLPQLNELEATYSEFRASAPLEWS-----------------
A0A353BE27      EYKTVGEEIAQLMEGAHADLTKRMRELSESASQFKEANPDIVF-----------------
A0A5C6BPW1      TKLNDKKRITKLVELSVDYEQQTKKKLDEIAKLGRRLGITNEE-----------------
A0A1I3GSP0      TRDENAQQLYKSLLERQQQLENDVKSLEAEYQKFRHDAPVFLK-----------------
A0A517QJV1      TRDENSRQMYDTLLNRQKKLSDEIAKLEKDYREFRVSAPVFLK-----------------
A0A3C1QS25      KYKATGQELKGILDDLKRNYDAKAEELQAKIQEQVEAHGEKLA-----------------
A0A5C6FX55      KYSNSRDELKRFITEATDKVQPQLDKYESIYAQFRKESDLFFD-----------------
A0A5C6DS51      HSQNTSREAAELIEAARVQNEMELVTADNEYRDFISKVPVLLE-----------------
A0A5C6DSL6      HSKNTSREAANLIEKAQNDNKKELELADIEYREFIKNVPVLLE-----------------
A0A3M1VG27      SQKEHTNELLTLIHTATVDLRKQLEAKQQEYLRFRAEAPFLWR-----------------
A0A518GC22      EYKTVGIEIEQLISGARDQLSNRLKQLTQQTHDFMLRAPEVIW-----------------
A0A3L7Q373      QKDNNARDLYETKLTQKNALDEERKALEKEYSQWRADVPFYIN-----------------
A0A3E0PW54      KQDSNSQELRESLARRQTELAEEIERLQSEYHAFRADSPYYLP-----------------
A0A7C3TAH2      RDTLKEEADLRLLENHRKELTER---LQQHYEQIRQLGQLYGT-----------------
A0A1Z8MHR4      ERQATIKEIENLVNNARNKLLPDQEKLEQEYRRFRETAPLQWD-----------------
A0A5C6EHJ0      QYRNIGQETIDLIQTARNDVLTKLDKLEAEFSEFKKSSGLIFR-----------------
A0A5C6F1H9      QFRNVGQETIDLIQTARNDVLAKLDTLEGEFSDFKKSSGLIYR-----------------
A0A255QXY0      ERESTINEFTRLINKAQDKLLPQQLALERDYKEFRREAPLEWD-----------------
A0A517SYI0      ERQATIKEIENLVNNARNKLLPDQEKLEQEYRRFRETAPLQWD-----------------
A0A518HX54      ERELRVNEFEQLVSQAQEKLLPQQAELEEAYKTFREGAPLEWD-----------------
A0A5B9MF59      ERQSTINEVGELVRNAMDKLIREQKDLESEYLTFRNNADLEWD-----------------
A0A2A2WC24      ERQSTINEVGELVRNAMDKLIREQKDLESEYLTFRDNADLEWN-----------------
A0A518KYW8      ERQSTINEVGELVRNAMDKLIREQKDLESEYLTFRDNADLEWN-----------------
A0A5C5YZZ0      RHRRNIENVVEFFREGRDSILPKLDELENEFTEFRSTAPLEWN-----------------
A0A518JLD2      QYRNVSQETLDLIESAQKDVSKKLTALEEDYAKFKTSSNLIYH-----------------
A0A5M6DJ15      QRDSRLKELREIYDERSEAIRRERQDLQLRAESLGTSDSESLSIAQQMSVQRYGQIQSEL
A0A3L7P7S7      EYNLADDQFMTRLERSSTVARREAQQLREDLRLIEEQ--LQKN-----------------
A0A517N8M1      NYKSSRGDLIKLISTGMEQLHPKMLELESRYREFRRDAPLAWD-----------------
A0A5C6CW01      RQKSSRSELLQLISVAIEQLHPKMTDLEKQYRDFRRDAPLAWN-----------------
A0A5C6BXS9      KHKTSRSELMRLITVATDQLQPKMAKLEQQYRDFRTQAPLVWN-----------------
M5U569          KHKSSRTELLRLITLATDQLQPKMTELEQRYRDFRTSAPLVWN-----------------
L7CND7          KHKSSRGELLRLIEDATKVLQPKLSELEENYREFRTNASLVWD-----------------
A0A0J1B8S4      KHKSSRSELLKLISIATNQMQPKMAELESRYREFRQDAPLVWD-----------------
F2ARR3          RHKSSRSELMSLISVATDQLQPKLTELEERYREFRTNAPLVWD-----------------
K5D8H6          RHKSSRSELMSLISVATDQLQPKLTELEERYREFRTNAPLVWD-----------------
M2AKU0          RHKSSRSELMSLISVATDQLQPKLTELEERYREFRTNAPLVWD-----------------
A0A5B1CKI2      NYKSNRGDLIRLISTGMEQLHPKMLELENRYRTFRRDAPLAWN-----------------
A0A5C6EG84      NYKSNRGDLINLIAKGMEQLHPKMLDLEARYREFRRDAPLAWD-----------------
A0A5C6F2X4      NYKSNRGDLINLIAKGMEQLHPKMLDLESRYREFRRDAPLAWD-----------------
A0A5C5XTV6      KHRSSRGELIRLITVATDQLQPKMDLIEERYRKFRIEAPLVWN-----------------
A0A5C6AAB1      KHKSSRSELMRLISVATDQLQPKMTELEQRYRDFRTTAPLVWN-----------------
M5T8W8          KHKSSRTELLRLITMATDQLQPKMVELEKRYRDFRTDAPLVWN-----------------
M5SF00          KHKSSRGELLRLIRDATDNLQPKLSELEEDYRAFRTKASLVWN-----------------
A0A2G1WDS1      KHKSSRGELLRLIRDATDNLQPKLSELEKDYRAFRTKASLVWN-----------------
Q7UVS9          KHKSSRGELLRLIRDATDNLQPKLSELEKDYRAFRTKASLVWN-----------------
A0A5C6B601      ERESQLDNLGKLVNQAYNDLLPKYEELVEEYHEFQENSPLKWD-----------------
A0A517PFU1      EGQSGIREAIRLISEARDQVLRDLEAAEAAHREFERTSPLVRG-----------------
A0A5B9M8J9      EREQRVNEFEQLVSSAQEKLLPQQAELEESYKVFREGAPLEWD-----------------
A0A2A2WFP6      ERELRVNEFEQLVSQAQEKLLPQQAELEEAYKSFRESAPLEWD-----------------
A0A518L8N2      ERELRVNEFEQLVSQAQEKLLPQQAELEEAYKTFREGAPLEWD-----------------
A0A518HQN9      ERQSTINEVGELVRNAMDKLIREQKDLESEYLTFRDNADLEWN-----------------
A0A5M6D8H8      ERESTINEFSRLIDDAQQKLLPQQRMLEEEYKSFRENARLEWN-----------------
A0A5B1CRW9      QDQDSSKLAVELIEAARETHERELIEADETYRGYVASVPVLLE-----------------
A0A5C6EI46      QDQDNSKLAVELIEAARETHEQELSDADAAYRDFVASVPVLLE-----------------
A0A1G2ZG92      RKREEYKAAKIFIKCQMKEVKEEYYKSLSALSDFKISKKTVNL-----------------
A0A1G3A0W0      MSNENEEELYRQLSERHTSLRSEIQGHEEFVANLSKT-----------------------
A0A2E7D3V4      SQQEHNSETRELIDEANVKLEAQLQAKMAAYVDFRQSAPLQWK-----------------
A0A5B9PER9      DKNLFVSELRKYQDNFNNRFAVAIAERKKWDDQYDALRIN--------------------
A0A517QSM4      SRQDRLRQLQGFYRDINEELGLKRTQLEGIAQSLKTTDPEILS-----------------
A0A355GJI7      ------------------------------------------------------------
A0A1Z8MCI4      LDSTQISNVRESLRPAISEWESTVLNQQERLQLAA-------------------------
A0A517SYL7      LDSTQLSNVRESLRPAISEWESTVLNQQERLQLAA-------------------------
A0A3L7P0L2      KRGSGSQLLYKTLLDQKKMMDEERTRLEDEYEKWRGESPFYIS-----------------
A0A6M5YVJ1      RDNGTRRRRIDKLEATNRSYRADLKTNYDRIDAIAVSLGAKDG-----------------
A0A2E0SHG0      TYRNPVNDAAENIRADFKKAEEEWESIQAKYKNFVESSQFYTS-----------------
A0A518CQB8      TYQNPVNEAAQVIGGVANKAREEWEGIREKYKTFMESSQIYTT-----------------
A0A517SCC8      NLETNSAELFTNLTRQLKDAEQTIRDLDKEYHDWRNNAPFFLS-----------------
A0A3A0DR44      DEKTRREEMLVQLENVKLKREAEIRSIREKIVEIEKTVVGK-------------------
A0A358MY60      LDNRRVIDLESWLTPSIDLWKAEVQGHERRISELSKSTLG--------------------
A0A517MNB1      FDNERVANLESWLSPSIDLWKEEVAGHGRRVRELSKAAYG--------------------
A0A142YJ13      QDRLERVARFERLKGLFSDYQKDLSGKRAKFKELAGSVGTSDK-----------------
A0A517Z7D3      TRKTNSSELYEALTRREKDLQARIDELEQAYLQFRDESPWHAS-----------------
A0A1N6KY57      VEMKQSRQRYDLLKSTWNRYQENLREKRQQLKGLTELAGSDNK-----------------
L0DK20          VETKQRRQRYDLLKETWNRYQENLKEKRKELKRLTELAGSDDK-----------------
A0A3L7UX05      WANETTTAQIGKLTRELERRNKEVEDLRNNIKLLGSELGAADP-----------------
A0A517XRC2      AVRKNLMDKADRLEKLIGDLRAKVEQDEREIKRKAEFNGTIGI-----------------
A0A6M5YH47      FDRGQRTSEVTKLEQYAETLRTEIEATEKHIELLGRANNTTGS-----------------
A0A660UUK3      EEGRSDDNKLNILEEQKRTLDTKIDTQAKEINTLLDEFGTEEL-----------------
A0A517ZHG5      LDKKRIAMLIELSDDYEQETKKKLDEIAKLGRRLGITSE---------------------
A0A1Z8MPL5      EWLKQKDVLQAQYLEKVDELRLKREDLQELAKTVGTSDPDTAN-----------------
A0A7C1EH96      DEIRAIDDRLARLEAQRRTLEEQMRRQRARIRERVEEYGTEQL-----------------
A0A5C1AGE3      KETERRRAQKDILVKLREKYQKDIDD-------IMRAGHLRGD-----------------
A0A2Z3HEL7      FDNRSRTEEREHLRNRRSEVQNEIAQGERVIEFTARNLGVNGT-----------------
A0A142XAP8      LDRKQRDDQSAALQATLTSIEKKLSDQKSKLELAGRTNGTTGA-----------------
A0A6P2DEK1      IDRKQRDDQIAALETTLTSIERELKEQKSKLELAGRTNGTTGA-----------------
A0A5C6C1R5      ERMQRVNSLEEVYAEAEGKVRARRAEIRKLADTLGTGDSESLS-----------------
A6BZU4          VREENTEDIIQQLKQAEKQIATELKLKKSEYQKFRENAPLYWE-----------------
A0A2D5GZ77      VREENTEDIIQQLKQAEKQIATELKLKKSEYQKFRENAPLYWE-----------------
A0A3D3R1Z6      VREENTEDIIQQLKQAEKQIATELKLKKSEYQKFRENAPLYWE-----------------
A0A517XG00      VREENTEDIIQQLKQAEKQIATELKLKKSEYQKFRENAPLYWE-----------------
A0A1G2YRE4      SSSEEQDRKLNLLDAERKLLEDKLRSTNDSIRQLGTEYGSXXX-----------------
A0A353Z859      ERTKIVNSIDAAKADTRAKLGDFIKTKERLVKKLG-------------------------
A0A2D6ST10      ARRERLTKLENLFAKRRAELETKRRRTETLSEQTGAIT--EGQ-----------------
A0A177QX42      TQAGNRKVLEEILVSAKGDLDRRLGENRQKYDDFR-------------------------
A0A517SHR0      TQAGSRAELESLLKSGKTELEDRLANNRTEYDRFR-------------------------
A0A2E0AW64      FDVSLRSALLSRLEELRKDKEDDVDRLRQDFRNEAIRNLN--------------------
A0A351FZ59      FDVSLRSALLSRLEELRKDKEDDVDRLRQDFRNEAIRNLN--------------------
A0A660V239      DEVKGEDQTLAILDEERRSLEDQKQRQRDELRQLAQE-----------------------
A0A177Q3B7      RKLERLKHLQEIQSKYEESLRSHRETVRKLILALGS------------------------
A0A2E0X6Y6      THQGAAGAEKRRLTEKLARREQELEEFEAGLRALRRQVGHLAV-----------------
A0A518GFD7      QRRQRLESLEIVHAEAESKVRIKRAELKSLATLLGTGD--AES-----------------
A0A5C5VZJ8      RQSAEDNTDVRALERAAADLKRRIEARADEIKVVRKDLNLGAG-----------------
A0A518GE37      FDDERMGNVEAWLVQPIEQWKRNVESLRANLAELTKSA--NGY-----------------
A0A5C6F3H8      FDAARVTNIEEWLEPEIQQWEQRVEERQARVQTLSEQT--LGF-----------------
A0A5C5X072      FDDTRVNNLERWLEPEIQRWEQEVDERQKRVAALSQKT--LGY-----------------
A0A5C5WUQ3      FDNARMTNLEMWLEPEIQRWEQQVEERQLKVTRLSEQT--LGF-----------------
A0A5C6E697      FDNSRVNNLERWLEPEIQRWKQEVTERQRLVQSLSKQT--LGY-----------------
A0A5C5Z1A3      FDNIRVSNLGRWLEPEIQRWEQEVEERRQSVNRLSQQT--LGY-----------------
A0A5C6D2P7      FDSTRVSNLERWLEPEIQRWEREVSDRQRVVQSLSEQT--LGY-----------------
A0A5B9ML17      LDGRRVAILEELLDPEIDHWKGQVEQHKARVRELTIGM--KGY-----------------
A0A518HFS8      QEEQERVERLERLEQLFEKYQEELRAKREDYREQAQSAGASD------------------
A0A5Q3LBQ3      DDNAQTQRVIELLEGQKEQRSQNVMRLRENVRELSKQTTGQD------------------
A0A517LX75      QTRNVGEEAASLIQQAQQTNETELRQATQEYTRFVATSAGLLD-----------------
A0A7C5W7B3      MVNT------EGVEQIILSTQNGINDVEREISSIYSEGMEKGL-----------------
A0A2S8F9B8      ARVQRLENLERVYNETETKARQKRSDLRQLAETLGTSD--SET-----------------
A0A354GX32      KIKERIKQVLKNYQDGTTHLRNKKNELQA-------------------------------
A0A142XL75      RDNGAKWSRLQKLEETKRGYRSELEKFHKQIDTIAAAL----------------------
A0A6P2D5D5      RDNGAKRTRLKTLEDTTQKYRKDVEDAHKRMDIIAVAL----------------------
A0A5C1AAF0      ARRQRLDRLQALQTTAHESLKRKQATVRKLAEAVGSTRPENVA-----------------
A0A7C7T8W8      YVDRQLDDTVELLERERTRKAEDLAELRERLTTIASQM----------------------
A0A5C6B3S0      LKRERLNKLESIYEDANEQVRQKRNELKRLVEIHGSGS--SDA-----------------
A0A368KP63      ARVRRLDNLERVYNETEAKARSKRSDLRTLAETLGTSD--SDT-----------------
A0A518GIZ9      SRSEKTTEVFKTAQEAHDTLQKSLREKEEAYLKFRESAPLQWR-----------------
A0A1C3EBY9      SRSEKTTEVFKTAQDAHDTLQKSLREKEEAYLKFRESAPLQWR-----------------
D5SX64          SRSEKTTEVFKTAQEAHDTLQKSLREKEEAYLKFRESAPLQWR-----------------
A0A517Z0U7      DRRLKLTELKELLGREQTELDRQQSALRRLDKELAPNETQVD------------------
A0A2S8FCC0      SRTTRLSSLERAYSETENDLRSKRSEFRRLADTLGT------------------------
A0A1Z8MBT6      FDGTQSRRLISVIEKQIDELDVEISAKEAEVRQYEVEA--QGF-----------------
A0A517SXN9      FDGTQSRRLISVIEKQIDELDVEISAKEAEVRQYEVEA--QGF-----------------
A0A518HFL0      WADARNRGSIVRLESYREELEAEIEGLQQGLFRLVQQS----------------------
A0A3B8ZJM2      EYKFVDDEVIKLFNEVKKKLDQDLVAHKNGYDKFLVDIKQQGV-----------------
A0A1U7CLW1      ARVERLERLKELFAD----YQKDLTEKRLKFKEMAGSIGT--------------------
A0A142WPR7      THQTTSKDVAELIKEAKDVLLKQLETKEDEYHKFRQDAPLLFA-----------------
A0A3M1TFJ0      LWGQKTRQTEASVAVVVSRLGATLAASRKKLEEFLSSNQTPLF-----------------
A0A517P477      GSMDDREGKLANLRQVLATAEDALDLKRKQYQQFVEASQGGV------------------
A0A517T4K9      RRGERLRRLERIQSNLEEELRTKYMSQRRLAETLHTSD--SET-----------------
A0A7C6B2Q1      ERRERLSELDQLYAEKESELRKLENDLKALSQQLETG-----------------------
A0A7C4QPD3      ERKLALAELQRLHDAEAEQLKIRQNQLRSLDKELLVPN--AAQ-----------------
A0A2Z3GZZ5      ASQDRIATLDRLLEAVKGQRKAAGEHRITHLTELRGIT----------------------
A0A4V0I6L6      VYEDASVRQLKLLDEQIARLKRGLNDTRVQLDEAERKL--RGV-----------------
A0A7C4QQT3      TRNEKSNEVLRLAQNAHDEVLQKLREKEREYQAFREQAPLQWK-----------------
A0A255QXF5      YDNLRISRLVQYLGRQIDELKRRVEEQKEAVAKFAREA--SGA-----------------
A0A518KBI5      EGYRRVQRVVDLLEKERTRRQLEVERLQTYVIDLSREV--TGK-----------------
A0A5C5V6Q5      EQYKQVQRVVDLLEKERVRRKLEVDRLQQYVVELSKEV--TGK-----------------
A0A517MY49      NHRSAASDQLVHLEKQRATLEAELDEKQNQLQVHRERVGHLAI-----------------
A0A2E6AG00      YHRNVASEVVAILHKERKEVEQQLVTRDRQLLNTKRSLGDLGM-----------------
A0A1G3A880      THRGTAGQIMDVLGQEKVRVEAKLDEKKAALLAARRNFGDLGI-----------------
A0A2E8ATT1      NHKDVSVEVVTILEKERQVTEAKLEQKKRSLLELKRQIKDFGL-----------------
A0A7C2JZW2      ARKDRLDGLRKLLTEEEDRLKSQREALKLVDQNLEAAT--DSQ-----------------
A0A518KYQ0      YDNRRIGRLENWLTPQVEQLKRKVEEQEKLVAQLAKES--HGV-----------------
A0A5B9QX47      FDSSRMRNLERWLEPETTRWEQEVESRQLRVQELSARL--MGY-----------------
M5T666          FDDTRVNNLERWLEPEIQRWEQEVEERQQRVHMLSEKA--LGF-----------------
M5U6N6          FDDTRINNLERWLEPEIQRWEQEVESRQQRVHMLSEKA--LGF-----------------
A0A517M0G2      LDNDRVSNLESWLTPSIDQWKNEVHVHGERVRDLSKVV--IGY-----------------
A0A5C6AST1      LDSERVSNLESWLAPSIDLWKSEVQSHEKRVRELSKTA--LGF-----------------
A0A5C6C951      LDGERVSNLESWLAPSIELWKSEVQAHEKRVRELSKAA--LGF-----------------
A0A5C6C5T3      FDNTRVNNLERWLDPEIQRWEQEVDERRKRVQLLKQKS--FGY-----------------
A0A2A2W6A9      FDNRRIGRLESWLTPQVEQLRRKVEEREHLVSQLAKEA--HGV-----------------
A0A518HQS9      YDNRRIGRLEQWLTPQVEQLKRKVEEQEKLVSQLAKEA--HGV-----------------
A0A5M6DFE6      MDTNRVNSLINYLTPAIRDREKKVQEKQDIVQKLSEKT--LGY-----------------
A0A5C6F286      FDDARVNDVERWLEPEILRWEQEVEKRQSLVQALSEEA--LGF-----------------
A0A517NGN1      FDSKRTNNLERWLEPEIQRWEAEVSNRQSRVQSLSERT--LGF-----------------
M5RUI3          FDQARMVKVERGLEPEIQRWQQEVEQRHHRVQKLSETL--VGF-----------------
A0A660VT66      ENRES----LSFYTTQLKALEAQIADCNERINDFIHRNGLITP-----------------
A0A7C2VEF7      RKQTTVSKVLDILQKEKVKRDRELSDKYEEMVQFTRENGVVSF-----------------
A0A0S8H0S8      GNRSTAREILKTLRSEKARQAEELTANFQAMEEFKRANGIISL-----------------
A0A7C2ZTD2      SSAQGQDRRLTVLEDERRVLAEKLQRQRKTIRQLAQEYGTTAL-----------------
A0A2E3Z6T8      ------------------------------------------------------------
A0A257WQ92      ----------LAAEEQRRLNLLRKATLQSRLKSVETAVANNEP-----------------
A0A7C1U6X6      ----------MKYVDETASGQKKDEDRKRDELFLKLQTEI-SD-----------------
A0A7C7UXI5      ----------LELNSALTEAIEDRLEAEAQYRAVDQAVRNGED-----------------
A0A7C3SFJ0      ----------LYALETTNTLRDRITRLQQALSGIEQRIAIGEA-----------------
A0A7C7WWF7      ----------VLINNRLAEVQQERIELHAAQIAIRQAVASDTD-----------------
A0A356ETW1      ----------LYFADELSKIERKRIDLQPTLARVQTAVRNGED-----------------
A0A3L7NJY1      ----------KLLAAEYSEARRATEESRTRAASLNRAIANGED-----------------
A0A523CME0      ------------------------------------------------------------
A0A354PCV3      ------------------------------------------------------------
A0A354PHB4      ------------------------------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A538RV31      ------------------------------------------------------------
                                                                            

M5S2L2          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A7C2VXA0      ------------------------------------------------------------
A0A7C3AA48      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A7C5PFV3      ------------------------------------------------------------
A0A7C3QGD2      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A7C2ZUK5      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
A0A7C2JY73      ------------------------------------------------------------
A0A356AE44      ------------------------------------------------------------
A0A1G2XSU7      ------------------------------------------------------------
A0A350KD81      ------------------------------------------------------------
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      ------------------------------GETAGIIEQKLEGLKSNLTEIKIEKIKL--
A0A524HC32      -------------------------------------DSKLNSIYRQLEELNSVITVA--
A0A177PV03      ---------------------VSETLLTNLRTRRSNETILRDSLQRQVKDLDHAIKIG--
A0A1G2YIM0      -----------------------TGRQDMMLQQVTMLQSEMTRIQTQKLSLEAQIMML--
A0A7D8YCU5      ---------------------SSGEAVNPFRQDALAIEESLRRVRSETRQIDSKLRLIDD
A0A353BE27      ---------------------IGDDVNDPYHATWETLHKKLIDIRSRKSEIDALTTQVRK
A0A5C6BPW1      ---------------------ELSLDIAADNAFTRQLQDQWFNHTILRNKLRLETQITEK
A0A1I3GSP0      ---------------ASPIVSINGMPAPAQNQYETELASIETAQNENLRKRSSIQARLAT
A0A517QJV1      ---------------ASPIVGANGVPVPPQSRYEAELSSIEEEQNEGQIKQSGIEAKLSE
A0A3C1QS25      -------------------FWNAEGIINLEQQRMQELDAHIRQLELQKTEYQSQLDRIAQ
A0A5C6FX55      ---------------------EQGNAINPHRVRVQELMADRGKLVQEYVDAELTYRSIKQ
A0A5C6DS51      ----------------------GDQVRDVHKNRLDQLEQELTDVRSSLAEAKSRLIVISS
A0A5C6DSL6      ----------------------GDQVRDLHKNRLDQLEKELAEVRSSLAEAKSRLIVISS
A0A3M1VG27      --------------RPTVADESSQDVISVHIDEVQKIQQALSGVTVEQTVVRSKIRALEE
A0A518GC22      ---------------------TGDEATDPYSVNFLKLNSKITELRVERGRLESVYSQALK
A0A3L7Q373      ----------------------TTPAVTAQGTPLAQQSIYQAKLSDVITRQSANEALLRS
A0A3E0PW54      --------------------------TPPTVAVNGSVIPGKNPYQARVEKIGTDLSRNRV
A0A7C3TAH2      ----------------------------------TFLDSRQDMVTQRLASLMAELSRIEA
A0A1Z8MHR4      ---------------------LDGQAINPHRERQVMLQKNRLDLEQQLRLLSSDLRLAQK
A0A5C6EHJ0      ----------------------GNETTSLHRDNADRYMAQRQNLLIQKAKISGLLAAARK
A0A5C6F1H9      ----------------------GNDTTSIHRDNADRFMAQRQDLLIQKAKLSSLLSSTRK
A0A255QXY0      ---------------------TQGNVINPHRQHYDHLQTMRQGLERRRRQLGTELTFVTN
A0A517SYI0      ---------------------LDGQAINPHRERQVMLQKNRLDLEQQLRLLSSDLRLAQK
A0A518HX54      ---------------------PNGQVVNPHRQRQFQLQSFRDQLEQKQRQLDCELRFAES
A0A5B9MF59      ---------------------VEGQAINPYRERQFQLQTYRTELEQKKRELNSDLRLAVN
A0A2A2WC24      ---------------------VEGQAINPYRERQFQLQSYRTDLEQKKRELNSDLRLAIN
A0A518KYW8      ---------------------VEGQAINPYRERQFQLQSYRTELEQKKRELNSDLRLAIN
A0A5C5YZZ0      ---------------------GKGEAINPYRDDAIRLEESLHALETQSRQLNSKLRLIRE
A0A518JLD2      ---------------------DDKIASVHRENSGVYLSQIQSLTLERAKLNSVMDSAKLA
A0A5M6DJ15      GKVNFNLLRAEGELEAYQQLLAGMEATRAKLEKELDAMRKSNAAGEQAESKGSNIAKQDG
A0A3L7P7S7      ---------------------TTSGVVN----RQKLLQEKSNGLMNRLDRVRARQEELTD
A0A517N8M1      ---------------------SEGKAINPHRERQLFLVGSRSEVVEKLRQKSVEVAAIES
A0A5C6CW01      ---------------------SQGEAINPHRESQLFLTGKRSELNEQMRQKATQLAAVES
A0A5C6BXS9      ---------------------EQGVAVNPHRERQLYLTGRRSELFEELRQRSVELTAIET
M5U569          ---------------------EEGKAVNPHRERQLYLTERRSELFEQARQKSIELASIKS
L7CND7          ---------------------ENGKAINPHRERQLYLTARRSELFETLRSESVELSAIES
A0A0J1B8S4      ---------------------ENGQAINPHRERQLYLTARRSELFEELRKKAIELTAIDS
F2ARR3          ---------------------QNGAAINPHRERQLYLTERRSELFEHLRQKSIELTAIQS
K5D8H6          ---------------------QNGAAINPHRERQLYLTERRSELFEHLRQKSIELTAIQS
M2AKU0          ---------------------QNGAAINPHRERQLYLTERRSELFEHLRQKSIELTAIQS
A0A5B1CKI2      ---------------------AEGLAINPHRERQLFLVGRRSEIDEIARQKKTEVAALKS
A0A5C6EG84      ---------------------SEGIAINPHRERQLFLVGRRSEVVEKLREKAVEVAALES
A0A5C6F2X4      ---------------------SQGIAINPHRERQLFLVGRRSEVTEKLREKAVEVAAIES
A0A5C5XTV6      ---------------------ERGDATNPHRERQLYLTGRRSQLDEELRQKSVELTAIES
A0A5C6AAB1      ---------------------EKGEAVNPHRERQLFLTERRSELYELMRQKATELAAMTT
M5T8W8          ---------------------EEGKAVNPHRERQLYLTERRSELFEQARQKSIELAAIQS
M5SF00          ---------------------ENGEAINPHRERQLYLTERRSELFETLRSQSVELSAVES
A0A2G1WDS1      ---------------------ENGEAINPHRERQLYLTGRRSELFETLRSQSVELSAVES
Q7UVS9          ---------------------ENGEAINPHRERQLYLTERRSELFETLRSQSVELSAVES
A0A5C6B601      ---------------------KDRQVINPHRERQLRLQAEREDLESEAMKYERELKTADL
A0A517PFU1      ---------------------PDGQPLNPHAADLLALDRARDELSLELSNLTAEV-----
A0A5B9M8J9      ---------------------PDGQVVNPHRQRQFQLQAFRDELEQKQRELDCELRFAES
A0A2A2WFP6      ---------------------PNGQVVNPHRHRQFQLQSFRDQLEQKQRQLDGELRFAES
A0A518L8N2      ---------------------PNGQVVNPHRHRQFQLQSFRDQLEQKQRQLDGELRFAES
A0A518HQN9      ---------------------VEGQAINPYRERQFQLQSYRTELEHKKRELNSDLRLAIN
A0A5M6D8H8      ---------------------LEGQAINPHREQQFRLQAHRTELQQRMRQINSELRFATS
A0A5B1CRW9      ---------------------GD-KVRDVHKERLSDMETELNEVRSLLAESSSRLQVIQA
A0A5C6EI46      ---------------------GD-KVRDIHKERLSDMETELNKVRSSLAENESRLQVILT
A0A1G2ZG92      -------DTETQNLI---------NKIATLQGEYEDNEKTILESRRKIVDSNKKLKEM--
A0A1G3A0W0      ------------------------LGTATPGELVSSKRVRLDQTKARLNELKQSIALL--
A0A2E7D3V4      -------RPPGTESSPADVVNVHQDRLEAIDAERRKNLLEREDLQSKIAVFEEAIASG--
A0A5B9PER9      ------------------------GNSNIHAVMVVQLAKSMQAMREELGKLQNERAKN--
A0A517QSM4      ------------------------SKRQLEYEYYGQLREEFTRLRFELMQANIQLAAR--
A0A355GJI7      ------------------------------------------------------------
A0A1Z8MCI4      ------------------------RSAGIPLDEMTQQREFLASLKRAHMDATMQLKAV--
A0A517SYL7      ------------------------RSAGIPLDELTQQREFLASLKRAHMDATMQLKAV--
A0A3L7P0L2      -------SSPVVSAQGVPT-----SMPSPYQANLQDLVTRRNLNRDQLRKTKIKIDQL--
A0A6M5YVJ1      -------ETQA-------------LNDSLLRDDLRNATRELSVVRDQLQRAELDLRAA--
A0A2E0SHG0      -------DS---------------DSVNVYLNTLNDYETQLRLLQFQRYASESRLEII--
A0A518CQB8      -------TG---------------DTVNVYLNSLNDYETQLRLLQFERYAAESRLEII--
A0A517SCC8      -------TPVIV------------TAQGTAMPGQSPYMVELDRINTAVRDNMLKRTAV--
A0A3A0DR44      ------------------------VPAKGDTGAAGSVLSPVFALQQRLVEIEADREVL--
A0A358MY60      ------------------------FDPNNPVESLEYDLSTLSNLRKEVQDMRVQESWL--
A0A517MNB1      ------------------------FDPTMRVEGLENDLSVLGSLRRDLADLIVEESIL--
A0A142YJ13      -------TASA-------------VRQQMMVEHLGLARQELMRLQSDVRRSQARLNVL--
A0A517Z7D3      -------TPPIV------------TANGMVAAGQSPYQARVERIRQDRNENDIRKAEI--
A0A1N6KY57      -------STIA-------------TIHQHELDRLGRAEDELSRIQSELRSLRIESEVL--
L0DK20          -------KTIA-------------NIHQHELDRLGRAEDELARVQSELRGLRVEHEVL--
A0A3L7UX05      -------ELIK-------------DRSRLTLEDYTRMSRDLSQLEFERITAESRVERL--
A0A517XRC2      -------EDTN-------------KQLSTLKL----METQLSQEVAALKTINQDNELL--
A0A6M5YH47      -------EDNS-------------LQIGLLHRQHAEAEADYNKTTREISRLESELSVL--
A0A660UUK3      -------D----------------GRQEIMLQTVARLQDDLDGVTIRRIELEAQVNMY--
A0A517ZHG5      ------------------------EELSLDIAADNAFSRELQQQYFDLTIMRYNLKLE--
A0A1Z8MPL5      ------------------------ATQQLLLDQILYLRRQISEVREQSVQKQRDLRAY--
A0A7C1EH96      -------TP----------------RQEIALQQVATLKQEQISIGVQRMQMEARVQAK--
A0A5C1AGE3      -------MNAP-------------QTPEMFNEKVKDVGDELRKARSAKREAEVKLAAL--
A0A2Z3HEL7      -------GDAN-------------GSTQLLHIKFGELDRMFTAANHELGDLQSQLSVY--
A0A142XAP8      -------EATS-------------NALALLQKQHVEADALFVGAGREIEKAEAELKVV--
A0A6P2DEK1      -------EATS-------------NALALLQKRHIEADALFVAAGREIEKAEAELKVL--
A0A5C6C1R5      ------------------------IAQQLSVERYGHVQTELGKVNFDLMRTQGEVEAY--
A6BZU4          -------STPGSEAAVAGSTNVHQERVKAIDNERRLNLLKLTELKSKIDSLKAAIASG--
A0A2D5GZ77      -------STPGSEAAVAGSTNVHQERVKAIDNERRLNLLKLTELKSKIDSLKAAIASG--
A0A3D3R1Z6      -------STPGSEAAVAGSTNVHQERVKAIDNERRLNLLKLTELKSKIDSLKAAIASG--
A0A517XG00      -------STPGSEAAVAGSTNVHQERVKAIDNERRLNLLKLTELKSKIDSLKAAIASG--
A0A1G2YRE4      -------I----------------DRQDMKLRRVTALQSTLTAVEARRISLEAQVQFL--
A0A353Z859      ------------------------GDNETAAEAAKARESFYADIRKQSVMAKIEKTKI--
A0A2D6ST10      -------RD---------------WKYQNDLAIQRSLIAEFRQVKVQLINLRFDQTHL--
A0A177QX42      ------------------------NTATLIFQDNKGINYYEERLRKIEDERHQKMIAL--
A0A517SHR0      ------------------------NKAQLLFQDNKGINYYEERLRKIEDERHLKMLEL--
A0A2E0AW64      ------------------------WDPYAVAQTESDPGASALSYEKQLAKLAIDQAIV--
A0A351FZ59      ------------------------WDPYAVAQTESDPGASALSYEKQLAKLAIDQAIV--
A0A660V239      ------------------------FGSTELTSRQEMMLQQVTSLRNELINVNIRRISL--
A0A177Q3B7      ------------------------GDAQVLAVKQRYAAEALGQAERELLQTQSELRRA--
A0A2E0X6Y6      -------SS---------------KDGLTDPIIQQALRVNEMLMDAQQQRLQLQATLA--
A0A518GFD7      -------LT---------------VAQQNALQQYGLMQEKLSTIQFALMQAEGEMKLA--
A0A5C5VZJ8      -------SP---------------------AEVVVKRQVALDERRAELWTLRKEIALD--
A0A518GE37      -------DP---------------FKESSPRERDASQ---MVQVRSELSNIEAEKTVT--
A0A5C6F3H8      -------AP---------------GKAIEKAENESNLAL-LTQLRSEIGDLKIELSLF--
A0A5C5X072      -------AP---------------GQSVDRNDSEAHMSR-VAALRSQIGDLKIELALF--
A0A5C5WUQ3      -------AP---------------GQRLDVIEDQSSLSL-MTHLRSQIADLSVQLAID--
A0A5C6E697      -------AP---------------GENAASLESDSNLSL-MARLRDEIADLNVQLAVM--
A0A5C5Z1A3      -------AP---------------GRATSVAENNDNMSL-LAKLRADIADLTVELSIA--
A0A5C6D2P7      -------SP---------------GERVSTLEDSSSFSL-MTRLRQQIAELNVEISVL--
A0A5B9ML17      -------DPGSPLGF---------SRNESRLALLNGYESQINDLRVDIFELEGKLQLE--
A0A518HFS8      ------------------------QKGSALRQQMVA--EHLGQSRREL--VQLQSEIR--
A0A5Q3LBQ3      ------------------------PFGPNPVSEVISLEHPLGNLQKRLTEAEVHREVM--
A0A517LX75      -------GE---------------ELRSVPHERLKGIEQELAEIRSQLAYAKSRYEMI--
A0A7C5W7B3      -------MP---------------KDISRTLDRIEELNRTIEETRLAIIEVEQRVNTY--
A0A2S8F9B8      -------LS---------------LAQQGSVQHYGLVRNELAQVRFDLMRSEGELDFLTS
A0A354GX32      ------------------------RRDLLGLKDPLTLGKELDSTQDLLKTPQSQRLLL--
A0A142XL75      -----------------------------GTKDEATLMTFDSFLRDELRLAQRDLQNA--
A0A6P2D5D5      -----------------------------GTKDEATLMTLDAILRDELRLAQRDLQTA--
A0A5C1AAF0      ------------------------MQQQLAHEQYGTAQREYVKLQSDLRRLRLEESSL--
A0A7C7T8W8      ------------------------TSLPAFQIGDPTSPLLMSAPHRPMLELNKRLGAL--
A0A5C6B3S0      -------LS---------------LKQQNTLQQYAIVRNELTKLHFESMRARGELETL--
A0A368KP63      -------LS---------------LAQQGSVQHYGLVRNELAQVRFDLMRAQGELDFLTS
A0A518GIZ9      -------APIGAIAADG-------TSGATNVHQERVIAVEEQRRLNLLRRTEINSRMQ--
A0A1C3EBY9      -------APIGAIAADG-------TSGATNVHQERVIAVEEQRRLNLLRRTEINSRIQ--
D5SX64          -------APIGAIAADG-------TSGATNVHQERVIAVEEQRRLNLLRRTEINSRMQ--
A0A517Z0U7      ------------------------AMQQAKLDLRVELRKQLGAVRLQIIEQEIILQTI--
A0A2S8FCC0      ------------------------GDTASLSLVQQNALQQFAALRSELTKVQLELLRA--
A0A1Z8MBT6      -------SS---------------NNQVSVIEDQSQTSR-LRELIDQRFELEQQISLI--
A0A517SXN9      -------SS---------------NNQVSVIEDQSQTSR-LRELIDQRFELEQQISLI--
A0A518HFL0      -------------------------------ENPEMMQRNLDKLLSP-------------
A0A3B8ZJM2      -------LF---------------NVTEPVNHFFEAAMRNQQQLTAKRLEANQIKSIL--
A0A1U7CLW1      ------------------------SDKQAAAVRQQMMVEHLGLARQELLKLNSDVRKS--
A0A142WPR7      -------KEE--------------GAKNIHQERLAGIEQARSALLIALHEKTAELDSL--
A0A3M1TFJ0      -------ER---------------QEELLIQQIDANNRALEAVRRDRIA-----------
A0A517P477      ------------------------ASTIMAEQRHAGLQELRTMLRGEVTRTELELIRE--
A0A517T4K9      -------VT---------------VKHQLDLEYFSELRKKLAETRFELTRAKIQLAVL--
A0A7C6B2Q1      ------------------------DSQALSLKQQITLQQ-FSTYRSELINVQLRMMRA--
A0A7C4QPD3      -------SD---------------AKRQAQLDLQLELRKQLSLLQPQIIELELALGDA--
A0A2Z3GZZ5      ------------------------------TEDVSSVRTRVSALRDQARALRTDISNL--
A0A4V0I6L6      -------ID---------------------------------------------------
A0A7C4QQT3      -------TPVAGLSADAQATTNVHQERVVAIEDQRKLNL------LRRAELQSRLQAI--
A0A255QXF5      -------AP---------------GERVAEIESAESFLL-IEKLRSQISNLEIQLAMI--
A0A518KBI5      -------DP---------------FGQN-VVDVEKAISP-LASLHQQLTEIEVRIEIL--
A0A5C5V6Q5      -------DP---------------FGHNTLMDVDKAISP-LASLHSQLTDVEVRIEIL--
A0A517MY49      -------SS---------------EDNVVEPMIQAAMSLNEAALEAKQKRLELQAKLD--
A0A2E6AG00      -------RD---------------ASNSLHPLVQRVVQINDSLIEAQQKRIRLQATYD--
A0A1G3A880      -------KP---------------GGQVVHPLVQRAVRLNEALVEAQEKRVELQSALA--
A0A2E8ATT1      -------RE---------------GS--IHPEVQRVLQLNKAIMEVQEERLQLQASLT--
A0A7C2JZW2      -------MD---------------LRRQAKIDEQLEIRREMAKLHPQIIELELLLGAL--
A0A518KYQ0      -------AP---------------GERVAALENSDSFSV-IRNLRSQISDLEIEIALL--
A0A5B9QX47      -------AP---------------TERVDAMEDKNSFSM-MQSLHSQVANLTYELAVL--
M5T666          -------AP---------------GRNVDRAESESSMSR-LADLRSQVGELEIELALF--
M5U6N6          -------AP---------------GQNLDRAESESNLSR-LSDLRAQIGELKIELALF--
A0A517M0G2      -------DP---------------THRVEGLEND--LSV-LAGLRTDLSNMIVEESIL--
A0A5C6AST1      -------DP---------------TQRVEGLEND--LSI-LGSLRRDLANFIVEESVL--
A0A5C6C951      -------DP---------------TQRVEGLEND--LSI-LTGLRRDLANYIVEESIL--
A0A5C6C5T3      -------AP---------------GQSIGRSDSEAHATR-MSELRSQVGDLKIKLALF--
A0A2A2W6A9      -------AP---------------GEKVAALENSDSLSV-AQKLRNQISDLEIELAML--
A0A518HQS9      -------AP---------------GERVAAIENSDSIAL-VEKLRGEISDLEIELALM--
A0A5M6DFE6      -------NP---------------SAPLSSMENQHSISL-FGQLQSQISSLEAEIEML--
A0A5C6F286      -------SP---------------GHALDRAENDTNVAL-LTQLRSEIGDLKIELAMF--
A0A517NGN1      -------NP---------------AARLSVAEDESSLAL-FAELRSKITDIEVKLSVL--
M5RUI3          -------AP---------------GQKIAALENESNMTL-MAELRSRISDLRVKIAIA--
A0A660VT66      ----------------------E---------MWKAFREELTRLRSEVAQQRND---L--
A0A7C2VEF7      ----------------------DNQGGNVVFQKLIKLSEALTEAQLMTIEAQAD---Y--
A0A0S8H0S8      ----------------------ADGKGSIMAQRLGELSAALTVAEVEAILAKAE---Y--
A0A7C2ZTD2      ----------------------G-GRQDMMLQRVASLLAELTKIEARRINLEAQVQLL--
A0A2E3Z6T8      ------------------------------------------------------------
A0A257WQ92      -------------------------------------RDALEVLIRRFLAQDGAAGSE--
A0A7C1U6X6      ------------------------LEFII--------NGLSQKLGTSTPQERISAMRL--
A0A7C7UXI5      ------------------------LQQYV--------FSIMDSVGRQVLLQRLGLDPG--
A0A7C3SFJ0      ------------------------MLKKMGEEGVPDETKQRETLKRKMMEAALAQDPW--
A0A7C7WWF7      ------------------------LRQHL--------LTLEPFLGRELLLSAMGLNPN--
A0A356ETW1      ------------------------LRRHW--------ITVADVVGQEMMMRSFGLSPA--
A0A3L7NJY1      ------------------------ILQFA--------MEALDSAGRQLIEQSMGLGSS--
A0A523CME0      ------------------------------------------------------------
A0A354PCV3      ------------------------------------------------------------
A0A354PHB4      ------------------------------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A538RV31      ------------------------------------------------------------
                                                                            

M5S2L2          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A7C2VXA0      ------------------------------------------------------------
A0A7C3AA48      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A7C5PFV3      ------------------------------------------------------------
A0A7C3QGD2      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A7C2ZUK5      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
A0A7C2JY73      ------------------------------------------------------------
A0A356AE44      ------------------------------------------------------------
A0A1G2XSU7      ------------------------------------------------------------
A0A350KD81      ------------------------------------------------------------
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      ------------------------------------KALSDQIKQYSKDPTLTKLIPEIV
A0A524HC32      ----------------------------------------EADMITKMAAYQQALGDETS
A0A177PV03      ------------------------------------------QGAEMFNDMRRVSAHPQT
A0A1G2YIM0      -----------------------------------EKAEEETLPLEKVLTMKNEILRNDA
A0A7D8YCU5      ALRDQKSASLALRTLQFL--------------------LEDSGSIAPGEVGGMKVVQESD
A0A353BE27      SLNKGHSPESLMRLLAMVSGGGTASANGAWDLEVFRQEQAQTRIRTDEMSRRLEQ-----
A0A5C6BPW1      IGDSLEENPDI-----------------------------QADLIDTLIERDPKM-----
A0A1I3GSP0      LDRKLKDNASR---------------EELEFWVMHSLSTGT-AGAGGGNGGGGASIAGPP
A0A517QJV1      LKRRRERGDSR---------------ESLEFWVTYSLSTGTGAGKSASSGGGAGALSGPP
A0A3C1QS25      LEEEGKTQAVIVFILEQH---EKIK-----------------------------------
A0A5C6FX55      TVEGAEDPRL---AFTIV---SQLLD------RPLSLPKELDATRLAMGADDGEL-----
A0A5C6DS51      YAKRDDTNDVN--DLDKL---ALLSQKEVTRLKLFLDMT-RGETQSVAFQMDQPL-----
A0A5C6DSL6      YADQSKESGVD--DLDKL---ALLSQKEVTRLKLFLDMT-RGETQSVAFQADQPL-----
A0A3M1VG27      AIASGRSPRELTALVKLF---LYSEGHKNAAEAFAAPAD---------------------
A0A518GC22      AIESGRSPETIMMLLTQL---NNASLTALDSTYSQLLQIDDNDLKNRLNSKSAQI-----
A0A3L7Q373      TRSKIG-------ILKEM---MANPEERESIQTYIMSSLAASSSPGGEGGSGAGLVSTPT
A0A3E0PW54      LQSEIASRIATLEELQAS---GESREALEFFVIHWMSQGKSSSGDGESGGGGGSLLTEPP
A0A7C3TAH2      TRIGMEAELQVPEPVDVN---APVIM--PEDVNAIIAGS-TILSRNQYINADPLV-----
A0A1Z8MHR4      TIQRHQDPAIVAQVIGLL---GSLNHEGMTGIKRALNGENQ-------RQDDLTL-----
A0A5C6EHJ0      AMIENQPNEAILLALNSS---LKIA-DGDVDLSKAMSPESRWELEKIRKKPLLSA-----
A0A5C6F1H9      AMEEEQPYEAILMALNSS---FQATDDAAADFTRSMSPEQKWELEKIRSKPLLNA-----
A0A255QXY0      MRTQQRHPELVARVISEL---SDEAHD-LGDVPFGMRKLMD-------VKEDIGI-----
A0A517SYI0      TIQRHQDPAIVAQVIGLL---GSLNHEGMTGIKRALNGENQ-------RQDDLTL-----
A0A518HX54      MRSRHKNPLMVAMIIGQL---SDVFED-SRLMLNGRSSGSL-------ATDDLEM-----
A0A5B9MF59      TRKLHSDPVLVAQIIGHL---GSVVDD-FEPLKQIVGPGSA-------TTDDLTL-----
A0A2A2WC24      TRKLHSDPVLVAQIIGHL---GSVVNE-FEPLRQIVGPGNA-------APDDLTL-----
A0A518KYW8      TRKLHSDPVLVAQIIGHL---GSVVNE-FEPLRQIVGPGNA-------APDDLTL-----
A0A5C5YZZ0      AVKDGTNNYAILQEVQYL---LEDVK--------------DIDTIQQVIEADVPN-----
A0A518JLD2      ISEEKPLESVLMSLRNLA---VDDSK------QDLANDAVALKMSSIERKRIVDQ-----
A0A5M6DJ15      ESSAADSEKLVADSVPPM---DQIPE--------------------EMRLTEVEV-----
A0A3L7P7S7      QMRLAG-------TLSQT---DLLPG-----------------------VGDSPA-----
A0A517N8M1      IIRESGDDPLL--GLSII---GELLD------KKFSLPN-SQGRLSDLQQGDSQL-----
A0A5C6CW01      IYSQ-ANDHLI--AMAVI---SKLLN------VNLELSNVENEITRNLVDADVEL-----
A0A5C6BXS9      ISKE-AKDPLV--RLSII---GQLVG------RTFAIPQ-ATHFNQDMRESDTEL-----
M5U569          IAKE-GKDPTV--SLSII---GQLVG------TTFDIPE-VMQTRQDLREGDAEL-----
L7CND7          IARE-ADDPLV--RLSII---GQLLG------KTFKIPD-SAQISQNMREGDAQL-----
A0A0J1B8S4      ISNE-AKDPLV--RLSII---GQLIG------KNFEIPD-SKRISQDMRDGDVEL-----
F2ARR3          IADE-AEDPIV--GLSII---GQLIG------KTFEVPG-KAVFNQNVREGDEEL-----
K5D8H6          IADE-AEDPIV--GLSII---GQLIG------KTFEVPG-KAVFNQNVREGDEEL-----
M2AKU0          IADE-AEDPIV--GLSII---GQLIG------KTFEVPG-KAVFNQNVREGDEEL-----
A0A5B1CKI2      IVSQSGQDPIL--GLNII---GELLG------KQFSLPN-SGSRLGELQQGDRIL-----
A0A5C6EG84      IIRESKSDPLL--ALNII---GELLG------KSFSMPS-TQGRLEDLQQGDAEL-----
A0A5C6F2X4      IIRESKSDPLL--GLNII---GELLG------KSFTMPN-SQGRLEDLQQGDAEL-----
A0A5C5XTV6      IAREAS-DPLV--GMSVI---GQLVG------KTFTLPQ-ATQFNRDLRESDTEL-----
A0A5C6AAB1      ISKEAK-DPEI--GLSII---GQLTG------KQFDISS-SAPLTQNMREGDMRL-----
M5T8W8          IAEEGK-DPLV--SLSII---GQLVG------KTFKIPE-TLQTRQDLREGDAQL-----
M5SF00          IAREAD-DPLV--RLSII---GQLMG------KTFEMPE-SNQISQNMRDGDAEL-----
A0A2G1WDS1      IAKEAE-DPLV--RLSII---GQLMG------KTFEMPE-SNQISQNMRDGDAEL-----
Q7UVS9          IAKEAD-DPLV--RLSII---GQLMG------KTFEMPE-SNEISQNMRDGDAQL-----
A0A5C6B601      IRQQNP-DPIM--VAQMI---GGSAGL-GDPNRFSEIQS-PMAANVLGLGDDLEL-----
A0A517PFU1      -------ESIR--SSMEV---GGRRAA-LAQMASLKRES-AGENPAI---AELGF-----
A0A5B9M8J9      MKRRHK-NPLM--VALII---GQLSDV-FEDSRLMLKGE-STADLTT---DDLEL-----
A0A2A2WFP6      MRSRHK-NPLM--VAMII---GQLSDV-FEDSRLMLNGK-STDSLAT---DDLEM-----
A0A518L8N2      MRSRHK-NPLM--VAMII---GQLSDV-FEDSRLMLNGK-STDRLAT---DDLEM-----
A0A518HQN9      TRKLHR-DPVL--VAQII---GHLGSV-VDEFEPLRQIV-GPGNTAP---DDLTL-----
A0A5M6D8H8      TFKRHD-DPVL--VAQII---GQMGSD-NDGFDFVSRVD-QSPNPVP---GDLEL-----
A0A5B1CRW9      AQLSND-DAVNADMGQLA---LLSQNE-VERLQFFVNMA-RGGARSEAFQAEQPM-----
A0A5C6EI46      EAEERG-DELAGEMDQLA---LLSEKE-VDRLKFFLDMT-RGSSQSEKFQAEAPV-----
A0A1G2ZG92      ---------------------------------------------------------EKF
A0A1G3A0W0      -------------------------------------------EWKKKALIDDSNNVAFA
A0A2E7D3V4      ---------------------------------------------QSMESLTMLVKFYIS
A0A5B9PER9      -------------------------------------------------ERAAALGPAGI
A0A517QSM4      -------------------------------------QPSLAADGDVNSVSLPAAEPPPV
A0A355GJI7      ------------------------------------------------------------
A0A1Z8MCI4      ------------------------------------------QQELSSLPDADLSDSEGV
A0A517SYL7      ------------------------------------------QQELSSLPDADLSDSEGV
A0A3L7P0L2      ------------------------------KEMMANPEERETLQAWIMNSISSSSSGGPG
A0A6M5YVJ1      ----------------------------------ETPNAAPEAGGKGGAGTAPPGREAVV
A0A2E0SHG0      --------------KESL---KPENREKYNDFQRLALISAESVERMGLILSVENLGVQIA
A0A518CQB8      --------------KESL---EPENMERFTDYQRLALVDSKHVERLGLLLSVENLEISVA
A0A517SCC8      --------------------------------EAKLKTLKDMLARNEPREAIQMRVLWSL
A0A3A0DR44      ------------------------------------------NAQIAAYGQPVASKPPKI
A0A358MY60      -------------------------------ETAVTRQLDTNATPFNLNE---ELLVPEP
A0A517MNB1      -------------------------------EAKIAMRKAGGKDIREVVKTLPEITIPEP
A0A142YJ13      ----------------------------------------------KSQPTVATTSNQDF
A0A517Z7D3      ---------------------QSRISVLQDMIDKGESRETLEFFVLQWFSSGSAATQGSG
A0A1N6KY57      -------------------------------------------------HEKAALNQMMV
L0DK20          -------------------------------------------------QEDVARNSSMI
A0A3L7UX05      --------------------------------------------RGELAQPPVIAQRQNL
A0A517XRC2      -----------------------------------LEKVKEKVEQAKTDKTKLDADTLML
A0A6M5YH47      -----------------------------------EKQLAEKEPKAPPSPVLVD-EQVRT
A0A660UUK3      ---------------------------------------------------EKDVSEPLP
A0A517ZHG5      -------------------------------------------TRITEKIGDTVEENPDI
A0A1Z8MPL5      --------------------------------------------------------EQQV
A0A7C1EH96      ------------------------------------------------EEQLNEPLTAED
A0A5C1AGE3      --------------------------------------------DDQVKAANDEAAS---
A0A2Z3HEL7      --------------------------------------------QDQLEERKRDPKKFAA
A0A142XAP8      --------------------------------------------QKQLED--KDPKT-PP
A0A6P2DEK1      --------------------------------------------QKQLED--KDPKT-PP
A0A5C6C1R5      ------------------------------------------QQLSERMRRQAELIATEL
A6BZU4          ---------------------------------ESKETLELLAQQFLMGQTRGQAANGNT
A0A2D5GZ77      ---------------------------------ESKETLELLAQQFLMGQTRGQAANGNT
A0A3D3R1Z6      ---------------------------------ESKETLELLAQQFLMGQTRGQAANGNT
A0A517XG00      ---------------------------------ESKETLELLAQQFLMGQTRGQAANGNT
A0A1G2YRE4      ----------------------------------------------------EQIKEQSI
A0A353Z859      ------------------------------------------NAELSLRERQEKIEGKDL
A0A2D6ST10      ------------------------------------------------ENDKASGQPAEV
A0A177QX42      -------------------------------------------------------QELQA
A0A517SHR0      -------------------------------------------------------QQLSV
A0A2E0AW64      --------------------------QYQIERAQGIHQKVEENLNAQSESIEISDTDLAT
A0A351FZ59      --------------------------QYQIERAQGIHQKVEENLNAQSESIEISDTDLAT
A0A660V239      --------------------------------------------ETQIQVQEGGLQEVAT
A0A177Q3B7      ---------------------------------------RLAGEVKRRRIKAITEKGLSG
A0A2E0X6Y6      --------------------------AVEEAVATGADVFQHLAGLEESVAAQMLQMTLGI
A0A518GFD7      ------------------------------SEFDQRLRTQAAELAADSQSEEGGLVAARE
A0A5C5VZJ8      ---------------------------------------EKRLERAKAQHAASTDAGDAA
A0A518GE37      --------------------------------------RGRINALQSQADNPSEEKLPPL
A0A5C6F3H8      ---------DAGL------------------YDGGNLAASPVLAAAPMVVPEAVVKRGKP
A0A5C5X072      ---------DAIV-----------------EAPLPLDSDESLAAATPAIAP-TEIQKQVI
A0A5C5WUQ3      ---------DAQI-----------------AMQDDSEPLPSLVASTPFVPPAISIQKQVP
A0A5C6E697      ---------DAQL-----------------AMHDKE--GSDFEPEAEILAETALSAARKP
A0A5C5Z1A3      ---------DAQL-----------------AMKGEAQSAMVLDVNSTFVPPIIKVQRREP
A0A5C6D2P7      ---------DAQQ-----------------AMKDSGVLVSGDPMSDSLVIP-------EP
A0A5B9ML17      ----------------------------EMEQANHVKEDAGEFVPEAFIPPPSEVTRNVI
A0A518HFS8      ---------------------------------------KARAEVTVLAEDAATPAAAAH
A0A5Q3LBQ3      ---------------------------------------EARLKVY---QEAIHARPVEL
A0A517LX75      ------------------------------DDLEGAKQEGEPTDIERLALLSAKEIDRLK
A0A7C5W7B3      -------------------------------------------------------QAILT
A0A2S8F9B8      SNKAKMEAQAVAGNATAE---PGKQENSGTGQTPAEDKGNSANSSGEEDADGSSDASEEI
A0A354GX32      ------------------------------ELDLAKSESELSILNERIKAPEKLTVSETA
A0A142XL75      ---------RENLELAKP---TPKIGINSLDEEGAALTLPWDLGVVEIVPPLSPAELRAQ
A0A6P2D5D5      ---------TENVALTVS---SPP-GAKSLEEWGPVLTLPWNLGTIEPVPPIPPAESRSR
A0A5C1AAF0      --------------------------------------------------KAGAVVPRTP
A0A7C7T8W8      ------------------------------------EARRSELLAKQAAAQTLLTEIQNE
A0A5C6B3S0      -----------------------------------------------KKQVIGPALPDAV
A0A368KP63      SNSSSQAADKAQAEPSKE---VEKTVSGENAALPVGSDQALVADAATVEGEQSEEIEPQL
A0A518GIZ9      ---------ALQK-----------------AQDQGESTSTMEMLIRRFIANDGSGAELQQ
A0A1C3EBY9      ---------ALQK-----------------AQDQGESTSTMEMLIRRFIANDGSGAELQQ
D5SX64          ---------ALQK-----------------AQDQGESTSTMEMLIRRFIANDGSGAELQQ
A0A517Z0U7      ---------EGTQE----------------------------------EGVELAIPEAVV
A0A2S8FCC0      ---------RANVLGMEP---REA------PVEKDAVVAKKPVVDGDKEAPEASVANSDE
A0A1Z8MBT6      ---------EQDLESIEA---GEN------PLAVISGDLLEEMDEQDFTPPRSMVKKRLV
A0A517SXN9      ---------EQDLESIEA---GEN------PLAVISGDLLEEMDEQDFTPPRSMVKKRLV
A0A518HFL0      ------------------------------GASGDGISGNPDLEVELSEYQRLHQSLLEL
A0A3B8ZJM2      ---------DTVETAMKS---GDFRAQELLLLINDSSDLVKSTIFDQLFEDQDLAGKAML
A0A1U7CLW1      ---------QARLNV--------------------------------LASKPELEPTSNQ
A0A142WPR7      ---------KNA------------------MARGGNREALALIINANKESRENGLPQEKS
A0A3M1TFJ0      ------------------------------------------------------------
A0A517P477      ---------RAKQSYRD-----------------------------------SVDDEFEL
A0A517T4K9      ---------EN-------------------ARKEAEERNRASEETESVADDKKSVTDTDG
A0A7C6B2Q1      ---------QGELSLKK--------------------------------ALRDKAAQLQV
A0A7C4QPD3      ---------DAAAAADA---------------------------------EESAAKALSV
A0A2Z3GZZ5      ---------DAQVEL---------------VSRTGPAPE---------------------
A0A4V0I6L6      ------------------------------PATGAVLVPGISQETPERVQQRISDNRSAQ
A0A7C4QQT3      ---------DA-------------------AVREGAHREALELMIRQFLNHDGTAAAEQR
A0A255QXF5      ---------DAGVS----------------IRNPSADDNIDDLPMTHFVPPYIPVVKGKI
A0A518KBI5      ---------KAEL--------------------------------QSIEETPIVTQTHED
A0A5C5V6Q5      ---------HAEI--------------------------------QSLEESEVTIAPHAD
A0A517MY49      ---------SVKE-----------------SVEQGETIN---LGADSTAGQEMLLASLGL
A0A2E6AG00      ---------AVQL-----------------AMREGRDLRQYVTAVEPVVGREVMLAALGL
A0A1G3A880      ---------AIQN-----------------AVRSGADLQHHLLSVEEAVGREILLTGLGF
A0A2E8ATT1      ---------SVRS-----------------AVRSGKDLRQHLINLEPVVGDRLISSALGL
A0A7C2JZW2      ---------A--------------------TSDSAEPAGDEPRAVEGSAPESAAGPLSAA
A0A518KYQ0      ---------DAGVG----------------IRNPLSSSELGESSIEEFVPAVEKVKRGTI
A0A5B9QX47      ---------DAHHAMRE-------------ELRGEQGLESPED----------SVKRIEP
M5T666          ---------DATKDLPV-------------ALPPSETAQLPDA-PVVPTLAETEVQKAAI
M5U6N6          ---------DATEDFP--------------ALPLENTSSSPQAIPSVPAVADIKVQKRIV
A0A517M0G2      ---------EAKVAMNA-------------AMGEESANTDLDRSKVR-----------TP
A0A5C6AST1      ---------EAKVAM---------------HNAGIPDKTDIDVKLPELIIP-------EP
A0A5C6C951      ---------EAKVAM---------------HEAGVSGESDRNIELPKLEIP-------EP
A0A5C6C5T3      ---------DVMAAELPA---LEVGGSKVPDPAPAAA---------------VEIQKATV
A0A2A2W6A9      ---------DAGVG----------------IRNPSESDDIIVPSVAEFVPPEIRVQRGEI
A0A518HQS9      ---------DAGIG----------------IRNPSASDNIIVPSVAEFVPPVIQVERGEI
A0A5M6DFE6      ---------DAIEKGQR-------------QDRENLASNGENLDYPKFVPPIIDVRRDIL
A0A5C6F286      ---------DAGLADSG-------------FSAGGAAKTGLTPGSVEAIVVKRAEPRESQ
A0A517NGN1      ---------DASEAMANE---VEIENVSDLAAADSVSVMDLDAAGVAFVPVRREVRRQSI
M5RUI3          ---------DASRVS---------------AAGEAEFVPPVEAAVIPSAVVERHVPSEQE
A0A660VT66      ----------------------------------------RIRTRRCKEIEKVRSEGGDL
A0A7C2VEF7      ----------------------------------------EAVKAIADDPAQVKQFAAAL
A0A0S8H0S8      ----------------------------------------DAARAMMNDPGRMRYFAEQG
A0A7C2ZTD2      ----------------------------------------EQTKEQVIAPEDLLKM----
A0A2E3Z6T8      ------------------------------------------------------------
A0A257WQ92      ------------------------------------------------------------
A0A7C1U6X6      ------------------------------------------------------------
A0A7C7UXI5      ------------------------------------------------------------
A0A7C3SFJ0      ------------------------------------------------------------
A0A7C7WWF7      ------------------------------------------------------------
A0A356ETW1      ------------------------------------------------------------
A0A3L7NJY1      ------------------------------------------------------------
A0A523CME0      ------------------------------------------------------------
A0A354PCV3      ------------------------------------------------------------
A0A354PHB4      ------------------------------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A538RV31      ------------------------------------------------------------
                                                                            

