BYKdb

Dataset for cluster orphancd of phylum planctomycetes

[Download (right click)] [Edit] [Sequences] [Repertoires]

207 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


M5S2L2          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A7C2VXA0      ------------------------------------------------------------
A0A7C3AA48      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A7C5PFV3      ------------------------------------------------------------
A0A7C3QGD2      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A7C2ZUK5      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
A0A7C2JY73      ------------------------------------------------------------
A0A356AE44      ------------------------------------------------------------
A0A1G2XSU7      ------------------------------------------------------------
A0A350KD81      ------------------------------------------------------------
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      ------------------------------------------------------------
A0A524HC32      ------------------------------------------------------------
A0A177PV03      ------------------------------------------------------------
A0A1G2YIM0      ------------------------------------------------------------
A0A1G2ZG92      ------------------------------------------------------------
A0A1G3A0W0      ------------------------------------------------MNPAEKEFQPQT
A0A353BE27      ------------------------------------------------------------
A0A5C6BPW1      ----------------------------------------------------------MM
A0A1I3GSP0      ------------------------------------------------------------
A0A517QJV1      ------------------------------------------------------------
A0A3C1QS25      MRRHACPTLLLDPYVWVHRACLVGTTGTSCECRARISPTRLKLAPPNRCPGRGPRYTEGS
A0A5C6FX55      -----------------------------------------------------MNRQFSV
A0A5C6DS51      ------------------------------------------------------------
A0A5C6DSL6      ------------------------------------------------------------
A0A3M1VG27      -----------------------------------------------------MNDDVPF
A0A518GC22      ------------------------------------------------------------
A0A3L7Q373      ------------------------------------------------------------
A0A3E0PW54      -----------------------------------------------------MVGFRPP
A0A7C3TAH2      ------------------------------------------------------------
A0A1Z8MHR4      ------------------------------------------------------------
A0A5C6EHJ0      ------------------------------------------------------------
A0A5C6F1H9      ------------------------------------------------------------
A0A255QXY0      ------------------------------------------------------------
A0A517SYI0      ------------------------------------------------------------
A0A518HX54      ------------------------------------------------------------
A0A5B9MF59      ------------------------------------------------------------
A0A2A2WC24      ------------------------------------------------------------
A0A518KYW8      ------------------------------------------------------------
A0A5C5YZZ0      ------------------------------------------------------------
A0A518JLD2      ------------------------------------------------------------
A0A5M6DJ15      ------------------------------------------------------------
A0A3L7P7S7      ------------------------------------------------------------
A0A517N8M1      -----------------------------------------------------MKATPLP
A0A5C6CW01      -----------------------------------------------------MKQSSDR
A0A5C6BXS9      -----------------------------------------------------MQVIPEP
M5U569          -----------------------------------------------------MSILSEF
L7CND7          ------------------------------------------------------------
A0A0J1B8S4      ---------------------------------------------------------MTP
F2ARR3          -----------------------------------------------------MELPSNA
K5D8H6          -----------------------------------------------------MELPSNA
M2AKU0          -----------------------------------------------------MELPSNA
A0A5B1CKI2      ------------------------------------------------------------
A0A5C6EG84      ------------------------------------------------------------
A0A5C6F2X4      ------------------------------------------------------------
A0A5C5XTV6      ------------------------------------------------------------
A0A5C6AAB1      ------------------------------------------------------------
M5T8W8          ------------------------------------------------------------
M5SF00          ------------------------------------------------------------
A0A2G1WDS1      ---------------------------------------------------------MTP
Q7UVS9          ---------------------------------------------------------MTP
A0A5C6B601      ------------------------------------------------------------
A0A517PFU1      ------------------------------------------------------------
A0A5B9M8J9      ------------------------------------------------------------
A0A2A2WFP6      ------------------------------------------------------------
A0A518L8N2      ------------------------------------------------------------
A0A518HQN9      ------------------------------------------------------------
A0A5M6D8H8      ------------------------------------------------------------
A0A5B1CRW9      ------------------------------------------------------------
A0A5C6EI46      ------------------------------------------------------------
A0A2E7D3V4      ------------------------------------------------------------
A0A5B9PER9      ------------------------------------------------------------
A0A517QSM4      ------------------------------------------------------------
A0A355GJI7      ------------------------------------------------------------
A0A1Z8MCI4      ------------------------------------------------------------
A0A517SYL7      ------------------------------------------------------------
A0A3L7P0L2      ------------------------------------------------------------
A0A6M5YVJ1      ------------------------------------------------------------
A0A2E0SHG0      ------------------------------------------------------------
A0A518CQB8      ------------------------------------------------------------
A0A517SCC8      ------------------------------------------------------------
A0A3A0DR44      ------------------------------------------------------------
A0A358MY60      ------------------------------------------------------------
A0A517MNB1      ------------------------------------------------------------
A0A7C1EH96      ------------------------------------------------------------
A0A142YJ13      --------------------------------------------------------MGTP
A0A517Z7D3      ------------------------------------------------------------
A0A1N6KY57      ------------------------------------------------------------
L0DK20          ------------------------------------------------------------
A0A3L7UX05      -----------------------------------------------------------M
A0A517XRC2      ------------------------------------------------------------
A0A6M5YH47      ------------------------------------------------------------
A0A660UUK3      ------------------------------------------------------------
A0A517ZHG5      ----------------------------------------------------------MM
A0A1Z8MPL5      ------------------------------------------------------------
A0A5C1AGE3      --------------------------------------------------------MRRS
A0A2Z3HEL7      --------------------------------------------------------MARP
A0A142XAP8      --------------------------------------------------------MARP
A0A6P2DEK1      --------------------------------------------------------MARP
A0A5C6C1R5      ------------------------------------------------------------
A6BZU4          ------------------------------------------------------------
A0A2D5GZ77      ------------------------------------------------------------
A0A3D3R1Z6      ------------------------------------------------------------
A0A517XG00      ------------------------------------------------------------
A0A1G2YRE4      ------------------------------------------------------------
A0A353Z859      ------------------------------------------------------------
A0A2D6ST10      ------------------------------------------------------------
A0A177QX42      ------------------------------------------------------------
A0A517SHR0      ------------------------------------------------------------
A0A2E0AW64      ------------------------------------------------------------
A0A351FZ59      ------------------------------------------------------------
A0A660V239      ------------------------------------------------------------
A0A177Q3B7      ------------------------------------------------------------
A0A2E0X6Y6      ------------------------------------------------------------
A0A518GFD7      ------------------------------------------------------------
A0A5C5VZJ8      ------------------------------------------------------------
A0A518GE37      ------------------------------------------------------------
A0A5C6F3H8      ------------------------------------------------------------
A0A5C5X072      ------------------------------------------------------------
A0A5C5WUQ3      ------------------------------------------------------------
A0A5C6E697      ------------------------------------------------------------
A0A5C5Z1A3      ------------------------------------------------------------
A0A5C6D2P7      ------------------------------------------------------------
A0A5B9ML17      ------------------------------------------------------------
A0A517LX75      ------------------------------------------------------------
A0A7C5W7B3      ------------------------------------------------------------
A0A2S8F9B8      ------------------------------------------------------------
A0A354GX32      ------------------------------------------------------------
A0A142XL75      ------------------------------------------------------------
A0A6P2D5D5      ------------------------------------------------------------
A0A5C1AAF0      ------------------------------------------------------------
A0A7C7T8W8      ------------------------------------------------------------
A0A5C6B3S0      ------------------------------------------------------------
A0A368KP63      ------------------------------------------------------------
A0A518GIZ9      ------------------------------------------------------------
A0A1C3EBY9      ------------------------------------------------------------
D5SX64          ------------------------------------------------------------
A0A517Z0U7      ------------------------------------------------------------
A0A2S8FCC0      ------------------------------------------------------------
A0A1Z8MBT6      ------------------------------------------------------------
A0A517SXN9      ------------------------------------------------------------
A0A518HFL0      ------------------------------------------------------------
A0A5Q3LBQ3      ------------------------------------------------------------
A0A3B8ZJM2      ------------------------------------------------------------
A0A1U7CLW1      -----------------------------------------------------MEPFRSS
A0A142WPR7      ------------------------------------------------------------
A0A3M1TFJ0      ------------------------------------------------------------
A0A517P477      ------------------------------------------------------------
A0A517T4K9      ------------------------------------------------------------
A0A7C6B2Q1      ------------------------------------------------------------
A0A7C4QPD3      ----------------------------------------------------------ME
A0A2Z3GZZ5      ------------------------------------------------------------
A0A4V0I6L6      ------------------------------------------------------------
A0A7C4QQT3      ------------------------------------------------------------
A0A255QXF5      ------------------------------------------------------------
A0A518KBI5      ------------------------------------------------------------
A0A5C5V6Q5      ------------------------------------------------------------
A0A517MY49      ------------------------------------------------------------
A0A2E6AG00      ------------------------------------------------------------
A0A1G3A880      ------------------------------------------------------------
A0A2E8ATT1      ------------------------------------------------------------
A0A7C2JZW2      ------------------------------------------------------------
A0A518KYQ0      ------------------------------------------------------------
A0A5B9QX47      ------------------------------------------------------------
M5T666          ------------------------------------------------------------
M5U6N6          ------------------------------------------------------------
A0A517M0G2      ------------------------------------------------------------
A0A5C6AST1      ------------------------------------------------------------
A0A5C6C951      ------------------------------------------------------------
A0A5C6C5T3      ------------------------------------------------------------
A0A2A2W6A9      ------------------------------------------------------------
A0A518HQS9      ------------------------------------------------------------
A0A5M6DFE6      ------------------------------------------------------------
A0A5C6F286      ------------------------------------------------------------
A0A517NGN1      ------------------------------------------------------------
M5RUI3          ------------------------------------------------------------
A0A660VT66      ------------------------------------------------------------
A0A7C2VEF7      ------------------------------------------------------------
A0A0S8H0S8      ------------------------------------------------------------
A0A7C2ZTD2      ------------------------------------------------------------
A0A2E3Z6T8      ------------------------------------------------------------
A0A257WQ92      ------------------------------------------------------------
A0A7C1U6X6      ------------------------------------------------------------
A0A7C7UXI5      ------------------------------------------------------------
A0A7C3SFJ0      ------------------------------------------------------------
A0A7C7WWF7      ------------------------------------------------------------
A0A356ETW1      ------------------------------------------------------------
A0A3L7NJY1      ------------------------------------------------------------
A0A523CME0      ------------------------------------------------------------
A0A354PCV3      ------------------------------------------------------------
A0A354PHB4      ------------------------------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A538RV31      ------------------------------------------------------------
                                                                            

M5S2L2          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A7C2VXA0      ------------------------------------------------------------
A0A7C3AA48      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A7C5PFV3      ------------------------------------------------------------
A0A7C3QGD2      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A7C2ZUK5      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
A0A7C2JY73      ------------------------------------------------------------
A0A356AE44      ------------------------------------------------------------
A0A1G2XSU7      ------------------------------------------------------------
A0A350KD81      ------------------------------------------------------------
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      ------------------------------------------------------------
A0A524HC32      -------------------------------------------MPGDKDKTDAV------
A0A177PV03      ------------------------------------------------------------
A0A1G2YIM0      ----------------------MNDIEKISAGRIISTELAGYGTMASNASNSEG------
A0A1G2ZG92      ------------------------------------------------------------
A0A1G3A0W0      DPIVQERDYSNGPGKESRSSEIVLSAEEIINPPHVTPWPNRLMRAGGSGPSVPL------
A0A353BE27      -------------------------MSDVVLDQRNVNGQPSPVPGGAPEAQSEGS-----
A0A5C6BPW1      QSNQEPNHYRNGNAGVPAYTNGGGGGGGALVPVGNGMDPSPAPMAGNEGAGQV-------
A0A1I3GSP0      ----------------------MTAPQKQPNAAAEFDFAPFGFHKATAGRSID-------
A0A517QJV1      ----------------------------------------MSGNSASSRASID-------
A0A3C1QS25      DISTGIHHGSTPGDGPLFPRFGWSTFVAQMPVEGRPAWAEMGPPMGTEPESQ--------
A0A5C6FX55      LSPPSERTPSCGGILYYFNEIRMSTNELSNRPYSNSPAMMQAPIAMMDRDGADGGKNE--
A0A5C6DS51      ----------------------------------------MPSNSSEQNVGHQS------
A0A5C6DSL6      ----------------------------------------MRPQSSEQAVGNQS------
A0A3M1VG27      RFADGVAGAPAVSTDRITTVQRPGDVATPGAPSPPIELMRRQ------------------
A0A518GC22      -------------------------MSDVAMDQPRTNGQLAIPGAPEAAPQEGS------
A0A3L7Q373      ------------MWWRLPETSDVTQRSQLPVVAPSIDFAPLGFQKSNDGRSID-------
A0A3E0PW54      GESGTAFALTVSRPPVAPSARHSHERTDMPAPQHNVDFAPLGYRQPDEGK----------
A0A7C3TAH2      ---------MSDLEQYIDKVIEPRPAQQALPRPGVPAAYAVPAVHAGTGDQQLE------
A0A1Z8MHR4      ---------------------------MLDMPPSTPVGFDTSGAYGSQNQSPAN------
A0A5C6EHJ0      -----------------------MNQQAKPREVTSREMSDKRPPQQPMPQSALA------
A0A5C6F1H9      -----------------------MNQMQSQDETRSPDLADRRGREMAASPVGGG------
A0A255QXY0      ---------------------------MLPLHSSTSSNDLRSIADGS---QDEH------
A0A517SYI0      ------------------------------MPPSTPVGFDTSGAYGSQNQSPAN------
A0A518HX54      ---------------------------MLEPSPPHVHADTFHARQPD-DIGRLQ------
A0A5B9MF59      ---------------------------MLDQTTTQPGNYEASVSLGP-SQEHHH------
A0A2A2WC24      -----------------------MYSSMLDQTSPQPVNYDSSVTLDP-AQEQHH------
A0A518KYW8      ---------------------------MLDQTSPQPVNYDSSVTLDP-AQEQHH------
A0A5C5YZZ0      ------------------------------MQPAPPSSTNRSGSELMNNMQSAS------
A0A518JLD2      ------------------------------------------------------------
A0A5M6DJ15      MEFINGNGSGDGDDRGLLTEPRSLRTSRPRVNGSSPVMPPPVVQGTIDDDEPQF------
A0A3L7P7S7      --------------------------------------------MSQEGGRLPE------
A0A517N8M1      EPRFSDSRLSDPSTAFGSSAQPE----------------------------QQ-------
A0A5C6CW01      GLAYSQAPAITGADRSMSDTS------------------------------AD-------
A0A5C6BXS9      ESDRST-------------------------AVGSYPTHAPAWEGGK----HE-------
M5U569          QSDRSGSYQTLGSPATGVGMPEGPSG-------------------------DS-------
L7CND7          --------------------------------------MNEGWRSGGSAEPAD-------
A0A0J1B8S4      NSNSTDPTAGKRGPNSFASYPSQNAGTMGLAATGSYPAMNEGWGSADQG---D-------
F2ARR3          SSDSRSQGASTRGKEAFASYPSPNPGAMGLAAQGSYPAMNTGWQPTHQAA-NE-------
K5D8H6          SSDSRSQGASTRGKEAFASYPSPNPGAMGLAAQGSYPAMNTGWQPTHQAT-NE-------
M2AKU0          SSDSRSQGASTRGKEAFASYPSPNPGAMGLAAQGSYPAMNTGWQPTHQAT-NE-------
A0A5B1CKI2      -------------------------MQATAPPSPQLAQKLDPF--STAPGTNAQ------
A0A5C6EG84      -------------------------MKVQQLTEPRFSDPSGAF--AAPSEAEDK------
A0A5C6F2X4      -------------------------MKAQQLTEPRFSDPNQGL--TASAQTENQ------
A0A5C5XTV6      ------------------MQVIPESESDRPTPVGAYPAPAPSWQGGKP-----E------
A0A5C6AAB1      ------------------MQANPDSDFERPVVMGAYPAQNPGWQGDSAAAAGGD------
M5T8W8          --------------------------------------------MSTPDGPSVD------
M5SF00          ---------------------------MGQAAMGSYPAMNEGW-GSSGSSQTAE------
A0A2G1WDS1      NSNSTDSTAGKRGPNSFVSYPSQNAGTMGQAAMGSYPAMNEGW-GSSGSAQTAE------
Q7UVS9          NSNSTEPSAGKRGPNSFASYPSQNAGTMGQAAMGSYPAMNEGW-GSSGSAQTAE------
A0A5C6B601      --------------------------------MLEQDIHQINDAAAGEDLPGLS------
A0A517PFU1      --------------------MPSFAASGSSFPGEDPQAEGYGRGGDGPNAPRSHAVTGYD
A0A5B9M8J9      -----------------------------MLDHSTPHLHSHAGRLMDQDVELPQ------
A0A2A2WFP6      -----------------------------MLEQLPPHVHSDTGHAMERDGGRLQ------
A0A518L8N2      ---------------------------------------------MERDGGRLQ------
A0A518HQN9      -----------------------------MLDQASPHSAIQDANGSADLLPEHH------
A0A5M6D8H8      -----------------------------MLDQTSPSQQTHEISGAIDSVQDVQ------
A0A5B1CRW9      ------------------------------------------MTKPSKTISMVT------
A0A5C6EI46      ------------------------------------------MADANKSMGLSP------
A0A2E7D3V4      -----------------------------MDNSENRPVERPFEFAVLSENSDKP------
A0A5B9PER9      ---------------------MEPNNNQIGQYQNPNQMGSPMGMPPVMMAQDDD------
A0A517QSM4      -------------METQLTSDSSSSLTSVNPVHEVAQPRATSVGPHPNQGNEAI------
A0A355GJI7      ------------------------------------------------------------
A0A1Z8MCI4      -----------------------------------------MDDLDKIETSQAI------
A0A517SYL7      -----------------------------------------MDDLDKIETSQAI------
A0A3L7P0L2      ----------------------------MNKRSSLPVAEPDVDFAPLGYHKSQE------
A0A6M5YVJ1      ------------------------------------------------------------
A0A2E0SHG0      --------------------------------------MPTAPLPETLSSQSPL------
A0A518CQB8      --------------------------------------MPTTPPPEQQTSQSPL------
A0A517SCC8      -----------------------MNEVEPVNMPQNARSSESVEFAPLGVVSGNK------
A0A3A0DR44      -----------MSSPHVSESALIAQTAGPPALLRPPPIQFGGPPKPAPQTGAGI------
A0A358MY60      ----------------MDKVKSIIDQQAV--PALPRSGAGQPMPQPAADSVNFD------
A0A517MNB1      ----------------MDNRITPSNEYRVDRSAAPRGPVERRVEPPAAKGQEFD------
A0A7C1EH96      ------------------------------------------------------------
A0A142YJ13      GPNALHAEELPTVLPRREEAVAHGEMMIPVDRIAQRSVAVPSNLEPAPGTTDAP------
A0A517Z7D3      ------------------------------MSTQTPTHESDIEFAPLGHASSSP------
A0A1N6KY57      -------------MMLNSNPGSRPDSVNLPATIPPHRKDSFADSSAVMGSSTSL------
L0DK20          -------------MMSNSNFGPQPNSANLPAVVPPHRAEVFSVSSPPAGPVAGL------
A0A3L7UX05      IGPKIPMNNHQNEAMNQSLSPQLPVHQQGYGQGAALWNAHQHDSHEPENQSKGM------
A0A517XRC2      --MARSNNGENPPTGPLQPYNNPPGGM--LAPGGGP--YGPSVTIPGGTGKTPP------
A0A6M5YH47      --MARPIAGDPPAGSPPAPFPTGSGGLPPVQAGASPFNYTNQPSLPGSAVQTTP------
A0A660UUK3      --------------------------MADLERYENRMVQQEVVQFDGPPDGHEG------
A0A517ZHG5      QSNQEPNHYRNGNAGVPAYTNGGGGGGGGALVPVGNGMEPSPASMGGNEGAGQV------
A0A1Z8MPL5      ------------------------------------------------------------
A0A5C1AGE3      PEGDQQGNAALAQYSAPTYSIP--GG-AYSAAPSPV------SLPSPVGNRNVP------
A0A2Z3HEL7      IAGD-------PPASPPPAPFPTPGGVPAPVAPSPFSYTNQPSLPGPT-VSSAP------
A0A142XAP8      IAGD-------PPMMQPPYQVPQSGG-PVPVALSPFNYTNQPNIPGPA-VAATP------
A0A6P2DEK1      IAGD-------SPMIQPPYQAPQSGV-PVPVVTSPFNYTNQPNIPGPV-VVGTP------
A0A5C6C1R5      MDNHHLNGTGVPAVLEPSRGQRSSSSGQSISYADNSSGWSESPRAEVESQENFD------
A6BZU4          --------------------------MNTDFQPLDQQSDFAIDGMEENAEVNSS------
A0A2D5GZ77      --------------------------MNTDFQPLDQQSDFGIDGMEENAEVNSS------
A0A3D3R1Z6      --------------------------MNTDFQPLDQQSDFGIDGMEENAEVNSS------
A0A517XG00      --------------------------MNTDFQPLDQQSDFGIDGMEENAEVNSS------
A0A1G2YRE4      --------------------------MNNLEKYADRLLEQKLVNTGTPPEFNGQ------
A0A353Z859      ----------------MSTDQMNGQGAMVPVRRNEVGMPGPAVGGAPANSGIVV------
A0A2D6ST10      ---MDHTTRTSDTSAPAAGNETNGANDNGTLSVPAPLVLPLSVVNAADGEEATV------
A0A177QX42      ---------------------MFHLEIRVSTTTTDWQAP---NNPALEEQPNEK------
A0A517SHR0      ----------------------------MSTTTTDWQAPTPITPSATEEQPTDK------
A0A2E0AW64      -------------------------------MNLSTSQPPPLNSSTESESAAQL------
A0A351FZ59      -------------------------------MNLSTSQPPPLNSSTESESAAQL------
A0A660V239      --------------------------MDELQRYQPQPLGQEVVQFEGPVEDQSD------
A0A177Q3B7      -----------------------------------------MSGPDSGRATAPS------
A0A2E0X6Y6      ----------------------------------MNSELDSNLAQEGPASSEIV------
A0A518GFD7      -------------------MVTDRVNGTNGQRTNAQQQIVVARPVKGGPEPSGP------
A0A5C5VZJ8      -------------MSESEVHDTTQPVRALAKAGPIGPAGALAAPLIIDADAGAA------
A0A518GE37      --------------------------------------MQNPATAKNASPPAFD------
A0A5C6F3H8      ----MTTSRKKNAKPTHSKPTHSKLSGTVPSAAPRSSSKARAHAPVDSESSSFD------
A0A5C5X072      ------------------MTQHLNHQGSRTSIVGPPRAKAAANSPSNDAAKAFD------
A0A5C5WUQ3      ---------------------------MNTNYISSERATETSYRPSARPENQFD------
A0A5C6E697      ---------------MNDTQQLTKTSPHAREETTKAVPSRTVSTPPKDAAAAFD------
A0A5C5Z1A3      ---------------------------------------MTASN--SGASTQFD------
A0A5C6D2P7      --------------MNDHKATSGHAGRIAPPPLPTAVPSKSIAA--TSSAGQFD------
A0A5B9ML17      ------------------------------MNQSVVVSAPIARNQPKTEAKAFD------
A0A517LX75      -----------------------------------------MNESETHRIAEQD------
A0A7C5W7B3      ------------MSRQPPAPPFDMGNILRAQRKLLLGGGQHVSPQPHAEPPERS------
A0A2S8F9B8      ------------------MTNGNLVIPSDRDRHASKADVPGAVIGMRPPEENGM------
A0A354GX32      ------------MMPHDPNAMKTKTASPAGPITPAAASTEQAAPAPPGLSAPPG------
A0A142XL75      -----------------------------------------------------M------
A0A6P2D5D5      -----------------------------------MTQISGNGQAPPEKRATTL------
A0A5C1AAF0      -----------MALNEQLTPVAKSVDVVVHRAELIGGTGAGSAPAVGAPGLALT------
A0A7C7T8W8      ------------------MHSQNGTHVNDTSGTPHNGMPVNTLPAPQSVFRGLS------
A0A5C6B3S0      ------------------MSTDPLPNGQSQMIVLPHDLDWGDDQDAGNRDSSGG------
A0A368KP63      ------------------MSNGNLVIPSDNNRQAASVNVPGRVVDVRSSDEDSN------
A0A518GIZ9      ----------------------------------MRQTPQDSELASSFETEGEG------
A0A1C3EBY9      ----------------------------------MRQTPQDSELASSFETEGEG------
D5SX64          ----------------------------------MRQTPQDSELASSFETEGEG------
A0A517Z0U7      --MDRNGDPQYVPEPGTPGNGHMVEPPVPAHAPPQPVQVMGGNPAGEEQQEGGI------
A0A2S8FCC0      ------MSTDQTSLPVERTNREIRFDSPIDLTPGSSNEFPHINDVVEMDDTGGT------
A0A1Z8MBT6      ------------MPSERFWTPLQIVLMTTESTSNIASRQSSHSNASTGEGAPID------
A0A517SXN9      ------------MPSERFWTPLQIVLMTTESTSNIASRQSSHSNASTGEGASID------
A0A518HFL0      -----------MDTADSPRPGHELARLTELPPALRVPPPPASRTSSPGGGLPIN------
A0A5Q3LBQ3      ----------------------------MATKAILPAIRQAPALPAETNPAQPI------
A0A3B8ZJM2      ------------------------------------------------------------
A0A1U7CLW1      SFINGIPTVLSQEQGASAPTPVELLPVDRIVPGYGASLKAVEPPPGLSEMPDLD------
A0A142WPR7      --------------------------------------MGIRGDFEDELSEKSD------
A0A3M1TFJ0      -----------------------------------MDSRESQLGRLEDEDELHE------
A0A517P477      --------------------------------MAAARTPRPPVSQPVADEHFQI------
A0A517T4K9      ----------------------------MLPALPAGQVPAITTAMMPAESRPID------
A0A7C6B2Q1      -------MSQHERLPEPSSGVPVGLPPSLSAGQSGPLYVDAEWHPLAGGQGTNE------
A0A7C4QPD3      TGDNDNTSASVNGALRVVPEGTASRGAAKVRAKAAPSLSARAFRAPEGDPQGYL------
A0A2Z3GZZ5      --------------------------------MADTDKNTAAPPDDDEPASGLN------
A0A4V0I6L6      -----------------------MATLNPLLDPASQSSASIILPPVAAEPPAEQ------
A0A7C4QQT3      -------------------------------MTRELEFHPGRLPSHVHPDEEAD------
A0A255QXF5      -------------------------MQQHTPRQHQGAPYHFNGPSSGPDSGGFD------
A0A518KBI5      --------MSDHTKTDETQLPIRRVD-NGIVKHDAYHRHPRPVNNSGPAPSHFT------
A0A5C5V6Q5      --------MSKHEHPTEPNFMLQRVDQSGSPQPIATQSNSRHWSAPQNAPQQFT------
A0A517MY49      MNIDQDPAHREDNDSTSTSELLKTFM----------------------------------
A0A2E6AG00      -MTRQSTSSVSNLLPTTGSHVLHNAM----------------------------------
A0A1G3A880      --------------------MVYAVL----------------------------------
A0A2E8ATT1      -MSRDSHYNEQN----STSEAVRAVL----------------------------------
A0A7C2JZW2      MGGDSVLSPSEVAARSPMSTGMSAADAPQAKANGRPSASSQAATRPREAHTGPH------
A0A518KYQ0      ------MDHQSNQLQPYHAG------------------PVVRVPASSEPTNSFD------
A0A5B9QX47      ------MTTHAPPKGIP---------------------GYSAGSPGAAPPFQFD------
M5T666          ------------------------------------------------------------
M5U6N6          ------------------------------------------------------------
A0A517M0G2      ------MQKTPTSSPQAASQFRNHARP-----------PVRAAHGAPSGSTDLD------
A0A5C6AST1      ------MNPG-SGP---RSNGVRTYE------------GLRRPDEKPNSGYEFD------
A0A5C6C951      ------MSPHPNGPDSRRQNSSGRAK------------VKRSAHGNDKSNIEFD------
A0A5C6C5T3      ------MSHNHNNLGGHASVPGTQG-------------RTLPAPSGDAAAKAFD------
A0A2A2W6A9      ------MDHQSNQLQPYHTG------------------PVGRMPVSNEPPNAFD------
A0A518HQS9      ------MDHQSNQLQPYHNG------------------PVVRMSASSESPNAFD------
A0A5M6DFE6      --------MVAQNSTGTHSMTLHTNQPGHGHPGHGPGHHRPGHPGHGHSSNAFD------
A0A5C6F286      ------MATSRKKTTTPNRNPETGADRDQARPRRKGPVMTGPPSRAATDETSFD------
A0A517NGN1      --------------MHPSRS------------------ASSASIGDAASGASFD------
M5RUI3          ------MQSNANRVNGNDRP------------------IGRLSGPSAGANSQFD------
A0A660VT66      ------------------------------------------------------------
A0A7C2VEF7      ------------------------------------------------------------
A0A0S8H0S8      ------------------------------------------------------------
A0A7C2ZTD2      ------------------------------------------------------------
A0A2E3Z6T8      ------------------------------------------------------------
A0A257WQ92      ------------------------------------------------------------
A0A7C1U6X6      ------------------------------------------------------------
A0A7C7UXI5      ------------------------------------------------------------
A0A7C3SFJ0      ------------------------------------------------------------
A0A7C7WWF7      ------------------------------------------------------------
A0A356ETW1      ------------------------------------------------------------
A0A3L7NJY1      ------------------------------------------------------------
A0A523CME0      ------------------------------------------------------------
A0A354PCV3      ------------------------------------------------------------
A0A354PHB4      ------------------------------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A538RV31      ------------------------------------------------------------
                                                                            

M5S2L2          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A7C2VXA0      ------------------------------------------------------------
A0A7C3AA48      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A7C5PFV3      ------------------------------------------------------------
A0A7C3QGD2      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A7C2ZUK5      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
A0A7C2JY73      ------------------------------------------------------------
A0A356AE44      ------------------------------------------------------------
A0A1G2XSU7      ------------------------------------------------------------
A0A350KD81      ------------------------------------------------------------
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      ---------------------------------------------------MDYKDSPEF
A0A524HC32      ------------------------------------------------------------
A0A177PV03      ------------------------------------------------------------
A0A1G2YIM0      ------------------ASMNLWPAICRHW-RALLVTFMIAAGMGTPLIW--FAVKPMY
A0A1G2ZG92      ----------------MEFLKIWEILSRRKWIFISAFLGFFGIVVIGTILI-----TPTY
A0A1G3A0W0      ------------------ANDILGSFLRFKW--TVLFVFLLVSAPAIAIIW--MQIVPKY
A0A353BE27      ------------------NFDFVQILWRWKW-LPILGSIV--GACLGFLYF--SRLPETF
A0A5C6BPW1      ------------------DPKALLNAFRRRW-FLAVTVGLFCGGSAAAAVY--LLVPPNY
A0A1I3GSP0      ------------------IVSFVLSLWK----PMAIGLFL--GLLVGVGLY--LMMGPVY
A0A517QJV1      ------------------IGRFLLSIWK----PLILGGCL--GGMAGIGMY--LFLGPIY
A0A3C1QS25      ------------------RFDFLAMAWRRKW-LIAFGLMV--GLGLGFLAY--KQQTPIY
A0A5C6FX55      ------------------MPNIGAAMWRYRW-AVALPTML--GMVAGFLLF--LRTNETF
A0A5C6DS51      ------------------VELDIIGLIRRRWYHLVLGTVF--GVGVGLLYF--YATTPMY
A0A5C6DSL6      ------------------IELDFIGLFRRRWHHLLIGICV--GIAIGLLYF--YSTTPMY
A0A3M1VG27      ------------------QFDPLEIGLRYRV-WIGLAILA--GLLLGGLAY--WKFGPTY
A0A518GC22      ------------------SFDIVQILWRWKW-LPILGSIV--GACLGFLYF--SRQPATY
A0A3L7Q373      ------------------IVRFAMSIWK----SLAIGLMA--GCGLGVLAY--LYSGPTY
A0A3E0PW54      ------------------SIDILKFTMSIRN-MLIAGLAV--GLLVGVGVY--MCLGPAY
A0A7C3TAH2      ------------------QPNVLKGILR-RWYIALGVFILLAGLGIPAIWL--LVEPK-Y
A0A1Z8MHR4      ------------------GESVLTILWRYKW-LIGMLLLA--GLIIGYWNY--KRTPTTF
A0A5C6EHJ0      ------------------SIDFAKIAWNSKY-LLILGMLL--GLGCGYFYF--SRTPATY
A0A5C6F1H9      ------------------HLDYAKVAWNARY-LLALGTLI--GLAVGYFHF--TRQPAMY
A0A255QXY0      ------------------GQAVLSILWRFRY-LVAICVVI--GVGVGHWYH--RQKPAQY
A0A517SYI0      ------------------GESVLTILWRYKW-LIGMLLLA--GLIIGYWNY--KRTPTTF
A0A518HX54      ------------------GEPIGTVLWRYKW-LIGVLLPI--GTLLGYWVN--RQKPMTY
A0A5B9MF59      ------------------GETILTVLWRFKW-LLTAFVAV--GTSVGYWMY--KQKPTTY
A0A2A2WC24      ------------------GETILTVLWRFKW-LLAAFVAI--GTSIGYWMY--KQKPTTY
A0A518KYW8      ------------------GETILTVLWRFKW-LLAAFVAI--GTSIGYWMY--KQKPTTY
A0A5C5YZZ0      ------------------DVSVGGVLWRRKG-LILFLILC--GLGGGYWFF--TQQEETF
A0A518JLD2      -----------------MQIDWVKLIWGGRW-LLLLGLLV--GLGAGYFHF--KTLPPEF
A0A5M6DJ15      ------------------DPAVIRHSVRRRWPLALIFGLMLAPLLAGAAWI--ALKPKDM
A0A3L7P7S7      ------------------DAMNIFRMLQQRMGLIAVLAVL--GLVAGGLFT--LRMLPAY
A0A517N8M1      ------------------AINVAAAVWRYRW-AVAIPVLI--GAVCGLMIY--LQLPETY
A0A5C6CW01      ------------------STNLLASLWRYRW-AVILPAIV--GATAGFLLY--LKTPETF
A0A5C6BXS9      ------------------TTDMLAAVWRYRW-AVLIPAVL--GLVGGLLMY--LKTPETF
M5U569          ------------------GPDMLAAIWRYRW-AVIIPAIL--GAAGGFIAF--LKTPETF
L7CND7          ------------------AGDLMGAIWRYRW-AAFVPAIL--GAVIGFLVF--VKTPETF
A0A0J1B8S4      ------------------ASDLLGAIWRYRW-AAMGPTIL--GAMIGFLVF--IKTPETF
F2ARR3          ------------------TADIAAAIWRYRW-AVLIPTIL--GLVAGFLAF--VKTPETY
K5D8H6          ------------------TADIAAAIWRYRW-AVLIPTIL--GLVAGFLVF--VKTPETY
M2AKU0          ------------------TADIAAAIWRYRW-AVLIPTIL--GLVAGFLVF--VKTPETY
A0A5B1CKI2      ------------------PVNVAEVLWRYRW-AVALPVVV--GAVVGLLIY--LQLPETY
A0A5C6EG84      ------------------AVNIADAVWRYRW-AVAIPVVV--GAVCGLLIY--LQLPETY
A0A5C6F2X4      ------------------AVNIADAVWRYRW-AVALPVIV--GAVCGLLIY--LQLPETY
A0A5C5XTV6      ------------------TTDMLSAIWRYRW-AVLIPTVI--GFVCGLLLY--LKTPETY
A0A5C6AAB1      ------------------SADLVAAIWRYRW-AVIVPGIL--GLLFGFLFY--IKTPETF
M5T8W8          ------------------SADMVASIWRYRW-AVIIPAIL--GAAGGFIAF--LKTPETF
M5SF00          ------------------SADLMGAIWRYRW-AALVPTIL--GAVIGFLVF--VKTPETF
A0A2G1WDS1      ------------------SADLMGAIWRYRW-AALVPTIL--GAVIGFLVF--VKTPETF
Q7UVS9          ------------------SADLMGAIWRYRW-AALVPTIL--GAVIGFLVF--VKTPESF
A0A5C6B601      ------------------GESMLTVLWRFKW-LLVIFTAV--GLGVGYWVY--QRKPTTY
A0A517PFU1      ANGGWGAQSAGGDAATEEGFQLGRLLRRRWW-VLLLGLAS--GLGGGYLYD--LYQPPVY
A0A5B9M8J9      ------------------GETIATVLWRYKW-LIGILLPL--GTLLGYWVN--CQKPTTY
A0A2A2WFP6      ------------------GEAIGTVLWRYKW-LIGILLPI--GTLLGYWVN--RHKPVTY
A0A518L8N2      ------------------GEAIGTVLWRYKW-LIAILLPI--GTLLGYWVN--RQKTVTY
A0A518HQN9      ------------------GESILAVFWRFKP-LILVLVII--GTGVGYWRY--HEKPTTY
A0A5M6D8H8      ------------------GESILTVLWRFKW-LLGVFLAA--GTGVGYWIY--KQKPTTY
A0A5B1CRW9      ------------------GEIDPIGMIRRRWRLLTFGAVM--GVLLSGLYF--QTAKKSY
A0A5C6EI46      ------------------NELDISGMIRRRWRLLVFGMVV--GVGLSILYF--KTAPRVY
A0A2E7D3V4      ------------------KVEFDVVQIALRH-KKIISIGVICGLVIGHLAY--KQAGPEY
A0A5B9PER9      ------------------EAAFDFWGVLNRR-KWLVFLGLVTGLALGALVY--AKSETIY
A0A517QSM4      ------------------DTRALLNSVRRNW-FVATLLGLIFGTGAAVATW--VYVPAPY
A0A355GJI7      ------------------------------------------------------------
A0A1Z8MCI4      ------------------GLGLILQTARRHL-LWVLPTGFVLCALVFLLLH--DWKVDRY
A0A517SYL7      ------------------GLGLILQTARRHL-LWVLPTGFVLCTLVFLLLH--DWKVDRY
A0A3L7P0L2      ------------------GRSIDIVRFAISM-WKYLIAGLVLGCGMGGLAY--LYMGPVY
A0A6M5YVJ1      --------------------------------------MFLLALAAGAAAW-CLLALPKT
A0A2E0SHG0      ------------------HGILDVLSILRRR-IGIILFFVVVGVALGTLGI--LQLKEKW
A0A518CQB8      ------------------QGVLDVLSIIRRR-KGIILFGIIVGAALGTLAI--LKLPEKW
A0A517SCC8      ------------------GRSIDIARFALSL-WKPMVLGLVAGCLMGLGAY--SYLGPTF
A0A3A0DR44      ------------------TIGFVYRSFQHWW-RVAIPAGLVCALLAGAAVW--LTWTPKY
A0A358MY60      ------------------PRVLVS-TWRHCW-FWATPLGVALGCAAAFTVY--ASFVPMF
A0A517MNB1      ------------------PRLIWV-TFRRCW-LWAVPLGLALASVAAYAVF--ATFVPMY
A0A7C1EH96      ------------------------------------------------------FMPDKY
A0A142YJ13      ------------------DLIGLLRALRRRW-RLAFLGGLSCASLAAAAAF-YYLPSPKY
A0A517Z7D3      ------------------GKSIDIINFTLSI-WKPLALGIVAGGILGVLMY--LRMGPVY
A0A1N6KY57      ------------------DPFMLLKALRRRW-AMALGIGLVGAGVIGFTTY-LLVPAAKY
L0DK20          ------------------DPVAMLKALRRRW-PLALGAGLLGGAVLAFATY-FLVPPAKY
A0A3L7UX05      ------------------NLATVWRSIRRYW-WQAGLLWVISSGVLMFLAF--TSVKPTF
A0A517XRC2      ------------------TPLGLLNALRRRW-VLATFLGLLVGSALGTGVW--FILPGGK
A0A6M5YH47      ------------------TAMGLFNAFRRRW-VLSTFIGGLVAAAVAVGAW--VALPGGK
A0A660UUK3      ------------------SVTELIVPILRRW-YVIMATFIVVCGIGVPAIW--FGMEQKY
A0A517ZHG5      ------------------DPKALLNAFRRRW-FLAVTVGLFCGGSAAAAVY--LLVPPNY
A0A1Z8MPL5      ---------------------------------------MLFAIPAGLGTW--FLVPVNY
A0A5C1AGE3      ------------------TFMGLLNALKRRW-VLASFLGLLVAAAAAVALW-IAAPQGKH
A0A2Z3HEL7      ------------------TPSGLWNAFRRRW-VLSTFVGALVAAAVAVGAW-LAMPAGKH
A0A142XAP8      ------------------TPLGLLNAFRRRW-VLGTFIGGLVAVAVAVGIW-LALPTGKH
A0A6P2DEK1      ------------------TPLGLLNAFRRRW-VLSTFIGGLVAVAVAVGIW-LALPAGKH
A0A5C6C1R5      ------------------PLSVFH-SLRRHW-PVALLTGLLLAPPMAVVGW--FLLAPKD
A6BZU4          ------------------GPGVDIVRLLLRN-KYLLVLGLATGLLLGQAAY--MKLGPIF
A0A2D5GZ77      ------------------GPGVDIVRLLLRN-KYLLVLGLATGLLLGQAAY--MKLGPIF
A0A3D3R1Z6      ------------------GPGVDIVRLLLRN-KYLLVLGLATGLLLGQAAY--MKLGPIF
A0A517XG00      ------------------GPGVDIVRLLLRN-KYLLVLGLATGLLLGQAAY--MKLGPIF
A0A1G2YRE4      ------------------GSPDLIKGILHRW-YILLLGFSIMCAIGLPAIW--LSIKPQY
A0A353Z859      ------------------DQNTVLAAMRRRW-LIATALGLTGALVGAATTW--LLIPVTY
A0A2D6ST10      ------------------NFHVLWGAFRRRW-LLASVLGLIFGVAAAAAAW--ELLPAPF
A0A177QX42      ------------------GLDFFTAIMGRKF-LVVAFIGIGLGLGHLHF----TRQPPVF
A0A517SHR0      ------------------GLDVFNAIMGRKF-LVVAFIGIGIALGHLYY----TRQPPVY
A0A2E0AW64      ------------------SPMLVLEAARRWW-AIATPVGLLAGLIVAAILY--LQFEPLY
A0A351FZ59      ------------------SPMLVLEAARRWW-AIATPVGLLAGLIVAAILY--LQFEPLY
A0A660V239      ------------------STMNLAAAILRRW-PVLVATFVVVCAVGVPAIW--FLVEKKY
A0A177Q3B7      ------------------PWELLR-AFRRCW-FPATSLGLLVALLAAGAVW--YLLPNRF
A0A2E0X6Y6      ------------------SAAMRFLRLIRRR-QNVLLVALALCSAVGAAVY--IAAPRYY
A0A518GFD7      ------------------NLSAALGSLRRWW-WIGLPLGVLLGVAGAVAGW--LAMVPKY
A0A5C5VZJ8      ------------------PSTPVSLAMLWRF-KWTIAGTFMLCAAAGLGLI-WTAIRPAY
A0A518GE37      ------------------PWLLWI-AFRKHW-GWVLPMGFLFASAAGLAVW--SQFVPEF
A0A5C6F3H8      ------------------PWILWV-TFRRCW-PWAVPAGMVLAGVAAMFVL--QGFVPRY
A0A5C5X072      ------------------PWIIWV-TFRRCW-PWAVPVGAALAGIAAFVVM--QGFVPEY
A0A5C5WUQ3      ------------------PWILWV-TFRQCW-PWAVPCGAILSAITAFVVL--QNFTPTY
A0A5C6E697      ------------------PWILWV-TFRRCW-FWALPLGILLGGFSVYYVN--RTFVPTY
A0A5C5Z1A3      ------------------PWILWV-TFRRCW-FWVLPIGAVLAALASFGVL--STFVPTY
A0A5C6D2P7      ------------------PWLIWH-TFRRCW-PWALPIGIILAGAAALAVQ--RTFVPEY
A0A5B9ML17      ------------------PWLLWV-TLRRCW-YWAVPVGLVLACLAAFSVL--ATFEPRF
A0A517LX75      ------------------SFEIDILRLLRRR-WPLLLFGLLVGVGVAVAYQ--MNARVSY
A0A7C5W7B3      ------------------LWEHMKTILMFRW-PWGLASLVIVFAMTLAFD---SMTPLQY
A0A2S8F9B8      ------------------QFGQVLHSLRRQW-LAAVVLGLLCAAPIAVGAW--LLQSPTY
A0A354GX32      ------------------ATAVWY-AIRRRW-LTILVLGLGLGSLGAAAAW--YIMPAKY
A0A142XL75      ------------------TGRAILNAVKRRP-FTLLGVALLAAGTGAAVWL--FLPLPKA
A0A6P2D5D5      ------------------SGRAILNAVKRRP-FTLLGVAILAAGVGATVWL--FLPLPKA
A0A5C1AAF0      ------------------PGALLR-ALRRRL-ILALAVGVVLAAVAATAVW-VYLPPPKP
A0A7C7T8W8      ------------------PAIVVH-TVKRSL-WWTLPVGVLLSIAAGAAVW--YGVPYRY
A0A5C6B3S0      ------------------GLTSVLHAFRRRW-LLATALGICGGLMASFTAW--RLTAPTY
A0A368KP63      ------------------RMGQVVHSLRRQW-LASVVLGVLLAVPIGVGVW--LLQAPKY
A0A518GIZ9      ------------------GLSIDWMNLVFRY-RWWLCAGVVLGLGLGIAAY--MKLGPEY
A0A1C3EBY9      ------------------GLSIDWMNLVFRY-RWWLCAGVVLGLGLGIAAY--IKLGPEY
D5SX64          ------------------GLSIDWMNLVFRY-RWWLCAGVVLGLGLGIAAY--IKLGPEY
A0A517Z0U7      ------------------QISAVLAAFRRRW-FTAISLGLVLGAAAAATVW--YVTPVTY
A0A2S8FCC0      ------------------GISHVFHAVRRRW-LPAFSIGVLLAAVAATSVW--LLDVPEY
A0A1Z8MBT6      ------------------PWIIWV-TFRRCW-VWAVPIGLVIGTIGAVMVL--KSFQPEY
A0A517SXN9      ------------------PWIIWV-TFRRCW-VWAVPIGLVIGTIGAVMVL--KSFQPEY
A0A518HFL0      ------------------PRLVLR-GLARHW-WQALALWVVGTAALATLVY--LRYEPTY
A0A5Q3LBQ3      ------------------TATFVANSLRQWW-WAFVPAALGLALASATAIM--MFFEPVY
A0A3B8ZJM2      ------------------------------------------------------------
A0A1U7CLW1      ------------------GLLR---ALRRRW-LFALLGGLLCSSLSAAAVY-LYLPPPKY
A0A142WPR7      ------------------ERTVNFLALTWRY-LWLLILFGGVGTGAAYLHF--LKQPPIY
A0A3M1TFJ0      ------------------DLWVYLQTLRRQL-PLVLVVA---GACTLLATLRTLRLPAVY
A0A517P477      ------------------DWRPAVAGLKRFW-YVAVLVGLPLGAGGAYAAW--IYIPAPY
A0A517T4K9      ------------------HRGLWS-AFRRRW-LWATLGGGIVGLCAAAVVY--FMMETPY
A0A7C6B2Q1      ------------------GLTAYLHAFRRRW-FPAVFLGIVLAAAAAVAVW--FLYIPQY
A0A7C4QPD3      ------------------SLLSVLHALRLRW-PWVIVLGLPLAAALAVAAY--VTVPAPY
A0A2Z3GZZ5      ------------------PLHLVM----RRW-QF-LAVGLIIGGVLGALIY--STSAPQY
A0A4V0I6L6      ------------------PNVLF--AVLRRW-PWLV-LGLAVGCVLGLLFH--MQRTPVY
A0A7C4QQT3      ------------------RKPINYAELAFRY-RFWLAAGAVAGLLLGELAY--LKLGPEY
A0A255QXF5      ------------------PWLIWV-TFRRCW-HWAVPAGLVLGSIAAFGVL--STFEPQF
A0A518KBI5      ------------------PKFLLW-VFSRSW-KVVVPVGVLLAAATAAVLL--YTYVPQF
A0A5C5V6Q5      ------------------PKFLVW-VFLRHW-KLVVPSGLVLAAAAVSALL--WTYQPDY
A0A517MY49      -------------------RFARILRLRQKT-VLATLVLSCLLGGCYYTFA--TRYFQSS
A0A2E6AG00      -------------------WLVRSVRYRKHY-LIGALVASGLVGAVYFFTA--DRIYEAS
A0A1G3A880      -------------------YFLRVVRYRRSV-MVTALLITGLLGGLYFTTA--TRYYEAD
A0A2E8ATT1      -------------------RFLRVIRYRKSY-LIVALTTAVLLGSVYYFTA--ARIYEAK
A0A7C2JZW2      ------------------PWVCALHAMRLQW-PWIVFLGIPLSAVLAYTAW--TTVPTPF
A0A518KYQ0      ------------------PWLLWI-TLRRCW-FWAIPIGIVLATVAAFLVL--QTFVPMY
A0A5B9QX47      ------------------PWLIWV-TFRRCW-MWALPCGLVLAGIAAYVVQ--RDFVPRY
M5T666          ------------------------------------------------------------
M5U6N6          --------------------------------------------------M--LGFVPRY
A0A517M0G2      ------------------PKLLWV-TIRHCW-IWATPIGLALAAAAAFAVF--SGFVPVY
A0A5C6AST1      ------------------PRLIWV-TIRRCW-LWATPIGLALAALAAYGVY--ATFVPIY
A0A5C6C951      ------------------PKLLWV-TVRRCW-LWATPIGLSLAAAAAFIVY--SRFVPIY
A0A5C6C5T3      ------------------PWILWV-TFRRCW-PWAIPLGAALAGIAAFVVI--RGFVPRY
A0A2A2W6A9      ------------------PWLLWI-TLRRCW-YWAFPVGIVLGVIAAFVVL--QSFVPRF
A0A518HQS9      ------------------PWLLWI-TLRRCW-YWAIPVGVVLAVIAAFAVL--QSFVPQF
A0A5M6DFE6      ------------------PWLIWV-TLRRTW-YWAVPVGLVLASVAAFAVL--KQFVPRY
A0A5C6F286      ------------------PWIIWV-TFRRCW-AWAIPAGAVLAGLTAMAVL--RGFVPRY
A0A517NGN1      ------------------PWMLWV-TVRRCW-FWAVPIGLVLASLAGFVVL--KTFVPRY
M5RUI3          ------------------PWILWV-TFRRNW-LWAVPVGMVLASLAAFGVF--KSFVPVY
A0A660VT66      -------------------------------------------VCRSLRER--GKLSPDL
A0A7C2VEF7      ------------------------------------------------------------
A0A0S8H0S8      --------------------------------VLQAALERCGGAGLKILQG--RP-NPVA
A0A7C2ZTD2      ---------------------------------------------MSFFEN--KAINPAA
A0A2E3Z6T8      ------------------------------------------------------------
A0A257WQ92      ------------------------------------------------SLQ---------
A0A7C1U6X6      --------------------------------------------------M---------
A0A7C7UXI5      ------------------------------------------------------------
A0A7C3SFJ0      --------------------------------------------KRKTTQY---------
A0A7C7WWF7      --------------------------------YNIIQKENLYSKKRQLRVL---------
A0A356ETW1      ------------------------------------------------------------
A0A3L7NJY1      ------------------------------------------------------------
A0A523CME0      ------------------------------------------------------------
A0A354PCV3      ------------------------------------------------------------
A0A354PHB4      ------------------------------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A538RV31      ------------------------------------------------------------
                                                                            

M5S2L2          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A7C2VXA0      ------------------------------------------------------------
A0A7C3AA48      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A7C5PFV3      ------------------------------------------------------------
A0A7C3QGD2      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A7C2ZUK5      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
A0A7C2JY73      ------------------------------------------------------------
A0A356AE44      ------------------------------------------------------------
A0A1G2XSU7      ------------------------------------------------------------
A0A350KD81      ------------------------------------------------------------
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      NPVKKANIFSI-----------------------------------------KELTRGN-
A0A524HC32      ------------------------------------------------------------
A0A177PV03      ------------------------------------------------------------
A0A1G2YIM0      ESAGAIRISPIVPSILFSDRD---------------------------------------
A0A1G2ZG92      KAKAKLIIETSDTISSLLSSLGT-----------------------------KGTKIGG-
A0A1G3A0W0      RARAEVRVRPIVPHLVFRTDENGAIPF---------------------------------
A0A353BE27      EAAARVQV---ISSIPAPVK--------------------------------NPYFSGG-
A0A5C6BPW1      VASSIIYI---DATPGSVLQDN------------------------------SSF-----
A0A1I3GSP0      SATTSVLV---SKKASVPANNG------------------------------EANRYGE-
A0A517QJV1      SANTQVLV---SKKASVPINDG------------------------------EANRFGD-
A0A3C1QS25      TSVAKVMI---TPKNPATV---------------------------------IIPGFEG-
A0A5C6FX55      RATTQIMI---ESNRPAVMDTM------------------------------TGEMVGG-
A0A5C6DS51      ESHIEILV---GQRSSEMAS--------------------------------NGTMSNA-
A0A5C6DSL6      ESRIEILV---GQRSSEMAN--------------------------------SGTMSNA-
A0A3M1VG27      DAKAQILV---SRKASIHLKSD------------------------------DLRTYGE-
A0A518GC22      EAAALVQV---VSSTPTQTRMD------------------------------FYDPRGS-
A0A3L7Q373      VAETQIMV-----SKKASISDQ------------------------------EARRYGD-
A0A3E0PW54      QADTRIEV---SQKSAIPMDER------------------------------SINFSGE-
A0A7C3TAH2      TVSGYIRV------APAMQDLL------------------------------TGQPDRGD
A0A1Z8MHR4      LSSTQLMF---KSETPLSLDTA------------------------------TGLVQGG-
A0A5C6EHJ0      RSAAQVQI---VESTARNLPVD------------------------------S--LDAG-
A0A5C6F1H9      RSAAQVQI---VESLARNLPVD------------------------------G--LDTG-
A0A255QXY0      QATSKLMF---RSDAPMALDTS------------------------------TGLIRGG-
A0A517SYI0      LSSTQLMF---KSETPLSLDTA------------------------------TGLVQGG-
A0A518HX54      RATTRLMF---KSDTPLTLDTS------------------------------TGMVRGG-
A0A5B9MF59      RATTQLMF---KSDTPISLDSN------------------------------TGIVRGG-
A0A2A2WC24      RATTQLMF---KSDTPISLDSN------------------------------TGIVRGG-
A0A518KYW8      RATTQLMF---KSDTPISLDSN------------------------------TGIVRGG-
A0A5C5YZZ0      RAGATIEVY--SQNVQTNTGSV------------------------------VENLTES-
A0A518JLD2      LSSSDVQIIESTTNKNMAVDGV--------------------------------------
A0A5M6DJ15      AVAVLKID---SVAAPLIFQT-------------------------------ADQSGGG-
A0A3L7P7S7      AASVDVMV---VKKKGAMASDFRTAMLDDYVAIQVTIIKSDRVLREAAQLLQQGEIAGG-
A0A517N8M1      RSTTRLMI---ESDKSTMLDSM------------------------------TGEIVGG-
A0A5C6CW01      RASTRLIV---ESDRPAILDSM------------------------------TGDVIGG-
A0A5C6BXS9      QSSTRLMF---EANRPAVINTM------------------------------TGDIVGG-
M5U569          KSATRLMF---ESDRPAVLDTM------------------------------TGDVLGG-
L7CND7          QSGTLLMF---ESDRAAVIDTM------------------------------TGDLIGG-
A0A0J1B8S4      QSATLLMF---ESDRPAVIDTM------------------------------TGDRIGG-
F2ARR3          QSATRLMF---ESDRPAVMDTM------------------------------TGDVLGG-
K5D8H6          QSATRLMF---ESDRPAVMDTM------------------------------TGDVVGG-
M2AKU0          QSATRLMF---ESDRPAVMDTM------------------------------TGDVVGG-
A0A5B1CKI2      RSTTRLMI---ESDQAAVLDPI------------------------------NGDMVGG-
A0A5C6EG84      RSTTRLMI---ESDNQAVLESK------------------------------SGDVVGG-
A0A5C6F2X4      RSTTRLMI---ESDNKAMLESM------------------------------SGEVIGG-
A0A5C5XTV6      QSSTRLMF---ESHRPAVIDTM------------------------------TGDIVGG-
A0A5C6AAB1      QASTRLMF---ESDRPVVLDSM------------------------------TGDVMGG-
M5T8W8          KSATRLMF---ESDRPAVLDTM------------------------------TGDVLGG-
M5SF00          QSGTLLMF---ESDRPAVIDTM------------------------------TGDLIGG-
A0A2G1WDS1      QSGTLLMF---ESDRPAVIDTM------------------------------TGDLIGG-
Q7UVS9          QSGTLLMF---ESDRPAVIDTM------------------------------TGDLIGG-
A0A5C6B601      MASSKLMF---RSDKPLILNSQ------------------------------TGVMEGG-
A0A517PFU1      QSVAELTV---SARRTALPGSE------------------------------GG---GG-
A0A5B9M8J9      RATTKLML---KSDTPLTLDTA------------------------------TGVVRGG-
A0A2A2WFP6      RATTRLMF---KTDTPLTLDTS------------------------------TGLVRGG-
A0A518L8N2      RATTRLMF---KTDTPLTLDTS------------------------------TGLVRGG-
A0A518HQN9      RATSQLMF---KSDTPISLDSN------------------------------TGIVRGG-
A0A5M6D8H8      RATTQLMF---KSDTPLTLDAA------------------------------SGSIRGG-
A0A5B1CRW9      QSSVEVLV---GQRSSEMTNRG------------------------------TISDGSA-
A0A5C6EI46      ESSIEVLV---GQRSSEMTNRG------------------------------TISSTSG-
A0A2E7D3V4      EATVKIL-----------VSKKADVMDK------------------------DNLADTK-
A0A5B9PER9      ESVASVKI----------EPRNKPSIRN------------------------HRQVEYG-
A0A517QSM4      QAFFEFHI----------NSVESKILFE------------------------TSEAQSN-
A0A355GJI7      ------------------------------------------------------------
A0A1Z8MCI4      QASHWVEI---------------------------------------------APNHVA-
A0A517SYL7      QASHWVEI---------------------------------------------APNHVA-
A0A3L7P0L2      VAGTKI----------------------------------------------TVSKKAT-
A0A6M5YVJ1      SVAVAFHI----------STQAPALLDA------------------------TSESRID-
A0A2E0SHG0      KSEAQIH-----------IIRRDPNLAT------------------------EAAESTS-
A0A518CQB8      ESQAQIH-----------IIRHDPNLAT------------------------EGSENSS-
A0A517SCC8      EANTQVKV---------------------------------------------SQKASL-
A0A3A0DR44      RAYAIIEIPDRGGVLLPTSPDTSPRFA---------------------------------
A0A358MY60      KASHML------------EANQDYIVF---------------------------------
A0A517MNB1      QATHLL------------EKNQDYVVF---------------------------------
A0A7C1EH96      ETQGSVLVSSVVVPIMYETTAQGGV--------------------------------GA-
A0A142YJ13      TTSSLVHV----------AEKRPREIFE------------------------TRESDVG-
A0A517Z7D3      EANTRILV--------------------------------------------SQRAAVA-
A0A1N6KY57      TARSMLHV----------NSVQPRILLT------------------------TGEVHTE-
L0DK20          TARSMLHV----------SSTQPRILLK------------------------VGENETD-
A0A3L7UX05      LSFALLR-----------VEPPRASILG------------------------PSMNTLG-
A0A517XRC2      HTARAT------------VQLRPSTVES------------------------GKGQVED-
A0A6M5YH47      HEARAL------------VQLRPKAIEF------------------------VNRNTEN-
A0A660UUK3      ETTGSIRI----------SPIVSRILFN------------------------DSDSDRP-
A0A517ZHG5      VASSIVYI----------DATPGTVLQD------------------------SSSFSSD-
A0A1Z8MPL5      TAHSLM------------QSRRNTLIF---------------------------------
A0A5C1AGE3      QVKALLEIT---------PENVGLMPGA------------------------NQQNDSN-
A0A2Z3HEL7      QVRALVQLQ---------PQHAYIT----------------------------NKGQED-
A0A142XAP8      QVRALVQLQ---------PKQVEFV----------------------------NKTQED-
A0A6P2DEK1      QARALVQLQ---------PKQVEFV----------------------------NKTQED-
A0A5C6C1R5      TAMAYLRI----------DSVDSLLVFQ------------------------TADRLNA-
A6BZU4          SANTKIQV--------------------------------------------SQKNPVP-
A0A2D5GZ77      SANTKIQV--------------------------------------------SQKNPVP-
A0A3D3R1Z6      SANTKIQV--------------------------------------------SQKNPVP-
A0A517XG00      SANTKIQV--------------------------------------------SQKNPVP-
A0A1G2YRE4      TVTGALRFSPVLMNILTGEQNSAQISM---------------------------------
A0A353Z859      TTRAELRV--------------KAVNYT------------------------PGGGLKQ-
A0A2D6ST10      TATAQVRI----------NSFDPFFFFK------------------------VDNQTPR-
A0A177QX42      ASFAKVMVLRPQSVLPNEDPER------------------------------GTKKSAN-
A0A517SHR0      ASFAKVMVLRPQTSMSTGRDDR-------------------------------TTNSIN-
A0A2E0AW64      EAKALLRITTPISFDGSKNKADRSFL----------------------------------
A0A351FZ59      EAKALLRITTPISFDGSKNKADRSFL----------------------------------
A0A660V239      DTEGAIQI----------SPVESPILFE------------------------TEERLPN-
A0A177Q3B7      TATTLLH-----------VSAQEPTILA------------------------TSEAHTD-
A0A2E0X6Y6      ASTAKL------------------LIIE------------------------QKSDQLA-
A0A518GFD7      AASAYLRID---------SDNRPLLFET------------------------VDQAGGG-
A0A5C5VZJ8      SASGVIHI----------KPVRDDLLSG------------------------RQDVMPM-
A0A518GE37      EATHIM------------EANRDYVL--------------------------AQSLHNT-
A0A5C6F3H8      EATHLL------------VANDEYVVF-------------------------DNVMKYS-
A0A5C5X072      RASYLL------------ESNEDYVVF-------------------------KGVMPQV-
A0A5C5WUQ3      RASHLL------------EANDDFVVF-------------------------KGVMPTV-
A0A5C6E697      RASHLL------------EANEDFVVF-------------------------KGVMPTI-
A0A5C5Z1A3      RANALL------------QANQDWIVF-------------------------KGVMPTL-
A0A5C6D2P7      RAQHLL------------EANEDYVVF-------------------------QGVMPMV-
A0A5B9ML17      RAQHLI------------EANQDYILY---------------------------------
A0A517LX75      ESNMEIL-----------IALRSSELTN------------------------SGTSSDG-
A0A7C5W7B3      RARGQMLLVQNVTGASGMDQVFAWRLYF------------------------SNVALAR-
A0A2S8F9B8      TSSAYLRI----------SASEQPLAF-------------------------RTVEQAG-
A0A354GX32      TATATLRL--------------------------------------------NPQSPRG-
A0A142XL75      TAATVFH-----------VSAQAPSVLG------------------------QADGQAN-
A0A6P2D5D5      TAATVFH-----------ISSQTPSVLG------------------------QTDGQTN-
A0A5C1AAF0      RVSAKLYV----------DYSQRGTLFE------------------------HPDSPLN-
A0A7C7T8W8      EAKAWIRI----------KSTRPKVAFE------------------------LEESKLW-
A0A5C6B3S0      STASLLRV----------ASQDAPLVF-------------------------KTVDQAS-
A0A368KP63      SSSAYLRI----------SANDQPLAF-------------------------KTVEQAA-
A0A518GIZ9      MAIGQV------------------MVSR------------------------RNAVPLK-
A0A1C3EBY9      MAIGQV------------------MVSR------------------------RNAVPLK-
D5SX64          MAIGQV------------------MVSR------------------------RNAVPLK-
A0A517Z0U7      TSYAELQFDLTPFYFGDRE---------------------------------TGEANGD-
A0A2S8FCC0      TARALLRI----------SSRHGTLLKQ------------------------NGEANGD-
A0A1Z8MBT6      TARYIV------------AANQDWVIY-------------------------KGINEAP-
A0A517SXN9      TARYIV------------AANQNWVLY-------------------------KGINEAP-
A0A518HFL0      RSSSMLRI----------ETDPANPYVT------------------------NGGPPVR-
A0A5Q3LBQ3      EASAWIQI----------AEREPYIAF---------------------------DTPLE-
A0A3B8ZJM2      ------------------------------------------------------------
A0A1U7CLW1      TARALVHV----------AEKRPRELFE------------------------TRESEVG-
A0A142WPR7      QSSSTVLVTGDR------QQQANPLGTE------------------------SGFAQGI-
A0A3M1TFJ0      AATASLRL----------------VREP------------------------PDPIQAK-
A0A517P477      VASAELYM----------RSYVDRVAFS------------------------TSEQQAS-
A0A517T4K9      HAFAEIRM----------KSVQERLLFN------------------------TAEAQTS-
A0A7C6B2Q1      TATALIRV----------AASSQSVLFP------------------------ANDRGGA-
A0A7C4QPD3      TGYAELFCQPRRFFWKTNEDDPQFAVYK--------------------------------
A0A2Z3GZZ5      QSTAQV------------LVVKKGVEVT------------------------KEGDGRI-
A0A4V0I6L6      QSTAELMVVKSRPDMVAGGAGDARVQY---------------------------------
A0A7C4QQT3      ------------------EATGQILVYR------------------------RNVVPLK-
A0A255QXF5      EAGYRL------------EANKDWLLD-------------------------RGVMPTP-
A0A518KBI5      AASGLIKI----------EDIQPYVAFQ------------------------QAAVGSN-
A0A5C5V6Q5      LATGLVRI----------EDTQPYIAFE------------------------KASVGSA-
A0A517MY49      AELLII------------EQYRDQLS--------------------------SAGNHRS-
A0A2E6AG00      SQLLVQ------------QMSPVVASG-------------------------PIGQVGX-
A0A1G3A880      ASLLIL------------QTGGDVLTP-------------------------SLSVDGA-
A0A2E8ATT1      ASLLIT------------QSSPDVWNG-------------------------AASSEVG-
A0A7C2JZW2      TAYVELLCQPRRFFWETKEDEAQFSVY-------------------------KQTMMRR-
A0A518KYQ0      RASHHL------------AANKDWLID-------------------------RGVLPAP-
A0A5B9QX47      RASHLL------------EASQDYVLF-------------------------KNLLPTA-
M5T666          ----ML------------EANEDFVVF-------------------------KGVMPVV-
M5U6N6          QATHLL------------EANEDFVVF-------------------------KGVMPVV-
A0A517M0G2      KASHLL------------EVNQDFVVF-------------------------KGIMPTP-
A0A5C6AST1      QATHLM------------EANQDFVVF-------------------------RGVMPTS-
A0A5C6C951      QATHLL------------EANQDYVVF-------------------------QGVMPTS-
A0A5C6C5T3      QASYLL------------EANEDFVVF-------------------------KGVMPVM-
A0A2A2W6A9      RATHQL------------AANKDWLID-------------------------RGVMPTP-
A0A518HQS9      QATHHL------------AANKDWLID-------------------------SGVMPTP-
A0A5M6DFE6      ESSALL------------EASRDYVAF-------------------------KGVMPAL-
A0A5C6F286      EASHLL------------VANDEYVVF-------------------------NNVMKVS-
A0A517NGN1      KAIHLL------------EANQDYVVF-------------------------KGVMPMV-
M5RUI3          RASHLL------------EANSQWVVF-------------------------KDVIPVI-
A0A660VT66      ATPDDL------------------------------------------------------
A0A7C2VEF7      ------------------------------------------------------------
A0A0S8H0S8      YLKEAL------------------------------------------------------
A0A7C2ZTD2      KLKRAI------------------------------------------------------
A0A2E3Z6T8      ------------------------------------------------------------
A0A257WQ92      ------------------------------------------------------------
A0A7C1U6X6      ------------------------------------------------------------
A0A7C7UXI5      ------------------------------------------------------------
A0A7C3SFJ0      ------------------------------------------------------------
A0A7C7WWF7      ------------------------------------------------------------
A0A356ETW1      ------------------------------------------------------------
A0A3L7NJY1      ------------------------------------------------------------
A0A523CME0      ------------------------------------------------------------
A0A354PCV3      ------------------------------------------------------------
A0A354PHB4      ------------------------------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A538RV31      ------------------------------------------------------------
                                                                            

M5S2L2          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A7C2VXA0      ------------------------------------------------------------
A0A7C3AA48      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A7C5PFV3      ------------------------------------------------------------
A0A7C3QGD2      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A7C2ZUK5      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
A0A7C2JY73      ------------------------------------------------------------
A0A356AE44      ----------------------------------------------NI-----HHQRVDA
A0A1G2XSU7      ----------------------------------------------MV------------
A0A350KD81      ----------------------------------MAQQFLMG------------------
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      ----------------------------------SSPTVRKP-----------EPGKESQ
A0A524HC32      ----------------------------------VSRELLKQQKLFDY-----MAENLQA
A0A177PV03      ------------------------------MVLGDAASALATKGLSSL-----EGLSQSE
A0A1G2YIM0      --------------SEQAMPNYMNFMNTQAELI-ASFQVLNR-----------AADDLKT
A0A1G2ZG92      ------------VIPPKTGKTGSTDYETDIALA-KIRPLIEK----LISLLNIKDRHGKT
A0A1G3A0W0      --------------YDSFV-------NTQVSYM-RSSTVLQR----VL-----DQPAIRQ
A0A353BE27      ---------------QEVNRIDESMI------I-RSQAVLRL----AV-----SLGRLGE
A0A5C6BPW1      --------------SSDFDTFKRTQMFRALSRV-VLDTALNE----PVRNQTLKKYGFKT
A0A1I3GSP0      -------------------------RGDHVQLI-QTDLIVER----AF-----KDHGLNE
A0A517QJV1      -------------------------RGDHVELI-KSDLIIEP----AF-----KKHGLNS
A0A3C1QS25      --------------MPSGPGVKQ--DHEHDAVL-TSTTFIRD----SVVSNPELDQQVPS
A0A5C6FX55      --------------VPSIEIVQA--Q------L-FSDEVIRG----AF-----ENPEMIQ
A0A5C6DS51      --------------QASGDSIHEDLLATHMRLF-LSRKNVAN----AI-----ETGNLKA
A0A5C6DSL6      --------------QASGDTIHEDLLATHMRLF-LSRKNIAN----AI-----ETANLKK
A0A3M1VG27      -------------------------RSEHVALI-MSPMIVRK----AV-----ALRRLDR
A0A518GC22      ----------------AITRVDESMV------I-RSQTVLRR----AV-----QLGRLTE
A0A3L7Q373      -------------------------RGEHVRVI-ATDIIARI----AY-----EKYGLNQ
A0A3E0PW54      -------------------------RTEHVHLI-KSDAIVSR----AV-----RDHGLGE
A0A7C3TAH2      IGTYESFVNTQAMAITQPQVLER---------V-LDELLPRN----LTFFSGQNRGRLAW
A0A1Z8MHR4      --------------VPSGNLMES--L------V-ISDAIVKR----VA-----MSPQLRQ
A0A5C6EHJ0      --------------LKSRNLSDEALV------M-RSEQILRR----AA-----EIGELST
A0A5C6F1H9      --------------LKGRNLGDEAIV------M-RSEQILRR----AA-----ELGELST
A0A255QXY0      --------------LPSGQLLKS--L------I-NSRAIVGR----VK-----NDRQLRE
A0A517SYI0      --------------VPSGNLMES--L------V-ISDAIVKR----VA-----MSPQLRQ
A0A518HX54      --------------IPSGNLMQS--L------I-SSDAIAGR----VH-----LNEQLRS
A0A5B9MF59      --------------IPSGNLMQS--L------V-TSDAIVNR----VA-----SNPELKS
A0A2A2WC24      --------------IPSGKLMQS--L------I-TSDAIVRR----VA-----ANPELKS
A0A518KYW8      --------------IPSGKLMQS--L------I-TSDAIVRR----VA-----ANPELKS
A0A5C5YZZ0      --------------APSLAFIQA--E------M-TSDEVLKS----AI-----EIGQLTA
A0A518JLD2      ----------------EVAASRS--LADEALVM-RSEFILRR----AA-----ELPEIVE
A0A5M6DJ15      --------------RGSYELYKN--TQSQL--I-KTSEVLAT----AL-----KNEEVRR
A0A3L7P7S7      --------------VAQATDTAG--APKTDAPT-GTVSATVN----RF-----QGKEIQD
A0A517N8M1      --------------VPGLDIVES--Q------L-FSDRVMEA----AF-----ENPKLHP
A0A5C6CW01      --------------VPSVDILSS--H------L-YSDRVVKM----AF-----DNPEMVP
A0A5C6BXS9      --------------VPSVEILRS--Q------L-FSDTVMEN----AF-----RNPSFEI
M5U569          --------------VPSIDILRS--Q------L-FSDTVTKN----AF-----EDDSFDA
L7CND7          --------------VPSIEILRS--Q------L-FSDKVTEY----AF-----ENENMVV
A0A0J1B8S4      --------------VPSIEIIRA--Q------L-FSDEVNRS----AL-----SDGNMNV
F2ARR3          --------------VPSIDILRS--Q------L-FSDIVLAK----TF-----ADENMRP
K5D8H6          --------------VPSIDILRS--Q------L-FSDTVLNK----TF-----NDENMRP
M2AKU0          --------------VPSIDILRS--Q------L-FSDTVLNK----TF-----NDENMRP
A0A5B1CKI2      --------------VPSLDIVQS--Q------L-FSDRVMQM----TF-----NAPRLRP
A0A5C6EG84      --------------VPGLDIVES--Q------L-FSDRVMAT----AF-----GNERMRP
A0A5C6F2X4      --------------VPGLDIVES--Q------L-FSDRVLAA----TF-----ANPRMRP
A0A5C5XTV6      --------------VPSVDILRS--Q------L-FSDSVVKR----AF-----EDPHFEI
A0A5C6AAB1      --------------VPSIDILRS--Q------L-FSDSVTRN----AF-----QHAAFEV
M5T8W8          --------------VPSIDILRS--Q------L-FSDTVTKN----AF-----EDESFEV
M5SF00          --------------VPSIDILRS--Q------L-LSDKVTRN----AF-----ENESMEV
A0A2G1WDS1      --------------VPSIDILRS--Q------L-LSDKVTRN----AF-----ENESMEV
Q7UVS9          --------------VPSIDILRS--Q------L-LSDKVTRN----AF-----ENESMEV
A0A5C6B601      --------------IPSGNIMQS--V------I-TSDSIMAS----VA-----QDPALTL
A0A517PFU1      --------------EPEELAGEA--LGNYLYRA-QTGPLVAR----AV-----RERRLDE
A0A5B9M8J9      --------------IPSGNLMQS--L------I-SSDAISGR----VE-----LDDQLRS
A0A2A2WFP6      --------------IPSGNLMQS--L------I-SSDAIAGR----VH-----LSEQLRS
A0A518L8N2      --------------IPSGNLMQS--L------I-SSDAIAGR----VH-----LNEQLRS
A0A518HQN9      --------------IPSGKLMQS--L------I-TSDAIVGR----VA-----SNPEVKS
A0A5M6D8H8      --------------IPSGNLMQS--L------I-TSDGIVSR----VA-----SHHELKS
A0A5B1CRW9      --------------GSDSLGEDQ--LATHMRLF-VARKVVAK----AI-----EMGELNQ
A0A5C6EI46      --------------GTEGMGEDE--LATHMRLF-VARKVLTE----AI-----KLGSLDE
A0A2E7D3V4      --------------GAGGR-------GEHIALI-MSPLIVGA----AI-----EEAGLDG
A0A5B9PER9      --------------PEVAQ-------VAHDKLI-VQRLMVEQ----CL-----NDDGGKL
A0A517QSM4      --------------FNTYK-------QTQMRKV-TGEYVLNA----AL-----RDPEISN
A0A355GJI7      ------------------------------------------------------------
A0A1Z8MCI4      --------------FSDVRARGGSDAKGEEALL-KSPMVLES----VL-----AQPFIKE
A0A517SYL7      --------------FSDVRARGGSDAKGEEALL-KSPMVLES----VL-----AQPFIKE
A0A3L7P0L2      --------------VGETEARLYGGRSEHISAI-KSDEVVRI----AY-----EKYGLK-
A0A6M5YVJ1      --------------FGSYR-------QAQIALV-KRRQTLAA----VL-----SSPAVQQ
A0A2E0SHG0      --------------PGDFR-RMEDELANQMKIM-SSYKIVSAGLESGL-----E-EDGKP
A0A518CQB8      --------------PNDFR-RMEDELANQMKIM-SSHKIVKAALEAGL-----KNEDGTP
A0A517SCC8      --------------PSSDQARRYGDRGEHVYLI-KSDAICQR----AL-----DEFGLNK
A0A3A0DR44      --------------------------QTQLRSI-ASSVVLTP----AL-----ADPEIAK
A0A358MY60      ---------------ENVLAESSNLEATEKQII-LSDIVLDD----VV-----SKADIQA
A0A517MNB1      ---------------EGVMPTSANLAGSERQLI-YTDMVLDE----VL-----AKPEIQS
A0A7C1EH96      --------------YQTFK-------NTQAGVM-TSDVILNR----VA-----DAVKDRR
A0A142YJ13      --------------YRTYQ-------ETQLILV-KSRKVLEA----AI-----APPAIAA
A0A517Z7D3      --------------DSPRETNLTGERSEHVDLI-MSDDIVQR----AM-----DKFGLRE
A0A1N6KY57      --------------YGAYQ-------RTQLALL-HSRLVLSS----AL-----KQPEVAK
L0DK20          --------------FVAYQ-------RTQLALL-KSRLVLGT----AL-----KDPEVAK
A0A3L7UX05      --------------IDQIK-------RTHMQLI-KAPDVLSD----AV-----SEYPEIV
A0A517XRC2      --------------FDSFR-------RSQMYLV-KSRDLINR----TI-----AEPKVAS
A0A6M5YH47      --------------FAEYR-------GRQVFLL-KSRDLITK----TL-----AEPAVSS
A0A660UUK3      --------------MPNYA----NFMTTEAERI-AGPTVLNR----VA-----DELSGKK
A0A517ZHG5      --------------FDTFK-------RTQMFRA-LQRVVLDTALSEPV-----RNSELKR
A0A1Z8MPL5      ----------------DVQNAEESGWEAQEQLI-RGYRVLNTALNDGL-----MELEYIK
A0A5C1AGE3      --------------TSNFK-------ENQMVLI-KTRTILTR----VV-----QNEKLKD
A0A2Z3HEL7      --------------FEWYR-------RRQIYLLTKDRDLFNR----VL-----ADPAVSS
A0A142XAP8      --------------FEAYR-------RHQMFLL-KSRDVFTR----AL-----ADPAVSS
A0A6P2DEK1      --------------FEAYR-------RHQMFLL-KTRDVLTR----VL-----ADPAVSS
A0A5C6C1R5      --------------GRDSF---SMYKNTQAQLI-KTPFVLNE----AL-----AVPEVRD
A6BZU4          --------------IKDGEIQTFGELTAHIDVI-KSPRIVGE----AV-----KEAKLNQ
A0A2D5GZ77      --------------IKDGEIQTFGELTAHIDVI-KSPRIVGE----AV-----KEAKLNQ
A0A3D3R1Z6      --------------IKDGEIQTFGELTAHIDVI-KSPRIVGE----AV-----KEAKLNQ
A0A517XG00      --------------IKDGEIQTFGELTAHIDVI-KSPRIVGE----AV-----KEAKLNQ
A0A1G2YRE4      --------------------------LTEAELI-TSERVIQR----VA-----DNLANRN
A0A353Z859      --------------GEELR--GEVYRQTLGRMV-QGPIVLKQ----VV-----RREEVAK
A0A2D6ST10      --------------FETYK-------QTQMILV-RSPLVLMA----AL-----RSPELAG
A0A177QX42      --------------AVNLL-------ENHQYLL-TQPKILKGAVDPPI-----KDDASEE
A0A517SHR0      --------------SVDLL-------ENHQYLL-TQPTIIKGAVDPTL-----PEGATDE
A0A2E0AW64      --------------------------ANQFAVL-YSVVTLEP----LL-----ADKEIAT
A0A351FZ59      --------------------------ANQFAVL-YSVVTLEP----LL-----ADKEIAT
A0A660V239      --------------YQNFM-------NTQAQLF-RRNNVLNQ----VA-----DELADMD
A0A177Q3B7      --------------FGLYQ-------KAQAALI-SSRLVLNA----VL-----KRDAIAS
A0A2E0X6Y6      --------------SVNDADGSDNTMATQREIV-VSPVVLRR----AI-----ERLAPED
A0A518GFD7      --------------VSGFK----LYKSTQQQIM-LTPFVLNA----AL-----RDGELSS
A0A5C5VZJ8      --------------YESFR-------QTQASFV-TNAEVRNG----VL-----EDSAVKG
A0A518GE37      --------------SRDLA-------RSERQLI-TNALVLDP----VL-----ADPALKK
A0A5C6F3H8      ---------------KDLA-------RTETALI-LNPIVLVP----AL-----ADPSLHD
A0A5C5X072      ---------------ENLA-------RTEKSLF-QNSIVLDP----VL-----ADPTLRS
A0A5C5WUQ3      ---------------DDLA-------NTEKSLF-FNPIVIDP----VL-----ADPEIRR
A0A5C6E697      ---------------NDLA-------RTEKPLF-FNPIILDP----VL-----SDPEFRI
A0A5C5Z1A3      ---------------TDLA-------RTEKSLF-FNPIVIDP----VL-----ADPDLRR
A0A5C6D2P7      ---------------KDLA-------RTETSLF-FNPIVLDP----VL-----ADPENRM
A0A5B9ML17      ---------------RDVFNTVRDLAGTEKTIF-FDEIVLRP----VL-----SDPELRA
A0A517LX75      --------------GIDSTVLHSDMLATHIELL-TSPLILNDAIK-VG-----RFDELES
A0A7C5W7B3      --------------LGTLP------ATGQKAHT-HLNAWLEGAENRPE-----HLPEVDE
A0A2S8F9B8      --------------RDDYR----TFKSTQRQLM-ITPFVLNK----AL-----SREDIMN
A0A354GX32      --------------VNETSEDYTNLRSYLAGWV-KSDPVLDA----TL-----KKQEVGD
A0A142XL75      --------------FVSYR-------ASQIATI-KRQRTLNN----VI-----KVPAVEN
A0A6P2D5D5      --------------FASYR-------ASQIALI-KRRLTLNN----VI-----KEPAVDN
A0A5C1AAF0      --------------Q-----------QTQINVL-KSEAVITA----AL-----RNPEVNK
A0A7C7T8W8      --------------T-----------RTQVELI-RSPLILRE----VL-----LRPTVAK
A0A5C6B3S0      --------------VSSFD----IYKRTQRELL-KSDFVLAA----AL-----RKKDVME
A0A368KP63      --------------RNDFR----TFKNTQVQLM-ITPFVLSK----AL-----GKDGIIN
A0A518GIZ9      --------------EQSAM-GDWGERSEHIALI-MSPMIASE----AV-----RLGQLDK
A0A1C3EBY9      --------------EQSAI-GDWGERSEHIALI-MSPMIASE----AV-----RLGKLDK
D5SX64          --------------EQSAI-GDWGERSEHIALI-MSPMIASE----AV-----RLGQLDK
A0A517Z0U7      --------------LRSFK-------GTMMRLA-TYPFVLVA----AL-----REPGVHQ
A0A2S8FCC0      --------------FEVYK-------LTQRQLI-RGSFVINA----AL-----RDTEVLR
A0A1Z8MBT6      --------------RDLAA-------SEKTWVI-DHPGVIQA----VM-----GDQTVCK
A0A517SXN9      --------------RDLAA-------SEKTWVI-DHPGVIQA----VM-----GDQTVCK
A0A518HFL0      --------------SDL---------QTQIQLI-TSANVLTS----AV-----SDPDVSK
A0A5Q3LBQ3      --------------SHRFV-------ETQVGLM-RSPLILGP----VV-----SKPEVAQ
A0A3B8ZJM2      ------------------------------------------------------------
A0A1U7CLW1      --------------FRTYQ-------ETQVILV-KSRKVLEA----AL-----NPPAIAS
A0A142WPR7      --------------TQTMP---------HQMLI-GSPLVVRK----AV-----ETHDLRK
A0A3M1TFJ0      --------------YAYRW-------DG------IPQEYLNS----EI-----RDMTSLS
A0A517P477      --------------FRTRK-------QTNQKLL-RSREVLTA----AL-----RNAEVAN
A0A517T4K9      --------------FQTFK-------QTQMKLV-KSPFVLNA----AL-----RRPEVAR
A0A7C6B2Q1      --------------SFDIYK------ATQLEYL-RSRFVLVA----AL-----RQPEVAR
A0A7C4QPD3      --------------------------QTTMRLL-KDPFVLEAALRETI-----SQEPPLT
A0A2Z3GZZ5      --------------VEDHV-------ATQVTLI-KSEKIRLA----AA-----AKARAAG
A0A4V0I6L6      --------------LEDYI-------GPQVILL-GSEAILKVAAERRL-----DEQKPFQ
A0A7C4QQT3      --------------EDQRALHDWGERSEHIALI-MSPMILNK----AV-----EIGKLME
A0A255QXF5      ---------------DDLA-------KSEGPII-ASPIVLSS----IL-----ANDTLHQ
A0A518KBI5      --------------NGSFI-------RTQIELM-RSPVVLRE----VL-----SDQRVGA
A0A5C5V6Q5      --------------NSAFV-------RTQIELM-RSPLVIRE----VL-----SEASVGK
A0A517MY49      --------------SENTM-------ATHSKIV-RSPKVIQGA---IE-----RLPQKYR
A0A2E6AG00      --------------XXGML-------PTYEKLF-ASAVVLNGAIXRIV-----EMPTDLQ
A0A1G3A880      --------------KQEII-------PTYCQLI-ESAVVLQGA---IA-----RLGPQHQ
A0A2E8ATT1      --------------RHGLI-------PTYEQLF-SSAVILNGATQRLA-----RLPAALR
A0A7C2JZW2      --------------------------------I-KDPQVIAA----AM-----RKEDVAK
A0A518KYQ0      ---------------EDLA-------KSERLLL-TSPIVLSQ----VI-----NNPELQA
A0A5B9QX47      --------------GSNLS-------GTERTIL-LNSIVLDP----VL-----EDASLRK
M5T666          ---------------KDLA-------RTENSLF-FNPIVLDP----VL-----ADPSLRN
M5U6N6          ---------------KDLA-------RNEKSLF-FNPIVLDP----VL-----ADPQLRS
A0A517M0G2      ---------------RNLV-------ASERPLV-LNALVLEE----VK-----NDPEVQA
A0A5C6AST1      ---------------SNLA-------ATEKQLI-TTDLVLDN----VL-----TDPEIQA
A0A5C6C951      ---------------RNLA-------ATERQLI-TTDLVLDS----VL-----ADAEVQA
A0A5C6C5T3      ---------------ENMA-------RTEKNLF-TNPIVLDP----VL-----ADPSLRT
A0A2A2W6A9      ---------------DNLS-------SSERMLI-TSPIVLSQ----VL-----DNPEFQA
A0A518HQS9      ---------------DDLA-------RSEKTLI-TSPIVLSQ----VI-----DKPELQA
A0A5M6DFE6      ---------------DDIA-------RTEKPLI-VNPVVLDP----IL-----QDPELRN
A0A5C6F286      ---------------KDLA-------RTETALI-LNPIVLDP----VL-----ADSSLHD
A0A517NGN1      ---------------DDLV-------RTERALF-LNPIVLDP----VL-----SDPDLRS
M5RUI3          ---------------EDIA-------ATEKPLF-FNSIILDP----VL-----ADPALRK
A0A660VT66      ----------------------------------L-DAVEVQ------------------
A0A7C2VEF7      ------------------------------------------------------------
A0A0S8H0S8      ----------------------------------K-----IE------------------
A0A7C2ZTD2      ----------------------------------SDDIITAA------------------
A0A2E3Z6T8      ------------------------------------------------------------
A0A257WQ92      --------------WKAPVGSAAADGQTTTNVHQERVLAAEEQRRLNL------------
A0A7C1U6X6      --------------DVSFTCASASDAVVIANAVLDQYMKYVDETASGQ------------
A0A7C7UXI5      --------------------LVIRDAQDGLSVVVKRALELNSALTEAI------------
A0A7C3SFJ0      --------------EQLANELGAPDSE----AMRLKSLYALETTNTLR------------
A0A7C7WWF7      --------------KEQVGDLGISDDDDLVHPILQRVVLINNRLAEVQ------------
A0A356ETW1      -------------------MLPSGDGKEILDPATKRALYFADELSKIE------------
A0A3L7NJY1      ------------------DLVDTGDKTNSLSVVSETIKLLAAEYSEAR------------
A0A523CME0      ------------------------------------------------------------
A0A354PCV3      ------------------------------------------------------------
A0A354PHB4      ------------------------------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A538RV31      ------------------------------------------------------------
                                                                            