M5S2L2          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A7C2VXA0      ------------------------------------------------------------
A0A7C3AA48      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A7C5PFV3      ------------------------------------------------------------
A0A7C3QGD2      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A7C2ZUK5      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
A0A7C2JY73      ------------------------------------------------------------
A0A356AE44      ------------------------------------------------------------
A0A1G2XSU7      ------------------------------------------------------------
A0A350KD81      ------------------------------------------------------------
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      KDGSINT----------------------------------------------LKAKYAD
A0A524HC32      NLPQVLK----------------------------------------SNLVANLKDKYAQ
A0A177PV03      GNTKLDE-----------------------------------------KLWELYMQMAL-
A0A1G2YIM0      QEQSLS--------------------------------------SQISQLEQALIVANQT
A0A7D8YCU5      RELEIQ-----------------------------------------EKLAPMVIRLEL-
A0A353BE27      -----------------------------------------------EQLNPLRIQLEV-
A0A5C6BPW1      VDLSIK-----------------------------------------ADAIEATIRRYE-
A0A1I3GSP0      EKGALD-----------------------------------------SQLLTARLLEQR-
A0A517QJV1      EKAALD-----------------------------------------QQFLTARLLEQG-
A0A3C1QS25      EDKEKNS--------------------------------------EETDILELRLNLER-
A0A5C6FX55      ASMEVQ-----------------------------------------EELAPLKADRDA-
A0A5C6DS51      RAEAARA--------------------------------------QYNRLLDLLQKERT-
A0A5C6DSL6      RAEAARA--------------------------------------QYNRLLDLLQKERT-
A0A3M1VG27      APDVVR-----------------------------------------TQLVPLYLEEQR-
A0A518GC22      EQ---------------------------------------------QILFPLQVEERV-
A0A3L7Q373      GKAELD-----------------------------------------QQLLVNRMLERR-
A0A3E0PW54      VRAELD-----------------------------------------KRFLDLQLMRDR-
A0A7C3TAH2      QDLT-------------------------------------------RRIIDLEQELIV-
A0A1Z8MHR4      QRLEVQ-----------------------------------------RKLIPLQIKRDQ-
A0A5C6EHJ0      AERFRQ-----------------------------------------ERLLPLELERET-
A0A5C6F1H9      GERMRQ-----------------------------------------ESLLPLQLERES-
A0A255QXY0      QQIEIE-----------------------------------------KSLVPLKIKLEQ-
A0A517SYI0      QRLEVQ-----------------------------------------RKLIPLQIKRDQ-
A0A518HX54      QKIEVE-----------------------------------------KKLVPLVIRREQ-
A0A5B9MF59      KKLEVE-----------------------------------------RTLIPLQIKRDQ-
A0A2A2WC24      KKLEVE-----------------------------------------RALIPLQIKRDQ-
A0A518KYW8      KKLEVE-----------------------------------------RTLIPLQIKRDQ-
A0A5C5YZZ0      SEWELQ-----------------------------------------TKLMGLRVRADT-
A0A518JLD2      LRTSARI--------------------------------------REEKLLPLEIERKK-
A0A5M6DJ15      STILAS-----------------------------------------DNIYQRLYNESRQ
A0A3L7P7S7      SEVNLTR--------------------------------------NQEIRILERKVKQL-
A0A517N8M1      ASNNLA-----------------------------------------QELVPLMIERDK-
A0A5C6CW01      AQLKLD-----------------------------------------QQLVPLIIERNK-
A0A5C6BXS9      KQLELD-----------------------------------------QKLVPLMIERNK-
M5U569          KQLELD-----------------------------------------QQLVPLIIERNK-
L7CND7          AQIELD-----------------------------------------QQLVPLMIERNK-
A0A0J1B8S4      AQIELD-----------------------------------------QQLVPLMIERNK-
F2ARR3          AQIKLD-----------------------------------------QQLVPLMIERHK-
K5D8H6          AQIKLD-----------------------------------------QQLVPLMIERHK-
M2AKU0          AQIKLD-----------------------------------------QQLVPLMIERHK-
A0A5B1CKI2      ATIGLD-----------------------------------------KELVPMIIERDK-
A0A5C6EG84      AKNNLA-----------------------------------------QELVPLMIERNK-
A0A5C6F2X4      AKNNLA-----------------------------------------QELVPLMIERNK-
A0A5C5XTV6      QQLQLD-----------------------------------------QKLVPLMIERNR-
A0A5C6AAB1      AQIELD-----------------------------------------QQLVPLMIERNK-
M5T8W8          KQLELD-----------------------------------------QQLVPLIIERNK-
M5SF00          AQIELD-----------------------------------------QQLVPLMIERNK-
A0A2G1WDS1      AQIELD-----------------------------------------QQLVPLMIERNK-
Q7UVS9          AQIELD-----------------------------------------QQLVPLMIERNK-
A0A5C6B601      ERLGVE-----------------------------------------QQLVPLETERAE-
A0A517PFU1      EEQHLD----------------------------------------------LILQLEE-
A0A5B9M8J9      QKIEVE-----------------------------------------KKLIPLEIQREQ-
A0A2A2WFP6      QKIEVE-----------------------------------------KKLVPLVIRREQ-
A0A518L8N2      QKIEVE-----------------------------------------KKLVPLVIRREQ-
A0A518HQN9      KKLEVE-----------------------------------------RALIPLQIKRDQ-
A0A5M6D8H8      QKIEIE-----------------------------------------RSLIPLEIKREQ-
A0A5B1CRW9      RQEVAKA--------------------------------------HYNRLLDLIQKERA-
A0A5C6EI46      RQEVAKA--------------------------------------QYNRLLDLIQREKA-
A0A1G2ZG92      RKESKEL-------------------------------------TRSDALKSLQTKLDGY
A0A1G3A0W0      SSPAIQS------------------------------EYSDD--EEWRKLDYDVRAMKLQ
A0A2E7D3V4      TSEKAVA-------------------------------------PQTIVTGLPGQENTAQ
A0A5B9PER9      SARIWEM------------------------------REQQQLSGERYQPQRGSQTATLR
A0A517QSM4      PQELLNE------------------------------RINSS--PEYQRISNSIRELEWS
A0A355GJI7      ------------------------------------------------------------
A0A1Z8MCI4      RVAELED-------------------------------------GEATDLTRLRAGLVAE
A0A517SYL7      RVAELED-------------------------------------GEATDLTRLRAGLVAE
A0A3L7P0L2      AEGGSSG-------------------------------------GGLLSSPAGKMELDQQ
A0A6M5YVJ1      SPAQIDE------------------------------ELRQD--ADLRELEARVVQAQLT
A0A2E0SHG0      TNTATTE------------------------------VSQANQILRAKTADTEFDTLVSA
A0A518CQB8      TNAATSE------------------------------AFQAQQYTRAETANTEFDKLLSA
A0A517SCC8      STGTVAA------------------------GGAEGGGGGGGGGGSILASPPGKAELDSQ
A0A3A0DR44      PDDVLDV------------------------------EVKMH--PEVREQSRVISAMRLQ
A0A358MY60      TNADIKR------------------------------FVENS--QEVTRQRGIVAEQETI
A0A517MNB1      TSAEIAR------------------------------YVSSD--GEVAKHRGLLADREKK
A0A142YJ13      ASVEVRE------------------------------ATSPD--PKMMLIQDRISELRGR
A0A517Z7D3      GAGLTEP-------------------------------------PGKAQLDNRLLEAQLL
A0A1N6KY57      TPAMIAD------------------------------AISRD--RSIELLKDKEALVQRA
L0DK20          TPAMIVD------------------------------AINRD--HSIEVLKEREAAAQKA
A0A3L7UX05      QDAVYQA-------------------------------FYAD--RDVADLADALDDAKAR
A0A517XRC2      RDWVAKH-------------------------------------PRVDTLVKQKLAREID
A0A6M5YH47      DAGVIKA-------------------------------------KAAWEYTKSVLEREIL
A0A660UUK3      EINRLQE---------------------------QSAYINTD--PTMQTLVANIRQYEAQ
A0A517ZHG5      QAEMIET------------------------------LIDRD--PKMADLLVKADAIEAN
A0A1Z8MPL5      GSLALAG------------------------------SILPEDIEAELSENEDLAEYQVS
A0A7C1EH96      IADQIQM------------------------------RVEND--PTIVALRQDIRRYEQI
A0A5C1AGE3      ----LQT------------------------------KKFTD--EQIEAAL---------
A0A2Z3HEL7      DTQLLKL------------------------------AVARD--KRVVAANELWQAANDL
A0A142XAP8      DPAIVTQ------------------------------LVAAD--VRVKAAKSAYTARKEY
A0A6P2DEK1      DQAIVAQ------------------------------LVAAD--VRVKTAKSAYTARKEY
A0A5C6C1R5      ESRAKAN------------------------------AADSEEGEEDQESSVLTAYETDR
A6BZU4          SEGQIAS-------------------------------------PGTSQVDRARTALETH
A0A2D5GZ77      SEGQIAS-------------------------------------PGTSQVDRARTALETH
A0A3D3R1Z6      SEGQIAS-------------------------------------PGTSQVDRARTALETH
A0A517XG00      SEGQIAS-------------------------------------PGTSQVDRARTALETH
A0A1G2YRE4      TPEDMLR--------------------------IRNENINSD--PMVQELTRNIVSLERD
A0A353Z859      DEQLIDL------------------------------HLDRR--NEVLSAAYTVEKEREA
A0A2D6ST10      PDDVLEA------------------------------ALSRD--PQYAAASKKVAELERR
A0A177QX42      TRNAMKD------------------------------ALSRGASKEALLLMANMLKPNGD
A0A517SHR0      QRNAMKD------------------------------ALARGASKEALLLMANMLK-NDP
A0A2E0AW64      MVDQSAD------------------------------MLQHN--EDLARAQAAIKLLRKE
A0A351FZ59      MVDQSAD------------------------------MLQHN--EDLARAQAAIKLLRKE
A0A660V239      PGSLIER---------------------------QNAIVNSD--PIIQALTNSIMQYEEL
A0A177Q3B7      SATPIDL------------------------------EVDAD--PSIQTLLAHKARVEKD
A0A2E0X6Y6      SEQDMTM------------------------------LAEQE--SRLLKTQEELQ-----
A0A518GFD7      PQSDVSE------------------------------SLLRT--PDVLRLEDDIARIQSQ
A0A5C5VZJ8      PDPAAAE------------------------------KAAFERNAEWRGLRRELQTARDN
A0A518GE37      NPRDIDY------------------------------LVAED--SQVQKAKLALEDVKTK
A0A5C6F3H8      SESEIAS------------------------------HLEAD--PRVAELVQKVNRYRAS
A0A5C5X072      RERDIEN------------------------------GIDAD--AKVRAAKAVVNRYTSI
A0A5C5WUQ3      TESQIAQ------------------------------FVAND--AEVREAEMVYRKYQGM
A0A5C6E697      SEANIMA------------------------------LVNAD--PEVLEAKSRIARYKKI
A0A5C5Z1A3      TEDDIAK------------------------------IVQRK--PEVVNARERIRRYEGM
A0A5C6D2P7      SEGEIAS------------------------------WVNAD--TDVVEAKSMIQRYKSI
A0A5B9ML17      GPGDIAN------------------------------YVNSD--ESVVEALQQIGRYEAQ
A0A518HFS8      RDLGFEG------------------------------LIGRD--PVVAKLRADLAEYSGR
A0A5Q3LBQ3      SQMEVEE------------------------------SVERN--VEVQELKTKLATMRVM
A0A517LX75      LFIEVTK------------------------------GEVDSQQFQIDQPMRSAALDAEY
A0A7C5W7B3      SPDRLTG-------------------------------------KMPVPLTLVDELLRKE
A0A2S8F9B8      DLESIEY-----------------------SETEMNEAIASD--PISVKLQAELERFEEA
A0A354GX32      VEEALNK------------------------------EMKDDNLTKAQLEGLVKDQADLA
A0A142XL75      IDAEIRQ----------------------------------D--AQLKQLAEAAASAKER
A0A6P2D5D5      VEAETRQ----------------------------------D--AHLKLLDEAVVASKER
A0A5C1AAF0      AESAIKQ------------------------------YVDSD--PVVKDLEKRQAQIEAR
A0A7C7T8W8      ELSQFQQ------------------------------IRAVESDPQVTRLSNQQLNATTA
A0A5C6B3S0      PNAEIDA------------------------------YIAAD--ASVMVLENKVANLNAM
A0A368KP63      SEVEMNE------------------------------AISSD--PISVKLQAELDRFEEP
A0A518GIZ9      QQQEISA-----------------------------------------------FENRLL
A0A1C3EBY9      QQQEISA-----------------------------------------------FENRLL
D5SX64          QQQEISA-----------------------------------------------FENRLL
A0A517Z0U7      DSQLLED-------------------------------------PGFQKLYRSTRQKEVQ
A0A2S8FCC0      ESEEIDF--------------------------ELERIMAAD--EVMVAFKSQIMQLENE
A0A1Z8MBT6      TRPVLDQ------------------------------AISQX--RKVVTQKGVVDRHQAA
A0A517SXN9      TRPVLDQ------------------------------AIGQH--RKVVTQKGVVDRHQAA
A0A518HFL0      EYEEIEA------------------------------------KAELEAVRREAGGTDPR
A0A3B8ZJM2      ESEKLEQSELLLLQGELDHLLEKYGEKHPNIRRIRSTIASVE--KKIAHAKEAESRLEQA
A0A1U7CLW1      TVSTLDT------------------------------LSTAEVDPQVMELRSRLAELRRK
A0A142WPR7      PVTELFP------------------------------LLLDE------------------
A0A3M1TFJ0      ----------------------------------------------------LDASLETI
A0A517P477      GDEQLAA------------------------------LVADL--PEYKQAEEVARAAETY
A0A517T4K9      NSSDSES------------------------------THNIPEELILARLAQEPQLESQA
A0A7C6B2Q1      TERELDA------------------------------AARTD--SLMLQLLMREAELKGL
A0A7C4QPD3      SAEDLRN------------------------------ALLSD--PEYASLMRQLRSAETL
A0A2Z3GZZ5      --------------------------------------------DRQLAFVQLTAQYRAP
A0A4V0I6L6      NARELEK------------------------------IVIENRLKQIRDAGKTRAERLAT
A0A7C4QQT3      RQQEITV------------------------------FENRL--LPLLLEEQKLLR----
A0A255QXF5      DDSDVQD------------------------------FIEKD--ESVKLANERYERHRRE
A0A518KBI5      RTGSIDL------------------------------EVSMH--AEVRQREQAILALESQ
A0A5C5V6Q5      RAGAIDL------------------------------EVNMA--PEVVQRERALTGIADQ
A0A517MY49      SSRDTRV------------------------------LAEQD--KRLLTAEEELRNIEPF
A0A2E6AG00      NQHDVDA------------------------------VAELD--QQLVADRTKLANIRVH
A0A1G3A880      NTRDAAV------------------------------QANME--RSLLEYQSEMKSMQQF
A0A2E8ATT1      SPLSSQL------------------------------VNDME--RKLIEDRSKLAMYRGH
A0A7C2JZW2      SQEELSA------------------------------LLMKD--PEFVRLARTHEGHKRL
A0A518KYQ0      DPKRLSD------------------------------FISRD--KEVNRTKEMYEIYRKQ
A0A5B9QX47      TPEAIAQ------------------------------TVANN--PSVKEAQAHIARYKKI
M5T666          READIQE------------------------------AIEGD--VKVREASRVVGRYQAI
M5U6N6          NESDIKS------------------------------AVEDD--VKVREAKRVVDRYSAI
A0A517M0G2      YPEEIDQ------------------------------YVEAD--PSVVTNRKLLAERESR
A0A5C6AST1      TSAEIER------------------------------FVSND--STVKRHAARIAQQEAI
A0A5C6C951      TTAEIDR------------------------------YVESS--AEVSRYENRVAQLQGM
A0A5C6C5T3      SEREIEN------------------------------AIDGD--AKVKAARAVVDRYNAV
A0A2A2W6A9      DPKRLAA------------------------------MVENS--RDVFLAKERYEIYRKQ
A0A518HQS9      DPDRLES------------------------------LILND--KVVARAQEMYEIYRKQ
A0A5M6DFE6      DPDEVNA------------------------------MAEND--PAVVEARQRYNYFKDR
A0A5C6F286      ILAAIEN----------------------------------D--SKVRETVRKVDRYRAM
A0A517NGN1      SSNDVDR------------------------------MAQTD--ADVLQARKKAAYYEGL
M5RUI3          ILNAINQ----------------------------------D--AKVSEALSRVAHYKAI
A0A660VT66      SNLLF-L----------------------------------QEDPLLAEMRKEILSLEKE
A0A7C2VEF7      PTVGVRI----------------------------------FINDTETQLQSELRNAEIE
A0A0S8H0S8      SRSHL-A----------------------------------QAGPDDAELAAAINQMQLQ
A0A7C2ZTD2      -RQEY-I----------------------------------NADPAVETLTVNIVQLDQE
A0A2E3Z6T8      ------------------------------------------------------------
A0A257WQ92      ------------------------------------------FQQQQQQDIAIFESRLLP
A0A7C1U6X6      ------------------------------------------NLDETEA----RIDELKL
A0A7C7UXI5      ------------------------------------------DTYTVSR----MNEQLLQ
A0A7C3SFJ0      ------------------------------------------LSYAQQQ----IA---LL
A0A7C7WWF7      ------------------------------------------ELKAAED----LKQKLLL
A0A356ETW1      ------------------------------------------DIQTQAS----LEQTLLA
A0A3L7NJY1      ------------------------------------------DALHVQR----INEELLD
A0A523CME0      ------------------------------------------------------------
A0A354PCV3      ------------------------------------------------------------
A0A354PHB4      ------------------------------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A538RV31      ------------------------------------------------------------
                                                                            

M5S2L2          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A7C2VXA0      ------------------------------------------------------------
A0A7C3AA48      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A7C5PFV3      ------------------------------------------------------------
A0A7C3QGD2      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A7C2ZUK5      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
A0A7C2JY73      -------------------RRQGIRLPEERVAAG--------------------------
A0A356AE44      -------------------GHPDVINVRKRIDLV-----KSYYRQMGIDLPTMTTKVNPV
A0A1G2XSU7      -------------------TNPELARKESLLNAL-----KQRLEELRQQADKNFDEMAEK
A0A350KD81      -------------------NHPDLDAVNRSIETI--------INLYRRQGLDISADNLES
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      LQANKTMLSEKYGE-----KHPNIANIDLQLKEV-----ENRIKLETLSLITKVETDYN-
A0A524HC32      LRSEYEDLKTTFHD-----DYPSVKNLKARMNSI-----AARIEKEETIIFRAIQNEYL-
A0A177PV03      -------LQADYGE-----GHPQIQSVKRQIEAV-----RALYYGAKAKEVEMPKPGPDD
A0A1G2YIM0      LTA----------------ENPEIKRRSELLENM-----KKKLRAREEELTKNFNDMLTK
A0A7D8YCU5      -------LKRQYAD-----KHPVVSELEEEIAAT-----ERVLAGLEASRNERITDPSL-
A0A353BE27      -------FSNQLGE-----EHPSVATLRAQVQGL-----EKQLEKIREGERLYKEELEK-
A0A5C6BPW1      -------ETLKDTE-----NNSVLKSARREQKTT-----QEAIAKYREELRPVIEQKIR-
A0A1I3GSP0      -------LLHSLGD-----DHTQVRNVRRQINTILDFYTRQGLTPPDLKQTGKGPISSR-
A0A517QJV1      -------LLHSLGA-----DHTDVRNVRRQIDTILNSYAQQGLTPPAYQRSSNNPADAR-
A0A3C1QS25      -------LLFKFGE-----DHPEVKIV------------RNEIRAWEELMISRGISLPG-
A0A5C6FX55      -------LAAELGK-----GHPHVKVLDNKIASL-----EKALDRLGQSRSSRIGQLMD-
A0A5C6DS51      -------MVDVYGA-----NHPLVESTQQEIQVI-----RQFIAQNAPAEEPVRDNKLD-
A0A5C6DSL6      -------MVDVYGA-----NHPLVESTRQEIQVI-----KQFIEQNAPAETQANENKLD-
A0A3M1VG27      -------LLSEFGE-----DHPDVIAVRQRMEAL-----RRLARRTAADDSLDRLDTGD-
A0A518GC22      -------LLDSVGA-----GHPSVGIVQKKVESV-----KRQIAELRESE----------
A0A3L7Q373      -------LLLVLGE-----NHADVRNVRRQTETILDFYYRQGLTPPNLGTPGQTAAPGT-
A0A3E0PW54      -------LTVQLGK-----DHPNVIKLHQQLATL-----TD-------------------
A0A7C3TAH2      -------ARQSLTP-----DNPTIQRQERLLEDF-----RQKLEQRKKEVAADYQQVLE-
A0A1Z8MHR4      -------MELQFGP-----SHPEVKSIALQIESS-----QRKLNELNQLMSNRIAELQA-
A0A5C6EHJ0      -------LVESVGR-----DHPAIDTINKRIAVI-----EKMIETVGENETKLNAELDE-
A0A5C6F1H9      -------LVDTVGR-----DHPAIDTINKRIALI-----EKTIEKVEENEKRLNAELDE-
A0A255QXY0      -------MQMAFGA-----SHPEVVSLSTQIEAS-----QRRLHELNLMGQQRRKEIAP-
A0A517SYI0      -------MELQFGP-----SHPEVKSIALQIESS-----QRKLNELNQLMSNRIAELQA-
A0A518HX54      -------LEMAYGR-----SHPEVKSIVMQIESS-----QSKLNELIAQVDRRRKELSE-
A0A5B9MF59      -------LELAYGS-----SHPEVKSIAMQIESS-----QNKLNEINQQMTSRIAELRA-
A0A2A2WC24      -------LELAYGA-----SHPEVKSIAMQIESS-----QNKLNELNQQMSERIAELRA-
A0A518KYW8      -------LELAYGA-----SHPEVKSIAMQIESS-----QNKLNELNQQMSERIAELRA-
A0A5C5YZZ0      -------LASQFAP-----NHPQRIAIEQELKMT-----EKAFREIQKTRDSVQAETID-
A0A518JLD2      -------LSRSFGS-----GHVAIKSLDEEIQVV-----KRLILDAVQTEERSIAELESA
A0A5M6DJ15      VKDEIELYRLEYGEGMVRHQVGRLERLEKELERR-----REDLVRIAQTRKYKEMNPEG-
A0A3L7P7S7      -------ARTGLGK-----DHPDVKNLNDEIKDI-----REYIDQMAKGIVPKGPDGKA-
A0A517N8M1      -------FEAEFGP-----SHPSVKVLDAQLSTM-----RRELQKLVQEKTSRVMELMS-
A0A5C6CW01      -------MANEFGA-----SHPTVKQLDTELSLM-----KSELRRIVVDQTKRLMEIKK-
A0A5C6BXS9      -------YAAEFGE-----QHPTVKALDTELTMM-----KSELTRLVTEQTQRIIQLMD-
M5U569          -------YAAEFGD-----SHPTVKQLDVELKMM-----KSELKRLITEQAERIVELME-
L7CND7          -------FAAEFGE-----QHPTVKALDAELTMM-----KSELKRLVKEQSDRIVELME-
A0A0J1B8S4      -------FAAEFGE-----QHPTVKALDAELTMM-----KRELKRLITEQSERIVELME-
F2ARR3          -------FAAEFGE-----QHPTVKALDAELTMM-----KSELKRLVKEQSERLVELME-
K5D8H6          -------FAAEFGE-----QHPTVKALDAELTMM-----KSELKRLVKEQSERLVELME-
M2AKU0          -------FAAEFGE-----QHPTVKALDAELTMM-----KSELKRLVKEQSERLVELME-
A0A5B1CKI2      -------YAAEFGP-----EHPTVRNLDAQLESM-----KTEMKKLVEDQTDRVMELIG-
A0A5C6EG84      -------FEAEYGP-----SHPSVKVLDSQLETM-----RSELKKLVEAKTSRVMELMS-
A0A5C6F2X4      -------FESEYGP-----SHPSVKVLDSQLETM-----RSELQRLVEEKTTRVMTLMS-
A0A5C5XTV6      -------YAAEFGD-----QHPTVKALDTELTVM-----KSELKRLITEQTQRILQLME-
A0A5C6AAB1      -------YAAEFGD-----SHPTVKQLDAELTMM-----KSELKRLVTEQTERIVELME-
M5T8W8          -------FAAEFGE-----QHPTVKQLDVELKMM-----KSELKRLVTEQAERIVELME-
M5SF00          -------FAAEFGE-----QHPTVKALDAELSMM-----KRELKRLVKEQSERIVELME-
A0A2G1WDS1      -------FAAEFGE-----QHPTVKALDAELSMM-----KRELKRLVKEQSERIVELME-
Q7UVS9          -------FAAEFGE-----QHPTVKALDAELTMM-----KSELKRLVKEQSERIVELME-
A0A5C6B601      -------LISQFGD-----NHPQVVSITSKIENI-----RRRLNELESQKAARQAQLRA-
A0A517PFU1      -------ARETKGE-----NHPDIKRLENRVAA-------------LRRIEADRAGLQA-
A0A5B9M8J9      -------LELAYGR-----SHPEVKSIVMQIESS-----QSKLNELIGQVDRRRKELSD-
A0A2A2WFP6      -------LEMAYGR-----SHPEVKSVAMQIESS-----QSKLNGLIAQVDRRRKELSE-
A0A518L8N2      -------LEMAYGR-----SHPEVKSIVTQIESS-----QSKLNELIAQVDRRRKELSE-
A0A518HQN9      -------LELAYGA-----SHPEVKSIAMQIESS-----QNKLNELNQQMSERIAELRA-
A0A5M6D8H8      -------LELAYGE-----SHPEVKSITMQIDSS-----QKKLNELSERISQRRAELNA-
A0A5B1CRW9      -------LSDTFGS-----GHPLVEAARQETALT-----RQFITANTPETNGVKKD----
A0A5C6EI46      -------LSDTFGK-----GHPLVEATRQETEIT-----RQFIAANAPETKARETK----
A0A1G2ZG92      LVDI-AQKSVEYTK-----EHPDYKILEKEIETA-----KELIKNEKKVALNSVSISIDP
A0A1G3A0W0      IANS------GLTS-----KHPDMIRMEKNLEFV-----EESLRLRQMQLNERWHHRPQD
A0A2E7D3V4      LLPLLIQEQRLLRD-----LGADHPDVQSVQSEI-----ALVKAYYRQQGIPIPGADVVP
A0A5B9PER9      MRLL--EAEANAEL-----IRQKVGTGHPDHEAA-----VVSINIVKKQLAEMEEENSKN
A0A517QSM4      IT----DKSQNLGE-----KHPDRVRLNTHIERQ-----RLLAEELKKQIEKRILAEIAA
A0A355GJI7      -----------------------HPDLDAVNRSI-----ETIINLYRRQGLDISADNLES
A0A1Z8MCI4      KHRI--IVEDSENV-----FKEGLVRIEAKIRDI-----DEQLSLRKAQASSEAEAVLRD
A0A517SYL7      KHRI--IVEDSENV-----FKEGLVRIEAKIRDI-----DEQLSLRKAQASLEAETVLRD
A0A3L7P0L2      LLMARLLERRLLLV-----LGPNHGDVRNVRRQI-----DTILDFYHRQGLTPPNLGTSD
A0A6M5YVJ1      LNAT--KALFNPGE-----RPLAVAKAEEELAAA-----QQKRDKYRDELRPRLESAVRK
A0A2E0SHG0      RLSL-AERQSEFGA-----NHPKVREAEENLRDL-----EMLLDRSKEEIPDPSATNPEP
A0A518CQB8      RLDL-KAKKTEYAD-----NHPKVIEAEENLQDL-----EKFLVEKKDDVPPPSTEALTP
A0A517SCC8      LLAARLLEHRLLYV-----LGPNHNDVVDVRRQI-----DAIVKMYAQNGFAPPVMETLN
A0A3A0DR44      LEDI--EKKSRQGK-----QSSSYKDYAALIVRA-----EKELATLQDEVRAQLELRNSV
A0A358MY60      LRSL--EKNGLKNL-----RQEYYNEVSRKVTEA-----EKKLASAREAAEAQAVKAISD
A0A517MNB1      IRGM--EDAGFASL-----RQDHYEDLKKQADEL-----RKQVQAAEKVARDRAPEVLQK
A0A142YJ13      QARL--SRNARKGN-----ADPAAQALEREIKQL-----ARTLESHRNTAQRALSAEPER
A0A517Z7D3      LSRL----MQHLAD-----DHPSVLRLKEQIGSI-----LS-FYKRKGLAPPHVDDSLKA
A0A1N6KY57      IDRV---SHLVRNR-----NDPAVKKHRDDLEAI-----HVALAAQRRKLYPIVTKQLQD
L0DK20          IDRI---YHIARNK-----SDPSLKKHRDELEAA-----RTAMVAQRRKLYPIVEQQLQE
A0A3L7UX05      LDKLNKVSRGQDVS-----HREMNDRITDLKSKI-----KVLWERRRSALEKQLAQEGAG
A0A517XRC2      LGQA--KTAAGTVP-----DAPVVLALDAEVKQL-----QKAIDKARTEVLPDVRAALQE
A0A6M5YH47      KAAD--PDANAYIK-----E------IKGEVAKR-----LKEYEDARKFATAEATVRARE
A0A660UUK3      II----TDKQTMTD-----NNPELQNRIAILESF-----KKRMEERREELVKDFDDRYKQ
A0A517ZHG5      IRRY--EETLKDTE-----NNSVLKSARREQETT-----QEAIAKYREELRPIIEQKIRE
A0A1Z8MPL5      IAELQAELDAYKQI-----YRDSSAEAIKSREAE-----ITRLQEEQAGFAQQLRNEILA
A0A7C1EH96      IR----DGQATMLD-----TNPEMQRRRQILADL-----QEELEKQRQEATERYEKIALA
A0A5C1AGE3      -------LRDKEPA-----LVGFQAELEVAQAKL-----KARQGAYKDADNPRIVEVQDE
A0A2Z3HEL7      YTKE---LKNSNPE------NAYIQELKAAADKY-----KKALDDVQNQVTTEAETALRF
A0A142XAP8      ADKE--ATKATNPD-----LDDGIATLRAEVKKL-----EAEVKGAEKLAATEALEVARA
A0A6P2DEK1      ADKE--AAKATNPD-----IDDGITKLRAEVKKL-----ETEVKEAEKLAATEAIEVARA
A0A5C6C1R5      ILSSDRDYQSLLAM-----ARSLEEEIELYKTRY-----GKGMIQYKIDRFDRLTSDAKE
A6BZU4          LMPLLIQKNRLERD-----FQKNHPDLDAVNRSI-----ETIINLYRRQGLDISADNLES
A0A2D5GZ77      LMPLLIQKNRLERD-----FQKNHPDLDAVNRSI-----ETIINLYRRQGLDISADNLES
A0A3D3R1Z6      LMPLLIQKNRLERD-----FQKNHPDLDAVNRSI-----ETIINLYRRQGLDISADNLES
A0A517XG00      LMPLLIQKNRLERD-----FQKNHPDLDAVNRSI-----ETIINLYRRQGLDISADNLES
A0A1G2YRE4      L--I--TAKQMFAA-----SNPIIKQKQDLLEAF-----RSRIEEQRQKASEDFNNVASE
A0A353Z859      LSRR--EGKG---------PASSVEEYARRLREA-----EAKLKEVREELRPKVIEELKE
A0A2D6ST10      VQQN--DVE--LSE-----THPTLVKFKKQLADA-----QKHQQELQEELKPQIAQQILG
A0A177QX42      EKSD--PAASLQPK-----VDPFMEKMMPLLLER-----DTLLERVGESHPQVKMLDRKI
A0A517SHR0      EKSN--QTESLQAR-----MDPFMKEVTPLLVER-----ETLLETVGEGHPQIRKLDKRI
A0A2E0AW64      LAEI--EQIAAGDP-----ANLPRYQSAQRQIAL-----QQEQIEKLDAARQPLRESLME
A0A351FZ59      LAEI--EQIAAGDP-----ANLPRYQSAQRQIAL-----QQEQIEKLDAARQPLRESLME
A0A660V239      IVV----GQQTMTP-----GNPELKQRREILKTL-----KERLGQRRKEVAQEFDKNFEA
A0A177Q3B7      IERI--EQVSVRGR-----REPAMKPLLDQSAAL-----DAQLEKRRKLLRPEVVKRFAD
A0A2E0X6Y6      ------DAVNYYGP-----NHPRISELKRQEQTL-----IAYLRDYRSNLGNRFAGGDSG
A0A518GFD7      LTVM--RAS--VGP-----GHPSARALTVELEAR-----QELLDKRREYAREAALESLAK
A0A5C5VZJ8      LAA----GLRRWDE-----GHYKIQSLKNEVTRV-----EQQVAALETDLRDRLTNGRGD
A0A518GE37      IRNI--EREERQEL-----FADRYARLKEDVPRL-----EEDIRNAEVAARPQVISTLQG
A0A5C6F3H8      VLDM--EVNDMVRV-----NRDYYKELNKNLASA-----ESELQSERREARDRTIEKLER
A0A5C5X072      ILDI--EVKDMVRI-----SRDYYNDMKKNLEDA-----RDKLQDERDLARTRVEEELQR
A0A5C5WUQ3      VLEM--EISDLVRV-----RRDYYLEIKAKRDSL-----EYSLEAKKSKAEKLAIAVLTK
A0A5C6E697      SLDM--EQNDLVRI-----RREYYNENLARISEW-----EEVLKKAQEVAREAATAKLEQ
A0A5C5Z1A3      ILNM--EDTDLVRI-----NRSYYDELKAKKNES-----EKKLQAAMDAARQQALVEVQK
A0A5C6D2P7      AMNM--EDSDLVRI-----QGEYYRETLDKVKKW-----EQTLEESRQAARVVALEKLNE
A0A5B9ML17      IVRM--EDLGTWRL-----NQTHFAELKKKRDEW-----EATLKTAKAAAETKAATELEA
A0A518HFS8      LEQV--RRIVRNPG-----EPSR-KRLEQAVASL-----AESLRMRYEELRGFHGAQQSG
A0A5Q3LBQ3      MLDT--ERRAADPE-----KSSTYRKLAGDYKET-----QASLEEIREELRARVVSEMES
A0A517LX75      EKVL--SLILREQA-----LTADFGDDHPLVQRV-----RDEVASVKRFIREKAPGDLEA
A0A7C5W7B3      LLLD--DYRRKYTE-----ENPKLKKLVREIEGL-----RQTIEQVKQD--PDRFGLVGR
A0A2S8F9B8      KYTL--TPAAYERY-----RQTN----EAAISTL-----ESRLEKRREHLVLLIKERLAQ
A0A354GX32      ELQR--RLIPADRE-----NGPGVGQLRDRISLI-----QNLVTQKKEVQRPGMERQLRA
A0A142XL75      LNKV--KERYQEGE-----RPPTVIKAEDDLKAA-----ELRRDKHRDELGTTLAREVQK
A0A6P2D5D5      LNKV--KERYQEGE-----QAPAITKAENDLKAA-----EQKRDKYRDELQAAAAIIAQK
A0A5C1AAF0      VRET--ERVATKAV-----AEVAAKKAQDDLTAL-----SKDLKEARAKARVDYTTGVAQ
A0A7C7T8W8      IAKY--EELGYGR------DHPRIQSLLADIERL-----DTLLADRREAAKVDAIQNYKL
A0A5C6B3S0      IAKI--NEEIKSGS-----KEYHIERLQAQLNTA-----EESLKSHRAELRSELLEHWNA
A0A368KP63      QYTL--TPAAYQRY-----RETNSAAIKSLESRL-----KERREHLELLVKERIAQDLAA
A0A518GIZ9      PLIL--EEEKLLRD-----FGPDHPEVKAVRKSI-----DTTLDFYRKHGLRMPDDMTPG
A0A1C3EBY9      PLIL--EEEKLLRD-----FGPDHPEVKAVRKSI-----DTTLDFYRKHGLRMPDDMTPG
D5SX64          PLIL--EEEKLLRD-----FGPDHPEVKAVRKSI-----DTTLDFYRKHGLRMPDDMTPG
A0A517Z0U7      LSTL--R--DRLKE-----GHALITKAEDDLAAL-----EAQLEAYRETQLPQIRQQLQS
A0A2S8FCC0      ILAI--EQTAAPKI-----QNQYVSRLRDKISEL-----EEQVSLRKDQLTKDKEQWSVA
A0A1Z8MBT6      LIAI--KADRRFGP-----GYVGIQETEDLLVTA-----QTELDRLMDSVKDEVRQELEQ
A0A517SXN9      LIAI--KADRRFGP-----GYVGIQETEDLLVTA-----QSELDRLMDSVKDEVRQELEQ
A0A518HFL0      IWVE--RRIEQVFL-----SDPDVRSLREGLKDI-----QVQIDEAQGRIRNPADPAVSR
A0A3B8ZJM2      AAEL--NQKRNRSK-----NKMLNSEVASNDQPI-----DPPSDTTPGDASATAVTDSPN
A0A1U7CLW1      HASV--KRISRQGN-----VDPSILAIQREIKLV-----TGELEGRRQELRAAAAEFNRA
A0A142WPR7      ------------QM-----LLETLGPDHPKVTAV-----QKRIEITRKYLTESLAEERKN
A0A3M1TFJ0      RRVL--EQGRPLDM-----APPVAQSPVVSMLRR-----NLAEAELELA---GLEQRYGE
A0A517P477      VGKL--ERSKGADS-----TSPTLATARAEATRR-----QAELKELQVSLRPHVKEQLKN
A0A517T4K9      TEVL--QLERQLET-----LKDRVKEDHPELARV-----AAKLEAGQKEYEKLEQQLRPA
A0A7C6B2Q1      VAQT--RDVVRPEM-----AGRYGNRYSQELADV-----QGRIQARREELRQELEQKRVA
A0A7C4QPD3      LAEW----------------QKRVRDDHPAIAKY-----SAAVKDAVAKLAARHRAIEPA
A0A2Z3GZZ5      VVPN--AANGGELT-----GTAALRALEFERREL-----TQATGLGKDHPRVLAVDARIA
A0A4V0I6L6      MAKL--GIAN---------DRPFLFGDVKDPESM-----LAHLKYKKGELGTRLGPGHPE
A0A7C4QQT3      ----------------------DYGRDHPDVQSV-----QQSIRAVLRYYRERGIHLLDD
A0A255QXF5      VVNL--EVAEGWRR-----AQAYYADQQKLRDEW-----KTKLDEARAEASARAISVLNA
A0A518KBI5      MRQI--QQLTKQWR-----ENGSYKSLSDARKHA-----RTELTEFKAALREQLLAARES
A0A5C5V6Q5      MRHY--QRVSKRYE-----QNANYKALAEQYQRF-----KDELAGYKANLRRKLLLSTRS
A0A517MY49      YGP----------------NHPRVRELQTQIINI-----NQFLANYGSNAGKILNAERRD
A0A2E6AG00      YGD----------------RHPKVQDXLKSIRDT-----QNYLENYQQSVADRAERTQAE
A0A1G3A880      LGP----------------AHPRLTEVAERVRAT-----EQYLTAYQTRVSERLTQLKDT
A0A2E8ATT1      YGP----------------NHPQVRQLQHSLQLA-----QAHREEYHAKVQKHMEKVQER
A0A7C2JZW2      LDEW----------------RRRVNGPHREIERL-----ELAVDQAAEQLAKRRDEIEPA
A0A518KYQ0      VIEL--EVSERWRF-----DKDRYARLQTERDQW-----EEKHALARKAASERAIDIMEA
A0A5B9QX47      MLEM--EDNGRIRV-----ARDHYEDMQSRRDEW-----TAKLEQATKDAQEQALAYLNQ
M5T666          LLDL--EVKDMVRV-----SRDYYNQMKENLADA-----QSKLDQERQVARDRALKELQR
M5U6N6          VLDL--EVKDMVRV-----SRDYYNQMRKNMEEA-----ERKLAQERTLARDRATKELQR
A0A517M0G2      VRNL--EDRGLAPL-----RQEYHKELKEKAAEQ-----QRELDNAVAAARQRAPEAITE
A0A5C6AST1      VRSI--EDRDMVRI-----SRDYYNDLKSKIADT-----QKELDKAKEVARAKAADEIKS
A0A5C6C951      IRSM--EDGDLVRI-----QRDHYEGLKTQLADT-----EDDLRQARIDVRSTAVAEIKS
A0A5C6C5T3      VLDL--EIQDMVRI-----SKDYYLDMKQNLEDA-----KDTLKQERDSARTRVTKELER
A0A2A2W6A9      VLEL--EISERWRF-----DKERYARLQKDRDEW-----EAKLASAKQAASEAAVQILED
A0A518HQS9      VLEL--EISERWRF-----DKERYARLQKDRDEW-----EAKLASARETASKTAVRILED
A0A5M6DFE6      VFDM--ENNDVARM-----RKEYYREMMDQRDEW-----EEKLLAFRKEARTRAEKAMKE
A0A5C6F286      ILDL--EVKDMVRV-----SRTYYNELIRSLAEA-----ESKLEGIRQEARPRAIAKLDQ
A0A517NGN1      RLNM--EASDLVRI-----NREHYRGIVADQALW-----EGKVEEALTAARERVQAELED
M5RUI3          LLEL--EDSDIVRI-----RREYYEEMQGKRDEW-----TANLETLKAGARERVVAMLNE
A0A660VT66      LSIARLSYGPKHSK-----I----LSLEASLAKQ-----KQILNDTAEQLAE--------
A0A7C2VEF7      LKNTRYHVTEEHPA-----V----KALHTKIDYI-----KSDLKAEMKKFAD--------
A0A0S8H0S8      LVALKRQRTEGHPA-----V----QALQAQLARA-----RQRQAKADKKFAE--------
A0A7C2ZTD2      LIVANQTLASANPE-----LKRKAQLLEALNARL-----EEQKKQAGKSFDDLMSRELVN
A0A2E3Z6T8      ---------MHYGP-----NHPRIIELQQDVRSL-----DQYINNYHS-GAGDRLEAMGK
A0A257WQ92      LILEEKQLLRDFGP-----DHPDVKLKRQTIQTA-----LDFYRRQGVRLPEERRQQQAD
A0A7C1U6X6      SIAKLEAQVNQAGV-----ADGNEVAIAGTDQPP-----LSYYRQDPQWQTLDERFREVR
A0A7C7UXI5      NTARLKTLLQRYGP-----AHHEVQEAQERIRIA-----EEYLRNRHR-NQLAQLRQISD
A0A7C3SFJ0      DIRIFEEKQRVVDE-----NAPSIARMRERQQKY-----REGMEKRIA-EISPTLEKQIE
A0A7C7WWF7      SRARHRKLAEHFGP-----SHPERLELQQAIEDS-----EKYLEQMRSGSTSRSRERLTN
A0A356ETW1      DQALLESMRGRVGM-----SHPSMIAQQEKVRLA-----REYLQRNQE-RAAESISRLQN
A0A3L7NJY1      LRSRLRDANLKYGV-----NHPRIVAINDEILVK-----ESYLQQLPM-LQQQRMQDMAR
A0A523CME0      ------------------------------------------------------------
A0A354PCV3      ------------------------------------------------------------
A0A354PHB4      ------------------------------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A538RV31      ------------------------------------------------------------
                                                                            