M5S2L2          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A7C2VXA0      ------------------------------------------------------------
A0A7C3AA48      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A7C5PFV3      ------------------------------------------------------------
A0A7C3QGD2      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A7C2ZUK5      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
A0A7C2JY73      ------------------------------------------------------------
A0A356AE44      IA----------TERVK-------VELLYEEISSRLS-----------------------
A0A1G2XSU7      ------------------------------------------------------------
A0A350KD81      ------------QTRGQ-------------------------------------------
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      EP----------ETPVK-------YDVDDALINNYLSKLTVQMTGNS-------------
A0A524HC32      -S----------PSRKS-------------------------------------------
A0A177PV03      IL----------AVLKG-------GFGANRVFKDGVT-----------------------
A0A1G2YIM0      -K----------NVAMV-------GRDPFTFLRDAASNGRLIIEPAK-------------
A0A1G2ZG92      IR----------PDKLT-------ELSLISKLKNKVL---------------PRPYIEVN
A0A1G3A0W0      TQWYKNPRSSLMQRFYG------NKAPPLERLRDTLS---VRPRQRT-------------
A0A353BE27      -Q----------PEFVG-------L--ASEDIVSALQ-----DVGSPL------VIEPAD
A0A5C6BPW1      -I----------GDLPL-------L-----------------KGQTFEIDWLEARLSASG
A0A1I3GSP0      -I----------PALAN-------AYDPLREVT---------EGLSVS------RSAGQE
A0A517QJV1      -V----------PALAT-------AYDPYKNIR---------EGMAVS------RSAGQE
A0A3C1QS25      -I----------AGL------------SPEMKLFQIQ-----EGLEVD------LEKDSE
A0A5C6FX55      -Y----------HESLD-------E--GDGPWARFVEMVKKDEVLELE------PEVSDV
A0A5C6DS51      -T----------ETIRQ-------VLSEDGNPIDYII-----EQMEVG------R-GGEG
A0A5C6DSL6      -I----------ASIGT-------VLADGGSPIDYIV-----EQMEVG------R-GGEG
A0A3M1VG27      -L----------PSLA-----------TKKDPVAAII-----TELKAK------RVAGTD
A0A518GC22      -Q----------SEFLG-------M--QTDEVVATLM-----DEESPL------IIEPAD
A0A3L7Q373      -I----------SNFAG-------A----YDPLKAVW-----EDLQVK------RVAGQE
A0A3E0PW54      -L----------PAFQ-----------KSKDPVMDII-----DSLTVK------RSAGSD
A0A7C3TAH2      -L----------KNWIA-------SLQGPMTPMDRLK-----DAISSG------DISAQA
A0A1Z8MHR4      -S----------PSMRG-------R--SEAQVVSAIR-----GSVRFH------TITAVK
A0A5C6EHJ0      -T----------PEFAG-------Y--SSEQIAAVVG-----GLD--L------VVGSAD
A0A5C6F1H9      -A----------PEFAG-------M--APEQIAAAIG-----DAS--L------SIGSAG
A0A255QXY0      -V----------AAVRG-------L--TDREVMRLVR-----QRIRFD------SVTDLK
A0A517SYI0      -S----------PSMRG-------R--SEAQVVSAIR-----GSVRFH------TITAVK
A0A518HX54      -I----------PALRE-------L--TNDQFIALVR-----RGIRFQ------TITDLK
A0A5B9MF59      -I----------PSLQS-------N--TDQQIVSMVR-----GGIRFQ------TLTDQS
A0A2A2WC24      -I----------PSLES-------S--SETQIVSMVR-----SGIRFQ------TLTDQG
A0A518KYW8      -I----------PSLES-------S--TETQIVSLVR-----SGIRFQ------TLTDQS
A0A5C5YZZ0      -F----------EETPA----------DVGALIALIR-----KNLRLQ------APFDGA
A0A518JLD2      -S----------AEFAG-------L--GPEQIAGLMG-----GR---A------LTIGPA
A0A5M6DJ15      -L----------SLIRS-------KPDPEQWLAE-----------ELQ------VDFPGR
A0A3L7P7S7      -L----------IDYLR-------A-----------------GVGIIK------AKEAGS
A0A517N8M1      -F----------HKQFE-------N--ESKAFTSQAL-----RSMELE------PEVDDV
A0A5C6CW01      -L----------QERFG-------G--DPTRYNGTAR-----GGLSLT------VEGTGG
A0A5C6BXS9      -F----------RDRFQ-------N--RSGSFAGMSA-----SALKFH------TDLQDA
M5U569          -F----------RAKFN-------D--DPRAFAGMSS-----KALQFS------PDVQGT
L7CND7          -F----------QESLG-------G--RPSGLAGLAF-----ESLKFE------TDIEDA
A0A0J1B8S4      -F----------REQFH-------G--SPVELAALAS-----KMLEFE------TDLKDE
F2ARR3          -F----------RDRFE-------N--NPNLFAGLAN-----GALEFE------TDLQGV
K5D8H6          -F----------RDRFE-------N--NANLFAGLAN-----GALEFE------TDLQGV
M2AKU0          -F----------RDRFE-------N--NANLFAGLAN-----GALEFE------TDLQGV
A0A5B1CKI2      -F----------QEEFE-------G--RVGAFVEESL-----ESLELE------PEVEDV
A0A5C6EG84      -F----------QVEFE-------S--NLREFNEVAI-----KSLELE------PEVDDL
A0A5C6F2X4      -F----------QSEFE-------S--HQAMFNDIAL-----NSLELE------PEVDDL
A0A5C5XTV6      -F----------QDQFS-------G---PGAFGGMSA-----GALRFQ------TDLQDG
A0A5C6AAB1      -F----------RGQFE-------N--QPGVFGGTAS-----KSLKFN------TDLQDV
M5T8W8          -F----------RSKFG-------D--NPAGFAGASG-----EALQFN------ADVQDT
M5SF00          -F----------RESLG-------G--HPSALLGLAN-----KALKFE------TDIQDA
A0A2G1WDS1      -F----------RESLG-------G--HPSALLGLAN-----KALKFE------TDIQDA
Q7UVS9          -F----------RESLG-------G--HPSALLGLAN-----NALKFE------TNIQDA
A0A5C6B601      -L----------PSMTG-------K--SVAQIAATIR-----SGVRFQ------TITNAA
A0A517PFU1      -L----------PAFKG-------A--GSP--VGRIL-----KGLEGG------QVPGTR
A0A5B9M8J9      -I----------PKLRD-------L--SDDQFVALVR-----GGIRFQ------TMTDLK
A0A2A2WFP6      -I----------PALRE-------L--TDDQFVALVR-----RGIQFQ------TITDLK
A0A518L8N2      -I----------PALRE-------L--TNDQFIAMVR-----GGIQFQ------TITDLK
A0A518HQN9      -I----------PSLES-------S--TEKQIAAMVR-----SGIHFQ------TLTDQS
A0A5M6D8H8      -I----------PSMQG-------K--DAKSVASMIR-----KGIKFQ------TLTDVS
A0A5B1CRW9      -F----------KSFAQ-------IARNGGSAVDHII-----QNIEVE------R-GGEG
A0A5C6EI46      -L----------DTFRK-------ARENDQSLVDHIL-----ENIEVE------R-GGEG
A0A2E7D3V4      -L----------PSMLT-------SGDPEEDIVDGLK---VERSAGH-------------
A0A5B9PER9      ------------RLLNS--FDEIPKDDIAEYVINNLV---VTPDPEA-------------
A0A517QSM4      -L----------PTLKE-------QQHPTDWLEKNLK---VTSPASE-------------
A0A355GJI7      ------------MLIQK-------------------------------------------
A0A1Z8MCI4      LK----------PTTDG-------GPRNLAYLVENVA---LTSKGAQ-------------
A0A517SYL7      LK----------PTTDG-------GPRNLAYLVENVA---LTSKGAQ-------------
A0A3L7P0L2      ------------EIFGN-------DKDPLKSIWENLV---VVRESGQ-------------
A0A6M5YVJ1      -L----------GVIQK-------QPNPQDWLSDALK---VDTKGGE-------------
A0A2E0SHG0      VNLLTCPSLL--EEVKE-------GETVVDYVIQHLF---LSTQGEE----------GNV
A0A518CQB8      INMMNLPSIM--EELAD-------DQNPIDYVIDNLY---LSLQGEE----------GNI
A0A517SCC8      -L----------PAFEG-------ADDAAKEISERLT---VKRTSGQ-------------
A0A3A0DR44      -I----------PEIKR-------QVAPLEFLEETLK---VSGEGGS-------------
A0A358MY60      -V-----------GFSD-------PVQSVNTIRDGLG---IETAGTQ-------------
A0A517MNB1      -L----------PAFAD-------TQLAKDTMRKYMR---VSGAGSA-------------
A0A7C1EH96      -L----------AFFEP-------GQNLLQALRSMVSKGDIEVIPDR-------------
A0A142YJ13      -L----------PIVRN-------SVDPIEWLSQQVQ---VEFPRGS-------------
A0A517Z7D3      -L----------PAFKT-------AYDPLMDVLDSLS---AQRSAGR-------------
A0A1N6KY57      -L----------PILTK-------VSDPIEWLENELK---VDFAPGS-------------
L0DK20          -L----------EVITK-------AVDPIEWLEKELQ---VDFASGS-------------
A0A3L7UX05      QL----------PELKN-------SASPEYVMDKKIN---VIDRVNS-------------
A0A517XRC2      -L----------QTIRE-------ADDPVALLETGVR---VDGSIAP-------------
A0A6M5YH47      -L----------DSVKQ-------TPDPVSIVEDQIK---VT-VVAD-------------
A0A660UUK3      -L----------TLLEG-------SVDPVLTLRQAANNGGIEIATQR-------------
A0A517ZHG5      YGFKTIGDL---PLIKA-------QAFPIDWLEARLS----ASGRQE-------------
A0A1Z8MPL5      ------------EAQED-------GIDPIDYLANVLI---IEVPDSE----------KEM
A0A5C1AGE3      -T----------QLVKT-------SDDPAKVIEDMLR---LRWEAPD-------------
A0A2Z3HEL7      -L----------ALVKT-------ADDPVAMLEDAVR---VSVAAPE-------------
A0A142XAP8      -L----------DTVKQ-------SEDPVAMLEDTIR---VAVAAPE-------------
A0A6P2DEK1      -L----------DTIKQ-------SEDPVSMLEDTIR---VTVAAPE-------------
A0A5C6C1R5      -L----------PEIKE-------KPSPLQWLSESLR---VEFPGKG-------------
A6BZU4          -L----------STLAG-------EKDPTQDIIDSLK---VKRISGN-------------
A0A2D5GZ77      -L----------STLAG-------EKDPTQDIIDSLK---VKRISGN-------------
A0A3D3R1Z6      -L----------STLAG-------EKDPTQDIIDSLK---VKRISGN-------------
A0A517XG00      -L----------STLAG-------EKDPTQDIIDSLK---VKRISGN-------------
A0A1G2YRE4      LSFFEAESTDLAGKMKQKLTGDNTKLDAVTKLKRAISSGVISAKAVR-------------
A0A353Z859      -L----------PTITD-------QEDPLIFFEKNMR---VTNPATE-------------
A0A2D6ST10      LS----------EWTDP-------GQNTQEWLEENLE---VSSRASE-------------
A0A177QX42      ------------EKKHA-------KEASLSRLASL-----AASSNPA--ATIATGLRVIR
A0A517SHR0      ------------EKLAS-------KESGLLKLPTL-----AGQSKPSVISTIAGGMRVQR
A0A2E0AW64      -I----------PDLVE-------ADDPIAELKRNLS---IKSAYRD-------------
A0A351FZ59      -I----------PDLVE-------ADDPIAELKRNLS---IKSAYRD-------------
A0A660V239      -I----------VFFRD-------TGDLVLALREAILDGVIIIEPER-------------
A0A177Q3B7      LA----------ILPRD-------PEKQIAWLQAELK---VDYKTGP-------------
A0A2E0X6Y6      ------------RIDLV-------DEAPHEWIDRLAALSSSSVTRRT-------------
A0A518GFD7      -L----------PIIAQ-------HDDPVSWLQEKLE---VTFPGDG-------------
A0A5C5VZJ8      LSWFAARPLTFWDRLIS-------ADPVEQRFDDDVN---VIVPPGK-------------
A0A518GE37      -A----------PSLSN-------PLTAERQIRKRLS---IGNAGTD-------------
A0A5C6F3H8      -V----------PSLSN-------PATAEAHLRSNLT---IKSGGDP-------------
A0A5C5X072      -A----------PSLSD-------PNSAEGKLRKNLS---ISSGGTD-------------
A0A5C5WUQ3      -A----------PSLAD-------PDTAEVNLRKNLT---VGNGGTR-------------
A0A5C6E697      -A----------PSLSD-------PGKAEAAMRKNLT---VASAGTA-------------
A0A5C5Z1A3      -A----------PSLSD-------PDTAEVNLRKNLK---ISSDGTP-------------
A0A5C6D2P7      -A----------PSLSD-------PESAEQSLQRNLS---VASGGTS-------------
A0A5B9ML17      -A----------PSLSD-------PEEAERNIRKNLN---ISHGGSR-------------
A0A517LX75      YI----------EARRE-------GTSALSLLQKNLL---VERGGEG-------------
A0A7C5W7B3      -A----------AAEKL-------QALTPSHILSLVS---VTPDTEN-------------
A0A2S8F9B8      -L----------PVVRE-------NENPLEWLQEALV---VSFPGDA-------------
A0A354GX32      LS----------EIKAQ-------GEGRVAWMKSAAL---VDDKTGL-------------
A0A142XL75      -L----------AIVRK-------SPNPVAWLDHAIK---IDAPANS-------------
A0A6P2D5D5      -L----------ATVRK-------QPDPIAWLEHAIK---IDAPVNS-------------
A0A5C1AAF0      -T----------ELISQ-------QADPVDWLAKELM---VDYPSGD-------------
A0A7C7T8W8      -L----------PEIQK-------TISPLELIEKSLT---VKSVGGS-------------
A0A5C6B3S0      -S----------RVIQS-------QIDPAEWLKANLG---VGFPGEA-------------
A0A368KP63      -L----------PVIAE-------NENPLEWLQKELQ---VRFPGDA-------------
A0A518GIZ9      -L----------QTFAG-------ESDPTQMVLDDLK---VKRVAGQ-------------
A0A1C3EBY9      -L----------KTFAG-------ESDPTQMVLDDLK---VKRVAGQ-------------
D5SX64          -L----------KTFAG-------ESDPTQMVLDDLK---VKRVAGQ-------------
A0A517Z0U7      -C----------PTIRE-------QRDPEAWLEDAIE---VSAVGEQ-------------
A0A2S8FCC0      -L----------PMVEQ-------EPDPVAWLQSALS---VNFPDNA-------------
A0A1Z8MBT6      -A----------PSLAD-------PTTRETNLRKNLS---VAGAGTK-------------
A0A517SXN9      -A----------PSLAD-------PTTRETNLRKNLS---VAGAGTK-------------
A0A518HFL0      -L----------PSVIQ-------SEDAVGYIREAIK---VSPLPGG-------------
A0A5Q3LBQ3      -M----------PEILQ-------EEAPIEWLSERIH---VKSVGDS-------------
A0A3B8ZJM2      MD----------PKKGV-------DVSPAEKSERTIT-----------------------
A0A1U7CLW1      -L----------PTVRK-------LLDPIDWLSGVLM---VDFPRGS-------------
A0A142WPR7      -H----------PAFAG-------ESDPASRIVRGLNV--LADSKTP-------------
A0A3M1TFJ0      -L----------ARAVI-------ESNSVIARQLAED---IGSEDPNALAMAFLAGVDVH
A0A517P477      -T----------PTLQE-------VPDPVVHLQKHLS---VGSPGAE-------------
A0A517T4K9      -L----------TTVRG-------ENHPVDWLEQEVE---VSSPATE-------------
A0A7C6B2Q1      -L----------PSIQE-------QLDPVQWVAQNLN---VRFPGNS-------------
A0A7C4QPD3      -V----------ADLPF-------FAKGDDQLRVALLSDALRVTSPA-------------
A0A2Z3GZZ5      GA----------GLPAD-------DRAVADMIGTGLTVVRDKDSAGP-------------
A0A4V0I6L6      -N----------PPPDG-------VAERVAYMKARFAVARVKEAGSN-------------
A0A7C4QQT3      -L----------PAFRE-------SEDIVEDLLDGLQ---VKRSSGQ-------------
A0A255QXF5      ------------FSLAD-------PESREQHLKQRLK---IHGGGTK-------------
A0A518KBI5      -A----------SHLNK-------TPDRLSHLRKNLQ---IKQVGGS-------------
A0A5C5V6Q5      -A----------EHLVA-------KPDKLKHIKENLS---IRQIGGS-------------
A0A517MY49      GD----------LKNKA-------SKDWVSAISANLS---TSITRKT-------------
A0A2E6AG00      CD----------LKNYP-------REDWVRXLREQXT---VRSFRST-------------
A0A1G3A880      VD----------FRGQP-------RDQWIEILEDNLT---AVAIRRT-------------
A0A2E8ATT1      VD----------FLSVP-------RDKWIDVLRANVS---ARSVRNT-------------
A0A7C2JZW2      -T----------KYARE-------SIDILEQINQDLV---VSSP-AQ-------------
A0A518KYQ0      FS----------LNDPD-------PDVREQALLSNLT---IGNSGTR-------------
A0A5B9QX47      -A----------PSLSD-------PLIAEQNLRRNIS---ISSGGAA-------------
M5T666          -V----------PTLVD-------PATAEANLRKNLS---VSSGGTE-------------
M5U6N6          -A----------PSLSD-------AETAEAQLRENLS---VSSGGTE-------------
A0A517M0G2      FY----------GSETP-------LNVGQ--LRSSVG---LSNAGSS-------------
A0A5C6AST1      -T----------GHFVN-------MDDAKHSLRKNLG---IGNAGTN-------------
A0A5C6C951      -T----------GLFQN-------SEAAKNALRAGLS---IGNAGVD-------------
A0A5C6C5T3      -A----------PSLSN-------PETAEANLRKNLS---IGSGGTD-------------
A0A2A2W6A9      FS----------LQDPD-------PDVRDQKLRSSLS---IGSAGSR-------------
A0A518HQS9      YG----------LQDPD-------PDVREQTLISNLS---IRGGGTR-------------
A0A5M6DFE6      -A----------PSLSD-------PEQAEQNLRDNLS---IRSAGSK-------------
A0A5C6F286      -V----------PSLSD-------PATAEANLRANLK---IKGGGDP-------------
A0A517NGN1      -A----------PSLSD-------PETAEAQLRKNLS---VQSAGAK-------------
M5RUI3          -A----------PSLAD-------PEYAEVSLRENLK---VTSGGNR-------------
A0A660VT66      ------------PRPRS-------------------------------------------
A0A7C2VEF7      ------------VGKKD-------------------------------------------
A0A0S8H0S8      ------------AGKKD-------------------------------------------
A0A7C2ZTD2      ------------PANRT-------------------------------------------
A0A2E3Z6T8      ------------------------------------------------------------
A0A257WQ92      ------------LRKAT-------LQSRLKSVETAVA-----------------------
A0A7C1U6X6      ------------KKDED-------RKRDELFLKLQTE-----------------------
A0A7C7UXI5      ------------EDRLE-------AEAQYRAVDQAVR-----------------------
A0A7C3SFJ0      ------------DRITR-------LQQALSGIEQRIA-----------------------
A0A7C7WWF7      ------------QERIE-------LHAAQIAIRQAVA-----------------------
A0A356ETW1      ------------RKRID-------LQPTLARVQTAVR-----------------------
A0A3L7NJY1      ------------RATEE-------SRTRAASLNRAIA-----------------------
A0A523CME0      ---------------MS-------------------------------------------
A0A354PCV3      ---------------RI-------------------------------------------
A0A354PHB4      ---------------RI-------------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A538RV31      ------------REKQG-------------------------------------------
                                                                            

M5S2L2          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A7C2VXA0      ------------------------------------------------------------
A0A7C3AA48      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A7C5PFV3      ------------------------------------------------------------
A0A7C3QGD2      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A7C2ZUK5      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
A0A7C2JY73      ----------------EVKLVRESI--------ATAMDFY--------------------
A0A356AE44      ----------TLKAAIERGESHEAL--------MLLVKTF----LQKDQTSNSQTVVSGA
A0A1G2XSU7      -------------------------------------------------QTTTSNVANLE
A0A350KD81      ---------------------------------AANGNTS----EGQIASPGTSQVDRAR
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      -----DIISISFTGT-HPETLAKMC--------NMHAKKF----LETHLELRFAASQDAV
A0A524HC32      -----MLIEVSFTSP-DPKLSQVVV--------NTLVDEF----IGWKMEQKFEASRMAR
A0A177PV03      ----NNVLYLSFRGT-NRDDCQVIL--------DAIMQKY----DTYLKSKYERLNDKTV
A0A1G2YIM0      ---KSELIRIVMSSK-NPREGEQVV--------NAIIRAY----MAVEVSNSVRGGDEKL
A0A1G2ZG92      QYKDADMLEIAAYSP-NPFEAANMS--------NKLATLY----IEDRLERKREEYKAAK
A0A1G3A0W0      -----EIIDVDFVDP-SANEAKLIV--------DTVLEQY----IRYIAEMSNENEEELY
A0A353BE27      KDDQTTLIRIAYVSE-DAETAAKVV--------HAVVEGY----EKYLADEYKTVGEEIA
A0A5C6BPW1      RDEEFFAIKMEYSEK-PEELAEIVN--------AITQVYY----RDIANETKLNDKKRIT
A0A1I3GSP0      SSFDNVL-SITYLHP-DKRIARAVV--------QAMVEAY----RDYLEDTRDENAQQLY
A0A517QJV1      NSFDNVF-DISFDHP-DKEIAKTVV--------QAIVESY----RDYLHETRDENSRQMY
A0A3C1QS25      N-----LYLVSFSSP-NQEDCDRVL--------WGVLNGY----QEYLNRKYKATGQELK
A0A5C6FX55      KTAQSVVALLHFDSP-NPDLSTAAV--------TAFSQSL----QQYYNKKYSNSRDELK
A0A5C6DS51      AAENAMVLSASFRAP-HPDDAAMIL--------AAVYSSY----QTYVESHSQNTSREAA
A0A5C6DSL6      SAENAMVLSATYRDP-NPDDAATIL--------AAVFASY----EDYVESHSKNTSREAA
A0A3M1VG27      QSFLNII-ELTYSNR-YAQDAVAVL--------DAIVAAY----SQYLQESQKEHTNELL
A0A518GC22      KDDSTTLIEISYISQ-DAEVAAKVV--------SAIVDGY----EGYLAEEYKTVGIEIE
A0A3L7Q373      SSFDNIL-SIAYQSK-DPKLAKQVV--------ESIVAAY----GDWLEAQKDNNARDLY
A0A3E0PW54      QSFVNLI-DISYLHP-DKNAAGAVV--------RGLVAAY----EDYLEAKQDSNSQELR
A0A7C3TAH2      RRGSELIV-VTMVST-KPDEARQIV--------DSLIRNY----MAVSAYRDTLKEEADL
A0A1Z8MHR4      DSRDRMIVGLNYQSQ-DPYACVAAI--------NGFYSAI----RQHFDAERQATIKEIE
A0A5C6EHJ0      ENIDSSVFQIRYDST-SATTTQRVV--------QSIVDAY----ASHLQDQYRNIGQETI
A0A5C6F1H9      SSIGSSVFQIQFNST-SPSTSQRVV--------QAVTDAY----ASHLKEQFRNVGQETI
A0A255QXY0      DSHDRLIAVLSFEHD-DPQVCEAAV--------DAVSRAI----GAHFQEERESTINEFT
A0A517SYI0      DSRDRMIVGLNYQSQ-DPYACVAAI--------NGFYSAI----RQHFDAERQATIKEIE
A0A518HX54      DSRDRLIAAVHFDGH-DPEVCVAAV--------NAVSDAI----RSHFQEERELRVNEFE
A0A5B9MF59      DSRDRMIAALNFDGR-DPQVCVAAV--------KAVSQAI----SEHFERERQSTINEVG
A0A2A2WC24      DSRDRMIAALNFDGR-DPQVCVATV--------NAVSQAI----SQHFERERQSTINEVG
A0A518KYW8      DSRDRMIAALNFDGR-DPQVCVATV--------NAVSQAI----SQHFERERQSTINEVG
A0A5C5YZZ0      ESRDRTMVEVTFESG-DATVATAIV--------NAVVEAY----NEYVNGRHRRNIENVV
A0A518JLD2      TEESNSVFRVQFVSD-SPVISKLVV--------QALVDAY----GLHLQDQYRNVSQETL
A0A5M6DJ15      SELMAVSLSADDAKA-AAVVLDAVV--------QAYMSEV----ANGERKQRDSRLKELR
A0A3L7P7S7      TTASNNVLKVSFQSG-SSTECVQAL--------KAVIKGY----KNYLDKEYNLADDQFM
A0A517N8M1      RTAQSVVALLHFESE-NRELCQPVV--------QAFSESL----QAFYNENYKSSRGDLI
A0A5C6CW01      RVAQSFVAVLSFEHS-DAELCEASV--------KAFSDAM----QTFFNERQKSSRSELL
A0A5C6BXS9      RSASSLVATLSFEGT-DPDLCEAAV--------KSFSSSL----QKMFAEKHKTSRSELM
M5U569          RSASSLVATLAFESS-DRELCLGAV--------KAYSSAL----QRLFAEKHKSSRTELL
L7CND7          RSASSLVATLTFDHS-DPELCEAAV--------KAYSAAV----QQLFSEKHKSSRGELL
A0A0J1B8S4      RSASSLVAQMTFENT-DPELCEAAI--------KAYSAAL----QKLFADKHKSSRSELL
F2ARR3          RGASSIVANMTFEHT-DPELCEAAI--------RAFSSSF----QQFFADRHKSSRSELM
K5D8H6          RGASSIVANMTFEHT-DPELCEAAI--------RAFSASF----QQFFADRHKSSRSELM
M2AKU0          RGASSIVANMTFEHT-DPELCEAAI--------RAFSASF----QQFFADRHKSSRSELM
A0A5B1CKI2      KTAQSVVTLMHFESE-NEELCKAAV--------ESFSESL----QSFYNENYKSNRGDLI
A0A5C6EG84      RTAQSVVALLHFESD-VEELCQPVV--------QSFSESL----QAYYNENYKSNRGDLI
A0A5C6F2X4      RTAQSVVALLHFESD-VEELCQPVV--------QSFSESL----QDYYNENYKSNRGDLI
A0A5C5XTV6      RMASSLVATLSFHGA-DPDLCEGAV--------EAYSAAL----QEMFAEKHRSSRGELI
A0A5C6AAB1      RSGSSLVASMSFEHT-DPELCEAAV--------KAYSAAI----QQLFAEKHKSSRSELM
M5T8W8          RSASSLVATLAFEST-DSELCVGAV--------KAYSAAL----QKLFAEKHKSSRTELL
M5SF00          RSASSLVASLSFEHS-DPELCEAAV--------KAYSAAL----QQLFAEKHKSSRGELL
A0A2G1WDS1      RSASSLVASLTFEHS-DPELCEASV--------KAYSAAL----QQLFAEKHKSSRGELL
Q7UVS9          RSASSLVASLSFEHS-DPELCEAAV--------KAYSAAL----QQLFAEKHKSSRGELL
A0A5C6B601      DSRDRMIASLSFEGG-DPALCVAAV--------NVMSAAI----SDHFDAERESQLDNLG
A0A517PFU1      ------VLQLTYSGG-SPEETGAVL--------DAVVATF----VEEVREEGQSGIREAI
A0A5B9M8J9      DSRDRMIAALHFDGN-DPQVCVAAV--------NAVCDAI----GDHFQEEREQRVNEFE
A0A2A2WFP6      DSRDRLIAAVHFDGH-DPEVCVAAV--------NAVSDSI----RSHFQEERELRVNEFE
A0A518L8N2      DSRDRLIAAVHFDGH-DPEVCVAAV--------NAVSDSI----RSHFQEERELRVNEFE
A0A518HQN9      DSRDRMIAALNFDGR-DPQLCVATV--------NAVSQAI----SQHFERERQSTINEVG
A0A5M6D8H8      DSRDRMIAALHFDGP-DPQVCVAVV--------NAASEAI----GEHFEAERESTINEFS
A0A5B1CRW9      SAQDAMVLRVFYRAE-EPEEAALVL--------SAVYNSY----KAYIDSQDQDSSKLAV
A0A5C6EI46      AAADAMVLRVFYHAS-NPEESATVL--------AAVFQSY----KRYIDSQDQDNSKLAV
A0A2E7D3V4      DRSLLNVLDITYKNR-NKDDARQIL--------EAVVDAY----EAYLKNSQQEHNSETR
A0A5B9PER9      ----PYIYEIRYTSP-DKSDAPTVV--------NNLLQTYEETLIRQYETDKNLFVSELR
A0A517QSM4      ------FFRLELEGD-RPKDLAMIV--------NAVADAFLTEVVNKERTSRQDRLRQLQ
A0A355GJI7      -----NRLERDFQKN---------------------------------------------
A0A1Z8MCI4      -----GRYAISFIDN-DPVAAKQLS--------DAIAESF----MAVRTLLDSTQISNVR
A0A517SYL7      -----GRYAISFIDN-DPVAAKQLS--------DAIAESF----MAVRTLLDSTQLSNVR
A0A3L7P0L2      ETSFDNILNISFTSA-DKVEAKKVV--------SAVIDAY----ADWLEAKRGSGSQLLY
A0A6M5YVJ1      ------LMVVSIEGD-NPEELFTIL--------EALCRAY----LAEVDERDNGTRRRRI
A0A2E0SHG0      AVSGGHWIYATFEHT-NKEDTPRVL--------QAILNAY----QDHVEETYRNPVNDAA
A0A518CQB8      AVNGGHWIYVTFEHT-NEADTPRVL--------KAILAAY----QEHITETYQNPVNEAA
A0A517SCC8      DSSFDNLIDITYLYP-DPNVAKAVV--------EAIVKAY----DAYLKANLETNSAELF
A0A3A0DR44      -----ELYRIEYVGE-NAKDAATIV--------NGVIRVY----LGKLVADEKTRREEML
A0A358MY60      -----TLLRITYADP-DPNIAALVC--------NEVAASF----LEQRERLDNRRVIDLE
A0A517MNB1      -----S-LTISYQDP-DPQHAALIC--------NEIVEAY----LARREQFDNERVANLE
A0A7C1EH96      ---QTEFLHVRMKTE-HAADAEVLI--------DAFLRSY----EAVVRTDEIRAIDDRL
A0A142YJ13      -----EILSISITANGPPSDLSMLV--------NSVTEAYLSQIVEQDRLERVARFERLK
A0A517Z7D3      DSSFVNLIDLKYAHP-DKDVAKKVI--------AAMVAAY----DDYLEETRKTNSSELY
A0A1N6KY57      -----EILRISISAE-KPDLPMLLV--------NAVTQAY----LDEIVDVEMKQSRQRY
L0DK20          -----EILRISINGE-KPHEPMLLV--------NAVTQAY----IDEIVDVETKQRRQRY
A0A3L7UX05      -----ELIEVQMVGT-SPQNATDIV--------NAVVRSY----LKQAGRWANETTTAQI
A0A517XRC2      -----DLMQVSFNGN-NRDDLVKIV--------DALVGKY----VDDANNAVRKNLMDKA
A0A6M5YH47      -----DILQVTLTGN-NLDDMKVVL--------DHLVKRY----VDDATAFDRGQRTSEV
A0A660UUK3      ---HSELITIKMISR-FPREAEQIV--------DAFIRSY----MNIVRAEEGRSDDNKL
A0A517ZHG5      -----EFFAIKMEYSEKPEELAEIV--------NAITQVYYRDIANESKLLDKKRIAMLI
A0A1Z8MPL5      KGYGGQILRISMRGD-DPDQLKQIL--------EAVTDAYLEEVVTEERAEWLKQKDVLQ
A0A5C1AGE3      ------LMAVTMNGD-RPDELKEVL--------DVLVQTF----KAESSAKETERRRAQK
A0A2Z3HEL7      ------MLEVTLTGN-HLDDMKVLL--------DRLIKRY----LDDTNAFDNRSRTEER
A0A142XAP8      ------ILEVTLTGN-NIEDMKVIL--------DHVVRRY----VDDATVLDRKQRDDQS
A0A6P2DEK1      ------ILEVTLTGN-NIEDMKVIL--------DHVVRRY----VDDATAIDRKQRDDQI
A0A5C6C1R5      -----EVMTIALETE-DPKASTIIV--------DAVVKAYMNEAVLDERNERMQRVNSLE
A6BZU4          DRAFLNILTLTYENP-NAKDARLVT--------QAVVDAY----KRYLHEVREENTEDII
A0A2D5GZ77      DRAFLNILTLTYENP-NAKDARVVT--------QAIVDAY----KRYLHEVREENTEDII
A0A3D3R1Z6      DRAFLNILTLTYENP-NAKDARVVT--------QAIVDAY----KRYLHEVREENTEDII
A0A517XG00      DRAFLNILTLTYENP-NAKDARLVT--------QAVVDAY----KRYLHEVREENTEDII
A0A1G2YRE4      ---NTELLKLTMVSK-KSEEAQQII--------NAFINAY----MAVEVSSSSEEQDRKL
A0A353Z859      ------FLQMSLTGN-NPADLAPIL--------NAVVEVFLREVAQREAQERTKIVNSID
A0A2D6ST10      ------FISISLSGE-RPTELKDTV--------NAVMGAYLQEEVAGAAAARRERLTKLE
A0A177QX42      SEVSEDVLEISYVGP-NAGDCKKIL--------DSVLASY----KRWLESTQAGNRKVLE
A0A517SHR0      SEVSEDVLEISYSGP-NAGDCKRIL--------IAVLDSY----KTWLQSTQAGSRAELE
A0A2E0AW64      ----SNQWYLTYRST-DPQVAAMLA--------NRIYESF----IRTKGDFDVSLRSALL
A0A351FZ59      ----SNQWYLTYRST-DPQVAAMLA--------NRIYESF----IRTKGDFDVSLRSALL
A0A660V239      ---NTELIKIKMTTQ-YPDQAEKVI--------DALIRAY----KARAVTDEVKGEDQTL
A0A177Q3B7      -----EFMRLSLTAE-RAADVKTLV--------GEITDVYLKEVVYKERTRKLERLKHLQ
A0A2E0X6Y6      -----NLIDVKFRSK-RPDTAAAVV--------RAIIDSY----LEWVRDTHQGAAGAEK
A0A518GFD7      -----EVMQVTLETQ-SPADCVKIV--------NGVVDAYMKEVVGNERSQRRQRLESLE
A0A5C5VZJ8      -----QLIEVSISTP-WPGEAAVLV--------NKILENY----KRNYEDRQSAEDNTDV
A0A518GE37      -----NLLTISYRDT-DKVMAAAVC--------NAVAESY----LQVRRRFDDERMGNVE
A0A5C6F3H8      -----KSLEIRYEDT-DPEVAKNVC--------NAVAKSY----LRQRDSFDAARVTNIE
A0A5C5X072      -----SRLVVSYTDT-DREAAAMVC--------NAIVDSY----LRQRDSFDDTRVNNLE
A0A5C5WUQ3      -----ARLVVSYEDS-DREAAAMVC--------NAVVDSY----LRQRDAFDNARMTNLE
A0A5C6E697      -----ARLIVSYEDT-DPEAAALIC--------NAIVESY----LRQRDSFDNSRVNNLE
A0A5C5Z1A3      -----TQLLVSYEDT-DREAAANVC--------NAVVESY----LRQRDDFDNIRVSNLG
A0A5C6D2P7      -----TRLVVSYKDT-DPEAAALVC--------NAVVESY----LRQRDSFDSTRVSNLE
A0A5B9ML17      -----ARMIVSYEDA-NREYAAKVC--------NAIVEAY----MMQRKALDGRRVAILE
A0A517LX75      DARGASVLNASYRNP-NPADAEHVL--------TVVYERY----CHYVESQTRNVGEEAA
A0A7C5W7B3      -----VAVEINGWHE-DEAFIHYVV--------QAVLEGLIDTLVDHELAMVNT------
A0A2S8F9B8      -----EILQVSLTNA-DRQAAMKLV--------NAVVGAYKDEVIESERLARVQRLENLE
A0A354GX32      -----QVLRLSLSGD-QPDEMAKVV--------NEWAATCDSLYTASEEAKIKERIKQVL
A0A142XL75      -----EYMRVSLEGD-DATESKIIL--------EHLKTAY----LADVDLRDNGAKWSRL
A0A6P2D5D5      -----EYMRVSLEGN-DPTESKIIL--------EHLRTAY----LADVDLRDNGAKRTRL
A0A5C1AAF0      -----EIVRISLVTM-QTDDGVKIV--------DAVKTAYLDEFVNKSAKARRQRLDRLQ
A0A7C7T8W8      -----ELYTIAYNTK-FKASAPIVA--------NAILQAY----LEKQPEYVDRQLDDTV
A0A5C6B3S0      -----EIMQVSLASQ-EPKGLNTVV--------NAVVNAYLEEIVQKERDLKRERLNKLE
A0A368KP63      -----EILQVSMSSA-DPTTAMKIV--------NAVVGAYQEEVIESERMARVRRLDNLE
A0A518GIZ9      DRSYLNVLDVTFQSA-SADDARHVV--------KAVIDAY----ASYLNESRSEKTTEVF
A0A1C3EBY9      DRSYLNVLDVTFQSA-SADDARHVV--------KAVIDAY----ASYLNESRSEKTTEVF
D5SX64          DRSYLNVLDVTFQSA-SADDARHVV--------KAVIDAY----ASYLNESRSEKTTEVF
A0A517Z0U7      ------FMRISLTGE-RPADLKTIV--------EAVTNAFVTQVVDQQLQDRRLKLTELK
A0A2S8FCC0      -----EIMEVRLSGE-NSKAISKIV--------NAVVQAYMDEVVDAEAISRTTRLSSLE
A0A1Z8MBT6      -----DKMMIKYTDT-DRDAAAAVC--------NAVVAEY----LQRRAEFDGTQSRRLI
A0A517SXN9      -----DKMMIKYTDT-DRDAAAAVC--------NAVVAEY----LQRRAEFDGTQSRRLI
A0A518HFL0      -----SLIEVSAESR-LRHEAATIV--------NAVVDAF----LKEDATWADARNRGSI
A0A5Q3LBQ3      -----ELFEVRFEGP-NAAHAQLIT--------NEVVNTY----LKMRNEDDNAQTQRVI
A0A3B8ZJM2      -----DQLKISYIAG-DPDTAMAVV--------NAIVLGY----QKFLDEEYKFVDDEVI
A0A1U7CLW1      -----EILSISMTASCPPLDLSTLV--------NAIADSYLTEIVDKERLARVERLERLK
A0A142WPR7      -----DVIRMSFRDS-DPEVCQVAL--------EAVLDGY----RSYLGETHQTTSKDVA
A0A3M1TFJ0      PEETTYVVDVTYTSS-HEERCALYA--------NALAEAY----TRQRKSLWGQKTRQTE
A0A517P477      ------FISVGLSGE-HAEDLPVII--------NGVVDAY----MKEVVVGSMDDREGKL
A0A517T4K9      ------FIRISLRGE-HPADLAAIV--------NAVTTCYMEEIVNSEENRRGERLRRLE
A0A7C6B2Q1      -----EFMNVSFSSP-RAEETAVLV--------NAIVDAYMREVVDTEQRERRERLSELD
A0A7C4QPD3      ----EEFIRVELTSP-HKEEVDDIV--------NAVINAFVREVVAKEVQERKLALAELQ
A0A2Z3GZZ5      -TIGSGVLNLTLREP-DPELCKRLL--------EAVIAAYQAELYSIYEKASQDRIATLD
A0A4V0I6L6      --TPSNVLQLSFKSL-HPADAPKYL--------RAIIAAY----KDELTGVYEDASVRQL
A0A7C4QQT3      DRSHTNVLNISYSHR-DAAVARAVV--------QAVISAY----AAYLEDTRNEKSNEVL
A0A255QXF5      -----STMVVTYTDA-DKNFSAEVC--------NAIVGAY----LQKRDEYDNLRISRLV
A0A518KBI5      -----ELYEVSYSAP-SPQEASDVV--------GAVIQQY----FARQSDEGYRRVQRVV
A0A5C5V6Q5      -----ELYDVSYTSP-SAQESQDIV--------AAVIKKY----FVLQSDEQYKQVQRVV
A0A517MY49      -----NFIDVRYRSK-QAESAAAVV--------QAVVNSY----LEFVRQNHRSAASDQL
A0A2E6AG00      -----HIIEIRYRSQ-RADAAEAVV--------GAIVDAC----LEFMDEYHRNVASEVV
A0A1G3A880      -----NIIRVSYQSR-SASAAVAVI--------RAVMQSY----FDFIEKTHRGTAGQIM
A0A2E8ATT1      -----NIIELSCRSR-DPAAGEAVV--------GAVVDSY----LEFIERNHKDVSVEVV
A0A7C2JZW2      -----EFIRIELRGP-DPKELNVLL--------KAIVDSFQVEVIDREQAARKDRLDGLR
A0A518KYQ0      -----STLSISYRDI-DKRFAADVC--------NAIVEAY----LQKRDEYDNRRIGRLE
A0A5B9QX47      -----TRMVVSYTDT-DQQAAAMVC--------NAIVDSY----LRQRNAFDSSRMRNLE
M5T666          -----SRLVVSYTDT-DREAAAVVC--------NAVVDSY----LRQRDSFDDTRVNNLE
M5U6N6          -----ARLVVGYTDT-DREAAAMVC--------NAVVESY----LRQRDSFDDTRINNLE
A0A517M0G2      -----TLLSIQFEHE-DPVAAATIC--------NKITHSF----LSIRDRLDNDRVSNLE
A0A5C6AST1      -----SLLSISFKHP-DPQTAALVC--------NKVTEAY----LTQRDRLDSERVSNLE
A0A5C6C951      -----SLLTISFKHA-DPEVAALVC--------NKVTEAY----LVQRDRLDGERVSNLE
A0A5C6C5T3      -----SRLVVSYTDT-DREAAAQVC--------NAIVESY----LRQRDSFDNTRVNNLE
A0A2A2W6A9      -----STLTVSYTDT-DKQFAADVC--------NAIVESY----LQKRDEFDNRRIGRLE
A0A518HQS9      -----SAMSISYIDS-DKKFAADVC--------NAVVEAY----LQKRDEYDNRRIGRLE
A0A5M6DFE6      -----SRMEVSYTDT-DREYAQKIC--------TAIVVSY----LSQRDSMDTNRVNSLI
A0A5C6F286      -----KSLEVRYQDT-DRDAAARVC--------NAVVESY----LRQRDSFDDARVNDVE
A0A517NGN1      -----TQMLVSYEDS-DRDMAAKVC--------NAVVNAY----LRQRDAFDSKRTNNLE
M5RUI3          -----RHLVVSYEDS-DGVAAATVC--------NAVVDSY----LRQRDAFDQARMVKVE
A0A660VT66      -----RIVELSVYST-DPEAAAEYA--------NTIARTF----IEFYSRENRES----L
A0A7C2VEF7      -----DIISVAFDSP-YPQEAAGVV--------NTVVDSY----IKYHSLRKQTTVSKVL
A0A0S8H0S8      -----DIICVSLDSP-YPSEADLLV--------NNIVEAF----VSSSPGGNRSTAREIL
A0A7C2ZTD2      -----ELIKVVVKST-NGEEAKQIV--------DAFISAY----MAIEVSSSAQGQDRRL
A0A2E3Z6T8      ------------------------------------------------------------
A0A257WQ92      ----------------NNEP-------------RDALEVLIRRFLAQDGAAGSEFQQQQQ
A0A7C1U6X6      ----------------I-SDLEFII--------NGLSQKLGTSTPQERISAMRLNLDETE
A0A7C7UXI5      ----------------NGEDLQQYV--------FSIMDSVGRQVLLQRLGLDPGDTYTVS
A0A7C3SFJ0      ----------------IGEAMLKKMGEEGVPDETKQRETLKRKMMEAALAQDPWLSYAQQ
A0A7C7WWF7      ----------------SDTDLRQHL--------LTLEPFLGRELLLSAMGLNPNELKAAE
A0A356ETW1      ----------------NGEDLRRHW--------ITVADVVGQEMMMRSFGLSPADIQTQA
A0A3L7NJY1      ----------------NGEDILQFA--------MEALDSAGRQLIEQSMGLGSSDALHVQ
A0A523CME0      ----------------KIEGALRKS-----------------------------------
A0A354PCV3      ----------------NQTLSRNQL-----------------------------------
A0A354PHB4      ----------------NQTLSRNQL-----------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A538RV31      ----------------KDGERLRML-----------------------------------
                                                                            

M5S2L2          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A7C2VXA0      ------------------------------------------------------------
A0A7C3AA48      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A7C5PFV3      ------------------------------------------------------------
A0A7C3QGD2      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A7C2ZUK5      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
A0A7C2JY73      ------------------------------------------------------------
A0A356AE44      TERQQLDTQLIPLLLEEQTALKRYGS----------------------------------
A0A1G2XSU7      QVLITAKQHLAP------------------------------------------------
A0A350KD81      TALETHLMPLLIQKNRLERDFQK-------------------------------------
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      KWLQDQLVDKKLKVEEAEEALILYKEKQNIVGL---------------------------
A0A524HC32      DFLMMQIDQAKIHLEKAEEDLNRFAKKAGIVSL---------------------------
A0A177PV03      REVLNIIKELKKGMDETKQKEDAWLAKNPPPTE---------------------------
A0A1G2YIM0      SVLEDEYRTLTDKLQRQRKIVRQMAEEFGTSAL---------------------------
A0A1G2ZG92      IFIKCQMKEVKEEYYKSLSALSDFKISK--------------------------------
A0A1G3A0W0      RQLSERHTSLRSEIQGHEEFVANLSKTLGTATP---------------------------
A0A353BE27      QLMEGAHADLTKRMRELSESASQFKEANPDIVF---------------------------
A0A5C6BPW1      KLVELSVDYEQQTKKKLDEIAKLGRRLGITNEE---------------------------
A0A1I3GSP0      KSLLERQQQLENDVKSLEAEYQKFRHDAPVFLK---------------------------
A0A517QJV1      DTLLNRQKKLSDEIAKLEKDYREFRVSAPVFLK---------------------------
A0A3C1QS25      GILDDLKRNYDAKAEELQAKIQEQVEAHGEKLA---------------------------
A0A5C6FX55      RFITEATDKVQPQLDKYESIYAQFRKESDLFFD---------------------------
A0A5C6DS51      ELIEAARVQNEMELVTADNEYRDFISKVPVLLE---------------------------
A0A5C6DSL6      NLIEKAQNDNKKELELADIEYREFIKNVPVLLE---------------------------
A0A3M1VG27      TLIHTATVDLRKQLEAKQQEYLRFRAEAPFLWR---------------------------
A0A518GC22      QLISGARDQLSNRLKQLTQQTHDFMLRAPEVIW---------------------------
A0A3L7Q373      ETKLTQKNALDEERKALEKEYSQWRADVPFYIN---------------------------
A0A3E0PW54      ESLARRQTELAEEIERLQSEYHAFRADSPYYLP---------------------------
A0A7C3TAH2      RLLENHRKELTER---LQQHYEQIRQLGQLYGT---------------------------
A0A1Z8MHR4      NLVNNARNKLLPDQEKLEQEYRRFRETAPLQWD---------------------------
A0A5C6EHJ0      DLIQTARNDVLTKLDKLEAEFSEFKKSSGLIFR---------------------------
A0A5C6F1H9      DLIQTARNDVLAKLDTLEGEFSDFKKSSGLIYR---------------------------
A0A255QXY0      RLINKAQDKLLPQQLALERDYKEFRREAPLEWD---------------------------
A0A517SYI0      NLVNNARNKLLPDQEKLEQEYRRFRETAPLQWD---------------------------
A0A518HX54      QLVSQAQEKLLPQQAELEEAYKTFREGAPLEWD---------------------------
A0A5B9MF59      ELVRNAMDKLIREQKDLESEYLTFRNNADLEWD---------------------------
A0A2A2WC24      ELVRNAMDKLIREQKDLESEYLTFRDNADLEWN---------------------------
A0A518KYW8      ELVRNAMDKLIREQKDLESEYLTFRDNADLEWN---------------------------
A0A5C5YZZ0      EFFREGRDSILPKLDELENEFTEFRSTAPLEWN---------------------------
A0A518JLD2      DLIESAQKDVSKKLTALEEDYAKFKTSSNLIYH---------------------------
A0A5M6DJ15      EIYDERSEAIRRERQDLQLRAESLGTSDSESLSIAQQMSVQRYGQIQSELGKVNFNLLRA
A0A3L7P7S7      TRLERSSTVARREAQQLREDLRLIEEQ--LQKN---------------------------
A0A517N8M1      KLISTGMEQLHPKMLELESRYREFRRDAPLAWD---------------------------
A0A5C6CW01      QLISVAIEQLHPKMTDLEKQYRDFRRDAPLAWN---------------------------
A0A5C6BXS9      RLITVATDQLQPKMAKLEQQYRDFRTQAPLVWN---------------------------
M5U569          RLITLATDQLQPKMTELEQRYRDFRTSAPLVWN---------------------------
L7CND7          RLIEDATKVLQPKLSELEENYREFRTNASLVWD---------------------------
A0A0J1B8S4      KLISIATNQMQPKMAELESRYREFRQDAPLVWD---------------------------
F2ARR3          SLISVATDQLQPKLTELEERYREFRTNAPLVWD---------------------------
K5D8H6          SLISVATDQLQPKLTELEERYREFRTNAPLVWD---------------------------
M2AKU0          SLISVATDQLQPKLTELEERYREFRTNAPLVWD---------------------------
A0A5B1CKI2      RLISTGMEQLHPKMLELENRYRTFRRDAPLAWN---------------------------
A0A5C6EG84      NLIAKGMEQLHPKMLDLEARYREFRRDAPLAWD---------------------------
A0A5C6F2X4      NLIAKGMEQLHPKMLDLESRYREFRRDAPLAWD---------------------------
A0A5C5XTV6      RLITVATDQLQPKMDLIEERYRKFRIEAPLVWN---------------------------
A0A5C6AAB1      RLISVATDQLQPKMTELEQRYRDFRTTAPLVWN---------------------------
M5T8W8          RLITMATDQLQPKMVELEKRYRDFRTDAPLVWN---------------------------
M5SF00          RLIRDATDNLQPKLSELEEDYRAFRTKASLVWN---------------------------
A0A2G1WDS1      RLIRDATDNLQPKLSELEKDYRAFRTKASLVWN---------------------------
Q7UVS9          RLIRDATDNLQPKLSELEKDYRAFRTKASLVWN---------------------------
A0A5C6B601      KLVNQAYNDLLPKYEELVEEYHEFQENSPLKWD---------------------------
A0A517PFU1      RLISEARDQVLRDLEAAEAAHREFERTSPLVRG---------------------------
A0A5B9M8J9      QLVSSAQEKLLPQQAELEESYKVFREGAPLEWD---------------------------
A0A2A2WFP6      QLVSQAQEKLLPQQAELEEAYKSFRESAPLEWD---------------------------
A0A518L8N2      QLVSQAQEKLLPQQAELEEAYKTFREGAPLEWD---------------------------
A0A518HQN9      ELVRNAMDKLIREQKDLESEYLTFRDNADLEWN---------------------------
A0A5M6D8H8      RLIDDAQQKLLPQQRMLEEEYKSFRENARLEWN---------------------------
A0A5B1CRW9      ELIEAARETHERELIEADETYRGYVASVPVLLE---------------------------
A0A5C6EI46      ELIEAARETHEQELSDADAAYRDFVASVPVLLE---------------------------
A0A2E7D3V4      ELIDEANVKLEAQLQAKMAAYVDFRQSAPLQWK------------------------RPP
A0A5B9PER9      KYQDNFNNRFAVAIAERKKWDDQYDALRIN------------------------------
A0A517QSM4      GFYRDINEELGLKRTQLEGIAQSLKTTDPEILS---------------------------
A0A355GJI7      ------------------------------------------------------------
A0A1Z8MCI4      ESLRPAISEWESTVLNQQERLQLAARSA--------------------------------
A0A517SYL7      ESLRPAISEWESTVLNQQERLQLAARSA--------------------------------
A0A3L7P0L2      KTLLDQKKMMDEERTRLEDEYEKWRGESPFYIS------------------------SSP
A0A6M5YVJ1      DKLEATNRSYRADLKTNYDRIDAIAVSLGAKDG------------------------ETQ
A0A2E0SHG0      ENIRADFKKAEEEWESIQAKYKNFVESSQFYTS------------------------DS-
A0A518CQB8      QVIGGVANKAREEWEGIREKYKTFMESSQIYTT------------------------TG-
A0A517SCC8      TNLTRQLKDAEQTIRDLDKEYHDWRNNAPFFLS------------------------TPV
A0A3A0DR44      VQLENVKLKREAEIRSIREKIVEIEKTV--VGK------------------------VPA
A0A358MY60      SWLTPSIDLWKAEVQGHERRISELSKST--LGF------------------------DP-
A0A517MNB1      SWLSPSIDLWKEEVAGHGRRVRELSKAA--YGF------------------------DP-
A0A7C1EH96      ARLEAQRRTLEEQMRRQRARIRERVEEYGTEQL------------------------TP-
A0A142YJ13      GLFSDYQKDLSGKRAKFKELAGSVGTSDKTASA---------------------------
A0A517Z7D3      EALTRREKDLQARIDELEQAYLQFRDESPWHAS------------------------TPP
A0A1N6KY57      DLLKSTWNRYQENLREKRQQLKGLTELAGSDNK------------------------STI
L0DK20          DLLKETWNRYQENLKEKRKELKRLTELAGSDDK------------------------KTI
A0A3L7UX05      GKLTRELERRNKEVEDLRNNIKLLGSELGAADP------------------------ELI
A0A517XRC2      DRLEKLIGDLRAKVEQDEREIKRKAEFNGTIGI------------------------EDT
A0A6M5YH47      TKLEQYAETLRTEIEATEKHIELLGRANNTTGS------------------------EDN
A0A660UUK3      NILEEQKRTLDTKIDTQAKEINTLLDEFGTEEL------------------------D--
A0A517ZHG5      ELSDDYEQETKKKLDEIAKLGRRLGITSE-------------------------------
A0A1Z8MPL5      AQYLEKVDELRLKREDLQELAKTVGTSDPDTAN---------------------------
A0A5C1AGE3      DILVKLREKYQKDIDD-------IMRAGHLRGD------------------------MNA
A0A2Z3HEL7      EHLRNRRSEVQNEIAQGERVIEFTARNLGVNGT------------------------GDA
A0A142XAP8      AALQATLTSIEKKLSDQKSKLELAGRTNGTTGA------------------------EAT
A0A6P2DEK1      AALETTLTSIERELKEQKSKLELAGRTNGTTGA------------------------EAT
A0A5C6C1R5      EVYAEAEGKVRARRAEIRKLADTLGTGD--SES------------------------LS-
A6BZU4          QQLKQAEKQIATELKLKKSEYQKFRENAPLYWE------------------------STP
A0A2D5GZ77      QQLKQAEKQIATELKLKKSEYQKFRENAPLYWE------------------------STP
A0A3D3R1Z6      QQLKQAEKQIATELKLKKSEYQKFRENAPLYWE------------------------STP
A0A517XG00      QQLKQAEKQIATELKLKKSEYQKFRENAPLYWE------------------------STP
A0A1G2YRE4      NLLDAERKLLEDKLRSTNDSIRQLGTEYGSXXX------------------------I--
A0A353Z859      AAKADTRAKLGDFIKTKERLVKKLG-----------------------------------
A0A2D6ST10      NLFAKRRAELETKRRRTETLSEQTGAIT--EGQ------------------------RD-
A0A177QX42      EILVSAKGDLDRRLGENRQKYDDFRNTA--------------------------------
A0A517SHR0      SLLKSGKTELEDRLANNRTEYDRFRNKA--------------------------------
A0A2E0AW64      SRLEELRKDKEDDVDRLRQDFRNEAIRN--LNW------------------------DP-
A0A351FZ59      SRLEELRKDKEDDVDRLRQDFRNEAIRN--LNW------------------------DP-
A0A660V239      AILDEERRSLEDQKQRQRDELRQLAQE---------------------------------
A0A177Q3B7      EIQSKYEESLRSHRETVRKLILALGS----------------------------------
A0A2E0X6Y6      RRLTEKLARREQELEEFEAGLRALRRQVGHLAV------------------------SS-
A0A518GFD7      IVHAEAESKVRIKRAELKSLATLLGTGD--AES------------------------LT-
A0A5C5VZJ8      RALERAAADLKRRIEARADEIKVVRKDLNLGAG------------------------SP-
A0A518GE37      AWLVQPIEQWKRNVESLRANLAELTKSA--NGY------------------------DP-
A0A5C6F3H8      EWLEPEIQQWEQRVEERQARVQTLSEQT--LGF------------------------AP-
A0A5C5X072      RWLEPEIQRWEQEVDERQKRVAALSQKT--LGY------------------------AP-
A0A5C5WUQ3      MWLEPEIQRWEQQVEERQLKVTRLSEQT--LGF------------------------AP-
A0A5C6E697      RWLEPEIQRWKQEVTERQRLVQSLSKQT--LGY------------------------AP-
A0A5C5Z1A3      RWLEPEIQRWEQEVEERRQSVNRLSQQT--LGY------------------------AP-
A0A5C6D2P7      RWLEPEIQRWEREVSDRQRVVQSLSEQT--LGY------------------------SP-
A0A5B9ML17      ELLDPEIDHWKGQVEQHKARVRELTIGM--KGY------------------------DPG
A0A517LX75      SLIQQAQQTNETELRQATQEYTRFVATSAGLLD------------------------GE-
A0A7C5W7B3      EGVEQIILSTQNGINDVEREISSIYSEGMEKGL------------------------MP-
A0A2S8F9B8      RVYNETETKARQKRSDLRQLAETLGTSD--SET------------------------LS-
A0A354GX32      KNYQDGTTHLRNKKNELQA-----------------------------------------
A0A142XL75      QKLEETKRGYRSELEKFHKQIDTIAAAL--------------------------------
A0A6P2D5D5      KTLEDTTQKYRKDVEDAHKRMDIIAVAL--------------------------------
A0A5C1AAF0      ALQTTAHESLKRKQATVRKLAEAVGSTR--PEN------------------------VA-
A0A7C7T8W8      ELLERERTRKAEDLAELRERLTTIASQM--------------------------------
A0A5C6B3S0      SIYEDANEQVRQKRNELKRLVEIHGSGS--SDA------------------------LS-
A0A368KP63      RVYNETEAKARSKRSDLRTLAETLGTSD--SDT------------------------LS-
A0A518GIZ9      KTAQEAHDTLQKSLREKEEAYLKFRESAPLQWR------------------------API
A0A1C3EBY9      KTAQDAHDTLQKSLREKEEAYLKFRESAPLQWR------------------------API
D5SX64          KTAQEAHDTLQKSLREKEEAYLKFRESAPLQWR------------------------API
A0A517Z0U7      ELLGREQTELDRQQSALRRLDKELAPNETQVD----------------------------
A0A2S8FCC0      RAYSETENDLRSKRSEFRRLADTLGT----------------------------------
A0A1Z8MBT6      SVIEKQIDELDVEISAKEAEVRQYEVEA--QGF------------------------SS-
A0A517SXN9      SVIEKQIDELDVEISAKEAEVRQYEVEA--QGF------------------------SS-
A0A518HFL0      VRLESYREELEAEIEGLQQGLFRLVQQS--------------------------------
A0A5Q3LBQ3      ELLEGQKEQRSQNVMRLRENVRELSKQT--TGQ------------------------DP-
A0A3B8ZJM2      KLFNEVKKKLDQDLVAHKNGYDKFLVDIKQQGV------------------------LF-
A0A1U7CLW1      ELFAD----YQKDLTEKRLKFKEMAGSIGT------------------------------
A0A142WPR7      ELIKEAKDVLLKQLETKEDEYHKFRQDAPLLFA------------------------KEE
A0A3M1TFJ0      ASVAVVVSRLGATLAASRKKLEEFLSSNQTPLF------------------------ER-
A0A517P477      ANLRQVLATAEDALDLKRKQYQQFVEASQGGV----------------------------
A0A517T4K9      RIQSNLEEELRTKYMSQRRLAETLHTSD--SET------------------------VT-
A0A7C6B2Q1      QLYAEKESELRKLENDLKALSQQLETG---------------------------------
A0A7C4QPD3      RLHDAEAEQLKIRQNQLRSLDKELLVPN--AAQ------------------------SD-
A0A2Z3GZZ5      RLLEAVKGQRKAAGEHRITHLTELRGIT--------------------------------
A0A4V0I6L6      KLLDEQIARLKRGLNDTRVQLDEAERKL--RGV------------------------ID-
A0A7C4QQT3      RLAQNAHDEVLQKLREKEREYQAFREQAPLQWK------------------------TPV
A0A255QXF5      QYLGRQIDELKRRVEEQKEAVAKFAREA--SGA------------------------AP-
A0A518KBI5      DLLEKERTRRQLEVERLQTYVIDLSREV--TGK------------------------DP-
A0A5C5V6Q5      DLLEKERVRRKLEVDRLQQYVVELSKEV--TGK------------------------DP-
A0A517MY49      VHLEKQRATLEAELDEKQNQLQVHRERVGHLAI------------------------SS-
A0A2E6AG00      AILHKERKEVEQQLVTRDRQLLNTKRSLGDLGM------------------------RD-
A0A1G3A880      DVLGQEKVRVEAKLDEKKAALLAARRNFGDLGI------------------------KP-
A0A2E8ATT1      TILEKERQVTEAKLEQKKRSLLELKRQIKDFGL------------------------RE-
A0A7C2JZW2      KLLTEEEDRLKSQREALKLVDQNLEAAT--DSQ------------------------MD-
A0A518KYQ0      NWLTPQVEQLKRKVEEQEKLVAQLAKES--HGV------------------------AP-
A0A5B9QX47      RWLEPETTRWEQEVESRQLRVQELSARL--MGY------------------------AP-
M5T666          RWLEPEIQRWEQEVEERQQRVHMLSEKA--LGF------------------------AP-
M5U6N6          RWLEPEIQRWEQEVESRQQRVHMLSEKA--LGF------------------------AP-
A0A517M0G2      SWLTPSIDQWKNEVHVHGERVRDLSKVV--IGY------------------------DP-
A0A5C6AST1      SWLAPSIDLWKSEVQSHEKRVRELSKTA--LGF------------------------DP-
A0A5C6C951      SWLAPSIELWKSEVQAHEKRVRELSKAA--LGF------------------------DP-
A0A5C6C5T3      RWLDPEIQRWEQEVDERRKRVQLLKQKS--FGY------------------------AP-
A0A2A2W6A9      SWLTPQVEQLRRKVEEREHLVSQLAKEA--HGV------------------------AP-
A0A518HQS9      QWLTPQVEQLKRKVEEQEKLVSQLAKEA--HGV------------------------AP-
A0A5M6DFE6      NYLTPAIRDREKKVQEKQDIVQKLSEKT--LGY------------------------NP-
A0A5C6F286      RWLEPEILRWEQEVEKRQSLVQALSEEA--LGF------------------------SP-
A0A517NGN1      RWLEPEIQRWEAEVSNRQSRVQSLSERT--LGF------------------------NP-
M5RUI3          RGLEPEIQRWQQEVEQRHHRVQKLSETL--VGF------------------------AP-
A0A660VT66      SFYTTQLKALEAQIADCNERINDFIHRNGLITP---------------------------
A0A7C2VEF7      DILQKEKVKRDRELSDKYEEMVQFTRENGVVSF---------------------------
A0A0S8H0S8      KTLRSEKARQAEELTANFQAMEEFKRANGIISL---------------------------
A0A7C2ZTD2      TVLEDERRVLAEKLQRQRKTIRQLAQEYGTTAL---------------------------
A0A2E3Z6T8      ---------------------MHYGP----------------------------------
A0A257WQ92      QDIAIFESRLLPLILEEKQLLRDFGP----------------------------------
A0A7C1U6X6      A----RIDELKLSIAKLEAQVNQAGV----------------------------------
A0A7C7UXI5      R----MNEQLLQNTARLKTLLQRYGP----------------------------------
A0A7C3SFJ0      Q----IA---LLDIRIFEEKQRVVDE----------------------------------
A0A7C7WWF7      D----LKQKLLLSRARHRKLAEHFGP----------------------------------
A0A356ETW1      S----LEQTLLADQALLESMRGRVGM----------------------------------
A0A3L7NJY1      R----INEELLDLRSRLRDANLKYGV----------------------------------
A0A523CME0      ------------------------------------------------------------
A0A354PCV3      ------------------------------------------------------------
A0A354PHB4      ------------------------------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A538RV31      ------------------------------------------------------------
                                                                            