M5S2L2          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A7C2VXA0      ------------------------------------------------------------
A0A7C3AA48      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A7C5PFV3      ------------------------------------------------------------
A0A7C3QGD2      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A7C2ZUK5      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
A0A7C2JY73      ----------------------------------------ELTFAPQDFVALYLSSLRQE
A0A356AE44      TGEPELVTGNDPIA-------------------------------------TYVVALEQQ
A0A1G2XSU7      EFKESDMLEIQEYK--------------------------------------------YK
A0A350KD81      GEFQVAKTKDVDFV------------------------------------NVYLKSMEQQ
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      ------------------------------------------------------------
A0A524HC32      ------------------------------------------------------------
A0A177PV03      PARWHLQSLKRELV----------------------------------------------
A0A1G2YIM0      EIARNRVYKLKESR--------------------------------------------AE
A0A7D8YCU5      -------------------------------------FSEYREEEARRIIDSFTEGLGRK
A0A353BE27      ------------------------------NGDALARKTGAEIRSIEERLEERLLALEEQ
A0A5C6BPW1      --------------------------------------------ESGNAPNPGDLPAEEQ
A0A1I3GSP0      -----------------------------------------SAALGLDLVSVYRDTLQGQ
A0A517QJV1      -----------------------------------------NHE-GMDLISVYEETLKSQ
A0A3C1QS25      -----------------------------------------TGDNRADFVALYKISLTEQ
A0A5C6FX55      -------------------------------------DEERKTKQALQAISAVQATAKTK
A0A5C6DS51      ---------------------------------------------PKGMLSTYTRLLTND
A0A5C6DSL6      ---------------------------------------------PKGMLSTYTRLLTND
A0A3M1VG27      ----------------------------------------------SSLVDVYLAGLREQ
A0A518GC22      -------QQVDSEM--------------DRMKLEMQTRTGARIRSMEERLTAGTDMLAEQ
A0A3L7Q373      ------------------------------------------VAINEGLSQQYLKVLESR
A0A3E0PW54      -------FYRQKGH--------------TPPRSHGPGADTTDDAGPIDLVAAYIRIQQQE
A0A7C3TAH2      -------EQRRLAL--------------DQLQRARREA----ERARQERVAQRRMEMEAA
A0A1Z8MHR4      -------KNQNDPE--------------SQRPRD------ASKNAASVMVDAYVNGITER
A0A5C6EHJ0      -------AMKAAAA--------------AESSLL-PSGEYDPRDRILEKVRFAVGALRQE
A0A5C6F1H9      -------AMKAAAA--------------EASSFQNPDEDLEPRNRAMEQVRFAVGALRQE
A0A255QXY0      -------ED--LPT--------------EDGSSP------TNKSNASELVDAFICGLQER
A0A517SYI0      -------KNKNDPE--------------SQRPRD------ASKNAASVMVDAYVNGITER
A0A518HX54      -------QSQQIDE--------------ADGSTQ------AQVARAGEAVDAYIRGLSER
A0A5B9MF59      -------QSQTVDY--------------DKEARK------ARDERARTAVDAYIRGIEAQ
A0A2A2WC24      -------QSQRVDY--------------DKEARE------ARDERARMAVDAYIRGLEAQ
A0A518KYW8      -------QSQRTDY--------------DKEARE------ARDERARMAVDAYIRGLEAQ
A0A5C5YZZ0      -------------------------------VAA------QRNEAAKTLLIMYVSSIRKK
A0A518JLD2      WAELDELASNQPTT--------------NP------------EDELRRQVRLVFDSMTQK
A0A5M6DJ15      -------EQIAGYA--------------NLTGEQ------RAKALQIQELDQQIKTQKRA
A0A3L7P7S7      -------SSLLGLG--------------E-------------DEIFSNKAQGLLKHYSER
A0A517N8M1      -------ETLA-----------------DP------------RERAVEAVNAVVLASKAQ
A0A5C6CW01      -------ENEIKTI--------------DP------------KEKAKEAISAVLIAAKAE
A0A5C6BXS9      -------ENRVEGI--------------DP------------GVRAQESVDVILIAAKAE
M5U569          -------ANKVEGV--------------DP------------AARAREAVDVILYASEAE
L7CND7          -------QNKVEGV--------------DP------------AKRAEEAVNVILTASRAE
A0A0J1B8S4      -------QNKVEGI--------------DP------------AKRAEEAVNVVLIASRAE
F2ARR3          -------QNKVEGV--------------DP------------AKRAMEAVSVILTASNAE
K5D8H6          -------QNKVEGV--------------DP------------AKRAMEAVSVILTASNAE
M2AKU0          -------QNKVEGV--------------DP------------AKRAMEAVSVILTASNAE
A0A5B1CKI2      -------ETL---V--------------DP------------VQRAKEALAAIVMASEAQ
A0A5C6EG84      -------ETL---A--------------DP------------RERAVEAVSAVVLASKAQ
A0A5C6F2X4      -------ESL---A--------------DP------------RERAIEAVNAVVLASKAQ
A0A5C5XTV6      -------ESRGQGV--------------DP------------SVRAKESVDVILIASRAE
A0A5C6AAB1      -------ENKVDGV--------------DP------------AKRAAEAVSVILTASNAE
M5T8W8          -------QNRVEGV--------------DP------------AARAQEAVDVILFASNAE
M5SF00          -------QNKVEGV--------------DP------------RKRAEEAVNVILTASRAE
A0A2G1WDS1      -------QNKVEGV--------------DP------------RKRAEEAVNVILTASRAE
Q7UVS9          -------QNKVEGV--------------DP------------RKRAEEAVNVILTASRAE
A0A5C6B601      -------EIKTTDI--------------NTLRLK------ERQERASSFVAAYMGGLAQR
A0A517PFU1      -------GPDGTEG--------------PSSF-----------------LDLYVAARVER
A0A5B9M8J9      -------QGQRIAG--------------GEGFQK------AQLARAGEAVDAYIRGLSER
A0A2A2WFP6      -------QSQQGAD--------------ADGSTQ------AQVVRAGEAVDAYIRGLSER
A0A518L8N2      -------QSQQIAE--------------ANGSTQ------AQVVRAGEAVDAYIRGLSER
A0A518HQN9      -------QSQRVDY--------------DKAARE------ARDERARMAVDAYIRGLEAQ
A0A5M6D8H8      -------QSSRTDL--------------GAEAQK------ARTEHAREIVEAHIRGLQER
A0A5B1CRW9      ------------------------------------------DLDPTEMVNTYVMLLKND
A0A5C6EI46      ------------------------------------------TMDAEEMLKTYVMLLRND
A0A1G2ZG92      IYDELSKNLIDAHI---------------------------------------------D
A0A1G3A0W0      VPGTPSTIAQWRNQ-----------------TINVLGAPVTIANSGMPDLDEDSAGVERQ
A0A2E7D3V4      GADKKTPKSADANL-----------------------------------VTTYMASLRQQ
A0A5B9PER9      SADLDILPDEIIFE--------------------------------------------RK
A0A517QSM4      NEDKSIVELQSRVK----------------------------------------------
A0A355GJI7      GEFQVAETKDVDFV------------------------------------NVYLKSMEQQ
A0A1Z8MCI4      KAGKAAK---------------------------------------------------QQ
A0A517SYL7      KAGKAAK---------------------------------------------------QQ
A0A3L7P0L2      ASTRNAQGAAGADL-----------------------------------AQTYLTILKSR
A0A6M5YVJ1      QAEQRERARMAGLR--------------------------------------------DA
A0A2E0SHG0      IEPIQLVSAYVTQL-------------------------------------------EKD
A0A518CQB8      IDTSDLIRAYVSLL-------------------------------------------EKD
A0A517SCC8      DEQKPAAVASADLA------------------------------------STYVDVLQDQ
A0A3A0DR44      VSTADRGQEAVQWR--------------------------------------------QR
A0A358MY60      DLRQAAERARTIAS-----------------------------KKAVIKTKQDAVNAKEE
A0A517MNB1      HAMELAQRERESQL-----------------------------ANLEVSTKASLASQEVQ
A0A142YJ13      FESSPVQDTRSREV-------------------------------------------EEY
A0A517Z7D3      APPAGQTEEGVDLV------------------------------------TSFMQLQKQK
A0A1N6KY57      MGRDSDESKEILVQ--------------------------------------------HR
L0DK20          IGRDDDDSNKALIP--------------------------------------------HR
A0A3L7UX05      QSTSTLDRELRDAE--------------------------------------------NQ
A0A517XRC2      YGEEMLKAKHAELQ--------------------------------------------EQ
A0A6M5YH47      TERAQKQAQVTALT--------------------------------------------TA
A0A660UUK3      EVEARRNYAKVQVK--------------------------------------------AQ
A0A517ZHG5      SGNAQNPDDLPAEE---------------------------------------------R
A0A1Z8MPL5      AVRRGERKSDAQYN---------------------------------------HERLEAE
A0A7C1EH96      DVRRSRQAELEALK--------------------------------------------SE
A0A5C1AGE3      IKDIIARRAALTSQ--------------------------------------------RR
A0A2Z3HEL7      SDLAERQKKVSDLA--------------------------------------------DQ
A0A142XAP8      IDTANKKKRAEELA--------------------------------------------YT
A0A6P2DEK1      IDTAKKKKRVEELA--------------------------------------------YS
A0A5C6C1R5      REATLLKLAAEEKGRKIAQGEMGQIDLSLSPEDQKLAQRHARLLADAEEHDKRIVARGIQ
A6BZU4          GEFQVAKTKDVDFV------------------------------------NVYLKSMEQQ
A0A2D5GZ77      GEFQVAKTKDVDFV------------------------------------NVYLKSMEQQ
A0A3D3R1Z6      GEFQVAKTKDVDFV------------------------------------NVYLKSMEQQ
A0A517XG00      GEFQVAKTKDVDFV------------------------------------NVYLKSMEQQ
A0A1G2YRE4      EIAKVNKEKTLNLK--------------------------------------------TE
A0A353Z859      RSQLEEVLSTQALQ--------------------------------------------RR
A0A2D6ST10      GMAASGEMSNLERK--------------------------------------------KL
A0A177QX42      ESLRGLLREEAGAK-----------------------------GSKLDLLSIHLESLDER
A0A517SHR0      EALRGLLRQETGDS-----------------------------GPKRDLLSIHLESLDER
A0A2E0AW64      VARKDRQGAWKTYQ-----------------------------QEVISRQKEEVARLQEQ
A0A351FZ59      VARKDRQGAWKTYQ-----------------------------QEVISRQKEEVARLQEQ
A0A660V239      ELAKNRDRRLAELK--------------------------------------------IQ
A0A177Q3B7      RAVRDLQAEFASLE--------------------------------------------ER
A0A2E0X6Y6      EAGEATLKMLRQAL----------------------------------------------
A0A518GFD7      TNAESMLPLGQQQS-------------------------ATNRTPLGALTQQDLISRASH
A0A5C5VZJ8      PDTGDFALTDPRVI-------------------------------------------ELR
A0A518GE37      LVAEREALKRAEQI----------------------------------------EEFQLQ
A0A5C6F3H8      FAEDEYERQKVAAK-------RTSEWQQEQFAAQAKELAQQSSKIQSEVSAAEKASRERQ
A0A5C5X072      VVDEDYRQRKAVAE-------RTLAWQEEQQKKQQDLSKQERKRAQERSQKAFAKEREKS
A0A5C5WUQ3      RAEEDYQRQMAEAE-------AKLTAMKQLHEVELDAARSHDSLKRNHQDNMNTALKKRD
A0A5C6E697      LAADELKFAQSEQI-------RQ----KEIGVRL------------------KKVSEKKN
A0A5C5Z1A3      LADEDFKLQEEEAK-------TK----IELARREFEQGLKLASLDHQSEGRIAMEAEKQQ
A0A5C6D2P7      LAKDQLERSRIEAK-------LQ----QQLGAQD------------------RVASKQQT
A0A5B9ML17      LADADYEHQQKQWE-------EKVAALRAAHEEKQRLDRQNRALVDAQLRTETTRQYRRM
A0A518HFS8      DRPAARDPGLEQAG--------------------------------------------RY
A0A5Q3LBQ3      HERSVRDDQLLSLQ--------------------------------------------SE
A0A517LX75      LESKEMKPAQILEA--------------------------------------YSSLLAND
A0A7C5W7B3      QFDRGWQTENVELA--------------------------------VATESARKAAYLAR
A0A2S8F9B8      QLLEGRSRQGSIAN---------------------------NGLVVPAEVDNSLPELRVH
A0A354GX32      KALDDLVNEAAKTK-------------------------------------GHIEGDKNQ
A0A142XL75      KHAQQEILRRAETR--------------------------------------------KQ
A0A6P2D5D5      KYAQQELQRRAEFR--------------------------------------------EK
A0A5C1AAF0      LSELESKTRVTQLS--------------------------------------------EQ
A0A7C7T8W8      EIMRNHRDELRQFQ--------------------------------------------NE
A0A5C6B3S0      RPESVSNDGSDELR--------------------------------------------AK
A0A368KP63      QAKGEIARKGSSIL-------------------------------AVPEVDNTLPDLRVR
A0A518GIZ9      PDGKPLIKERANLV------------------------------------QNYMETLRQQ
A0A1C3EBY9      PDGKPLIKERANLV------------------------------------QNYMETLRQQ
D5SX64          PDGKPLIKERANLV------------------------------------QNYMETLRQQ
A0A517Z0U7      RIADVPDSAGQIRQ---------------------------------------------R
A0A2S8FCC0      THRAELNKARSEVA----------------------------------------------
A0A1Z8MBT6      QFEAQYQQDLEDEG-------KELERLEDAWAKNRDLQIKNASKSSAGQRELVVKRLQFD
A0A517SXN9      QFEAQYQQDLEDEG-------KELERLEDAWAKNRDLQIKNASKSSAGQRELVVKRLQFD
A0A518HFL0      LKVQQQRLLERYNQ----------------LWADLEPALRAQLAAEETNPTQLVRKAEAQ
A0A3B8ZJM2      EVEKAIASTDSDSS------------------VSPEDEAPDVEEQVNLYLQISLNSLTQR
A0A1U7CLW1      EPAAIPDARLEEVK--------------------------------------------EY
A0A142WPR7      AGENPMLKGGKRPD----------------------------------LVSLYLESLQHE
A0A3M1TFJ0      NWPQVRAARARRDQ-----------------------------------------LKLLL
A0A517P477      SWEAQGEAGDQKLS-----------------------------------------ETI--
A0A517T4K9      IIEDLILQRERQSE-------------------------------------ATLTGVQSQ
A0A7C6B2Q1      NIDQEIE------------------------------------------------NLNFE
A0A7C4QPD3      ILQDLAQRKVTVGG--------------------------------------QPQGSLDQ
A0A2Z3GZZ5      VLKEELARPPAAGG------------------------------PVLDELGAHILWVEQK
A0A4V0I6L6      MAALNSQIKVLEEE------------------------VAARGGPAEDELERYRRKLETE
A0A7C4QQT3      AASDSPGTPARPPA--------------------------------DDFVQLYVAALHQE
A0A255QXF5      DLEADYQQRLRERD-------DEIERQRKEFADLADIKQAELARRADYMSEHEAENLKQG
A0A518KBI5      D--------------------------------------------RQVGGQSVADHKREE
A0A5C5V6Q5      E--------------------------------------------RPFGGSTVVDEKRKE
A0A517MY49      ELGSIVINKLQQDV----------------------------------------------
A0A2E6AG00      QLQSFLXGMVKQEV----------------------------------------------
A0A1G3A880      RLGPMLIQMLSQAL----------------------------------------------
A0A2E8ATT1      ELGPLLISMLEEKL----------------------------------------------
A0A7C2JZW2      LLHELYKSRSAAVL------------------------------------GTQGVSTRAQ
A0A518KYQ0      ELD------------------EELERARAEYVASSIAKQKQHARRAELMSDQEKAEIAER
A0A5B9QX47      KADEDFEARKAAAI-----------------------------VERERKRAAQIAADEQE
M5T666          LVEEDFRQRKEVAERAFAWQQEQLKKQQQEMKRLQDKSAEERKVAQKAYAAAQAKERDNQ
M5U6N6          IVEEEYERQKEVVARTFAWQKEQLAKQQEELKKQQANSAEEQKAAQQAYIAAQERERERQ
A0A517M0G2      RLRRTAERTYKESL-------AER----------------------KAASFAQRESINQQ
A0A5C6AST1      LATEVAQRERAAQI-------AQMQFST------------------KANMESNRKSEQEQ
A0A5C6C951      DALELAERNRKAQL-------AQLEFKR------------------KAELKLGQQSDQQR
A0A5C6C5T3      IVDEDYRQRKAVAE-------RTLEWQQEQQKRQLALTEQERKLEETKNREAQLKERERS
A0A2A2W6A9      EIEEDYQQQLALAE-------KEKERLRAEFPAKVKAKQEELERRAEIMSDQEKQQIADR
A0A518HQS9      EIEEDYQRQLELAE-------LEKERLRAEFAANADAKKAELERRSELMSEQEKLLIGDR
A0A5M6DFE6      RIEFDYQRRLKDAE-------GDIERQKIAFQNEYRRSLADRDRQNQAELERQKWQDQEK
A0A5C6F286      IAEEQYQRDLANAE-------REMEFQREQLLARLKQEGRESEQMKEARAAAVRMEHDAQ
A0A517NGN1      RAETIYKQELAAVD-------AEVQLQRDQFLADQQLAKRKAVAMRQAAMKIDQETAQLA
M5RUI3          RADAEYERQKIAAK-------ARIESLKEGFEAQRKSKIEAARVEWQRELQKRYADEKKE
A0A660VT66      -------------S--------------------------------------YISETEDR
A0A7C2VEF7      -------------T--------------------------------------YIEVMRQR
A0A0S8H0S8      -------------N--------------------------------------HLALCAQR
A0A7C2ZTD2      AGSRSLIDARNELK--------------------------------------QTAAYENR
A0A2E3Z6T8      S------IPKEVVV----------------------------------------NLLRQS
A0A257WQ92      GSAPGEVDFVALYA----------------------------------------ESVRQE
A0A7C1U6X6      H------QIDVSLL----------------------------------------KPTHQN
A0A7C7UXI5      R------ELRPVLI----------------------------------------QMARQR
A0A7C3SFJ0      E------RIREHLA----------------------------------------EGWNTA
A0A7C7WWF7      E------SLGRLLL----------------------------------------SMVNER
A0A356ETW1      E------QLGPLLV----------------------------------------EMVRQQ
A0A3L7NJY1      N------ELGPRLL----------------------------------------QYINQQ
A0A523CME0      ------------------------------------------------------------
A0A354PCV3      ------------------------------------------------------------
A0A354PHB4      ------------------------------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A538RV31      ------------------------------------------------------------
                                                                            

M5S2L2          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A7C2VXA0      ------------------------------------------------------------
A0A7C3AA48      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A7C5PFV3      ------------------------------------------------------------
A0A7C3QGD2      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A7C2ZUK5      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
A0A7C2JY73      MA-------ER-----------QVRDKELEGIVQRESA------------------EARN
A0A356AE44      QA-------EL-----------KNRIGELQKLFDRSAD------------------QAKD
A0A1G2XSU7      LE-------QI-----------SLHQQQLRDMLVHEDS------------------KTIE
A0A350KD81      LK-------EL-----------ENRELELTKIFDQETE------------------LAKK
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      ---------VL-----------LASEESYEKAYNEQSL------------------VVFD
A0A524HC32      ---------TA-----------QRIVAAMKERIEQQKK------------------LVLG
A0A177PV03      ---------AA-----------QANLDEIEKQCNAAEY------------------KARA
A0A1G2YIM0      LE-------RI-----------NAYEEKLMAMLSKHNV------------------QTIE
A0A7D8YCU5      RL-------LL-----------LEDSTELETRLTEMRS------------------RAHD
A0A353BE27      SE-------VF-----------RLEEEELANQAERERR------------------SSRE
A0A5C6BPW1      IA-------RL-----------DVILEQLKEELDNRKI------------------QKTQ
A0A1I3GSP0      LK-------EL-----------ELDNQNLALLHTDAQK------------------KAKQ
A0A517QJV1      LE-------EL-----------KSIAKNLDIMREDAEK------------------KAKD
A0A3C1QS25      VR-------SI-----------DYELVAFRAQFEEHRA------------------RAME
A0A5C6FX55      VD-------ML-----------KQRLDLLTKEIESEAA------------------KGRL
A0A5C6DS51      VS-------EY-----------EIREKVLVETCEEELR------------------LAKE
A0A5C6DSL6      VA-------EY-----------EIREKVLVETSDQELI------------------EAKK
A0A3M1VG27      DA-------EL-----------THRRQQLEKLYEEKLR------------------VAKQ
A0A518GC22      IA-------AL-----------QLEEEHLQRDAAEEKK------------------KSRE
A0A3L7Q373      VE-------EL-----------QADQIALKSAYDDAEK------------------TARM
A0A3E0PW54      LM-------HR-----------QDLEQRLTADLASAES------------------EAKA
A0A7C3TAH2      IQ-------RL-----------KAQEDRLRQVLTEQDE------------------LAKK
A0A1Z8MHR4      IN-------IL-----------DEDMQSIDVQIERERQ------------------LADE
A0A5C6EHJ0      MD-------AM-----------DSELQVVTDAYEDEMT------------------QART
A0A5C6F1H9      MD-------AL-----------DSELTVVSDAYEAEMT------------------QARA
A0A255QXY0      LK-------VT-----------QKEIDDLDLQIEAEKR------------------AADE
A0A517SYI0      IN-------IL-----------DEDMQSIDVQIERERQ------------------LADE
A0A518HX54      LR-------VA-----------NEDLSEVDRKIDTEKL------------------AADE
A0A5B9MF59      LT-------VL-----------AQDMADIDLQIEQQKD------------------EADK
A0A2A2WC24      LT-------VL-----------AQDMSDIDLQIEQQKD------------------EADK
A0A518KYW8      LT-------VL-----------AQDMSDIDLQIEQQKD------------------EADK
A0A5C5YZZ0      IQ-------LI-----------DEDIADTNSRLTEVRD------------------RALK
A0A518JLD2      LQ-------SV-----------EQEIGEIQTAYHTAVE------------------AAKA
A0A5M6DJ15      IESRKIAAGVL-----------KQQSERINDDLVKMDE------------------EVKE
A0A3L7P7S7      IE-------EH-----------ETELAKVKDESQSLQE------------------ELDK
A0A517N8M1      ID-------LL-----------KAQIKELDGQITVERQ------------------DAAK
A0A5C6CW01      LD-------LL-----------KNQILELDKQIVDERA------------------AAIE
A0A5C6BXS9      VD-------LL-----------KEQIAEIDAQVTTEKS------------------EAIK
M5U569          VE-------LL-----------RQQIKELDSQIATEKS------------------EAVK
L7CND7          VQ-------LL-----------QQQISEIDSQIASERI------------------EATK
A0A0J1B8S4      VN-------LL-----------EQQIGEIDLQIASERK------------------EAIK
F2ARR3          VQ-------LL-----------RQQISEIDAQVNAEKS------------------EAVK
K5D8H6          VQ-------LL-----------RQQISEIDAQVNAEKS------------------EAVK
M2AKU0          VQ-------LL-----------RQQISEIDAQVNAEKS------------------EAVK
A0A5B1CKI2      VD-------LL-----------TEQRKELDDQISEERL------------------GASK
A0A5C6EG84      VE-------LL-----------NSQVRELDEQIAVERQ------------------SAAK
A0A5C6F2X4      VA-------LL-----------TSQVKELDSQIEDERT------------------EAAK
A0A5C5XTV6      VA-------LL-----------NEQISEIEAQIETEKK------------------KAIE
A0A5C6AAB1      VN-------LL-----------KQQITDLEEQIAVEKG------------------EAIK
M5T8W8          VE-------LL-----------QQQIAELDQQIANEKS------------------EAVQ
M5SF00          VQ-------LL-----------KQQISEIDSQIASERI------------------EAMK
A0A2G1WDS1      VQ-------LL-----------KQQISEIDSQIADERI------------------EAMK
Q7UVS9          VQ-------LL-----------KQQISEIDSQIAGERI------------------EAMK
A0A5C6B601      LT-------VL-----------QEDMRELDQKIATEEA------------------LADQ
A0A517PFU1      AR-------VL-----------QSQIDKLDERYAETRE------------------AAED
A0A5B9M8J9      LR-------VA-----------NEDLGVIDQKISVEKQ------------------AADE
A0A2A2WFP6      LR-------VA-----------NEDLAEVDRKIEAEKL------------------AADE
A0A518L8N2      LR-------VA-----------NEDLAEVDRKIDAEKL------------------AADE
A0A518HQN9      LT-------VL-----------AQDMSDIDLQIEKQKD------------------EADK
A0A5M6D8H8      LL-------VM-----------QDDLSQLDDQIAVEKR------------------AADE
A0A5B1CRW9      IA-------EY-----------EKRKSLLLAESQKEML------------------LAKQ
A0A5C6EI46      IS-------EL-----------QKRKTILMEEAEREML------------------AAKE
A0A1G2ZG92      KN-------IA-----------IAKKGLLQKYINAYQE------------------ELLN
A0A1G3A0W0      LA-------QT-----------KHEEQLLAAEIDKQQV------------------EFDT
A0A2E7D3V4      WK-------AL-----------ANKNVRLDSLYDDEAK------------------KAKE
A0A5B9PER9      TA-------EI-----------DQSIKDVSRMLAEQDE------------------QWQM
A0A517QSM4      ---------IL-----------EAEKNHLEQELSALKI------------------KEAG
A0A355GJI7      LK-------EL-----------ENRELELTKLFTQESE------------------LAKK
A0A1Z8MCI4      IA-------DL-----------ELRIKTLNDGINAEKA------------------RLAG
A0A517SYL7      IA-------DL-----------ELRIKTLNDGINAEKA------------------RLAG
A0A3L7P0L2      LE-------EL-----------EDEQVRLVEDYKEAEK------------------TAKE
A0A6M5YVJ1      VA-------GL-----------KKQEALVKTKVLDLRE------------------EVVK
A0A2E0SHG0      LE-------DI-----------KQREEMLKQYRDAAES------------------QAKL
A0A518CQB8      LE-------DL-----------LRQETTLVTFRDMAEA------------------KAKE
A0A517SCC8      LE-------EL-----------DSNSRLLEQEQKSSME------------------RAKS
A0A3A0DR44      LT-------AL-----------DAEHALLKRRYDEYMK------------------SLSE
A0A358MY60      LA-------KL-----------KARRALLEVEYDNERA------------------RLQQ
A0A517MNB1      LA-------EL-----------KSKRSILQQEYDLEKG------------------RLEQ
A0A142YJ13      LD-------IL-----------REQEKSLVQEIAGLES------------------QMSS
A0A517Z7D3      LV-------EL-----------DHRDKLLAKSLEEAEI------------------EAKR
A0A1N6KY57      CV-------IL-----------EKIEAALQDDVKRLTE------------------RSRS
L0DK20          IS-------IL-----------SKLEAVLASDVKRLSE------------------RSLS
A0A3L7UX05      YQ-------DL-----------IVREQAIRKNMQESKL------------------TLEN
A0A517XRC2      LT-------LD-----------RARLERKERTLTELTK------------------NAGN
A0A6M5YH47      LD-------VK-----------KLDRDKLKDLREAYKK------------------SISA
A0A660UUK3      LA-------QT-----------IEHEKKIREELDRYDT------------------ATIG
A0A517ZHG5      IA-------RM-----------DVILEQLKEELDNRKI------------------QKTQ
A0A1Z8MPL5      SI-------EA-----------NNYLASLQAEYSKLAL------------------QVQE
A0A7C1EH96      LN-------RL-----------ITYEEKIIAQLEEQDE------------------STIR
A0A5C1AGE3      SD-------VE-----------TKLRAERRDEIEKGQR------------------LIQI
A0A2Z3HEL7      IA-------IK-----------EKVRNGLRTERDTAKK------------------TIES
A0A142XAP8      IE-------VK-----------KGVREKHRLERDGLQR------------------VIAT
A0A6P2DEK1      IE-------VK-----------KGEREGHRLEREGLQR------------------VIAT
A0A5C6C1R5      VG-------IL-----------QQQKERIEHDLVELDS------------------EAKK
A6BZU4          LK-------EL-----------ENRELELTKIFDQETE------------------LAKK
A0A2D5GZ77      LK-------EL-----------ENRELELTKIFDQETE------------------LAKK
A0A3D3R1Z6      LK-------EL-----------ENRELELTKIFDQETE------------------LAKK
A0A517XG00      LK-------EL-----------ENRELELTKIFDQETE------------------LAKK
A0A1G2YRE4      LE-------QT-----------KVHEKHLREVLAQEDT------------------QVIE
A0A353Z859      LQ-------LL-----------EITIDGLDKQLVYEDE------------------SRNN
A0A2D6ST10      IG-------DL-----------LAWQAELEKKIDEHKT------------------TLTK
A0A177QX42      IN-------AY-----------ENEVAQLNSAFDNIKG------------------DALK
A0A517SHR0      IT-------SL-----------QNEVAELNTGFEDVKA------------------KALS
A0A2E0AW64      TE-------QM-----------AIEERVVTEKYQAEIE------------------EIQN
A0A351FZ59      TE-------QM-----------AIEERVVTEKYQAEIE------------------EIQN
A0A660V239      LA-------QT-----------IEYEERIRAKLAQQDK------------------DTIG
A0A177Q3B7      AS-------LL-----------QDLETSLVETVERLRK------------------QTQA
A0A2E0X6Y6      -A-------EA-----------QRREQRLTETFASARQ------------------AAAE
A0A518GFD7      IE-------VL-----------KQQEALLQEKVDVLSD------------------ETRK
A0A5C5VZJ8      LS-------RL-----------RDEEAVLAGLLDEEEA------------------RYEN
A0A518GE37      LD-------EL-----------DIRQAALQKEYEVEKS------------------RLEK
A0A5C6F3H8      RF-------AI-----------VSRLEILQAQYNEESE------------------RLEK
A0A5C5X072      RK-------AM-----------VAKLDVLQTQYNEERE------------------RLEQ
A0A5C5WUQ3      RA-------AL-----------VAKLGILQKQYDEERD------------------RMEQ
A0A5C6E697      RQ-------QL-----------QSRLSVLQNQYEAERM------------------RLEQ
A0A5C5Z1A3      RD-------GL-----------ETRLQMIEKQYDAERT------------------RLEQ
A0A5C6D2P7      RQ-------QL-----------QMKLDVLNKQYEEERI------------------RMEQ
A0A5B9ML17      IT-------EK-----------KEKIKIIQRQLDQESE------------------KFTT
A0A518HFS8      LE-------IL-----------EEQERIL----REEIA------------------SLEQ
A0A5Q3LBQ3      LD-------ST-----------RLMEELLSRRYEEELG------------------KVKK
A0A517LX75      IN-------EL-----------TKRQQHLVEEAKTERV------------------LAKE
A0A7C5W7B3      LE-------TL-----------ESQRKALEEKIA-----------------------ASD
A0A2S8F9B8      LG-------VL-----------RQQEKTLAKEVAELEN------------------EVRT
A0A354GX32      LL-------TL-----------GKKISELESQVANLRA------------------GGQT
A0A142XL75      IR-------IL-----------EKRFALAKEKHDNILR------------------KISQ
A0A6P2D5D5      VE-------TL-----------EKREKIAKGKIEEIIK------------------RVSK
A0A5C1AAF0      IA-------FQ-----------EELGKVLVTEIDRLGK------------------SIKS
A0A7C7T8W8      LA-------EL-----------AISEEMINESITEEKN------------------KLLK
A0A5C6B3S0      IA-------IL-----------AAQEKQLQQEVNELEN------------------EAKQ
A0A368KP63      VG-------VL-----------KQQEETLAAEVAVLEK------------------EVRT
A0A518GIZ9      LK-------EL-----------DIREQQLNVLFELESN------------------KAKE
A0A1C3EBY9      LK-------EL-----------DIREQQLNVLFELESN------------------KAKE
D5SX64          LK-------EL-----------DIREQQLNVLFELESN------------------KAKE
A0A517Z0U7      ID-------LL-----------RKMEDGYTEEINALKV------------------EERH
A0A2S8FCC0      ---------IL-----------EQMEKQLDESVQLFEK------------------EAKQ
A0A1Z8MBT6      LG-------RR-----------KRQLEMVKNEYQIEGD------------------KRSK
A0A517SXN9      LG-------RR-----------KRQLEMVNNEYQIEGD------------------KRSK
A0A518HFL0      LL-------AL-----------QQKRELMKQRLDRIEP------------------STRS
A0A3B8ZJM2      YK-------SL-----------KLEEEEIQRWIDEDTA------------------KSQI
A0A1U7CLW1      LE-------IL-----------HEQEKSLIDEIASLES------------------QMSS
A0A142WPR7      VD-------VI-----------QTKQKEMNLLFDQEKE------------------AAKS
A0A3M1TFJ0      RQ-------EI-----------DTILGQLESQRQQRLS------------------EEEG
A0A517P477      -A-------QL-----------ESFRNNLRQQLEENQI------------------EERQ
A0A517T4K9      IE-------LL-----------QAEYDYLTKELENQKA------------------DEKR
A0A7C6B2Q1      LA-------IL-----------DAQQQQLQQEVENVRR------------------TAET
A0A7C4QPD3      MA-------TR-----------LKMLRSLRDRYVAELD------------------SLQL
A0A2Z3GZZ5      RR-------TA-----------GRQLVQLEAQLSKDEE------------------TMKR
A0A4V0I6L6      LG-------AI-----------SAQLDILARRIDADEE------------------TARN
A0A7C4QQT3      LA-------EL-----------KIRDEQLAKLFHIESE------------------QAKE
A0A255QXF5      RE-------RL-----------ERQLAVLQKQYDAEAD------------------RLRK
A0A518KBI5      LA-------SL-----------EIQERTLRRRFEKELA------------------NVQE
A0A5C5V6Q5      LA-------AL-----------QIQQRSLKTRFQAELK------------------SVQD
A0A517MY49      -S-------QA-----------MQQERQLTSSFEEARD------------------VASK
A0A2E6AG00      -D-------QA-----------SAHESQLKIEYVEARD------------------SAVQ
A0A1G3A880      -A-------NA-----------SQREMALRDSFETARA------------------EAVR
A0A2E8ATT1      -F-------EA-----------WTFEKGLLKEYQALEE------------------SALT
A0A7C2JZW2      LD-------ER-----------LKMLKLLLARYDEQLS------------------ASKT
A0A518KYQ0      RE-------QL-----------VKRLDVLESQYKAESD------------------ILRQ
A0A5B9QX47      RK-------SL-----------VAKLEIAQSLYDEERE------------------RMSQ
M5T666          RK-------VL-----------VAKLDILKAQHDEERE------------------RMEQ
M5U6N6          RK-------AL-----------LAKLNILQAQHDEERE------------------RLEQ
A0A517M0G2      LV-------DL-----------KARRAIIQQEYDIEKS------------------RLEQ
A0A5C6AST1      LA-------AL-----------KAKRAIIQQEYDEEKA------------------RLEQ
A0A5C6C951      LA-------EL-----------KAKRAITQQEYDNEKA------------------RLEK
A0A5C6C5T3      RK-------EM-----------VAELNVVQSEYDEERE------------------RLEQ
A0A2A2W6A9      RE-------QM-----------VKRLAVLQEQYEAEAD------------------LLRQ
A0A518HQS9      RD-------QL-----------VKRLQVLQDQYKTESD------------------RLRQ
A0A5M6DFE6      RR-------QL-----------VARLASVREQYEQERE------------------RMKK
A0A5C6F286      RK-------VI-----------ASRLDILQSQYSEERQ------------------RLEK
A0A517NGN1      RK-------EL-----------EARLAVLNTHYDRERV------------------RLEQ
M5RUI3          YE-------AL-----------ATQLDVLQKQYDDERS------------------RLEQ
A0A660VT66      KV-------LL-----------DEMEQE----LRDSEA------------------RAQR
A0A7C2VEF7      WR-------TA-----------KQKEQTLLVSFQIQRR------------------QAQD
A0A0S8H0S8      LS-------AA-----------QQKQGEIRAALVDQQK------------------QAEQ
A0A7C2ZTD2      LR-------EI-----------LDKEDAETIGLGRKQL------------------TIQD
A0A2E3Z6T8      TQ-------QA-----------IEKEKQIRQAYQQARA------------------EAAA
A0A257WQ92      LA-------EL-----------DVRDQHLAQLVEDESV------------------KARG
A0A7C1U6X6      MK-------RMEKELAYAEDALRRRAAELDEEWRNRSSVVAPVAPGVSALAEALLSPEQQ
A0A7C7UXI5      LE-------QA-----------RQHEQAVRRQYEVEMQ------------------RAIA
A0A7C3SFJ0      PK-------TP-----------REQQIASLDAWKTEKAVLEKELQIAQEAFNKHVEETQK
A0A7C7WWF7      LT-------KA-----------VAHERELDRQYNLATG------------------EAKV
A0A356ETW1      LR-------EA-----------VEQEQSLRVQFQAAQA------------------DASR
A0A3L7NJY1      LQ-------KN-----------EENELAIFARLESEQV------------------KAQN
A0A523CME0      ----------------------KTELKKRKDRESASFT------------------EKEK
A0A354PCV3      ----------------------ETKLTVLRKQYEEEVA------------------RLEQ
A0A354PHB4      ----------------------ETKLTVLRKQYEEEVA------------------RLEQ
A0A356ESF4      ------------------------------------------------------------
A0A538RV31      ----------------------EEMEKKLREELDKMAS------------------DVKS
                                                                            

M5S2L2          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A7C2VXA0      ------------------------------------------------------------
A0A7C3AA48      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A7C5PFV3      ------------------------------------------------------------
A0A7C3QGD2      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A1V6CUG1      ---------------------------------MANVWDAIKKHQAEQEQQRAAAD----
A0A3M1SE88      ------------------------------------------------------------
A0A7C2ZUK5      ---------------------------------------MRISGTRERSFYRRVTV----
A0A660WB30      ---------------------------------GRNGEGADVKRFAASLPLVHSSP----
A0A660W9Z7      ------------------------------------------MSNESLGKLNNLIS----
A0A3M1R9K7      ----------------------------------------VEIVQEAQQPRVADQD----
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
A0A7C2JY73      VAK----Y-------------------------QAKDETLNAELARLRQLWGQLDS----
A0A356AE44      FAQ----Y-------------------------EEREQTLSDELKRIKSLHDIVAN----
A0A1G2XSU7      LGR----K-------------------------QLAMQDVKEQLDNSKDMYSTIQK----
A0A350KD81      VGD----F-------------------------QVVDQSYNEEIAQLKSQRDNIFK----
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      LNR----K-------------------------ITVYRRLQREADSERAFYDILLK----
A0A524HC32      LNE----R-------------------------ATQYSIIAREVDTNKAIYQSLLE----
A0A177PV03      REE----W-------------------------IKQEARFKESALSARQSYEEVGK----
A0A1G2YIM0      LGR----K-------------------------QLAMQDQKDQFALTEEMYNTIRR----
A0A7D8YCU5      LMR----F-------------------------ENENISFNRRIKRLQDMLDSFEA----
A0A353BE27      LQG----M-------------------------LDGYRILQTDRDAVSELLTAYTE----
A0A5C6BPW1      IVT----D-------------------------SFELQQLQKEAAKLEARTDEIDN----
A0A1I3GSP0      AEM----F-------------------------EVEDQRRKDEIAQKKQQLERMFD----
A0A517QJV1      AEL----Y-------------------------QVEDQRLKDDLSIKKAQLSQVFN----
A0A3C1QS25      LNQ----V-------------------------DLSLKNLLDQKKYQESVITSVVD----
A0A5C6FX55      LAD----K-------------------------EVDYIALQNKIEGTRELVTQVSE----
A0A5C6DS51      VEN----A-------------------------FLEGSAKKAKLVRAQARYDEVIR----
A0A5C6DSL6      VEN----A-------------------------FLEGSAKKAILVRAQARYDEVIR----
A0A3M1VG27      FAH----I-------------------------LEQDQAYRDQIQSIKSTLDVVIS----
A0A518GC22      LQI----M-------------------------LGEDRVIKAELEAVNTLLAGYTE----
A0A3L7Q373      AST----Y-------------------------EVTDQQYKDDIARMKKDLDLALK----
A0A3E0PW54      AGL----F-------------------------EVEDQKRKDEIARHKKQWQDVIV----
A0A7C3TAH2      MGR----T-------------------------AVDIQTLQWELDLVKKDHDLAYN----
A0A1Z8MHR4      LKK----A-------------------------EENDASFNRRLETIHALRFQLEQ----
A0A5C6EHJ0      ESD----S-------------------------EIRSAQFVREIERQQQLYDRIVA----
A0A5C6F1H9      ESD----S-------------------------EIRSAQFVREIDRQQQLYDRIVA----
A0A255QXY0      LKH----F-------------------------EEDESSYKRRIASVQGMLIQLEE----
A0A517SYI0      LKK----A-------------------------EENDASFNRRLETIHALRFQLEQ----
A0A518HX54      LKK----Y-------------------------EDTDASFRRRIASLQGMLIQLEQ----
A0A5B9MF59      LKI----V-------------------------EERDASFNRRIETMRGLETQLEQ----
A0A2A2WC24      LKI----V-------------------------EERDASFNRRIETMRGLETQLEQ----
A0A518KYW8      LKI----V-------------------------EERDASFNRRIETMRGLETQLEQ----
A0A5C5YZZ0      LIA----F-------------------------ENKNSSFLRSIARYQETLQSFDS----
A0A518JLD2      ESI----A-------------------------ESRSEQYVREIERQQQLYDRIVA----
A0A5M6DJ15      LGK----S-------------------------SMEIEMKRSEIASLSDVLTRLAA----
A0A3L7P7S7      HKA----L-------------------------ENRKLEMSRRLEQLTRDSETIEF----
A0A517N8M1      LAQ----F-------------------------EQENQAQLREIERTRDLLNQLEE----
A0A5C6CW01      LAK----Y-------------------------EQDNVAMLRELERNRDLMDQLEE----
A0A5C6BXS9      LAK----Y-------------------------EQENMALLREIERNRELSNQLEE----
M5U569          LAR----Y-------------------------EQENNAILREIERNRELINQLEE----
L7CND7          LAQ----D-------------------------EQENASMLRQIDRNRELINQLDE----
A0A0J1B8S4      LAQ----F-------------------------EQENTALLREIDRNRELINHLEE----
F2ARR3          LAK----F-------------------------EQDNTALLREIDRNRELINQLEE----
K5D8H6          LAK----F-------------------------EQDNTALLREIDRNRELINQLEE----
M2AKU0          LAK----F-------------------------EQDNTALLREIDRNRELINQLEE----
A0A5B1CKI2      LAQ----Y-------------------------EQENQAQLREIERTRELLEQLEE----
A0A5C6EG84      LAQ----F-------------------------EQENHAQLREIERTRELLDQLEE----
A0A5C6F2X4      LAQ----F-------------------------EQENQAQLREIERTRELLNQLEE----
A0A5C5XTV6      IAK----F-------------------------EQENMAILREMERNQALINQLDE----
A0A5C6AAB1      LAK----F-------------------------EQENSAILREIERNRELINQLEE----
M5T8W8          LAK----Y-------------------------EQENNAILREIDRNRELIDQLEE----
M5SF00          LAQ----D-------------------------EQENASMLRQIDRNRELINQLDE----
A0A2G1WDS1      LAQ----D-------------------------EQENASMLRQIDRNRELINQLDE----
Q7UVS9          LAQ----D-------------------------EQENASMLRQIDRNRELINQLDE----
A0A5C6B601      LHK----A-------------------------ENTDKAFNRKMDFLKGMLDELDQ----
A0A517PFU1      VRD----A-------------------------ESRERELRDRRNRHADLYAALVA----
A0A5B9M8J9      LKK----F-------------------------EDTDASFRRRIASIQGMLIQLEQ----
A0A2A2WFP6      LKK----F-------------------------EDTDASFRRRIASLQGMLIQLEQ----
A0A518L8N2      LKK----F-------------------------EDTDASFRRRIASLQGMLIQLEQ----
A0A518HQN9      LKI----V-------------------------EERDASFNRQIETMRGLETQLEQ----
A0A5M6D8H8      LKE----Q-------------------------EQNDASYRRRIESIRGMTIQLEQ----
A0A5B1CRW9      IEA----D-------------------------FMKATSLRAKMQRAQQRYDEVVE----
A0A5C6EI46      VEA----S-------------------------FMESNSLKAKLARAQSRYDQVIV----
A0A1G2ZG92      IPL----K-------------------------DSENSKLELTLTINKDMYQNLLE----
A0A1G3A0W0      LFA----T-------------------------AQSLEKANNDLNHKRDLFEAVRQ----
A0A2E7D3V4      FSK----F-------------------------EAEDQKFVEEIARIKSLQAVIVK----
A0A5B9PER9      HNN----E-------------------------AIKLSKIEQEITRLDEQLKEIGASQRL
A0A517QSM4      EGT----A-------------------------AFNLEELKREITHMETTESRFRT----
A0A355GJI7      VGN----F-------------------------QVIDQSYNEEIAQLKSQRDNIFK----
A0A1Z8MCI4      EQS----K-------------------------WNAIQFELDNVEVSKDVLISLRR----
A0A517SYL7      EQS----K-------------------------WNAIQFELDNVEVSKDVLISLRR----
A0A3L7P0L2      ASS----Y-------------------------EVIDQRYKDDIARKKKELDAILT----
A0A6M5YVJ1      SND----Y-------------------------RVEIAKIRSEIAQTEKVMTRIAD----
A0A2E0SHG0      VAN----F-------------------------KLNQELLSDERELKKELRSVSIQ----
A0A518CQB8      VAT----F-------------------------KLNEELLRDEKELKKELFTNSNR----
A0A517SCC8      GML----L-------------------------EKDDRDWKERIADQKKFRDDLQM----
A0A3A0DR44      SGG----D-------------------------AVRLQFKYADLERESSVFNLIAQ----
A0A358MY60      KGG----N-------------------------AVELLFAKEDREIASQLLGMMQQ----
A0A517MNB1      KGG----D-------------------------AADLRFAQEDREIAVGILAKLNE----
A0A142YJ13      LNV----K-------------------------TMDVHWLDEEIEVASSTAKTVGA----
A0A517Z7D3      ASL----F-------------------------ELEDQKRKDEIERVKDQLKTALT----
A0A1N6KY57      IGQ----N-------------------------SVDLFSIQEEIANADEIARLIGK----
L0DK20          ITQ----N-------------------------SVDLFSVQEEIANADEIARTIGK----
A0A3L7UX05      DES----K-------------------------ELQLAFRRTDLARAESTLDSVQR----
A0A517XRC2      IAK----T-------------------------GFDIQSLTRGLEPMKKRLDTLED----
A0A6M5YH47      GVG----G-------------------------GLNMKALQDGLKPQRENLERVNA----
A0A660UUK3      LGR----K-------------------------QLNIDDKKAELARTREIFNTVCN----
A0A517ZHG5      IVT----D-------------------------SFELQQLQKEAAKLEARTDEINN----
A0A1Z8MPL5      IGE----Y-------------------------SADLERRQDELVHLTQVTNELGY----
A0A7C1EH96      IGR----T-------------------------QLDIDDLREQFENSRQIYNEITR----
A0A5C1AGE3      ERT----TAQSNLTKYSQAVTELESRLEVMNRMGIEVIKQDREIKPKMEQKQKIEE----
A0A2Z3HEL7      TAG----G-------------------------GASIDALRKNLEPQRALLSRLDE----
A0A142XAP8      TAA----G-------------------------GLSIDEDRKNLQPQREMHDKIQS----
A0A6P2DEK1      TAA----G-------------------------GLSIEEERKNLQPQREMHDKIQT----
A0A5C6C1R5      LGR----S-------------------------SIDIEMMRAEIASLDDVLNRLGS----
A6BZU4          VGD----F-------------------------QVVDQSYNEEIAQLKSQRDNIFK----
A0A2D5GZ77      VGD----F-------------------------QVVDQSYNEEIAQLKSQRDNIFK----
A0A3D3R1Z6      VGD----F-------------------------QVVDQSYNEEIAQLKSQRDNIFK----
A0A517XG00      VGD----F-------------------------QVVDQSYNEEIAQLKSQRDNIFK----
A0A1G2YRE4      IGR----R-------------------------QLNIEDLQFQQNLDQETYDTVRR----
A0A353Z859      KLA----W-------------------------QMELDELNKSIEQFRTIYNRLQE----
A0A2D6ST10      NNI----F-------------------------NAELNRLDQDIAQDGALIDAIAT----
A0A177QX42      MQG----E-------------------------QRTNERLNEEHANLKQTYEALVS----
A0A517SHR0      MQE----D-------------------------QRIDQRLTEEHNHLKQLYDALVA----
A0A2E0AW64      AKG----R-------------------------TFDMVQLQTSLERAEEQALAFQD----
A0A351FZ59      AKG----R-------------------------TFDMVQLQTSLERAEEQALAFQD----
A0A660V239      MGR----K-------------------------QFVIDDKKDQLARTTARLEDTKK----
A0A177Q3B7      ATV----G-------------------------QSDIESFRTEIAQSEKIADRIGS----
A0A2E0X6Y6      HSG----H-------------------------IVEIERLEGQVEWTKTQREAILA----
A0A518GFD7      LGQ----S-------------------------SIDVELMRAEIAGLEDVLQHVGG----
A0A5C5VZJ8      ASR----L-------------------------ASRLVEVEREVEADTHELDNLEK----
A0A518GE37      QGG----E-------------------------TAEIFFAREDYEQAAEILSQLNN----
A0A5C6F3H8      FGG----T-------------------------TAQLQFAQDELAVASGVLKKLRD----
A0A5C5X072      YGG----M-------------------------TAELRFANDELVVASGVLTKLRG----
A0A5C5WUQ3      FGG----A-------------------------TAALQFAQEELSVATDVLRKLRD----
A0A5C6E697      FGG----A-------------------------TAELQFAQEELSVANDVLRKLRD----
A0A5C5Z1A3      FGG----T-------------------------TAELQFAQEQLDVANEVLIQLRS----
A0A5C6D2P7      FGG----A-------------------------TAELQFAQEELAVANDVLKKLRD----
A0A5B9ML17      LLD----D-------------------------SAKLQFAQDDLRRASLLLNKLED----
A0A518HFS8      EMGTLGIQ-------------------------SLDLHWVEDEIDLSTEVARAVGS----
A0A5Q3LBQ3      SSG----Q-------------------------SLELVFALAELEREEKVFELIAA----
A0A517LX75      VES----E-------------------------YLEGKALKARMVRAQQRYDEVME----
A0A7C5W7B3      TDD----N-------------------------TIRLRILEKRREALRTLLEDLNR----
A0A2S8F9B8      FGR----S-------------------------SVEVEMMRSEIESLDEIVQQLNA----
A0A354GX32      AGK----S-------------------------NGDVDGLQAEVNALDAEVKKSGE----
A0A142XL75      TND----Y-------------------------KIELSTIQFSIGQTEKLNQSLGE----
A0A6P2D5D5      TND----Y-------------------------KIELDGLKLSIGQTEKLNQSLGE----
A0A5C1AAF0      INT----A-------------------------NLDLEAEKIEIQTAEDLYAKVAA----
A0A7C7T8W8      TGD----R-------------------------SLEFAFALQEVNRAEGVHSLISE----
A0A5C6B3S0      FGK----S-------------------------SIDVEMMRSEMSALEQVLSSIGE----
A0A368KP63      YGR----S-------------------------SVEVEMMRSEIEGLDSIVQQLSA----
A0A518GIZ9      YAR----F-------------------------QAEDQAMTAELNRLRSLWGQLVD----
A0A1C3EBY9      YAR----F-------------------------QAEDQAMTAELNRLRGLWGQLVD----
D5SX64          YAR----F-------------------------QAEDQAMTAELNRLRSLWGQLVD----
A0A517Z0U7      LAV----S-------------------------WVDRQILADTVDSLKEKVNRFSD----
A0A2S8FCC0      FGR----S-------------------------SIDVEMMRTEIDSLEGILSRLGH----
A0A1Z8MBT6      RVN----D-------------------------SWDVDKHVNHLAMLRERYAAAEQ----
A0A517SXN9      RVN----D-------------------------SWDVDKHVNHLAMLRERYAAAEQ----
A0A518HFL0      EGI----E-------------------------QLKVSFAATDLRQRRIMLDQVNR----
A0A3B8ZJM2      VQG----F-------------------------LLTHESIKNQAEKLDKIQEVLSD----
A0A1U7CLW1      LNV----K-------------------------SMDFHWLEDEIAVASDTAKMVGA----
A0A142WPR7      LVA----Y-------------------------EVRDESLRNEIARTSKLFEGVVK----
A0A3M1TFJ0      LSQ----R-------------------------AQQLREQSRQLARRARLYESLKK----
A0A517P477      AGK----E-------------------------SVGLRRLEAELLRKEELVNLLAT----
A0A517T4K9      TGT----L-------------------------SYELETVNKAIEQTEKIVQNVKD----
A0A7C6B2Q1      FGK----G-------------------------SIEIEFLRAEVELARRTLQTIAE----
A0A7C4QPD3      AET----K-------------------------LARDWVDREAIAEEIAALKGTVDAYAM
A0A2Z3GZZ5      AGG----L-------------------------LDLAEAMAVQSQHADAEIMRLEA----
A0A4V0I6L6      MAP----V-------------------------QQAIRNNEEKLKQTAAELQAAEK----
A0A7C4QQT3      VAR----F-------------------------QAQEQALSAELTRLRELWGQLVT----
A0A255QXF5      RDN----N-------------------------NVALEFAKTDLQQSRAMLQKVTE----
A0A518KBI5      GGG----K-------------------------GAELEFAKAELAREEKVFELIAA----
A0A5C5V6Q5      SGG----K-------------------------GAELEFAKAELAREEKVFEMIAA----
A0A517MY49      HSA----D-------------------------LATLENLEREKGRLESSYDAVKD----
A0A2E6AG00      XHX----Q-------------------------IEELAIAEREVERLRSLHHTLQD----
A0A1G3A880      LNG----D-------------------------LAQLEILEHDVEQLRSFHDVLVN----
A0A2E8ATT1      LND----D-------------------------MAELTITERDVERLSRLHDTLLE----
A0A7C2JZW2      EEA----S-------------------------LANLMIEREQLTEQITSLKSTVDIYAQ
A0A518KYQ0      RDG----V-------------------------SVALLFAQDDLERTRSMLHRITD----
A0A5B9QX47      YGG----A-------------------------TAELSFARQELEVANDVLSKLRG----
M5T666          FGG----T-------------------------TAELQFANDELVVASDVLTKLRG----
M5U6N6          YGG----T-------------------------TAELQFANDELTVASDVLTKLRG----
A0A517M0G2      RGG----K-------------------------AADLRFATEDREIAAGILGQLNQ----
A0A5C6AST1      HGG----D-------------------------AADLHFAQEDREIAVGILGQLNQ----
A0A5C6C951      QGG----N-------------------------SADLKFAQEDREVAVGILAQLNQ----
A0A5C6C5T3      YGG----M-------------------------TAELEFAEDEQAVASDVLTKLRG----
A0A2A2W6A9      RDG----N-------------------------SVALQFAQDDLARSRTMLHRIMD----
A0A518HQS9      RDG----N-------------------------SVALQFANDDLERSRSMLHRIVD----
A0A5M6DFE6      YSG----A-------------------------SAELEFAQQELAIERETLQTLRN----
A0A5C6F286      FGG----T-------------------------TAQLQFAQDELDVASGLLKKLRD----
A0A517NGN1      LGG----D-------------------------AAELQFAEEDLAVGNGVLDKLRQ----
M5RUI3          FGG----A-------------------------SADLQLAIDEKQIAMDVLGKLKI----
A0A660VT66      MLT----L-------------------------LQSYTKLERDLKSSQSLYDIVLQ----
A0A7C2VEF7      SGV----K-------------------------AAEYSMLQSELGRTERICKILDD----
A0A0S8H0S8      MDA----R-------------------------LARCALLEAAFKRSLRMNELLDS----
A0A7C2ZTD2      LQF----Q-------------------------LELDGELYDKIRRRIQEMEMEQK----
A0A2E3Z6T8      YSG----S-------------------------LVQFRALERAVARDEAKSDILTD----
A0A257WQ92      VAK----F-------------------------QAKDEAMHAELARLRDLWGQLVT----
A0A7C1U6X6      LEQ----A-------------------------KQELPLLEEQYAKDKKDFDQLFA----
A0A7C7UXI5      LDR----D-------------------------NTELTNLELDLDRLRRYYDAVLQ----
A0A7C3SFJ0      FSS----Q-------------------------SIDLELRKNELDRLKRLTERMGQ----
A0A7C7WWF7      VTR----E-------------------------LTLLSETQSDVERLMHLHDTLLD----
A0A356ETW1      RTG----Q-------------------------IARLTMLQREVKRLYDLSDALVS----
A0A3L7NJY1      LTQ----I-------------------------LTRLADVDREIERLYTQQSDYQN----
A0A523CME0      KGE----N-------------------------NSEIERFTKKGQNLKR-DSKMAG----
A0A354PCV3      FGG----M-------------------------TAELQFAQAELEVANDVLKKLRD----
A0A354PHB4      FGG----M-------------------------TAELQFAQEELEVANDVLKKLRD----
A0A356ESF4      ---------------------------------MTELENKERDLKRLQTWNEQLLN----
A0A538RV31      DAR----R-------------------------GVELESLKEQIESTDKISQRLHQ----
                                                                            