M5S2L2          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A7C2VXA0      ------------------------------------------------------------
A0A7C3AA48      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A7C5PFV3      ------------------------------------------------------------
A0A7C3QGD2      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A7C2ZUK5      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
A0A7C2JY73      ------------------------------------------------------------
A0A356AE44      ------------------------------------------------------------
A0A1G2XSU7      ------------------------------------------------------------
A0A350KD81      ------------------------------------------------------------
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      --------------------GETAGIIEQKLEGLKSNLTEIKIEKIKL------------
A0A524HC32      ---------------------------DSKLNSIYRQLEELNSVITVA------------
A0A177PV03      -----------VSETLLTNLRTRRSNETILRDSLQRQVKDLDHAIKIG------------
A0A1G2YIM0      -------------TGRQDMMLQQVTMLQSEMTRIQTQKLSLEAQIMML------------
A0A1G2ZG92      ----------------------KTVNLDTETQNLINKIATLQGEYEDN------------
A0A1G3A0W0      -------------GELVSSKRVRLDQTKARLNELKQSIALLEWKKKAL------------
A0A353BE27      -----------IGDDVNDPYHATWETLHKKLIDIRSRKSEIDALTTQVRKSLNKGHSPES
A0A5C6BPW1      -----------ELSLDIAADNAFTRQLQDQWFNHTILRNKLRLETQITEKIGDSLEENPD
A0A1I3GSP0      -----ASPIVSINGMPAPAQNQYETELASIETAQNENLRKRSSIQARLATLDRKLKDNAS
A0A517QJV1      -----ASPIVGANGVPVPPQSRYEAELSSIEEEQNEGQIKQSGIEAKLSELKRRRERGDS
A0A3C1QS25      ---------FWNAEGIINLEQQRMQELDAHIRQLELQKTEYQSQLDRIAQLEEEGKTQAV
A0A5C6FX55      -----------EQGNAINPHRVRVQELMADRGKLVQEYVDAELTYRSIKQTVEGAEDPRL
A0A5C6DS51      ------------GDQVRDVHKNRLDQLEQELTDVRSSLAEAKSRLIVISSYAKRDDTNDV
A0A5C6DSL6      ------------GDQVRDLHKNRLDQLEKELAEVRSSLAEAKSRLIVISSYADQSKESGV
A0A3M1VG27      ----RPTVADESSQDVISVHIDEVQKIQQALSGVTVEQTVVRSKIRALEEAIASGRSPRE
A0A518GC22      -----------TGDEATDPYSVNFLKLNSKITELRVERGRLESVYSQALKAIESGRSPET
A0A3L7Q373      ------------TTPAVTAQGTPLAQQSIYQAKLSDVITRQSANEALLRSTRSKIG----
A0A3E0PW54      ----------------TPPTVAVNGSVIPGKNPYQARVEKIGTDLSRNRVLQSEIASRIA
A0A7C3TAH2      ------------------------TFLDSRQDMVTQRLASLMAELSRIEATRIGMEAELQ
A0A1Z8MHR4      -----------LDGQAINPHRERQVMLQKNRLDLEQQLRLLSSDLRLAQKTIQRHQDPAI
A0A5C6EHJ0      ------------GNETTSLHRDNADRYMAQRQNLLIQKAKISGLLAAARKAMIENQPNEA
A0A5C6F1H9      ------------GNDTTSIHRDNADRFMAQRQDLLIQKAKLSSLLSSTRKAMEEEQPYEA
A0A255QXY0      -----------TQGNVINPHRQHYDHLQTMRQGLERRRRQLGTELTFVTNMRTQQRHPEL
A0A517SYI0      -----------LDGQAINPHRERQVMLQKNRLDLEQQLRLLSSDLRLAQKTIQRHQDPAI
A0A518HX54      -----------PNGQVVNPHRQRQFQLQSFRDQLEQKQRQLDCELRFAESMRSRHKNPLM
A0A5B9MF59      -----------VEGQAINPYRERQFQLQTYRTELEQKKRELNSDLRLAVNTRKLHSDPVL
A0A2A2WC24      -----------VEGQAINPYRERQFQLQSYRTDLEQKKRELNSDLRLAINTRKLHSDPVL
A0A518KYW8      -----------VEGQAINPYRERQFQLQSYRTELEQKKRELNSDLRLAINTRKLHSDPVL
A0A5C5YZZ0      -----------GKGEAINPYRDDAIRLEESLHALETQSRQLNSKLRLIREAVKDGTNNYA
A0A518JLD2      -----------DDKIASVHRENSGVYLSQIQSLTLERAKLNSVMDSAKLAISEEKPLESV
A0A5M6DJ15      EGELEAYQQLLAGMEATRAKLEKELDAMRKSNAAGEQAESKGSNIAKQDGESSAADSEKL
A0A3L7P7S7      -----------TTSGVVN----RQKLLQEKSNGLMNRLDRVRARQEELTDQMRLAG----
A0A517N8M1      -----------SEGKAINPHRERQLFLVGSRSEVVEKLRQKSVEVAAIESIIRESGDDPL
A0A5C6CW01      -----------SQGEAINPHRESQLFLTGKRSELNEQMRQKATQLAAVESIYSQ-ANDHL
A0A5C6BXS9      -----------EQGVAVNPHRERQLYLTGRRSELFEELRQRSVELTAIETISKE-AKDPL
M5U569          -----------EEGKAVNPHRERQLYLTERRSELFEQARQKSIELASIKSIAKE-GKDPT
L7CND7          -----------ENGKAINPHRERQLYLTARRSELFETLRSESVELSAIESIARE-ADDPL
A0A0J1B8S4      -----------ENGQAINPHRERQLYLTARRSELFEELRKKAIELTAIDSISNE-AKDPL
F2ARR3          -----------QNGAAINPHRERQLYLTERRSELFEHLRQKSIELTAIQSIADE-AEDPI
K5D8H6          -----------QNGAAINPHRERQLYLTERRSELFEHLRQKSIELTAIQSIADE-AEDPI
M2AKU0          -----------QNGAAINPHRERQLYLTERRSELFEHLRQKSIELTAIQSIADE-AEDPI
A0A5B1CKI2      -----------AEGLAINPHRERQLFLVGRRSEIDEIARQKKTEVAALKSIVSQSGQDPI
A0A5C6EG84      -----------SEGIAINPHRERQLFLVGRRSEVVEKLREKAVEVAALESIIRESKSDPL
A0A5C6F2X4      -----------SQGIAINPHRERQLFLVGRRSEVTEKLREKAVEVAAIESIIRESKSDPL
A0A5C5XTV6      -----------ERGDATNPHRERQLYLTGRRSQLDEELRQKSVELTAIESIAREAS-DPL
A0A5C6AAB1      -----------EKGEAVNPHRERQLFLTERRSELYELMRQKATELAAMTTISKEAK-DPE
M5T8W8          -----------EEGKAVNPHRERQLYLTERRSELFEQARQKSIELAAIQSIAEEGK-DPL
M5SF00          -----------ENGEAINPHRERQLYLTERRSELFETLRSQSVELSAVESIAREAD-DPL
A0A2G1WDS1      -----------ENGEAINPHRERQLYLTGRRSELFETLRSQSVELSAVESIAKEAE-DPL
Q7UVS9          -----------ENGEAINPHRERQLYLTERRSELFETLRSQSVELSAVESIAKEAD-DPL
A0A5C6B601      -----------KDRQVINPHRERQLRLQAEREDLESEAMKYERELKTADLIRQQNP-DPI
A0A517PFU1      -----------PDGQPLNPHAADLLALDRARDELSLELSNLTAEV------------ESI
A0A5B9M8J9      -----------PDGQVVNPHRQRQFQLQAFRDELEQKQRELDCELRFAESMKRRHK-NPL
A0A2A2WFP6      -----------PNGQVVNPHRHRQFQLQSFRDQLEQKQRQLDGELRFAESMRSRHK-NPL
A0A518L8N2      -----------PNGQVVNPHRHRQFQLQSFRDQLEQKQRQLDGELRFAESMRSRHK-NPL
A0A518HQN9      -----------VEGQAINPYRERQFQLQSYRTELEHKKRELNSDLRLAINTRKLHR-DPV
A0A5M6D8H8      -----------LEGQAINPHREQQFRLQAHRTELQQRMRQINSELRFATSTFKRHD-DPV
A0A5B1CRW9      -----------GD-KVRDVHKERLSDMETELNEVRSLLAESSSRLQVIQAAQLSND-DAV
A0A5C6EI46      -----------GD-KVRDIHKERLSDMETELNKVRSSLAENESRLQVILTEAEERG-DEL
A0A2E7D3V4      GTESSPADVVNVHQDRLEAIDAERRKNLLEREDLQSKIAVFEEAIASG------------
A0A5B9PER9      --------------GNSNIHAVMVVQLAKSMQAMREELGKLQNERAKN------------
A0A517QSM4      --------------SKRQLEYEYYGQLREEFTRLRFELMQANIQLAAR------------
A0A355GJI7      ------------------------------------------------------------
A0A1Z8MCI4      -----------------GIPLDEMTQQREFLASLKRAHMDATMQLKAV------------
A0A517SYL7      -----------------GIPLDELTQQREFLASLKRAHMDATMQLKAV------------
A0A3L7P0L2      VVSAQGVPT-----SMPSPYQANLQDLVTRRNLNRDQLRKTKIKIDQL------------
A0A6M5YVJ1      A-------------LNDSLLRDDLRNATRELSVVRDQLQRAELDLRAA------------
A0A2E0SHG0      --------------DSVNVYLNTLNDYETQLRLLQFQRYASESRLEII------------
A0A518CQB8      --------------DTVNVYLNSLNDYETQLRLLQFERYAAESRLEII------------
A0A517SCC8      IV------------TAQGTAMPGQSPYMVELDRINTAVRDNMLKRTAV------------
A0A3A0DR44      KGDT----------GAAGSVLSPVFALQQRLVEIEADREVLNAQIAAY------------
A0A358MY60      -----------------NNPVESLEYDLSTLSNLRKEVQDMRVQESWL------------
A0A517MNB1      -----------------TMRVEGLENDLSVLGSLRRDLADLIVEESIL------------
A0A7C1EH96      ---------------RQEIALQQVATLKQEQISIGVQRMQMEARVQAK------------
A0A142YJ13      --------------VRQQMMVEHLGLARQELMRLQSDVRRSQARLNVL------------
A0A517Z7D3      IV------------TANGMVAAGQSPYQARVERIRQDRNENDIRKAEI------------
A0A1N6KY57      A-------------TIHQHELDRLGRAEDELSRIQSELRSLRIESEVL------------
L0DK20          A-------------NIHQHELDRLGRAEDELARVQSELRGLRVEHEVL------------
A0A3L7UX05      K-------------DRSRLTLEDYTRMSRDLSQLEFERITAESRVERL------------
A0A517XRC2      N-------------KQLSTLKL----METQLSQEVAALKTINQDNELL------------
A0A6M5YH47      S-------------LQIGLLHRQHAEAEADYNKTTREISRLESELSVL------------
A0A660UUK3      --------------GRQEIMLQTVARLQDDLDGVTIRRIELEAQVNMY------------
A0A517ZHG5      --------------EELSLDIAADNAFSRELQQQYFDLTIMRYNLKLE------------
A0A1Z8MPL5      --------------ATQQLLLDQILYLRRQISEVREQSVQKQRDLRAY------------
A0A5C1AGE3      P-------------QTPEMFNEKVKDVGDELRKARSAKREAEVKLAAL------------
A0A2Z3HEL7      N-------------GSTQLLHIKFGELDRMFTAANHELGDLQSQLSVY------------
A0A142XAP8      S-------------NALALLQKQHVEADALFVGAGREIEKAEAELKVV------------
A0A6P2DEK1      S-------------NALALLQKRHIEADALFVAAGREIEKAEAELKVL------------
A0A5C6C1R5      --------------IAQQLSVERYGHVQTELGKVNFDLMRTQGEVEAY------------
A6BZU4          GSEAAVAGSTNVHQERVKAIDNERRLNLLKLTELKSKIDSLKAAIASG------------
A0A2D5GZ77      GSEAAVAGSTNVHQERVKAIDNERRLNLLKLTELKSKIDSLKAAIASG------------
A0A3D3R1Z6      GSEAAVAGSTNVHQERVKAIDNERRLNLLKLTELKSKIDSLKAAIASG------------
A0A517XG00      GSEAAVAGSTNVHQERVKAIDNERRLNLLKLTELKSKIDSLKAAIASG------------
A0A1G2YRE4      --------------DRQDMKLRRVTALQSTLTAVEARRISLEAQVQFL------------
A0A353Z859      --------------GDNETAAEAAKARESFYADIRKQSVMAKIEKTKI------------
A0A2D6ST10      --------------WKYQNDLAIQRSLIAEFRQVKVQLINLRFDQTHL------------
A0A177QX42      -----------------TLIFQDNKGINYYEERLRKIEDERHQKMIAL------------
A0A517SHR0      -----------------QLLFQDNKGINYYEERLRKIEDERHLKMLEL------------
A0A2E0AW64      -----------------YAVAQTESDPGASALSYEKQLAKLAIDQAIV------------
A0A351FZ59      -----------------YAVAQTESDPGASALSYEKQLAKLAIDQAIV------------
A0A660V239      --------------FGSTELTSRQEMMLQQVTSLRNELINVNIRRISL------------
A0A177Q3B7      --------------GDAQVLAVKQRYAAEALGQAERELLQTQSELRRA------------
A0A2E0X6Y6      --------------KDGLTDPIIQQALRVNEMLMDAQQQRLQLQATLA------------
A0A518GFD7      --------------VAQQNALQQYGLMQEKLSTIQFALMQAEGEMKLA------------
A0A5C5VZJ8      --------------------AEVVVKRQVALDERRAELWTLRKEIALD------------
A0A518GE37      --------------FKESSPRERDASQ---MVQVRSELSNIEAEKTVT------------
A0A5C6F3H8      --------------GKAIEKAENESNLAL-LTQLRSEIGDLKIELSLF-----------D
A0A5C5X072      --------------GQSVDRNDSEAHMSR-VAALRSQIGDLKIELALF-----------D
A0A5C5WUQ3      --------------GQRLDVIEDQSSLSL-MTHLRSQIADLSVQLAID-----------D
A0A5C6E697      --------------GENAASLESDSNLSL-MARLRDEIADLNVQLAVM-----------D
A0A5C5Z1A3      --------------GRATSVAENNDNMSL-LAKLRADIADLTVELSIA-----------D
A0A5C6D2P7      --------------GERVSTLEDSSSFSL-MTRLRQQIAELNVEISVL-----------D
A0A5B9ML17      SPLGF---------SRNESRLALLNGYESQINDLRVDIFELEGKLQLE------------
A0A517LX75      --------------ELRSVPHERLKGIEQELAEIRSQLAYAKSRYEMI------------
A0A7C5W7B3      --------------KDISRTLDRIEELNRTIEETRLAIIEVEQRVNTY------------
A0A2S8F9B8      --------------LAQQGSVQHYGLVRNELAQVRFDLMRSEGELDFLTSSNKAKMEAQA
A0A354GX32      --------------RRDLLGLKDPLTLGKELDSTQDLLKTPQSQRLLL------------
A0A142XL75      -------------------GTKDEATLMTFDSFLRDELRLAQRDLQNA-----------R
A0A6P2D5D5      -------------------GTKDEATLMTLDAILRDELRLAQRDLQTA-----------T
A0A5C1AAF0      --------------MQQQLAHEQYGTAQREYVKLQSDLRRLRLEESSL------------
A0A7C7T8W8      --------------TSLPAFQIGDPTSPLLMSAPHRPMLELNKRLGAL------------
A0A5C6B3S0      --------------LKQQNTLQQYAIVRNELTKLHFESMRARGELETL------------
A0A368KP63      --------------LAQQGSVQHYGLVRNELAQVRFDLMRAQGELDFLTSSNSSSQAADK
A0A518GIZ9      GAIAADG-------TSGATNVHQERVIAVEEQRRLNLLRRTEINSRMQ-----------A
A0A1C3EBY9      GAIAADG-------TSGATNVHQERVIAVEEQRRLNLLRRTEINSRIQ-----------A
D5SX64          GAIAADG-------TSGATNVHQERVIAVEEQRRLNLLRRTEINSRMQ-----------A
A0A517Z0U7      --------------AMQQAKLDLRVELRKQLGAVRLQIIEQEIILQTI-----------E
A0A2S8FCC0      --------------GDTASLSLVQQNALQQFAALRSELTKVQLELLRA-----------R
A0A1Z8MBT6      --------------NNQVSVIEDQSQTSR-LRELIDQRFELEQQISLI-----------E
A0A517SXN9      --------------NNQVSVIEDQSQTSR-LRELIDQRFELEQQISLI-----------E
A0A518HFL0      ---------------------ENPEMMQRNLDKLLSP-----------------------
A0A5Q3LBQ3      ---------------FGPNPVSEVISLEHPLGNLQKRLTEAEVHREVM-----------E
A0A3B8ZJM2      --------------NVTEPVNHFFEAAMRNQQQLTAKRLEANQIKSIL-----------D
A0A1U7CLW1      --------------SDKQAAAVRQQMMVEHLGLARQELLKLNSDVRKS-----------Q
A0A142WPR7      --------------GAKNIHQERLAGIEQARSALLIALHEKTAELDSL-----------K
A0A3M1TFJ0      --------------QEELLIQQIDANNRALEAVRRDRIA---------------------
A0A517P477      --------------ASTIMAEQRHAGLQELRTMLRGEVTRTELELIRE-----------R
A0A517T4K9      --------------VKHQLDLEYFSELRKKLAETRFELTRAKIQLAVL-----------E
A0A7C6B2Q1      --------------DSQALSLKQQITLQQ-FSTYRSELINVQLRMMRA-----------Q
A0A7C4QPD3      --------------AKRQAQLDLQLELRKQLSLLQPQIIELELALGDA-----------D
A0A2Z3GZZ5      --------------------TEDVSSVRTRVSALRDQARALRTDISNL-----------D
A0A4V0I6L6      ------------------------------------------------------------
A0A7C4QQT3      AGLSADAQATTNVHQERVVAIEDQRKLNL------LRRAELQSRLQAI-----------D
A0A255QXF5      --------------GERVAEIESAESFLL-IEKLRSQISNLEIQLAMI-----------D
A0A518KBI5      --------------FGQN-VVDVEKAISP-LASLHQQLTEIEVRIEIL-----------K
A0A5C5V6Q5      --------------FGHNTLMDVDKAISP-LASLHSQLTDVEVRIEIL-----------H
A0A517MY49      --------------EDNVVEPMIQAAMSLNEAALEAKQKRLELQAKLD-----------S
A0A2E6AG00      --------------ASNSLHPLVQRVVQINDSLIEAQQKRIRLQATYD-----------A
A0A1G3A880      --------------GGQVVHPLVQRAVRLNEALVEAQEKRVELQSALA-----------A
A0A2E8ATT1      --------------GS--IHPEVQRVLQLNKAIMEVQEERLQLQASLT-----------S
A0A7C2JZW2      --------------LRRQAKIDEQLEIRREMAKLHPQIIELELLLGAL-----------A
A0A518KYQ0      --------------GERVAALENSDSFSV-IRNLRSQISDLEIEIALL-----------D
A0A5B9QX47      --------------TERVDAMEDKNSFSM-MQSLHSQVANLTYELAVL-----------D
M5T666          --------------GRNVDRAESESSMSR-LADLRSQVGELEIELALF-----------D
M5U6N6          --------------GQNLDRAESESNLSR-LSDLRAQIGELKIELALF-----------D
A0A517M0G2      --------------THRVEGLEND--LSV-LAGLRTDLSNMIVEESIL-----------E
A0A5C6AST1      --------------TQRVEGLEND--LSI-LGSLRRDLANFIVEESVL-----------E
A0A5C6C951      --------------TQRVEGLEND--LSI-LTGLRRDLANYIVEESIL-----------E
A0A5C6C5T3      --------------GQSIGRSDSEAHATR-MSELRSQVGDLKIKLALF-----------D
A0A2A2W6A9      --------------GEKVAALENSDSLSV-AQKLRNQISDLEIELAML-----------D
A0A518HQS9      --------------GERVAAIENSDSIAL-VEKLRGEISDLEIELALM-----------D
A0A5M6DFE6      --------------SAPLSSMENQHSISL-FGQLQSQISSLEAEIEML-----------D
A0A5C6F286      --------------GHALDRAENDTNVAL-LTQLRSEIGDLKIELAMF-----------D
A0A517NGN1      --------------AARLSVAEDESSLAL-FAELRSKITDIEVKLSVL-----------D
M5RUI3          --------------GQKIAALENESNMTL-MAELRSRISDLRVKIAIA-----------D
A0A660VT66      ------------E---------MWKAFREELTRLRSEVAQQRND---L------------
A0A7C2VEF7      ------------DNQGGNVVFQKLIKLSEALTEAQLMTIEAQAD---Y------------
A0A0S8H0S8      ------------ADGKGSIMAQRLGELSAALTVAEVEAILAKAE---Y------------
A0A7C2ZTD2      ------------G-GRQDMMLQRVASLLAELTKIEARRINLEAQVQLL------------
A0A2E3Z6T8      ------------------------------------------------------------
A0A257WQ92      ------------------------------------------------------------
A0A7C1U6X6      ------------------------------------------------------------
A0A7C7UXI5      ------------------------------------------------------------
A0A7C3SFJ0      ------------------------------------------------------------
A0A7C7WWF7      ------------------------------------------------------------
A0A356ETW1      ------------------------------------------------------------
A0A3L7NJY1      ------------------------------------------------------------
A0A523CME0      ------------------------------------------------------------
A0A354PCV3      ------------------------------------------------------------
A0A354PHB4      ------------------------------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A538RV31      ------------------------------------------------------------
                                                                            

M5S2L2          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A7C2VXA0      ------------------------------------------------------------
A0A7C3AA48      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A7C5PFV3      ------------------------------------------------------------
A0A7C3QGD2      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A7C2ZUK5      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
A0A7C2JY73      ------------------------------------------------------------
A0A356AE44      ------------------------------------------------------------
A0A1G2XSU7      ------------------------------------------------------------
A0A350KD81      ------------------------------------------------------------
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      --------------------------KALSDQIKQYSKDPTLTKLIPEIVKDGSINT---
A0A524HC32      ------------------------------EADMITKMAAYQQALGDETSNLPQVLK---
A0A177PV03      --------------------------------QGAEMFNDMRRVSAHPQTGNTKLDE---
A0A1G2YIM0      -------------------------EKAEEETLPLEKVLTMKNEILRNDAQEQSLS----
A0A1G2ZG92      ----------------------------------EKTILESRRKIVDSNKKLKEMEK---
A0A1G3A0W0      -----------IDDSNNVAFASSPAIQSEYSDDEEWRKLDYDVRAMKLQIANSGLTS---
A0A353BE27      LMRLLAMVSGGGTASANGAWDLEVFRQEQAQTRIRTDEMSRRLEQ---------------
A0A5C6BPW1      I-----------------------------QADLIDTLIERDPKM-----VDLSIK----
A0A1I3GSP0      R---------------EELEFWVMHSLSTGT-AGAGGGNGGGGASIAGPPEKGALD----
A0A517QJV1      R---------------ESLEFWVTYSLSTGTGAGKSASSGGGAGALSGPPEKAALD----
A0A3C1QS25      IVFILEQH---EKIK-----------------------------------EDKEKNS---
A0A5C6FX55      ---AFTIV---SQLLD------RPLSLPKELDATRLAMGADDGEL-----ASMEVQ----
A0A5C6DS51      N--DLDKL---ALLSQKEVTRLKLFLDMT-RGETQSVAFQMDQPL-----RAEAARA---
A0A5C6DSL6      D--DLDKL---ALLSQKEVTRLKLFLDMT-RGETQSVAFQADQPL-----RAEAARA---
A0A3M1VG27      LTALVKLF---LYSEGHKNAAEAFAAPAD---------------------APDVVR----
A0A518GC22      IMMLLTQL---NNASLTALDSTYSQLLQIDDNDLKNRLNSKSAQI-----EQ--------
A0A3L7Q373      ---ILKEM---MANPEERESIQTYIMSSLAASSSPGGEGGSGAGLVSTPTGKAELD----
A0A3E0PW54      TLEELQAS---GESREALEFFVIHWMSQGKSSSGDGESGGGGGSLLTEPPVRAELD----
A0A7C3TAH2      VPEPVDVN---APVIM--PEDVNAIIAGS-TILSRNQYINADPLV-----QDLT------
A0A1Z8MHR4      VAQVIGLL---GSLNHEGMTGIKRALNGENQ-------RQDDLTL-----QRLEVQ----
A0A5C6EHJ0      ILLALNSS---LKIA-DGDVDLSKAMSPESRWELEKIRKKPLLSA-----AERFRQ----
A0A5C6F1H9      ILMALNSS---FQATDDAAADFTRSMSPEQKWELEKIRSKPLLNA-----GERMRQ----
A0A255QXY0      VARVISEL---SDEAHD-LGDVPFGMRKLMD-------VKEDIGI-----QQIEIE----
A0A517SYI0      VAQVIGLL---GSLNHEGMTGIKRALNGENQ-------RQDDLTL-----QRLEVQ----
A0A518HX54      VAMIIGQL---SDVFED-SRLMLNGRSSGSL-------ATDDLEM-----QKIEVE----
A0A5B9MF59      VAQIIGHL---GSVVDD-FEPLKQIVGPGSA-------TTDDLTL-----KKLEVE----
A0A2A2WC24      VAQIIGHL---GSVVNE-FEPLRQIVGPGNA-------APDDLTL-----KKLEVE----
A0A518KYW8      VAQIIGHL---GSVVNE-FEPLRQIVGPGNA-------APDDLTL-----KKLEVE----
A0A5C5YZZ0      ILQEVQYL---LEDVK--------------DIDTIQQVIEADVPN-----SEWELQ----
A0A518JLD2      LMSLRNLA---VDDSK------QDLANDAVALKMSSIERKRIVDQ-----LRTSARI---
A0A5M6DJ15      VADSVPPM---DQIPE--------------------EMRLTEVEV-----STILAS----
A0A3L7P7S7      ---TLSQT---DLLPG-----------------------VGDSPA-----SEVNLTR---
A0A517N8M1      L--GLSII---GELLD------KKFSLPN-SQGRLSDLQQGDSQL-----ASNNLA----
A0A5C6CW01      I--AMAVI---SKLLN------VNLELSNVENEITRNLVDADVEL-----AQLKLD----
A0A5C6BXS9      V--RLSII---GQLVG------RTFAIPQ-ATHFNQDMRESDTEL-----KQLELD----
M5U569          V--SLSII---GQLVG------TTFDIPE-VMQTRQDLREGDAEL-----KQLELD----
L7CND7          V--RLSII---GQLLG------KTFKIPD-SAQISQNMREGDAQL-----AQIELD----
A0A0J1B8S4      V--RLSII---GQLIG------KNFEIPD-SKRISQDMRDGDVEL-----AQIELD----
F2ARR3          V--GLSII---GQLIG------KTFEVPG-KAVFNQNVREGDEEL-----AQIKLD----
K5D8H6          V--GLSII---GQLIG------KTFEVPG-KAVFNQNVREGDEEL-----AQIKLD----
M2AKU0          V--GLSII---GQLIG------KTFEVPG-KAVFNQNVREGDEEL-----AQIKLD----
A0A5B1CKI2      L--GLNII---GELLG------KQFSLPN-SGSRLGELQQGDRIL-----ATIGLD----
A0A5C6EG84      L--ALNII---GELLG------KSFSMPS-TQGRLEDLQQGDAEL-----AKNNLA----
A0A5C6F2X4      L--GLNII---GELLG------KSFTMPN-SQGRLEDLQQGDAEL-----AKNNLA----
A0A5C5XTV6      V--GMSVI---GQLVG------KTFTLPQ-ATQFNRDLRESDTEL-----QQLQLD----
A0A5C6AAB1      I--GLSII---GQLTG------KQFDISS-SAPLTQNMREGDMRL-----AQIELD----
M5T8W8          V--SLSII---GQLVG------KTFKIPE-TLQTRQDLREGDAQL-----KQLELD----
M5SF00          V--RLSII---GQLMG------KTFEMPE-SNQISQNMRDGDAEL-----AQIELD----
A0A2G1WDS1      V--RLSII---GQLMG------KTFEMPE-SNQISQNMRDGDAEL-----AQIELD----
Q7UVS9          V--RLSII---GQLMG------KTFEMPE-SNEISQNMRDGDAQL-----AQIELD----
A0A5C6B601      M--VAQMI---GGSAGL-GDPNRFSEIQS-PMAANVLGLGDDLEL-----ERLGVE----
A0A517PFU1      R--SSMEV---GGRRAA-LAQMASLKRES-AGENPAI---AELGF-----EEQHLD----
A0A5B9M8J9      M--VALII---GQLSDV-FEDSRLMLKGE-STADLTT---DDLEL-----QKIEVE----
A0A2A2WFP6      M--VAMII---GQLSDV-FEDSRLMLNGK-STDSLAT---DDLEM-----QKIEVE----
A0A518L8N2      M--VAMII---GQLSDV-FEDSRLMLNGK-STDRLAT---DDLEM-----QKIEVE----
A0A518HQN9      L--VAQII---GHLGSV-VDEFEPLRQIV-GPGNTAP---DDLTL-----KKLEVE----
A0A5M6D8H8      L--VAQII---GQMGSD-NDGFDFVSRVD-QSPNPVP---GDLEL-----QKIEIE----
A0A5B1CRW9      NADMGQLA---LLSQNE-VERLQFFVNMA-RGGARSEAFQAEQPM-----RQEVAKA---
A0A5C6EI46      AGEMDQLA---LLSEKE-VDRLKFFLDMT-RGSSQSEKFQAEAPV-----RQEVAKA---
A0A2E7D3V4      -----------------------------------QSMESLTMLVKFYISTSEKAVA---
A0A5B9PER9      ---------------------------------------ERAAALGPAGISARIWEM---
A0A517QSM4      ---------------------------QPSLAADGDVNSVSLPAAEPPPVPQELLNE---
A0A355GJI7      ------------------------------------------------------------
A0A1Z8MCI4      --------------------------------QQELSSLPDADLSDSEGVRVAELED---
A0A517SYL7      --------------------------------QQELSSLPDADLSDSEGVRVAELED---
A0A3L7P0L2      --------------------KEMMANPEERETLQAWIMNSISSSSSGGPGAEGGSSG---
A0A6M5YVJ1      ------------------------ETPNAAPEAGGKGGAGTAPPGREAVVSPAQIDE---
A0A2E0SHG0      ----KESL---KPENREKYNDFQRLALISAESVERMGLILSVENLGVQIATNTATTE---
A0A518CQB8      ----KESL---EPENMERFTDYQRLALVDSKHVERLGLLLSVENLEISVATNAATSE---
A0A517SCC8      ----------------------EAKLKTLKDMLARNEPREAIQMRVLWSLSTGTVAA---
A0A3A0DR44      ---------------------------------------GQPVASKPPKIPDDVLDV---
A0A358MY60      ---------------------ETAVTRQLDTNATPFNLNE---ELLVPEPTNADIKR---
A0A517MNB1      ---------------------EAKIAMRKAGGKDIREVVKTLPEITIPEPTSAEIAR---
A0A7C1EH96      --------------------------------------EEQLNEPLTAEDIADQIQM---
A0A142YJ13      ------------------------------------KSQPTVATTSNQDFASVEVRE---
A0A517Z7D3      -----------QSRISVLQDMIDKGESRETLEFFVLQWFSSGSAATQGSGGAGLTEP---
A0A1N6KY57      ---------------------------------------HEKAALNQMMVTPAMIAD---
L0DK20          ---------------------------------------QEDVARNSSMITPAMIVD---
A0A3L7UX05      ----------------------------------RGELAQPPVIAQRQNLQDAVYQA---
A0A517XRC2      -------------------------LEKVKEKVEQAKTDKTKLDADTLMLRDWVAKH---
A0A6M5YH47      -------------------------EKQLAEKEPKAPPSPVLVD-EQVRTDAGVIKA---
A0A660UUK3      ----------------------------------EKDVSEPLPEINRLQEQSAYINT---
A0A517ZHG5      ---------------------------------TRITEKIGDTVEENPDIQAEMIET---
A0A1Z8MPL5      ----------------------------------------------EQQVGSLALAG---
A0A5C1AGE3      ----------------------------------DDQVKAANDEAAS-------LQT---
A0A2Z3HEL7      ----------------------------------QDQLEERKRDPKKFAADTQLLKL---
A0A142XAP8      ----------------------------------QKQLED--KDPKT-PPDPAIVTQ---
A0A6P2DEK1      ----------------------------------QKQLED--KDPKT-PPDQAIVAQ---
A0A5C6C1R5      --------------------------------QQLSERMRRQAELIATELESRAKAN---
A6BZU4          -----------------------ESKETLELLAQQFLMGQTRGQAANGNTSEGQIAS---
A0A2D5GZ77      -----------------------ESKETLELLAQQFLMGQTRGQAANGNTSEGQIAS---
A0A3D3R1Z6      -----------------------ESKETLELLAQQFLMGQTRGQAANGNTSEGQIAS---
A0A517XG00      -----------------------ESKETLELLAQQFLMGQTRGQAANGNTSEGQIAS---
A0A1G2YRE4      ------------------------------------------EQIKEQSITPEDMLR---
A0A353Z859      --------------------------------NAELSLRERQEKIEGKDLDEQLIDL---
A0A2D6ST10      --------------------------------------ENDKASGQPAEVPDDVLEA---
A0A177QX42      ---------------------------------------------QELQATRNAMKD---
A0A517SHR0      ---------------------------------------------QQLSVQRNAMKD---
A0A2E0AW64      --------------------QYQIERAQGIHQKVEENLNAQSESIEISDTDLATMVD---
A0A351FZ59      --------------------QYQIERAQGIHQKVEENLNAQSESIEISDTDLATMVD---
A0A660V239      ----------------------------------ETQIQVQEGGLQEVATPGSLIER---
A0A177Q3B7      -----------------------------RLAGEVKRRRIKAITEKGLSGSATPIDL---
A0A2E0X6Y6      ----------------AVEEAVATGADVFQHLAGLEESVAAQMLQMTLGISEQDMTM---
A0A518GFD7      --------------------SEFDQRLRTQAAELAADSQSEEGGLVAAREPQSDVSE---
A0A5C5VZJ8      ------------------EKRLERAKAQHAASTDAGDAAPDPAAAEKAAFERNAEWR---
A0A518GE37      ----------------------------RGRINALQSQADNPSEEKLPPLNPRDIDY---
A0A5C6F3H8      AGL------------------YDGGNLAASPVLAAAPMVVPEAVVKRGKPSESEIAS---
A0A5C5X072      AIV-----------------EAPLPLDSDESLAAATPAIAP-TEIQKQVIRERDIEN---
A0A5C5WUQ3      AQI-----------------AMQDDSEPLPSLVASTPFVPPAISIQKQVPTESQIAQ---
A0A5C6E697      AQL-----------------AMHDKE--GSDFEPEAEILAETALSAARKPSEANIMA---
A0A5C5Z1A3      AQL-----------------AMKGEAQSAMVLDVNSTFVPPIIKVQRREPTEDDIAK---
A0A5C6D2P7      AQQ-----------------AMKDSGVLVSGDPMSDSLVIP-------EPSEGEIAS---
A0A5B9ML17      ------------------EMEQANHVKEDAGEFVPEAFIPPPSEVTRNVIGPGDIAN---
A0A517LX75      --------------------DDLEGAKQEGEPTDIERLALLSAKEIDRLKLFIEVTK---
A0A7C5W7B3      ---------------------------------------------QAILTSPDRLTG---
A0A2S8F9B8      VAGNATAE---PGKQENSGTGQTPAEDKGNSANSSGEEDADGSSDASEEIDLESIEY---
A0A354GX32      --------------------ELDLAKSESELSILNERIKAPEKLTVSETAVEEALNK---
A0A142XL75      ENLELAKP---TPKIGINSLDEEGAALTLPWDLGVVEIVPPLSPAELRAQIDAEIRQ---
A0A6P2D5D5      ENVALTVS---SPP-GAKSLEEWGPVLTLPWNLGTIEPVPPIPPAESRSRVEAETRQ---
A0A5C1AAF0      ----------------------------------------KAGAVVPRTPAESAIKQ---
A0A7C7T8W8      --------------------------EARRSELLAKQAAAQTLLTEIQNEELSQFQQ---
A0A5C6B3S0      -------------------------------------KKQVIGPALPDAVPNAEIDA---
A0A368KP63      AQAEPSKE---VEKTVSGENAALPVGSDQALVADAATVEGEQSEEIEPQLSEVEMNE---
A0A518GIZ9      LQK-----------------AQDQGESTSTMEMLIRRFIANDGSGAELQQQQQEISA---
A0A1C3EBY9      LQK-----------------AQDQGESTSTMEMLIRRFIANDGSGAELQQQQQEISA---
D5SX64          LQK-----------------AQDQGESTSTMEMLIRRFIANDGSGAELQQQQQEISA---
A0A517Z0U7      GTQE----------------------------------EGVELAIPEAVVDSQLLED---
A0A2S8FCC0      ANVLGMEP---REA------PVEKDAVVAKKPVVDGDKEAPEASVANSDEESEEIDF---
A0A1Z8MBT6      QDLESIEA---GEN------PLAVISGDLLEEMDEQDFTPPRSMVKKRLVTRPVLDQ---
A0A517SXN9      QDLESIEA---GEN------PLAVISGDLLEEMDEQDFTPPRSMVKKRLVTRPVLDQ---
A0A518HFL0      --------------------GASGDGISGNPDLEVELSEYQRLHQSLLELEYEEIEA---
A0A5Q3LBQ3      ARL---------------------------------KVYQEAIHARPVELSQMEVEE---
A0A3B8ZJM2      TVETAMKS---GDFRAQELLLLINDSSDLVKSTIFDQLFEDQDLAGKAMLESEKLEQSEL
A0A1U7CLW1      ARLNV--------------------------------LASKPELEPTSNQTVSTLDT---
A0A142WPR7      NA------------------MARGGNREALALIINANKESRENGLPQEKSPVTELFP---
A0A3M1TFJ0      ------------------------------------------------------------
A0A517P477      AKQSYRD-----------------------------------SVDDEFELGDEQLAA---
A0A517T4K9      N-------------------ARKEAEERNRASEETESVADDKKSVTDTDGNSSDSES---
A0A7C6B2Q1      GELSLKK--------------------------------ALRDKAAQLQVTERELDA---
A0A7C4QPD3      AAAAADA---------------------------------EESAAKALSVSAEDLRN---
A0A2Z3GZZ5      AQVEL---------------VSRTGPAPE-------------------------------
A0A4V0I6L6      --------------------PATGAVLVPGISQETPERVQQRISDNRSAQNARELEK---
A0A7C4QQT3      A-------------------AVREGAHREALELMIRQFLNHDGTAAAEQRRQQEITV---
A0A255QXF5      AGVS----------------IRNPSADDNIDDLPMTHFVPPYIPVVKGKIDDSDVQD---
A0A518KBI5      AEL--------------------------------QSIEETPIVTQTHEDRTGSIDL---
A0A5C5V6Q5      AEI--------------------------------QSLEESEVTIAPHADRAGAIDL---
A0A517MY49      VKE-----------------SVEQGETIN---LGADSTAGQEMLLASLGLSSRDTRV---
A0A2E6AG00      VQL-----------------AMREGRDLRQYVTAVEPVVGREVMLAALGLNQHDVDA---
A0A1G3A880      IQN-----------------AVRSGADLQHHLLSVEEAVGREILLTGLGFNTRDAAV---
A0A2E8ATT1      VRS-----------------AVRSGKDLRQHLINLEPVVGDRLISSALGLSPLSSQL---
A0A7C2JZW2      --------------------TSDSAEPAGDEPRAVEGSAPESAAGPLSAASQEELSA---
A0A518KYQ0      AGVG----------------IRNPLSSSELGESSIEEFVPAVEKVKRGTIDPKRLSD---
A0A5B9QX47      AHHAMRE-------------ELRGEQGLESPED----------SVKRIEPTPEAIAQ---
M5T666          ATKDLPV-------------ALPPSETAQLPDA-PVVPTLAETEVQKAAIREADIQE---
M5U6N6          ATEDFP--------------ALPLENTSSSPQAIPSVPAVADIKVQKRIVNESDIKS---
A0A517M0G2      AKVAMNA-------------AMGEESANTDLDRSKVR-----------TPYPEEIDQ---
A0A5C6AST1      AKVAM---------------HNAGIPDKTDIDVKLPELIIP-------EPTSAEIER---
A0A5C6C951      AKVAM---------------HEAGVSGESDRNIELPKLEIP-------EPTTAEIDR---
A0A5C6C5T3      VMAAELPA---LEVGGSKVPDPAPAAA---------------VEIQKATVSEREIEN---
A0A2A2W6A9      AGVG----------------IRNPSESDDIIVPSVAEFVPPEIRVQRGEIDPKRLAA---
A0A518HQS9      AGIG----------------IRNPSASDNIIVPSVAEFVPPVIQVERGEIDPDRLES---
A0A5M6DFE6      AIEKGQR-------------QDRENLASNGENLDYPKFVPPIIDVRRDILDPDEVNA---
A0A5C6F286      AGLADSG-------------FSAGGAAKTGLTPGSVEAIVVKRAEPRESQILAAIEN---
A0A517NGN1      ASEAMANE---VEIENVSDLAAADSVSVMDLDAAGVAFVPVRREVRRQSISSNDVDR---
M5RUI3          ASRVS---------------AAGEAEFVPPVEAAVIPSAVVERHVPSEQEILNAINQ---
A0A660VT66      ------------------------------RIRTRRCKEIEKVRSEGGDLSNLLF-L---
A0A7C2VEF7      ------------------------------EAVKAIADDPAQVKQFAAALPTVGVRI---
A0A0S8H0S8      ------------------------------DAARAMMNDPGRMRYFAEQGSRSHL-A---
A0A7C2ZTD2      ------------------------------EQTKEQVIAPEDLLKM-----RQEY-I---
A0A2E3Z6T8      ------------------------------------------------------------
A0A257WQ92      ------------------------------------------------------------
A0A7C1U6X6      ------------------------------------------------------------
A0A7C7UXI5      ------------------------------------------------------------
A0A7C3SFJ0      ------------------------------------------------------------
A0A7C7WWF7      ------------------------------------------------------------
A0A356ETW1      ------------------------------------------------------------
A0A3L7NJY1      ------------------------------------------------------------
A0A523CME0      ------------------------------------------------------------
A0A354PCV3      ------------------------------------------------------------
A0A354PHB4      ------------------------------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A538RV31      ------------------------------------------------------------
                                                                            

M5S2L2          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A7C2VXA0      ------------------------------------------------------------
A0A7C3AA48      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A7C5PFV3      ------------------------------------------------------------
A0A7C3QGD2      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A7C2ZUK5      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
A0A7C2JY73      ------------------------------------------------------------
A0A356AE44      ------------------------------------------------------------
A0A1G2XSU7      ------------------------------------------------------------
A0A350KD81      ------------------------------------------------------------
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      -------------------------------------------LKAKYADLQANKTMLSE
A0A524HC32      -------------------------------------SNLVANLKDKYAQLRSEYEDLKT
A0A177PV03      --------------------------------------KLWELYMQMAL--------LQA
A0A1G2YIM0      ----------------------------------SQISQLEQALIVANQTLTA-------
A0A1G2ZG92      ---------------------------FRKESKELTRSDALKSLQTKLDGYLVDIAQKSV
A0A1G3A0W0      ------------------------------------------------------------
A0A353BE27      -------------------------------------EQLNPLRIQLEV--------FSN
A0A5C6BPW1      -------------------------------------ADAIEATIRRYE--------ETL
A0A1I3GSP0      -------------------------------------SQLLTARLLEQR--------LLH
A0A517QJV1      -------------------------------------QQFLTARLLEQG--------LLH
A0A3C1QS25      -----------------------------------EETDILELRLNLER--------LLF
A0A5C6FX55      -------------------------------------EELAPLKADRDA--------LAA
A0A5C6DS51      -----------------------------------QYNRLLDLLQKERT--------MVD
A0A5C6DSL6      -----------------------------------QYNRLLDLLQKERT--------MVD
A0A3M1VG27      -------------------------------------TQLVPLYLEEQR--------LLS
A0A518GC22      -------------------------------------QILFPLQVEERV--------LLD
A0A3L7Q373      -------------------------------------QQLLVNRMLERR--------LLL
A0A3E0PW54      -------------------------------------KRFLDLQLMRDR--------LTV
A0A7C3TAH2      -------------------------------------RRIIDLEQELIV--------ARQ
A0A1Z8MHR4      -------------------------------------RKLIPLQIKRDQ--------MEL
A0A5C6EHJ0      -------------------------------------ERLLPLELERET--------LVE
A0A5C6F1H9      -------------------------------------ESLLPLQLERES--------LVD
A0A255QXY0      -------------------------------------KSLVPLKIKLEQ--------MQM
A0A517SYI0      -------------------------------------RKLIPLQIKRDQ--------MEL
A0A518HX54      -------------------------------------KKLVPLVIRREQ--------LEM
A0A5B9MF59      -------------------------------------RTLIPLQIKRDQ--------LEL
A0A2A2WC24      -------------------------------------RALIPLQIKRDQ--------LEL
A0A518KYW8      -------------------------------------RTLIPLQIKRDQ--------LEL
A0A5C5YZZ0      -------------------------------------TKLMGLRVRADT--------LAS
A0A518JLD2      -----------------------------------REEKLLPLEIERKK--------LSR
A0A5M6DJ15      -------------------------------------DNIYQRLYNESRQVKDEIELYRL
A0A3L7P7S7      -----------------------------------NQEIRILERKVKQL--------ART
A0A517N8M1      -------------------------------------QELVPLMIERDK--------FEA
A0A5C6CW01      -------------------------------------QQLVPLIIERNK--------MAN
A0A5C6BXS9      -------------------------------------QKLVPLMIERNK--------YAA
M5U569          -------------------------------------QQLVPLIIERNK--------YAA
L7CND7          -------------------------------------QQLVPLMIERNK--------FAA
A0A0J1B8S4      -------------------------------------QQLVPLMIERNK--------FAA
F2ARR3          -------------------------------------QQLVPLMIERHK--------FAA
K5D8H6          -------------------------------------QQLVPLMIERHK--------FAA
M2AKU0          -------------------------------------QQLVPLMIERHK--------FAA
A0A5B1CKI2      -------------------------------------KELVPMIIERDK--------YAA
A0A5C6EG84      -------------------------------------QELVPLMIERNK--------FEA
A0A5C6F2X4      -------------------------------------QELVPLMIERNK--------FES
A0A5C5XTV6      -------------------------------------QKLVPLMIERNR--------YAA
A0A5C6AAB1      -------------------------------------QQLVPLMIERNK--------YAA
M5T8W8          -------------------------------------QQLVPLIIERNK--------FAA
M5SF00          -------------------------------------QQLVPLMIERNK--------FAA
A0A2G1WDS1      -------------------------------------QQLVPLMIERNK--------FAA
Q7UVS9          -------------------------------------QQLVPLMIERNK--------FAA
A0A5C6B601      -------------------------------------QQLVPLETERAE--------LIS
A0A517PFU1      ------------------------------------------LILQLEE--------ARE
A0A5B9M8J9      -------------------------------------KKLIPLEIQREQ--------LEL
A0A2A2WFP6      -------------------------------------KKLVPLVIRREQ--------LEM
A0A518L8N2      -------------------------------------KKLVPLVIRREQ--------LEM
A0A518HQN9      -------------------------------------RALIPLQIKRDQ--------LEL
A0A5M6D8H8      -------------------------------------RSLIPLEIKREQ--------LEL
A0A5B1CRW9      -----------------------------------HYNRLLDLIQKERA--------LSD
A0A5C6EI46      -----------------------------------QYNRLLDLIQREKA--------LSD
A0A2E7D3V4      ----------------------------------PQTIVTGLPGQENTAQLLPLLIQEQR
A0A5B9PER9      ---------------------------REQQQLSGERYQPQRGSQTATLRMRLL--EAEA
A0A517QSM4      ---------------------------RINSS--PEYQRISNSIRELEWSIT----DKSQ
A0A355GJI7      ------------------------------------------------------------
A0A1Z8MCI4      ----------------------------------GEATDLTRLRAGLVAEKHRI--IVED
A0A517SYL7      ----------------------------------GEATDLTRLRAGLVAEKHRI--IVED
A0A3L7P0L2      ----------------------------------GGLLSSPAGKMELDQQLLMARLLERR
A0A6M5YVJ1      ---------------------------ELRQD--ADLRELEARVVQAQLTLNAT--KALF
A0A2E0SHG0      ---------------------------VSQANQILRAKTADTEFDTLVSARLSL-AERQS
A0A518CQB8      ---------------------------AFQAQQYTRAETANTEFDKLLSARLDL-KAKKT
A0A517SCC8      ---------------------GGAEGGGGGGGGGGSILASPPGKAELDSQLLAARLLEHR
A0A3A0DR44      ---------------------------EVKMH--PEVREQSRVISAMRLQLEDI--EKKS
A0A358MY60      ---------------------------FVENS--QEVTRQRGIVAEQETILRSL--EKNG
A0A517MNB1      ---------------------------YVSSD--GEVAKHRGLLADREKKIRGM--EDAG
A0A7C1EH96      ---------------------------RVEND--PTIVALRQDIRRYEQIIR----DGQA
A0A142YJ13      ---------------------------ATSPD--PKMMLIQDRISELRGRQARL--SRNA
A0A517Z7D3      ----------------------------------PGKAQLDNRLLEAQLLLSRL----MQ
A0A1N6KY57      ---------------------------AISRD--RSIELLKDKEALVQRAIDRV---SHL
L0DK20          ---------------------------AINRD--HSIEVLKEREAAAQKAIDRI---YHI
A0A3L7UX05      ----------------------------FYAD--RDVADLADALDDAKARLDKLNKVSRG
A0A517XRC2      ----------------------------------PRVDTLVKQKLAREIDLGQA--KTAA
A0A6M5YH47      ----------------------------------KAAWEYTKSVLEREILKAAD--PDAN
A0A660UUK3      -------------------------------D--PTMQTLVANIRQYEAQII----TDKQ
A0A517ZHG5      ---------------------------LIDRD--PKMADLLVKADAIEANIRRY--EETL
A0A1Z8MPL5      ---------------------------SILPEDIEAELSENEDLAEYQVSIAELQAELDA
A0A5C1AGE3      ---------------------------KKFTD--EQIEAAL----------------LRD
A0A2Z3HEL7      ---------------------------AVARD--KRVVAANELWQAANDLYTKE---LKN
A0A142XAP8      ---------------------------LVAAD--VRVKAAKSAYTARKEYADKE--ATKA
A0A6P2DEK1      ---------------------------LVAAD--VRVKTAKSAYTARKEYADKE--AAKA
A0A5C6C1R5      ---------------------------AADSEEGEEDQESSVLTAYETDRILSSDRDYQS
A6BZU4          ----------------------------------PGTSQVDRARTALETHLMPLLIQKNR
A0A2D5GZ77      ----------------------------------PGTSQVDRARTALETHLMPLLIQKNR
A0A3D3R1Z6      ----------------------------------PGTSQVDRARTALETHLMPLLIQKNR
A0A517XG00      ----------------------------------PGTSQVDRARTALETHLMPLLIQKNR
A0A1G2YRE4      -----------------------IRNENINSD--PMVQELTRNIVSLERDL--I--TAKQ
A0A353Z859      ---------------------------HLDRR--NEVLSAAYTVEKEREALSRR--EGKG
A0A2D6ST10      ---------------------------ALSRD--PQYAAASKKVAELERRVQQN--DVE-
A0A177QX42      ---------------------------ALSRGASKEALLLMANMLKPNGDEKSD--PAAS
A0A517SHR0      ---------------------------ALARGASKEALLLMANMLK-NDPEKSN--QTES
A0A2E0AW64      -----------------------QSADMLQHN--EDLARAQAAIKLLRKELAEI--EQIA
A0A351FZ59      -----------------------QSADMLQHN--EDLARAQAAIKLLRKELAEI--EQIA
A0A660V239      ------------------------QNAIVNSD--PIIQALTNSIMQYEELIVV----GQQ
A0A177Q3B7      ---------------------------EVDAD--PSIQTLLAHKARVEKDIERI--EQVS
A0A2E0X6Y6      ---------------------------LAEQE--SRLLKTQEELQ-----------DAVN
A0A518GFD7      ---------------------------SLLRT--PDVLRLEDDIARIQSQLTVM--RAS-
A0A5C5VZJ8      ----------------------------------GLRRELQTARDNLAAGLRRW--DE--
A0A518GE37      ---------------------------LVAED--SQVQKAKLALEDVKTKIRNI--EREE
A0A5C6F3H8      ---------------------------HLEAD--PRVAELVQKVNRYRASVLDM--EVND
A0A5C5X072      ---------------------------GIDAD--AKVRAAKAVVNRYTSIILDI--EVKD
A0A5C5WUQ3      ---------------------------FVAND--AEVREAEMVYRKYQGMVLEM--EISD
A0A5C6E697      ---------------------------LVNAD--PEVLEAKSRIARYKKISLDM--EQND
A0A5C5Z1A3      ---------------------------IVQRK--PEVVNARERIRRYEGMILNM--EDTD
A0A5C6D2P7      ---------------------------WVNAD--TDVVEAKSMIQRYKSIAMNM--EDSD
A0A5B9ML17      ---------------------------YVNSD--ESVVEALQQIGRYEAQIVRM--EDLG
A0A517LX75      ---------------------------GEVDSQQFQIDQPMRSAALDAEYEKVL--SLIL
A0A7C5W7B3      ----------------------------------KMPVPLTLVDELLRKELLLD--DYRR
A0A2S8F9B8      --------------------SETEMNEAIASD--PISVKLQAELERFEEAKYTL--TPAA
A0A354GX32      ---------------------------EMKDDNLTKAQLEGLVKDQADLAELQR--RLIP
A0A142XL75      -------------------------------D--AQLKQLAEAAASAKERLNKV--KERY
A0A6P2D5D5      -------------------------------D--AHLKLLDEAVVASKERLNKV--KERY
A0A5C1AAF0      ---------------------------YVDSD--PVVKDLEKRQAQIEARVRET--ERVA
A0A7C7T8W8      ---------------------------IRAVESDPQVTRLSNQQLNATTAIAKY--EELG
A0A5C6B3S0      ---------------------------YIAAD--ASVMVLENKVANLNAMIAKI--NEEI
A0A368KP63      ---------------------------AISSD--PISVKLQAELDRFEEPQYTL--TPAA
A0A518GIZ9      --------------------------------------------FENRLLPLIL--EEEK
A0A1C3EBY9      --------------------------------------------FENRLLPLIL--EEEK
D5SX64          --------------------------------------------FENRLLPLIL--EEEK
A0A517Z0U7      ----------------------------------PGFQKLYRSTRQKEVQLSTL----RD
A0A2S8FCC0      -----------------------ELERIMAAD--EVMVAFKSQIMQLENEILAI--EQTA
A0A1Z8MBT6      ---------------------------AISQX--RKVVTQKGVVDRHQAALIAI--KADR
A0A517SXN9      ---------------------------AIGQH--RKVVTQKGVVDRHQAALIAI--KADR
A0A518HFL0      ---------------------------------KAELEAVRREAGGTDPRIWVE--RRIE
A0A5Q3LBQ3      ---------------------------SVERN--VEVQELKTKLATMRVMMLDT--ERRA
A0A3B8ZJM2      LLLQGELDHLLEKYGEKHPNIRRIRSTIASVE--KKIAHAKEAESRLEQAAAEL--NQKR
A0A1U7CLW1      ---------------------------LSTAEVDPQVMELRSRLAELRRKHASV--KRIS
A0A142WPR7      ---------------------------LLLDE----------------------------
A0A3M1TFJ0      ------------------------------------------LDASLETIRRVL--EQGR
A0A517P477      ---------------------------LVADL--PEYKQAEEVARAAETYVGKL--ERSK
A0A517T4K9      ---------------------------THNIPEELILARLAQEPQLESQATEVL--QLER
A0A7C6B2Q1      ---------------------------AARTD--SLMLQLLMREAELKGLVAQT--RDVV
A0A7C4QPD3      ---------------------------ALLSD--PEYASLMRQLRSAETLLAEW------
A0A2Z3GZZ5      ----------------------------------DRQLAFVQLTAQYRAPVVPN--AANG
A0A4V0I6L6      ---------------------------IVIENRLKQIRDAGKTRAERLATMAKL--GIAN
A0A7C4QQT3      ---------------------------FENRL--LPLLLEEQKLLR--------------
A0A255QXF5      ---------------------------FIEKD--ESVKLANERYERHRREVVNL--EVAE
A0A518KBI5      ---------------------------EVSMH--AEVRQREQAILALESQMRQI--QQLT
A0A5C5V6Q5      ---------------------------EVNMA--PEVVQRERALTGIADQMRHY--QRVS
A0A517MY49      ---------------------------LAEQD--KRLLTAEEELRNIEPFYGP-------
A0A2E6AG00      ---------------------------VAELD--QQLVADRTKLANIRVHYGD-------
A0A1G3A880      ---------------------------QANME--RSLLEYQSEMKSMQQFLGP-------
A0A2E8ATT1      ---------------------------VNDME--RKLIEDRSKLAMYRGHYGP-------
A0A7C2JZW2      ---------------------------LLMKD--PEFVRLARTHEGHKRLLDEW------
A0A518KYQ0      ---------------------------FISRD--KEVNRTKEMYEIYRKQVIEL--EVSE
A0A5B9QX47      ---------------------------TVANN--PSVKEAQAHIARYKKIMLEM--EDNG
M5T666          ---------------------------AIEGD--VKVREASRVVGRYQAILLDL--EVKD
M5U6N6          ---------------------------AVEDD--VKVREAKRVVDRYSAIVLDL--EVKD
A0A517M0G2      ---------------------------YVEAD--PSVVTNRKLLAERESRVRNL--EDRG
A0A5C6AST1      ---------------------------FVSND--STVKRHAARIAQQEAIVRSI--EDRD
A0A5C6C951      ---------------------------YVESS--AEVSRYENRVAQLQGMIRSM--EDGD
A0A5C6C5T3      ---------------------------AIDGD--AKVKAARAVVDRYNAVVLDL--EIQD
A0A2A2W6A9      ---------------------------MVENS--RDVFLAKERYEIYRKQVLEL--EISE
A0A518HQS9      ---------------------------LILND--KVVARAQEMYEIYRKQVLEL--EISE
A0A5M6DFE6      ---------------------------MAEND--PAVVEARQRYNYFKDRVFDM--ENND
A0A5C6F286      -------------------------------D--SKVRETVRKVDRYRAMILDL--EVKD
A0A517NGN1      ---------------------------MAQTD--ADVLQARKKAAYYEGLRLNM--EASD
M5RUI3          -------------------------------D--AKVSEALSRVAHYKAILLEL--EDSD
A0A660VT66      -------------------------------QEDPLLAEMRKEILSLEKELSIARLSYGP
A0A7C2VEF7      -------------------------------FINDTETQLQSELRNAEIELKNTRYHVTE
A0A0S8H0S8      -------------------------------QAGPDDAELAAAINQMQLQLVALKRQRTE
A0A7C2ZTD2      -------------------------------NADPAVETLTVNIVQLDQELIVANQTLAS
A0A2E3Z6T8      ------------------------------------------------------------
A0A257WQ92      ------------------------------------------------------------
A0A7C1U6X6      ------------------------------------------------------------
A0A7C7UXI5      ------------------------------------------------------------
A0A7C3SFJ0      ------------------------------------------------------------
A0A7C7WWF7      ------------------------------------------------------------
A0A356ETW1      ------------------------------------------------------------
A0A3L7NJY1      ------------------------------------------------------------
A0A523CME0      ------------------------------------------------------------
A0A354PCV3      ------------------------------------------------------------
A0A354PHB4      ------------------------------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A538RV31      ------------------------------------------------------------
                                                                            

M5S2L2          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A7C2VXA0      ------------------------------------------------------------
A0A7C3AA48      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A7C5PFV3      ------------------------------------------------------------
A0A7C3QGD2      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A7C2ZUK5      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
A0A7C2JY73      ---------RRQGIRLPEERVAAG------------------------------------
A0A356AE44      ---------GHPDVINVRKRIDLV-----KSYYRQMGIDLPTMTTKVNPVTGEPELVTGN
A0A1G2XSU7      ---------TNPELARKESLLNAL-----KQRLEELRQQADKNFDEMAEKEFKESDMLEI
A0A350KD81      ---------NHPDLDAVNRSIETI--------INLYRRQGLDISADNLESGEFQVAKTKD
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      KYGE-----KHPNIANIDLQLKEV-----ENRIKLETLSLITKVETDYN-----------
A0A524HC32      TFHD-----DYPSVKNLKARMNSI-----AARIEKEETIIFRAIQNEYL-----------
A0A177PV03      DYGE-----GHPQIQSVKRQIEAV-----RALYYGAKAKEVEMPKPGPDDPARWHLQSLK
A0A1G2YIM0      ---------ENPEIKRRSELLENM-----KKKLRAREEELTKNFNDMLTKEIARNRVYKL
A0A1G2ZG92      EYTK-----EHPDYKILEKEIETA-----KELIKNEKKVALNSVSISIDPIYDELSKNLI
A0A1G3A0W0      ---------KHPDMIRMEKNLEFV-----EESLRLRQMQLNERWHHRPQDVPGTPSTIAQ
A0A353BE27      QLGE-----EHPSVATLRAQVQGL-----EKQLEKIREGERLYKEELEK-----------
A0A5C6BPW1      KDTE-----NNSVLKSARREQKTT-----QEAIAKYREELRPVIEQKIR-----------
A0A1I3GSP0      SLGD-----DHTQVRNVRRQINTILDFYTRQGLTPPDLKQTGKGPISSR-----------
A0A517QJV1      SLGA-----DHTDVRNVRRQIDTILNSYAQQGLTPPAYQRSSNNPADAR-----------
A0A3C1QS25      KFGE-----DHPEVKIV------------RNEIRAWEELMISRGISLPG-----------
A0A5C6FX55      ELGK-----GHPHVKVLDNKIASL-----EKALDRLGQSRSSRIGQLMD-----------
A0A5C6DS51      VYGA-----NHPLVESTQQEIQVI-----RQFIAQNAPAEEPVRDNKLD-----------
A0A5C6DSL6      VYGA-----NHPLVESTRQEIQVI-----KQFIEQNAPAETQANENKLD-----------
A0A3M1VG27      EFGE-----DHPDVIAVRQRMEAL-----RRLARRTAADDSLDRLDTGD-----------
A0A518GC22      SVGA-----GHPSVGIVQKKVESV-----KRQIAELRESE-----------------QQV
A0A3L7Q373      VLGE-----NHADVRNVRRQTETILDFYYRQGLTPPNLGTPGQTAAPGT-----------
A0A3E0PW54      QLGK-----DHPNVIKLHQQLATL-----TD--------------------------FYR
A0A7C3TAH2      SLTP-----DNPTIQRQERLLEDF-----RQKLEQRKKEVAADYQQVLE--------EQR
A0A1Z8MHR4      QFGP-----SHPEVKSIALQIESS-----QRKLNELNQLMSNRIAELQA--------KNQ
A0A5C6EHJ0      SVGR-----DHPAIDTINKRIAVI-----EKMIETVGENETKLNAELDE--------AMK
A0A5C6F1H9      TVGR-----DHPAIDTINKRIALI-----EKTIEKVEENEKRLNAELDE--------AMK
A0A255QXY0      AFGA-----SHPEVVSLSTQIEAS-----QRRLHELNLMGQQRRKEIAP--------ED-
A0A517SYI0      QFGP-----SHPEVKSIALQIESS-----QRKLNELNQLMSNRIAELQA--------KNK
A0A518HX54      AYGR-----SHPEVKSIVMQIESS-----QSKLNELIAQVDRRRKELSE--------QSQ
A0A5B9MF59      AYGS-----SHPEVKSIAMQIESS-----QNKLNEINQQMTSRIAELRA--------QSQ
A0A2A2WC24      AYGA-----SHPEVKSIAMQIESS-----QNKLNELNQQMSERIAELRA--------QSQ
A0A518KYW8      AYGA-----SHPEVKSIAMQIESS-----QNKLNELNQQMSERIAELRA--------QSQ
A0A5C5YZZ0      QFAP-----NHPQRIAIEQELKMT-----EKAFREIQKTRDSVQAETID-----------
A0A518JLD2      SFGS-----GHVAIKSLDEEIQVV-----KRLILDAVQTEERSIAELESAWAELDELASN
A0A5M6DJ15      EYGEGMVRHQVGRLERLEKELERR-----REDLVRIAQTRKYKEMNPEG--------EQI
A0A3L7P7S7      GLGK-----DHPDVKNLNDEIKDI-----REYIDQMAKGIVPKGPDGKA--------SSL
A0A517N8M1      EFGP-----SHPSVKVLDAQLSTM-----RRELQKLVQEKTSRVMELMS--------ETL
A0A5C6CW01      EFGA-----SHPTVKQLDTELSLM-----KSELRRIVVDQTKRLMEIKK--------ENE
A0A5C6BXS9      EFGE-----QHPTVKALDTELTMM-----KSELTRLVTEQTQRIIQLMD--------ENR
M5U569          EFGD-----SHPTVKQLDVELKMM-----KSELKRLITEQAERIVELME--------ANK
L7CND7          EFGE-----QHPTVKALDAELTMM-----KSELKRLVKEQSDRIVELME--------QNK
A0A0J1B8S4      EFGE-----QHPTVKALDAELTMM-----KRELKRLITEQSERIVELME--------QNK
F2ARR3          EFGE-----QHPTVKALDAELTMM-----KSELKRLVKEQSERLVELME--------QNK
K5D8H6          EFGE-----QHPTVKALDAELTMM-----KSELKRLVKEQSERLVELME--------QNK
M2AKU0          EFGE-----QHPTVKALDAELTMM-----KSELKRLVKEQSERLVELME--------QNK
A0A5B1CKI2      EFGP-----EHPTVRNLDAQLESM-----KTEMKKLVEDQTDRVMELIG--------ETL
A0A5C6EG84      EYGP-----SHPSVKVLDSQLETM-----RSELKKLVEAKTSRVMELMS--------ETL
A0A5C6F2X4      EYGP-----SHPSVKVLDSQLETM-----RSELQRLVEEKTTRVMTLMS--------ESL
A0A5C5XTV6      EFGD-----QHPTVKALDTELTVM-----KSELKRLITEQTQRILQLME--------ESR
A0A5C6AAB1      EFGD-----SHPTVKQLDAELTMM-----KSELKRLVTEQTERIVELME--------ENK
M5T8W8          EFGE-----QHPTVKQLDVELKMM-----KSELKRLVTEQAERIVELME--------QNR
M5SF00          EFGE-----QHPTVKALDAELSMM-----KRELKRLVKEQSERIVELME--------QNK
A0A2G1WDS1      EFGE-----QHPTVKALDAELSMM-----KRELKRLVKEQSERIVELME--------QNK
Q7UVS9          EFGE-----QHPTVKALDAELTMM-----KSELKRLVKEQSERIVELME--------QNK
A0A5C6B601      QFGD-----NHPQVVSITSKIENI-----RRRLNELESQKAARQAQLRA--------EIK
A0A517PFU1      TKGE-----NHPDIKRLENRVAA-------------LRRIEADRAGLQA--------GPD
A0A5B9M8J9      AYGR-----SHPEVKSIVMQIESS-----QSKLNELIGQVDRRRKELSD--------QGQ
A0A2A2WFP6      AYGR-----SHPEVKSVAMQIESS-----QSKLNGLIAQVDRRRKELSE--------QSQ
A0A518L8N2      AYGR-----SHPEVKSIVTQIESS-----QSKLNELIAQVDRRRKELSE--------QSQ
A0A518HQN9      AYGA-----SHPEVKSIAMQIESS-----QNKLNELNQQMSERIAELRA--------QSQ
A0A5M6D8H8      AYGE-----SHPEVKSITMQIDSS-----QKKLNELSERISQRRAELNA--------QSS
A0A5B1CRW9      TFGS-----GHPLVEAARQETALT-----RQFITANTPETNGVKKD--------------
A0A5C6EI46      TFGK-----GHPLVEATRQETEIT-----RQFIAANAPETKARETK--------------
A0A2E7D3V4      LLRD-----LGADHPDVQSVQSEI-----ALVKAYYRQQGIPIPGADVVPGADKKTPKSA
A0A5B9PER9      NAEL-----IRQKVGTGHPDHEAA-----VVSINIVKKQLAEMEEENSKNSADLDILPDE
A0A517QSM4      NLGE-----KHPDRVRLNTHIERQ-----RLLAEELKKQIEKRILAEIAANEDKSIVELQ
A0A355GJI7      -------------HPDLDAVNRSI-----ETIINLYRRQGLDISADNLESGEFQVAETKD
A0A1Z8MCI4      SENV-----FKEGLVRIEAKIRDI-----DEQLSLRKAQASSEAEAVLRDKAGKAAK---
A0A517SYL7      SENV-----FKEGLVRIEAKIRDI-----DEQLSLRKAQASLEAETVLRDKAGKAAK---
A0A3L7P0L2      LLLV-----LGPNHGDVRNVRRQI-----DTILDFYHRQGLTPPNLGTSDASTRNAQGAA
A0A6M5YVJ1      NPGE-----RPLAVAKAEEELAAA-----QQKRDKYRDELRPRLESAVRKQAEQRERARM
A0A2E0SHG0      EFGA-----NHPKVREAEENLRDL-----EMLLDRSKEEIPDPSATNPEPIEPIQLVSAY
A0A518CQB8      EYAD-----NHPKVIEAEENLQDL-----EKFLVEKKDDVPPPSTEALTPIDTSDLIRAY
A0A517SCC8      LLYV-----LGPNHNDVVDVRRQI-----DAIVKMYAQNGFAPPVMETLNDEQKPAAVAS
A0A3A0DR44      RQGK-----QSSSYKDYAALIVRA-----EKELATLQDEVRAQLELRNSVVSTADRGQEA
A0A358MY60      LKNL-----RQEYYNEVSRKVTEA-----EKKLASAREAAEAQAVKAISDDLRQAAERAR
A0A517MNB1      FASL-----RQDHYEDLKKQADEL-----RKQVQAAEKVARDRAPEVLQKHAMELAQRER
A0A7C1EH96      TMLD-----TNPEMQRRRQILADL-----QEELEKQRQEATERYEKIALADVRRSRQAEL
A0A142YJ13      RKGN-----ADPAAQALEREIKQL-----ARTLESHRNTAQRALSAEPERFESSPVQDTR
A0A517Z7D3      HLAD-----DHPSVLRLKEQIGSI-----LS-FYKRKGLAPPHVDDSLKAAPPAGQTEEG
A0A1N6KY57      VRNR-----NDPAVKKHRDDLEAI-----HVALAAQRRKLYPIVTKQLQDMGRDSDESKE
L0DK20          ARNK-----SDPSLKKHRDELEAA-----RTAMVAQRRKLYPIVEQQLQEIGRDDDDSNK
A0A3L7UX05      QDVS-----HREMNDRITDLKSKI-----KVLWERRRSALEKQLAQEGAGQSTSTLDREL
A0A517XRC2      GTVP-----DAPVVLALDAEVKQL-----QKAIDKARTEVLPDVRAALQEYGEEMLKAKH
A0A6M5YH47      AYIK-----E------IKGEVAKR-----LKEYEDARKFATAEATVRARETERAQKQAQV
A0A660UUK3      TMTD-----NNPELQNRIAILESF-----KKRMEERREELVKDFDDRYKQEVEARRNYAK
A0A517ZHG5      KDTE-----NNSVLKSARREQETT-----QEAIAKYREELRPIIEQKIRESGNAQNPDDL
A0A1Z8MPL5      YKQI-----YRDSSAEAIKSREAE-----ITRLQEEQAGFAQQLRNEILAAVRRGERKSD
A0A5C1AGE3      KEPA-----LVGFQAELEVAQAKL-----KARQGAYKDADNPRIVEVQDEIKDIIARRAA
A0A2Z3HEL7      SNPE------NAYIQELKAAADKY-----KKALDDVQNQVTTEAETALRFSDLAERQKKV
A0A142XAP8      TNPD-----LDDGIATLRAEVKKL-----EAEVKGAEKLAATEALEVARAIDTANKKKRA
A0A6P2DEK1      TNPD-----IDDGITKLRAEVKKL-----ETEVKEAEKLAATEAIEVARAIDTAKKKKRV
A0A5C6C1R5      LLAM-----ARSLEEEIELYKTRY-----GKGMIQYKIDRFDRLTSDAKEREATLLKLAA
A6BZU4          LERD-----FQKNHPDLDAVNRSI-----ETIINLYRRQGLDISADNLESGEFQVAKTKD
A0A2D5GZ77      LERD-----FQKNHPDLDAVNRSI-----ETIINLYRRQGLDISADNLESGEFQVAKTKD
A0A3D3R1Z6      LERD-----FQKNHPDLDAVNRSI-----ETIINLYRRQGLDISADNLESGEFQVAKTKD
A0A517XG00      LERD-----FQKNHPDLDAVNRSI-----ETIINLYRRQGLDISADNLESGEFQVAKTKD
A0A1G2YRE4      MFAA-----SNPIIKQKQDLLEAF-----RSRIEEQRQKASEDFNNVASEEIAKVNKEKT
A0A353Z859      ---------PASSVEEYARRLREA-----EAKLKEVREELRPKVIEELKERSQLEEVLST
A0A2D6ST10      -LSE-----THPTLVKFKKQLADA-----QKHQQELQEELKPQIAQQILGGMAASGEMSN
A0A177QX42      LQPK-----VDPFMEKMMPLLLER-----DTLLERVGESHPQVKMLDRKIESLRGLLREE
A0A517SHR0      LQAR-----MDPFMKEVTPLLVER-----ETLLETVGEGHPQIRKLDKRIEALRGLLRQE
A0A2E0AW64      AGDP-----ANLPRYQSAQRQIAL-----QQEQIEKLDAARQPLRESLMEVARKDRQGAW
A0A351FZ59      AGDP-----ANLPRYQSAQRQIAL-----QQEQIEKLDAARQPLRESLMEVARKDRQGAW
A0A660V239      TMTP-----GNPELKQRREILKTL-----KERLGQRRKEVAQEFDKNFEAELAKNRDRRL
A0A177Q3B7      VRGR-----REPAMKPLLDQSAAL-----DAQLEKRRKLLRPEVVKRFADRAVRDLQAEF
A0A2E0X6Y6      YYGP-----NHPRISELKRQEQTL-----IAYLRDYRSNLGNRFAGGDSGEAGEATLKML
A0A518GFD7      -VGP-----GHPSARALTVELEAR-----QELLDKRREYAREAALESLAKTNAESMLPLG
A0A5C5VZJ8      ---------GHYKIQSLKNEVTRV-----EQQVAALETDLRDRLTNGRGDPDTGDFALTD
A0A518GE37      RQEL-----FADRYARLKEDVPRL-----EEDIRNAEVAARPQVISTLQGLVAEREALKR
A0A5C6F3H8      MVRV-----NRDYYKELNKNLASA-----ESELQSERREARDRTIEKLERFAEDEYERQK
A0A5C5X072      MVRI-----SRDYYNDMKKNLEDA-----RDKLQDERDLARTRVEEELQRVVDEDYRQRK
A0A5C5WUQ3      LVRV-----RRDYYLEIKAKRDSL-----EYSLEAKKSKAEKLAIAVLTKRAEEDYQRQM
A0A5C6E697      LVRI-----RREYYNENLARISEW-----EEVLKKAQEVAREAATAKLEQLAADELKFAQ
A0A5C5Z1A3      LVRI-----NRSYYDELKAKKNES-----EKKLQAAMDAARQQALVEVQKLADEDFKLQE
A0A5C6D2P7      LVRI-----QGEYYRETLDKVKKW-----EQTLEESRQAARVVALEKLNELAKDQLERSR
A0A5B9ML17      TWRL-----NQTHFAELKKKRDEW-----EATLKTAKAAAETKAATELEALADADYEHQQ
A0A517LX75      REQA-----LTADFGDDHPLVQRV-----RDEVASVKRFIREKAPGDLEALESKEMKPAQ
A0A7C5W7B3      KYTE-----ENPKLKKLVREIEGL-----RQTIEQVKQDPDRFGLVGRQFDRGWQTENVE
A0A2S8F9B8      YERY-----RQTN----EAAISTL-----ESRLEKRREHLVLLIKERLAQQLLEGRSRQG
A0A354GX32      ADRE-----NGPGVGQLRDRISLI-----QNLVTQKKEVQRPGMERQLRAKALDDLVNEA
A0A142XL75      QEGE-----RPPTVIKAEDDLKAA-----ELRRDKHRDELGTTLAREVQKKHAQQEILRR
A0A6P2D5D5      QEGE-----QAPAITKAENDLKAA-----EQKRDKYRDELQAAAAIIAQKKYAQQELQRR
A0A5C1AAF0      TKAV-----AEVAAKKAQDDLTAL-----SKDLKEARAKARVDYTTGVAQLSELESKTRV
A0A7C7T8W8      YGR------DHPRIQSLLADIERL-----DTLLADRREAAKVDAIQNYKLEIMRNHRDEL
A0A5C6B3S0      KSGS-----KEYHIERLQAQLNTA-----EESLKSHRAELRSELLEHWNARPESVSNDGS
A0A368KP63      YQRY-----RETNSAAIKSLESRL-----KERREHLELLVKERIAQDLAAQAKGEIARKG
A0A518GIZ9      LLRD-----FGPDHPEVKAVRKSI-----DTTLDFYRKHGLRMPDDMTPGPDGKPLIKER
A0A1C3EBY9      LLRD-----FGPDHPEVKAVRKSI-----DTTLDFYRKHGLRMPDDMTPGPDGKPLIKER
D5SX64          LLRD-----FGPDHPEVKAVRKSI-----DTTLDFYRKHGLRMPDDMTPGPDGKPLIKER
A0A517Z0U7      RLKE-----GHALITKAEDDLAAL-----EAQLEAYRETQLPQIRQQLQSRIADVPDSAG
A0A2S8FCC0      APKI-----QNQYVSRLRDKISEL-----EEQVSLRKDQLTKDKEQWSVATHRAELNKAR
A0A1Z8MBT6      RFGP-----GYVGIQETEDLLVTA-----QTELDRLMDSVKDEVRQELEQQFEAQYQQDL
A0A517SXN9      RFGP-----GYVGIQETEDLLVTA-----QSELDRLMDSVKDEVRQELEQQFEAQYQQDL
A0A518HFL0      QVFL-----SDPDVRSLREGLKDI-----QVQIDEAQGRIRNPADPAVSRLKVQQQRLLE
A0A5Q3LBQ3      ADPE-----KSSTYRKLAGDYKET-----QASLEEIREELRARVVSEMESHERSVRDDQL
A0A3B8ZJM2      NRSK-----NKMLNSEVASNDQPI-----DPPSDTTPGDASATAVTDSPNEVEKAIASTD
A0A1U7CLW1      RQGN-----VDPSILAIQREIKLV-----TGELEGRRQELRAAAAEFNRAEPAAIPDARL
A0A142WPR7      --QM-----LLETLGPDHPKVTAV-----QKRIEITRKYLTESLAEERKNAGENPMLKGG
A0A3M1TFJ0      PLDM-----APPVAQSPVVSMLRR-----NLAEAELELA---GLEQRYGENWPQVRAARA
A0A517P477      GADS-----TSPTLATARAEATRR-----QAELKELQVSLRPHVKEQLKNSWEAQGEAGD
A0A517T4K9      QLET-----LKDRVKEDHPELARV-----AAKLEAGQKEYEKLEQQLRPAIIEDLILQRE
A0A7C6B2Q1      RPEM-----AGRYGNRYSQELADV-----QGRIQARREELRQELEQKRVANIDQEIE---
A0A7C4QPD3      ----------QKRVRDDHPAIAKY-----SAAVKDAVAKLAARHRAIEPAILQDLAQRKV
A0A2Z3GZZ5      GELT-----GTAALRALEFERREL-----TQATGLGKDHPRVLAVDARIAVLKEELARPP
A0A4V0I6L6      ---------DRPFLFGDVKDPESM-----LAHLKYKKGELGTRLGPGHPEMAALNSQIKV
A0A7C4QQT3      ------------DYGRDHPDVQSV-----QQSIRAVLRYYRERGIHLLDDAASDSPGTPA
A0A255QXF5      GWRR-----AQAYYADQQKLRDEW-----KTKLDEARAEASARAISVLNADLEADYQQRL
A0A518KBI5      KQWR-----ENGSYKSLSDARKHA-----RTELTEFKAALREQLLAARESD---------
A0A5C5V6Q5      KRYE-----QNANYKALAEQYQRF-----KDELAGYKANLRRKLLLSTRSE---------
A0A517MY49      ---------NHPRVRELQTQIINI-----NQFLANYGSNAGKILNAERRDELGSIVINKL
A0A2E6AG00      ---------RHPKVQDXLKSIRDT-----QNYLENYQQSVADRAERTQAEQLQSFLXGMV
A0A1G3A880      ---------AHPRLTEVAERVRAT-----EQYLTAYQTRVSERLTQLKDTRLGPMLIQML
A0A2E8ATT1      ---------NHPQVRQLQHSLQLA-----QAHREEYHAKVQKHMEKVQERELGPLLISML
A0A7C2JZW2      ----------RRRVNGPHREIERL-----ELAVDQAAEQLAKRRDEIEPALLHELYKSRS
A0A518KYQ0      RWRF-----DKDRYARLQTERDQW-----EEKHALARKAASERAIDIMEAELD-------
A0A5B9QX47      RIRV-----ARDHYEDMQSRRDEW-----TAKLEQATKDAQEQALAYLNQKADEDFEARK
M5T666          MVRV-----SRDYYNQMKENLADA-----QSKLDQERQVARDRALKELQRLVEEDFRQRK
M5U6N6          MVRV-----SRDYYNQMRKNMEEA-----ERKLAQERTLARDRATKELQRIVEEEYERQK
A0A517M0G2      LAPL-----RQEYHKELKEKAAEQ-----QRELDNAVAAARQRAPEAITERLRRTAERTY
A0A5C6AST1      MVRI-----SRDYYNDLKSKIADT-----QKELDKAKEVARAKAADEIKSLATEVAQRER
A0A5C6C951      LVRI-----QRDHYEGLKTQLADT-----EDDLRQARIDVRSTAVAEIKSDALELAERNR
A0A5C6C5T3      MVRI-----SKDYYLDMKQNLEDA-----KDTLKQERDSARTRVTKELERIVDEDYRQRK
A0A2A2W6A9      RWRF-----DKERYARLQKDRDEW-----EAKLASAKQAASEAAVQILEDEIEEDYQQQL
A0A518HQS9      RWRF-----DKERYARLQKDRDEW-----EAKLASARETASKTAVRILEDEIEEDYQRQL
A0A5M6DFE6      VARM-----RKEYYREMMDQRDEW-----EEKLLAFRKEARTRAEKAMKERIEFDYQRRL
A0A5C6F286      MVRV-----SRTYYNELIRSLAEA-----ESKLEGIRQEARPRAIAKLDQIAEEQYQRDL
A0A517NGN1      LVRI-----NREHYRGIVADQALW-----EGKVEEALTAARERVQAELEDRAETIYKQEL
M5RUI3          IVRI-----RREYYEEMQGKRDEW-----TANLETLKAGARERVVAMLNERADAEYERQK
A0A660VT66      KHSK-----I----LSLEASLAKQ-----KQILNDTAEQLAE------------------
A0A7C2VEF7      EHPA-----V----KALHTKIDYI-----KSDLKAEMKKFAD------------------
A0A0S8H0S8      GHPA-----V----QALQAQLARA-----RQRQAKADKKFAE------------------
A0A7C2ZTD2      ANPE-----LKRKAQLLEALNARL-----EEQKKQAGKSFDDLMSRELVNAGSRSLIDAR
A0A2E3Z6T8      ---------NHPRIIELQQDVRSL-----DQYINNYHS-GAGDRLEAMGKS------IPK
A0A257WQ92      ---------DHPDVKLKRQTIQTA-----LDFYRRQGVRLPEERRQQQADGSAPGEVDFV
A0A7C1U6X6      ---------ADGNEVAIAGTDQPP-----LSYYRQDPQWQTLDERFREVRH------QID
A0A7C7UXI5      ---------AHHEVQEAQERIRIA-----EEYLRNRHR-NQLAQLRQISDR------ELR
A0A7C3SFJ0      ---------NAPSIARMRERQQKY-----REGMEKRIA-EISPTLEKQIEE------RIR
A0A7C7WWF7      ---------SHPERLELQQAIEDS-----EKYLEQMRSGSTSRSRERLTNE------SLG
A0A356ETW1      ---------SHPSMIAQQEKVRLA-----REYLQRNQE-RAAESISRLQNE------QLG
A0A3L7NJY1      ---------NHPRIVAINDEILVK-----ESYLQQLPM-LQQQRMQDMARN------ELG
A0A523CME0      ------------------------------------------------------------
A0A354PCV3      ------------------------------------------------------------
A0A354PHB4      ------------------------------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A538RV31      ------------------------------------------------------------
                                                                            