M5S2L2          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A7C2VXA0      ------------------------------------------------------------
A0A7C3AA48      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A7C5PFV3      ------------------------------------------------------------
A0A7C3QGD2      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A1V6CUG1      --QVSAET----------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A7C2ZUK5      --GKVSRA----------------------------------------------------
A0A660WB30      --KFALIM----------------------------------------------------
A0A660W9Z7      --TALDLQ----------------------------------------------------
A0A3M1R9K7      --RQIQLT----------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
A0A7C2JY73      --QVNQVG---------I-E-----------------------KD-----GSGYSLRQIA
A0A356AE44      --RVEVLS---------L-------------------------AS-----DEGYQLTQIS
A0A1G2XSU7      --RIGELE---------MER-----------------------KR-----LARISVAYLA
A0A350KD81      --QLLVEK---------V-S-----------------------QG-----NSGYTLTQLA
A0A2D6SRY7      --EEARIA-----------E-----------------------AA-----EVGT-AQLVD
A0A1G3C300      --RMKESN---------I-A-----------------------GD-----LQTSNVSILD
A0A524HC32      --RAKEIE---------S-M-----------------------SG-----VSASNIQKVD
A0A177PV03      --RLNELQ---------L-S-----------------------KN-----FGGVTADVI-
A0A1G2YIM0      --RIQELE---------M-E-----------------------RK-----RPARISIAFN
A0A7D8YCU5      --QVERAS---------L-P-----------------------LM-----NPGLEVEVLN
A0A353BE27      --KLQEID---------L-M-----------------------PK-----MGQRTLKRLD
A0A5C6BPW1      --KIDELK---------IEL-----------------------DA-----PDRINVAQWA
A0A1I3GSP0      --QIAEYD---------I-T-----------------------RG-----QEGYRLQQIS
A0A517QJV1      --QIATYD---------V-S-----------------------KE-----QEGYRMKQIA
A0A3C1QS25      --RLQQVD---------V-T-----------------------GD-----KEGFNYEILE
A0A5C6FX55      --SMARVD---------MST-----------------------ST-----ESETRVVELI
A0A5C6DS51      --RLQELN---------L-A-----------------------GS-----YAGFSTDLLA
A0A5C6DSL6      --RLQELN---------L-A-----------------------GS-----YAGFSTDLLA
A0A3M1VG27      --RMQEIE---------L-I-----------------------KD-----NRGYALRTVA
A0A518GC22      --KLQEIS---------L-M-----------------------PK-----VGQRTLKRLN
A0A3L7Q373      --QLSDLD---------Q-N-----------------------KA-----QEGYKMSRTN
A0A3E0PW54      --ELESFG---------V-R-----------------------KE-----QEGYRVNQIA
A0A7C3TAH2      --RLAEKQ---------L-E-----------------------QR-----RERRITVQAS
A0A1Z8MHR4      --QLAALN---------L-A-----------------------HV-----NDGIMVKQIQ
A0A5C6EHJ0      --RLDEVN---------L-M-----------------------SG-----GDGLKVFPLN
A0A5C6F1H9      --RLDEVN---------L-M-----------------------SG-----GDGLKVFPLN
A0A255QXY0      --QLAGLK---------L-I-----------------------DM-----DGGIIVDQLW
A0A517SYI0      --QLAALN---------L-A-----------------------HV-----NDGIMVKQIQ
A0A518HX54      --QLAALE---------L-I-----------------------DI-----NGGILVEPLL
A0A5B9MF59      --QLAALN---------L-A-----------------------DV-----KGGILVEPLL
A0A2A2WC24      --QLAALN---------L-A-----------------------DV-----KGGILVEPLL
A0A518KYW8      --QLAALN---------L-A-----------------------DV-----KGGILVEPLL
A0A5C5YZZ0      --QLEKAN---------L-P-----------------------SL-----NSGLHVNVLR
A0A518JLD2      --RLDEVN---------L-I-----------------------SE-----GEGLKVIPLN
A0A5M6DJ15      --EIERTS---------I-------------------------EL-----NAQPRVTVVD
A0A3L7P7S7      --NKQQYA---------M-T-----------------------KD-----HGGYDAQELG
A0A517N8M1      --QMARVT---------I-S-----------------------ED-----ERGTRVIELT
A0A5C6CW01      --QMARVS---------L-T-----------------------EE-----EGGTRVQELT
A0A5C6BXS9      --QMARIE---------L-T-----------------------EE-----EGGLRVSELR
M5U569          --QMARVE---------L-T-----------------------EE-----EGGVQVTELS
L7CND7          --QMARVE---------L-T-----------------------EE-----EGGLQVSELR
A0A0J1B8S4      --QMARVE---------L-V-----------------------EE-----EGGIRVTELV
F2ARR3          --QMARVE---------L-T-----------------------EE-----EGGLRLTELR
K5D8H6          --QMARVE---------L-T-----------------------EE-----EGGLRLTELR
M2AKU0          --QMARVE---------L-T-----------------------EE-----EGGLRLTELR
A0A5B1CKI2      --QMAKVS---------I-G-----------------------KD-----ERGTRVIELT
A0A5C6EG84      --QMARVN---------L-V-----------------------ED-----ERGTRVIELT
A0A5C6F2X4      --QMARVN---------L-V-----------------------ED-----ERGTRVVELT
A0A5C5XTV6      --QMARIE---------L-S-----------------------EE-----DGGLQVTSLR
A0A5C6AAB1      --QMARVE---------L-T-----------------------DE-----EGGVRVSELT
M5T8W8          --QMARVE---------L-T-----------------------EE-----EGGVRVSELS
M5SF00          --QMARVE---------L-T-----------------------EE-----EGGIQVSELR
A0A2G1WDS1      --QMARVE---------L-T-----------------------EE-----EGGIQVSELR
Q7UVS9          --QMARVE---------L-T-----------------------EE-----EGGVQVSELR
A0A5C6B601      --RIEELD---------L-A-----------------------NT-----NGGIVVEPLL
A0A517PFU1      --DVDQLD---------L-L-----------------------KD-----ADTVRVTPIV
A0A5B9M8J9      --QLAALE---------L-I-----------------------DI-----NGGILVQPLL
A0A2A2WFP6      --QLAALE---------L-I-----------------------DI-----NGGILVEPLL
A0A518L8N2      --QLAALE---------L-I-----------------------DI-----NGGILVEPLL
A0A518HQN9      --QLAALN---------L-A-----------------------DV-----KGGILVEPLL
A0A5M6D8H8      --QMSALK---------L-V-----------------------DV-----NGGIIVEPLL
A0A5B1CRW9      --RLQELK---------L-S-----------------------RS-----YAGFSTDLLA
A0A5C6EI46      --RLQELN---------L-S-----------------------RS-----YAGFSTDLLA
A0A1G2ZG92      --YLMTVS---------I-A-----------------------ES-----MTLSNIRLIE
A0A1G3A0W0      --RMDQKT---------M-E-----------------------RD-----IPPS-IEVLS
A0A2E7D3V4      --RLAEMG---------L-V-----------------------AK-----NYGYKLKQIS
A0A5B9PER9      GAELL------------L-Q-----------------------ISPDGDISNSNGNDGYR
A0A517QSM4      --EIEALL---------I-E-----------------------IQ-----AKQR-ITENR
A0A355GJI7      --QLLVER---------V-S-----------------------QG-----NSGYMLTQLA
A0A1Z8MCI4      --REAALK---------T-E-----------------------GG-----YKDV-VSSLA
A0A517SYL7      --REAALK---------T-E-----------------------GG-----YKDV-VSSLA
A0A3L7P0L2      --QITHFD---------L-N-----------------------KD-----QEGYTLSRTN
A0A6M5YVJ1      --EANSIK---------I-E-----------------------LG-----GAPPRVSLAE
A0A2E0SHG0      --RLNDIA---------L-L-----------------------ED----------YDLLQ
A0A518CQB8      --RLEDIS---------L-L-----------------------ED----------YELLK
A0A517SCC8      --KLASFN---------Q-T-----------------------RD-----QEGYRMEQIA
A0A3A0DR44      --RKLQVE---------T-E-----------------------TH-----NPAK-VIVRS
A0A358MY60      --RLAAIK---------I-E-----------------------RR-----RGSG-LHTVD
A0A517MNB1      --RLAAIR---------T-E-----------------------RR-----RGMT-IQTLA
A0A142YJ13      --EVQSMT---------V-E-----------------------MQ-----APPR-IRLIE
A0A517Z7D3      --QLSTFA---------Q-Y-----------------------KD-----QEGYRLKQIA
A0A1N6KY57      --EVEALT---------V-E-----------------------LQ-----APPR-IRLLE
L0DK20          --EVEALT---------V-E-----------------------LQ-----APAR-IRLLE
A0A3L7UX05      --ALEQLQ---------F-E-----------------------SQ-----GQTQ-ISLIQ
A0A517XRC2      --QKIQIV---------I-E-----------------------RG-----MESR-VSVRE
A0A6M5YH47      --HLLQLR---------L-A-----------------------VK-----MEGR-VSPHG
A0A660UUK3      --RISEIV---------M-E-----------------------QK-----RPAR-ISI--
A0A517ZHG5      --KIDVLK---------I-E-----------------------LG-----APDR-IKVAQ
A0A1Z8MPL5      --ELEKLD---------L-E-----------------------LR-----ANQSRVRRVD
A0A7C1EH96      --RIEELN---------I-E-----------------------RD-----RQPR-ISI--
A0A5C1AGE3      --QIEQLN---------L-W-----------------------LS-----SGGR-IEIRE
A0A2Z3HEL7      --QLLQLS---------T-G-----------------------EG-----RT-R-ASARG
A0A142XAP8      --QLIQLQ---------V-A-----------------------AL-----QSGR-VSARG
A0A6P2DEK1      --QLIQLR---------I-A-----------------------AQ-----QSGR-VSARG
A0A5C6C1R5      --EIERTR---------I-E-----------------------LN-----SGSR-VAVIS
A6BZU4          --QLLVEK---------V-S-----------------------QG-----NSGYTLTQLA
A0A2D5GZ77      --QLLVEK---------V-S-----------------------QG-----NSGYTLTQLA
A0A3D3R1Z6      --QLLVEK---------V-S-----------------------QG-----NSGYTLTQLA
A0A517XG00      --QLLVEK---------V-S-----------------------QG-----NSGYTLTQLA
A0A1G2YRE4      --RIRDLE---------L-E-----------------------RK-----RPAR-VSV--
A0A353Z859      --EGERAR---------M-T-----------------------MS-----NLMR-VEKFR
A0A2D6ST10      --QIEQIE---------V-E-----------------------IE-----NSPKRIMEFR
A0A177QX42      --KLVSLD---------L-A-----------------------KD----------AMAMQ
A0A517SHR0      --KITTLD---------L-S-----------------------KS----------AAPMQ
A0A2E0AW64      --REDRLR---------L-E-----------------------SK-----NLDS-ITLLK
A0A351FZ59      --REDRLR---------L-E-----------------------SK-----NLDS-ITLLK
A0A660V239      --RIDQIR---------L-E-----------------------SK-----RPSR-ISV--
A0A177Q3B7      --EVERLK---------L-E-----------------------VD-----APQR-VHLIE
A0A2E0X6Y6      --QLQQVE---------S-L-----------------------AG-----QAPIKASVVR
A0A518GFD7      --EIERTS---------I-E-----------------------LK-----TASR-IKLLS
A0A5C5VZJ8      --QLNIRE------------------------------------------MRRATEVTVA
A0A518GE37      --RLATLR---------T-E-----------------------RG-----RGSS-VSTMA
A0A5C6F3H8      --RVAAIK---------T-E-----------------------RR-----QDGA-VRTLA
A0A5C5X072      --RVAAIR---------T-E-----------------------RR-----QDGA-VRTLA
A0A5C5WUQ3      --RTAAIQ---------T-E-----------------------RR-----QDGA-VRTLA
A0A5C6E697      --RVAAIR---------T-E-----------------------RR-----QDGA-VRSIA
A0A5C5Z1A3      --RDAAIK---------T-E-----------------------RR-----QDGA-VRTLA
A0A5C6D2P7      --RVAAIR---------T-E-----------------------RR-----QDGA-VRTLA
A0A5B9ML17      --RKAAIK---------T-E-----------------------RT-----QADA-VRSVS
A0A518HFS8      --EVRAVT---------V-E-----------------------LE-----APPR-IRLLE
A0A5Q3LBQ3      --RTLALR---------T-E-----------------------MR-----APAR-VNLLK
A0A517LX75      --RLQEIQ---------L-T-----------------------TN-----YAGFSTDLLS
A0A7C5W7B3      --RVEQGRWVREGL---L-K-----------------------KD-----PAFTKVEKVN
A0A2S8F9B8      --EIERTK---------I-E-----------------------LR-----QAPR-ITLLS
A0A354GX32      --ELASLD---------S-S-----------------------LP-----VTPR-LTVTE
A0A142XL75      --TIERLK---------V-E-----------------------LG-----APSR-VTCSE
A0A6P2D5D5      --TIARLR---------V-E-----------------------LG-----APPR-VSCSE
A0A5C1AAF0      --AISTHL---------A-E-----------------------ND-----APSR-VAHLE
A0A7C7T8W8      --RIQVLQ---------T-E-----------------------MG-----GPER-IERLR
A0A5C6B3S0      --EIERSK---------V-E-----------------------LRDQIDSTGGSRVTLFS
A0A368KP63      --EIERTK---------I-E-----------------------LR-----GTPR-ITLLS
A0A518GIZ9      --RMSQLT---------I-D-----------------------KE-----SSGY------
A0A1C3EBY9      --RMSQLT---------I-D-----------------------KE-----SSGY------
D5SX64          --RMSQLT---------I-D-----------------------KE-----SSGY------
A0A517Z0U7      --TIYKRE---------I-E-----------------------LE-----KAGVPIVVRR
A0A2S8FCC0      --EIENTK---------I-E-----------------------LK-----SDSR-VSVLQ
A0A1Z8MBT6      --RLDAIK---------T-E-----------------------SE-----NMSR-VQPIA
A0A517SXN9      --RLDAIK---------T-E-----------------------SE-----NMSR-VQPIA
A0A518HFL0      --RIEMLE---------Y-E-----------------------SR-----GSEP-IIVIS
A0A3B8ZJM2      --KLKGVE---------L-F-----------------------QN-----SSNRKILQEL
A0A1U7CLW1      --EVQSMT---------V-E-----------------------MQ-----APPR-IRLIE
A0A142WPR7      --RLDEIS---------L-V-----------------------KG-----YGGYEMSVLS
A0A3M1TFJ0      --EVEANERFYEEFIQQQ-K-----------------------DI-----SAYSRVNVAE
A0A517P477      --EAERRE---------F-E-----------------------IS-----NATPPIAVQE
A0A517T4K9      --EIQRLQ---------I-E-----------------------LQ-----SPSR-IALHR
A0A7C6B2Q1      --ERNRMS---------I-E-----------------------LR-----AKPR-ITVVQ
A0A7C4QPD3      EIRRRQVE---------L-D-----------------------NA-----PPA--IRIHQ
A0A2Z3GZZ5      --ERLARQ---------A-T-----------------------LG-----AGGYSAEQIT
A0A4V0I6L6      --EKDRVS---------G-S-----------------------RS-----AGAYEVRDVT
A0A7C4QQT3      --QVNQVS---------I-E-----------------------RQ-----GAGYSLKQIA
A0A255QXF5      --RLDSIQ---------L-E-----------------------SQ-----RGSS-VISVA
A0A518KBI5      --RKLALQ---------T-E-----------------------SK-----APAR-VEVVD
A0A5C5V6Q5      --RKLALQ---------T-E-----------------------TN-----APAR-VRVMG
A0A517MY49      --QIRSVG---------G-L-----------------------QV-----QAPIRAIAVS
A0A2E6AG00      --RIANID---------X-N-----------------------QN-----QADVRVEVVS
A0A1G3A880      --QIANTD---------L-R-----------------------QE-----HGDIRATVVK
A0A2E8ATT1      --RISNID---------M-T-----------------------QH-----RANVRVSVVS
A0A7C2JZW2      EVRKLEVE---------L-A-----------------------KA-----PPPI-VVSPA
A0A518KYQ0      --RLASIQ---------M-E-----------------------SK-----RGSS-VMSIS
A0A5B9QX47      --RVAAIQ---------T-E-----------------------RR-----QDGA-VRSLA
M5T666          --RVAAIR---------T-E-----------------------RR-----QDGA-VRTLA
M5U6N6          --RVAAIR---------T-E-----------------------RR-----QDGA-VRTLA
A0A517M0G2      --RLAAIR---------T-E-----------------------RR-----RGSG-LHTLA
A0A5C6AST1      --RLAAIR---------T-E-----------------------RR-----RGSG-VHTLA
A0A5C6C951      --RVAAIR---------T-E-----------------------RR-----RGSG-VHTMA
A0A5C6C5T3      --RVAAIR---------T-E-----------------------RR-----QDGA-VRTLA
A0A2A2W6A9      --RLESIQ---------M-E-----------------------SK-----RGSS-VLSIS
A0A518HQS9      --RLESIQ---------M-E-----------------------SK-----RGSS-VISIA
A0A5M6DFE6      --RIDAIR---------T-E-----------------------SE-----HEGV-VRLLA
A0A5C6F286      --RVAAIH---------T-E-----------------------RR-----QDGA-VRTLA
A0A517NGN1      --RVAEIR---------T-E-----------------------RR-----QDGA-VRSLA
M5RUI3          --RAAAIR---------T-E-----------------------KQ-----QGGS-VQTLA
A0A660VT66      --KMKESD---------L-T-----------------------AQ-----GGVKPIEVID
A0A7C2VEF7      --RIKELN---------V-T-----------------------ED-----TGALNISILE
A0A0S8H0S8      --RISEVA---------L-A-----------------------SD-----VGPMFIRVLE
A0A7C2ZTD2      --RPARIS---------V-A-----------------------YN-----ADVISIR---
A0A2E3Z6T8      --KIANID---------F-R-----------------------QN-----QAPIRATVVR
A0A257WQ92      --QVNQVS---------I-E-----------------------RD-----GNGYVMKQIA
A0A7C1U6X6      --IAQDFE---------T-QSIALRHKRELFDQVRQVRETKRMES-----GVAGSIKVLT
A0A7C7UXI5      --RIKDVD---------L-G-----------------------EQ-----NGMVRTAVLT
A0A7C3SFJ0      --ELEQWE---------V-E-----------------------LA-----AA-PRVTVLE
A0A7C7WWF7      --RIVSFD---------L-S-----------------------KN-----GPDVRVSTVG
A0A356ETW1      --QIASLD---------L-R-----------------------QD-----GHDVRAKVTA
A0A3L7NJY1      --HADGIS---------L-N-----------------------KD-----TF-IRTKIAS
A0A523CME0      --SKSYIK---------S-A-----------------------IE-----KKGEEVPSRY
A0A354PCV3      --RVAAIR---------T-E-----------------------RR------QDGAVRLLA
A0A354PHB4      --RVAAIR---------T-E-----------------------RR------QDGAVRLLT
A0A356ESF4      --KLTDLN---------I-R-----------------------RD-----GQEVRIEVVQ
A0A538RV31      --MIDEEQ---------I-N-----------------------LT-----AQDRIARLGS
                                                                            

M5S2L2          ---------------------------------------MA-------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A7C2VXA0      -------------------------------------------------QTDASHAIQTA
A0A7C3AA48      -----------------------GLFLGC-GLAV-----LR----SFL-DQRLRSAEEIS
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A2D6A9B6      ---------------------------------------------------------MSE
A0A2G6JGH3      -----------------------------------------------------------M
A0A7C5PFV3      ---------------------------------------------------------MSN
A0A7C3QGD2      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A1V6CUG1      ----------------------EAAPREA-WRVT-----PA----ADA-APAPAPAPASQ
A0A3M1SE88      --------------------------------------------------------RFRS
A0A7C2ZUK5      ----------------------LDKAGAP-IKPD-----EN----SFI-PADVTPRSRDA
A0A660WB30      ----------------------VLAGVGG-VVLG-----GA----LTL-LAEMTDHTVKR
A0A660W9Z7      ----------------------KEHRPSG-SGAA-----AG----TVV-EPHSLPSTETD
A0A3M1R9K7      ----------------------VLAGLGG-FACP-----VA----LIL-WWDTRGKRINT
A0A3L7PH51      ------------------------------MALG-----LG----LIY-VLDALDDRFRS
A0A3N5UQY5      -----------------------MALLCG-LVLG-----GG----IAA-ARDWIDQTIRS
A0A7C2JY73      ------PVKDMLSIKRLLKFV-GAGGLFG-LALA-----GA----LCV-FRELRDTRLNT
A0A356AE44      PSRAEPDIKH------------VIKIVGGCLVMT-----LMSTYAFLF-LREMRDTSLKS
A0A1G2XSU7      --------NTAPYQDRRMQYS-LAITMGS-LVFG-----LG----LAL-ITNKLDLRLKT
A0A350KD81      ------PVKDELVIKRQLKFL-MAGAGAG-LGLI-----LA----FSY-FREMRDTTMKS
A0A2D6SRY7      ----PALPPGGPFRPNTSVNV-FLGALLG-LVLG-----IA----QAF-LLEHIDNSVHS
A0A1G3C300      ----PAMEPRTPIGASRNSQI-MKGVMIG-LALG-----IG----LAF-FLDYLDNTVKS
A0A524HC32      ----RALLPIFSVKPNVKLTL-LFAIVVG-LLGG-----LG----CAF-LAEYIADTITD
A0A177PV03      ----EPATPALKVAPVPAKIF-IVAMMLG-LLLG-----AG----LAF-VAEAMDQNFHT
A0A1G2YIM0      -------ADSMLAKDKRPKYV-VANIFGS-GFLA-----IL----IAL-VFDKLDRRVHT
A0A7D8YCU5      ----RSG-RGVQTGPNLSRSL-MMGLMVS-VALG-----FA----LVW-LADWSEQTYRN
A0A353BE27      ----MPN-TGLFYGPKVIKYL-VGGAAVG-FILL-----SG----LAV-LMDLADRSYKN
A0A5C6BPW1      ----EV--PRIKDWESLYKKS-AMAGLGV-FGLF-----VA----AIV-WFEFQAKRIDT
A0A1I3GSP0      ----QV--RIERSMKRVIKLV-GTCGVMG-IAII-----FC----LAY-FREWYDTSLKT
A0A517QJV1      ----QV--RIERSLKRVIKIV-GMFGFLG-IGLV-----FI----LSY-FREWMDTRIKN
A0A3C1QS25      ----PPT-FAEQTEPSLLKVF-AVAGFLG-LLGG-----VG----IAY-LVDLADKTFRS
A0A5C6FX55      ----AAK-GAYLVAPILWKLV-GIGGFLG-LALG-----AG----MAF-LLEKNANTFRD
A0A5C6DS51      ----SPESARNPSWPKLPIVV-VLGAMLG-MFLG-----SS----SAL-AAELLDTTFRD
A0A5C6DSL6      ----SPEAATVPSWPSLPIAI-VVGAMLG-LFLG-----SA----SAL-TSEILDTTFRD
A0A3M1VG27      ----EP--KAEVSIKRPLKFL-GAGLFGS-LVAV-----TA----MIY-LREVRSRSLRS
A0A518GC22      ----MPS-IGWFYGPTLPKYL-LGGAAVG-FVLL-----SG----LAV-LMDLADRSYRN
A0A3L7Q373      ----DV--RVDRSLKQTIKIV-GAFGVMG-LLAV-----FG----MAY-FREWYDTTLKS
A0A3E0PW54      ----QV--RVEKSIKRIIKIV-GAMGCLG-VAVV-----FG----LSY-LKEWTDMTLRT
A0A7C3TAH2      ----A---EVERIDDKRPKYA-AAMAFAA-LGAG-----CF----LAF-LRDKADKRFRS
A0A1Z8MHR4      ----ETS-PAIRVGPELTRYL-LIYGLFG-LGIS-----GL----LAM-TFEASAKMFRS
A0A5C6EHJ0      ----TAK-LGYQVAPSLAKSL-ILGGFLG-SMLA-----FG----LAV-LRELSDRSYHS
A0A5C6F1H9      ----TAK-LGYQFAPSMPKSL-ILGGLLG-GMLA-----FG----LAL-LREMSDRSYHS
A0A255QXY0      ----GSG-GAARIGPDQKKDL-LAGGMIG-FILG-----GI----LSI-LIEFWSMTFRS
A0A517SYI0      ----ETS-PAIRVGPELTRYL-LIYGLFG-LGIS-----GL----LAM-TFEASAKMFRS
A0A518HX54      ----ATG-KAHPTGPDLRKDV-AVFTMLG-LGLS-----GL----LAL-LLEAGAKTFRS
A0A5B9MF59      ----DTG-QAYVTGPDLRKDL-ILYGMLG-LALS-----GL----LAM-VFESTAKMFRS
A0A2A2WC24      ----DTG-QAYETGPDLKKDL-VLFGMLG-LGLS-----GL----LAM-IFESTAKMFRS
A0A518KYW8      ----DTG-QAYETGPDLKKDL-VLFGMLG-LGLS-----GL----LAM-IFESTAKMFRS
A0A5C5YZZ0      ----PAG-LGYLVGPILSRAL-VLGGFLG-LVLG-----AA----LAF-LWDWSERTFRS
A0A518JLD2      ----TAN-YGYQIAPVMLKSL-VMGGFLG-TVLA-----FG----LAF-LREISDRSYRS
A0A5M6DJ15      ----DARARTNSGSKKRVLAS-GVMGFAG-LCLP-----LL----GFI-GLDVRSKLVND
A0A3L7P7S7      ----RIPELGGEVPSRKSLIV-VAGGIFG-VAIG-----GG----LAW-LMERADRTFRS
A0A517N8M1      ----APS-LAYKVGPSLLKTV-GGGSILG-ILLG-----CG----LAL-LLEKNANTFRD
A0A5C6CW01      ----APS-RAGRVGPNLTRTL-AMGTFIG-LVIG-----AG----LAL-LLEMNANTFRD
A0A5C6BXS9      ----APS-GAYRIGPNMAKML-SVGALLG-VAVG-----MG----LAL-LLEKNANTFRD
M5U569          ----APS-NAYRVGPNMAKML-SFGTFIG-LAAG-----CG----LAL-LLEKNANTFRD
L7CND7          ----APS-RAYRTGPNLVKML-GIGTFLG-LALG-----CG----LAL-LLEKNANTFRD
A0A0J1B8S4      ----APS-TAYVIGPSIIKTL-GIGTIAG-LIIG-----CG----LAL-LLEKNANTFRD
F2ARR3          ----APT-RAYRVGPNMLLML-GIGLGVG-LLLG-----CG----LAL-LLEKNANTFRD
K5D8H6          ----APT-RAYRVGPNMLLML-GIGLGAG-LLLG-----CG----LAL-LLEKNANTFRD
M2AKU0          ----APT-RAYRVGPNMLLML-GIGLGAG-LLLG-----CG----LAL-LLEKNANTFRD
A0A5B1CKI2      ----APS-LAYKVGPSILKTV-GLGSLLG-IMLG-----SG----LAL-LLEKNANTFRD
A0A5C6EG84      ----APS-LAYKVGPSLIKTV-GAGSILG-ILLG-----CG----LAI-LLEKNANTFRD
A0A5C6F2X4      ----APS-LAYKVGPSLIKTV-GAGSILG-ILLG-----CG----LAI-LLEKNANTFRD
A0A5C5XTV6      ----APG-NAYRIGPNMAKML-TIGTLLG-IAAG-----LG----LAL-LLEKNANTFRE
A0A5C6AAB1      ----APS-SAYRVGPNMVKML-GIGTFLG-LALG-----CG----LAL-LLEKNANTFRD
M5T8W8          ----APS-SAYRVGPSMAKML-GIGTFLG-IALG-----CG----LAL-LLEKNANTFRD
M5SF00          ----APS-RAYRTGPNLVKML-GIGTFLG-LALG-----CG----LAL-LLEKNANTFRD
A0A2G1WDS1      ----APS-RAYRTGPNLVKML-GIGTFLG-LALG-----CG----LAV-LLEKNANTFRD
Q7UVS9          ----APS-RAYRIGPNLMKML-GIGTFLG-LALG-----CG----LAV-LLEKNANTFRD
A0A5C6B601      ----NTG-NAYVTGPDLKKDL-ILFGMLG-LGLS-----GL----MAM-LFEAGAKMFRS
A0A517PFU1      ----PPG-PGRPARAPLIRAL-AAGGALG-LAVA-----FG----LSY-LLEQSDRRFTG
A0A5B9M8J9      ----ATG-KAHPTGPDLKKDL-AVFAMLG-LGLS-----GL----LAL-LFETTAKTFRS
A0A2A2WFP6      ----ATG-KAHRTGPDLKKDL-AVFTMLG-LGLS-----GL----LAL-LFEAGAKTFRS
A0A518L8N2      ----ATG-KAHRTGPDLKKDL-AVFAMLG-LGLS-----GL----LAL-LFEAGAKTFRS
A0A518HQN9      ----DTG-QAYETGPDLKKDL-VLFGMLG-LGLS-----GL----LAM-IFESTAKMFRS
A0A5M6D8H8      ----STG-QAYVTGPDLKRDL-ILYGMLG-LGAS-----GL----LAL-LFEASAKMFRS
A0A5B1CRW9      ----SAEVPMNPVWPRLPIVL-ALGLMGG-LAMG-----SL----LVL-AAETFDSTFSS
A0A5C6EI46      ----SAEVPRNAVWPKLPIVL-AVGVGAG-LALG-----LL----LTL-AAETFDSTFGS
A0A1G2ZG92      ----AAIEPYKPHFPRRYLNF-AIALFLS-VFWG-----LV----LSL-FVEYIDNTIKT
A0A1G3A0W0      ----KAFVPSQPHSDRRMVFM-AMALILG-VGAG-----GG----MGL-LRANRRQTVYV
A0A2E7D3V4      ----PVRDQLVFKRKLKFWFMGLAMAMSA-VGAV-----IY--------WREWRDTTLKT
A0A5B9PER9      FERLANALEGQAVWPNLPMLL-GLGGLLG-SLFG-----FG----LGC-LVELADKTFHN
A0A517QSM4      ----RASTPHTPQMSKKYKMA-GMAGLAA-LGLI-----AG----GII-FLDYRRRRVST
A0A355GJI7      ------PVKDELVIKRQLKFL-MAGAAGG-LGLI-----LA----FSY-FREMRDTTMKS
A0A1Z8MCI4      ----SASLPETPLENSNTKRQ-LLAYPLV-FAAL-----FG----LGL-TVEVFSQRFXR
A0A517SYL7      ----SASLPETPLENSNTKRQ-LLAYPLV-FAAL-----FG----LGL-TVEVFSQRFSR
A0A3L7P0L2      ------DVRVDRSMKRVMKIV-GACGILG-LLSV-----FC----LAY-FREWYDTTLKT
A0A6M5YVJ1      ----EPHVVPGLGGSRRKKFA-VAAVLGV-LFVG-----FA----GVV-LWEQRTARVTH
A0A2E0SHG0      VHSMGNLNEVRSAKTSLLLGI-LPGAFFG-FIFG-----GL----MAA-VIDLADSTFRS
A0A518CQB8      VQSMGNIDDVKSAKVSILYGI-IPGGFVG-MMFG-----LL----LAF-VIDLADSTFRS
A0A517SCC8      ------QVRVGKSMKRFLKIV-GACTLAG-IAAV-----FG----LAY-FREWYDTSLRS
A0A3A0DR44      ----DAQIPPAPIEAWPYKPL-ILFCGAA-FVLP-----FF----VVV-GWEKLSRRIAD
A0A358MY60      ----AAKPPTRPVVPLPFKNM-ILAGLLG-LAAP-----FS----LGL-LLELRAKRVSD
A0A517MNB1      ----AAKPPNKPLVPVPVKKM-VVAGGAA-FMIP-----FL----LGL-LLEFRSQRICD
A0A142YJ13      ----KASIPTLSDPMKRYKLS-GAAGAGA-LVAF-----LG-----CLSLLEFRSRKVDM
A0A517Z7D3      ----PIRVDRSRTRPIKIVGMFSMMGVMA-VFVL-----LY--------YREWSDISIRT
A0A1N6KY57      ----KAELPRTKDETRKFKLA-GVAGCGA-FALA-----L-----LGISFWESSARRVDS
L0DK20          ----KAELPRTKDEARQLKMA-GVAGCGA-FALA-----L-----IGVSFWEFQSRRIDS
A0A3L7UX05      ----TARPIGLPSNDKRWRFM-AMAPLGM-FLAV-----AS----LCV-LVEVRSGRVSN
A0A517XRC2      ----AAVLILNENLKQKVMLS-GAVGVAG-FLGV-----LA----LIA-LLEWRNRRVDG
A0A6M5YH47      ----VTEKIPNNNQNRKLLMS-SVGGLGA-FFGV-----VF----LVS-FLEWRTRRVDG
A0A660UUK3      ----AEMASSVPAQSKRKKLA-LATPFGG-IALG-----VF----LAF-LLAKADKRLRG
A0A517ZHG5      ----WAEVPRIKDWESLYKKS-AMAGLGV-FGLF-----VA----AIV-WFEFQAKRIDT
A0A1Z8MPL5      ----GGVRKPKTGDTSKRDQLTLVASFGA-LLLG-----IG----APT-LLDVIRRKVSS
A0A7C1EH96      ----GSWARSVSAEGKKKKLV-AAAPFGG-LAAG-----MA----LAF-LLAKLDRRVHT
A0A5C1AGE3      ----KAVIMYNHNQRQKMLYS-GMIGVAM-FLVV-----LT----LVA-FLEWRTRRVDG
A0A2Z3HEL7      ----EAEKIPNNNQNKKLAMS-SVGGLGA-FLTV-----VL----LIS-FLEWRTRRVDG
A0A142XAP8      ----GAEKIPNNNQNKKIVLS-SAGGAVS-FFGV-----IL----LVS-FLEWRSRRVDG
A0A6P2DEK1      ----GAEKIPNNNQNKKIVMS-SAGGFVS-FFGV-----IL----LVS-FLEWRSRRVDG
A0A5C6C1R5      ----EATPVADSSSKKRYVGT-AGLGFIG-FCLP-----F-----LGFIGLDLTKKRVNS
A6BZU4          ------PVKDELVIKRQLKFL-MAGAGAG-LGLI-----LA----FSY-FREMRDTTMKS
A0A2D5GZ77      ------PVKDELVIKRQLKFL-MAGAGAG-LGLI-----LA----FSY-FREMRDTTMKS
A0A3D3R1Z6      ------PVKDELVIKRQLKFL-MAGAGAG-LGLI-----LA----FSY-FREMRDTTMKS
A0A517XG00      ------PVKDELVIKRQLKFL-MAGAGAG-LGLI-----LA----FSY-FREMRDTTMKS
A0A1G2YRE4      ----AYNADISGIQDKRAKYS-AALLFGA-LFCG-----MG----LAF-LKDKTDQRLRT
A0A353Z859      ----DAVTPTQPDMAKKIMAT-TAVGGGL-FGLI-----F-----LGILFLDLRTRRINS
A0A2D6ST10      ----KADAPQRRDQKKKITGA-AAAGFGV-FGLF-----VA----AIV-FLEYRSHRISR
A0A177QX42      AEITSEPSPGVQIGPSMVQSL-GFGGIGG-LLAA-----IA----IAL-LLETADKSFRN
A0A517SHR0      ADILSEPTPGIQIGPSMPQAL-GFGGFGG-LLAA-----IA----IAL-LLETADKSFRN
A0A2E0AW64      ----SASPPVKPAVIAPWKNM-LMGGGIA-LLIP-----FG----LAV-LWELRVGRITD
A0A351FZ59      ----SASPPVKPAVIAPWKNM-LMGGGIA-LLIP-----FG----LAV-LWELRVGRITD
A0A660V239      ----AYGASSVPARGKRRKLA-AALGFGG-LALG-----AL----LAL-LLDKADKSLHD
A0A177Q3B7      ----EPVVMESASTRFRAKAL-LGAAFGA-LLLA-----IG----LMT-WREYSFRRVEL
A0A2E0X6Y6      ----EPLPDPRPVSPRLKMVV-VGALAGG-LFLG-----SL----IIY-VQDVLDDRFGS
A0A518GFD7      ----SADRAIAPDLKKRFAVA-GAGGGLG-LLLP-----LV----LLV-GWDLTRRKVDN
A0A5C5VZJ8      ----MSTAVAKPPVDKRVKLS-AAALFGA-LIAG-----LG----AGF-VRLRFSATVTS
A0A518GE37      ----AAKVPSWPIEEIPFKKV-IMAGGAA-FLLP-----FA----LAL-LLEFRMKRLTH
A0A5C6F3H8      ----EATAPKSPIETVPYKKL-AMASSVA-FMVP-----FL----IGL-IFEYRVQRVTD
A0A5C5X072      ----AATPPKAPVESKPYKKL-VMASAGA-FVIP-----FL----LGL-LWEFKVQRLTD
A0A5C5WUQ3      ----SATPPKNPTETIPVKQL-GLASTVA-FVAP-----FL----LGL-LLELRIQRVTD
A0A5C6E697      ----KATPPRTPVEPIPLKKM-AVFGLGA-MMIP-----FL----FGL-LWEVRVHRVTH
A0A5C5Z1A3      ----AATPPKTPVEEIPVKKM-AVAGLAA-MMIP-----FL----IGL-LWELRVQRVTD
A0A5C6D2P7      ----AATPPRTPIESLPVKQM-AVFGGGA-LMIP-----FL----LGL-LWELRVRRVTD
A0A5B9ML17      ----PATPPGHPVEDIPVKKL-LVASGGA-FAIP-----LL----LGL-LWEFKTNRVTD
A0A518HFS8      ----PAK-PQGPADPMERYKFCAMAAVAS-MGAF-----VG----LVS-LWEFRAQRIDA
A0A5Q3LBQ3      ----EAEIPPKPIEALPVKKL-GIAMLGS-LGLP-----LL----ICV-FWERTVRRVSE
A0A517LX75      -----APVVGTQVWPNPLVVL-SLGSFAG-LLLG-----SC----GAL-WADYSDQTFRD
A0A7C5W7B3      ----AATGRAAPNSSLVYVLA-LLVGLFA-GAAV-----MY--------FMENMDTTIHS
A0A2S8F9B8      ----EAKLGVVSDKKRPLMIT-AAAAFAG-FMLP-----AG----LLL-LRDFSKKHLSD
A0A354GX32      ----AAAPPMSPASDKRIKAA-GGAFLGL-FGLV-----F-----LGVVATEFRTRRVYK
A0A142XL75      ----EPFIVTGIEGNRRLKYT-VLAALAV-FGIG-----FA----GTI-GLETRARRVTD
A0A6P2D5D5      ----DPFIVTGLEGNRRLKFT-VLAALAV-FGLG-----LA----GAI-GWETRARRVID
A0A5C1AAF0      ----NARVERVNTEARKMQFA-GFAGAAA-LGFV-----CL----VVS-LFEFRNQRVDS
A0A7C7T8W8      ----EADADSVSIASSPIKTM-TAASSCA-FVVP-----FL----LAL-VFELRARHLSF
A0A5C6B3S0      ----SAYAPRRGKSMTRYSMA-GLAGVVG-MAFP-----L-----FGIIFWDTRKKCINS
A0A368KP63      ----KAEPGTVTDKKRPIMIT-AAAALAG-LVLP-----GG----LLV-LRDFQKKRLSD
A0A518GIZ9      ----TLRQTGPIKDEWVLKRL-LKIVGAG-MVAG-----MGLIISLIV-LKEFLSNQVRT
A0A1C3EBY9      ----TLRQTGPIKDEWVLKRL-LKIVGAG-MVAG-----MGLIISLIV-LKEFLSNQVRT
D5SX64          ----TLRQTGPIKDEWVLKRL-LKIVGAG-MVAG-----MGLIISLIA-LKEFLSNQVRT
A0A517Z0U7      ----PAEVPKKPDGGKREKMA-GVAGFGV-FGLL-----VA----AIV-WLEMAAKRINS
A0A2S8FCC0      ----EAQPPKSK-NPRSYAMV-GVAGVFG-FMLP-----VA-----GFVFWDLRSQRINV
A0A1Z8MBT6      ----AATPPTKPNEEVPTKKL-AMVALAG-FCVP-----FG----LGL-LWELHTKRITD
A0A517SXN9      ----AATPPTKPNEEVPTKKL-AMVALAG-FCVP-----FG----LGL-LWELHTKRITD
A0A518HFL0      ----EAKPGGPPVTNKRDKYL-AVTPLAM-LGLV-----LG----LVT-LVELRSGRVSG
A0A3B8ZJM2      ----IPSMPGAYYGPFSSTYT-AAGALAG-ILLM-----SF----VAL-LMDMADRSYRS
A0A1U7CLW1      ----KASVPTM-NDPLRRCKL-STIVGAG-VFLA-----FV----GCVSLWEFQSRKIDV
A0A142WPR7      -----PPTEGFLTGPVMARYL-ALGAVAG-IAVG-----YL----LAY-LLELNDRSFRD
A0A3M1TFJ0      VRIVDPALAAVRVGPNHVRNV-LV--GAL-LGLF-----AGVLAALGLDRFSDRVRSLAE
A0A517P477      ----DAVVPRTRNDGKRIKTA-VLVGGGG-VGFG-----MALAAGLGF-LFTSVQRTQDL
A0A517T4K9      ----KAEPPRTRETGRKLKLA-SVAGFGM-FGLI-----FI----GVI-WIESLTRRVCS
A0A7C6B2Q1      ----RAEAPRVADQDKRIQLA-TLAGFAG-FVLP-----GV----VLL-WWDVRRKPVNT
A0A7C4QPD3      ----KAREPQVADERKRLLAT-VGGAGAG-LTLV-----LL----VVV-ALEMHACRISD
A0A2Z3GZZ5      ----RPGSGHK-VAPVLLRSL-LLGLGIG-ALLG-----CG----LMV-LAETRDKSFRS
A0A4V0I6L6      ----KPADGGQ-VAPVLLQSL-MLGAVLG-LLLG-----GG----LAL-RAELVDRGFRS
A0A7C4QQT3      ----PVK------DALSLKRL-LKFWGAG-GMLG-----ALLVAGLCV-VRELRDSRLKD
A0A255QXF5      ----KATPPTRPVEDMPFKKM-LAAGGAG-FFVP-----FL----LGL-LWEFRVKRITD
A0A518KBI5      ----EVTASPVPLEAAPWKKL-VLACGLA-MAAP-----FG----LAV-LREASLRRVSD
A0A5C5V6Q5      ----PIVASPTPVESAPWKKI-FLACGVG-MLAP-----FG----LVL-LREVTLRRVAD
A0A517MY49      ----EPRPEYRPVSPRLKNVV-LGSIFAG-FALG-----CL----VVY-VQDVLDDRFSS
A0A2E6AG00      ----DPKGRQTPVSPRLANVF-VXSLLGG-TLIG-----IG----LVY-VIDALDDHVRS
A0A1G3A880      ----EPMASQQPVSPRLMTVA-LLVLVIG-LLGG-----GI----SVY-VLDILDDRFRS
A0A2E8ATT1      ----EPAASRMPVSPRLAFVG-VLCLTFG-LGGG-----TG----LIY-VLDLLDDRFRS
A0A7C2JZW2      ----GVRVPVQPDQKKRYLAT-IAGAGGG-VGLV-----AA----LLL-LLELSIQRIFE
A0A518KYQ0      ----QATPPSRPVEAVPFKKM-IMAGGAG-FAIP-----FL----IGL-AWEFRTKRITD
A0A5B9QX47      ----AAKPPSRPIEKIPYKKM-FMASAGA-MALP-----FL----LGL-LWEFRVRRISD
M5T666          ----SATPPKSPVEAMPYKKL-GMASAVA-FMVP-----FL----FGL-LWELKVQRLTD
M5U6N6          ----SATPPKSPVEKMPYKKL-LMASAIA-FAVP-----FF----LGL-LWEYKIQRLTD
A0A517M0G2      ----EATPPLAPVEPMPTKKM-IVAAGGA-FAIP-----FF----LGL-LWELRSQKICD
A0A5C6AST1      ----AATVPTRPIEPMPTKNM-AVAGAGA-FAIP-----FL----LGL-LWEFRSQRICD
A0A5C6C951      ----AANTPTRPIEPMPTKNM-VVVAAGA-FAIP-----FL----LGL-LWEFRTQRISD
A0A5C6C5T3      ----AATPPRAPVEAVPYKKL-ALASAGA-FVIP-----FL----IGL-LWEFKVQRLTD
A0A2A2W6A9      ----EAVPPSRPVEAVPVKKM-LMAGGGA-FAIP-----FL----IGL-FWEFMTKRITD
A0A518HQS9      ----AATPPSRPVEAVPFKKM-VMAGGGA-FAIP-----FL----IGL-LWEFRTKRITD
A0A5M6DFE6      ----DATEPRSPVENVPVKKM-AMAGGAC-FLIP-----FV----FGL-LWEMRTNRVTD
A0A5C6F286      ----VARPPKSPIETAPYKKL-AMVSSVA-FLIP-----FL----IGL-AFEYRVQRVTD
A0A517NGN1      ----EATPPRAPVESIPTKKI-LMASGAC-FAIP-----FL----VGL-LWEMRTQRITD
M5RUI3          ----AATPPRIPLESVPTKKL-IAVSGGA-FCIP-----FL----LGL-LWELRVQRVTD
A0A660VT66      ----EAVVPHRPYYPKVKLNL-AAGLLLG-LVLA-----VL----ASL-LMEYFDDSIRS
A0A7C2VEF7      ----VARPATGPSRPQKTRIM-AIALILG-LMFG-----GA----LAL-VRDWMDIRLRS
A0A0S8H0S8      ----EASSGDEPTRPNRPHAA-AMALGLG-LILG-----VM----LAL-LAARLDHRIHS
A0A7C2ZTD2      ---------------DKRIKY-TMALIFGAMALG-----ML----SAF-LRDKADLSLHT
A0A2E3Z6T8      ----EPIANNNPVTPQIRLIA-AVCLLGG-TCVG-----VV----MAY-AQDVLADRFNS
A0A257WQ92      -----------PVKEELSMKR-ILKFVGG-GGVAGMFLIAG----ICL-LRELRDLRIMS
A0A7C1U6X6      ----KASAPSKPSEDRRVVFT-AMALFMG-LGMG-----GG----VAF-LRASRNQTIYA
A0A7C7UXI5      ----QPEVPTAPVSPRLVVVA-FLAVTLG-LAVG-----LA----VVY-VQDLLDDRFRS
A0A7C3SFJ0      ----PASVPKTSDIKRKYRMM-WFLSAAA-FGVA-----VL----GVA-GVDFLSRRVNS
A0A7C7WWF7      ----KTEARMDPVAPKLSLVV-VLAALGG-LSFG-----LG----VIY-VLDLMDDRFRS
A0A356ETW1      ----PPVANHRPVSPRLAFVA-LVAIVSG-LGIG-----FA----AVY-VLDVLDDRFRD
A0A3L7NJY1      ----KPTVPTRPVSPRLAIVG-ILSLMVG-TAGG-----LL----IIW-VLDILDDRFRT
A0A523CME0      ----DPLPDDSRQYALSQDAVSI----------------------------------IQQ
A0A354PCV3      ----SATPPRTPVAEFPLKKMAM--AGGAAMAVP-----FF----FAL-LWEL---RVRR
A0A354PHB4      ----SATPPKTPVAELPLKKMGL--VGGAAMAVP-----FF----LGL-LWEL---RVRR
A0A356ESF4      ----EPQVASAPAIPDRRRVALL--ALAAGLALG-----LL----AVH-VLDTLDDRFRG
A0A538RV31      ----DPTPDTRRTLDEKKQAIIAGGAGAAAMALV-----FL----VIA-YWEFLARRIIT
                                                                            