M5S2L2          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A7C2VXA0      ------------------------------------------------------------
A0A7C3AA48      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A7C5PFV3      ------------------------------------------------------------
A0A7C3QGD2      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A7C2ZUK5      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
A0A7C2JY73      ------------------------------ELTFAPQDFVALYLSSLRQEMA-------E
A0A356AE44      DPIA-------------------------------------TYVVALEQQQA-------E
A0A1G2XSU7      QEYK--------------------------------------------YKLE-------Q
A0A350KD81      VDFV------------------------------------NVYLKSMEQQLK-------E
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      -----------------------------------------------------------V
A0A524HC32      -----------------------------------------------------------T
A0A177PV03      RELV-------------------------------------------------------A
A0A1G2YIM0      KESR--------------------------------------------AELE-------R
A0A1G2ZG92      DAHI---------------------------------------------DKN-------I
A0A1G3A0W0      WRNQ-----------------TINVLGAPVTIANSGMPDLDEDSAGVERQLA-------Q
A0A353BE27      --------------------NGDALARKTGAEIRSIEERLEERLLALEEQSE-------V
A0A5C6BPW1      ----------------------------------ESGNAPNPGDLPAEEQIA-------R
A0A1I3GSP0      -------------------------------SAALGLDLVSVYRDTLQGQLK-------E
A0A517QJV1      -------------------------------NHE-GMDLISVYEETLKSQLE-------E
A0A3C1QS25      -------------------------------TGDNRADFVALYKISLTEQVR-------S
A0A5C6FX55      ---------------------------DEERKTKQALQAISAVQATAKTKVD-------M
A0A5C6DS51      -----------------------------------PKGMLSTYTRLLTNDVS-------E
A0A5C6DSL6      -----------------------------------PKGMLSTYTRLLTNDVA-------E
A0A3M1VG27      ------------------------------------SSLVDVYLAGLREQDA-------E
A0A518GC22      DSEM--------------DRMKLEMQTRTGARIRSMEERLTAGTDMLAEQIA-------A
A0A3L7Q373      --------------------------------VAINEGLSQQYLKVLESRVE-------E
A0A3E0PW54      QKGH--------------TPPRSHGPGADTTDDAGPIDLVAAYIRIQQQELM-------H
A0A7C3TAH2      RLAL--------------DQLQRARREA----ERARQERVAQRRMEMEAAIQ-------R
A0A1Z8MHR4      NDPE--------------SQRPRD------ASKNAASVMVDAYVNGITERIN-------I
A0A5C6EHJ0      AAAA--------------AESSLL-PSGEYDPRDRILEKVRFAVGALRQEMD-------A
A0A5C6F1H9      AAAA--------------EASSFQNPDEDLEPRNRAMEQVRFAVGALRQEMD-------A
A0A255QXY0      -LPT--------------EDGSSP------TNKSNASELVDAFICGLQERLK-------V
A0A517SYI0      NDPE--------------SQRPRD------ASKNAASVMVDAYVNGITERIN-------I
A0A518HX54      QIDE--------------ADGSTQ------AQVARAGEAVDAYIRGLSERLR-------V
A0A5B9MF59      TVDY--------------DKEARK------ARDERARTAVDAYIRGIEAQLT-------V
A0A2A2WC24      RVDY--------------DKEARE------ARDERARMAVDAYIRGLEAQLT-------V
A0A518KYW8      RTDY--------------DKEARE------ARDERARMAVDAYIRGLEAQLT-------V
A0A5C5YZZ0      ---------------------VAA------QRNEAAKTLLIMYVSSIRKKIQ-------L
A0A518JLD2      QPTT--------------NP------------EDELRRQVRLVFDSMTQKLQ-------S
A0A5M6DJ15      AGYA--------------NLTGEQ------RAKALQIQELDQQIKTQKRAIESRKIAAGV
A0A3L7P7S7      LGLG--------------E-------------DEIFSNKAQGLLKHYSERIE-------E
A0A517N8M1      A-----------------DP------------RERAVEAVNAVVLASKAQID-------L
A0A5C6CW01      IKTI--------------DP------------KEKAKEAISAVLIAAKAELD-------L
A0A5C6BXS9      VEGI--------------DP------------GVRAQESVDVILIAAKAEVD-------L
M5U569          VEGV--------------DP------------AARAREAVDVILYASEAEVE-------L
L7CND7          VEGV--------------DP------------AKRAEEAVNVILTASRAEVQ-------L
A0A0J1B8S4      VEGI--------------DP------------AKRAEEAVNVVLIASRAEVN-------L
F2ARR3          VEGV--------------DP------------AKRAMEAVSVILTASNAEVQ-------L
K5D8H6          VEGV--------------DP------------AKRAMEAVSVILTASNAEVQ-------L
M2AKU0          VEGV--------------DP------------AKRAMEAVSVILTASNAEVQ-------L
A0A5B1CKI2      ---V--------------DP------------VQRAKEALAAIVMASEAQVD-------L
A0A5C6EG84      ---A--------------DP------------RERAVEAVSAVVLASKAQVE-------L
A0A5C6F2X4      ---A--------------DP------------RERAIEAVNAVVLASKAQVA-------L
A0A5C5XTV6      GQGV--------------DP------------SVRAKESVDVILIASRAEVA-------L
A0A5C6AAB1      VDGV--------------DP------------AKRAAEAVSVILTASNAEVN-------L
M5T8W8          VEGV--------------DP------------AARAQEAVDVILFASNAEVE-------L
M5SF00          VEGV--------------DP------------RKRAEEAVNVILTASRAEVQ-------L
A0A2G1WDS1      VEGV--------------DP------------RKRAEEAVNVILTASRAEVQ-------L
Q7UVS9          VEGV--------------DP------------RKRAEEAVNVILTASRAEVQ-------L
A0A5C6B601      TTDI--------------NTLRLK------ERQERASSFVAAYMGGLAQRLT-------V
A0A517PFU1      GTEG--------------PSSF-----------------LDLYVAARVERAR-------V
A0A5B9M8J9      RIAG--------------GEGFQK------AQLARAGEAVDAYIRGLSERLR-------V
A0A2A2WFP6      QGAD--------------ADGSTQ------AQVVRAGEAVDAYIRGLSERLR-------V
A0A518L8N2      QIAE--------------ANGSTQ------AQVVRAGEAVDAYIRGLSERLR-------V
A0A518HQN9      RVDY--------------DKAARE------ARDERARMAVDAYIRGLEAQLT-------V
A0A5M6D8H8      RTDL--------------GAEAQK------ARTEHAREIVEAHIRGLQERLL-------V
A0A5B1CRW9      --------------------------------DLDPTEMVNTYVMLLKNDIA-------E
A0A5C6EI46      --------------------------------TMDAEEMLKTYVMLLRNDIS-------E
A0A2E7D3V4      DANL-----------------------------------VTTYMASLRQQWK-------A
A0A5B9PER9      IIFE--------------------------------------------RKTA-------E
A0A517QSM4      SRVK-------------------------------------------------------I
A0A355GJI7      VDFV------------------------------------NVYLKSMEQQLK-------E
A0A1Z8MCI4      ------------------------------------------------QQIA-------D
A0A517SYL7      ------------------------------------------------QQIA-------D
A0A3L7P0L2      GADL-----------------------------------AQTYLTILKSRLE-------E
A0A6M5YVJ1      AGLR--------------------------------------------DAVA-------G
A0A2E0SHG0      VTQL-------------------------------------------EKDLE-------D
A0A518CQB8      VSLL-------------------------------------------EKDLE-------D
A0A517SCC8      ADLA------------------------------------STYVDVLQDQLE-------E
A0A3A0DR44      VQWR--------------------------------------------QRLT-------A
A0A358MY60      TIAS-----------------------------KKAVIKTKQDAVNAKEELA-------K
A0A517MNB1      ESQL-----------------------------ANLEVSTKASLASQEVQLA-------E
A0A7C1EH96      EALK--------------------------------------------SELN-------R
A0A142YJ13      SREV-------------------------------------------EEYLD-------I
A0A517Z7D3      VDLV------------------------------------TSFMQLQKQKLV-------E
A0A1N6KY57      ILVQ--------------------------------------------HRCV-------I
L0DK20          ALIP--------------------------------------------HRIS-------I
A0A3L7UX05      RDAE--------------------------------------------NQYQ-------D
A0A517XRC2      AELQ--------------------------------------------EQLT-------L
A0A6M5YH47      TALT--------------------------------------------TALD-------V
A0A660UUK3      VQVK--------------------------------------------AQLA-------Q
A0A517ZHG5      PAEE---------------------------------------------RIA-------R
A0A1Z8MPL5      AQYN---------------------------------------HERLEAESI-------E
A0A5C1AGE3      LTSQ--------------------------------------------RRSD-------V
A0A2Z3HEL7      SDLA--------------------------------------------DQIA-------I
A0A142XAP8      EELA--------------------------------------------YTIE-------V
A0A6P2DEK1      EELA--------------------------------------------YSIE-------V
A0A5C6C1R5      EEKGRKIAQGEMGQIDLSLSPEDQKLAQRHARLLADAEEHDKRIVARGIQVG-------I
A6BZU4          VDFV------------------------------------NVYLKSMEQQLK-------E
A0A2D5GZ77      VDFV------------------------------------NVYLKSMEQQLK-------E
A0A3D3R1Z6      VDFV------------------------------------NVYLKSMEQQLK-------E
A0A517XG00      VDFV------------------------------------NVYLKSMEQQLK-------E
A0A1G2YRE4      LNLK--------------------------------------------TELE-------Q
A0A353Z859      QALQ--------------------------------------------RRLQ-------L
A0A2D6ST10      LERK--------------------------------------------KLIG-------D
A0A177QX42      AGAK-----------------------------GSKLDLLSIHLESLDERIN-------A
A0A517SHR0      TGDS-----------------------------GPKRDLLSIHLESLDERIT-------S
A0A2E0AW64      KTYQ-----------------------------QEVISRQKEEVARLQEQTE-------Q
A0A351FZ59      KTYQ-----------------------------QEVISRQKEEVARLQEQTE-------Q
A0A660V239      AELK--------------------------------------------IQLA-------Q
A0A177Q3B7      ASLE--------------------------------------------ERAS-------L
A0A2E0X6Y6      RQAL-----------------------------------------------A-------E
A0A518GFD7      QQQS-------------------------ATNRTPLGALTQQDLISRASHIE-------V
A0A5C5VZJ8      PRVI-------------------------------------------ELRLS-------R
A0A518GE37      AEQI----------------------------------------EEFQLQLD-------E
A0A5C6F3H8      VAAK-------RTSEWQQEQFAAQAKELAQQSSKIQSEVSAAEKASRERQRF-------A
A0A5C5X072      AVAE-------RTLAWQEEQQKKQQDLSKQERKRAQERSQKAFAKEREKSRK-------A
A0A5C5WUQ3      AEAE-------AKLTAMKQLHEVELDAARSHDSLKRNHQDNMNTALKKRDRA-------A
A0A5C6E697      SEQI-------RQ----KEIGVRL------------------KKVSEKKNRQ-------Q
A0A5C5Z1A3      EEAK-------TK----IELARREFEQGLKLASLDHQSEGRIAMEAEKQQRD-------G
A0A5C6D2P7      IEAK-------LQ----QQLGAQD------------------RVASKQQTRQ-------Q
A0A5B9ML17      KQWE-------EKVAALRAAHEEKQRLDRQNRALVDAQLRTETTRQYRRMIT-------E
A0A517LX75      ILEA--------------------------------------YSSLLANDIN-------E
A0A7C5W7B3      LAVA----------------------------------TESARKAAYLARLE-------T
A0A2S8F9B8      SIAN---------------------------NGLVVPAEVDNSLPELRVHLG-------V
A0A354GX32      AKTK-------------------------------------GHIEGDKNQLL-------T
A0A142XL75      AETR--------------------------------------------KQIR-------I
A0A6P2D5D5      AEFR--------------------------------------------EKVE-------T
A0A5C1AAF0      TQLS--------------------------------------------EQIA-------F
A0A7C7T8W8      RQFQ--------------------------------------------NELA-------E
A0A5C6B3S0      DELR--------------------------------------------AKIA-------I
A0A368KP63      SSIL-------------------------------AVPEVDNTLPDLRVRVG-------V
A0A518GIZ9      ANLV------------------------------------QNYMETLRQQLK-------E
A0A1C3EBY9      ANLV------------------------------------QNYMETLRQQLK-------E
D5SX64          ANLV------------------------------------QNYMETLRQQLK-------E
A0A517Z0U7      QIRQ---------------------------------------------RID-------L
A0A2S8FCC0      SEVA-------------------------------------------------------I
A0A1Z8MBT6      EDEG-------KELERLEDAWAKNRDLQIKNASKSSAGQRELVVKRLQFDLG-------R
A0A517SXN9      EDEG-------KELERLEDAWAKNRDLQIKNASKSSAGQRELVVKRLQFDLG-------R
A0A518HFL0      RYNQ----------------LWADLEPALRAQLAAEETNPTQLVRKAEAQLL-------A
A0A5Q3LBQ3      LSLQ--------------------------------------------SELD-------S
A0A3B8ZJM2      SDSS------------------VSPEDEAPDVEEQVNLYLQISLNSLTQRYK-------S
A0A1U7CLW1      EEVK--------------------------------------------EYLE-------I
A0A142WPR7      KRPD----------------------------------LVSLYLESLQHEVD-------V
A0A3M1TFJ0      RRDQ-----------------------------------------LKLLLRQ-------E
A0A517P477      QKLS-----------------------------------------ETI---A-------Q
A0A517T4K9      RQSE-------------------------------------ATLTGVQSQIE-------L
A0A7C6B2Q1      ---------------------------------------------NLNFELA-------I
A0A7C4QPD3      TVGG--------------------------------------QPQGSLDQMA-------T
A0A2Z3GZZ5      AAGG------------------------------PVLDELGAHILWVEQKRR-------T
A0A4V0I6L6      LEEE------------------------VAARGGPAEDELERYRRKLETELG-------A
A0A7C4QQT3      RPPA--------------------------------DDFVQLYVAALHQELA-------E
A0A255QXF5      RERD-------DEIERQRKEFADLADIKQAELARRADYMSEHEAENLKQGRE-------R
A0A518KBI5      -----------------------------------RQVGGQSVADHKREELA-------S
A0A5C5V6Q5      -----------------------------------RPFGGSTVVDEKRKELA-------A
A0A517MY49      QQDV-----------------------------------------------S-------Q
A0A2E6AG00      KQEV-----------------------------------------------D-------Q
A0A1G3A880      SQAL-----------------------------------------------A-------N
A0A2E8ATT1      EEKL-----------------------------------------------F-------E
A0A7C2JZW2      AAVL------------------------------------GTQGVSTRAQLD-------E
A0A518KYQ0      -----------EELERARAEYVASSIAKQKQHARRAELMSDQEKAEIAERRE-------Q
A0A5B9QX47      AAAI-----------------------------VERERKRAAQIAADEQERK-------S
M5T666          EVAERAFAWQQEQLKKQQQEMKRLQDKSAEERKVAQKAYAAAQAKERDNQRK-------V
M5U6N6          EVVARTFAWQKEQLAKQQEELKKQQANSAEEQKAAQQAYIAAQERERERQRK-------A
A0A517M0G2      KESL-------AER----------------------KAASFAQRESINQQLV-------D
A0A5C6AST1      AAQI-------AQMQFST------------------KANMESNRKSEQEQLA-------A
A0A5C6C951      KAQL-------AQLEFKR------------------KAELKLGQQSDQQRLA-------E
A0A5C6C5T3      AVAE-------RTLEWQQEQQKRQLALTEQERKLEETKNREAQLKERERSRK-------E
A0A2A2W6A9      ALAE-------KEKERLRAEFPAKVKAKQEELERRAEIMSDQEKQQIADRRE-------Q
A0A518HQS9      ELAE-------LEKERLRAEFAANADAKKAELERRSELMSEQEKLLIGDRRD-------Q
A0A5M6DFE6      KDAE-------GDIERQKIAFQNEYRRSLADRDRQNQAELERQKWQDQEKRR-------Q
A0A5C6F286      ANAE-------REMEFQREQLLARLKQEGRESEQMKEARAAAVRMEHDAQRK-------V
A0A517NGN1      AAVD-------AEVQLQRDQFLADQQLAKRKAVAMRQAAMKIDQETAQLARK-------E
M5RUI3          IAAK-------ARIESLKEGFEAQRKSKIEAARVEWQRELQKRYADEKKEYE-------A
A0A660VT66      ---S--------------------------------------YISETEDRKV-------L
A0A7C2VEF7      ---T--------------------------------------YIEVMRQRWR-------T
A0A0S8H0S8      ---N--------------------------------------HLALCAQRLS-------A
A0A7C2ZTD2      NELK--------------------------------------QTAAYENRLR-------E
A0A2E3Z6T8      EVVV----------------------------------------NLLRQSTQ-------Q
A0A257WQ92      ALYA----------------------------------------ESVRQELA-------E
A0A7C1U6X6      VSLL----------------------------------------KPTHQNMK-------R
A0A7C7UXI5      PVLI----------------------------------------QMARQRLE-------Q
A0A7C3SFJ0      EHLA----------------------------------------EGWNTAPK-------T
A0A7C7WWF7      RLLL----------------------------------------SMVNERLT-------K
A0A356ETW1      PLLV----------------------------------------EMVRQQLR-------E
A0A3L7NJY1      PRLL----------------------------------------QYINQQLQ-------K
A0A523CME0      ------------------------------------------------------------
A0A354PCV3      ------------------------------------------------------------
A0A354PHB4      ------------------------------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A538RV31      ------------------------------------------------------------
                                                                            

M5S2L2          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A7C2VXA0      ------------------------------------------------------------
A0A7C3AA48      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A7C5PFV3      ------------------------------------------------------------
A0A7C3QGD2      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A7C2ZUK5      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
A0A7C2JY73      R-----------QVRDKELEGIVQRESA------------------EARNVAKY------
A0A356AE44      L-----------KNRIGELQKLFDRSAD------------------QAKDFAQY------
A0A1G2XSU7      I-----------SLHQQQLRDMLVHEDS------------------KTIELGRK------
A0A350KD81      L-----------ENRELELTKIFDQETE------------------LAKKVGDF------
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      L-----------LASEESYEKAYNEQSL------------------VVFDLNRK------
A0A524HC32      A-----------QRIVAAMKERIEQQKK------------------LVLGLNER------
A0A177PV03      A-----------QANLDEIEKQCNAAEY------------------KARAREEW------
A0A1G2YIM0      I-----------NAYEEKLMAMLSKHNV------------------QTIELGRK------
A0A1G2ZG92      A-----------IAKKGLLQKYINAYQE------------------ELLNIPLK------
A0A1G3A0W0      T-----------KHEEQLLAAEIDKQQV------------------EFDTLFAT------
A0A353BE27      F-----------RLEEEELANQAERERR------------------SSRELQGM------
A0A5C6BPW1      L-----------DVILEQLKEELDNRKI------------------QKTQIVTD------
A0A1I3GSP0      L-----------ELDNQNLALLHTDAQK------------------KAKQAEMF------
A0A517QJV1      L-----------KSIAKNLDIMREDAEK------------------KAKDAELY------
A0A3C1QS25      I-----------DYELVAFRAQFEEHRA------------------RAMELNQV------
A0A5C6FX55      L-----------KQRLDLLTKEIESEAA------------------KGRLLADK------
A0A5C6DS51      Y-----------EIREKVLVETCEEELR------------------LAKEVENA------
A0A5C6DSL6      Y-----------EIREKVLVETSDQELI------------------EAKKVENA------
A0A3M1VG27      L-----------THRRQQLEKLYEEKLR------------------VAKQFAHI------
A0A518GC22      L-----------QLEEEHLQRDAAEEKK------------------KSRELQIM------
A0A3L7Q373      L-----------QADQIALKSAYDDAEK------------------TARMASTY------
A0A3E0PW54      R-----------QDLEQRLTADLASAES------------------EAKAAGLF------
A0A7C3TAH2      L-----------KAQEDRLRQVLTEQDE------------------LAKKMGRT------
A0A1Z8MHR4      L-----------DEDMQSIDVQIERERQ------------------LADELKKA------
A0A5C6EHJ0      M-----------DSELQVVTDAYEDEMT------------------QARTESDS------
A0A5C6F1H9      L-----------DSELTVVSDAYEAEMT------------------QARAESDS------
A0A255QXY0      T-----------QKEIDDLDLQIEAEKR------------------AADELKHF------
A0A517SYI0      L-----------DEDMQSIDVQIERERQ------------------LADELKKA------
A0A518HX54      A-----------NEDLSEVDRKIDTEKL------------------AADELKKY------
A0A5B9MF59      L-----------AQDMADIDLQIEQQKD------------------EADKLKIV------
A0A2A2WC24      L-----------AQDMSDIDLQIEQQKD------------------EADKLKIV------
A0A518KYW8      L-----------AQDMSDIDLQIEQQKD------------------EADKLKIV------
A0A5C5YZZ0      I-----------DEDIADTNSRLTEVRD------------------RALKLIAF------
A0A518JLD2      V-----------EQEIGEIQTAYHTAVE------------------AAKAESIA------
A0A5M6DJ15      L-----------KQQSERINDDLVKMDE------------------EVKELGKS------
A0A3L7P7S7      H-----------ETELAKVKDESQSLQE------------------ELDKHKAL------
A0A517N8M1      L-----------KAQIKELDGQITVERQ------------------DAAKLAQF------
A0A5C6CW01      L-----------KNQILELDKQIVDERA------------------AAIELAKY------
A0A5C6BXS9      L-----------KEQIAEIDAQVTTEKS------------------EAIKLAKY------
M5U569          L-----------RQQIKELDSQIATEKS------------------EAVKLARY------
L7CND7          L-----------QQQISEIDSQIASERI------------------EATKLAQD------
A0A0J1B8S4      L-----------EQQIGEIDLQIASERK------------------EAIKLAQF------
F2ARR3          L-----------RQQISEIDAQVNAEKS------------------EAVKLAKF------
K5D8H6          L-----------RQQISEIDAQVNAEKS------------------EAVKLAKF------
M2AKU0          L-----------RQQISEIDAQVNAEKS------------------EAVKLAKF------
A0A5B1CKI2      L-----------TEQRKELDDQISEERL------------------GASKLAQY------
A0A5C6EG84      L-----------NSQVRELDEQIAVERQ------------------SAAKLAQF------
A0A5C6F2X4      L-----------TSQVKELDSQIEDERT------------------EAAKLAQF------
A0A5C5XTV6      L-----------NEQISEIEAQIETEKK------------------KAIEIAKF------
A0A5C6AAB1      L-----------KQQITDLEEQIAVEKG------------------EAIKLAKF------
M5T8W8          L-----------QQQIAELDQQIANEKS------------------EAVQLAKY------
M5SF00          L-----------KQQISEIDSQIASERI------------------EAMKLAQD------
A0A2G1WDS1      L-----------KQQISEIDSQIADERI------------------EAMKLAQD------
Q7UVS9          L-----------KQQISEIDSQIAGERI------------------EAMKLAQD------
A0A5C6B601      L-----------QEDMRELDQKIATEEA------------------LADQLHKA------
A0A517PFU1      L-----------QSQIDKLDERYAETRE------------------AAEDVRDA------
A0A5B9M8J9      A-----------NEDLGVIDQKISVEKQ------------------AADELKKF------
A0A2A2WFP6      A-----------NEDLAEVDRKIEAEKL------------------AADELKKF------
A0A518L8N2      A-----------NEDLAEVDRKIDAEKL------------------AADELKKF------
A0A518HQN9      L-----------AQDMSDIDLQIEKQKD------------------EADKLKIV------
A0A5M6D8H8      M-----------QDDLSQLDDQIAVEKR------------------AADELKEQ------
A0A5B1CRW9      Y-----------EKRKSLLLAESQKEML------------------LAKQIEAD------
A0A5C6EI46      L-----------QKRKTILMEEAEREML------------------AAKEVEAS------
A0A2E7D3V4      L-----------ANKNVRLDSLYDDEAK------------------KAKEFSKF------
A0A5B9PER9      I-----------DQSIKDVSRMLAEQDE------------------QWQMHNNE------
A0A517QSM4      L-----------EAEKNHLEQELSALKI------------------KEAGEGTA------
A0A355GJI7      L-----------ENRELELTKLFTQESE------------------LAKKVGNF------
A0A1Z8MCI4      L-----------ELRIKTLNDGINAEKA------------------RLAGEQSK------
A0A517SYL7      L-----------ELRIKTLNDGINAEKA------------------RLAGEQSK------
A0A3L7P0L2      L-----------EDEQVRLVEDYKEAEK------------------TAKEASSY------
A0A6M5YVJ1      L-----------KKQEALVKTKVLDLRE------------------EVVKSNDY------
A0A2E0SHG0      I-----------KQREEMLKQYRDAAES------------------QAKLVANF------
A0A518CQB8      L-----------LRQETTLVTFRDMAEA------------------KAKEVATF------
A0A517SCC8      L-----------DSNSRLLEQEQKSSME------------------RAKSGMLL------
A0A3A0DR44      L-----------DAEHALLKRRYDEYMK------------------SLSESGGD------
A0A358MY60      L-----------KARRALLEVEYDNERA------------------RLQQKGGN------
A0A517MNB1      L-----------KSKRSILQQEYDLEKG------------------RLEQKGGD------
A0A7C1EH96      L-----------ITYEEKIIAQLEEQDE------------------STIRIGRT------
A0A142YJ13      L-----------REQEKSLVQEIAGLES------------------QMSSLNVK------
A0A517Z7D3      L-----------DHRDKLLAKSLEEAEI------------------EAKRASLF------
A0A1N6KY57      L-----------EKIEAALQDDVKRLTE------------------RSRSIGQN------
L0DK20          L-----------SKLEAVLASDVKRLSE------------------RSLSITQN------
A0A3L7UX05      L-----------IVREQAIRKNMQESKL------------------TLENDESK------
A0A517XRC2      D-----------RARLERKERTLTELTK------------------NAGNIAKT------
A0A6M5YH47      K-----------KLDRDKLKDLREAYKK------------------SISAGVGG------
A0A660UUK3      T-----------IEHEKKIREELDRYDT------------------ATIGLGRK------
A0A517ZHG5      M-----------DVILEQLKEELDNRKI------------------QKTQIVTD------
A0A1Z8MPL5      A-----------NNYLASLQAEYSKLAL------------------QVQEIGEY------
A0A5C1AGE3      E-----------TKLRAERRDEIEKGQR------------------LIQIERTTAQSNLT
A0A2Z3HEL7      K-----------EKVRNGLRTERDTAKK------------------TIESTAGG------
A0A142XAP8      K-----------KGVREKHRLERDGLQR------------------VIATTAAG------
A0A6P2DEK1      K-----------KGEREGHRLEREGLQR------------------VIATTAAG------
A0A5C6C1R5      L-----------QQQKERIEHDLVELDS------------------EAKKLGRS------
A6BZU4          L-----------ENRELELTKIFDQETE------------------LAKKVGDF------
A0A2D5GZ77      L-----------ENRELELTKIFDQETE------------------LAKKVGDF------
A0A3D3R1Z6      L-----------ENRELELTKIFDQETE------------------LAKKVGDF------
A0A517XG00      L-----------ENRELELTKIFDQETE------------------LAKKVGDF------
A0A1G2YRE4      T-----------KVHEKHLREVLAQEDT------------------QVIEIGRR------
A0A353Z859      L-----------EITIDGLDKQLVYEDE------------------SRNNKLAW------
A0A2D6ST10      L-----------LAWQAELEKKIDEHKT------------------TLTKNNIF------
A0A177QX42      Y-----------ENEVAQLNSAFDNIKG------------------DALKMQGE------
A0A517SHR0      L-----------QNEVAELNTGFEDVKA------------------KALSMQED------
A0A2E0AW64      M-----------AIEERVVTEKYQAEIE------------------EIQNAKGR------
A0A351FZ59      M-----------AIEERVVTEKYQAEIE------------------EIQNAKGR------
A0A660V239      T-----------IEYEERIRAKLAQQDK------------------DTIGMGRK------
A0A177Q3B7      L-----------QDLETSLVETVERLRK------------------QTQAATVG------
A0A2E0X6Y6      A-----------QRREQRLTETFASARQ------------------AAAEHSGH------
A0A518GFD7      L-----------KQQEALLQEKVDVLSD------------------ETRKLGQS------
A0A5C5VZJ8      L-----------RDEEAVLAGLLDEEEA------------------RYENASRL------
A0A518GE37      L-----------DIRQAALQKEYEVEKS------------------RLEKQGGE------
A0A5C6F3H8      I-----------VSRLEILQAQYNEESE------------------RLEKFGGT------
A0A5C5X072      M-----------VAKLDVLQTQYNEERE------------------RLEQYGGM------
A0A5C5WUQ3      L-----------VAKLGILQKQYDEERD------------------RMEQFGGA------
A0A5C6E697      L-----------QSRLSVLQNQYEAERM------------------RLEQFGGA------
A0A5C5Z1A3      L-----------ETRLQMIEKQYDAERT------------------RLEQFGGT------
A0A5C6D2P7      L-----------QMKLDVLNKQYEEERI------------------RMEQFGGA------
A0A5B9ML17      K-----------KEKIKIIQRQLDQESE------------------KFTTLLDD------
A0A517LX75      L-----------TKRQQHLVEEAKTERV------------------LAKEVESE------
A0A7C5W7B3      L-----------ESQRKALEEKIA-----------------------ASDTDDN------
A0A2S8F9B8      L-----------RQQEKTLAKEVAELEN------------------EVRTFGRS------
A0A354GX32      L-----------GKKISELESQVANLRA------------------GGQTAGKS------
A0A142XL75      L-----------EKRFALAKEKHDNILR------------------KISQTNDY------
A0A6P2D5D5      L-----------EKREKIAKGKIEEIIK------------------RVSKTNDY------
A0A5C1AAF0      Q-----------EELGKVLVTEIDRLGK------------------SIKSINTA------
A0A7C7T8W8      L-----------AISEEMINESITEEKN------------------KLLKTGDR------
A0A5C6B3S0      L-----------AAQEKQLQQEVNELEN------------------EAKQFGKS------
A0A368KP63      L-----------KQQEETLAAEVAVLEK------------------EVRTYGRS------
A0A518GIZ9      L-----------DIREQQLNVLFELESN------------------KAKEYARF------
A0A1C3EBY9      L-----------DIREQQLNVLFELESN------------------KAKEYARF------
D5SX64          L-----------DIREQQLNVLFELESN------------------KAKEYARF------
A0A517Z0U7      L-----------RKMEDGYTEEINALKV------------------EERHLAVS------
A0A2S8FCC0      L-----------EQMEKQLDESVQLFEK------------------EAKQFGRS------
A0A1Z8MBT6      R-----------KRQLEMVKNEYQIEGD------------------KRSKRVND------
A0A517SXN9      R-----------KRQLEMVNNEYQIEGD------------------KRSKRVND------
A0A518HFL0      L-----------QQKRELMKQRLDRIEP------------------STRSEGIE------
A0A5Q3LBQ3      T-----------RLMEELLSRRYEEELG------------------KVKKSSGQ------
A0A3B8ZJM2      L-----------KLEEEEIQRWIDEDTA------------------KSQIVQGF------
A0A1U7CLW1      L-----------HEQEKSLIDEIASLES------------------QMSSLNVK------
A0A142WPR7      I-----------QTKQKEMNLLFDQEKE------------------AAKSLVAY------
A0A3M1TFJ0      I-----------DTILGQLESQRQQRLS------------------EEEGLSQR------
A0A517P477      L-----------ESFRNNLRQQLEENQI------------------EERQAGKE------
A0A517T4K9      L-----------QAEYDYLTKELENQKA------------------DEKRTGTL------
A0A7C6B2Q1      L-----------DAQQQQLQQEVENVRR------------------TAETFGKG------
A0A7C4QPD3      R-----------LKMLRSLRDRYVAELD------------------SLQLAETK------
A0A2Z3GZZ5      A-----------GRQLVQLEAQLSKDEE------------------TMKRAGGL------
A0A4V0I6L6      I-----------SAQLDILARRIDADEE------------------TARNMAPV------
A0A7C4QQT3      L-----------KIRDEQLAKLFHIESE------------------QAKEVARF------
A0A255QXF5      L-----------ERQLAVLQKQYDAEAD------------------RLRKRDNN------
A0A518KBI5      L-----------EIQERTLRRRFEKELA------------------NVQEGGGK------
A0A5C5V6Q5      L-----------QIQQRSLKTRFQAELK------------------SVQDSGGK------
A0A517MY49      A-----------MQQERQLTSSFEEARD------------------VASKHSAD------
A0A2E6AG00      A-----------SAHESQLKIEYVEARD------------------SAVQXHXQ------
A0A1G3A880      A-----------SQREMALRDSFETARA------------------EAVRLNGD------
A0A2E8ATT1      A-----------WTFEKGLLKEYQALEE------------------SALTLNDD------
A0A7C2JZW2      R-----------LKMLKLLLARYDEQLS------------------ASKTEEAS------
A0A518KYQ0      L-----------VKRLDVLESQYKAESD------------------ILRQRDGV------
A0A5B9QX47      L-----------VAKLEIAQSLYDEERE------------------RMSQYGGA------
M5T666          L-----------VAKLDILKAQHDEERE------------------RMEQFGGT------
M5U6N6          L-----------LAKLNILQAQHDEERE------------------RLEQYGGT------
A0A517M0G2      L-----------KARRAIIQQEYDIEKS------------------RLEQRGGK------
A0A5C6AST1      L-----------KAKRAIIQQEYDEEKA------------------RLEQHGGD------
A0A5C6C951      L-----------KAKRAITQQEYDNEKA------------------RLEKQGGN------
A0A5C6C5T3      M-----------VAELNVVQSEYDEERE------------------RLEQYGGM------
A0A2A2W6A9      M-----------VKRLAVLQEQYEAEAD------------------LLRQRDGN------
A0A518HQS9      L-----------VKRLQVLQDQYKTESD------------------RLRQRDGN------
A0A5M6DFE6      L-----------VARLASVREQYEQERE------------------RMKKYSGA------
A0A5C6F286      I-----------ASRLDILQSQYSEERQ------------------RLEKFGGT------
A0A517NGN1      L-----------EARLAVLNTHYDRERV------------------RLEQLGGD------
M5RUI3          L-----------ATQLDVLQKQYDDERS------------------RLEQFGGA------
A0A660VT66      L-----------DEMEQE----LRDSEA------------------RAQRMLTL------
A0A7C2VEF7      A-----------KQKEQTLLVSFQIQRR------------------QAQDSGVK------
A0A0S8H0S8      A-----------QQKQGEIRAALVDQQK------------------QAEQMDAR------
A0A7C2ZTD2      I-----------LDKEDAETIGLGRKQL------------------TIQDLQFQ------
A0A2E3Z6T8      A-----------IEKEKQIRQAYQQARA------------------EAAAYSGS------
A0A257WQ92      L-----------DVRDQHLAQLVEDESV------------------KARGVAKF------
A0A7C1U6X6      MEKELAYAEDALRRRAAELDEEWRNRSSVVAPVAPGVSALAEALLSPEQQLEQA------
A0A7C7UXI5      A-----------RQHEQAVRRQYEVEMQ------------------RAIALDRD------
A0A7C3SFJ0      P-----------REQQIASLDAWKTEKAVLEKELQIAQEAFNKHVEETQKFSSQ------
A0A7C7WWF7      A-----------VAHERELDRQYNLATG------------------EAKVVTRE------
A0A356ETW1      A-----------VEQEQSLRVQFQAAQA------------------DASRRTGQ------
A0A3L7NJY1      N-----------EENELAIFARLESEQV------------------KAQNLTQI------
A0A523CME0      ------------KTELKKRKDRESASFT------------------EKEKKGEN------
A0A354PCV3      ------------ETKLTVLRKQYEEEVA------------------RLEQFGGM------
A0A354PHB4      ------------ETKLTVLRKQYEEEVA------------------RLEQFGGM------
A0A356ESF4      ------------------------------------------------------------
A0A538RV31      ------------EEMEKKLREELDKMAS------------------DVKSDARR------
                                                                            

M5S2L2          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A7C2VXA0      ------------------------------------------------------------
A0A7C3AA48      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A7C5PFV3      ------------------------------------------------------------
A0A7C3QGD2      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A1V6CUG1      -------------------MANVWDAIKKHQAEQEQQRAAAD------QVSAET------
A0A3M1SE88      ------------------------------------------------------------
A0A7C2ZUK5      -------------------------MRISGTRERSFYRRVTV------GKVSRA------
A0A660WB30      -------------------GRNGEGADVKRFAASLPLVHSSP------KFALIM------
A0A660W9Z7      ----------------------------MSNESLGKLNNLIS------TALDLQ------
A0A3M1R9K7      --------------------------VEIVQEAQQPRVADQD------RQIQLT------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
A0A7C2JY73      -------------------QAKDETLNAELARLRQLWGQLDS------QVNQVG------
A0A356AE44      -------------------EEREQTLSDELKRIKSLHDIVAN------RVEVLS------
A0A1G2XSU7      -------------------QLAMQDVKEQLDNSKDMYSTIQK------RIGELE------
A0A350KD81      -------------------QVVDQSYNEEIAQLKSQRDNIFK------QLLVEK------
A0A2D6SRY7      --------------------FELVGLLRKSEVNQDLYTRLLQ------KYEEAR------
A0A1G3C300      -------------------ITVYRRLQREADSERAFYDILLK------RMKESN------
A0A524HC32      -------------------ATQYSIIAREVDTNKAIYQSLLE------RAKEIE------
A0A177PV03      -------------------IKQEARFKESALSARQSYEEVGK------RLNELQ------
A0A1G2YIM0      -------------------QLAMQDQKDQFALTEEMYNTIRR------RIQELE------
A0A1G2ZG92      -------------------DSENSKLELTLTINKDMYQNLLE------YLMTVS------
A0A1G3A0W0      -------------------AQSLEKANNDLNHKRDLFEAVRQ------RMDQKT------
A0A353BE27      -------------------LDGYRILQTDRDAVSELLTAYTE------KLQEID------
A0A5C6BPW1      -------------------SFELQQLQKEAAKLEARTDEIDN------KIDELK------
A0A1I3GSP0      -------------------EVEDQRRKDEIAQKKQQLERMFD------QIAEYD------
A0A517QJV1      -------------------QVEDQRLKDDLSIKKAQLSQVFN------QIATYD------
A0A3C1QS25      -------------------DLSLKNLLDQKKYQESVITSVVD------RLQQVD------
A0A5C6FX55      -------------------EVDYIALQNKIEGTRELVTQVSE------SMARVD------
A0A5C6DS51      -------------------FLEGSAKKAKLVRAQARYDEVIR------RLQELN------
A0A5C6DSL6      -------------------FLEGSAKKAILVRAQARYDEVIR------RLQELN------
A0A3M1VG27      -------------------LEQDQAYRDQIQSIKSTLDVVIS------RMQEIE------
A0A518GC22      -------------------LGEDRVIKAELEAVNTLLAGYTE------KLQEIS------
A0A3L7Q373      -------------------EVTDQQYKDDIARMKKDLDLALK------QLSDLD------
A0A3E0PW54      -------------------EVEDQKRKDEIARHKKQWQDVIV------ELESFG------
A0A7C3TAH2      -------------------AVDIQTLQWELDLVKKDHDLAYN------RLAEKQ------
A0A1Z8MHR4      -------------------EENDASFNRRLETIHALRFQLEQ------QLAALN------
A0A5C6EHJ0      -------------------EIRSAQFVREIERQQQLYDRIVA------RLDEVN------
A0A5C6F1H9      -------------------EIRSAQFVREIDRQQQLYDRIVA------RLDEVN------
A0A255QXY0      -------------------EEDESSYKRRIASVQGMLIQLEE------QLAGLK------
A0A517SYI0      -------------------EENDASFNRRLETIHALRFQLEQ------QLAALN------
A0A518HX54      -------------------EDTDASFRRRIASLQGMLIQLEQ------QLAALE------
A0A5B9MF59      -------------------EERDASFNRRIETMRGLETQLEQ------QLAALN------
A0A2A2WC24      -------------------EERDASFNRRIETMRGLETQLEQ------QLAALN------
A0A518KYW8      -------------------EERDASFNRRIETMRGLETQLEQ------QLAALN------
A0A5C5YZZ0      -------------------ENKNSSFLRSIARYQETLQSFDS------QLEKAN------
A0A518JLD2      -------------------ESRSEQYVREIERQQQLYDRIVA------RLDEVN------
A0A5M6DJ15      -------------------SMEIEMKRSEIASLSDVLTRLAA------EIERTS------
A0A3L7P7S7      -------------------ENRKLEMSRRLEQLTRDSETIEF------NKQQYA------
A0A517N8M1      -------------------EQENQAQLREIERTRDLLNQLEE------QMARVT------
A0A5C6CW01      -------------------EQDNVAMLRELERNRDLMDQLEE------QMARVS------
A0A5C6BXS9      -------------------EQENMALLREIERNRELSNQLEE------QMARIE------
M5U569          -------------------EQENNAILREIERNRELINQLEE------QMARVE------
L7CND7          -------------------EQENASMLRQIDRNRELINQLDE------QMARVE------
A0A0J1B8S4      -------------------EQENTALLREIDRNRELINHLEE------QMARVE------
F2ARR3          -------------------EQDNTALLREIDRNRELINQLEE------QMARVE------
K5D8H6          -------------------EQDNTALLREIDRNRELINQLEE------QMARVE------
M2AKU0          -------------------EQDNTALLREIDRNRELINQLEE------QMARVE------
A0A5B1CKI2      -------------------EQENQAQLREIERTRELLEQLEE------QMAKVS------
A0A5C6EG84      -------------------EQENHAQLREIERTRELLDQLEE------QMARVN------
A0A5C6F2X4      -------------------EQENQAQLREIERTRELLNQLEE------QMARVN------
A0A5C5XTV6      -------------------EQENMAILREMERNQALINQLDE------QMARIE------
A0A5C6AAB1      -------------------EQENSAILREIERNRELINQLEE------QMARVE------
M5T8W8          -------------------EQENNAILREIDRNRELIDQLEE------QMARVE------
M5SF00          -------------------EQENASMLRQIDRNRELINQLDE------QMARVE------
A0A2G1WDS1      -------------------EQENASMLRQIDRNRELINQLDE------QMARVE------
Q7UVS9          -------------------EQENASMLRQIDRNRELINQLDE------QMARVE------
A0A5C6B601      -------------------ENTDKAFNRKMDFLKGMLDELDQ------RIEELD------
A0A517PFU1      -------------------ESRERELRDRRNRHADLYAALVA------DVDQLD------
A0A5B9M8J9      -------------------EDTDASFRRRIASIQGMLIQLEQ------QLAALE------
A0A2A2WFP6      -------------------EDTDASFRRRIASLQGMLIQLEQ------QLAALE------
A0A518L8N2      -------------------EDTDASFRRRIASLQGMLIQLEQ------QLAALE------
A0A518HQN9      -------------------EERDASFNRQIETMRGLETQLEQ------QLAALN------
A0A5M6D8H8      -------------------EQNDASYRRRIESIRGMTIQLEQ------QMSALK------
A0A5B1CRW9      -------------------FMKATSLRAKMQRAQQRYDEVVE------RLQELK------
A0A5C6EI46      -------------------FMESNSLKAKLARAQSRYDQVIV------RLQELN------
A0A2E7D3V4      -------------------EAEDQKFVEEIARIKSLQAVIVK------RLAEMG------
A0A5B9PER9      -------------------AIKLSKIEQEITRLDEQLKEIGASQRLGAELL---------
A0A517QSM4      -------------------AFNLEELKREITHMETTESRFRT------EIEALL------
A0A355GJI7      -------------------QVIDQSYNEEIAQLKSQRDNIFK------QLLVER------
A0A1Z8MCI4      -------------------WNAIQFELDNVEVSKDVLISLRR------REAALK------
A0A517SYL7      -------------------WNAIQFELDNVEVSKDVLISLRR------REAALK------
A0A3L7P0L2      -------------------EVIDQRYKDDIARKKKELDAILT------QITHFD------
A0A6M5YVJ1      -------------------RVEIAKIRSEIAQTEKVMTRIAD------EANSIK------
A0A2E0SHG0      -------------------KLNQELLSDERELKKELRSVSIQ------RLNDIA------
A0A518CQB8      -------------------KLNEELLRDEKELKKELFTNSNR------RLEDIS------
A0A517SCC8      -------------------EKDDRDWKERIADQKKFRDDLQM------KLASFN------
A0A3A0DR44      -------------------AVRLQFKYADLERESSVFNLIAQ------RKLQVE------
A0A358MY60      -------------------AVELLFAKEDREIASQLLGMMQQ------RLAAIK------
A0A517MNB1      -------------------AADLRFAQEDREIAVGILAKLNE------RLAAIR------
A0A7C1EH96      -------------------QLDIDDLREQFENSRQIYNEITR------RIEELN------
A0A142YJ13      -------------------TMDVHWLDEEIEVASSTAKTVGA------EVQSMT------
A0A517Z7D3      -------------------ELEDQKRKDEIERVKDQLKTALT------QLSTFA------
A0A1N6KY57      -------------------SVDLFSIQEEIANADEIARLIGK------EVEALT------
L0DK20          -------------------SVDLFSVQEEIANADEIARTIGK------EVEALT------
A0A3L7UX05      -------------------ELQLAFRRTDLARAESTLDSVQR------ALEQLQ------
A0A517XRC2      -------------------GFDIQSLTRGLEPMKKRLDTLED------QKIQIV------
A0A6M5YH47      -------------------GLNMKALQDGLKPQRENLERVNA------HLLQLR------
A0A660UUK3      -------------------QLNIDDKKAELARTREIFNTVCN------RISEIV------
A0A517ZHG5      -------------------SFELQQLQKEAAKLEARTDEINN------KIDVLK------
A0A1Z8MPL5      -------------------SADLERRQDELVHLTQVTNELGY------ELEKLD------
A0A5C1AGE3      KYSQAVTELESRLEVMNRMGIEVIKQDREIKPKMEQKQKIEE------QIEQLN------
A0A2Z3HEL7      -------------------GASIDALRKNLEPQRALLSRLDE------QLLQLS------
A0A142XAP8      -------------------GLSIDEDRKNLQPQREMHDKIQS------QLIQLQ------
A0A6P2DEK1      -------------------GLSIEEERKNLQPQREMHDKIQT------QLIQLR------
A0A5C6C1R5      -------------------SIDIEMMRAEIASLDDVLNRLGS------EIERTR------
A6BZU4          -------------------QVVDQSYNEEIAQLKSQRDNIFK------QLLVEK------
A0A2D5GZ77      -------------------QVVDQSYNEEIAQLKSQRDNIFK------QLLVEK------
A0A3D3R1Z6      -------------------QVVDQSYNEEIAQLKSQRDNIFK------QLLVEK------
A0A517XG00      -------------------QVVDQSYNEEIAQLKSQRDNIFK------QLLVEK------
A0A1G2YRE4      -------------------QLNIEDLQFQQNLDQETYDTVRR------RIRDLE------
A0A353Z859      -------------------QMELDELNKSIEQFRTIYNRLQE------EGERAR------
A0A2D6ST10      -------------------NAELNRLDQDIAQDGALIDAIAT------QIEQIE------
A0A177QX42      -------------------QRTNERLNEEHANLKQTYEALVS------KLVSLD------
A0A517SHR0      -------------------QRIDQRLTEEHNHLKQLYDALVA------KITTLD------
A0A2E0AW64      -------------------TFDMVQLQTSLERAEEQALAFQD------REDRLR------
A0A351FZ59      -------------------TFDMVQLQTSLERAEEQALAFQD------REDRLR------
A0A660V239      -------------------QFVIDDKKDQLARTTARLEDTKK------RIDQIR------
A0A177Q3B7      -------------------QSDIESFRTEIAQSEKIADRIGS------EVERLK------
A0A2E0X6Y6      -------------------IVEIERLEGQVEWTKTQREAILA------QLQQVE------
A0A518GFD7      -------------------SIDVELMRAEIAGLEDVLQHVGG------EIERTS------
A0A5C5VZJ8      -------------------ASRLVEVEREVEADTHELDNLEK------QLNIRE------
A0A518GE37      -------------------TAEIFFAREDYEQAAEILSQLNN------RLATLR------
A0A5C6F3H8      -------------------TAQLQFAQDELAVASGVLKKLRD------RVAAIK------
A0A5C5X072      -------------------TAELRFANDELVVASGVLTKLRG------RVAAIR------
A0A5C5WUQ3      -------------------TAALQFAQEELSVATDVLRKLRD------RTAAIQ------
A0A5C6E697      -------------------TAELQFAQEELSVANDVLRKLRD------RVAAIR------
A0A5C5Z1A3      -------------------TAELQFAQEQLDVANEVLIQLRS------RDAAIK------
A0A5C6D2P7      -------------------TAELQFAQEELAVANDVLKKLRD------RVAAIR------
A0A5B9ML17      -------------------SAKLQFAQDDLRRASLLLNKLED------RKAAIK------
A0A517LX75      -------------------YLEGKALKARMVRAQQRYDEVME------RLQEIQ------
A0A7C5W7B3      -------------------TIRLRILEKRREALRTLLEDLNR------RVEQGRWVREGL
A0A2S8F9B8      -------------------SVEVEMMRSEIESLDEIVQQLNA------EIERTK------
A0A354GX32      -------------------NGDVDGLQAEVNALDAEVKKSGE------ELASLD------
A0A142XL75      -------------------KIELSTIQFSIGQTEKLNQSLGE------TIERLK------
A0A6P2D5D5      -------------------KIELDGLKLSIGQTEKLNQSLGE------TIARLR------
A0A5C1AAF0      -------------------NLDLEAEKIEIQTAEDLYAKVAA------AISTHL------
A0A7C7T8W8      -------------------SLEFAFALQEVNRAEGVHSLISE------RIQVLQ------
A0A5C6B3S0      -------------------SIDVEMMRSEMSALEQVLSSIGE------EIERSK------
A0A368KP63      -------------------SVEVEMMRSEIEGLDSIVQQLSA------EIERTK------
A0A518GIZ9      -------------------QAEDQAMTAELNRLRSLWGQLVD------RMSQLT------
A0A1C3EBY9      -------------------QAEDQAMTAELNRLRGLWGQLVD------RMSQLT------
D5SX64          -------------------QAEDQAMTAELNRLRSLWGQLVD------RMSQLT------
A0A517Z0U7      -------------------WVDRQILADTVDSLKEKVNRFSD------TIYKRE------
A0A2S8FCC0      -------------------SIDVEMMRTEIDSLEGILSRLGH------EIENTK------
A0A1Z8MBT6      -------------------SWDVDKHVNHLAMLRERYAAAEQ------RLDAIK------
A0A517SXN9      -------------------SWDVDKHVNHLAMLRERYAAAEQ------RLDAIK------
A0A518HFL0      -------------------QLKVSFAATDLRQRRIMLDQVNR------RIEMLE------
A0A5Q3LBQ3      -------------------SLELVFALAELEREEKVFELIAA------RTLALR------
A0A3B8ZJM2      -------------------LLTHESIKNQAEKLDKIQEVLSD------KLKGVE------
A0A1U7CLW1      -------------------SMDFHWLEDEIAVASDTAKMVGA------EVQSMT------
A0A142WPR7      -------------------EVRDESLRNEIARTSKLFEGVVK------RLDEIS------
A0A3M1TFJ0      -------------------AQQLREQSRQLARRARLYESLKK------EVEANERFYEEF
A0A517P477      -------------------SVGLRRLEAELLRKEELVNLLAT------EAERRE------
A0A517T4K9      -------------------SYELETVNKAIEQTEKIVQNVKD------EIQRLQ------
A0A7C6B2Q1      -------------------SIEIEFLRAEVELARRTLQTIAE------ERNRMS------
A0A7C4QPD3      -------------------LARDWVDREAIAEEIAALKGTVDAYAMEIRRRQVE------
A0A2Z3GZZ5      -------------------LDLAEAMAVQSQHADAEIMRLEA------ERLARQ------
A0A4V0I6L6      -------------------QQAIRNNEEKLKQTAAELQAAEK------EKDRVS------
A0A7C4QQT3      -------------------QAQEQALSAELTRLRELWGQLVT------QVNQVS------
A0A255QXF5      -------------------NVALEFAKTDLQQSRAMLQKVTE------RLDSIQ------
A0A518KBI5      -------------------GAELEFAKAELAREEKVFELIAA------RKLALQ------
A0A5C5V6Q5      -------------------GAELEFAKAELAREEKVFEMIAA------RKLALQ------
A0A517MY49      -------------------LATLENLEREKGRLESSYDAVKD------QIRSVG------
A0A2E6AG00      -------------------IEELAIAEREVERLRSLHHTLQD------RIANID------
A0A1G3A880      -------------------LAQLEILEHDVEQLRSFHDVLVN------QIANTD------
A0A2E8ATT1      -------------------MAELTITERDVERLSRLHDTLLE------RISNID------
A0A7C2JZW2      -------------------LANLMIEREQLTEQITSLKSTVDIYAQEVRKLEVE------
A0A518KYQ0      -------------------SVALLFAQDDLERTRSMLHRITD------RLASIQ------
A0A5B9QX47      -------------------TAELSFARQELEVANDVLSKLRG------RVAAIQ------
M5T666          -------------------TAELQFANDELVVASDVLTKLRG------RVAAIR------
M5U6N6          -------------------TAELQFANDELTVASDVLTKLRG------RVAAIR------
A0A517M0G2      -------------------AADLRFATEDREIAAGILGQLNQ------RLAAIR------
A0A5C6AST1      -------------------AADLHFAQEDREIAVGILGQLNQ------RLAAIR------
A0A5C6C951      -------------------SADLKFAQEDREVAVGILAQLNQ------RVAAIR------
A0A5C6C5T3      -------------------TAELEFAEDEQAVASDVLTKLRG------RVAAIR------
A0A2A2W6A9      -------------------SVALQFAQDDLARSRTMLHRIMD------RLESIQ------
A0A518HQS9      -------------------SVALQFANDDLERSRSMLHRIVD------RLESIQ------
A0A5M6DFE6      -------------------SAELEFAQQELAIERETLQTLRN------RIDAIR------
A0A5C6F286      -------------------TAQLQFAQDELDVASGLLKKLRD------RVAAIH------
A0A517NGN1      -------------------AAELQFAEEDLAVGNGVLDKLRQ------RVAEIR------
M5RUI3          -------------------SADLQLAIDEKQIAMDVLGKLKI------RAAAIR------
A0A660VT66      -------------------LQSYTKLERDLKSSQSLYDIVLQ------KMKESD------
A0A7C2VEF7      -------------------AAEYSMLQSELGRTERICKILDD------RIKELN------
A0A0S8H0S8      -------------------LARCALLEAAFKRSLRMNELLDS------RISEVA------
A0A7C2ZTD2      -------------------LELDGELYDKIRRRIQEMEMEQK------RPARIS------
A0A2E3Z6T8      -------------------LVQFRALERAVARDEAKSDILTD------KIANID------
A0A257WQ92      -------------------QAKDEAMHAELARLRDLWGQLVT------QVNQVS------
A0A7C1U6X6      -------------------KQELPLLEEQYAKDKKDFDQLFA------IAQDFE------
A0A7C7UXI5      -------------------NTELTNLELDLDRLRRYYDAVLQ------RIKDVD------
A0A7C3SFJ0      -------------------SIDLELRKNELDRLKRLTERMGQ------ELEQWE------
A0A7C7WWF7      -------------------LTLLSETQSDVERLMHLHDTLLD------RIVSFD------
A0A356ETW1      -------------------IARLTMLQREVKRLYDLSDALVS------QIASLD------
A0A3L7NJY1      -------------------LTRLADVDREIERLYTQQSDYQN------HADGIS------
A0A523CME0      -------------------NSEIERFTKKGQNLKR-DSKMAG------SKSYIK------
A0A354PCV3      -------------------TAELQFAQAELEVANDVLKKLRD------RVAAIR------
A0A354PHB4      -------------------TAELQFAQEELEVANDVLKKLRD------RVAAIR------
A0A356ESF4      -------------------MTELENKERDLKRLQTWNEQLLN------KLTDLN------
A0A538RV31      -------------------GVELESLKEQIESTDKISQRLHQ------MIDEEQ------
                                                                            