M5S2L2          ------------------------------------------------------------
A0A2Z3GYP4      -----------------------MADAAGN------------------------------
A0A7C2VXA0      AAKGAVSQ------SL-SSAARRNWPRSAD------------------------------
A0A7C3AA48      AVLGVPTL------GV-VPTMSRKL-----------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      -STHQLTY------DL-GIHVVGSLPLVHK------------------------------
A0A2D6A9B6      PETNPALT------DG---------VLVIV------------------------------
A0A2G6JGH3      SEEPQEER------AN-DEERGDATPFVLV------------------------------
A0A7C5PFV3      KKKGKPER------GG-EFELDGEETFVLL------------------------------
A0A7C3QGD2      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A1V6CUG1      DAKAPALQ------AP-PIIQSVGAAKVIG------------------------------
A0A3M1SE88      IEEMQLQL------RT-PVMAVIRRMKPRE------------------------------
A0A7C2ZUK5      VVERKKVP------GG-TKTSPSPAPTVNT------------------------------
A0A660WB30      PTDLRRIV------DR-PVLAAIPSLDIGR------------------------------
A0A660W9Z7      MEEFRRTI--------------------RR------------------------------
A0A3M1R9K7      PAEVVRTT------GL-DLLGTVPLVPAKA------------------------------
A0A3L7PH51      PDELQWQL------GL-PMLAMIRKMEPME------------------------------
A0A3N5UQY5      TEEISTIF------RL-PVLGGGPAMSRRK------------------------------
A0A7C2JY73      LAELRPVL------TQ-PLLGTIVKFATAA------------------------------
A0A356AE44      LADLRAIV------DT-PILGTLPSIANPA------------------------------
A0A1G2XSU7      PDDITKRI------GV-RIIGTTTSRDKIK------------------------------
A0A350KD81      VDEIRNQL------HL-PILGEVPSFAESD------------------------------
A0A2D6SRY7      VRELEKAM------GL-PTFGLIPQIPEKP------------------------------
A0A1G3C300      TEDVENYL------GV-TLLGLVERAKQSK------------------------------
A0A524HC32      PEEINDRY------RI-PILGMIPQIKTDN------------------------------
A0A177PV03      LEEIRERL------GL-AVVGHIPIVEPVG------------------------------
A0A1G2YIM0      TEDITRRL------GL-RIIGTTVSSENID------------------------------
A0A7D8YCU5      PEEVVTAL------GL-PILAHLPVIAEAK------------------------------
A0A353BE27      PSEISTDL------GV-SVLGHIPVMN---------------------------------
A0A5C6BPW1      LGDVTGGL------NL-RIMGALPQMPRWA------------------------------
A0A1I3GSP0      LDDVTTFT------HE-PLMGSVPTFSSST------------------------------
A0A517QJV1      VDELCKLS------ET-TLLGSIPKFATTP------------------------------
A0A3C1QS25      PDDIAQSL------AL-PILGHIPFI----------------------------------
A0A5C6FX55      PDEIAASL------GT-SVLTHVPFF--KK------------------------------
A0A5C6DS51      VEDLEKTL------AA-PAIAHVPRF----------------------------------
A0A5C6DSL6      VEDLERAL------NA-PAIAHVPKF----------------------------------
A0A3M1VG27      LEELRNAL------AV-PVLGGIPEF----------------------------------
A0A518GC22      PSEIATDL------GV-TVLGHIPVM----------------------------------
A0A3L7Q373      IEEVRSIV------KA-PLMGAIPRFRLSG------------------------------
A0A3E0PW54      ADELKALV------PV-SVLGEVPEY----------------------------------
A0A7C3TAH2      PAEITKVL------RI-PVIGTVT------------------------------------
A0A1Z8MHR4      AEEVHSDL------RL-PVLSHIPLD--DS------------------------------
A0A5C6EHJ0      ARDIAEHT------RL-PIIGHVPV-----------------------------------
A0A5C6F1H9      ARDIAEHT------RL-PIIGHVPV-----------------------------------
A0A255QXY0      ADEVQRAL------RA-PVLTHIPVD--SS------------------------------
A0A517SYI0      AEEVHSDL------RL-PVLSHIPLD--DS------------------------------
A0A518HX54      AEAIQHEL------QA-PVLTHIPFD--AG------------------------------
A0A5B9MF59      AEEVQREL------RL-PVLTHIPLD--EG------------------------------
A0A2A2WC24      AEEVQREL------RL-PVLTHIPLD--EG------------------------------
A0A518KYW8      AEEIQREL------RL-PVLTHIPLD--EG------------------------------
A0A5C5YZZ0      PDEISTSL------GL-PILAHLPVMLTPR------------------------------
A0A518JLD2      PQEVSEHT------GL-PVIGHIPVL--K-------------------------------
A0A5M6DJ15      SESVSREA------GL-PILGSVPRE--RQ------------------------------
A0A3L7P7S7      PDDIRKRL------GI-PVLGHLPLF--P-------------------------------
A0A517N8M1      PDEIADIL------GV-PVLTHIPFF--KG------------------------------
A0A5C6CW01      PEEISALL------AV-PVLTHVPFF--KG------------------------------
A0A5C6BXS9      PDEVIAAV------GA-PVLTHVPFF--KG------------------------------
M5U569          PDEIAEAV------GA-PILTHVPFF--KG------------------------------
L7CND7          PEEIIAAV------GA-PILTHVPFF--KG------------------------------
A0A0J1B8S4      PEEIVAAV------GA-PILTHVPFF--KG------------------------------
F2ARR3          PEEIVTAV------GA-PILTHVPFF--KG------------------------------
K5D8H6          PEEIVTAV------GA-PILTHVPFF--KG------------------------------
M2AKU0          PEEIVTAV------GA-PILTHVPFF--KG------------------------------
A0A5B1CKI2      PDEISEEL------GV-PVLTHIPFF--KG------------------------------
A0A5C6EG84      PDEIADIL------GV-PVLTHIPFF--KG------------------------------
A0A5C6F2X4      PDEIADIL------GV-PVLTHIPFF--KG------------------------------
A0A5C5XTV6      PDEVVAAV------GA-PILTHVPFF--KG------------------------------
A0A5C6AAB1      PEEIATAV------GA-PILTHVPFF--KG------------------------------
M5T8W8          PDEIAEAI------GV-PILTHIPFF--KG------------------------------
M5SF00          PEEIIAAV------GA-PILTHVPFF--KG------------------------------
A0A2G1WDS1      PEEIIAAV------GA-PILTHVPFF--KG------------------------------
Q7UVS9          PEEIIAAV------GA-PILTHVPFF--KG------------------------------
A0A5C6B601      AEEIQKEL------RL-PVLSHIPLD--ES------------------------------
A0A517PFU1      PAELRAEF------GL-PLLGHVPEI--PP------------------------------
A0A5B9M8J9      ADAIEREL------QS-PVLTHIPVD--AA------------------------------
A0A2A2WFP6      AEAIQQEL------QA-PVLTHIPFD--GG------------------------------
A0A518L8N2      AEAIQHEL------QA-PVLTHIPVD--GG------------------------------
A0A518HQN9      AEEIQREL------RL-PVLTHIPLD--EG------------------------------
A0A5M6D8H8      AEEIQREL------RL-PVLTHIPLD--EG------------------------------
A0A5B1CRW9      VEELERAT------GA-AVIAHVPRM--PV------------------------------
A0A5C6EI46      VTDLESTT------KA-AVIAHVPRL--NL------------------------------
A0A1G2ZG92      PEDIKHIK------SL-NFLGIIPNTKLLK------------------------------
A0A1G3A0W0      PDDMPYAM------QV-PFLGYVPVLPVRR------------------------------
A0A2E7D3V4      FDDVRQSM------QF-PVLGGVPEFAAIS------------------------------
A0A5B9PER9      PSEIIRQL------NV-PLIGHVPVIGQSK------------------------------
A0A517QSM4      AEEITENL------RI-RILGVIPILPRTI------------------------------
A0A355GJI7      VDEIRNQL------HL-PILGEVPCFADSD------------------------------
A0A1Z8MCI4      ARNVTEIT------QL-SLLGELAKFPRWG------------------------------
A0A517SYL7      ARNVTEIT------QL-SLLGELAKFPRWG------------------------------
A0A3L7P0L2      VEETRTVI------GA-AVMGAIPHFRGGA------------------------------
A0A6M5YVJ1      PDDVTVAL------GV-RLIGAVPPAGPAQ------------------------------
A0A2E0SHG0      PEQIRETL------RS-PVLAHIPRLNVRR------------------------------
A0A518CQB8      PEQIRNTL------NT-AVLAHVPRLNVRR------------------------------
A0A517SCC8      LDEVSETA------GT-QLLGAVPTFKTTP------------------------------
A0A3A0DR44      ADQLSSES------TL-SIIGEIAQLPTRP------------------------------
A0A358MY60      AETLTAGN------LA-P-FGEVAKLPSKV------------------------------
A0A517MNB1      ASGFDGQS------LA-PVIGEVARLPSRA------------------------------
A0A142YJ13      PDEVSDRL------GL-RIIGDLPRLDHAR------------------------------
A0A517Z7D3      LADVRSLV------QS-PIFGAVPSFRPQL------------------------------
A0A1N6KY57      ASDVVQCL------GM-DLFGTLPILPRRR------------------------------
L0DK20          AADVIKSL------GM-NLFGTLPAIPKRS------------------------------
A0A3L7UX05      PDDLTNRS------RL-EVLGVVPPLPNPR------------------------------
A0A517XRC2      VDQVVTEL------GM-RVIGTVPAFPNRA------------------------------
A0A6M5YH47      VDQVVNEL------GM-RVIGTVPAFPNRA------------------------------
A0A660UUK3      AQDVVKRV------GV-RIIGTTTSSRHID------------------------------
A0A517ZHG5      LGDVTGGL------NL-RIMGALPQMPRWA------------------------------
A0A1Z8MPL5      VNQMSEGL------GI-RVLGNLPLLDKPK------------------------------
A0A7C1EH96      PDDVARRV------GV-RIIGTTTGPEHVS------------------------------
A0A5C1AGE3      VDQVVNEI------GM-RVIGTIPAFPSRQ------------------------------
A0A2Z3HEL7      VDQVVTEL------GM-RVIGTVPVFPNRA------------------------------
A0A142XAP8      VDQVVNEL------GM-RVIGTVPAFPNRA------------------------------
A0A6P2DEK1      VDQVVNEL------GM-RVIGTVPAFPNRA------------------------------
A0A5C6C1R5      VSGVGREL------SV-PILGSVPRHRKIH------------------------------
A6BZU4          VDEIRNQL------HL-PILGEVPSFAESD------------------------------
A0A2D5GZ77      VDEIRNQL------HL-PILGEVPSFAESD------------------------------
A0A3D3R1Z6      VDEIRNQL------HL-PILGEVPSFAESD------------------------------
A0A517XG00      VDEIRNQL------HL-PILGEVPSFAESD------------------------------
A0A1G2YRE4      PDDITKRI------HI-PVIGTTTSLHNIK------------------------------
A0A353Z859      LDDIVTGL------RL-PVIGSVPLIPSSR------------------------------
A0A2D6ST10      LEEVVDGL------GM-RIVGNIPTMPRAS------------------------------
A0A177QX42      PDEISRQL------RL-PVIGHIPELAADR------------------------------
A0A517SHR0      PDEISRQL------RL-PVIGHIPELAADR------------------------------
A0A2E0AW64      SKQIEKQS------QL-PVLAEIARFPSHA------------------------------
A0A351FZ59      SKQIEKQS------QL-PVLAEIARFPSHA------------------------------
A0A660V239      PKDVVRRV------GV-RIIGTTTSPKNVD------------------------------
A0A177Q3B7      AEEITQHL---------PVVACLPRLEASA------------------------------
A0A2E0X6Y6      PEEMAAQL------GV-GVLTVVGNLKTLV------------------------------
A0A518GFD7      LEGVSHSL------SL-STFGTVPMVDRDP------------------------------
A0A5C5VZJ8      MRDVSRPL------QQ-TLIGSVPLRRGVS------------------------------
A0A518GE37      VGGIEAQN------LA-PVLGEIARIPGGA------------------------------
A0A5C6F3H8      ASSFTRSG------DMVPIMGEVARLPSGS------------------------------
A0A5C5X072      AESHDKTG------LLAPVVGEVSRLPAGS------------------------------
A0A5C5WUQ3      GNAVQKHF------GMAPVVGEIARLPAGT------------------------------
A0A5C6E697      STAVGH----------LDVMGEVAKLPTGN------------------------------
A0A5C5Z1A3      SSMCDG----------LIVVGEVAKLPAGP------------------------------
A0A5C6D2P7      SSMCTS----------LAVVGEVSRLPSGP------------------------------
A0A5B9ML17      THVLDSSQ------AIAPVIGELARSPSTT------------------------------
A0A518HFS8      TAEVAGRL------GI-GVVGALPTSPRGD------------------------------
A0A5Q3LBQ3      AKQLGQDL------KV-ESVWEIASLPVRS------------------------------
A0A517LX75      PGDLERSL------GA-SVLAHVPRFQITR------------------------------
A0A7C5W7B3      VENAETIA------AA-RVLGEIPFFSADP------------------------------
A0A2S8F9B8      LPTTRDEL------GL-EILGTIPKLPRGI------------------------------
A0A354GX32      SEDVSQGL------GL-PLMGTVPALSAKV------------------------------
A0A142XL75      TDDVTKAL------GV-RLLGTVPAAGQES------------------------------
A0A6P2D5D5      TDDVTKAL------GV-RLLGTVPVAGQES------------------------------
A0A5C1AAF0      IASVGLAT------GL-PTLGTIPWFPSNV------------------------------
A0A7C7T8W8      ADQVATET------QL-PVLAEVSRVPTRL------------------------------
A0A5C6B3S0      PEEISGQM------SL-EVIGSLPLISQRK------------------------------
A0A368KP63      LPTTRDEL------GL-EILGTIPRLPRGI------------------------------
A0A518GIZ9      VREVRQLL------PE-AYLGAVTSFDP--------------------------------
A0A1C3EBY9      VREVRQLL------PE-AYLGAVTSFDP--------------------------------
D5SX64          VREVRQLL------PE-AYLGAVTSFDP--------------------------------
A0A517Z0U7      VDELEAAS------NL-QVMATIPLMPRWV------------------------------
A0A2S8FCC0      PSDVSDNL------RM-NVLGAIPLVPQRV------------------------------
A0A1Z8MBT6      SHHIE-AL------AVPPVIGELARAPRAS------------------------------
A0A517SXN9      SHHIE-AL------AVAPVIGELARAPRAS------------------------------
A0A518HFL0      AEDLTGRL------S--AEIFAVPPLPSAR------------------------------
A0A3B8ZJM2      PDEIVSDL------GK-PVLGHIPAMDLPN------------------------------
A0A1U7CLW1      PDEVAFRL------GL-RIIGDLPKLNGPR------------------------------
A0A142WPR7      PEEVQTSL------GL-PVVGHIPVIELAR------------------------------
A0A3M1TFJ0      AQRLGP-----------PVLGAVPELSDVS------------------------------
A0A517P477      KGNLAI-----------DLFGTLPHLPRGG------------------------------
A0A517T4K9      LNTVVDEL------RM-RVIGGVPLVPRNV------------------------------
A0A7C6B2Q1      PQDVLRVA------GT-DVWGTIPLLPPRA------------------------------
A0A7C4QPD3      LAAVRGRI------NV-PVLGSVPVIPYNV------------------------------
A0A2Z3GZZ5      PAEIRRRL------GL-AVVGHIPRIRTVP------------------------------
A0A4V0I6L6      PEDVRRRL------GL-PILAHVPVIRANQ------------------------------
A0A7C4QQT3      VKALRLCL------RQ-PVLGTVVRFTQGV------------------------------
A0A255QXF5      SHELERSQ------MLAPVIGELARAPSAT------------------------------
A0A518KBI5      AEQLFEDT------RL-RILGEISTFPTRR------------------------------
A0A5C5V6Q5      AEQLYEDT------RL-RVLGEISVFPSRR------------------------------
A0A517MY49      PEELTAQL------GT-PVLAMVRKLDPL-------------------------------
A0A2E6AG00      PDELKDQL------GL-PILAMIRXLPSTL------------------------------
A0A1G3A880      ADELRLRL------GV-PVLAMVRQLPNA-------------------------------
A0A2E8ATT1      PEELQEQL------EL-PVLAMIGNLEVG-------------------------------
A0A7C2JZW2      SSQIRTRT------NL-PLLGTVPLIPPGF------------------------------
A0A518KYQ0      SLDLEKSH------LIAPVIGELARAPRAA------------------------------
A0A5B9QX47      GSTLSKMT------GLAPVVGEVSRLPAGS------------------------------
M5T666          AETHDKTG------QLAPVLGEVARLPAGA------------------------------
M5U6N6          AETHDKNH------DLAPVLGEIARLPAGH------------------------------
A0A517M0G2      SAKLE-SK------LMAPIMGEVAKLPPKF------------------------------
A0A5C6AST1      AAALG-SK------DLAPVIGEVARIPTKV------------------------------
A0A5C6C951      ATTLE-SK------DVAPVIGEVARLPSKI------------------------------
A0A5C6C5T3      AETHDKTG------LLAPVLGEVSRLPAGS------------------------------
A0A2A2W6A9      SKDLERSL------ALAPVIGELARAPRGS------------------------------
A0A518HQS9      SLDLEKSH------TLAPVVGELARAPRAA------------------------------
A0A5M6DFE6      IQVLEKTG------GLAPIVGELARSPAGQ------------------------------
A0A5C6F286      ASSFSKAG------DMVPIMGEVARLPTGS------------------------------
A0A517NGN1      ANAVDRCA------VLAPVVGELTRAPIDP------------------------------
M5RUI3          SAAVDRSQ------SLAPVVGEIAQLPSGA------------------------------
A0A660VT66      SDEALDCLREVTGDQA-CILGYVQRLPGRS------------------------------
A0A7C2VEF7      ADEVSAIL------GV-PVLGVIPTMTDVRTITAHGRQAWLNFKPVAFGLCQRIHTIIST
A0A0S8H0S8      AADVPAVL------GL-PLLGAVPTIRRRR------------------------------
A0A7C2ZTD2      PDDVVKHI------GI-RILGTTTSPHAIK------------------------------
A0A2E3Z6T8      PEELTLQL------GV-PVLAMVKKLDALN------------------------------
A0A257WQ92      VGELRRAT------NY-SLLGTISRFTSVI------------------------------
A0A7C1U6X6      PKDMPPTL------QA-PFLGYIPLTRIKK------------------------------
A0A7C7UXI5      PEELQLQL------GV-SLLALLQEFEPLA------------------------------
A0A7C3SFJ0      SAEVAYGL------GL-RVVGDLPVISGRH------------------------------
A0A7C7WWF7      PEDLKDQL------GV-PVLAIVRKLETMV------------------------------
A0A356ETW1      IDDMQQQL------GV-PVLSLIRRLDVPE------------------------------
A0A3L7NJY1      PEELKLQL------ST-QILSMIPRLEQLP------------------------------
A0A523CME0      TEASELMM------GT-RSFSPKFKIDS--------------------------------
A0A354PCV3      VTDSSMSG------GL-SLVGEVARMPA--------------------------------
A0A354PHB4      VTDSSMCG------GL-SLVGEVARMPA--------------------------------
A0A356ESF4      IDDLQNQL------RT-TVLAVLPKL----------------------------------
A0A538RV31      GDDVVYGL------GW-RLVGAIPDLPSRQ------------------------------
                                                                            

M5S2L2          ------------------------------------------------------------
A0A2Z3GYP4      -----------------------AVELDSGLATVHSAMSPEA---EAYRGVRTALFFST-
A0A7C2VXA0      -----------------------KDVVNRGQKAHLKPKSVVA---EAYRTIRTGVFFGI-
A0A7C3AA48      ------------------------TVATRGRTVHMDSTSPVA---EAYRTIRTAVFFSV-
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      -----------------------RRLLPNPVYNGSVPDDIRAVLHESVDNIRTTLIHRA-
A0A2D6A9B6      -----------------------ERTVNPYLVCFHEPNGFRS---EQIRALRNRLTVMN-
A0A2G6JGH3      -----------------------DRVVDPYLVCFHEPRGFRA---EQFRALRSKLLVMN-
A0A7C5PFV3      -----------------------DRVVDPYLVLFHNPSGFRA---EQYRALRNKLIFLN-
A0A7C3QGD2      ----------------------------ERSLVRAAARSPIV---EVFNTAAALIESHA-
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A1V6CUG1      --H--------------------NGSFSEVLVTHHDRGGRIT---EEYRSLRTHLLAQY-
A0A3M1SE88      --FLGPKSL----------------------QVVAEPDSPES---EGFRTLRTALALSE-
A0A7C2ZUK5      -----------------------FEGWDERLVAASRNFSGVV---ESFRKLRTRILYPV-
A0A660WB30      --FHTPENLFFRTKRVVEADLESGMLYDRNYVREIRHRSIAT---EQIRKLRLRMN-TT-
A0A660W9Z7      -----------------------VERFQFSPECSFSHSSEIG---EKFREIRANLQVLQ-
A0A3M1R9K7      -----------------------AKQLHSEGKRYHHWRAIFT---ESVRGIAARLIRQA-
A0A3L7PH51      -----------------------GTGMELI-VTHMQPNSVES---ESFRSLRNFITFSN-
A0A3N5UQY5      -----------------------SVPVRGR-KVLLEPSSREA---EAFRIVRTAVFFGA-
A0A7C2JY73      ------------------PRRPEFGRLHPALRYLHSPNSLEA---ECYRTLRSALNVVC-
A0A356AE44      ----------------KNLQAARETGLAPMLYYYHDPGSPEA---EACRSVRATFFVRA-
A0A1G2XSU7      ---------------------------------KAMWPRQLA---DDYHSICINLGLMN-
A0A350KD81      -------------------AVVDDSEFAPALWYYYRPASREA---ESFRSLRTSLLLKT-
A0A2D6SRY7      -------GSGPS----LAERGRRKRVRPDRLISSMELGSIAM---EAYRCLRTNIQFAA-
A0A1G3C300      -------ENKDA---------------NLELLTSEAPKSVFS---ETIRNIRTGIMLST-
A0A524HC32      -------SGIES-------------------TFVRHPRTMFS---EAIRSSRVSIQLSG-
A0A177PV03      -------HVPGT----------PATAMESILCTYYQPKSVQA---EAFRGIRTALYFSL-
A0A1G2YIM0      -------KALLP--------------------------AKLA---DDYQAIRANLGLFN-
A0A7D8YCU5      -------AKRKKQKKVDAGGSEELGKISEKVSVVWNSSSPIS---EAFRGIRTTLLCTR-
A0A353BE27      ----------------LSKVKKSVEAVDPAVCAIHHSKGRVA---EAYRSVRTGLYFSN-
A0A5C6BPW1      -------SQKSS----KAKKTAKSAFWHSVL----------T---ESIDAARTVLIRDA-
A0A1I3GSP0      -------DLDRI---------AQQRGLSPALCYYHRPGSREA---EAYRSVRTTLFVSM-
A0A517QJV1      -------DSERL---------AKETGLTSALVFLHRPGSREA---EAFRTIRTTLFHGL-
A0A3C1QS25      ----------PK----SKQKQTEGITFDGTAISVHQPKSKIS---EAYRAVRTALFFSN-
A0A5C6FX55      -------RVTKRGSGQNADKDSPYKELDPCLAVLHSPSSVAA---ESVRSLRTATYFEL-
A0A5C6DS51      --------DLRK----MNIPSPSETSLAPSLITSHCPRSAEA---EVYRVARTSLMIKA-
A0A5C6DSL6      --------DFRK----LPMPAPGETPLAPSLVTEHCPRSAEA---EVYRVARTSLMIKS-
A0A3M1VG27      -----------T----ATEHGPPTARKCAQWYRLY-PRSGEA---EAFRVVRTRLLVSL-
A0A518GC22      -----------N----ISKVKKSVEAVDPSICAIHHSKGRVA---EAYRSVRTGLFFSN-
A0A3L7Q373      -------ALKRG----TTSNG-----LSPSLVYYHRPGSREA---EAFRSIRTTLFHST-
A0A3E0PW54      ----------SP----SAAAARSASALDPRLCYYHRPGSREA---EAYRSVRMAVLRNQ-
A0A7C3TAH2      ---------------------------DTTIPSPQQAAAHVA---EDLQTIRTNIGLQV-
A0A1Z8MHR4      -------MVQSA----K-VGDPHVDQLDPKLAVVHRPYSAAA---EAVRGVRTAMLFEQ-
A0A5C6EHJ0      --------LKPH----KFEKGEPGENLDSRLVTFFNGKGQKA---EAFRAIRTAIYFSN-
A0A5C6F1H9      --------LKPH----KVEPGEVGEHLDSRLVTFFSGKGQKA---EAFRAIRTAIYFSN-
A0A255QXY0      -------RVKAH----DSMDGENGSSLCDKISVVHRPHSPAA---EAVRAVRTAIMLER-
A0A517SYI0      -------MVQSA----K-VGDPHVDQLDPKLAVVHRPYSAAA---EAVRGVRTAMLFEQ-
A0A518HX54      -------RSHKR----KQMPTDSIARLDPKLAVIHRPHSPAA---EAVRAVRTAMLLDR-
A0A5B9MF59      -------RIQQG----KGMVDSAISNLDPKLSVVHRPYSPAA---EAVRGVRTAMLFDR-
A0A2A2WC24      -------RIQQG----KGLVDSEIAKLDPKLSVVHRPYSPAA---EAVRGVRTAMLFDR-
A0A518KYW8      -------RIQQG----KGLVDSEIAKLDPKLSVVHRPYSPAA---EAVRGVRTAMLFDR-
A0A5C5YZZ0      -------KLRKK----TSQKASAFPKTASIVTVLHEPHAPCS---EAFRSIRTNLFSTA-
A0A518JLD2      ----------RW----KVDADHVGAALDSRLCTFFQRKGMNS---EAFRALRTAVFFSN-
A0A5M6DJ15      -------ISAQF----NDDN------------FVHGAFGNSV---NSI----VAMLVNK-
A0A3L7P7S7      -----------P----MDEEEKALCKVDPTLICFHNPKSQEA---EFFRGLRTALYFST-
A0A517N8M1      -------KLKKV----AKGETNPYEKFDPSLAVVHMPASIPA---EAIRSCRTSVFFEL-
A0A5C6CW01      -------RIRKP----TKDEINPYKDLDPGMAVLHQPASVAA---EAIRSCRTAIFFEL-
A0A5C6BXS9      -------KVRKG----KPDNPNPFEELDPHLAVVHTPSSVPA---EAIRSCRTSIFFEL-
M5U569          -------RVRKA----KPDNPNPFEKLDPYLAVVHQPASVPA---ESIRSCRTSIFFEL-
L7CND7          -------RVKRK----KGEASNPFELLDPHLAVVHAPSSVAS---ESIRSCRTSVLFEM-
A0A0J1B8S4      -------RVRRA----KGETSNPFEQLDAHLAVVHAPSSVAS---EAIRSCRTSVLFEM-
F2ARR3          -------RVRHK----KGDKSNPFEHLDPHLAVVHAPSSVAS---ESIRSCRTSVLFEM-
K5D8H6          -------RVRHK----KGDKSNPFEHLDPHLAVVHAPSSVAS---ESIRSCRTSVLFEM-
M2AKU0          -------RVRHK----KGDKSNPFEHLDPHLAVVHAPSSVAS---ESIRSCRTSVLFEM-
A0A5B1CKI2      -------KLKKL----GKDEVNPYEKLDPALAVIHMPASVPA---EAIRSFRTSVFFET-
A0A5C6EG84      -------KVKKS----IKGDMNPYEKFDGSLAVVHMPASIPA---EAIRSCRTSVFFEL-
A0A5C6F2X4      -------KVKKS----VKGDINPYEKFDQSLAVVHMPASIPA---EAIRSCRTSVFFEL-
A0A5C5XTV6      -------KVRKS----KIDNPNPFEELDPHLAVVHTPSSVPA---EAIRSCRTSIFFEL-
A0A5C6AAB1      -------KVRKG----KPESPNPFEQLDPHLAVVHAPSSVPA---ESVRSCRTSLFFEL-
M5T8W8          -------RVRKS----KPDHPNPFEKLDPYLAVVHQPASVPA---EAIRSCRTSIFFDL-
M5SF00          -------RVKRK----KGEASNPFELLDPHLAVVHAPSSVAS---ESIRSCRTSVLFEL-
A0A2G1WDS1      -------RVKRK----KGEASNPFELLDPHLAVVHAPSSVAS---ESIRSCRTSVLFEL-
Q7UVS9          -------RVKRK----KGEASNPFELLDPHLAVVHAPSSVAS---ESIRSCRTSVLFEL-
A0A5C6B601      -------RVQQG----KTVMDKELSRLDPKLSVVHRPYSSSA---EAIRGIRTALFFDR-
A0A517PFU1      -------RTLKE----GKRIREGVP--DAGLSTVLRPKSQLA---ESYRAVRTGLLSAA-
A0A5B9M8J9      -------RAPKR----GPGPTGSIEQLDSKLAVIHRPHSPAA---EAVRAVRTAMLLDR-
A0A2A2WFP6      -------RRQNR----KQMPTNSIARLDPKLAVIHRPHSPAA---EAVRAVRTAMLLDR-
A0A518L8N2      -------RSPKR----KQMPTNSIARLDPKLAVIHRPHSPAA---EAVRAVRTAMLLDR-
A0A518HQN9      -------RIQQG----KGLVDSEIAKLDPKLSVVHRPYSPAA---EAVRGVRTAMLFDR-
A0A5M6D8H8      -------PVRPA----AGTVAPEIAELDPQLSVVHRPYSPAS---EAVRAVRTAMLFDH-
A0A5B1CRW9      -------RELRK----AAKAGSAL---DPSLMAYHSPRSQES---EIFRVGRTSMMIAN-
A0A5C6EI46      -------RTLRK----AAIAGSQL---DPSLLTYHTPRSAEA---EIFRVGRTSLMIAN-
A0A1G2ZG92      -------DMSII-------SKLNPTLP-------------VV---EAYRTIRNSIQYAS-
A0A1G3A0W0      -------FPQKP-------FGKSLCEQKYAQDR-------MA---ESIRLVRTALLSRL-
A0A2E7D3V4      -------LMDQM-------LYEQSPLQPSLCYFHRPGSS-EA---EAYRSVRTALFVSG-
A0A5B9PER9      -------RYLVE-------GSAIEPIVCSYHRPKSQ----VS---EAFRAVRTSLFFNT-
A0A517QSM4      -------IKAVD-------DGKRKLSSQQVALRSV-----LK---EAIDSTRAVLLRDP-
A0A355GJI7      -------AAVDE-------SEFAPALWYYYRPASR-----EA---EAFRSLRTSLLLKT-
A0A1Z8MCI4      -------SKSGR-------QF-------------------YE---RSVMALALRLGCLK-
A0A517SYL7      -------SRSGR-------QF-------------------YE---RSVMALAVRLGCLK-
A0A3L7P0L2      -------VSDRL-------AVQNGLSPALVYFHRPGSR--EA---EAYRSSRTTLYHST-
A0A6M5YVJ1      -------DGTHA-------V--------------------LV---EAIDATRTMLLSGG-
A0A2E0SHG0      -------ITKLA-------DRGSRLSPVLVTHHIPQSP--EA---EIFRALRTNLYYGT-
A0A518CQB8      -------LTKLA-------DKKSKLSPVLVTYHIPQSP--EA---EIFRSLRTNLYFGT-
A0A517SCC8      -------EAERA-------ARNSRLHPRLCYSHHPGSR--EA---ESFRTIRTALLFAC-
A0A3A0DR44      -------VLSGG-------AA--------SRRKIRRDLGLFQ---ESVDGLRTCLLLSE-
A0A358MY60      -------GQGKR-------QRV------------------FE---ESIDTLRANLMLSK-
A0A517MNB1      -------GSSKR-------QRV------------------FE---ESIDTLRANLMLSK-
A0A142YJ13      -------LDDPS-------GRDRDR---------------LV---QSIDAVRTMLLSVE-
A0A517Z7D3      -------FRVPD-------TSRLGAELFYYHHPGSR----EA---EAFRSIRTTLYASL-
A0A1N6KY57      -------LMLGS-------GAAQHRRWGSM----------LI---ESVDAARTALLHVS-
L0DK20          -------RGMKL-------REAESVRWRSM----------LV---ESVDAARTTLLHFS-
A0A3L7UX05      -------SARKL-------MGGIDETRLRRQLVE------YI---QSIDHLRVAISASL-
A0A517XRC2      -------SLKAA-------EAAGNANWRFI----------LN---ESINSTRTMLLHTA-
A0A6M5YH47      -------NLKAA-------VEAGGANWRFV----------LN---ESINSTRTMLLHTA-
A0A660UUK3      -------RSMIT-------QQ-------------------LS---DDYQTIRANLGLFN-
A0A517ZHG5      -------SQKSS-------KAKKTAKSAFWHSV-------LT---ESIDAARTVLIRDA-
A0A1Z8MPL5      -------RRLGF-------RAPTPEAIEDLQVT-------ME---ESIDGLRAMLLHLP-
A0A7C1EH96      -------RKLLG-------RQ-------------------LV---DDYQTIRANLGLLD-
A0A5C1AGE3      -------SIKTG-------EADANQNWRFI----------LN---ESVNSTRTMLLHTA-
A0A2Z3HEL7      -------SLQAA-------VEAGGANWRFV----------LN---ESINSTRTMLLHTA-
A0A142XAP8      -------SLQAA-------TEAGGANWRFV----------LN---ESINSTRTMLLHTA-
A0A6P2DEK1      -------SLQAA-------TEAGGANWRFV----------LN---ESINSTRTMLLHTA-
A0A5C6C1R5      -------EVLTN-------ENFSDCE--------------FG---NSVSSIVAMLVNMS-
A6BZU4          -------AVVDD-------SEFAPALWYYYRPASR-----EA---ESFRSLRTSLLLKT-
A0A2D5GZ77      -------AVVDD-------SEFAPALWYYYRPASR-----EA---ESFRSLRTSLLLKT-
A0A3D3R1Z6      -------AVVDD-------SEFAPALWYYYRPASR-----EA---ESFRSLRTSLLLKT-
A0A517XG00      -------AVVDD-------SEFAPALWYYYRPASR-----EA---ESFRSLRTSLLLKT-
A0A1G2YRE4      -------PALIP-------DQ-------------------IA---GEYQTIRANMGLLS-
A0A353Z859      -------GGKNS-------EGGGGQRWQGA----------LI---ESIDSARVMLLRRA-
A0A2D6ST10      -------SRRPT-------GDNRGKTAFWNSV--------LS---ESIDSARTVLLRDA-
A0A177QX42      -------DWKMV-------KDAQVDSSISVHHRPKSR---LA---ESYRAVRAAIFFGT-
A0A517SHR0      -------DWKIV-------KDAKVDSSISVHHRPKSR---LA---ESYRAVRAAIFFGM-
A0A2E0AW64      -------DGQRH-------S-----------RRVTRQLRLFE---ESVHHLRTSLVLSR-
A0A351FZ59      -------DGQRH-------S-----------RRVTRQLRLFE---ESVHHLRTSLVLSR-
A0A660V239      -------KLLLG-------RQ-------------------LA---DDYQAIRANLGLLD-
A0A177Q3B7      -------TLAAG-------ANGTHARDLV-----------FV---EHVDAARTSLLHLA-
A0A2E0X6Y6      -------GEGFD-------LV----------HAYVSPNKPET---EAFRTLRTALTLSP-
A0A518GFD7      -------LVSPG-------QAKKGRDYQRAVE--------LA---EAIDSVAAMVLHRA-
A0A5C5VZJ8      -------AEVLT-------NCPI-----------------QT---ESVRVLRTAFLNRL-
A0A518GE37      -------RSTQG-------HRL------------------FE---ESIDALRANLLFKL-
A0A5C6F3H8      -------RSQKG-------RRV------------------FE---ESIDTLRANLFLSM-
A0A5C5X072      -------GSRKA-------RRV------------------FE---ESIDSLRANLFLSV-
A0A5C5WUQ3      -------HGGRA-------RRV------------------FE---ESVDTLRSNLFHSL-
A0A5C6E697      -------KNSKA-------RRV------------------FE---ESVDSLRANLLLST-
A0A5C5Z1A3      -------RSSRG-------RRV------------------FE---ESIDSLRANLFLSK-
A0A5C6D2P7      -------QSSRS-------RRV------------------FE---ESIDSLRSNLFLST-
A0A5B9ML17      -------ASRGS-------KG----------RRI------FQ---ESVDTMRANIFLSK-
A0A518HFS8      -------RGGAT-------AVRRRAL--------------I----ESVDAVRTALLRAS-
A0A5Q3LBQ3      -------RNARR-------AGRARGL--------------FE---ESVDSLRTGLVLSE-
A0A517LX75      ---------KEK-------KAAKQSKLSPLCRTVFAPHSTEA---EVLRMARTGLFVHT-
A0A7C5W7B3      -------FIFPE-------NPTTR----------------TA---NVFSLLRNHLRYSD-
A0A2S8F9B8      -------VRKPK-------SLSVDLGSFEDQ---------VR---DSSDSVAATILRRA-
A0A354GX32      -------RATAP-------VAGDQSMGP------------MI---ESMDGIRTRLLHAG-
A0A142XL75      -------GKPGA-------PPPS-----------------LV---EAIDATRTMLVHGT-
A0A6P2D5D5      -------SKSGR-------PAPS-----------------LV---EAIDATRTMLVHGT-
A0A5C1AAF0      -------HRQSG-------VK------KEYWHSV------LT---ESMASTQMFLRHAG-
A0A7C7T8W8      -------VSGRE-------RKLGLRRAM------------FE---ESIDQLRISLLMAE-
A0A5C6B3S0      -------MRRVN-------HQ----------NQRTHWMGRLT---EAVDSVAAVFIRKA-
A0A368KP63      -------TRKPK-------ALAVNLGPFEDR---------VR---DSSDSVAATILRRA-
A0A518GIZ9      ---------EQS-------RLDPVQNVHPSLRYLRSPASIEA---ENYRTIRTSLLVTA-
A0A1C3EBY9      ---------EQS-------RLDPVQNVHPSLRYLRSPASIEA---ENYRTIRTSLLVTA-
D5SX64          ---------EQS-------RLDPVQNVHPSLRYLRSPASIEA---ENYRTIRTSLLVTA-
A0A517Z0U7      -------SRGDD-------RT---HHKAAYWHSV------LT---ESIDAARTLLLRNS-
A0A2S8FCC0      -------LAQSR-------KN---SKKQQYWKSL------IA---ESIGGIVARLFRQS-
A0A1Z8MBT6      -------GARQS-------RG----------RRV------FX---ESVDSLRANLALSQ-
A0A517SXN9      -------GARQS-------RG----------RRV------FE---ESVDSLRANLALSQ-
A0A518HFL0      -------SADRN-------RLEGPGHDPKFEQ--------FV---QQLDHLRVALCGEG-
A0A3B8ZJM2      -------IKKVV-------DTVDPSLITIHHSRGR-----IA---EAFRSVRTGLFFSS-
A0A1U7CLW1      -------RGDQK-------QIERDR---------------LV---QSIDAVRTMLLNAG-
A0A142WPR7      -------ADRRS-------NDAVHPSLVTFHRPKSR----LA---EAYRAVRTSLYFRT-
A0A3M1TFJ0      -------GRELD-------RYALSNPSSA-----------YA---EAFRRARVQL-----
A0A517P477      -------AGAGA-------GQRGSDWNEA-----------LK---ESVDAARVVLLRKL-
A0A517T4K9      -------TGSPK-------PDDDARRVFWKSR--------LT---ESIDAARTMILKES-
A0A7C6B2Q1      -------MRAIV-------DERVRSKKHRRWRQM------FV---ESVRKVAARLIREA-
A0A7C4QPD3      -------RGATP-------RR--QRMAAAYWRSV------LS---EAFDQIRTVLLHSP-
A0A2Z3GZZ5      -------ALSLE-------PATYDPLLVAALRPKSS----EA---EAYRGLRTQLYFST-
A0A4V0I6L6      -------PNEVT-------PAAAVDPTLVVWLRPKTA---EA---EAVRGLRTQLLFSV-
A0A7C4QQT3      -------EPGAP-------LA---ARAHPMLRYLRAPHSLEA---ENFRSLRTALGVIC-
A0A255QXF5      -------GSRNS-------KG----------RRV------FE---ESVDSLRANLALSK-
A0A518KBI5      -------VAANP-------RQ--------IPRKLRKEMFAFA---ESIDALRMSLTFSA-
A0A5C5V6Q5      -------VAANP-------RR--------LPRRIQKEMYSFA---ESIDSLRMSLTFCA-
A0A517MY49      ----------PG-------EGVATIHTATMPNAV------ET---ESFRTLRTSLTLSP-
A0A2E6AG00      ----------AT-------TGVNALHVATTPDSV------ES---EAFRTLRTTIAFAG-
A0A1G3A880      ----------GV-------PGWAGVQANAAPDAV------ES---EAFRTLRTALAFSP-
A0A2E8ATT1      ----------NE-------LGLGALQVHASPDAV------ES---EAFRTLRTTLAFSE-
A0A7C2JZW2      ---------RNP-------RTAKQRLTATYWRDV------LQ---EAFDGVQSIVRHNE-
A0A518KYQ0      -------VGRNS-------KS----------RRV------FE---ESVDALRANLALSK-
A0A5B9QX47      ---------GSR-------RS----------RRL------FE---ESIDTLRSNLFLSV-
M5T666          ---------GAV-------KG----------RRV------FE---ESIDTLRANLFLSV-
M5U6N6          ---------GAA-------KG----------RRV------FE---ESIDTLRANLFLSM-
A0A517M0G2      ---------GSR-------KG----------RRV------FE---ESIDTLRANLLLSK-
A0A5C6AST1      ---------GVG-------KR----------QRV------FE---ESIDTLRANLMLSK-
A0A5C6C951      ---------GVG-------KR----------QRV------FE---ESIDTLRANLMLSR-
A0A5C6C5T3      ---------GSQ-------KA----------RRV------FE---ESIDSLRSNLFLSV-
A0A2A2W6A9      -------TGRNS-------KS----------RRI------FE---ESVDTLRANLALSK-
A0A518HQS9      -------SGRNS-------KS----------RRV------FE---ESVDALRANLALSK-
A0A5M6DFE6      -------NGRGS-------RG----------RRV------FQ---ESVDTLRANLFLSE-
A0A5C6F286      ---------RSQ-------KR----------RRV------FE---ESIDTLRANLFLSM-
A0A517NGN1      ---------RNS-------KG----------RRI------FE---ESVDALRANLFLSQ-
M5RUI3          ---------RNG-------RG----------RRI------FE---ESVDALRANLFLSL-
A0A660VT66      -----------------------EDPRENDRICERMPRSVFA---EVYRNLRTSLIFSF-
A0A7C2VEF7      GIAGSRAKTTGVISPTSDGDIGKQDIAVRGQKVHIKPKSVIA---EAYRTIRTAVFFGV-
A0A0S8H0S8      ------------------------SLQSGAQTVLMDPASPAA---EAYRDIRTAVCFGV-
A0A7C2ZTD2      ------------------------EAYLQDQVV------------GDYQTIRANLGLMD-
A0A2E3Z6T8      ------------------GENL------ETIHTHACPNAPET---EAFRTLRTVLSL---
A0A257WQ92      ------------------DPHVIRGGMHSALRYLLAPRSMEA---ESYRSLRTALNVTS-
A0A7C1U6X6      ------------------SLGK------PLHEEIRRIRDDKV---ESVRLVRTALLSRL-
A0A7C7UXI5      ------------------ERGI------GALHAHVRPDAVET---EAFRTLRTALSL---
A0A7C3SFJ0      ------------------RRQL------ALDGRGSPLYGLLA---DSIDNIRTALLYQA-
A0A7C7WWF7      ------------------DAGA------ESLHVHIAPQSVEA---EAFRTLRTTLSF---
A0A356ETW1      ------------------TSGL------EAIQLHVAPASTES---EAFRTLRTALAL---
A0A3L7NJY1      ------------------GAGF------EAVLSHLKPHSKDV---EAFRALRTSIEF---
A0A523CME0      --------------------NHVDERIVSYYDFLGKQTWEGP---VMVHFRRLQISLNKM
A0A354PCV3      -----------------GTRGTKDRRIF-------------Q---ESVDTLRSNLFLST-
A0A354PHB4      -----------------GTRSTKERRIF-------------Q---ESVDALRSNLFLSS-
A0A356ESF4      ------------RVANGAGIDSLQVHVA-------------P---DTRESEGFRTLRTAL
A0A538RV31      ----------RRNLTLDGEANKHWNSLL-------------T---ESVDAARALLLRTA-
                                                                            

M5S2L2          --DIQ-----------GGKVIQVTSPLPGDGKTTLAGNLACSIAQS-GKRVLVIDCDLRR
A0A2Z3GYP4      --HGE-----------RHKVIQVTSPHMGDGKTTLIINLAVSIAQ-AGRKVLLLDADLRR
A0A7C2VXA0      --PKE-----------EAKTILVTSPAPGDGKSTLVSNLAITMAQ-AGQKTIIVDADFRK
A0A7C3AA48      --PKG-----------QARTLLVTSPSAGDGKSTLVSNLCIAMAQ-ADQKVLLIDADFRK
A0A3L7SU85      ---------------------------AGDGKSTTSANLAISIAQ-SGKKIVLLDADFRK
A0A3M1RAJ8      --KKD-----------GLKVVMVTSGVAREGKSTVASQLAASLAR-AGRKTVLIDGDLRR
A0A2D6A9B6      --PDG-----------SARSLVITSAIQGEGKTATALNLAMSMTELQDHRILVLDCDLRK
A0A2G6JGH3      --PER-----------APRSVVITSAIQGEGKSSSAINLALAFAELEDQRAVLLDFDFRK
A0A7C5PFV3      --PEG-----------LSRSLVVTSAIKEEGKSTTLLNLGLAFAELEGQSAIILDFDLRL
A0A7C3QGD2      --RQA-----------SARLYAVTSAVPGEGKSTVTCNLAVALAR-AGSRVLLVDADLRK
A0A3D4PLL5      ----E-----------NHQRISITSTQPSDGKTTVISNTAVAFAQ-AGKKTLVIDGDMRR
M5RD30          ---------------------MMTSPHPGDGKSTTISNLAISLAQ-TGKRVLLIDADMRR
A0A1V6CUG1      --PDE-----------RF-CLLITSAMAGEGKTVTAANLAMVMAERIDRKTILVDCDLRK
A0A3M1SE88      --SDA-----------D--TIVVSSTEPGDGKSTVAANLAAAFAQ-AGKKTLLIDGDLRR
A0A7C2ZUK5      --EDD-----------VPRSILIISADAQEGKSFVCANLGISLAHSVAQHALMIDCDLRR
A0A660WB30      --TGE-----------RVRTILVTSALAGEGKSTVAANLAVAISQMIGEHVLLVDGDLRR
A0A660W9Z7      --VDR-----------SVKTLVFSSAHHKEGKTHTVVNTARFLSQHENRHTLLMDCDLRR
A0A3M1R9K7      --KED-----------ETRVVLVTSAFGGEGKTTVASQLAISLAE-MGQKTILIDFDLRR
A0A3L7PH51      --EAT-----------QRLVVTSTEPG--DGKTTTLANLAVAFAQ-AGKKTLLIDADLRR
A0A3N5UQY5      --PNG-----------KAKTTLITSPGMEDGKSTLVSNLAIAMAR-AGQKTLILDADLRK
A0A7C2JY73      --EAS-----------DLKVVQISSPEPGDGKTTTVANLALAAAQS-GKRVLLVDADLRR
A0A356AE44      --ADV-----------DAHIIQFTSSEPGDGKTTTISNLGISIAQA-GKRVLLIDADLRK
A0A1G2XSU7      --NCT-----------IPNKLVISSASPREGKSTLAVNLATNLAKI-GKKVLLIDGDLRK
A0A350KD81      --DRS-----------GAKVLQMTSAEPGDGKTTSISNLALAIAQT-GRKVLIIDADLRR
A0A2D6SRY7      --PDT-----------KTPCYLVTSAGPGEGKSLTTSNLAIAIAQL-GRRVVLVDADMRR
A0A1G3C300      --TDT-----------PHKSLLITSTKQGEGKSFIAANLAIAFAQT-GKKTLLVDTDFRK
A0A524HC32      --ADT-----------RCKSFLITSGIPNEGKTTIAANLALSFAVA-GERVMLIDVDLRK
A0A177PV03      --RSG-----------DYKVIQITSPEARDGKTTLSANLAVSIAQS-GKKVVLLDADFRK
A0A1G2YIM0      --EEK-----------IPHILAITSARPQEGKTTFAINLASSMAKA-GARVLLVDGDLRK
A0A7D8YCU5      --TER---------P-DFQVIQITSSVPGEGKSTVAANLAASIAKA-QKRVIVIDADLRR
A0A353BE27      --KGK-----------ALKVIQVTSPVPGDGKSTLSSNISVTMAQS-GRRVLLIDADLRR
A0A5C6BPW1      --NVE-----------STRLVMVGSAISGEGKTTLSCHLAASLARV-GRNTLLVDCDFRK
A0A1I3GSP0      --RE------------DHKVVQVSSAAPGEGKSTTAANLAIAIAQS-GKKVLLVDCDLRR
A0A517QJV1      --RN------------NEKVLQITSAEPGDGKSTIAVNTALAMAQA-GKRVLLIDCDLRR
A0A3C1QS25      --RQR-----------DIKVIQVTSPSPGDGKSTLALNLAVSIAQS-GQKVLLVDADLRR
A0A5C6FX55      --AGV---------Q-GGKILQVTSPLPGDGKSTIAGNLACAIAQS-GKSVLVIDCDLRR
A0A5C6DS51      --SGQ-----------EAQVLMMSSPHPGDGKSTTIANLAISFAQT-GKRVLLIDSDLRR
A0A5C6DSL6      --RGQ-----------GTQVLMMSSPHPGDGKSTTIANLAISFAQT-GKRVLLIDSDLRR
A0A3M1VG27      --HDE-----------HHRVLQITSPEPNDGKTTVACNLALAVAQS-GKRVLLLDADLRR
A0A518GC22      --NGK-----------ALKVLQVTSPVPGDGKSTLACNIAVTMAQS-GRRVLLIDADLRR
A0A3L7Q373      --KES-----------QDKLIQITSAEPGDGKSTTAANLAIAIAQS-GKRVLLIDADLRR
A0A3E0PW54      --PES-----------GGQAVQMTSAEPGDGKSVSAANLSLAIAKS-GKRVLLIDADMRR
A0A7C3TAH2      --DGV-----------VPRRLVVTSPGVQEGKTSLAINLATSLARS-GRRVLLVDGDLRK
A0A1Z8MHR4      --RQF-----------NSKVFQVTSPLPGDGKSTLVGNIGCLVAQS-GKRTLLIDLDLRS
A0A5C6EHJ0      --QSG-----------NNQVLQMTSSTPSDGKSTIAANVAVAIAQS-GRKVLLLDGDLRR
A0A5C6F1H9      --QSG-----------NNQVLQMTSSTPSDGKSTIAANVAVAIAQS-GRRVLLMDGDLRR
A0A255QXY0      --KKN-----------GSQVFQITSPLPGDGKSTLAANVGCSIAQT-GKTTLLIDLDLRS
A0A517SYI0      --RQF-----------NSKVFQVTSPLPGDGKSTLVGNIGCLVAQS-GKRTLLIDLDLRS
A0A518HX54      --RQT-----------DSKVFQITSPLPGDGKSTLAANVGCSIAQS-GKRTLLIDLDLRS
A0A5B9MF59      --RQF-----------DSKVFQITSPLPGDGKSTLAANVGCSVAQS-GKRTLLIDLDLRS
A0A2A2WC24      --RQY-----------NSKVFQITSPLPGDGKSTLAANVGCSVAQS-GKRTLLIDLDLRS
A0A518KYW8      --RQY-----------NSKVFQITSPLPGDGKSTLAANVGCSVAQS-GKRTLLIDLDLRS
A0A5C5YZZ0      --GGA---------P-EYQVIQVTSALPGDGKSTIVANLAASVARA-NKRVLIIDADLRR
A0A518JLD2      --QSG-----------DNQILQITSATPSDGKTTTAGNLAITMAQA-GKSVLILDADLRR
A0A5M6DJ15      --AKF---------E-DANIIMVSSAVSGEGKSTLARSLWRGLAEA-KYRTVIVDFDLRR
A0A3L7P7S7      --QGH-----------GHQVLQATSPVAGDGKSTTAANLAISIAQS-GKKIVLLDADFRK
A0A517N8M1      --TG----------Q-RGKVIQVTSPLPGDGKSTIAGNLACSIAQS-GKRTLVIDCDLRR
A0A5C6CW01      --AGI---------D-GGKVVQVTSPLPGDGKTTVAGNLACSIAQS-GKRVLVIDCDLRR
A0A5C6BXS9      --AGV---------P-TGKILQVSSPLPGDGKSTISGNLACSIAQS-GKRTLLIDCDLRR
M5U569          --SGI---------P-GGKILQVTSPLPGDGKSTIAGNLACSIAQS-GKKTLLIDCDLRR
L7CND7          --AGI---------P-GGKIIQVTSPLPGDGKSTIAGNLACSIAQS-GKRTLIIDCDLRR
A0A0J1B8S4      --AGI---------H-GGKIIQVTSPLPGDGKSTIAGNLACSIAQS-GKRTLIIDCDLRR
F2ARR3          --AGI---------S-GGKIIQVTSPLPGDGKSTIAGNLACSIAQS-GKRTLIIDCDLRR
K5D8H6          --AGI---------P-GGKIIQVTSPLPGDGKSTIAGNLACSIAQS-GKRTLIIDCDLRR
M2AKU0          --AGI---------P-GGKIIQVTSPLPGDGKSTIAGNLACSIAQS-GKRTLIIDCDLRR
A0A5B1CKI2      --SGP-----------GCKVIQVTSPLPGDGKSTIAGNLACSMAQS-GKRVLVIDSDLRR
A0A5C6EG84      --AGS-----------GGKVIQVTSPLPGDGKSTIAGNLACSIAQS-GKRTLVIDCDLRR
A0A5C6F2X4      --TGSGSWGSAEKSP-GGRVIQVTSPLPGDGKSTIAGNLACSIAQS-GKRTLVIDCDLRR
A0A5C5XTV6      --AGI---------Q-GGKILQVSSPLPGDGKSTISGNLACSIAQS-GKRTLLIDCDLRR
A0A5C6AAB1      --ARV---------P-GGKIIQVTSPLPGDGKSTIAGNLACSIAQS-GKRTLLIDCDLRR
M5T8W8          --SNV---------P-GGKIIQVTSPLPGDGKSTIAGNLACSIAQS-GKKTLLIDCDLRR
M5SF00          --AGV---------E-GGKVLQVTSPLPGDGKSTIAGNLACSIAQS-GKRTLIIDCDLRR
A0A2G1WDS1      --AGV---------E-GGKVLQVTSPLPGDGKSTIAGNLACSIAQS-GKRTLIIDCDLRR
Q7UVS9          --AGV---------E-GGKVLQVTSPLPGDGKSTIAGNLACSIAQS-GKRTLIIDCDLRR
A0A5C6B601      --RAY-----------DSKVFQITSPLPGDGKSTIAANIGCSIAQS-GKKVLLIDLDLRS
A0A517PFU1      --RN------------GVKVVQVTSPDRGDGKSTLTANVAVTLGRV-GKRTVLVDVDLRR
A0A5B9M8J9      --RQN-----------DSKVFQITSPLPGDGKSTLAANVGCSIAQS-GKRTLLIDLDLRS
A0A2A2WFP6      --RQT-----------DSKVFQITSPLPGDGKSTLAANVGCSIAQS-GKRTLLIDLDLRS
A0A518L8N2      --RQT-----------DSKVFQITSPLPGDGKSTLAANVGCSIAQS-GKRTLLIDLDLRS
A0A518HQN9      --RQY-----------NSKVFQITSPLPGDGKSTLAANVGCSVAQS-GKRTLLIDLDLRS
A0A5M6D8H8      --RQY-----------DSRVFQVTSPLPGDGKSTLAANVGCSIAQS-GKKTLLLDLDLRS
A0A5B1CRW9      --RKD-----------SVQTMMVTSPQPGDGKSTTIANMAISFAQT-GKRVLLIDADMRR
A0A5C6EI46      --RKD-----------SVQTIMVTSPQPGDGKSTTISNLAISFAQA-GKRVLLIDADMRR
A0A1G2ZG92      --LDK-----------PMKTIVVTSSMESEGKSSMSSNISITYSME-KKKVILVDLDLRR
A0A1G3A0W0      --GGP-----------RNTALLITSAVAGTGKSYFTMTLGESLARA-GKKVLMIDADLRK
A0A2E7D3V4      --SGR------------SQAIQVSSPEPGDGKTTFISNLAIAIAQS-GRKVLLIDADLRR
A0A5B9PER9      --QNH-----------QHSVIQITSPTPGDGKSTLASNLAVSIAQS-GKRVLLVDADMRR
A0A517QSM4      --RMK-----------VMNTILITSASDGEGKTSNACHLAASLARS-GRKVVLVDCDMRR
A0A355GJI7      --DRS-----------GAKVLQMTSAEPGDGKTTSISNLALAIAQT-GRKVLIVDADLRR
A0A1Z8MCI4      --VLS-----------AGKVVGVVSGVSGEGKSTVTFGLACMLGHSKHLKVLVIDADVRK
A0A517SYL7      --VLS-----------AGKVVGVVSGVSGEGKSTVTFGLACMLGHSKHLKVLVIDADVRK
A0A3L7P0L2      --KDS-----------QDKIIQITSAEPGDGKSTTAANLAIAIAQS-GKKVLLIDADLRR
A0A6M5YVJ1      --PDS-----------DLRVVVVASAIAGEGKTSLSGHLAISLARA-GSRTLLIDGDLRA
A0A2E0SHG0      --HGS-----------TPKVVQFTSPNPKDGKSVTTANLAISLAQT-GKSVLLIDCDMRL
A0A518CQB8      --HGQ-----------SPKVVQITSPNPKDGKSVTTANLAISLAQT-GKSVLLIDCDMRL
A0A517SCC8      --QEH-----------NVRLLQFSSAEPGDGKTTTISNLAIAIAQS-GKKVLLIDADMRR
A0A3A0DR44      --ATS-----------SHRVFAVTSAVSGEGKTSLVSQLAISLARATGKRVLIVDADLRS
A0A358MY60      --QTK-----------DARTVTVASSMSGEGKSSVSSQLAISLAKACGETVLLVDADLRS
A0A517MNB1      --DTR-----------DVRTISVASSLSGEGKSSVSSQLAISLAKACGETILLIDADLRK
A0A142YJ13      --RQH-----------SFQVVMVTSATKGEGKTSLSCHLATSLARA-GRRTLLIDCDLRK
A0A517Z7D3      --DGT-----------DDRLLQISSPEPGDGKSTTAANLAIAMAQS-GKRVLLVDGDLRR
A0A1N6KY57      --RTE-----------SVRVVMIASALGGEGKTSLASHLATSLARA-GRRTLLVDGDLRR
L0DK20          --RTE-----------SVRVVMVASALSGEGKTSLSSHLATSLARA-GRRTLLIDGDLRR
A0A3L7UX05      --GSTH----------EHQSILITSAFGGEGKTTLSAQLAGRCANA-GLSTVVVDGDLRN
A0A517XRC2      --RSQ-----------SMQVVMVTSATQGEGKTSLSSQLASSMATA-GMRTLIVDCDLRN
A0A6M5YH47      --RTQ-----------SMQVVMVTSATQGEGKTSLTSQLATSMATA-GMRTLIVDCDLRN
A0A660UUK3      --GHE-----------STKVLVVTSPGVGDGKTTFAINIALSFAQS-GEKVLLIDGDLRK
A0A517ZHG5      --NVE-----------STRLVMVGSAISGEGKTTLSCHLAASLARV-GRNTLLVDCDFRK
A0A1Z8MPL5      --AAK-----------DVRTLMVTSALANEGKTTVASALATSMGRS-GRRTLLIDGDLRC
A0A7C1EH96      --GDG-----------ETKMLVITSPGMGDGKSTLAVNLATSFARS-GRKTLLIDGDLRK
A0A5C1AGE3      --KTQ-----------SMQVIMVTSAMQGEGKTSLSSQLATSMATA-GLRTLIVDCDLRN
A0A2Z3HEL7      --KSQ-----------SMQVVMVTSATQGEGKTSISSQLATSMATA-GMRTLIVDCDLRN
A0A142XAP8      --KAQ-----------AMQVVMVTSATQGEGKTSLASQLATSMATA-GMRTLIVDCDLRN
A0A6P2DEK1      --KAQ-----------AMQVVMVTSATQGEGKTSLASQLATSMATA-GMRTLIVDCDLRN
A0A5C6C1R5      --RFD-----------RASVLMVTSGVSGEGKTTLATSLWRGLTQA-SYRTILIDFDLRR
A6BZU4          --DRS-----------GAKVLQMTSAEPGDGKTTSISNLALAIAQT-GRKVLIIDADLRR
A0A2D5GZ77      --DRS-----------GAKVLQMTSAEPGDGKTTSISNLALAIAQT-GRKVLIVDADLRR
A0A3D3R1Z6      --DRS-----------GAKVLQMTSAEPGDGKTTSISNLALAIAQT-GRKVLIVDADLRR
A0A517XG00      --DRS-----------GAKVLQMTSAEPGDGKTTSISNLALAIAQT-GRKVLIVDADLRR
A0A1G2YRE4      --KNE-----------MPKILVITSPWMREGKTTLSINLATSLAKS-GKKVLLIDGDLRK
A0A353Z859      --SLE-----------NAKVVMVSSAVTSEGKTTMACHMGTSLARA-GYRTVVVDVDLRR
A0A2D6ST10      --KVD-----------SLKAVMICSAVGGEGKSTLSCHLATSLARA-GRKVLLIDCDLRR
A0A177QX42      --RGQ-----------THRVLQITSANSGDGKTTLCSNLASAIAMS-GKKVLLVDGDLRR
A0A517SHR0      --RGQ-----------SHRVLQVTSANSGDGKTTLCCNLASAIAMS-GKRCLLVDCDLRR
A0A2E0AW64      --PLE-----------DIQVLAVTSSVSGEGKTTLAAQLAMSIARASGQPTLLIDGDMRA
A0A351FZ59      --PLE-----------DIQVLAVTSSVSGEGKTTLAAQLAMSIARASGQPTLLIDGDMRA
A0A660V239      --GGG-----------ASKIIVVTSPGIGDGKTTFAVNLATSFAQS-GEKVLLIDGDLRK
A0A177Q3B7      --KHG-----------EVQAILVTSAVGGEGKTSLACQLAASLARA-GFQTLLIDGDMRR
A0A2E0X6Y6      --Q-------------AHSRLLVSSSEPSDGKTTVALNLAVTFAQA-GRRTLIIDADLRK
A0A518GFD7      --AVE-----------KRQVFMVSSALAGEGKSTISCQLSRSLAKS-GKRVLLVDFDLRR
A0A5C5VZJ8      --KQA-----------GCSVVQFTSVGPRTGKSTLVGMLGRSLAAA-GKRVLLVDGDVRR
A0A518GE37      --E-------------GARTIAVTSAMSSEGKSSVASQLAISLAKTSQTTVLLIDADLRS
A0A5C6F3H8      --DTS-----------NVRSIAVVSGMSGEGKSSVSSQLALSIAKATGETVLLVDGDLRC
A0A5C5X072      --DTR-----------HTRSIAVVSSMSGEGKSSVASQLALSMAKSTGETVLLVDGDLRR
A0A5C5WUQ3      --ATK-----------NIRSIAVASSMTSEGKSSVASQLAISIAKATGETVLLVDADLRC
A0A5C6E697      --DWK-----------HVRSIAVVSSVSGEGKSSVASQLALSIANATAETVLLVDADLRC
A0A5C5Z1A3      --QWE-----------GTRSIAVASSVSGEGKSSVASQLAISIAKATGETVLLVDADVRC
A0A5C6D2P7      --EWK-----------DTRTIAVVSSVSGEGKSSVASQLALSIAKATGNTVLLVDADLRC
A0A5B9ML17      --HTQ-----------HSRSIAIVSSMSGEGKSTAASQLAISLAKSSGKTVLLVDADMRC
A0A518HFS8      --QVE-----------PLQVIMVTSATKGEGKSSLSCHLATSLARA-GRRTLLLDCDLRS
A0A5Q3LBQ3      --PLR-----------DARVLAVTSAISREGKTSLSSELAVSIAQATGEPTLLIDGDMRS
A0A517LX75      --GRS-----------LDKVMLVTSPMPGDGKSTMIVNLAAAIAKA-GKSVLLVDADLRR
A0A7C5W7B3      --TNH-----------PEKAFAVTSPRPGDGKSFVAVNLAISFAQE-GNRTVLVDCDLRH
A0A2S8F9B8      --ADQ-----------QCQVLLISSAMPREGKSSLACHLAISLAHA-GRKVVVVDFDLRR
A0A354GX32      --RSE-----------TLRVVMVASAVSGEGKTTLASHLAASLARG-GRRTLLVDGDLRN
A0A142XL75      --DEP-----------DLRVLVVTSAVSGEGKTSLTGHLAISLARA-GFRTLLVDGDLRS
A0A6P2D5D5      --DEP-----------DLRVFVVTSAVSGEGKTSLTGHLAISLARA-GFRTLLVDGDLRA
A0A5C1AAF0      --NVG-----------LPRILLIASAEKGEGKTLLSTHLAAGFARN-GVKTLLIDGDLRK
A0A7C7T8W8      --KAQ-----------GKKVFSMSSSVSGEGKTSIASQLALSIARSQNLPVLLIDADMRA
A0A5C6B3S0      --RLE-----------QHSVIMITSALAGEGKTTLASQLAVSLAAS-GQRTVLVDCDLRR
A0A368KP63      --ATQ-----------KCQVLLISSAMPQEGKSSLTCHLAISLANA-GRRVVIVDFDLRR
A0A518GIZ9      --EAL-----------NAQVIQVGSPEPGDGKTTLVSNLALALASS-GKRVLLIDADLRR
A0A1C3EBY9      --EAL-----------NTQVIQVGSPEPGDGKTTLVSNLALALASS-GKRVLLIDADLRR
D5SX64          --EAL-----------NAQVIQVGSPEPGDGKTTLVSNLALALASS-GKRVLLIDADLRR
A0A517Z0U7      --QLS-----------GTRTVMIASATGGEGKSTLSCHLATSLARA-GRSVLLVDCDIRR
A0A2S8FCC0      --GAN-----------KNRVVMISSALAGEGKTTLAGQIAYALAES-GARTVLVDFDLRR
A0A1Z8MBT6      --DTR-----------TARSFCIASSMSGEGKSTAASQLAISLAKSSGKTVLIIDADLRC
A0A517SXN9      --DTR-----------TARTFCIASSMSGEGKSTAASQLAISLAKSSGKTVLIIDADLRC
A0A518HFL0      --GHDG----------RGRCVLITSAVGGEGKTTLAAQLAVRCAEA-GASTVLIDADLRR
A0A3B8ZJM2      --RGS-----------ELKVVQITSPVPGDGKSTLSSNLAVAMAQS-GRRVLLIDADFRR
A0A1U7CLW1      --RHQ-----------PFRVVLVTSALKGEGKTSLSCHLATSLARG-GRKTLLMDCDLRK
A0A142WPR7      --RGE-----------PLKVIQVTSPNPGDGKSTLSGNLAISIAQT-GKRVLLMDADFRR
A0A3M1TFJ0      ---NATGAFPSE----GCGVLVCVSGVPREGKTLCSVNLAVAEAQA-GRRTLLVDGDMRN
A0A517P477      --GDGRGQTPESRLDAGGRVVLISSAVASEGKTTLSCHLAASLART-GRRVVLVDADLRR
A0A517T4K9      --ENS-----------GLQVVLIASALGGEGKSTLACHLSSSLARA-GRKTLLIDGDMRR
A0A7C6B2Q1      --DQD-----------GLKLVMVSSAMAGEGKTTLAGQLALTLAQM-GKKTIIVDFDLRR
A0A7C4QPD3      --RLN-----------GVKTIMVAGSGIAEGKTSTTTQLALSLARS-GFRVLLIDGDLRR
A0A2Z3GZZ5      --QGR-----------GHQVIQVTSPTPGDGKSTLAANLALSVAQS-GKRTILVDCDLRK
A0A4V0I6L6      --ANR-----------NHQVIQVTSPMSGDGKSTTAANLAIALARA-DKRVVLVDCDFRK
A0A7C4QQT3      --ETR-----------QAKVIQVSSPEPGDGKTTTVVNLAVAVAQS-GRRVLLIDADLRR
A0A255QXF5      --DTR-----------DARTFAIVSSMSGEGKSTAVSQLAISLAKASGKTVLIIDADMRC
A0A518KBI5      --DSE-----------QQRIVAITSANSGEGKSSVSVALGMSFANATRRRTLIIDGDMRD
A0A5C5V6Q5      --PSE-----------RNRVIALTSAVSGEGKTSVSVALAMSFANATGAKTLLVDGDMRD
A0A517MY49      --T-------------SCERLLISSSEPGDGKTTVSANLAVAFAKA-GKRTLVIDADLRK
A0A2E6AG00      --D-------------DLKCVAVSSSEPGDGKTTVVANLGATFAQA-NXTTLMIDADLRK
A0A1G3A880      --H-------------ATERIAVSSSEPGDGKTTVLVNLAVSFAQA-GKRTLLIDADLRR
A0A2E8ATT1      --S-------------DTECIAVTSSEPGDGKTTVLANLGLVWAQV-GKKTLLIDADMRR
A0A7C2JZW2      --RCA-----------AARTIMVASSCEGEGKSTSAAQLALSFARA-GYRVLLIDGDLRR
A0A518KYQ0      --DTR-----------HARSFAVVSSMSGEGKSTAVSQLAISLAKSSGNTVLIVDCDMRC
A0A5B9QX47      --RTR-----------DTRSIAVASSMSGEGKSSVASQLAISIAKATGELVLLVDADLRC
M5T666          --DTR-----------ETRSIAIVSSMSGEGKSSVASQLALSIAKATGETVLLVDADLRC
M5U6N6          --DTR-----------NTRSIAVVSSMSGEGKSSVASQLALSIAKATGETVLLVDADLRC
A0A517M0G2      --ETS-----------GVRTLTIASSMSGEGKSSVASQLAISVAKASGKTVLLIDGDLRS
A0A5C6AST1      --DTQ-----------GVRTIAIASSMSGEGKSSVASQLAISLAKACGKTVLLIDADLRS
A0A5C6C951      --DTV-----------GVRSITIASSMSGEGKSSVSSQLAISLAKACGKTVLLIDADLRS
A0A5C6C5T3      --DTR-----------HIRSIAVVSSMSGEGKSSVASQLALSMAKSTGETVLLVDGDLRR
A0A2A2W6A9      --DTR-----------HARSFAVVSSMSGEGKSTAVSQLAISLAKSSGKTVLIIDCDMRC
A0A518HQS9      --DTR-----------HARSFAVVSSMSGEGKSTAVSQLAISLAKSSGKTVLIIDCDMRC
A0A5M6DFE6      --STR-----------DARSFAIVSSMSGEGKSTAASQLAISLAKATGKTVLLIDADMRC
A0A5C6F286      --DTN-----------KTRSIAVVSGMSGEGKSSVSSQLALSIAKATGGTVLLVDGDLRC
A0A517NGN1      --QTR-----------GARTIAICSSMSGEGKSTAAAQLAVSLAKASNKTVLLVDGDTRC
M5RUI3          --DTK-----------HTRSIAVVSSMSGEGKSSVASQLALSIAKATDQTVLLVDADLRY
A0A660VT66      --KEE-----------GPKSILVTSPGSLEGKSTIVSNLGIAFAQN-GQKTVIIDGDLRK
A0A7C2VEF7      --PRG-----------EARTILITSPDAGDGKSTLVSNLAIAMAQA-GQKTLILDADFRK
A0A0S8H0S8      --REG-----------QVKTLLVTSAQAGDGKTTLVSNLGIAMAQA-AQRTLILDADLRN
A0A7C2ZTD2      --GGG-----------IPNKLVITSAGPGEGKSTLAINLATSLARA-DKRVLLIDGDLRK
A0A2E3Z6T8      --SEQ-----------NCERILISSSEPGDGKTTISANLSVALAQA-GHRTLVIDADLRR
A0A257WQ92      --DNA-----------HANVILVTSPETGDGKTTTISNLAIAMAQS-GKRVLLVDADLRR
A0A7C1U6X6      --NGQ-----------GRTTVLIASAAEGTGKSTFTMMLGKSLAQS-GKKVIMIDADLRR
A0A7C7UXI5      --ARG-----------QVRSLVISSSEPGDGKTTVSANLAAVYAQA-GKRTLLVDADMRR
A0A7C3SFJ0      --SRE-----------GIKVTLITSALAREGKTTVATQLAASLGRT-GRSTLLVDGDLRR
A0A7C7WWF7      --SGP-----------EMQRVTISSAEPGDGKTTVLANLGASFGQS-GKRTLLIDADLRK
A0A356ETW1      --ADR-----------ELNRIVVTSAEPGDGKTTIIANLATCYAQS-NKKTLLIDADLRR
A0A3L7NJY1      --SPE-----------ETRRLVCTSTEPGDGKTTVSSNLAVAFAQS-GRRTLLIDADMRR
A0A523CME0      LRNVG-----------RSKVLIVASATQKEGKSTIALNTAITLCNN-NNKVVIIDCDLRK
A0A354PCV3      --RWK-----------GTRSIAVVSSISSEGKSSIASQLSVSIAKATGKTVLLVDADLRR
A0A354PHB4      --SWK-----------DTRSIAVVSSISSEGKSSVASQLALSIAKATGETVLLVDADLRR
A0A356ESF4      ALRDR-----------EARRLVVCSAEPGDGKTTVLANLGVSFAQA-QRKTLLIDADLRR
A0A538RV31      --RTE-----------AVRTVMVTSAVAGEGKTSLSCHLASSLARA-GRKTLLIDCDLRR
                                              **:                  :::* * * 

M5S2L2          P-----------------Q----ITDNF-AM------QS-KMGLS--------NVLN---
A0A2Z3GYP4      P-----------------R----VHRAF-GL------TS-RIGLA--------EVLT---
A0A7C2VXA0      P-----------------M----QHNIF-EI------DSGKKGLA--------DVLT---
A0A7C3AA48      P-----------------M----QHGIF-EV-------TREPGVS--------NIMA---
A0A3L7SU85      P-----------------R----VHKIF-RL------EQPEVGLA--------SVVN---
A0A3M1RAJ8      P-----------------R----MHRVL-KQ------DL-APGLS--------EYLR---
A0A2D6A9B6      P-----------------S----VETFL-GL------NR-GPGLA--------DLLQ---
A0A2G6JGH3      P-----------------S----VETLL-GL------NQ-EPGLT--------ELLM---
A0A7C5PFV3      P-----------------S----VERLL-GL------NP-EPGLT--------DLML---
A0A7C3QGD2      A-----------------T----QHQLL-NV------AN-DPGLS--------SYLI---
A0A3D4PLL5      P-----------------G----LTAVF-AL------KG-QAGLS--------TILR---
M5RD30          P-----------------V----IAGLF-GL------EG-EPGLT--------NVLF---
A0A1V6CUG1      K-----------------K----LTAML-GC------K-QQAGMA--------ELLQ---
A0A3M1SE88      P-----------------G----LTAML-GY------R-GESGLS--------RALQ---
A0A7C2ZUK5      P-----------------S----LAGLF-GL------DNNSRGLV--------DYLR---
A0A660WB30      P-----------------D----LHNFF-GL------P-PKPGLA--------EYLE---
A0A660W9Z7      P-----------------K----IKEHV-LV------D-CEYSLE--------DVLT---
A0A3M1R9K7      P-----------------S----LDGVF-GI------E-NDRGVS--------EILR---
A0A3L7PH51      PGMTQLLDLKGPRGLAQVL----NDKKL-DI------DIAERCLE--------NVFH---
A0A3N5UQY5      P-----------------I----QHRIF-DI------NHQEQCLC--------SVLE---
A0A7C2JY73      P-----------------M----LHTLF-AL------PN-DIGLT--------DVLS---
A0A356AE44      P-----------------M----VHQLF-GM------RE-EIGLS--------ECLS---
A0A1G2XSU7      P-----------------D----IAKYL-KL------DNKGKGMH--------QLL----
A0A350KD81      P-----------------T----IHKLF-GL------AN-SIGLG--------DVLN---
A0A2D6SRY7      P-----------------V----LHGLF-GV------ER-GPGLS--------EILV---
A0A1G3C300      P-----------------R----QHKIF-GI------DL-KPGLS--------NHFI---
A0A524HC32      P-----------------S----LHNVF-----IPSTPVNGNGLS--------SFLA---
A0A177PV03      P-----------------R----MHEIF-GV------SA-DVGVA--------SVIA---
A0A1G2YIM0      P-----------------D----IAKIL-NI------ETGHNALR--------KVLL---
A0A7D8YCU5      P-----------------T----QHILF-GR--GSQSEG-GIGLT--------SVMN---
A0A353BE27      P-----------------R----VAKIF-GI------DS-EIGVA--------AVVG---
A0A5C6BPW1      S-----------------N----VHRVF-GV------EE-HPGLS--------EVLL---
A0A1I3GSP0      P-----------------T----QHTLF-QV------PQ-EVGLT--------DVLL---
A0A517QJV1      P-----------------T----LHHLL-GL------PQ-EIGFT--------DVLL---
A0A3C1QS25      P-----------------R----QHKVI-GE------NA-EHGFA--------AVLR---
A0A5C6FX55      P-----------------Q----LTDNF-VM------QD-QLGLT--------NVLN---
A0A5C6DS51      P-----------------V----VAGLF-GL------EG-RLGLA--------DVLK---
A0A5C6DSL6      P-----------------V----VAGLF-GL------EG-QPGLA--------DVLN---
A0A3M1VG27      P-----------------S----IHKAL-GL------RQ-DIGVT--------DILR---
A0A518GC22      P-----------------R----VAKIF-GI------DS-DVGVA--------AVVG---
A0A3L7Q373      P-----------------T----MHTLF-GL------SQ-DIGLA--------DVLQ---
A0A3E0PW54      P-----------------T----VHELF-RI------KQ-DIGLS--------EVLL---
A0A7C3TAH2      P-----------------D----VAILM-GI---PVPAP-GSGES--------IEVD---
A0A1Z8MHR4      P-----------------R----LSLRF-NL------ST-NVGLT--------NVLN---
A0A5C6EHJ0      P-----------------R----VGKLL-GI------ES-EIGTAWAIEQCGPGSTD---
A0A5C6F1H9      P-----------------R----VGKVM-GI------EN-DKGTAWAIEQCEADAAG---
A0A255QXY0      P-----------------R----LSLRF-NL------QS-DKGLA--------NVLN---
A0A517SYI0      P-----------------R----LSLRF-NL------ST-NVGLT--------NVLN---
A0A518HX54      P-----------------R----LSLRF-NL------ET-KIGLA--------NVLN---
A0A5B9MF59      P-----------------R----LSLRF-NL------EA-QTGLT--------NVLN---
A0A2A2WC24      P-----------------R----LSLRF-NL------EA-KTGLT--------NVLN---
A0A518KYW8      P-----------------R----LSLRF-NL------EA-KTGLT--------NVLN---
A0A5C5YZZ0      P-----------------T----QAKVF-GV------QP-SAGLT--------GLLN---
A0A518JLD2      P-----------------R----IAKLF-DL------RA-DKGLA--------WAIEQIT
A0A5M6DJ15      P-----------------S----LHVDL-GC------EP-GIGVS--------DIVA---
A0A3L7P7S7      P-----------------R----VHKIF-KL-----DQP-EVGLA--------SVVS---
A0A517N8M1      P-----------------Q----LTDNF-DM------AD-LSGLS--------EVLN---
A0A5C6CW01      P-----------------Q----ITDNF-AM------KS-KLGLS--------NVLN---
A0A5C6BXS9      P-----------------Q----ITDNF-GS------AE-KQGLT--------DVLN---
M5U569          P-----------------Q----ITDNF-AS------AE-QLGLI--------DVLN---
L7CND7          P-----------------Q----VTDNF-AM------AD-QLGLV--------DVLN---
A0A0J1B8S4      P-----------------Q----VTDNF-AK------AD-QLGLV--------DVLS---
F2ARR3          P-----------------Q----VTDNF-AM------AD-QLGLV--------DVLN---
K5D8H6          P-----------------Q----VTDNF-AM------AD-QLGLV--------DVLN---
M2AKU0          P-----------------Q----VTDNF-AM------AD-QLGLV--------DVLN---
A0A5B1CKI2      P-----------------Q----LTDFF-SL------AE-QKGLT--------DVLN---
A0A5C6EG84      P-----------------Q----LTDNF-DM------AD-QRGLT--------HVLN---
A0A5C6F2X4      P-----------------Q----LTDNF-DM------AD-QKGLT--------DVLN---
A0A5C5XTV6      P-----------------Q----ITNNF-DS------AE-KQGLT--------DVLN---
A0A5C6AAB1      P-----------------Q----ITDNF-NG------SE-KLGLI--------DVLS---
M5T8W8          P-----------------Q----ITDNF-DS------AE-QLGLI--------DVLN---
M5SF00          P-----------------Q----VTDNF-AM------AD-QLGLV--------DVLN---
A0A2G1WDS1      P-----------------Q----VTDNF-AM------AD-QLGLV--------DVLN---
Q7UVS9          P-----------------Q----VTDNF-AM------AD-QLGLV--------DVLN---
A0A5C6B601      P-----------------R----MSLRF-NL------QS-DVGLT--------NVLN---
A0A517PFU1      P-----------------R----VRRMF-GLPQVAADNP-GVGTA--------EVIA---
A0A5B9M8J9      P-----------------R----LSLRF-NL------DT-NVGLA--------NVLN---
A0A2A2WFP6      P-----------------R----LSLRF-NL------ET-KIGLA--------NVLN---
A0A518L8N2      P-----------------R----LSLRF-NL------ET-KIGLA--------NVLN---
A0A518HQN9      P-----------------R----LSLRF-NL------EA-KTGLT--------NVLN---
A0A5M6D8H8      P-----------------R----MSLRF-NL------ES-GKGLT--------NVLN---
A0A5B1CRW9      P-----------------V----VAKLF-GL------QH-DPGLS--------DFLG---
A0A5C6EI46      P-----------------V----ISKLF-GI------DD-RKGLS--------DFLA---
A0A1G2ZG92      P-----------------T----AHKFF-KI------SN-NNGIT--------NILS---
A0A1G3A0W0      M-----------------G----LTRRF-NL------AG-KAGFI--------ESLR---
A0A2E7D3V4      P-----------------T----VNQLF-GL------PQ-DIGTC--------DVLL---
A0A5B9PER9      P-----------------R----QHSTF-GI------TS-KEGFA--------TVLG---
A0A517QSM4      P-----------------T----VHRVF-RL------NS-AHGFC--------EILR---
A0A355GJI7      P-----------------T----IHKLF-GL------AN-SVGLG--------DVLT---
A0A1Z8MCI4      P-----------------S----LHSLF-DV------SN-EVGLV--------DVLM---
A0A517SYL7      P-----------------S----LHSLF-DV------SN-EVGLV--------DVLM---
A0A3L7P0L2      P-----------------T----MHTLF-AL------PQ-DIGLT--------DVLL---
A0A6M5YVJ1      P-----------------T----AQRVF-GG------PL-APGLC--------EVLR---
A0A2E0SHG0      P-----------------M----VDKLF-GL------DT-SVGLS--------SVLR---
A0A518CQB8      P-----------------M----VDKLF-GL------ST-TVGLS--------DVLR---
A0A517SCC8      P-----------------T----VHDMF-RL------SQ-EAGLS--------DVLL---
A0A3A0DR44      P-----------------N----LHEIF-EI------HL-EPGLA--------GVLR---
A0A358MY60      P-----------------D----QHDIF-GL------EM-GPGLA--------GVMA---
A0A517MNB1      P-----------------D----QHAIF-GL------EM-GPGLT--------RVLS---
A0A142YJ13      P-----------------S----LHEIF-EV------PS-EPGLC--------EVLS---
A0A517Z7D3      P-----------------T----LHKLF-KL------RS-DIGLV--------DVLS---
A0A1N6KY57      P-----------------S----VHELF-DQ------PC-VPGFS--------EVLR---
L0DK20          P-----------------S----AHELF-DQ------PC-VPGFS--------EVLR---
A0A3L7UX05      P-----------------T----LTRTL-EA------TD-MPGLT--------NLLK---
A0A517XRC2      P-----------------S----IHKLF-DL------PL-TPGVS--------EVLC---
A0A6M5YH47      P-----------------S----VQKLF-EL------PL-GPGVS--------EVLR---
A0A660UUK3      P-----------------D----IADML-NL------PKGLRGLQ--------DMLF---
A0A517ZHG5      S-----------------N----VHRVF-GV------EE-QPGLS--------EVLL---
A0A1Z8MPL5      P-----------------S----AHRFL-EM------PL-DEGLA--------EVLR---
A0A7C1EH96      P-----------------D----IAGML-NL------SAGHRGIQ--------DYLF---
A0A5C1AGE3      P-----------------S----MHRLF-DL------PL-APGCS--------EILL---
A0A2Z3HEL7      P-----------------C----VMKLF-EV------PL-TPGVS--------EVLR---
A0A142XAP8      P-----------------S----IMKLF-EL------PL-APGVS--------EVLR---
A0A6P2DEK1      P-----------------S----IMKLF-EL------PL-APGVS--------EVLR---
A0A5C6C1R5      P-----------------S----LHENL-GY------EL-GVGVS--------DAVG---
A6BZU4          P-----------------T----IHKLF-GL------AN-SIGLG--------DVLN---
A0A2D5GZ77      P-----------------T----IHKLF-GL------AN-SIGLG--------DVLN---
A0A3D3R1Z6      P-----------------T----IHKLF-GL------AN-SIGLG--------DVLN---
A0A517XG00      P-----------------T----IHKLF-GL------AN-SIGLG--------DVLN---
A0A1G2YRE4      P-----------------D----IAYLL-NL------PKSTKGLK--------DVLL---
A0A353Z859      P-----------------T----VHRVF-DV------AG-DPGVC--------EVLS---
A0A2D6ST10      P-----------------S----ICRVF-DL------PQ-IPGVC--------ELLR---
A0A177QX42      P-----------------R----IHKLF-GL------DL-ERGLS--------SVIR---
A0A517SHR0      P-----------------R----VHKLF-GV------SI-DVGVA--------SVVR---
A0A2E0AW64      P-----------------D----LYDVF-EI------PN-QPGFA--------DLLE---
A0A351FZ59      P-----------------D----LYDVF-EI------PN-QPGFA--------DLLE---
A0A660V239      P-----------------D----IAEML-NL------PKGSRGLQ--------DLLF---
A0A177Q3B7      P-----------------A----CHRVF-GA------PA-SPGFS--------ELLR---
A0A2E0X6Y6      P-----------------G----LTTRL-SL------KR-DAGVA--------ELLL---
A0A518GFD7      P-----------------S----LHSYL-EL------SE-GPGVS--------ELLH---
A0A5C5VZJ8      G-----------------S----LTAAF-RA------AG-TAGLL--------DDLS---
A0A518GE37      P-----------------D----QHDLF-GL------PN-EPGLC--------KLLG---
A0A5C6F3H8      P-----------------D----QHEIF-GL------EM-GDGFA--------GVLS---
A0A5C5X072      P-----------------D----QHEIF-GL------EM-GPGLT--------GVLS---
A0A5C5WUQ3      P-----------------D----QHSLF-GL------DI-GPGLA--------GVLS---
A0A5C6E697      P-----------------D----QHRLF-GL------EM-GPGLC--------SVLD---
A0A5C5Z1A3      P-----------------D----QHRLF-GL------DM-GAGLS--------GVLS---
A0A5C6D2P7      P-----------------D----QHRLF-GL------EM-GPGLS--------AVLS---
A0A5B9ML17      P-----------------D----QHDHF-GI------SL-EPGLS--------GVLT---
A0A518HFS8      P-----------------A----IHLLM-DE------PL-APGLC--------EVLR---
A0A5Q3LBQ3      P-----------------D----IHTIF-EI------PM-EPGLS--------KVLD---
A0A517LX75      P-----------------T----LHKLL-GV------EA-SMGLA--------EYLR---
A0A7C5W7B3      P-----------------DKNVYQEALLVQA------HQ-QHGLI--------HMLE---
A0A2S8F9B8      P-----------------S----MHAIF-DC------PI-SPGVG--------ELLV---
A0A354GX32      P-----------------A----AHKLF-GM------AA-GPGFS--------ELLR---
A0A142XL75      P-----------------T----AHRVF-DA------PL-APGLC--------EILR---
A0A6P2D5D5      P-----------------T----VHRVF-DA------PL-APGLC--------EILR---
A0A5C1AAF0      P-----------------S----AHGAF-GV------PS-GPGLA--------ELLR---
A0A7C7T8W8      P-----------------S----QHNIF-NC------NI-GPGLT--------DVFD---
A0A5C6B3S0      S-----------------V----LHQLF-EA------NL-QPGLS--------EWLS---
A0A368KP63      P-----------------S----MHRIL-GL------PI-GPGVS--------DLLA---
A0A518GIZ9      P-----------------M----ATRLF-GL------RP-DPGLV--------DVLQ---
A0A1C3EBY9      P-----------------M----ATRLF-GL------RP-DPGLV--------DVLQ---
D5SX64          P-----------------M----ATRLF-GL------RP-DPGLV--------DVLQ---
A0A517Z0U7      P-----------------S----IHRVF-DF------EN-SPGIC--------DVLR---
A0A2S8FCC0      P-----------------A----LDISF-DI------EL-TPGVT--------ELLS---
A0A1Z8MBT6      P-----------------D----QHDIF-GL------AL-EPGLS--------DVVE---
A0A517SXN9      P-----------------D----QHDIF-GL------AL-EPGLS--------DVVG---
A0A518HFL0      A-----------------T----LGRLF-EV------PD-CPGLS--------DVLR---
A0A3B8ZJM2      P-----------------R----LQKLF-GF------DA-DVGVA--------QLVA---
A0A1U7CLW1      P-----------------S----LHDVF-DF------PS-GPGLG--------DILR---
A0A142WPR7      P-----------------R----IHKLI-GQ------NT-SLGVS--------SVIA---
A0A3M1TFJ0      P-----------------R----VHKVF-AA------DP-APGLR--------NALE---
A0A517P477      P-----------------S----THRVF-GC------ES-GPGLS--------DVLR---
A0A517T4K9      P-----------------S----VHEVF-DI------PL-GPGLS--------EVLL---
A0A7C6B2Q1      P-----------------A----IHDVF-NV------PL-SPGVS--------EVLR---
A0A7C4QPD3      P-----------------T----LEREF-NL------PR-QRGFC--------ELLA---
A0A2Z3GZZ5      P-----------------R----VHKLFAGA------DATGTGLA--------EVIA---
A0A4V0I6L6      P-----------------R----VHKLF-GL------EKPATGLA--------SVVA---
A0A7C4QQT3      P-----------------S----CHRLL-GV------SL-DIGLS--------DVLK---
A0A255QXF5      P-----------------D----QHDVF-GL------PL-EPGLN--------EVLR---
A0A518KBI5      P-----------------S----VTDLL-DV------PA-GPGLC--------EVLG---
A0A5C5V6Q5      P-----------------S----INDLV-DA------EP-GPGLY--------EVLS---
A0A517MY49      P-----------------G----MTALL-GL------KS-QHGVA--------DLLL---
A0A2E6AG00      P-----------------G----MTRLF-EL------RG-QEGLS--------DLLR---
A0A1G3A880      P-----------------G----LTTLL-GM------KG-AAGVS--------DVLR---
A0A2E8ATT1      P-----------------G----LSRLL-DM------RG-TSGLS--------DVLR---
A0A7C2JZW2      P-----------------S----LEKEF-GI------GT-GPGLC--------EVLD---
A0A518KYQ0      P-----------------D----QHDVF-GL------AL-EPGLN--------EVLR---
A0A5B9QX47      P-----------------D----QHDIF-GL------EM-GPGLC--------GVLS---
M5T666          P-----------------D----QHEIF-GL------EM-GPGFT--------SVLS---
M5U6N6          P-----------------D----QHEIF-GL------DM-GRGLT--------SLLA---
A0A517M0G2      P-----------------D----QHAIF-GL------DL-GPGLS--------KVLS---
A0A5C6AST1      P-----------------D----QHDIF-GL------EM-GPGLA--------KVLS---
A0A5C6C951      P-----------------D----QHAIF-GL------EM-GAGLS--------KVLS---
A0A5C6C5T3      P-----------------D----QHEIF-GI------EM-GPGFT--------GVLA---
A0A2A2W6A9      P-----------------D----QHDVF-GL------AL-EPGLN--------EVLR---
A0A518HQS9      P-----------------D----QHDVF-GL------AL-EPGLN--------EVLR---
A0A5M6DFE6      P-----------------D----QHDVF-GL------TL-EPGLS--------GVLL---
A0A5C6F286      P-----------------D----QHEIF-GL------EM-GVGFA--------GVLA---
A0A517NGN1      P-----------------D----LHDVF-GI------DL-SPGLT--------GVLG---
M5RUI3          P-----------------D----QHEIF-GL------EM-GPGLS--------GVLS---
A0A660VT66      P-----------------R----LHRTF-EA------DN-SVGLS--------TVLA---
A0A7C2VEF7      P-----------------M----QHNIF-EF------EN-NRGLS--------GVLA---
A0A0S8H0S8      P-----------------M----QHEVF-DV------AC-EPGLT--------GLLA---
A0A7C2ZTD2      P----------------------------DI------A----NLL--------NLPK---
A0A2E3Z6T8      P-----------------G----FTTLM-QL------KG-QPGVA--------DLLT---
A0A257WQ92      P-----------------S----VHTLF-NL------PT-DIGLA--------DVLA---
A0A7C1U6X6      M-----------------T----LSKRF-GL------AD-EPGFM--------ESLR---
A0A7C7UXI5      P-----------------G----LTPLL-DL------KG-PKGLS--------GVLR---
A0A7C3SFJ0      P-----------------S----AHRIF-DL------PQ-SPGLC--------EVLR---
A0A7C7WWF7      P-----------------G----LSTMF-CY------RK-MPGLS--------DFLQ---
A0A356ETW1      P-----------------G----LTNLM-QM------RQ-QEGLS--------TVLR---
A0A3L7NJY1      P-----------------G----LSTLL-GL------RD-DFGLS--------RLLR---
A0A523CME0      P-----------------S----INRLL-GF------IP-DKGVS--------DYLS---
A0A354PCV3      P-----------------D----QHRLF-GV------EM-GPGLS--------GVLA---
A0A354PHB4      P-----------------D----QHRLF-GV------QM-GPGLV--------AVLA---
A0A356ESF4      P-----------------G----LTSML-DL------RG-AEGLS--------NLLG---
A0A538RV31      P-----------------S----VHQLF-DM------PV-EPGFS--------GVLR---
                                                                            

M5S2L2          -----GDC-DP----SEA----CQQTPLST---------LQ-VMPSGP-IPANPA--EAL
A0A2Z3GYP4      -----GTA-EL----A----DAIQMTAIPN---------LS-VLPCGR-RPSNPA--ELL
A0A7C2VXA0      -----QEI-SL----K----EAIEHGPVPG---------LD-ILHCGM-ELPNPS--EVL
A0A7C3AA48      -----GTH-TI----D----QSVRPSGVPG---------LD-ILPCGP-DVPNPS--EML
A0A3L7SU85      -----GDA-TL----Q----EAIHTCEVPG---------LH-LIPCGP-RPANPS--ELL
A0A3M1RAJ8      -----GEA-AL----E----EIVRETDRDN---------LW-LIPAGR-CDTEAL--QAL
A0A2D6A9B6      -----GST-SL----D----EAIRPSGIPG---------LD-IIGAGS-RPKNPS--ELA
A0A2G6JGH3      -----GRL-AL----H----QAIRNSGVES---------FD-LIGPGG-MPTNPS--ELL
A0A7C5PFV3      -----GRI-PL----R----SAIRNAGKPG---------LD-FIGAGL-QKVHPA--EFL
A0A7C3QGD2      -----GATDEI----D----TVIFPTEVEN---------LS-LLPSGP-LLQSPA--PYL
A0A3D4PLL5      -----DTA-SI----EESALKHITKTRLEN---------LD-VISAGP-RPSNPV--ELL
M5RD30          -----DST-QF----D----KCIQSTPIET---------LS-VMAHGS-RTSEPA--ELL
A0A1V6CUG1      -----GKA-TL----RDV----VVPTVYPN---------LF-FLPPGN-AAGNVG--ELM
A0A3M1SE88      -----SNE-DI----EEAAVKTIRSTGIEN---------LD-LLPAGP-RALHPA--ELL
A0A7C2ZUK5      -----GEE-DF----ARL----VHGTGLPD---------LS-IMPAGL-PPDNPA--ELV
A0A660WB30      -----YDL-DL----SQL----LVKTDFDK---------LT-MLQAGK-VPANST--ELL
A0A660W9Z7      -----GKC-EL----ADA----LVYSEQDN---------LA-VLPTRH-GQHNAT--ELL
A0A3M1R9K7      -----GEA-KW----QQV----CRDSGIEN---------LD-IIPAGQ-WSYRGM--AVL
A0A3L7PH51      -------------------------LGVEG---------LD-FMPSGP-RPANPS--ELL
A0A3N5UQY5      -----GKV-KL----SQA----IQPTQVPG---------LS-LLTCGY-GIGNPA--EVL
A0A7C2JY73      -----GEI-EL----LNA----VRPGGVDT---------LS-VLPAGR-PPTNPA--ELL
A0A356AE44      -----GEI-EM----ANA----IQDSRIEN---------LH-ILSAGA-IPAKPA--ELL
A0A1G2XSU7      -----ADF-KL----RDL----LLYSDVPG---------LS-VLTAEP-CDISII--NRL
A0A350KD81      -----GEI-DA----QTA----IRETRVTH---------LS-ILTAGM-LPENPS--EML
A0A2D6SRY7      -----GNA-TW----QEN----LRSTSVEG---------LH-VLPAGQ-SPPNPA--ELL
A0A1G3C300      -----GEI-DY----ESI----IKHVNIPH---------LN-IITCGL-IPPNPS--ELL
A0A524HC32      -----AMT-DQ----VYS----YNKFHKN----------LK-VILSGP-VSPNPV--ELL
A0A177PV03      -----GTA-KL----KDA----VKPTAVEG---------LS-ILPCGP-RPANPA--ELL
A0A1G2YIM0      -----GYN-TL----DES----VWPMPSVG---------LDVLISDGN-DSYDAF--ELL
A0A7D8YCU5      -----YDV-SL----AEA----IQSTSVEG---------LD-VLTTGP-IPNNPA--EAL
A0A353BE27      -----GKV-EV----DDA----ICAGPVAN---------LS-ILPGGK-RPANPA--EIL
A0A5C6BPW1      -----GTA-SL----EEA----IKSPSDDG---------PD-VLPAGQ-FNSQLL--AAL
A0A1I3GSP0      -----REI-DW----QNA----VRPTQIEN---------LS-LMTAGL-CPENPA--ELL
A0A517QJV1      -----NEI-QW----QNA----IRETPSEN---------LS-VITAGL-CPENPA--EIL
A0A3C1QS25      -----GDL-AV----AEA----AIETQVPG---------LY-FIPCGE-RPSNPA--ELL
A0A5C6FX55      -----GEC-EW----QEA----CHSTPLGH---------LD-VMPSGP-IPANPA--EAL
A0A5C6DS51      -----GDS-TL----AEA----ASKTSVEN---------LD-VMPHGT-ETSVPA--ELL
A0A5C6DSL6      -----GQC-SL----AQS----VTHSSVEN---------LD-IMPHGT-ETSVPA--ELL
A0A3M1VG27      -----GEI-DW----QTA----VQHTVENN---------LD-VLPAGL-PVDNPA--ELL
A0A518GC22      -----GKC-EI----EDG----IHVGPVAN---------LS-IMPGGK-RPANPA--EIL
A0A3L7Q373      -----NEI-QW----VNA----VRSTRLEN---------LS-VLTAGR-CPSNPA--ELL
A0A3E0PW54      -----GEI-EW----MNA----LRETPVEG---------LS-VMTAGA-CPENPA--ELL
A0A7C3TAH2      ---------GF----CYV----LCKTGIPE---------LDSLVPAGA-PAADPY--EVI
A0A1Z8MHR4      -----GEL-AP----EEA----VCHSPIDN---------LD-ILPCGP-LPANPA--EAL
A0A5C6EHJ0      -----SNV-AI----DAA----IHPSLVAN---------LS-VMTAGE-RPDNPS--ELL
A0A5C6F1H9      -----LDD-RI----QAA----ITRSVVAN---------LS-VMTAGE-RPDNPS--ELL
A0A255QXY0      -----GEI-GI----SEA----IHETSIDY---------LD-VLPCGP-LPANPA--EAL
A0A517SYI0      -----GEL-AP----EEA----VCHSPIDN---------LD-ILPCGP-LPANPA--EAL
A0A518HX54      -----GEL-GV----AQA----VHQTPIEN---------LD-ILPCGP-LPANPA--EAL
A0A5B9MF59      -----GEL-GP----AEA----VHQSPIEN---------LD-ILPCGP-LPANPA--EAL
A0A2A2WC24      -----GEL-GP----AEA----IHQSPIEN---------LD-ILPCGP-LPANPA--EAL
A0A518KYW8      -----GEL-GP----AEA----IHQSPIEN---------LD-ILPCGP-LPANPA--EAL
A0A5C5YZZ0      -----GEI-EF----KDA----IVETDAEN---------LF-VLPSGP-KPNNPA--EAL
A0A518JLD2      LSKEIDDL-MI----NEA----IQDTVVPN---------LS-AMVAGN-PPDNPS--ELV
A0A5M6DJ15      -----ASA-NW----KEC----VRRQSQLR---------YY--MSAGS-VENVNL--AAA
A0A3L7P7S7      -----GDA-TL----QEA----IHTCAVPG---------LH-LMPCGP-RPANPS--ELL
A0A517N8M1      -----GEC-EA----MDA----CRQTPLRN---------LF-VMPSGA-IPANPA--EAL
A0A5C6CW01      -----GDC-DP----SEA----CHETPLST---------LQ-VMPSGP-IPANPA--EAL
A0A5C6BXS9      -----GTC-DH----VDA----IHDTPLAT---------LK-LMPSGP-IPANPA--EAL
M5U569          -----GHC-EH----IEA----IHDTPLAT---------LK-LMPSGP-IPANPA--EAL
L7CND7          -----GKC-EH----VDA----AHDTPLST---------LK-MMPSGP-IPANPA--EAL
A0A0J1B8S4      -----GKC-EH----VDA----AHDTPLST---------LK-MMPSGP-IPANPA--EAL
F2ARR3          -----GKC-EH----IDA----AHDTPLST---------LK-MMPSGP-IPANPA--EAL
K5D8H6          -----GKC-EH----VDA----AHDTPLST---------LK-MMPSGP-IPANPA--EAL
M2AKU0          -----GKC-EH----VDA----AHDTPLST---------LK-MMPSGP-IPANPA--EAL
A0A5B1CKI2      -----GDC-EV----SDG----CHSTPLNN---------LF-VMPSGP-VPANPA--EAL
A0A5C6EG84      -----CEC-EP----LDA----CHATPLRN---------LF-VMPSGA-IPANPA--EAL
A0A5C6F2X4      -----CEC-DA----LDA----CHVTPLRN---------LF-VMPSGA-IPANPA--EAL
A0A5C5XTV6      -----GTC-DH----GDA----IHDTPLAT---------LK-LMPSGP-IPANPA--EAL
A0A5C6AAB1      -----GKC-DH----IEA----IHDTPLAP---------LK-LMPSGP-IPANPA--EAL
M5T8W8          -----GHC-EH----IEA----IHQTPLAT---------LK-IMPSGP-IPANPA--EAL
M5SF00          -----GKC-EH----VDA----AHDTPLST---------LK-MMPSGP-IPANPA--EAL
A0A2G1WDS1      -----GKC-EH----VDA----AHDTPLST---------LK-MMPSGP-IPANPA--EAL
Q7UVS9          -----GKC-EH----VDA----AHDTPLST---------LK-MMPSGP-IPANPA--EAL
A0A5C6B601      -----GEM-SP----GAA----VHETPIEN---------LD-IMACGP-LPANPA--EAL
A0A517PFU1      -----DPD-KL----DEA----LVESGQPG---------LW-LLPCAA-RPDHPA--ELL
A0A5B9M8J9      -----GEL-PA----GRA----VHQTPIEN---------LD-ILPCGP-LPANPA--EAL
A0A2A2WFP6      -----GEL-SA----AQA----VHQTPIEN---------LD-ILPCGP-LPANPA--EAL
A0A518L8N2      -----GEL-SA----AQA----VHQTPIEN---------LD-ILPCGP-LPANPA--EAL
A0A518HQN9      -----GEL-GP----AEA----VHQSPIEN---------LD-ILPCGP-LPANPA--EAL
A0A5M6D8H8      -----GEM-DV----TEA----IHTTPIEN---------LD-ILPCGP-LPANPA--EAL
A0A5B1CRW9      -----GSM-PF----VDV----ISASEVPN---------LD-VMPNGS-PTAEPA--ELL
A0A5C6EI46      -----GRV-EF----ADG----VVETEVQN---------LH-IMPNGS-NTSEPA--ELL
A0A1G2ZG92      -----GGF-SL----DET----IVHTDVSG---------LD-LLTSGP-IPPDPS--SLI
A0A1G3A0W0      -----SRS-AD----KRH----IFPTDTFG---------LN-IMPAGK-HNDGAV--IEE
A0A2E7D3V4      -----GDI-EL----PNA----VKESGIEG---------LQ-ILTAGT-PVGSPA--ELL
A0A5B9PER9      -----GQS-HW----KDC----VFEVAEIEG--------MS-IMPCGS-KPSNPA--ELC
A0A517QSM4      -----GDK-PL----EGA----AQPTPTPG---------LS-VIPAGR-VDSAAL--QAL
A0A355GJI7      -----GEI-DA----QTA----IRETRVSH---------LS-ILTAGM-LPENPS--EML
A0A1Z8MCI4      -----QRS-EL----DDA----IVAVGK-----------LD-FLPAGR-LSAPPF--GIF
A0A517SYL7      -----QRS-EL----DDA----IVAVGK-----------LD-FLPAGR-LSAPPF--GIF
A0A3L7P0L2      -----SEV-DW----FNA----VRTTRLEN---------LS-VLTAGL-CPPNPA--ELL
A0A6M5YVJ1      -----GEI-GA----VAA----VRPTDVPG---------LS-VLTAGE-WTLVTR--QAL
A0A2E0SHG0      -----GEA-EI----PDA----IQETEVEN---------LT-ALPCGP-VPENPA--ELL
A0A518CQB8      -----GEA-EI----QDA----VQETEVKG---------LT-ALVCGP-VPDNPA--ELL
A0A517SCC8      -----SEI-EW----VNV----IKTTPFAT---------LS-VMTAGL-SPENPA--ELL
A0A3A0DR44      -----KEC-EI----TDA----IVEEVAEG---------VH-LLPAGR-VATSPH--NYL
A0A358MY60      -----GDA-NL----ADA----VDDTLGEL---------VH-VLPAGR-MTLSPH--RLL
A0A517MNB1      -----EDV-KL----EDA----VDKSLGDL---------VH-VLPAGL-MHQSPH--RLL
A0A142YJ13      -----GEI-GW----EGV----VRETEVRD---------LS-LILAGR-CNPEAI--ELL
A0A517Z7D3      -----GDV-DA----ETA----MQETAVEG---------LR-VLVAGA-PPANPA--EAL
A0A1N6KY57      -----DEI-EL----IDA----VQPTLISG---------LS-LLTAGF-SDSDSI--QTL
L0DK20          -----NEV-NI----ADA----IQPTAASG---------LS-LLTAGL-SDNETI--QAL
A0A3L7UX05      -----GQS-NI----DKC----LVRIGEGGG--------FH-LLPAGT-IHGDPS--RIL
A0A517XRC2      -----QEV-DP----SDA----VQPTAVPN---------LW-VIPAGQ-CSTRVI--AAL
A0A6M5YH47      -----QEV-DV----SDA----VQATAVPN---------LW-VITAGQ-CSNATI--AAL
A0A660UUK3      -----GK--SL----AES----VYELSPTG---------LH-ILAADR-RNCSDA--LDL
A0A517ZHG5      -----GTA-SL----EEA----IKSPSDDG---------PD-VLPAGQ-FNSQLL--AAL
A0A1Z8MPL5      -----GDV-AI----ENA----IRPSRMPG---------LR-FLSAGH-CDPTSL--QAL
A0A7C1EH96      -----G-I-DL----QKT----LYPVEGMP---------LF-VLASDD-RNIQDA--FEL
A0A5C1AGE3      -----SEL-DV----SDA----VQPTTVPN---------LW-VIPAGQ-CSNRVI--SAL
A0A2Z3HEL7      -----EEV-DV----SDA----VQATAVPN---------LW-VIPAGQ-CSNATI--AAL
A0A142XAP8      -----QEV-DV----SDA----VQATAVPN---------LW-VIPAGH-CSNATI--AAL
A0A6P2DEK1      -----QEV-DV----SDA----VQATAVPN---------LW-VIPAGH-CSNATI--AAL
A0A5C6C1R5      -----GNV-DW----KDA----VHATSPN----------AF-FMTAGS-SRPVNL--SAV
A6BZU4          -----GEI-DA----QTA----IRETRVTH---------LS-ILTAGM-LPENPS--EML
A0A2D5GZ77      -----GEI-DA----QTA----IRETRVTH---------LS-ILTAGM-LPENPS--EML
A0A3D3R1Z6      -----GEI-DA----QTA----IRETRVTH---------LS-ILTAGM-LPENPS--EML
A0A517XG00      -----GEI-DA----QTA----IRETRVTH---------LS-ILTAGM-LPENPS--EML
A0A1G2YRE4      -----G-T-EF----EQA----VSSIRSTG---------LN-VLAMHS-CHRVDA--YEL
A0A353Z859      -----GAA-KP----ADV----IQESTQPN---------LF-VIPAGI-LASESL--RNL
A0A2D6ST10      -----GES-SL----DDC----TREVAPEG---------LS-VIPAGK-IDHTVL--RLL
A0A177QX42      -----DGM-DL----PDA----VQTTLVPN---------LD-VMTVGP-RVDNPA--ELL
A0A517SHR0      -----DGM-DV----PDA----IQSTLVPN---------LD-VMTVGP-RVENPA--ELL
A0A2E0AW64      -----DHN-SL----GGY----VTKWDEH----------CH-VLPAGQ-LTSSPH--RLL
A0A351FZ59      -----DHN-SL----GGY----VTKWDEH----------CH-VLPAGQ-LTSSPH--RLL
A0A660V239      -----GK--EF----AKL----VYNTGAVG---------MD-VLAADR-RNVSDA--LDL
A0A177Q3B7      -----NEN-SL----EEV----LQATPLDH---------LT-LMAAGR-WNYQTS--QFL
A0A2E0X6Y6      -----ADG-EI----ADN----APRFVQKTVVER-----LD-VIPTGL-RRQNPA--ELL
A0A518GFD7      -----GST-KL----THA----IQETTTRN---------LH-VITAGG-ELCSVT--ECE
A0A5C5VZJ8      -----APS-PT----VTV----HSTDTPN----------LS-LVPVGR-IAKPED--AEL
A0A518GE37      -----GQS-KL----SDC----IDKSLGDL---------VH-VIPAGR-LHANPH--NLL
A0A5C6F3H8      -----GKT-TL----IEA----VDTSLGAL---------IH-VLPAGR-LTASPH--RLM
A0A5C5X072      -----DKS-TL----DDA----VDKSLGSL---------IH-VLPAGP-LSASPH--RLI
A0A5C5WUQ3      -----GEV-EF----EQA----IDSTLGHL---------IH-VMPAGP-LKANPH--RLI
A0A5C6E697      -----GTT-SL----SDA----VDTSLGER---------FH-LLPAGL-LKTSPH--RTI
A0A5C5Z1A3      -----GQT-TL----TEA----IDTSLGDL---------IH-VLPAGK-LTTSPH--RML
A0A5C6D2P7      -----GKA-KL----SDA----TDKSLGDL---------VH-LLPAGP-LSSSPH--RLI
A0A5B9ML17      -----NQA-TL----DEA----IQTELGDL---------IH-ILPAGR-LKASPH--RLM
A0A518HFS8      -----GEV-AL----DDA----VHATAASP---------LE-VLPAGC-CDAAAV--DAL
A0A5Q3LBQ3      -----YQC-DV----QDA----IVTDWGEG---------VH-LLPAGR-LHKSPH--KLL
A0A517LX75      -----GDG-DL----ESA----TVQTEVAG---------LD-FISHGH-HPSDPA--ELL
A0A7C5W7B3      -----NPD-IL----PEN----ILSATEITE--------LV-VVGAGG-VAHNPP--RLL
A0A2S8F9B8      -----NHV-KL----DEA----IQPTNIPN---------VD-LIPAGS-SEQSIP--RSA
A0A354GX32      -----GEV-EP----GQV----VQNTPLEN---------LS-LLAAGA-CDHQAL--QAL
A0A142XL75      -----GST-SV----LEA----VRPTGIPG---------LS-ALTAGQ-WTLATR--HAL
A0A6P2D5D5      -----GSA-SI----AEA----VRPTGIPG---------LS-ALTAGQ-WTLATR--HAI
A0A5C1AAF0      -----DEV-LD----RDV----IREVRAN----------LF-FIPAGA-CDDASL--CAL
A0A7C7T8W8      -----GTA-TL----DET----IVQWDDF----------VS-VLPAGE-LTRNPN--ALL
A0A5C6B3S0      -----GRA-DV----ISV----IQPTGIEN---------LS-LVAAGR-RNESTL--GQL
A0A368KP63      -----GQA-EL----ADV----VKATDIPN---------VS-FLPAGV-EEQSIS--RGA
A0A518GIZ9      -----GEI-AL----ENA----IVETVVEG---------LT-ILPSGR-PPHNPA--ELL
A0A1C3EBY9      -----GEI-AL----ENA----IVETVVEG---------LT-ILPSGR-PPHNPA--ELL
D5SX64          -----GEI-AL----ENA----IVETVVEG---------LT-ILPSGR-PPHNPA--ELL
A0A517Z0U7      -----QEV-PL----EEA----IKQGSPDG---------LS-ILPAGK-VDQTVL--RLL
A0A2S8FCC0      -----GEV-EF----DDA----IQQTGIGT---------LD-IVAAGD-WGHNSL--REL
A0A1Z8MBT6      -----EKS-TL----DDA----INRELGDL---------IH-ILPAGR-LKASPH--RIL
A0A517SXN9      -----EKS-TL----DDA----INRELGDL---------IH-ILPAGR-LKSSPH--RIL
A0A518HFL0      -----GDA-QL----EDA----LVPISQVGG--------CQ-LLPAGS-PEPNPN--RIL
A0A3B8ZJM2      -----GQC-EL----DDA----TYTTCVAN---------LS-IMPGGK-RPNNPA--ELL
A0A1U7CLW1      -----GEI-GW----TDA----VRQTPVPG---------LS-LIFAGR-CDPATI--DLL
A0A142WPR7      -----GTA-EL----VDA----IQDTPVEN---------LA-VLGCGP-RPDNPA--ELL
A0A3M1TFJ0      -----EGE-GL----EFL----Q-STDVEN---------LY-LLPAGQ-GEENAA--NLL
A0A517P477      -----GEK-SA----EEV----EIPLHGSE---------LR-LIPAGD-VCDTAL--AGF
A0A517T4K9      -----GDI-DA----EDA----ITSPNADA---------PF-ILPAGK-FDRTVL--RQL
A0A7C6B2Q1      -----AEI-SL----QDA----IQATSIEN---------LY-VLSAGY-WSPHRL--AVL
A0A7C4QPD3      -----GSI-SL----ADA----IHPSPLAE---------LD-LLPAGS-LDDNVR--GLL
A0A2Z3GZZ5      -----GVR-PL----ADG----IVASGAPG---------LD-LLPCGP-RPANPA--ELL
A0A4V0I6L6      -----DRA-DL----GDA----IRACEVEN---------LS-LLPCGP-IPANPA--ELL
A0A7C4QQT3      -----GEI-AP----LNA----IQQTAIEH---------LA-LLTAGQ-VPANPA--ELL
A0A255QXF5      -----EVV-PF----EQA----INKELGDL---------VH-VLPAGR-LKASPH--RLL
A0A518KBI5      -----GKL-SL----NEA----IQPVPATEH--------LF-VLRAGS-CAGAPH--HLA
A0A5C5V6Q5      -----SRC-SI----SDA----IRPAKGTDN--------LY-VLRAGD-CDDSPH--RVA
A0A517MY49      -----SDE-PI----AEQ----VGNYLHHTEVPG-----LD-VVPAGI-RRTNPA--ELL
A0A2E6AG00      -----SDV-DV----RDR----AASLICKTSCEC-----LH-VLPSGS-RPLDPT--GLL
A0A1G3A880      -----GDG-EV----ARL----AAQCVCRSAVAG-----LD-VLGSGP-RRPNPS--ELL
A0A2E8ATT1      -----GEG-AV----GEI----CERLVQSADVPH-----LD-ILPCGP-RPADPV--ELL
A0A7C2JZW2      -----GRV-TL----DQA----ICHTELQE---------LD-LLLAGQ-LTDKVR--GML
A0A518KYQ0      -----KAV-PL----KEA----INRELGDL---------VH-VLPAGH-LKASPH--RLI
A0A5B9QX47      -----EEA-TL----KDA----VDTSLGDL---------IH-VLPAGH-LTSSPH--RLI
M5T666          -----KES-QL----VDA----VDSSLGNL---------IH-LLPAGR-LNASPH--RLI
M5U6N6          -----KQT-EL----KDV----VDTSLGNL---------IH-LLPAGR-LSASPH--RLI
A0A517M0G2      -----GDI-EL----KDA----VDTSLGEL---------VH-VLPAGK-MHQSPH--RLV
A0A5C6AST1      -----GEA-TF----DEA----VDRTLGDL---------VH-VMPAGH-MNMSPH--RLL
A0A5C6C951      -----GEV-DF----DNA----IDRSLGDL---------VH-VMPAGQ-LDMSPH--RLL
A0A5C6C5T3      -----GKS-TL----DGA----VNSSLGRL---------IH-ILPAGQ-LSASPH--RLV
A0A2A2W6A9      -----KAA-PL----KEA----INRELGDL---------VH-VLPAGR-LKASPH--RLI
A0A518HQS9      -----KVV-PM----KEA----INRELGDL---------VH-VLPAGH-LKASPH--RLV
A0A5M6DFE6      -----NEV-KF----EDA----VRTELGDL---------IH-VLPAGR-LKASPH--RLM
A0A5C6F286      -----GKA-TL----AEA----VDTSLGGL---------IH-VLPAGR-LTASPH--RLV
A0A517NGN1      -----GRV-EL----KDA----INRSLGNL---------VH-VLPAGR-LDASPH--RLI
M5RUI3          -----QTA-TL----EEA----VDTSLGSL---------LH-VLPAGR-LDRSPH--RLI
A0A660VT66      -----GKA-SL----DEA----IRPTAVPL---------LD-IIPSGF-VPPLPS--ELL
A0A7C2VEF7      -----GTI-AL----QDA----IQAGPIEE---------LD-ILSCGP-EVPNPS--EIL
A0A0S8H0S8      -----GTA-GL----QDA----IRFSGVER---------LD-VLPCGA-APDRPA--EML
A0A7C2ZTD2      -----GSR-GL----QDM----LFGKEFDRAVCSIPSIGLD-VLAADSRNADDAY--DLL
A0A2E3Z6T8      -----SPE-TP----AQSAPPLIHSTIVKD---------LD-VLPAGL-RRPNPA--ELL
A0A257WQ92      -----GEI-QG----LNA----LRPTFVEN---------LQ-VLPAGQ-PPANPA--ELI
A0A7C1U6X6      -----ARS---------VDQRYIFATETPG---------LS-ILPGGI-PNGDGSVFEGT
A0A7C7UXI5      -----HEA-PV----PDVVSEHIRPDVLPN---------LD-VLPAGP-RPTNPA--ELL
A0A7C3SFJ0      -----NEA-RL----EDV----IRPTRVPG---------VW-LLPAGR-WDISAI--QAL
A0A7C7WWF7      -----SEE-PI----DNACKSRIQETAVTG---------MH-VFPCGP-KPADPA--ELL
A0A356ETW1      -----SNA-HV----ADLCVALIQPTGIER---------LD-VLPSGP-RPANPA--ELL
A0A3L7NJY1      -----STD-NL----ETSISQNLRVTVVEG---------LD-VISCGP-RPVNPA--ELL
A0A523CME0      -----EDL-DL----EEC----SATGLMPG---------LT-VIPAGN-RQANVC--ELL
A0A354PCV3      -----GTT-PL----LDA----VNTSLGHL---------IH-LLPAGE-LTASPH--RLM
A0A354PHB4      -----GKT-PL----LDA----VNTSLGHL---------IH-LLPAGE-LTASPH--RLM
A0A356ESF4      -----GNG-KVGAAAAAV----IRPSGIAG---------LD-MLPSGP-RFANPA--ELL
A0A538RV31      -----GDV-DL----SEV----IRPTPAKN---------LW-VVPAGQ-CDVHTL--EAL
                                                           .                

M5S2L2          TLP-EMGELIEL-LRDEFD--YLILDTPPLLVVTDP-SITA--SMVDGVLLALRVRRKSK
A0A2Z3GYP4      TTP-AFEDVLDD-LRAAYD--YVLVDSPPLLAVSDP-CVVA--PRVDGLVLTIRVTKNGR
A0A7C2VXA0      NSV-LFGGMLQE-LAQTYD--RVIIDSPPVGLVADS-QILA--ATCDIVLLVLRAEKSTR
A0A7C3AA48      NSE-TFTDMMAK-LSTRYD--RVVVDAPPVLPVTDA-CILG--ALCDVTLLVLRADKSTR
A0A3L7SU85      TSP-RFSEVIEE-LRKLYD--IVMVDTPPILAVSDP-SIVA--PRVDGVLMVMRVTRNGR
A0A3M1RAJ8      ARS-DPERLFEV-LRREFD--FVVVDTSPLLTAADS-LAVG--RFMDGVLLSVIRDNSRL
A0A2D6A9B6      ASR-RVDELLGQ-LKEQYN--YVLLDTPPIVPISDA-GILS--AKSDGTLVVVALERAAR
A0A2G6JGH3      SSR-RIDELIAR-LKEEYS--LIILDTPPAIPLTDA-GVLS--AKCDGTILVVGLERAPR
A0A7C5PFV3      SSG-KVEELLST-LKEEYN--YVLIDSPPALPFTDA-GILS--AKADGTLLVVKLEVSSK
A0A7C3QGD2      RSE-RFRALLPE-LRERFD--FLFVDLPPVRSAADG-LHVV--GLADAVLLVLAAGETRK
A0A3D4PLL5      TSE-RFEELIGW-AEGVYD--QILIDAPPSLAVTDP-AIIG--RLVDGIILTVRPDRNKR
M5RD30          ESF-RLSGLLRS-CEQRFD--IVLVDAPPLLAVADP-AIIA--PQVDGVLMTVRVLKNNR
A0A1V6CUG1      GRP-ELMEIVGE-LRRKYD--YVLFDTPPINVVSDA-GILS--KAANEALLVVRMHRTHR
A0A3M1SE88      SGS-RLAELLAW-VENVYD--QVVIDSPPVLAAGDT-AILG--RLADGVLLVVQPEKNRR
A0A7C2ZUK5      SSE-RMADLLNE-AVNGYVDGFILLDCPPFQAVSES-AVLA--QLVDKVVLVVRWGKAGR
A0A660WB30      NSE-KMRHLIME-VKSRYPDRYIVVDSPPVLSTPEP-DVLG--SQVDGIVLVVRAGMTPR
A0A660W9Z7      ETP-AMKKVIAD-VREMFD--FVLIDTSPTLSTTDP-MVLG--AMCDAVIIVVKAGSTQR
A0A3M1R9K7      ANG-VVGGLFRS-LREQYD--FVIVDGSPVLPVADT-RFVS--MHVDGVVMSVLRDVSRM
A0A3L7PH51      SSE-RFSDIIAW-AEQIYD--QILIDAPPVLAVTDP-SIIG--RIVDGAIVIVRPDKNRR
A0A3N5UQY5      NSP-QFAKLLAY-LGRAYD--RIIVDAPPVTAVTDA-QILG--ALCDFTILVLRADRSTR
A0A7C2JY73      TSS-GFAQTLAE-ARREFD--LVFVDGPPLLAVSDP-CIIG--QQTDGLLLVLRLGKTSL
A0A356AE44      SSS-KLHYLLGQ-AKREYD--FVLVDSPPVLAVSDP-CITA--QSVDTVMLIVRLHKNRR
A0A1G2XSU7      IHHKNMVEFINE-ISRIFD--HVIIDTPPVLAAVDA-LLWA--SMVDGVILTSLAGHTET
A0A350KD81      MSR-GFSELVKQ-LRNEYD--YILIDTPPLVVVSDP-SVIA--SIVDGVLLVVRIDKNRR
A0A2D6SRY7      ASE-RTRTLIRE-LSDNFD--LVLVDSPPALPLTDA-SVLS--TEVNGVFLVVRAGMASL
A0A1G3C300      GSH-SMEKFCDN-VRNRFD--IIIFDTPPTMTVTDA-VVLS--RNVDGVVFVIKSGQTPK
A0A524HC32      ASK-RFQILLQG-LSSRYD--RVILDGPPYLGFADV-LVLS--KQVDGIVLVSSMGETSR
A0A177PV03      TSP-AFEQLLAD-LRKEYD--FVLVDTPPLLAVSDP-SAVA--PRVDGVLLVVRFSKNAR
A0A1G2YIM0      TRS-QTPSRLKA-IAAHYE--HVIIDTPPVLAVPDA-IIWA--KMADAVVLASYAGHTQG
A0A7D8YCU5      MLP-EFGQIIDE-LRMEYD--LIVIDSPPMLACTDAGTISS--TIADGVLFVMRIQRNIK
A0A353BE27      SSE-RFRNMIDM-LRDKFD--VIVVDTPPLLAVSDP-GAVA--GIVDGVLMTMRLRRNVK
A0A5C6BPW1      AQD-GLGKIFEE-LKKKYE--FVVVDSSPVLPVTDS-LMVA--QHVDAVILSIRRDVSRR
A0A1I3GSP0      STG-TLQVMLRR-AREEYD--VVLLDSPPILAVSDP-CIIS--PHADGLLLVVRMKKTKR
A0A517QJV1      SQV-NLPALLNE-MRSEYD--FIILDSPPVLAVSDP-AILS--PHVDGISLVARLKKNKR
A0A3C1QS25      TSP-KLPEFIEI-ARQQYD--YVIIDSPPLLAVTDP-SVIA--PRVDAVVLTFRLRKNIK
A0A5C6FX55      TLP-EMAETLEQ-LREHYD--YVLVDTPPLLVVTDP-SILA--SMVDGVLLTLRVRRKSK
A0A5C6DS51      QSN-RMGLLLQS-ARNQYD--IVLVDAPPVLAVADP-AIVA--PLVDGVILTVRVCKNGR
A0A5C6DSL6      QSN-KMSLLIQA-ARKEYD--IVLIDAPPVLAVADP-AIVA--PLVDGVILTVRVCKNGR
A0A3M1VG27      SSH-AFRHLLQT-LRVEYD--LVVVDSAPVLAVTDP-CVVA--SLTDVVLFVVRLNKSRH
A0A518GC22      SSQ-RFKNMVDV-LRDKFD--MIVIDTPPLLAVSDP-GAVA--GIVDGVLMTMRLRRNVK
A0A3L7Q373      SSL-RLGETLRA-IRGDYD--IVIIDTPPILAVSDP-AIIA--PLVDGLLLVVRMGKNKR
A0A3E0PW54      TAS-DLDGLLRA-AREEYD--VVIVDTPPVLAVSDP-SIVA--PHADGVVLIVRMEKNKR
A0A7C3TAH2      SST-DLAHKVDL-FGKQYD--HIIIDTPPVLAFPDA-LIWT--RMAGAVVIVSRIGKTAT
A0A1Z8MHR4      ALA-EVAEVFRW-ARENYD--YVIVDTPPLLMVSDP-AVVT--TYVDSTILVMRIRRRCR
A0A5C6EHJ0      SSP-NFDRLLSV-LRTKFD--MIIVDTPPLLAVSDP-ANLA--SRVDGVLLVVRLRKNIK
A0A5C6F1H9      SSP-NFDRLLNL-LRKQYD--MIIVDTPPLLAVSDP-ANLA--SRVDGVILVVRLRKNIK
A0A255QXY0      TMP-DLVEIIAW-ARDRYD--CIIVDTPPLLMVSDP-SIVA--SYVDAAIMVMRIAHRCK
A0A517SYI0      ALA-EVAEVFRW-ARENYD--YVIVDTPPLLMVSDP-AVVT--TYVDSTILVMRIRRRCR
A0A518HX54      TLA-ELADVFQW-ARANYD--FIIVDTPPLLMVSDP-TIVT--TYVDAAILVMRIRRRCK
A0A5B9MF59      TLA-ELAEVFQW-AREHYD--FVIVDTPPLLMVSDP-AVVT--TYVDASMLVMRIRRRCK
A0A2A2WC24      TLA-ELAEVFQW-ARENYD--FVIVDTPPLLMVSDP-AVVT--TYVDAAMLVMRIRRRCK
A0A518KYW8      TLA-ELAEVFQW-ARENYD--FVIVDTPPLLMVSDP-AVVT--TYVDAAMLVMRIRRRCK
A0A5C5YZZ0      MLP-EFGQILDE-ARMQFD--LIIVDTPPLLSVTDA-SNVA--THMDGVMVVMRIGRNIK
A0A518JLD2      TSE-AFEQILSA-LRVKFD--LIIIDTPPMLAVSDP-SNVV--RRADGVILVARLRKNVK
A0A5M6DJ15      AQE-SIPRLFDE-LRIHFD--FVIVDTPPILPVVDT-RVIG--EHVDGCVLAVMRDRSRT
A0A3L7P7S7      TSP-KFVEVIDE-LRKMYD--IVLIDTPPILAVSDP-SIVA--PRVDGVLLVMRITRNGR
A0A517N8M1      TLP-DMQNMIEM-LREKFD--YVMLDTPPLLVVTDP-SITA--SLVDGVIVALRIRRKSR
A0A5C6CW01      TLP-EMGELIEL-LREDYD--YVILDTPPLLVVTDP-SITA--GMADGVIMALRIRRKSK
A0A5C6BXS9      SLP-EMSELLDL-LRYEFD--YIVLDTPPLLVVTDP-SILA--SMVDGVVLALKIRRKSK
M5U569          TLS-EMGELLEL-LRDEFD--YIIVDTPPLLVVTDP-SILA--SMVDVVVMTLKIRRKSK
L7CND7          TLP-EMSELLDV-LREEYD--YIILDTPPLLVVTDP-SITA--SMTDGVVMALKVRRKSK
A0A0J1B8S4      TLP-EMSELLDV-LREEYD--YIILDTPPLLVVTDP-SITA--SMTDGVVMALKVRRKSK
F2ARR3          TLP-EMSELLDV-LREEYD--YIILDTPPLLVVTDP-SITA--SMTDGVVMALKVRRKSR
K5D8H6          TLP-EMSELLDV-LREEYD--YIILDTPPLLVVTDP-SITA--SMTDGVVMALKVRRKSR
M2AKU0          TLP-EMSELLDV-LREEYD--YIILDTPPLLVVTDP-SITA--SMTDGVVMALKVRRKSR
A0A5B1CKI2      TLP-EMGSMLEV-LKQKFD--YIIVDTPPLLVVTDP-SIIA--SLVDGVVMALRVRRKSR
A0A5C6EG84      TLP-EMGNMMEM-LREKFD--YILLDTPPLLVVTDP-SITA--SLVDGVVVALRIRRKSR
A0A5C6F2X4      TLP-EMSNMMEM-LREKYD--YILLDTPPLLVVTDP-SITA--SMVDGVVVALRIRRKSR
A0A5C5XTV6      SLP-EMSELLDM-LREEFD--YIVLDTPPLLVVTDP-SILA--SMVDGVVVALKIRRKSK
A0A5C6AAB1      SLP-EMSELLEL-LREEYD--YIVLDTPPLLVVTDP-SILA--SMVDGVVMALKIRRKSK
M5T8W8          TLT-EMGELLEL-LRDEFD--YIIVDTPPLLVVTDP-SIMA--SLVDAVVMTLKIRRKSK
M5SF00          TLP-EMSELLDV-LREEYD--YIILDTPPLLVVTDP-SITA--SMTDGVVMALKVRRKSK
A0A2G1WDS1      TLP-EMSELLDV-LREEYD--YIILDTPPLLVVTDP-SITA--SMTDGVVMALKVRRKSK
Q7UVS9          TLP-EMSELLDV-LREEYD--YIILDTPPLLVVTDP-SITA--SMTDGVVMALKVRRKSK
A0A5C6B601      TIA-ELSDVFDW-ARANYD--FVIVDTPPLLMVSDP-AVVT--TYVDAAMLVMRIRRRCK
A0A517PFU1      SSE-AYETFLDV-LRQKFD--FILLDSPPVLAVSDP-AATA--RLADGVVVVTRLHPRTR
A0A5B9M8J9      TLA-ELADVFQW-ARENYD--FIIVDTPPLLMVSDP-AIVT--TYVDAALLVIRIRRRCR
A0A2A2WFP6      TLA-ELADVFQW-ARANYD--FIIVDTPPLLMVSDP-TVVT--TYVDAAILVMRIQRRCK
A0A518L8N2      TLA-ELADVFQW-ARANYD--FIIVDTPPLLMVSDP-TIVT--TYVDAAILVMRIQRRCK
A0A518HQN9      TLA-ELAEVFQW-ARDNYD--FVIVDTPPLLMVSDP-AVVT--TYVDAAMLVMRIRRRCK
A0A5M6D8H8      TLA-ELGEVLAW-ARKHYD--FVIVDTPPLLMVSDP-AVVT--SYVDAAMLVLRIRRRCK
A0A5B1CRW9      ESH-QLMRLFQH-ACDSYD--LVLVDAPPVLAVADP-AIIA--PFVDSVLLTVRVIKNGR
A0A5C6EI46      ESH-RLMRLFQN-ACESYD--LVMIDAPPVLAVADP-AIIA--PYVDSVLLTVRVTKNGR
A0A1G2ZG92      ESQ-KLRDIVNK-LKEMYD--MVIIDTPPVMAVNDA-TVVG--RIADGILLVIESGRATF
A0A1G3A0W0      TANGAFKACMSQ-LRQWYD--FILLDSTPILPVADA-MILS--SQVDGTIMVERELVSQR
A0A2E7D3V4      SSA-RMASTIEA-AKAEYD--FVLVDTPPLLAVSDP-CIVA--PYTDGLLMVVCVGKNKR
A0A5B9PER9      SSP-QVKDLIDE-MRTEYD--FVIIDTPPLLAVTDA-CPIA--ARVDGVVLCIRIKKNVR
A0A517QSM4      AEG-GAGQIFKH-LTEDYD--YVIVDSAPILPVADT-LLLA--QDVDGVILTIRRDVSRL
A0A355GJI7      MSR-AFSELVNQ-LRKEYD--YVLIDTPPLVVVSDP-SVIA--SIVDGVLLVVRIDKNRR
A0A1Z8MCI4      SEG-NVSGFIDS-LREHYD--LILVDTSPLNLTPET-MLVA--ESFDHAIVSFMRDKSRA
A0A517SYL7      SEG-NVSGFIDS-LREHYD--LILVDTSPLNLTPET-MLVA--ESFDHAIVSFMRDKSRA
A0A3L7P0L2      SSS-RLPDMLNA-AKKSYD--VIIIDTPPILAVSDP-AIVS--PHIDGLIMVVRMGKNKR
A0A6M5YVJ1      VGN-GWRAVKEQ-LRAAFD--FVVVDTSPLLLVSDA-LLLA--READGVVVSVLMGVSQV
A0A2E0SHG0      NQE-SFSRLLAV-VREQYD--FVVIDSPPLLVVSDA-TAVA--PRADVVILNLRFKKNGR
A0A518CQB8      NQE-SFTSLLAV-VREQYD--YVIIDSPPLLVVSDA-TAIA--PRVDSVILNLRFKKNGR
A0A517SCC8      SGS-GFGALMRQ-VRDEYD--IVLIDSPPVLAVTDP-CVIA--PQTDAMVLVVRMEKNKR
A0A3A0DR44      GNG-AIPKLVAQ-LREVYD--FVVIDTPPILCASES-LVIA--KAADGTLLCALRDVSRS
A0A358MY60      SSE-GMRTLLDE-ALQNYK--YVIVDTAPVLSAGET-LAVA--AQTDATLVCVMRDVSRS
A0A517MNB1      NSS-AIRDLLDQ-ALAKYR--YVVIDTAPVLAAGET-LAIA--AETDATLVCMMRDLSRT
A0A142YJ13      PRQ-PLPDLIIA-LREQYE--FIIVDSSPVLLVTDT-LIIS--QHIDAVLFSVLRDVSQL
A0A517Z7D3      SSA-RLGRTLHE-LRGECD--YIIVDTPPILAVSDP-CIIS--PHCDGMLLVIRADKNQR
A0A1N6KY57      ASR-DLRAMFDQ-LKEQFD--FLVIDSSPVLPVADA-LLIG--QHVDAVIFSIMRDVSRI
L0DK20          ACR-DLRVMFDQ-LKEHYD--FIVVDSSPVLPVADA-LLIG--QHVDAVLFSIMRDVSRI
A0A3L7UX05      ESA-KLGKIMAH-LRENFQ--VVIVDSAPVLPVPDA-LLFG--RWVQGIVIAVRYDTSRF
A0A517XRC2      AQGHPLETLFNR-LRGQFD--FVVVDSCPVLPVADA-LLIG--QHVDGVVFSIMQDISQL
A0A6M5YH47      AQGHPMETLFNR-LRGQFD--FIIVDSCPVLPVADA-LLIA--QHVDGVVFSIMQDVSQL
A0A660UUK3      LRQTHTVDCMKN-IRNEYD--HVIIDTPPVLASADP-LVWA--KMADAVIMACFAEHTSR
A0A517ZHG5      AQD-GLGKIFEE-LKKKYE--FVVVDSSPVLPVTDS-LMVA--QHVDAVILSIRRDVSRR
A0A1Z8MPL5      TKK-NLSEIFEK-LVDEFE--YIVVDSAPVLSVVDS-LLIG--QQCDAAILSILRDKSRI
A0A7C1EH96      LSLPDTAARMRK-LRDEFD--YIIIDTPPALAFADA-MVWA--KMADGVIMTSFVGHTSQ
A0A5C1AGE3      AQGHQLESLFNR-LRGQFD--FIVVDSCPVLPVADT-LLIG--QHVDGVLISILQDISQL
A0A2Z3HEL7      AQGHPLETLFNR-LRGQFD--FVIVDSCPVLPVADA-LLIA--QHVDGVVFSIMQDISQL
A0A142XAP8      AQGNPLKTLFNR-LRGQFD--FVIVDSCPVLPVADA-LLIA--QHVDGVVFSIMQDVSQL
A0A6P2DEK1      AQGNPLKTLFNR-LRGQFD--FVIVDSCPVLPVADA-LLIA--QHVDGVVFSIMQDVSQL
A0A5C6C1R5      GAK-TLPQLFSE-LRAEYD--FVIVDTPPVLPVVDT-RVIG--EHVDAAVLSVMKDKSRI
A6BZU4          MSR-GFSELVKQ-LRNEYD--YILIDTPPLVVVSDP-SVIA--SIVDGVLLVVRIDKNRR
A0A2D5GZ77      MSR-GFSELVKQ-LRNEYD--YILIDTPPLVVVSDP-SVIA--SIVDGVLLVVRIDKNRR
A0A3D3R1Z6      MSR-GFSELVKQ-LRNEYD--YILIDTPPLVVVSDP-SVIA--SIVDGVLLVVRIDKNRR
A0A517XG00      MSR-GFSELVKQ-LRNEYD--YILIDTPPLVVVSDP-SVIA--SIVDGVLLVVRIDKNRR
A0A1G2YRE4      VASPETANIINK-LSPKYD--YIIIDSPPVLLFPDA-LMWA--KIAGSVMLTSFAGQTTT
A0A353Z859      AQD-GLGALMEH-LRAEFD--FVIVDSSPLLQVTDP-LLAA--QSVDGVIVSIRRDVSQM
A0A2D6ST10      AED-AVGELFEN-VKKQYD--FVIIDSAPVLFVTDS-LLIA--QHVDGVLFAVRRDISRA
A0A177QX42      LSP-QFTELVQQ-LREKYD--FVLIDTPPILIVTDP-AAVA--AHVDGVILVVRNTKRSR
A0A517SHR0      LSP-EFTVLVQQ-LREKYD--FVLMDTPPILIVTDP-AAVA--AHVDGVILVVRNTKRCR
A0A2E0AW64      ANG-AFSGMLKE-ARATYK--HIVIDTPPILAAGES-MVMA--KAADATILCAKRDVTRM
A0A351FZ59      ANG-AFSGMLKE-ARATYK--HIVIDTPPILAAGES-MVMA--KAADATILCAKRDVTRM
A0A660V239      LGKPRTGECIEQ-VSADYD--HVIIDTPPVLAFSDA-LLWA--RMADGVILTSFVDRTSR
A0A177Q3B7      ARE-RMPDILAA-LRQQYE--YIVIDSAPVLPLVDS-LLLA--QHVDGVVLSVLRRVSQL
A0A2E0X6Y6      GSV-RFAELLAW-AEANYD--QVLVDCPPVLAVSDA-QVVG--RLVDGAVIVVRPDKNHR
A0A518GFD7      SDG-SLAALLNK-LRSHYD--LVIIDTPPVLPVIDA-RVIG--KYTDGVIFTLVRDRSRL
A0A5C5VZJ8      FANGAFGRLLEA-WKKAYD--VVLVDSAPLLMASES-VMLA--QRVDGTIMVIREQHCRR
A0A518GE37      TKS-KMEKLFAD-LESEYR--YIVVDTAPVLPASET-LAAT--SACDATLLCAMRDISRT
A0A5C6F3H8      SPS-GMKDFVDH-ALSHYS--YVVMDTAPVLSAGET-LAVA--SAVDASLICVMRDVSRI
A0A5C5X072      SPK-KFETFVKE-ALEVYQ--YVVIDTAPVLAAGES-LAIA--SAVDSTLICVMRDVSLK
A0A5C5WUQ3      NQA-SMKKFLDQ-ALESYS--FVVFDTAPVLAAGET-LAVV--SVVESTLVCVMRDVSRL
A0A5C6E697      GPE-AFNRFMNE-ACKRYR--YVVIDTAPVLSAAET-LTVG--AAADATLLCVMRDVSRQ
A0A5C5Z1A3      NPK-AMKAFISD-AMEKYT--YVVVDTSPVLSAGET-LAIA--SAVESTLMCMMRDVSRM
A0A5C6D2P7      NPD-TMRAFISQ-ALKQYK--FVVVDTAPVLSAGES-LAVA--ASVDSTLLCVMRDLSRV
A0A5B9ML17      SPE-SMKSLVSD-ILDRYE--YVIFDTAPVLSAGET-LSVA--ASVDTTLVCAMRDVTRM
A0A518HFS8      ARE-EFPRLIQD-LRGRYE--FIIVDSAPALIVTDT-LMLS--QHVDAALLSVLRLVSRA
A0A5Q3LBQ3      GNA-SFATILKN-LSRIYR--YIIIDCPPILPASEA-MVIA--KAADATLVCAKRDLSRV
A0A517LX75      ESF-GMERLIAE-ARQEYD--YVFIDTPPLLAVADP-LIIA--AQVDSALLVVRVQKNGR
A0A7C5W7B3      RSE-AFANLLKM-LQEQFD--VVILDTPPVIAVVDA-GVIA--EQVRGVLVVARWGITRN
A0A2S8F9B8      TSG-RLAELYRE-LRSLYD--FVIVDAGPVLGAPST-RLLAQPQYADGVILSIFKDVSQV
A0A354GX32      AQEGILRNVFDE-LKEQYD--FLIVDVSPILPVADA-LLIG--EHADAVLLSVLRNVSRL
A0A142XL75      VGD-RWRETKDQ-LKAEFD--FVVVDTSPLLLVSDT-LLLA--READGVVVSVLMGVSQV
A0A6P2D5D5      VGD-RWRVTKDE-LKSNFD--FVIVDTSPLLLVSDT-LLLA--READGVVVSVLMGVSQI
A0A5C1AAF0      ARG-VLAADFRR-FLSDYE--VVIIDSSPLMLVADA-LHFA--KRADGVILTVRNDYSRV
A0A7C7T8W8      TYE-SLTALLEK-VRDDYS--YILIDCPPLLAATEA-YVIA--RASDGVLLCCMRDVSRT
A0A5C6B3S0      AGD-EIENVFQT-LRAGFD--FIVVDGSPVLPVVDA-RLIG--QHVDSVVLSVLRDVSCA
A0A368KP63      TSG-VLDAILGD-LRKRYD--FVIVDAGPVLGSPST-RLLAQPQYVDGVILSVFKDVSQV
A0A518GIZ9      EGG-PLRQLIAK-ARTFAD--IVLIDAPPVLAVSDA-CIIG--QHVDGYLLTVRLGKNRR
A0A1C3EBY9      EGG-PLRQLMAK-ARTLAD--IVLIDAPPVLAVSDA-CIIG--QHVDGYLLTVRLGKNRR
D5SX64          EGG-PLRQLIAK-ARTLAD--IVLIDAPPVLAVSDA-CIIG--QHVDGYLLTVRLGKNRR
A0A517Z0U7      AQD-ELGNLFKE-LAAEYD--FIIIDSAPVLPVTDS-LLIA--QHVDAVMFSVRRDVSRA
A0A2S8FCC0      TSD-RMDSFFKS-LRSQYD--YVIVDGSPILPVVDA-RLIG--QYVDGVVMAVLRDVSRG
A0A1Z8MBT6      TTE-AVQGLIAR-CMEEYE--YVIFDSAPILAAGET-LAIA--AVVDSTLMCVMRDVTRT
A0A517SXN9      TTE-AVQDLIAQ-CMEEYE--YVIFDSAPILAAGET-LAIA--AVVDSTLMCVMRDVTRT
A0A518HFL0      RGK-NFAPMLER-LRRSFD--VVIIDTSPVLPVPDA-LILG--RLADGAVIATRHDQSRF
A0A3B8ZJM2      SSS-RFAELIEI-VREKYD--IVIIDTPPLLAVSDP-SVVA--SVVDGVVICMRLRRNVK
A0A1U7CLW1      PRE-DFPNLLQE-LRDQFD--FIIVDSSPLLLVTDA-LIVS--QHVDAVLLSVLRAVSQL
A0A142WPR7      TGK-RFDELLGV-LREQYD--FVIIDTPPLLAVTDP-SAVA--PRVDAVIVTLRIAKRTR
A0A3M1TFJ0      GSGEAFARLIGG-LRQRFD--RIVIDTPPVAAFSDG-VLMA--VAADAVVLVVSARTSRR
A0A517P477      GTA-AMAECLDD-LRARYD--IVIVDSPPALPVSDG-LMLA--EHVDGVMFAVRRGVTRL
A0A517T4K9      SMG-KAEQIVES-LRGQYD--LIILDSSPILPVTDT-LLLA--PAADGVVFSIRRDVSRV
A0A7C6B2Q1      TNG-VLGAMFRQ-LREDFN--FVIVDGTPVLPVADT-RFIS--THCDGVVLSVIRDYSRA
A0A7C4QPD3      ARG-AQAQLLQS-VQERYN--FVVIDSSPVLVAPEA-LMIA--RHVDGVILIVRRDVTQL
A0A2Z3GZZ5      GSP-QFQRVLAE-LRERYE--FVIVDSPPLMAVADP-AIVA--PQADGVLVVFRMTKTAR
A0A4V0I6L6      TSP-RFQDVLSD-LRASYD--FVLLDTPPVLAVSDP-AAVA--PRADGVIIVFRMTPAAG
A0A7C4QQT3      ASP-QLTELFRD-VRDDYD--LIFVDTPPLLAVSDP-CIIA--RQTDGLLLVVRLGKNTV
A0A255QXF5      STS-SMRDLLDQ-ALEKYE--YVIVDTAPVLSAGES-LAVA--SAVDSTLVCVMRDLTRM
A0A518KBI5      QPQ-RLQKLVEA-LRGDFR--TIVIDTPPVLGASEA-LSLC--RSADMTVVCARRGVSRI
A0A5C5V6Q5      QPA-RIAALVSR-LRNEFS--TVVIDTPPVLGASEA-LSFC--RSADMTAMCTLRGKSRG
A0A517MY49      STD-QFVELLAW-ADSQYD--QVLVDCPPVLAVSDA-QIVG--RHVDAAILVVRPEKNPR
A0A2E6AG00      ASN-QFGELLAW-AEARYD--QILIDCPPTLVASDA-AIAG--RIAGGLMLVVQPAKNHR
A0A1G3A880      AGP-RFADLLAW-AESQYE--QILVDSPPVLAASDA-QILG--RLVDGVLLVVQPDSNRR
A0A2E8ATT1      SGT-RIVDLLGW-AQSRYD--QILIDCPPIMAASDA-AIVG--HLADGIMLVVQPEKNHR
A0A7C2JZW2      ARD-EHAPLFRE-LSQQYS--FVFVDSAPVLASADT-MSLA--KHVDGVVMVVRKDVTRL
A0A518KYQ0      SPD-SMKELMDE-ALESYQ--YVILDTAPVLSAGET-LAVA--SVVDSTLVCVMRDLTRM
A0A5B9QX47      NPS-AMRDFVDR-ALADYR--FVVVDTAPVLAAGET-LAVA--SAVDSTLLCVMRDVSRT
M5T666          SPA-NVTAFVDA-ALESYE--YVVFDTAPVLAAGET-LAIA--SAVDSTLICVMRDVSRK
M5U6N6          NPA-NIDNFVSS-ALEQYQ--YVVFDTAPVLAAGET-LAIT--AVVDSTLICVMRDVSRK
A0A517M0G2      SAS-SIRDLLDQ-ALEKYS--FVIFDTAPVLAAGET-LAIA--SETDATLVCVMRDVSRT
A0A5C6AST1      NAS-ALRELLDD-ALAQYS--YVVVDTAPVLAAGET-LAVA--AETDATLVCVMRDVSRT
A0A5C6C951      NAS-ALRDLLDR-ALEHYS--YVVIDTAPVLAAGET-LAIA--AETDATLVCVMRDVSRS
A0A5C6C5T3      SPT-SIKSFVDD-ALLTYR--YVVIDTAPVLAAGES-LAIA--SAVDATLICVMRDVSLK
A0A2A2W6A9      SPD-SMKELMDE-ALESYQ--YVILDTAPVLSAGET-LAVA--STVDSTLVCVMRDLTRL
A0A518HQS9      SPD-SMKELMDE-ALDSYQ--YVILDTAPVLSAGET-LAIA--SVVDSTLVCVMRDLTRM
A0A5M6DFE6      SPA-KMRELIDQ-ALKRYD--FVIVDTAPVLSASET-LAVA--ASVDTTLVCAMRDVTRK
A0A5C6F286      SPS-GIRDFIDD-ALSQYS--YVVMDTAPVLSAGET-LAVA--SAVDATLICVMRDVSRI
A0A517NGN1      TQS-GIETLIEQ-ALQQYD--FIVFDTAPVLSAGET-LALA--AATDVTLLCVMRDRTRM
M5RUI3          SES-SMRDFVDR-ALEKYS--FVVIDTAPVLSASES-LAVA--SSVDSTLLCVMRDVSRM
A0A660VT66      SGE-ALPRMLDE-LKKRYD--WIIIDTPP-GIVTDP-VILS--AHVDGTVLVVRNDSTSR
A0A7C2VEF7      NSD-AFAEILKEQLTKHYD--RIIIDSPPIGPVADS-QILA--AICDITLLVLRAEKSTR
A0A0S8H0S8      HSP-AFRQMLAE-LSGRYD--RIVIDSPPVVSVTDS-RILG--AICEVTVLVLRAEKSTH
A0A7C2ZTD2      ALP-VVRQQINA-AGKKYD--HVIIDTPPVLAFPDA-LLLA--KIADAVVLTSFAGQTTA
A0A2E3Z6T8      SSK-AFIELLAW-AESKYD--RVIVDCPPVLAVSDA-QIVG--RLVDGAILVVRPEKNHR
A0A257WQ92      STP-RLTQFLKS-VRDEFD--MVLIDSPPLLAVSDP-CAIA--RHADGLLLVVRLGKTSL
A0A7C1U6X6      ANG-AFKACIDQ-LRRHYD--IVLLDSSPILPVADA-AILS--SQVDGTIMVERELVSRR
A0A7C7UXI5      ATD-RFHELLAW-AETVYD--QVIIDSPPAM-VADA-AIIG--RLVDGLVLVMQPEKNPR
A0A7C3SFJ0      VND-ELHEQFAK-LREGFD--FILIDSGPVLTDSDA-LLLG--RYVDGVLLSVLRDVSRV
A0A7C7WWF7      SRS-RFDELVAW-AEQNYD--QVLIDCPPVMAASDA-AIVG--RRTDGLLLVVQPAKNHR
A0A356ETW1      AGP-RFLELIDW-ASTVYD--QILIDSPPTLATSDS-AVIG--RLVDGTILVVQPEKNHR
A0A3L7NJY1      AGD-RFANLLAW-AETRYE--QIIVDAPPVLAVSDP-AIVG--RLVDAVVLVVRPDKDRR
A0A523CME0      ASD-KMGSFASR-MRELFD--YVIIDTPPVLAFPDT-AILA--PLSDGIVFVINNKTTKK
A0A354PCV3      SPQ-RLQAFMKD-ALNSYT--YVVVDTAPVLSAGET-LAIA--ATVESTLLCLMRDVSRL
A0A354PHB4      SPQ-RLQAFMKN-ALNTYT--YVVVDTAPVLAAGET-LAIA--ATAESTLLCLMRDVSRL
A0A356ESF4      AQP-RLAELLAW-ADKVYD--QVLIDSPPVLAASDA-AVIG--RLVDGVVLVVRPEKNCR
A0A538RV31      AQE-ALASVLAR-VKEQFD--FILIDSSPVLPVADA-LIIG--QHVDGVLFSLLRDVSRF
                                      :..*  *     .               .         

M5S2L2          PNAKESVNILRSVGANIFGIVINNS-----------------------------DESGAS
A0A2Z3GYP4      PAAERARDLLVRLKVNCLGVVVNGV------------------------------GKQGA
A0A7C2VXA0      RHSLYAKDSLMGVGGNILGVVVNDV----------------------------------P
A0A7C3AA48      KTAQQARDGLLSVGARILGAVVNDV----------------------------------H
A0A3L7SU85      PAAEQAAEILGTLGAKVLGVVINGY---------------------------------DP
A0A3M1RAJ8      PLLLEAYQRLEEVELPLLGVVVNGG----------------------------------P
A0A2D6A9B6      RMVKEALEQLESVGAQLLGTFVVGI------------------------------RGADP
A0A2G6JGH3      KLSKEARKQLVESGAHLLGSFVVGV------------------------------RGADP
A0A7C5PFV3      KLTKMALQNLQELGGNVLGTFVLGI------------------------------RGADP
A0A7C3QGD2      DDATAAKRLVRGAQGKLAGCILNKA----------------------------------E
A0A3D4PLL5      RMIIRAAESVTSLGGNLLGVVVNGL----------------------------------S
M5RD30          RSVERAGNVLEEIGVTPTAIIVNGS----------------------------------D
A0A1V6CUG1      ESVDKALRLLHATNAKLVGLVLTHR---------------------------------R-
A0A3M1SE88      RVILRAAEYLTVLKIRLVGLVVNRT---------------------------------AK
A0A7C2ZUK5      ENVKKLVEQVGR--DKIIGIVFNSF---------------------------------EM
A0A660WB30      EMVEDVLLSLNP--DKVLGIVMNDV---------------------------------RS
A0A660W9Z7      ESVEHAISLMYQANAKVLGVVLTQV---------------------------------K-
A0A3M1R9K7      PKVHAAYRTLAAFDAKILGAIVTG------------------------------------
A0A3L7PH51      KMVTRAIDSFRASGVKVIGLVANHV---------------------------------EV
A0A3N5UQY5      EITQRAIEALRGVGGRLLGIVVNQV---------------------------------H-
A0A7C2JY73      QAVRQARDLAQTHALNVVGAVANGL-----------------------------------
A0A356AE44      PSVKRALEIFEAHEIPLLGVIANGL----------------------------QDGSGDY
A0A1G2XSU7      PDLKDTIERLKQINVNLLGIVLSNV----------------------------------K
A0A350KD81      GVIRKVQQIIQTNGIKVTGLLANGV-----------QSGK--------------------
A0A2D6SRY7      EAARRAKASLQNVGARLLGVIFNGA-----------------------------CVQEGL
A0A1G3C300      ELTRRALLQYKNSKSDLLGIILNLV-----------------------DVSKGGYYSYYY
A0A524HC32      RTIEHFRKKMSIVNGTILGCIANKV---------------------------------NQ
A0A177PV03      PSARRAKEILESMRADVVGVVVNGY----------------------------------G
A0A1G2YIM0      PDVQRSLERLRAAGVKIIGTVLNSV-----------RINKSYNE----------------
A0A7D8YCU5      PYSERSLAILKSFRVNLIGVVINAV--------GDSRYSSTYAASWSTQYGVYGSQYYYG
A0A353BE27      PLALRAKSILEGVGANLLGVVINGV-------SSEAGYGYNYDYNDYRYAYKYGSN----
A0A5C6BPW1      PKVAATRDRLAMLGVPVLGAVVIGL----------DGETSGYRS----------------
A0A1I3GSP0      ATVQRVHETLQSHGVQVYGVIANDF--------QPTTSGES-------------------
A0A517QJV1      AAIVRAMETLRVHGANVHGLIANGL--------DMESASES-------------------
A0A3C1QS25      LTSDRARDILASVGAEILGVVVNGI--------GGQAGYGDYK---------YSKYGRNY
A0A5C6FX55      LNAREAVNILSSVGGNLIGTVINNS--------DEASSSDGYR-----------------
A0A5C6DS51      RPVERASRILSDIGIRPLAIVVNGV---------SNNAKATY------------------
A0A5C6DSL6      RAVERAGRILREINIQPLAIVVNGV---------SNNAKATY------------------
A0A3M1VG27      SSTRRALELMHAHGARILGVVGNCL-------PDDGEDSELYT-----------------
A0A518GC22      PLAVRAKSILESVGANLLGVVINGV-------SSEAGYGYNYDYNDYRYAYKYGSN----
A0A3L7Q373      ATAQRSRELIDSHGIPLYGVVANDI--------DYTADGGQEF-----------------
A0A3E0PW54      AAIRRTLETLGGLDVELLGVVANGV----------SPAADDYRA----------------
A0A7C3TAH2      TDIEEARSRLVQTKARVIGTVVNKV-----------------------------------
A0A1Z8MHR4      PNAREAVAMLRSAGASILGVVINKM--------DEFTGKSYYRSSAS------GSY----
A0A5C6EHJ0      PAVAQASRMLETLEANVLGIIVNGV--------GSRAARGYGKYSGSEGEYNYGSS----
A0A5C6F1H9      PAVAQATRMLETLDANVLGIVVNGV--------GSRAARGYGKSSEAEGNYNYGSS----
A0A255QXY0      PNAKEALSMLRWSGTRVIGVVINKL--------S--PRNQAYKASAS------GGY----
A0A517SYI0      PNAREAVAMLRSAGASILGVVINKM--------DEFTGKSYYRSSAS------GSY----
A0A518HX54      PNAKEAVAMLRWTGSRVMGVVINKF--------TAPHSTASYQSSAC------GSY----
A0A5B9MF59      PNAKEAISMLRAAGARVMGVVVNEI--------DEVSGGASYKTSAS------GSY----
A0A2A2WC24      PNAKEAISMLRAAGARVMGVVVNEI--------DDVSGGASYKSSAS------GSY----
A0A518KYW8      PNAKEAISMLRAAGARVMGVVVNEI--------DDVSGGASYKSSAS------GSY----
A0A5C5YZZ0      PMSKRATTLLRMLHVNIIGIIVNAV--------GDSGYSATYSQAWS------DSYGGQP
A0A518JLD2      PVVAQASRMLETLEANVLGIVINGVGSREAGAYGKSSGREGYY--NQ------GEY----
A0A5M6DJ15      PQLIAAAETLRAHGTPIMGVVVNGC--------NDGSNDNSY------------------
A0A3L7P7S7      PAAEQAAEVLGTLGAKVLGVIVNGY--------DPRESDKYGY-----------------
A0A517N8M1      HNAKESISILRSVGAKILGVVINNS--------DEAGASDGYR-----------------
A0A5C6CW01      PNAKESVNILRSVGANLFGVVINNS--------DEAGTSDGYK-----------------
A0A5C6BXS9      PNVKEAANILRNVGASIIGVVINNS--------DESSASDGYK-----------------
M5U569          PNLKEAANILRNVGARLVGVVVNNS--------DESSSSDGYK-----------------
L7CND7          PNAKEAASILANVGAKLLGVVINAS--------DEGANNDGYK-----------------
A0A0J1B8S4      PNAKEAASILANVGAKLLGVVINAS--------DEAGNNDGYK-----------------
F2ARR3          PNAKEAASILANVGAKLLGVVINAS--------DEGSNNDGYK-----------------
K5D8H6          PNAKEAASILANVGAKLLGVVINAS--------DEGSNNDGYK-----------------
M2AKU0          PNAKEAASILSNVGAKLLGVVINAS--------DEGSNNDGYK-----------------
A0A5B1CKI2      HNSKESINILRSVGARVLGVVINNS--------DEAGASDGYR-----------------
A0A5C6EG84      HNAKESLSILRSVHARILGIVINNS--------DEAGSSDGYR-----------------
A0A5C6F2X4      HNARESINILRSVSARILGIVINNS--------DEAGASDGYR-----------------
A0A5C5XTV6      PNVKEAATILRNVGARVLGIVINNS--------DESSASDGYR-----------------
A0A5C6AAB1      PNTKEAAGILRTVGARLIGVVVNNS--------DESGSSDGYK-----------------
M5T8W8          PNLKEAATILRTVGARLIGVVVNNS--------DESGSSDGYK-----------------
M5SF00          PNAKEAASILANVGAKLLGVVINAS--------DEGANNDGYK-----------------
A0A2G1WDS1      PNAKEAASILANVGAKLLGVVINAS--------DEGANNDGYK-----------------
Q7UVS9          PNAKEAASILANVGAKLLGVVINSS--------DEGSNNDGYK-----------------
A0A5C6B601      PNAKESVAMLRSAGVRIVGVVVNKI--------DEVSGSASYKASAS------GSY----
A0A517PFU1      RRLGECLDTLDQAGARVLGLVVN-----------AVPAGGEYTREVQ------GGY----
A0A5B9M8J9      PNAKEAAAMLRWSGSRVMGVVINKF--------TATHSTASYQSSAS------GSY----
A0A2A2WFP6      PNAKEAVAMLRWTGSRVMGVVINKF--------TAPRSMASYQSSAS------GSY----
A0A518L8N2      PNAKEAVAMLRWTGSRVMGVVINKF--------TAPHSTASYQSSAS------GSY----
A0A518HQN9      PNAKEAISMLRAAGARVMGVVVNEI--------DDVSGGASYKSSAS------GSY----
A0A5M6D8H8      PNAKEAVAMLRSAGARVMGVVVNKM--------DEISGGASYKSSAS------GSY----
A0A5B1CRW9      GIVDDAIRILDDIQIQPTAVIVNGI--------D---------KNVS------RSY----
A0A5C6EI46      GTVEDAVRILNDIQITPAAVIVNGI--------D---------RNAL------KTY----
A0A1G2ZG92      SIVDHIKELFTKAGLNTIGIVLNKF-----------KAYE--------------------
A0A1G3A0W0      GTQIDALMRLTSGGGQLLGTVFVGS-----------SDS---------------------
A0A2E7D3V4      TTTRRAADLLDTHNVEVLGVIANSI-----------EQTQGNSYT---------------
A0A5B9PER9      ISAERSTEMLRNLGANCLGLVVNGV-----------GQQSGYGSQYTYGAYRAGYSYNGY
A0A517QSM4      GNVAAAQQRLEMIGVPPIGSILIGL-----------DE----------------------
A0A355GJI7      GVIRKVQQIIQTNGIKVAGILANSV-----------KSGK-----------PGD------
A0A1Z8MCI4      AYAAKMLDKLELLDSNVVGAVFSGT-----------PIRE--------------------
A0A517SYL7      AYAAKMLDKLELLGSNVVGAVFSGT-----------PIRE--------------------
A0A3L7P0L2      AAAERAREMIDAHGIRLYGVIVNDI-----------DYSV-----------E--------
A0A6M5YVJ1      ALTEEAVSRLQTVRAKLTGVIANGV-----------RSAA-----------HE-------
A0A2E0SHG0      PEALRAIEILNGVAANILGVTMTGY-----------DSQS-----------GGYYSGGKY
A0A518CQB8      PEATRAMEILQSVDADVLGVTMTGY-----------DSQG-----------GQYYSASKY
A0A517SCC8      ASVTHTREQLDSYGVRLLGAIANDA-----------SHAA-----------QR-------
A0A3A0DR44      RQVRLASDRLNMAGVNLMGAVLSGT-----------SARR--------------------
A0A358MY60      DAVLRSSKRLEAAGANVVGTVFSGV-----------PSRQ--------------------
A0A517MNB1      DTAIRSQRRLEAAGANVVGSVFSGV-----------PYQQ--------------------
A0A142YJ13      PQIRAAFDWLTSMGVRILGAVVSGV-----------PAG---------------------
A0A517Z7D3      PAVRRTQEILAAHGVRLHGVVVNAL-----------DAEK-----------D--------
A0A1N6KY57      PTVQAAYDRLARLGIRMLGAIVTGE-----------QTDH--------------------
L0DK20          PKVHEAYERLAKLGIRMLGAIVTGE-----------QSDH--------------------
A0A3L7UX05      PMIERAYKRLSTLKVPVLGAVVNGV-----------RNAS-----------ATYGGYG--
A0A517XRC2      PKVMVASEKLHQLSINLLGAVVNGV-----------HMGS-----------AY-------
A0A6M5YH47      PKVMTATEKLNQLNIPLVGAVVNGI-----------K--Q-----------DV-------
A0A660UUK3      PDLREAIERLEQIGVRVLGTVLNNV-----------RVGS-----------SY-------
A0A517ZHG5      PKVAATRDRLAMLGVPVLGAVVIGL-----------DGET-----------SGYRSGY--
A0A1Z8MPL5      VPVYETNERLRTTQIPVLGCVFNGQ-----------QNNI-----------FSPGY----
A0A7C1EH96      TEMKQATKRLQEIKANIIGTVVNNV-----------KTSH-----------SYRR-----
A0A5C1AGE3      PKVLDASDRLSQLNIPLLGAVVNGI-----------KTDI--------------------
A0A2Z3HEL7      PKVMTASEKLTQLNIPLVGAVVNGI-----------KQDV--------------------
A0A142XAP8      PKVVTASEKLTQLNIQLVGAVVNGI-----------KQDV--------------------
A0A6P2DEK1      PKVVTASEKLTQLNIQMVGAVVNGI-----------KQDV--------------------
A0A5C6C1R5      PQVVAAHETLKAHGVPVMGVVVSGC-----------PSKN-----------GE-------
A6BZU4          GVIRKVQQIIQTNGIKVTGLLANGV-----------QSGK-----------FGD------
A0A2D5GZ77      GVIRKVQQIIQTNGIKVTGLLANGV-----------QSGK-----------FGD------
A0A3D3R1Z6      GVIRKVQQIIQTNGIKVTGLLANGV-----------QSGK-----------FGD------
A0A517XG00      GVIRKVQQIIQTNGIKVTGLLANGV-----------QSGK-----------FGD------
A0A1G2YRE4      QDLREANQRLTQINVKVLGTVLGNV-----------QAQ---------------------
A0A353Z859      PKVSSAIEKLQMMGIPVWGAVAIGV-----------DQSS-----------YGYGYGYGY
A0A2D6ST10      MKVASAQQRLSMLGVPMLGAVVIGL-----------DRDS-----------YG-------
A0A177QX42      PQTRRVRETLDLIGARVLGVVVNGI-----------SERA-----------AGYGYGDS-
A0A517SHR0      PQTRRVRETLDLIGARVLGVVVNGI-----------SERA-----------AGYGYGDS-
A0A2E0AW64      EQLKKSRERLKGAGAEIVGCVFNDV-----------PPNR--------------------
A0A351FZ59      EQLKKSRERLKGAGAEIVGCVFNDV-----------PPNR--------------------
A0A660V239      LDLKEAIERLEQADAKILGTVVNNV-----------KVTH-----------SYHRYG---
A0A177Q3B7      PLFESAVERLQSVGVNLLGAVMNGM-----------SPKV-----------HA-------
A0A2E0X6Y6      RMVIRAVENFAATGCHIFGVVANGV-----------TADS-----------NGYGYGYG-
A0A518GFD7      PNAARACDLLKSYGIAVLGTVVIGG-----------RSTG-----------YQ-------
A0A5C5VZJ8      HGLTEVIELLDSAGGTLLGTVFVGS-----------TTPS-----------GYASYN---
A0A518GE37      DHVKRTQNRLLASGTNVIGVVFSGV-----------PSSD--------------------
A0A5C6F3H8      DNVTRTTRRLEAAGASIAGTVFSGV-----------SARQ--------------------
A0A5C5X072      ENVVRTTRRLEAAGACVAGTVFSGV-----------SARQ--------------------
A0A5C5WUQ3      DNVGRAMRRIQASGASIAGTVFSGV-----------TPRQ--------------------
A0A5C6E697      DATQLTARRLQAAGATVTGTVFSGV-----------ATQE--------------------
A0A5C5Z1A3      DSVRLATRRLEAAGANMVGTVFSGV-----------TAQQ--------------------
A0A5C6D2P7      ETVQLTTRRLQAAGATLTGTVFSGV-----------TARQ--------------------
A0A5B9ML17      DSVIRTTHRLESAGANVAGTIFSGV-----------TPRQ--------------------
A0A518HFS8      PDVGEAYERLATLGVRILGAVVSGV-----------RDDP--------------------
A0A5Q3LBQ3      EQVEAAFERLHVAGARPVGAVLNGV-----------PARS--------------------
A0A517LX75      RPVERSRELLVSSKVNVAGIIVNGA-----------ERGD-----------KNFGYGEYV
A0A7C5W7B3      HELKGAVERVRHVRGRVLGIALNQS-----------PSAE-----------PDY------
A0A2S8F9B8      TLVEDAKRILTSFGAPIIGTVLSGY-----------TSG---------------------
A0A354GX32      PAVHAAQQRLASLGIRVLGAVVIGE-----------GME---------------------
A0A142XL75      ALVDEAVTRLQAVRAKVTGVIANGV-----------RHAA-----------HA-------
A0A6P2D5D5      ALVDEAVARLLAVRAKVTGVIANGV-----------RHAA-----------HA-------
A0A5C1AAF0      ALVQETVRRLRQIAAPLLGVVVNGY-----------THGG-----------SG-------
A0A7C7T8W8      LQVRKAYERLIAVGCDVMGLILSGV-----------PTYD--------------------
A0A5C6B3S0      PRISAACEILRSFKIPLMGAVVLGS-----------RAE---------------------
A0A368KP63      TQVEDAKRVLTSFGAPILGTVLSGY-----------STG---------------------
A0A518GIZ9      PMLRRSRDLLLAHHIPILGVVANGV-----------EPSD-----------REEMGYY--
A0A1C3EBY9      PMLKRSRDLLLAHHIPILGVVANGV-----------EPSD-----------REEMGYY--
D5SX64          PMLRRSRDLLLAHHIPILGVVANGV-----------EPSD-----------REEMGYY--
A0A517Z0U7      AKVAAAVQRLSMLGVSILGAVAIGL-----------EDGG-----------SSNRYYGRY
A0A2S8FCC0      AKVQAARDLLSVFGVPFLGVVVVGT-----------TRE---------------------
A0A1Z8MBT6      DSVLRSTRRLEAAGANIVGTIFSGV-----------TPS------------K--------
A0A517SXN9      DSVLRSTRRLEAAGANIVGTIFSGV-----------TPS------------K--------
A0A518HFL0      PAVERANGLLTGAGIPVLGVVVNGA-----------RGSD-----------RR-------
A0A3B8ZJM2      PLATRAFRVLESVDAQVLGVVVNGV-----------STEA-----------A--------
A0A1U7CLW1      PQIYAASERLASMGVRILGAVVSGV-----------PLK---------------------
A0A142WPR7      SEARRAMEVLGSVGANVLGVVVNGI-----------SSRK-----------G-----YGY
A0A3M1TFJ0      SASQLAVVELSRVGREPVGVI---L-----------NQRP-----------GSDYGYYYG
A0A517P477      RNVAAALERFQAVGVPVLGAVAIGM-----------DDEV-----------GR-------
A0A517T4K9      SKVSAASERLAMLDIPILGAVVIGI-----------DQSA-----------YG----VMY
A0A7C6B2Q1      PLVRSAKQILESFRVRVLGTVVTGS-----------SEDA-----------Y--------
A0A7C4QPD3      HKLESALRRFEMIGVPVLGLLALGL-----------RDSS-----------PF----YGY
A0A2Z3GZZ5      PAAERAREVLAGVGAHTIGVVVNAS-----------GDEG-----------RG----YGY
A0A4V0I6L6      PNTERAKEELVAVSAHLLGVVVNAS-----------SEQ------------HA----NYG
A0A7C4QQT3      QAASRARELIQTNDMDLLGVVANCL-----------DAT------------DE----LAY
A0A255QXF5      DSVVRTTHRLEASGANVVGTIFSGV-----------SHR------------Q--------
A0A518KBI5      RQIKIASEKLENAGVSIVGSVLSGV-----------PPR------------G--------
A0A5C5V6Q5      RQIRLALDQLESAGASVSGSILSGV-----------P--------------S--------
A0A517MY49      HMVIRAVESFQSTNCEVLGIVANGL-----------TTE------------MG----G--
A0A2E6AG00      RSVFRCVEETRSVGVXVVGLIVNRL-----------TXX------------EG----RSY
A0A1G3A880      RVVERAVESFAALGVELLGVVANRI-----------RPE------------SN----DRY
A0A2E8ATT1      RVVFRAVASLLGMRNKVIGIIANRI-----------QPQ------------DQ----RGY
A0A7C2JZW2      RRLEASLHRFEMIGVPMLGLLSLGI-----------GDS------------A--------
A0A518KYQ0      DSVVRTTHRLEASGANVVGTIFSGV-----------TPR------------Q--------
A0A5B9QX47      ENLTRSMRRLEASGANIAGTVFSGV-----------SPR------------E--------
M5T666          ESVLRTTRRLEASGASVAGTVFSGV-----------SAR------------Q--------
M5U6N6          ESVVRTTRRLEASGASVAGTVFSGV-----------SAR------------Q--------
A0A517M0G2      DSVVRSSRRLEASGANVAGTVFSGV-----------PSS------------Q--------
A0A5C6AST1      DTVVRSSRRLEAAGANVVGTVFSGV-----------PYS------------N--------
A0A5C6C951      DTVVRSSRRLEAAGANVVGTVFSGV-----------PYS------------N--------
A0A5C6C5T3      ENVLRTTRRLQAAGASVAGTVFSGV-----------SAR------------Q--------
A0A2A2W6A9      DSVVRTTHRLEASGANVVGTIFSGV-----------TPR------------Q--------
A0A518HQS9      DSVVRTTHRLEASGANVVGTIFSGV-----------TPR------------Q--------
A0A5M6DFE6      DSVVRTTHRLEAAGANVAGTIFNGV-----------TPR------------Q--------
A0A5C6F286      DNVTRTTRRLEAAGASIAGTVFSGV-----------SAR------------Q--------
A0A517NGN1      DSLERTSRRLESAGANVTGTIFSGV-----------TSR------------A--------
M5RUI3          DNVNRSMRRLDASGATIAGTVFSGV-----------TAG------------Q--------
A0A660VT66      KFLRHFATLLRQGDSRITGLVVNDV-----------NVTEGYYDRY--------------
A0A7C2VEF7      KHSVAARDVLLSVGGRLLGAIVNDV-----------PRKHGRYGYY--------------
A0A0S8H0S8      PVAQQAIEDLLDVGARLLGAVINAV-----------PRGNRRYGRY--------------
A0A7C2ZTD2      PDLRKARERLAEINVKVLGTVMSNV-----------RAGH----SY--------------
A0A2E3Z6T8      RSVMRAVESFHATGCHVFGVVANGL------------------------------SSDSS
A0A257WQ92      VTARRAQELVKTHGLSVLGMVANDT------------------------------PAHDL
A0A7C1U6X6      TNVVDALARLDSAGGRLMGTV---F------------------------------VGSRE
A0A7C7UXI5      RMVTRIVESLSSLEIKILGVVVNRL------------------------------SGKNS
A0A7C3SFJ0      PYVYEACQRIRAVNLPLLGAVVNGV------------------------------GAQRY
A0A7C7WWF7      RLVIRAVEHLQSMESPLVGIVANRV------------------------------TNEQE
A0A356ETW1      RAVIRAVEGLLSLRIPLLGLVVNHA------------------------------KGEER
A0A3L7NJY1      RMVIRAAETLQSLGCSLLGIVVNHL------------------------------TATDS
A0A523CME0      SLAKRAIESLHE--CRVIGCVMNKC-----------EVSV--------------------
A0A354PCV3      DSIRQTTRRLEAAGAKIVGTVFSGV-----------TSRQ--------------------
A0A354PHB4      ESIRQTTRRLEAAGAKIVGTVFSGV-----------TSRQ--------------------
A0A356ESF4      RNVLRAAETFATLNVPLLGIAVNQV-----------KAES--------------------
A0A538RV31      PNVYAAYERLSSLGIRMLGAVVNGV-----------RQDR--------------------
                                  .                                         

M5S2L2          DGYKGYGY-------------YRYS----RYTNRYY------------------------
A0A2Z3GYP4      MAGYGYD--------------YYRHAD---------------------------------
A0A7C2VXA0      RKHGRYG--------------YYSSYGSYGGYGYYGRHGYYGRA----------------
A0A7C3AA48      RGKGRYG--------------YYYGYGYYG----YGHKKDGGAT----------------
A0A3L7SU85      REAGKYG--------------YGYGYGYKYSYGYKYGYKYNYGY----------------
A0A3M1RAJ8      AGRYRSY--------------Y--------------------------------------
A0A2D6A9B6      ATDERYR--------------YTWDGE---------------------------------
A0A2G6JGH3      SKDPRYG--------------YSRGE----------------------------------
A0A7C5PFV3      STDPRYG--------------YPETQW---------------------------------
A0A7C3QGD2      IQTRGYY--------------Y--------------------------------------
A0A3D4PLL5      DSRGEYG--------------YGYGYG---------------------------------
M5RD30          AESKAYG--------------YSNHYR---------------------------------
A0A1V6CUG1      FIIPSYL--------------YRYS-----------------------------------
A0A3M1SE88      ERVPGYD--------------AYDTAYDYHGRDESDDPVSADGV----------------
A0A7C2ZUK5      NILDRKM--------------QDVGYHNYYSEKY--------------------------
A0A660WB30      GVGRYYS--------------PSYA-----------------------------------
A0A660W9Z7      NHIPKYL--------------Y--RYHYFNDMYADLYERLGDSG----------------
A0A3M1R9K7      NPGEAYY--------------HDPRYTHYIDAADEPEPVSADET----------------
A0A3L7PH51      SSNSDYG--------------YGYGYGYGYGYGHDTPPETGTDH----------------
A0A3N5UQY5      RDGGRYG--------------Y-YGGHYRLGRSNHKHGPDAKAH----------------
A0A7C2JY73      ---------------------SGDDASSYAGRTAYYRQPPHSAERELEPAGV--------
A0A356AE44      QYRGGYG--------------GGYD-------KTPYQQNNDIPEFLAPTKTIIPS-----
A0A1G2XSU7      YNQIYYP--------------YGYGYYGKTNVIKDVKQEPADNIVIPEVK----------
A0A350KD81      -----FGD-------------YDYGSGPGYSDYYIVPPQVQTKQ----------------
A0A2D6SRY7      GLPGHYR--------------YSYS----HYSHYYHETDDDGEE----------------
A0A1G3C300      SHYYKYG--------------YGYGAEPPKEKRKREKREKKEINV---------------
A0A524HC32      SKTYGYGSY------------YKYYQAYNDSYDEEKKESREQIS----------------
A0A177PV03      RNGSGYGYDAYRYGYDQA---YGYGSNESGYYHEHEGSSRKPANGNGHGGGIVARLFRWL
A0A1G2YIM0      ---------------------YGYGYYGAAKSGYAKRVHNRRAI----------------
A0A7D8YCU5      ----RYGR---------------YGGYRGYGYSGYLDDATKRTV----------------
A0A353BE27      -YRSGYG--------------YRYGY---GNYRYGYSEYSDTQD----------------
A0A5C6BPW1      ----GYGG-------------YGYG----SRYGYGYQYNRSPEP----------------
A0A1I3GSP0      ----GYDY---------------------DSYGTYYRENQTPAA----------------
A0A517QJV1      ----GYGY---------------------ESYGSYYNEDESPKA----------------
A0A3C1QS25      AYNYRYGSYGNYGQPYGYGYGYGYGYDY-EEADKYYDEPVAPGG----------------
A0A5C6FX55      ----GYGY-------------YRYS----RYAKKYYRRGGNAGE----------------
A0A5C6DS51      ----GYGN---------------YRADEYSYVGQYHREYAAHEP----------------
A0A5C6DSL6      ----GYGD---------------YRQEEYGYIGQYHRQYAAQEL----------------
A0A3M1VG27      -----------------------------AFYAPYCAAGADADT----------------
A0A518GC22      -YRSGYG--------------YRYGY---GNYRYGYTEDADTND----------------
A0A3L7Q373      -----------------------------SMYDRYYNEQTPELP----------------
A0A3E0PW54      -----------------------------NQYNSYYNPNQRPDH----------------
A0A7C3TAH2      ------------------RPEHRYN----RYRPDYYQAAQSGRQ----------------
A0A1Z8MHR4      -QSIGYG----------------YG----DSYRRRYQHDAIAHD----------------
A0A5C6EHJ0      -YQYGYG----------------YS----YGYTYGYTDGNKNNS----------------
A0A5C6F1H9      -YQYGYG----------------YS----YGYSYGYRE---NNS----------------
A0A255QXY0      -QSIGYG----------------YG----DKYRRRYQREVNSKD----------------
A0A517SYI0      -QSIGYG----------------YG----DSYRRRYQHDAIAHD----------------
A0A518HX54      -QSIGYG----------------YG----DRYRRRYQREVNAQD----------------
A0A5B9MF59      -QSIGYG----------------YG----DKYRRRYQQEAKTQD----------------
A0A2A2WC24      -QSIGYG----------------YG----DKYRRRYQQEAKTQD----------------
A0A518KYW8      -QSIGYG----------------YG----DKYRRRYQQEAKTQD----------------
A0A5C5YZZ0      GSEYGYSS-------------YRYG------SDRYLDASKEQTV----------------
A0A518JLD2      -YKYGYG--------------YSYGAIANDSSREYYEVEAPKQA----------------
A0A5M6DJ15      ----------------------------------YYRR----------------------
A0A3L7P7S7      ----GYGYGYKYSYGYKYSYGYKYG----YNYSDYSSYTDEEGD----------------
A0A517N8M1      ----GYGY-------------YRYG----RHTSRYYR--SGKGD----------------
A0A5C6CW01      ----GYGY-------------YRYG----RYTNRYRRRNGSDTS----------------
A0A5C6BXS9      ----GYGY-------------YRYT----RHTNRYYRKTADNGA----------------
M5U569          ----GYGY-------------YRYG----RHTSRYYRKTKDNGP----------------
L7CND7          ----GYGY-------------YRYG----RHTNRYYRKTADNGA----------------
A0A0J1B8S4      ----GYGY-------------YRYG----RHTSRYYRKTANNGS----------------
F2ARR3          ----GYGY-------------YRYG----RHTNRYYRKTADNGA----------------
K5D8H6          ----GYGY-------------YRYG----RHTNRYYRKTADNGA----------------
M2AKU0          ----GYGY-------------YRYG----RHTNRYYRKTADNGA----------------
A0A5B1CKI2      ----GYGY-------------YRYA----RHTSRYYR--SAKGN----------------
A0A5C6EG84      ----GYGY-------------YRYG----RHTSRYYR--SGKAG----------------
A0A5C6F2X4      ----GYGY-------------YRYG----RHTSRYYR--AGKSG----------------
A0A5C5XTV6      ----GYGY-------------YRYA----RQTNRYYRNTPENGP----------------
A0A5C6AAB1      ----GYGY-------------YRYG----RHTSRYYRKTADNGA----------------
M5T8W8          ----GYGY-------------YRYG----RHTSRYYRKTKDNGT----------------
M5SF00          ----GYGY-------------YRYG----RHTNRYYRKTADNGA----------------
A0A2G1WDS1      ----GYGY-------------YRYG----RHTNRYYRKTADNGA----------------
Q7UVS9          ----GYGY-------------YRYG----RHTNRYYRKTADNGA----------------
A0A5C6B601      -QSIGYG----------------YG----DKYRQRYQKEANATD----------------
A0A517PFU1      -YG-GYG----------------YG----AMAGR--------DA----------------
A0A5B9M8J9      -QSIGYG----------------YG----DRYRRRYQREVNAQD----------------
A0A2A2WFP6      -QSIGYG----------------YG----DRYRRRYQREVNAQD----------------
A0A518L8N2      -QSIGYG----------------YG----DRYRRRYQREVNAQD----------------
A0A518HQN9      -QSIGYG----------------YG----DKYRRRYQQEAKTQD----------------
A0A5M6D8H8      -QSIGYG----------------YG----DKYRRRYQQEAKVQD----------------
A0A5B1CRW9      -QYGGYGR-------------NKY------GYVGRYHQDYAAKDVASDQPRVVTVNAKTI
A0A5C6EI46      -AYGGYGK-------------GKYG----GGYIGHYHADYAAKE----------------
A0A1G2ZG92      -----AG--------------YYYY----NRAYYK-------------------------
A0A1G3A0W0      -----KD--------------YRYS----SAY----------------------------
A0A2E7D3V4      -----YS--------------GGYA-------DYLAPSEQSLEL----------------
A0A5B9PER9      GYGYGYG--------------YGYG----QGGKYYDEDQKGRKV----------------
A0A517QSM4      -----FA--------------DKYG----YYSRHYNTLDVS-------------------
A0A355GJI7      -----YD--------------YGSG----PGYSDYYIVPPQAQA----------------
A0A1Z8MCI4      -----YK--------------YQYG-------SYYYYGGKKAIE----------------
A0A517SYL7      -----YK--------------YQYG-------SYYYYGGKKAIE----------------
A0A3L7P0L2      -----DG--------------QTYN----EYEKYYDAAAPSLSA----------------
A0A6M5YVJ1      -----YT--------------RAYR----AHESPALPVGGAGGP----------------
A0A2E0SHG0      -----AS--------------YSAK----ESRSYYTNYTKTAAR----------------
A0A518CQB8      -----TS--------------FGAK----ESRSYYTSYTKT-AR----------------
A0A517SCC8      -----DG--------------YHYN----SYDVYYSAPAAPRKA----------------
A0A3A0DR44      -----YA--------------STYG-------NYAYLEDSLS------------------
A0A358MY60      -----YA--------------YRYG-------DYRYL-TPKIDT----------------
A0A517MNB1      -----YS--------------YRYG-------DYNYLMAPEANQ----------------
A0A142YJ13      -----SK--------------HNYG-------SYPGPK----------------------
A0A517Z7D3      -----EG--------------YDVQ----SYAAYYAEETAPTPA----------------
A0A1N6KY57      -----YG--------------SNYL----PSGRA--------------------------
L0DK20          -----YG--------------SKYG----YSARAQESV----------------------
A0A3L7UX05      -----YG--------------YGYG----YGGSFGDGADEDVVT----------------
A0A517XRC2      -----YA--------------YGYN----YVKQLPA------------------------
A0A6M5YH47      -----YS--------------YGYN----YVKQLPA------------------------
A0A660UUK3      -----YR--------------YGYG----YGADGGKAQRKAKAK----------------
A0A517ZHG5      -----GG--------------YGYG----SRYGYGYQYNRSPEP----------------
A0A1Z8MPL5      -----YT--------------YGYG----SPQPLGSDTESPS------------------
A0A7C1EH96      -----YG--------------YGYG--------YHYSAKKHPKR----------------
A0A5C1AGE3      -----HA--------------YGYN----YVKQLPA------------------------
A0A2Z3HEL7      -----YS--------------YGYN----YVKQLPA------------------------
A0A142XAP8      -----YS--------------YGYN----YVKQLPA------------------------
A0A6P2DEK1      -----YS--------------YGYN----YVKQLPA------------------------
A0A5C6C1R5      -----YL--------------YQY------------------------------------
A6BZU4          -----YD--------------YGSG----PGYSDYYIVPPQVQT----------------
A0A2D5GZ77      -----YD--------------YGSG----PGYSDYYIVPPQVQT----------------
A0A3D3R1Z6      -----YD--------------YGSG----PGYSDYYIVPPQVQT----------------
A0A517XG00      -----YD--------------YGSG----PGYSDYYIVPPQVQT----------------
A0A1G2YRE4      -----YS--------------FHRY-------DRYYQNPSSRKT----------------
A0A353Z859      GYGYGYG--------------YGYG----YGNSYGYGYGNRPRS----------------
A0A2D6ST10      -----YN--------------SRYG-------RNYQSYQQYRQY----------------
A0A177QX42      -----YS--------------YNYT-------TSYRSRSGKYYS----------------
A0A517SHR0      -----YS--------------YNYT-------TSYRSKSGKYYS----------------
A0A2E0AW64      -----YS--------------YRYG-------YYGYEDHGGI------------------
A0A351FZ59      -----YS--------------YRYG-------YYGYEDHGGV------------------
A0A660V239      -----YG--------------YGYG-------HATEDDRKRESD----------------
A0A177Q3B7      -----SR--------------YHYE-------PASSTLAPESLL----------------
A0A2E0X6Y6      -----YG--------------YGYG-------HDEDETDGFEED----------------
A0A518GFD7      -----GY--------------YAYQ-------NRSVERKPKLIE----------------
A0A5C5VZJ8      -----YY--------------GSYA-------QYGRSASTDATD----------------
A0A518GE37      -----YA--------------YRYG-------DYHYTTANLPPP----------------
A0A5C6F3H8      -----YS--------------YRYG-------DYHYALGDVPFG----------------
A0A5C5X072      -----YG--------------YRYG-------NYHYALPDTMAT----------------
A0A5C5WUQ3      -----YS--------------YRYG-------DYHYSAAGLAVQ----------------
A0A5C6E697      -----YS--------------SRYG-------DYNYFMNAGVRS----------------
A0A5C5Z1A3      -----YA--------------YRYG-------DYHYVMPDFNTP----------------
A0A5C6D2P7      -----YA--------------YRYG-------DYHYAVSSSEAH----------------
A0A5B9ML17      -----YA--------------YRYG-------DYNYSNFTNLPG----------------
A0A518HFS8      -----NL--------------SDDR-------YHYLSGVKR-------------------
A0A5Q3LBQ3      -----YL--------------YSYG-------RYALPTA---------------------
A0A517LX75      QP---YE--------------YGYA-------TKYTKSYSSRDT----------------
A0A7C5W7B3      -----YY--------------YMHS-------EADVPVAVQA------------------
A0A2S8F9B8      -----MY--------------YSYT-------NRPTSTVEVEQ-----------------
A0A354GX32      ----------------------AYG-------QVRYPTKAPQAP----------------
A0A142XL75      -----YT--------------HGYG-------TVDPVEHT-PAP----------------
A0A6P2D5D5      -----YT--------------HGYG-------TIDPIDHNVPAP----------------
A0A5C1AAF0      -----YG--------------YGYG-------YNRLAAAKTVEV----------------
A0A7C7T8W8      -----YA--------------YRYG-------GYSRYYKKYYRQ----------------
A0A5C6B3S0      ------A--------------YYSD-------TNPLDTDDHFAD----------------
A0A368KP63      -----MY--------------YSYT-------ARTKSTVEVAK-----------------
A0A518GIZ9      -----AD--------------YNRN-------EAYFPQDQASVE----------------
A0A1C3EBY9      -----AD--------------YNRN-------EAFFPQDQSLPE----------------
D5SX64          -----AD--------------YNRN-------EAFFPQDQSSPE----------------
A0A517Z0U7      GYGYGYN--------------YGYR-------GSYHRTPANIS-----------------
A0A2S8FCC0      -----DV--------------YDYT-------SRRDRKKRLVHV----------------
A0A1Z8MBT6      -----YV--------------YRYG-------DYKYSNLVS-------------------
A0A517SXN9      -----YV--------------YRYG-------DYKYSNLVS-------------------
A0A518HFL0      -----FG--------------GGYA-------AYTYRTDRMPDP----------------
A0A3B8ZJM2      YGGYGYN--------------YSYN-------DYRYSYRSSYGY----------------
A0A1U7CLW1      -----PN--------------RYYG-------SYTSPQWNPVEE----------------
A0A142WPR7      SGSGNRG--------------YAYG-------EGKAGVYYSEEE----------------
A0A3M1TFJ0      DLYYGYG--------------YGYG-------PSQPP-----------------------
A0A517P477      ---------------------YGYA-------PGRYPYAKHRQA----------------
A0A517T4K9      NERYRYA--------------YGYP-------GTK-------------------------
A0A7C6B2Q1      -----YA--------------HSYH-------TLLENTSGAPDD----------------
A0A7C4QPD3      GYGYGYG--------------YGYD-------PHTAEHHLELPS----------------
A0A2Z3GZZ5      GYGYGYE--------------YKYT-------SYKYSDSYNTDA----------------
A0A4V0I6L6      YG---YT--------------YKYD--------YQYSDSYTDQK----------------
A0A7C4QQT3      APHSQYY--------------HVYQ-------AADEPVAVS-------------------
A0A255QXF5      -----YA--------------YRYG-------DYRYSDYTDLLP----------------
A0A518KBI5      -----YG--------------YAYA--------YGYGYRDDTQE----------------
A0A5C5V6Q5      -----YS--------------YSYA--------YGYGFRNPTEH----------------
A0A517MY49      -----YG--------------YGYG--------YGYGHEEEAEE----------------
A0A2E6AG00      -----YG--------------DSYG--------YGYGDNEGD------------------
A0A1G3A880      DDGCAYA--------------YGYG--------AAYRDEADQDG----------------
A0A2E8ATT1      -----YG--------------YGYA--------YDYSSPEDENE----------------
A0A7C2JZW2      -----TV--------------YTYN-------HYSGRTSRPSER----------------
A0A518KYQ0      -----YS--------------YRYG-------DYKYSDFGQMLA----------------
A0A5B9QX47      -----YA--------------YRYG-------NYDYAIAGETNS----------------
M5T666          -----YG--------------YRYG-------DYQYALGGEPQA----------------
M5U6N6          -----YA--------------YRYG-------DYHYAIGGEPVA----------------
A0A517M0G2      -----YA--------------YRYG-------DYRYFTARPEPQ----------------
A0A5C6AST1      -----YA--------------YRYG-------DYRYLSPKPRA-----------------
A0A5C6C951      -----YA--------------YRYG-------DYRYLTPKHDRV----------------
A0A5C6C5T3      -----YG--------------YRYG-------NYHYALPDTMAT----------------
A0A2A2W6A9      -----YS--------------YRYG-------DYKYSDFGQMLA----------------
A0A518HQS9      -----YS--------------YRYG-------DYKYSDFGQMLA----------------
A0A5M6DFE6      -----YA--------------YRYG-------DYTYAGAGEIPD----------------
A0A5C6F286      -----YS--------------YRYG-------DYDYAIGDGSFG----------------
A0A517NGN1      -----YA--------------YRYG-------DYHYSAIES-------------------
M5RUI3          -----YA--------------YRYG-------SYHYAIAGETDA----------------
A0A660VT66      ---------------------YRKGYYFAGDESGE-------------------------
A0A7C2VEF7      ---------------------SGYGYYRGYGYYGDREKKEAAVV----------------
A0A0S8H0S8      ---------------------SQYGY---------RRSHRRK------------------
A0A7C2ZTD2      ---------------------YRYGYSYYAENVRSRKNAKRAGI----------------
A0A2E3Z6T8      GYGYGYG--------------YGYSYDG------GYSHEEEQDM----------------
A0A257WQ92      NSYSADA--------------Y-------------YRDVTPRQ-----------------
A0A7C1U6X6      NGHYGYG--------------YGYGY--------GYGQKKQYC-----------------
A0A7C7UXI5      ESYYGYG--------------YGYGYSYRYGHRYGYGQDEEAT-----------------
A0A7C3SFJ0      RAYYSYR--------------S------------YYPRPEENT-----------------
A0A7C7WWF7      DGYYGYG--------------YGHGYGY------GHSEDGDSS-----------------
A0A356ETW1      GGYYGYG--------------YGYGYEY----NGGYGNDEDDY-----------------
A0A3L7NJY1      GG-YGYG--------------YGYGYGY------GYGHDDPAD-----------------
A0A523CME0      -----SE--------------Y-YGY----GYEYGNDS----------------------
A0A354PCV3      -----YA--------------YRYG-----DYHYTVNDEDFGDVGIRASQDL--------
A0A354PHB4      -----YS--------------YRYG-----DYHYTVNDEDFIDVGVRDSHDL--------
A0A356ESF4      -----RA--------------GYYGYAPGHAYDYADSRGSNDDPGEQKDHFEAARRSAA-
A0A538RV31      -----------------------YGY----SYQYYYNKDHN-------------------
                                                                            

M5S2L2          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A7C2VXA0      -----------------------------------------------GNREDDEA-----
A0A7C3AA48      -----------------------------------------------KRLAVASS-----
A0A3L7SU85      -----------------------------------------------NYTDYESYTDDED
A0A3M1RAJ8      ------------------------------------------------------------
A0A2D6A9B6      ---------------------------------------------------------AKE
A0A2G6JGH3      ------------------------------------------------------------
A0A7C5PFV3      ---------------------------------------------------------PEA
A0A7C3QGD2      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ---------------------------------------------------------SEE
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      -----------------------------------------------P---------FDD
A0A7C2ZUK5      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      -----------------------------------------------E----------PA
A0A3M1R9K7      -----------------------------------------------G------------
A0A3L7PH51      -----------------------------------------------E------------
A0A3N5UQY5      -----------------------------------------------DTCIGMTLQPLEA
A0A7C2JY73      ------------------------------------------------------------
A0A356AE44      ------------------------------------------------------------
A0A1G2XSU7      ------------------------------------------------------------
A0A350KD81      ------------------------------------------------------------
A0A2D6SRY7      -----------------------------STEFGWRRWLLKCRRALSSQRGETWAASAKG
A0A1G3C300      ------------------------------------------------------------
A0A524HC32      ------------------------------------------------------------
A0A177PV03      R-----------------------------------------------------------
A0A1G2YIM0      ------------------------------------------------------------
A0A7D8YCU5      -----------------------------------------TVQGMGRTNPQTSGRTPIA
A0A353BE27      ------------------------------------------------LSVKQPGNPQ--
A0A5C6BPW1      ------------------------------------------------------------
A0A1I3GSP0      ------------------------------------------------------------
A0A517QJV1      ------------------------------------------------------------
A0A3C1QS25      ------------------------------------------KRRKRSAAIGNDGPKS--
A0A5C6FX55      -----------------------------------VVPKGSKKR----SGMVVSGRSTQN
A0A5C6DS51      ------------------------------------------------------------
A0A5C6DSL6      ------------------------------------------------------------
A0A3M1VG27      --------------------------------------AGEAADPSALAEASEAGRPSEE
A0A518GC22      ------------------------------------------------------------
A0A3L7Q373      --------------------------------------------SPLSRELLVGSQK---
A0A3E0PW54      ------------------------------------------------------------
A0A7C3TAH2      -----------------------------------VERRPRTRPILLPVATAPAGQKDQK
A0A1Z8MHR4      --------------------------------AYVVRGYRPAGSDAQYDARYDSYAQSGP
A0A5C6EHJ0      --------------------------------YYEEE--PTGRKKAKAKKLAKSKLVVAP
A0A5C6F1H9      --------------------------------YYEEDDKKKGKDRKKAQQIRKAAVVAPP
A0A255QXY0      --------------------------------TYMIKAKGSTHRVDGPELDLEADAVVDP
A0A517SYI0      --------------------------------AYVVRGYRPAGSDAQYDARYDSYAQSGP
A0A518HX54      --------------------------------TYVVTGTKNLERVDL-VAPSKASQPGKP
A0A5B9MF59      --------------------------------TYVVKGKQASER---PTSAGKVDDAVEP
A0A2A2WC24      --------------------------------TYVVKGRHASDPVSVPAAPVESGDPPGT
A0A518KYW8      --------------------------------TYVVKGKHASDPVSVPAAPAESGHQPGT
A0A5C5YZZ0      ----------------------------------TVRGRHRAEK----AEPIGAGAGGES
A0A518JLD2      ------------------------------------------------APVQQTQHV---
A0A5M6DJ15      ------------------------------------------------------------
A0A3L7P7S7      -------------------------------------GEGDDGKGGYDDRPRAPSLGSRV
A0A517N8M1      --------------------------------------KSSRRRS---EPRIISGRG---
A0A5C6CW01      --------------------------------------KGRDSSRSNMAPVVVKGRG---
A0A5C6BXS9      --------------------------------------RGGTLR----TPVMVSGRG---
M5U569          --------------------------------------KGGQPR----TPIVVSGRA---
L7CND7          --------------------------------------KAGQRR----SPVVVSGRG---
A0A0J1B8S4      --------------------------------------KAGTRR----TPVVVSGRG---
F2ARR3          --------------------------------------KAGQRR----SPVVVSGRG---
K5D8H6          --------------------------------------KAGQRR----SPVVVSGRG---
M2AKU0          --------------------------------------KAGQRR----SPVVVSGRG---
A0A5B1CKI2      --------------------------------------KVRRDK----EPLIISGKG---
A0A5C6EG84      --------------------------------------KSQKQS----QPLIISGRG---
A0A5C6F2X4      --------------------------------------KSHKPS----QPLIISGRG---
A0A5C5XTV6      --------------------------------------MGGKVR----TPVIVSGRGEMG
A0A5C6AAB1      --------------------------------------KSGQLR----TPVIVSGRG---
M5T8W8          --------------------------------------KGGQPR----TPIVVSGRA---
M5SF00          --------------------------------------KAGQRR----SPVVVSGRG---
A0A2G1WDS1      --------------------------------------KAGQRR----SPVVVSGRG---
Q7UVS9          --------------------------------------KAGQRR----SPVVVSGRG---
A0A5C6B601      --------------------------------TYIVKGKSDEAP----TVVAPPDVSPTL
A0A517PFU1      --------------------------------YYSDEGTSAPAA----PALIAATPADGD
A0A5B9M8J9      --------------------------------TYVVTGTKHLGR----VDKVSSDAAATL
A0A2A2WFP6      --------------------------------TYIVTGTKNLER----VDLVAPSNSSQP
A0A518L8N2      --------------------------------TYIVTGTKNLER----VDLVTASEATRP
A0A518HQN9      --------------------------------TYVVKGRHASDP----GAM--PGAPTGP
A0A5M6D8H8      --------------------------------TYVVKGKVASEP----AEVRRPARNGKP
A0A5B1CRW9      GSAATAVPVRPTFAQQASQSVNGTESDGLPRQQSSNHQNNMEKL----ESIIESGKTAKI
A0A5C6EI46      --------------------------------RSDVHRSDATRS----EPTPKNGRPATF
A0A1G2ZG92      ------------------------------------------------------------
A0A1G3A0W0      ------------------------------------------------------------
A0A2E7D3V4      ------------------------------------------------------------
A0A5B9PER9      ------------------------------------------------------------
A0A517QSM4      ------------------------------------------------------------
A0A355GJI7      ------------------------------------------------------------
A0A1Z8MCI4      ------------------------------------------------------------
A0A517SYL7      ------------------------------------------------------------
A0A3L7P0L2      ------------------------------------------------------------
A0A6M5YVJ1      ------------------------------------------------------------
A0A2E0SHG0      ------------------------------------------------------------
A0A518CQB8      ------------------------------------------------------------
A0A517SCC8      ------------------------------------------------------------
A0A3A0DR44      ------------------------------------------------------------
A0A358MY60      ------------------------------------------------------------
A0A517MNB1      ------------------------------------------------------------
A0A142YJ13      ------------------------------------------------------------
A0A517Z7D3      ------------------------------------------------------------
A0A1N6KY57      ------------------------------------------------------------
L0DK20          ------------------------------------------------------------
A0A3L7UX05      ------------------------------------------------------------
A0A517XRC2      ------------------------------------------------------------
A0A6M5YH47      ------------------------------------------------------------
A0A660UUK3      ------------------------------------------------------------
A0A517ZHG5      ------------------------------------------------------------
A0A1Z8MPL5      ------------------------------------------------------------
A0A7C1EH96      ------------------------------------------------------------
A0A5C1AGE3      ------------------------------------------------------------
A0A2Z3HEL7      ------------------------------------------------------------
A0A142XAP8      ------------------------------------------------------------
A0A6P2DEK1      ------------------------------------------------------------
A0A5C6C1R5      ------------------------------------------------------------
A6BZU4          ------------------------------------------------------------
A0A2D5GZ77      ------------------------------------------------------------
A0A3D3R1Z6      ------------------------------------------------------------
A0A517XG00      ------------------------------------------------------------
A0A1G2YRE4      ------------------------------------------------------------
A0A353Z859      ------------------------------------------------------------
A0A2D6ST10      ------------------------------------------------------------
A0A177QX42      ------------------------------------------------------------
A0A517SHR0      ------------------------------------------------------------
A0A2E0AW64      ------------------------------------------------------------
A0A351FZ59      ------------------------------------------------------------
A0A660V239      ------------------------------------------------------------
A0A177Q3B7      ------------------------------------------------------------
A0A2E0X6Y6      ------------------------------------------------------------
A0A518GFD7      ------------------------------------------------------------
A0A5C5VZJ8      ------------------------------------------------------------
A0A518GE37      ------------------------------------------------------------
A0A5C6F3H8      ------------------------------------------------------------
A0A5C5X072      ------------------------------------------------------------
A0A5C5WUQ3      ------------------------------------------------------------
A0A5C6E697      ------------------------------------------------------------
A0A5C5Z1A3      ------------------------------------------------------------
A0A5C6D2P7      ------------------------------------------------------------
A0A5B9ML17      ------------------------------------------------------------
A0A518HFS8      ------------------------------------------------------------
A0A5Q3LBQ3      ------------------------------------------------------------
A0A517LX75      ------------------------------------------------------------
A0A7C5W7B3      ------------------------------------------------------------
A0A2S8F9B8      ------------------------------------------------------------
A0A354GX32      ------------------------------------------------------------
A0A142XL75      ------------------------------------------------------------
A0A6P2D5D5      ------------------------------------------------------------
A0A5C1AAF0      ------------------------------------------------------------
A0A7C7T8W8      ------------------------------------------------------------
A0A5C6B3S0      ------------------------------------------------------------
A0A368KP63      ------------------------------------------------------------
A0A518GIZ9      ------------------------------------------------------------
A0A1C3EBY9      ------------------------------------------------------------
D5SX64          ------------------------------------------------------------
A0A517Z0U7      ------------------------------------------------------------
A0A2S8FCC0      ------------------------------------------------------------
A0A1Z8MBT6      ------------------------------------------------------------
A0A517SXN9      ------------------------------------------------------------
A0A518HFL0      ------------------------------------------------------------
A0A3B8ZJM2      ------------------------------------------------------------
A0A1U7CLW1      ------------------------------------------------------------
A0A142WPR7      ------------------------------------------------------------
A0A3M1TFJ0      ------------------------------------------------------------
A0A517P477      ------------------------------------------------------------
A0A517T4K9      ------------------------------------------------------------
A0A7C6B2Q1      ------------------------------------------------------------
A0A7C4QPD3      ------------------------------------------------------------
A0A2Z3GZZ5      ------------------------------------------------------------
A0A4V0I6L6      ------------------------------------------------------------
A0A7C4QQT3      ------------------------------------------------------------
A0A255QXF5      ------------------------------------------------------------
A0A518KBI5      ------------------------------------------------------------
A0A5C5V6Q5      ------------------------------------------------------------
A0A517MY49      ------------------------------------------------------------
A0A2E6AG00      ------------------------------------------------------------
A0A1G3A880      ------------------------------------------------------------
A0A2E8ATT1      ------------------------------------------------------------
A0A7C2JZW2      ------------------------------------------------------------
A0A518KYQ0      ------------------------------------------------------------
A0A5B9QX47      ------------------------------------------------------------
M5T666          ------------------------------------------------------------
M5U6N6          ------------------------------------------------------------
A0A517M0G2      ------------------------------------------------------------
A0A5C6AST1      ------------------------------------------------------------
A0A5C6C951      ------------------------------------------------------------
A0A5C6C5T3      ------------------------------------------------------------
A0A2A2W6A9      ------------------------------------------------------------
A0A518HQS9      ------------------------------------------------------------
A0A5M6DFE6      ------------------------------------------------------------
A0A5C6F286      ------------------------------------------------------------
A0A517NGN1      ------------------------------------------------------------
M5RUI3          ------------------------------------------------------------
A0A660VT66      ------------------------------------------------------------
A0A7C2VEF7      ------------------------------------------------------------
A0A0S8H0S8      ------------------------------------------------------------
A0A7C2ZTD2      ------------------------------------------------------------
A0A2E3Z6T8      ------------------------------------------------------VDTADT
A0A257WQ92      ------------------------------------------------------------
A0A7C1U6X6      ------------------------------------------------------------
A0A7C7UXI5      ------------------------------------------------------------
A0A7C3SFJ0      ------------------------------------------------------------
A0A7C7WWF7      ------------------------------------------------------------
A0A356ETW1      ------------------------------------------------------------
A0A3L7NJY1      ------------------------------------------------------------
A0A523CME0      ------------------------------------------------------------
A0A354PCV3      ------------------------------------------------------------
A0A354PHB4      ------------------------------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A538RV31      ------------------------------------------------------------
                                                                            

M5S2L2          ----------------------------------------------------
A0A2Z3GYP4      ----DYSAPYTTADHDEPGMGEGQPLTPPARLSSEPAGHVEPVANGPAHAPE
A0A7C2VXA0      ----------------------------------------------------
A0A7C3AA48      ----------------------------------------------------
A0A3L7SU85      EENEAANAEGKVQRGPSMASRVLPNLVPRIQTKRLPSKPASETKPPETPEST
A0A3M1RAJ8      ------------------------------RAYTIDVESREPKTAPRQPVGK
A0A2D6A9B6      ----------------------------------------------------
A0A2G6JGH3      ----------------------------------------------------
A0A7C5PFV3      ----------------------------------------------------
A0A7C3QGD2      ------YSAAPAVEAGAAE---------------------------------
A0A3D4PLL5      ------YGEGYGEGHDDPTHDDEEEAIPMTQSNSHRPRKRFSRDESSDRYAA
M5RD30          YSYTPYYHDTYAASDPQPNSIRLQNAV---GSQPVQPTKLMSRS--------
A0A1V6CUG1      ----------------------------------------------------
A0A3M1SE88      DDEDIVPRRVA-----------------------------------------
A0A7C2ZUK5      ----------------------------------------------------
A0A660WB30      ----------------------------------------------------
A0A660W9Z7      RKSRGKRRKRK-----------------------------------------
A0A3M1R9K7      ----------------------------------------------------
A0A3L7PH51      --DEQPYRRAA-----------------------------------------
A0A3N5UQY5      GLSRSPVLRPS-----------------------------------------
A0A7C2JY73      ----------------------------------------------------
A0A356AE44      ----------------------------------------------------
A0A1G2XSU7      ----------------------------------------------------
A0A350KD81      -----------------------------------------ADAPAKTKLTH
A0A2D6SRY7      QTTDPQTTNAQIADPQAAALVTTTDPQTTDDETDEETDDETTERSRIVRSSS
A0A1G3C300      ----------------------------------------------------
A0A524HC32      ----------------------------------------------------
A0A177PV03      ----------------------------------------------------
A0A1G2YIM0      ------------------------------------IVPVQEEKTEVTNAAS
A0A7D8YCU5      GAYANGVAAAERNGGAAVDRDAVEHPVATNGHAPAHHSGPKGGSENGGHVDE
A0A353BE27      ----------------------------------------------------
A0A5C6BPW1      -----------------------------------------------TPSQS
A0A1I3GSP0      ---------------------------------S-----KAKSAYVPQTAGK
A0A517QJV1      ---------------------------------PQNPSQRPRPAEPTEIIKT
A0A3C1QS25      ----------------------------------------------------
A0A5C6FX55      RVRPSEAMPTRNEAVAAAA------------------PVTRPNVSSDQQADS
A0A5C6DS51      ---------------------------------MAAERLETQKRPTRPLVRA
A0A5C6DSL6      ---------------------------------PVSEIIPKQKLTHRVNAPV
A0A3M1VG27      EAADRSSTPIASGA--------------------------------------
A0A518GC22      --------------------------------------------LSTADKEG
A0A3L7Q373      ----------------------------------------------------
A0A3E0PW54      ----------------------------------------AAESRQPVAADA
A0A7C3TAH2      VLK-------------------------------------------------
A0A1Z8MHR4      GMGGPSSGGVVPPGHYPNG---------AEAPGLPPQPPQSSGGSYDSSIGS
A0A5C6EHJ0      PKPGDKT---------------------------------------------
A0A5C6F1H9      TSPADDV---------------------------------------------
A0A255QXY0      V-------------------------------DMAETGAVKTPTFK------
A0A517SYI0      GMGGPSSGGVVPPGHYPNG---------AEAPGLPPQPPQSSGGSYDSSIGS
A0A518HX54      HLHQVV---------------------------PQNSSPGPLPKN-------
A0A5B9MF59      Y---------------DHA---------MIPPQPTAAGPSAVAKRHRANVRS
A0A2A2WC24      YEGEIADPEFTDPEFTDRK---------ITAPDAAPFAPKVAPDRRRTNVRS
A0A518KYW8      YEQEIADPEFTDSEFADRK---------ITSPDAAPFAPKVVPERRRTNVRS
A0A5C5YZZ0      NGKG------------------------------------------------
A0A518JLD2      -----------------------------------PSACGADLTNHTS----
A0A5M6DJ15      ----------------------------------------------------
A0A3L7P7S7      LPNVQPRVRTKRLTGGSPP----------------QNVPGDGEPE-------
A0A517N8M1      -------AAI--AKVMEQP-------------------------AQEELLDR
A0A5C6CW01      -------STSSRKAKKAVP-------------------LSMTGVD----SDV
A0A5C6BXS9      -------SIEQSANVAKAPVAEAPLAEAPVANLASPSINGHGPYETNNGSHN
M5U569          -------VGLRASAAAAKP----------------TSVAATTPINGKPEDDV
L7CND7          -------SAARSARPIAVP----------------P--AVTSPTEQER-SDV
A0A0J1B8S4      -------PAPRSARPIAVP----------------P--TAMPPVEQERSSDV
F2ARR3          -------PAARSARPIAVP----------------P--ATAPSIEREG-SDV
K5D8H6          -------SAARSARPIAVP----------------P---TTPSVEQER-SDV
M2AKU0          -------SAARSARPIAVP----------------P---TTASVEQER-SDV
A0A5B1CKI2      --SQ-------------TS----------------SKPVAAVSASNSDELDG
A0A5C6EG84      --SR--------TAPAAAQ----------------ATQTAMGYEGHDDHLDS
A0A5C6F2X4      --SKPQAKATSAKATSAQA----------------ATPSTLGESTLKDLTD-
A0A5C5XTV6      QPVNGSPNPGSPNPVANIT----------------PAASRNGHASHDDTDES
A0A5C6AAB1      ----MTPVPRKANLGATTA----------------VGSSPSKMNGRSASSE-
M5T8W8          ----VGL---RASAAAAKP----------------TSVATSSTKNGTATDDV
M5SF00          ----SAA---RSARPIAVP----------------PT-TPSVEQERS---DV
A0A2G1WDS1      ----GGA---RSARPIAVP----------------PTVTSSTDQERS---DV
Q7UVS9          ----QAA---RSARPIAVP----------------PATAPSIEQERS---DV
A0A5C6B601      ITGSTNAESTPDESYSSR----------------------------------
A0A517PFU1      AATARRSTRTPDAARSR-----------------------------------
A0A5B9M8J9      AKPHLRTAQPTDSNA-------------------------------------
A0A2A2WFP6      GKPHLRQVVPQDSASGPRP----------------L----------------
A0A518L8N2      GKPHLQQTDSKSQSH-------------------------------------
A0A518HQN9      VGEPGAYEREITDSEITDS----------------FAPTVVPERRRTNVRS-
A0A5M6D8H8      VASTVAGD-PVQASRGPAP----------------LAPPVLTERHSTPTHH-
A0A5B1CRW9      DGPSKGRPTSPRGGPAPVA----------------APVSSMPMTPSETV---
A0A5C6EI46      AAASADLGSSVRRQPAPIT----------------IPSGDAPPMADQSSKS-
A0A1G2ZG92      ----------------------------------------------------
A0A1G3A0W0      ----------------------------------------------------
A0A2E7D3V4      ---QREAQQPTAQPVA------------------------------------
A0A5B9PER9      ---DPNVAQRIESKTS------------------------------------
A0A517QSM4      ----------------------------------------------------
A0A355GJI7      ---KQADVPAKTKITH------------------------------------
A0A1Z8MCI4      ---MPVSKDACSGIGSVPX---------------------------------
A0A517SYL7      ---MPVSKDACSGIGSVPS---------------------------------
A0A3L7P0L2      ---QPQTELVGGRK--------------------------------------
A0A6M5YVJ1      ---HER----------------------------------------------
A0A2E0SHG0      ---KSKA---------------------------------------------
A0A518CQB8      ---KEKV---------------------------------------------
A0A517SCC8      ---EEPVTV-------------------------------------------
A0A3A0DR44      ----------------------------------------------------
A0A358MY60      ----------------------------------------------------
A0A517MNB1      ---PAIK---------------------------------------------
A0A142YJ13      ----------------------------------------------------
A0A517Z7D3      ---APAKTQSEPANVTV-----------------------------------
A0A1N6KY57      ----------------------------------------------------
L0DK20          ----------------------------------------------------
A0A3L7UX05      ---DAVDIDVEIVD--------------------------------------
A0A517XRC2      ----------------------------------------------------
A0A6M5YH47      ----------------------------------------------------
A0A660UUK3      ---RGRSLLLVAPKSEQEDSK-------------------------------
A0A517ZHG5      ---TPSQS--------------------------------------------
A0A1Z8MPL5      ----------------------------------------------------
A0A7C1EH96      ---PAHKTKKSKALLLSEVAESAEQ---------------------------
A0A5C1AGE3      ----------------------------------------------------
A0A2Z3HEL7      ----------------------------------------------------
A0A142XAP8      ----------------------------------------------------
A0A6P2DEK1      ----------------------------------------------------
A0A5C6C1R5      ----------------------------------------------------
A6BZU4          ---KQADAPAKTKLTH------------------------------------
A0A2D5GZ77      ---KQADAPAKTKLTH------------------------------------
A0A3D3R1Z6      ---KQADAPAKTKLTH------------------------------------
A0A517XG00      ---KQADAPAKTKLTH------------------------------------
A0A1G2YRE4      ---AEQAKIQLLLPDTAVNETDKN----------------------------
A0A353Z859      ---SAPAVPSESPSDQSSQPPLN-----------------------------
A0A2D6ST10      ---PR-----------------------------------------------
A0A177QX42      ---DERVGHSYYDDSRKRR---------------------------------
A0A517SHR0      ---DERVGNSYYDDSRKRR---------------------------------
A0A2E0AW64      ----------------------------------------------------
A0A351FZ59      ----------------------------------------------------
A0A660V239      ---ARKRAETLLLTTEPKHETGHGSGS-------------------------
A0A177Q3B7      ---DIDLSGVPSESSES-----------------------------------
A0A2E0X6Y6      ---SPVGHDDLTLAINGRRTADEDHDGHDAPIRPRRAA--------------
A0A518GFD7      ---N------------------------------------------------
A0A5C5VZJ8      ----------------------------------------------------
A0A518GE37      ---H------------------------------------------------
A0A5C6F3H8      ---DSSSELSESSVS-------------------------------------
A0A5C5X072      ----------------------------------------------------
A0A5C5WUQ3      ---E------------------------------------------------
A0A5C6E697      ----------------------------------------------------
A0A5C5Z1A3      ---S------------------------------------------------
A0A5C6D2P7      ----------------------------------------------------
A0A5B9ML17      ---SAT----------------------------------------------
A0A518HFS8      ----------------------------------------------------
A0A5Q3LBQ3      ----------------------------------------------------
A0A517LX75      ---EELATASR-----------------------------------------
A0A7C5W7B3      ----------------------------------------------------
A0A2S8F9B8      ----------------------------------------------------
A0A354GX32      ---AQ-----------------------------------------------
A0A142XL75      ---AISASPVTTERE-------------------------------------
A0A6P2D5D5      ---AIAAGPATTERE-------------------------------------
A0A5C1AAF0      ---EVKAEAR------------------------------------------
A0A7C7T8W8      ---EFAENTQ------------------------------------------
A0A5C6B3S0      ---ETSATIPEST---------------------------------------
A0A368KP63      ----------------------------------------------------
A0A518GIZ9      ---KPSIHRDLTISASLVRQP-------------------------------
A0A1C3EBY9      ---KSSTHRDLTISASPVRQP-------------------------------
D5SX64          ---KSSTHRDLTISASPVRQP-------------------------------
A0A517Z0U7      ----------------------------------------------------
A0A2S8FCC0      ---G------------------------------------------------
A0A1Z8MBT6      ----------------------------------------------------
A0A517SXN9      ----------------------------------------------------
A0A518HFL0      ---AGGPSAG------------------------------------------
A0A3B8ZJM2      ---GYGKYGKYGYGKYGKYTSYSTGYIEDRQAEAAEVSTKNDADTQS-----
A0A1U7CLW1      ---EPS----------------------------------------------
A0A142WPR7      ---HPASSLTSQS---------------------------------------
A0A3M1TFJ0      --------ARAGGSGA------------------------------------
A0A517P477      ---RLLERTPAQAAKI------------------------------------
A0A517T4K9      ----------------------------------------------------
A0A7C6B2Q1      ---VEDIQPESTES--------------------------------------
A0A7C4QPD3      ---EATAG--------------------------------------------
A0A2Z3GZZ5      ---DEDGARLVPAPTR------------------------------------
A0A4V0I6L6      ---K------------------------------------------------
A0A7C4QQT3      ----------------------------------------------------
A0A255QXF5      ---AGSNAE-------------------------------------------
A0A518KBI5      ---QIESDDAGRR---------------------------------------
A0A5C5V6Q5      ---SGGIEVSR-----------------------------------------
A0A517MY49      ---SAATRVPATTHERPHYEVPADVQTVQYAPPVVPHSATEPAAPIRPRKAA
A0A2E6AG00      ---------------------------XEPAADSSSSFSVXATPSQQIRRAA
A0A1G3A880      ---LIGA------------DRDHEPQGADEAIERPRPANEAADQIGPVKRVA
A0A2E8ATT1      ---QIST------------SKPAAGTPQEQVSPDPASKPSGAKKRVVPRRAA
A0A7C2JZW2      ---EPGPPRNQGAAVSADLVPA------------------------------
A0A518KYQ0      ---ETTHRN-------------------------------------------
A0A5B9QX47      ----------------------------------------------------
M5T666          ---T------------------------------------------------
M5U6N6          ---T------------------------------------------------
A0A517M0G2      ---TIENA--------------------------------------------
A0A5C6AST1      ----------------------------------------------------
A0A5C6C951      ---PDAVATPTPAGMPLHGGMNEQSVL-------------------------
A0A5C6C5T3      ----------------------------------------------------
A0A2A2W6A9      ---ETAHRS-------------------------------------------
A0A518HQS9      ---ETAHRN-------------------------------------------
A0A5M6DFE6      ---YS-----------------------------------------------
A0A5C6F286      ---DSYHDEEQASS--------------------------------------
A0A517NGN1      ----------------------------------------------------
M5RUI3          ----------------------------------------------------
A0A660VT66      ---------------------------------------GVRGIPGKELVRS
A0A7C2VEF7      ----------------------------------------------------
A0A0S8H0S8      -------------------------------------------ASAPSE---
A0A7C2ZTD2      ----------------------------NLLLPMQSSEDNINGTDSPNEKMN
A0A2E3Z6T8      MMTPMPEIVQLPSIASEEHLPSASPQEHQSHETPFQTKSANSTTPLKPRRVA
A0A257WQ92      --------------PVTREALVTQA---------------------------
A0A7C1U6X6      ----------------------------------------------------
A0A7C7UXI5      --------------EAAA-----------------GTERLKKPVRRSAREAA
A0A7C3SFJ0      --------------PSPT----------------------------------
A0A7C7WWF7      --------------ADG-----------GSDNGPEDDDRNDENGMVSPRRVA
A0A356ETW1      --------------ADDVESEVTTATPRDAHFHDTDPDEGGRPGRIVPRRAA
A0A3L7NJY1      --------------RDGVQTLPLHSSETDVRHVSDDKT----------KNAA
A0A523CME0      ----------------------------------------------------
A0A354PCV3      ----------------------------------------------------
A0A354PHB4      ----------------------------------------------------
A0A356ESF4      ----------------------------------------------------
A0A538RV31      ----------------------------------------------------
                                                                    

© 1998-2021Legal notice