M5S2L2          -----------------------------MA-----------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A7C2VXA0      ------------------------------------------------------------
A0A7C3AA48      ------------------------------G-----------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A7C5PFV3      ------------------------------------------------------------
A0A7C3QGD2      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A1V6CUG1      -----------------------------EA-----------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A7C2ZUK5      -----------------------------LD-----------------------------
A0A660WB30      -----------------------------VL-----------------------------
A0A660W9Z7      -----------------------------KE-----------------------------
A0A3M1R9K7      -----------------------------VL-----------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------M-----------------------------
A0A7C2JY73      ---I-E-----------------------KD-----GSGYSLRQIA------PVKDMLSI
A0A356AE44      ---L-------------------------AS-----DEGYQLTQIS-----------PSR
A0A1G2XSU7      ---MER-----------------------KR-----LARISVAYLA--------NTAPYQ
A0A350KD81      ---V-S-----------------------QG-----NSGYTLTQLA------PVKDELVI
A0A2D6SRY7      ---I-A-----------------------EA-----AEVGTAQLVD----PALPPGGPFR
A0A1G3C300      ---I-A-----------------------GD-----LQTSNVSILD----PAMEPRTPIG
A0A524HC32      ---S-M-----------------------SG-----VSASNIQKVD----RALLPIFSVK
A0A177PV03      ---L-S-----------------------KN-----FGGVTADVIE-----PATPALKVA
A0A1G2YIM0      ---M-E-----------------------RK-----RPARISIAFN-------ADSMLAK
A0A1G2ZG92      ---I-A-----------------------ES-----MTLSNIRLIE----AAIEPYKPHF
A0A1G3A0W0      -----M-----------------------ER-----DIPPSIEVLS----KAFVPSQPHS
A0A353BE27      ---L-M-----------------------PK-----MGQRTLKRLD----MPN-TGLFYG
A0A5C6BPW1      ---IEL-----------------------DA-----PDRINVAQWA----EV--PRIKDW
A0A1I3GSP0      ---I-T-----------------------RG-----QEGYRLQQIS----QV--RIERSM
A0A517QJV1      ---V-S-----------------------KE-----QEGYRMKQIA----QV--RIERSL
A0A3C1QS25      ---V-T-----------------------GD-----KEGFNYEILE----PPT-FAEQTE
A0A5C6FX55      ---MST-----------------------ST-----ESETRVVELI----AAK-GAYLVA
A0A5C6DS51      ---L-A-----------------------GS-----YAGFSTDLLA----SPESARNPSW
A0A5C6DSL6      ---L-A-----------------------GS-----YAGFSTDLLA----SPEAATVPSW
A0A3M1VG27      ---L-I-----------------------KD-----NRGYALRTVA----EP--KAEVSI
A0A518GC22      ---L-M-----------------------PK-----VGQRTLKRLN----MPS-IGWFYG
A0A3L7Q373      ---Q-N-----------------------KA-----QEGYKMSRTN----DV--RVDRSL
A0A3E0PW54      ---V-R-----------------------KE-----QEGYRVNQIA----QV--RVEKSI
A0A7C3TAH2      ---L-E-----------------------QR-----RERRITVQAS----A---EVERID
A0A1Z8MHR4      ---L-A-----------------------HV-----NDGIMVKQIQ----ETS-PAIRVG
A0A5C6EHJ0      ---L-M-----------------------SG-----GDGLKVFPLN----TAK-LGYQVA
A0A5C6F1H9      ---L-M-----------------------SG-----GDGLKVFPLN----TAK-LGYQFA
A0A255QXY0      ---L-I-----------------------DM-----DGGIIVDQLW----GSG-GAARIG
A0A517SYI0      ---L-A-----------------------HV-----NDGIMVKQIQ----ETS-PAIRVG
A0A518HX54      ---L-I-----------------------DI-----NGGILVEPLL----ATG-KAHPTG
A0A5B9MF59      ---L-A-----------------------DV-----KGGILVEPLL----DTG-QAYVTG
A0A2A2WC24      ---L-A-----------------------DV-----KGGILVEPLL----DTG-QAYETG
A0A518KYW8      ---L-A-----------------------DV-----KGGILVEPLL----DTG-QAYETG
A0A5C5YZZ0      ---L-P-----------------------SL-----NSGLHVNVLR----PAG-LGYLVG
A0A518JLD2      ---L-I-----------------------SE-----GEGLKVIPLN----TAN-YGYQIA
A0A5M6DJ15      ---I-------------------------EL-----NAQPRVTVVD----DARARTNSGS
A0A3L7P7S7      ---M-T-----------------------KD-----HGGYDAQELG----RIPELGGEVP
A0A517N8M1      ---I-S-----------------------ED-----ERGTRVIELT----APS-LAYKVG
A0A5C6CW01      ---L-T-----------------------EE-----EGGTRVQELT----APS-RAGRVG
A0A5C6BXS9      ---L-T-----------------------EE-----EGGLRVSELR----APS-GAYRIG
M5U569          ---L-T-----------------------EE-----EGGVQVTELS----APS-NAYRVG
L7CND7          ---L-T-----------------------EE-----EGGLQVSELR----APS-RAYRTG
A0A0J1B8S4      ---L-V-----------------------EE-----EGGIRVTELV----APS-TAYVIG
F2ARR3          ---L-T-----------------------EE-----EGGLRLTELR----APT-RAYRVG
K5D8H6          ---L-T-----------------------EE-----EGGLRLTELR----APT-RAYRVG
M2AKU0          ---L-T-----------------------EE-----EGGLRLTELR----APT-RAYRVG
A0A5B1CKI2      ---I-G-----------------------KD-----ERGTRVIELT----APS-LAYKVG
A0A5C6EG84      ---L-V-----------------------ED-----ERGTRVIELT----APS-LAYKVG
A0A5C6F2X4      ---L-V-----------------------ED-----ERGTRVVELT----APS-LAYKVG
A0A5C5XTV6      ---L-S-----------------------EE-----DGGLQVTSLR----APG-NAYRIG
A0A5C6AAB1      ---L-T-----------------------DE-----EGGVRVSELT----APS-SAYRVG
M5T8W8          ---L-T-----------------------EE-----EGGVRVSELS----APS-SAYRVG
M5SF00          ---L-T-----------------------EE-----EGGIQVSELR----APS-RAYRTG
A0A2G1WDS1      ---L-T-----------------------EE-----EGGIQVSELR----APS-RAYRTG
Q7UVS9          ---L-T-----------------------EE-----EGGVQVSELR----APS-RAYRIG
A0A5C6B601      ---L-A-----------------------NT-----NGGIVVEPLL----NTG-NAYVTG
A0A517PFU1      ---L-L-----------------------KD-----ADTVRVTPIV----PPG-PGRPAR
A0A5B9M8J9      ---L-I-----------------------DI-----NGGILVQPLL----ATG-KAHPTG
A0A2A2WFP6      ---L-I-----------------------DI-----NGGILVEPLL----ATG-KAHRTG
A0A518L8N2      ---L-I-----------------------DI-----NGGILVEPLL----ATG-KAHRTG
A0A518HQN9      ---L-A-----------------------DV-----KGGILVEPLL----DTG-QAYETG
A0A5M6D8H8      ---L-V-----------------------DV-----NGGIIVEPLL----STG-QAYVTG
A0A5B1CRW9      ---L-S-----------------------RS-----YAGFSTDLLA----SAEVPMNPVW
A0A5C6EI46      ---L-S-----------------------RS-----YAGFSTDLLA----SAEVPRNAVW
A0A2E7D3V4      ---L-V-----------------------AK-----NYGYKLKQIS----------PVRD
A0A5B9PER9      ---L-Q-----------------------ISPDGDISNSNGNDGYRFERLANALEGQAVW
A0A517QSM4      ---I-E-----------------------IQ-----AKQR-ITENR----RASTPHTPQM
A0A355GJI7      ---V-S-----------------------QG-----NSGYMLTQLA------PVKDELVI
A0A1Z8MCI4      ---T-E-----------------------GG-----YKDV-VSSLA----SASLPETPLE
A0A517SYL7      ---T-E-----------------------GG-----YKDV-VSSLA----SASLPETPLE
A0A3L7P0L2      ---L-N-----------------------KD-----QEGYTLSRTN------DVRVDRSM
A0A6M5YVJ1      ---I-E-----------------------LG-----GAPPRVSLAE----EPHVVPGLGG
A0A2E0SHG0      ---L-L-----------------------ED----------YDLLQVHSMGNLNEVRSAK
A0A518CQB8      ---L-L-----------------------ED----------YELLKVQSMGNIDDVKSAK
A0A517SCC8      ---Q-T-----------------------RD-----QEGYRMEQIA------QVRVGKSM
A0A3A0DR44      ---T-E-----------------------TH-----NPAK-VIVRS----DAQIPPAPIE
A0A358MY60      ---I-E-----------------------RR-----RGSG-LHTVD----AAKPPTRPVV
A0A517MNB1      ---T-E-----------------------RR-----RGMT-IQTLA----AAKPPNKPLV
A0A7C1EH96      ---I-E-----------------------RD-----RQPR-ISI------GSWARSVSAE
A0A142YJ13      ---V-E-----------------------MQ-----APPR-IRLIE----KASIPTLSDP
A0A517Z7D3      ---Q-Y-----------------------KD-----QEGYRLKQIA------PIRVDRSR
A0A1N6KY57      ---V-E-----------------------LQ-----APPR-IRLLE----KAELPRTKDE
L0DK20          ---V-E-----------------------LQ-----APAR-IRLLE----KAELPRTKDE
A0A3L7UX05      ---F-E-----------------------SQ-----GQTQ-ISLIQ----TARPIGLPSN
A0A517XRC2      ---I-E-----------------------RG-----MESR-VSVRE----AAVLILNENL
A0A6M5YH47      ---L-A-----------------------VK-----MEGR-VSPHG----VTEKIPNNNQ
A0A660UUK3      ---M-E-----------------------QK-----RPAR-ISIAE------MASSVPAQ
A0A517ZHG5      ---I-E-----------------------LG-----APDR-IKVAQ----WAEVPRIKDW
A0A1Z8MPL5      ---L-E-----------------------LR-----ANQSRVRRVDG---GVRKPKTGDT
A0A5C1AGE3      ---L-W-----------------------LS-----SGGR-IEIRE----KAVIMYNHNQ
A0A2Z3HEL7      ---T-G-----------------------EG-----RT-R-ASARG----EAEKIPNNNQ
A0A142XAP8      ---V-A-----------------------AL-----QSGR-VSARG----GAEKIPNNNQ
A0A6P2DEK1      ---I-A-----------------------AQ-----QSGR-VSARG----GAEKIPNNNQ
A0A5C6C1R5      ---I-E-----------------------LN-----SGSR-VAVIS----EATPVADSSS
A6BZU4          ---V-S-----------------------QG-----NSGYTLTQLA------PVKDELVI
A0A2D5GZ77      ---V-S-----------------------QG-----NSGYTLTQLA------PVKDELVI
A0A3D3R1Z6      ---V-S-----------------------QG-----NSGYTLTQLA------PVKDELVI
A0A517XG00      ---V-S-----------------------QG-----NSGYTLTQLA------PVKDELVI
A0A1G2YRE4      ---L-E-----------------------RK-----RPAR-VSV------AYNADISGIQ
A0A353Z859      ---M-T-----------------------MS-----NLMR-VEKFR----DAVTPTQPDM
A0A2D6ST10      ---V-E-----------------------IE-----NSPKRIMEFR----KADAPQRRDQ
A0A177QX42      ---L-A-----------------------KD----------AMAMQAEITSEPSPGVQIG
A0A517SHR0      ---L-S-----------------------KS----------AAPMQADILSEPTPGIQIG
A0A2E0AW64      ---L-E-----------------------SK-----NLDS-ITLLK----SASPPVKPAV
A0A351FZ59      ---L-E-----------------------SK-----NLDS-ITLLK----SASPPVKPAV
A0A660V239      ---L-E-----------------------SK-----RPSR-ISV------AYGASSVPAR
A0A177Q3B7      ---L-E-----------------------VD-----APQR-VHLIE----EPVVMESAST
A0A2E0X6Y6      ---S-L-----------------------AG-----QAPIKASVVR----EPLPDPRPVS
A0A518GFD7      ---I-E-----------------------LK-----TASR-IKLLS----SADRAIAPDL
A0A5C5VZJ8      ------------------------------------MRRATEVTVA----MSTAVAKPPV
A0A518GE37      ---T-E-----------------------RG-----RGSS-VSTMA----AAKVPSWPIE
A0A5C6F3H8      ---T-E-----------------------RR-----QDGA-VRTLA----EATAPKSPIE
A0A5C5X072      ---T-E-----------------------RR-----QDGA-VRTLA----AATPPKAPVE
A0A5C5WUQ3      ---T-E-----------------------RR-----QDGA-VRTLA----SATPPKNPTE
A0A5C6E697      ---T-E-----------------------RR-----QDGA-VRSIA----KATPPRTPVE
A0A5C5Z1A3      ---T-E-----------------------RR-----QDGA-VRTLA----AATPPKTPVE
A0A5C6D2P7      ---T-E-----------------------RR-----QDGA-VRTLA----AATPPRTPIE
A0A5B9ML17      ---T-E-----------------------RT-----QADA-VRSVS----PATPPGHPVE
A0A517LX75      ---L-T-----------------------TN-----YAGFSTDLLS-----APVVGTQVW
A0A7C5W7B3      ---L-K-----------------------KD-----PAFTKVEKVN----AATGRAAPNS
A0A2S8F9B8      ---I-E-----------------------LR-----QAPR-ITLLS----EAKLGVVSDK
A0A354GX32      ---S-S-----------------------LP-----VTPR-LTVTE----AAAPPMSPAS
A0A142XL75      ---V-E-----------------------LG-----APSR-VTCSE----EPFIVTGIEG
A0A6P2D5D5      ---V-E-----------------------LG-----APPR-VSCSE----DPFIVTGLEG
A0A5C1AAF0      ---A-E-----------------------ND-----APSR-VAHLE----NARVERVNTE
A0A7C7T8W8      ---T-E-----------------------MG-----GPER-IERLR----EADADSVSIA
A0A5C6B3S0      ---V-E-----------------------LRDQIDSTGGSRVTLFS----SAYAPRRGKS
A0A368KP63      ---I-E-----------------------LR-----GTPR-ITLLS----KAEPGTVTDK
A0A518GIZ9      ---I-D-----------------------KE-----SSGY----------TLRQTGPIKD
A0A1C3EBY9      ---I-D-----------------------KE-----SSGY----------TLRQTGPIKD
D5SX64          ---I-D-----------------------KE-----SSGY----------TLRQTGPIKD
A0A517Z0U7      ---I-E-----------------------LE-----KAGVPIVVRR----PAEVPKKPDG
A0A2S8FCC0      ---I-E-----------------------LK-----SDSR-VSVLQ----EAQPPKSK-N
A0A1Z8MBT6      ---T-E-----------------------SE-----NMSR-VQPIA----AATPPTKPNE
A0A517SXN9      ---T-E-----------------------SE-----NMSR-VQPIA----AATPPTKPNE
A0A518HFL0      ---Y-E-----------------------SR-----GSEP-IIVIS----EAKPGGPPVT
A0A5Q3LBQ3      ---T-E-----------------------MR-----APAR-VNLLK----EAEIPPKPIE
A0A3B8ZJM2      ---L-F-----------------------QN-----SSNRKILQEL----IPSMPGAYYG
A0A1U7CLW1      ---V-E-----------------------MQ-----APPR-IRLIE----KASVPTM-ND
A0A142WPR7      ---L-V-----------------------KG-----YGGYEMSVLS-----PPTEGFLTG
A0A3M1TFJ0      IQQQ-K-----------------------DI-----SAYSRVNVAEVRIVDPALAAVRVG
A0A517P477      ---F-E-----------------------IS-----NATPPIAVQE----DAVVPRTRND
A0A517T4K9      ---I-E-----------------------LQ-----SPSR-IALHR----KAEPPRTRET
A0A7C6B2Q1      ---I-E-----------------------LR-----AKPR-ITVVQ----RAEAPRVADQ
A0A7C4QPD3      ---L-D-----------------------NA-----PPA--IRIHQ----KAREPQVADE
A0A2Z3GZZ5      ---A-T-----------------------LG-----AGGYSAEQIT----RPGSGHK-VA
A0A4V0I6L6      ---G-S-----------------------RS-----AGAYEVRDVT----KPADGGQ-VA
A0A7C4QQT3      ---I-E-----------------------RQ-----GAGYSLKQIA----PVK------D
A0A255QXF5      ---L-E-----------------------SQ-----RGSS-VISVA----KATPPTRPVE
A0A518KBI5      ---T-E-----------------------SK-----APAR-VEVVD----EVTASPVPLE
A0A5C5V6Q5      ---T-E-----------------------TN-----APAR-VRVMG----PIVASPTPVE
A0A517MY49      ---G-L-----------------------QV-----QAPIRAIAVS----EPRPEYRPVS
A0A2E6AG00      ---X-N-----------------------QN-----QADVRVEVVS----DPKGRQTPVS
A0A1G3A880      ---L-R-----------------------QE-----HGDIRATVVK----EPMASQQPVS
A0A2E8ATT1      ---M-T-----------------------QH-----RANVRVSVVS----EPAASRMPVS
A0A7C2JZW2      ---L-A-----------------------KA-----PPPI-VVSPA----GVRVPVQPDQ
A0A518KYQ0      ---M-E-----------------------SK-----RGSS-VMSIS----QATPPSRPVE
A0A5B9QX47      ---T-E-----------------------RR-----QDGA-VRSLA----AAKPPSRPIE
M5T666          ---T-E-----------------------RR-----QDGA-VRTLA----SATPPKSPVE
M5U6N6          ---T-E-----------------------RR-----QDGA-VRTLA----SATPPKSPVE
A0A517M0G2      ---T-E-----------------------RR-----RGSG-LHTLA----EATPPLAPVE
A0A5C6AST1      ---T-E-----------------------RR-----RGSG-VHTLA----AATVPTRPIE
A0A5C6C951      ---T-E-----------------------RR-----RGSG-VHTMA----AANTPTRPIE
A0A5C6C5T3      ---T-E-----------------------RR-----QDGA-VRTLA----AATPPRAPVE
A0A2A2W6A9      ---M-E-----------------------SK-----RGSS-VLSIS----EAVPPSRPVE
A0A518HQS9      ---M-E-----------------------SK-----RGSS-VISIA----AATPPSRPVE
A0A5M6DFE6      ---T-E-----------------------SE-----HEGV-VRLLA----DATEPRSPVE
A0A5C6F286      ---T-E-----------------------RR-----QDGA-VRTLA----VARPPKSPIE
A0A517NGN1      ---T-E-----------------------RR-----QDGA-VRSLA----EATPPRAPVE
M5RUI3          ---T-E-----------------------KQ-----QGGS-VQTLA----AATPPRIPLE
A0A660VT66      ---L-T-----------------------AQ-----GGVKPIEVID----EAVVPHRPYY
A0A7C2VEF7      ---V-T-----------------------ED-----TGALNISILE----VARPATGPSR
A0A0S8H0S8      ---L-A-----------------------SD-----VGPMFIRVLE----EASSGDEPTR
A0A7C2ZTD2      ---V-A-----------------------YN-----ADVISIR-----------------
A0A2E3Z6T8      ---F-R-----------------------QN-----QAPIRATVVR----EPIANNNPVT
A0A257WQ92      ---I-E-----------------------RD-----GNGYVMKQIA-----------PVK
A0A7C1U6X6      ---T-QSIALRHKRELFDQVRQVRETKRMES-----GVAGSIKVLT----KASAPSKPSE
A0A7C7UXI5      ---L-G-----------------------EQ-----NGMVRTAVLT----QPEVPTAPVS
A0A7C3SFJ0      ---V-E-----------------------LA-----AA-PRVTVLE----PASVPKTSDI
A0A7C7WWF7      ---L-S-----------------------KN-----GPDVRVSTVG----KTEARMDPVA
A0A356ETW1      ---L-R-----------------------QD-----GHDVRAKVTA----PPVANHRPVS
A0A3L7NJY1      ---L-N-----------------------KD-----TF-IRTKIAS----KPTVPTRPVS
A0A523CME0      ---S-A-----------------------IE-----KKGEEVPSRY----DPLPDDSRQY
A0A354PCV3      ---T-E-----------------------RR------QDGAVRLLA----SATPPRTPVA
A0A354PHB4      ---T-E-----------------------RR------QDGAVRLLT----SATPPKTPVA
A0A356ESF4      ---I-R-----------------------RD-----GQEVRIEVVQ----EPQVASAPAI
A0A538RV31      ---I-N-----------------------LT-----AQDRIARLGS----DPTPDTRRTL
                                                                            

M5S2L2          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A7C2VXA0      ------------------------------------QTDASHAIQTAAAKGAVSQ-----
A0A7C3AA48      -----------LFLGC-GLAV-----LR----SFL-DQRLRSAEEISAVLGVPTL-----
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------STHQLTY-----
A0A2D6A9B6      --------------------------------------------MSEPETNPALT-----
A0A2G6JGH3      ----------------------------------------------MSEEPQEER-----
A0A7C5PFV3      --------------------------------------------MSNKKKGKPER-----
A0A7C3QGD2      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A1V6CUG1      -----------APREA-WRVT-----PA----ADA-APAPAPAPASQDAKAPALQ-----
A0A3M1SE88      -------------------------------------------RFRSIEEMQLQL-----
A0A7C2ZUK5      -----------KAGAP-IKPD-----EN----SFI-PADVTPRSRDAVVERKKVP-----
A0A660WB30      -----------AGVGG-VVLG-----GA----LTL-LAEMTDHTVKRPTDLRRIV-----
A0A660W9Z7      -----------HRPSG-SGAA-----AG----TVV-EPHSLPSTETDMEEFRRTI-----
A0A3M1R9K7      -----------AGLGG-FACP-----VA----LIL-WWDTRGKRINTPAEVVRTT-----
A0A3L7PH51      -----------------MALG-----LG----LIY-VLDALDDRFRSPDELQWQL-----
A0A3N5UQY5      -----------ALLCG-LVLG-----GG----IAA-ARDWIDQTIRSTEEISTIF-----
A0A7C2JY73      KRLLKFVGA--GGLFG-LALA-----GA----LCV-FRELRDTRLNTLAELRPVL-----
A0A356AE44      AEPDIKHVI--KIVGGCLVMT-----LMSTYAFLF-LREMRDTSLKSLADLRAIV-----
A0A1G2XSU7      DRRMQYSLA--ITMGS-LVFG-----LG----LAL-ITNKLDLRLKTPDDITKRI-----
A0A350KD81      KRQLKFLMA--GAGAG-LGLI-----LA----FSY-FREMRDTTMKSVDEIRNQL-----
A0A2D6SRY7      PNTSVNVFL--GALLG-LVLG-----IA----QAF-LLEHIDNSVHSVRELEKAM-----
A0A1G3C300      ASRNSQIMK--GVMIG-LALG-----IG----LAF-FLDYLDNTVKSTEDVENYL-----
A0A524HC32      PNVKLTLLF--AIVVG-LLGG-----LG----CAF-LAEYIADTITDPEEINDRY-----
A0A177PV03      PVPAKIFIV--AMMLG-LLLG-----AG----LAF-VAEAMDQNFHTLEEIRERL-----
A0A1G2YIM0      DKRPKYVVA--NIFGS-GFLA-----IL----IAL-VFDKLDRRVHTTEDITRRL-----
A0A1G2ZG92      PRRYLNFAI--ALFLS-VFWG-----LV----LSL-FVEYIDNTIKTPEDIKHIK-----
A0A1G3A0W0      DRRMVFMAM--ALILG-VGAG-----GG----MGL-LRANRRQTVYVPDDMPYAM-----
A0A353BE27      PKVIKYLVG--GAAVG-FILL-----SG----LAV-LMDLADRSYKNPSEISTDL-----
A0A5C6BPW1      ESLYKKSAM--AGLGV-FGLF-----VA----AIV-WFEFQAKRIDTLGDVTGGL-----
A0A1I3GSP0      KRVIKLVGT--CGVMG-IAII-----FC----LAY-FREWYDTSLKTLDDVTTFT-----
A0A517QJV1      KRVIKIVGM--FGFLG-IGLV-----FI----LSY-FREWMDTRIKNVDELCKLS-----
A0A3C1QS25      PSLLKVFAV--AGFLG-LLGG-----VG----IAY-LVDLADKTFRSPDDIAQSL-----
A0A5C6FX55      PILWKLVGI--GGFLG-LALG-----AG----MAF-LLEKNANTFRDPDEIAASL-----
A0A5C6DS51      PKLPIVVVL--GAMLG-MFLG-----SS----SAL-AAELLDTTFRDVEDLEKTL-----
A0A5C6DSL6      PSLPIAIVV--GAMLG-LFLG-----SA----SAL-TSEILDTTFRDVEDLERAL-----
A0A3M1VG27      KRPLKFLGA--GLFGS-LVAV-----TA----MIY-LREVRSRSLRSLEELRNAL-----
A0A518GC22      PTLPKYLLG--GAAVG-FVLL-----SG----LAV-LMDLADRSYRNPSEIATDL-----
A0A3L7Q373      KQTIKIVGA--FGVMG-LLAV-----FG----MAY-FREWYDTTLKSIEEVRSIV-----
A0A3E0PW54      KRIIKIVGA--MGCLG-VAVV-----FG----LSY-LKEWTDMTLRTADELKALV-----
A0A7C3TAH2      DKRPKYAAA--MAFAA-LGAG-----CF----LAF-LRDKADKRFRSPAEITKVL-----
A0A1Z8MHR4      PELTRYLLI--YGLFG-LGIS-----GL----LAM-TFEASAKMFRSAEEVHSDL-----
A0A5C6EHJ0      PSLAKSLIL--GGFLG-SMLA-----FG----LAV-LRELSDRSYHSARDIAEHT-----
A0A5C6F1H9      PSMPKSLIL--GGLLG-GMLA-----FG----LAL-LREMSDRSYHSARDIAEHT-----
A0A255QXY0      PDQKKDLLA--GGMIG-FILG-----GI----LSI-LIEFWSMTFRSADEVQRAL-----
A0A517SYI0      PELTRYLLI--YGLFG-LGIS-----GL----LAM-TFEASAKMFRSAEEVHSDL-----
A0A518HX54      PDLRKDVAV--FTMLG-LGLS-----GL----LAL-LLEAGAKTFRSAEAIQHEL-----
A0A5B9MF59      PDLRKDLIL--YGMLG-LALS-----GL----LAM-VFESTAKMFRSAEEVQREL-----
A0A2A2WC24      PDLKKDLVL--FGMLG-LGLS-----GL----LAM-IFESTAKMFRSAEEVQREL-----
A0A518KYW8      PDLKKDLVL--FGMLG-LGLS-----GL----LAM-IFESTAKMFRSAEEIQREL-----
A0A5C5YZZ0      PILSRALVL--GGFLG-LVLG-----AA----LAF-LWDWSERTFRSPDEISTSL-----
A0A518JLD2      PVMLKSLVM--GGFLG-TVLA-----FG----LAF-LREISDRSYRSPQEVSEHT-----
A0A5M6DJ15      KKRVLASGV--MGFAG-LCLP-----LL----GFI-GLDVRSKLVNDSESVSREA-----
A0A3L7P7S7      SRKSLIVVA--GGIFG-VAIG-----GG----LAW-LMERADRTFRSPDDIRKRL-----
A0A517N8M1      PSLLKTVGG--GSILG-ILLG-----CG----LAL-LLEKNANTFRDPDEIADIL-----
A0A5C6CW01      PNLTRTLAM--GTFIG-LVIG-----AG----LAL-LLEMNANTFRDPEEISALL-----
A0A5C6BXS9      PNMAKMLSV--GALLG-VAVG-----MG----LAL-LLEKNANTFRDPDEVIAAV-----
M5U569          PNMAKMLSF--GTFIG-LAAG-----CG----LAL-LLEKNANTFRDPDEIAEAV-----
L7CND7          PNLVKMLGI--GTFLG-LALG-----CG----LAL-LLEKNANTFRDPEEIIAAV-----
A0A0J1B8S4      PSIIKTLGI--GTIAG-LIIG-----CG----LAL-LLEKNANTFRDPEEIVAAV-----
F2ARR3          PNMLLMLGI--GLGVG-LLLG-----CG----LAL-LLEKNANTFRDPEEIVTAV-----
K5D8H6          PNMLLMLGI--GLGAG-LLLG-----CG----LAL-LLEKNANTFRDPEEIVTAV-----
M2AKU0          PNMLLMLGI--GLGAG-LLLG-----CG----LAL-LLEKNANTFRDPEEIVTAV-----
A0A5B1CKI2      PSILKTVGL--GSLLG-IMLG-----SG----LAL-LLEKNANTFRDPDEISEEL-----
A0A5C6EG84      PSLIKTVGA--GSILG-ILLG-----CG----LAI-LLEKNANTFRDPDEIADIL-----
A0A5C6F2X4      PSLIKTVGA--GSILG-ILLG-----CG----LAI-LLEKNANTFRDPDEIADIL-----
A0A5C5XTV6      PNMAKMLTI--GTLLG-IAAG-----LG----LAL-LLEKNANTFREPDEVVAAV-----
A0A5C6AAB1      PNMVKMLGI--GTFLG-LALG-----CG----LAL-LLEKNANTFRDPEEIATAV-----
M5T8W8          PSMAKMLGI--GTFLG-IALG-----CG----LAL-LLEKNANTFRDPDEIAEAI-----
M5SF00          PNLVKMLGI--GTFLG-LALG-----CG----LAL-LLEKNANTFRDPEEIIAAV-----
A0A2G1WDS1      PNLVKMLGI--GTFLG-LALG-----CG----LAV-LLEKNANTFRDPEEIIAAV-----
Q7UVS9          PNLMKMLGI--GTFLG-LALG-----CG----LAV-LLEKNANTFRDPEEIIAAV-----
A0A5C6B601      PDLKKDLIL--FGMLG-LGLS-----GL----MAM-LFEAGAKMFRSAEEIQKEL-----
A0A517PFU1      APLIRALAA--GGALG-LAVA-----FG----LSY-LLEQSDRRFTGPAELRAEF-----
A0A5B9M8J9      PDLKKDLAV--FAMLG-LGLS-----GL----LAL-LFETTAKTFRSADAIEREL-----
A0A2A2WFP6      PDLKKDLAV--FTMLG-LGLS-----GL----LAL-LFEAGAKTFRSAEAIQQEL-----
A0A518L8N2      PDLKKDLAV--FAMLG-LGLS-----GL----LAL-LFEAGAKTFRSAEAIQHEL-----
A0A518HQN9      PDLKKDLVL--FGMLG-LGLS-----GL----LAM-IFESTAKMFRSAEEIQREL-----
A0A5M6D8H8      PDLKRDLIL--YGMLG-LGAS-----GL----LAL-LFEASAKMFRSAEEIQREL-----
A0A5B1CRW9      PRLPIVLAL--GLMGG-LAMG-----SL----LVL-AAETFDSTFSSVEELERAT-----
A0A5C6EI46      PKLPIVLAV--GVGAG-LALG-----LL----LTL-AAETFDSTFGSVTDLESTT-----
A0A2E7D3V4      QLVFKRKLK--FWFMG-LAMA-----MSAVGAVIY-WREWRDTTLKTFDDVRQSM-----
A0A5B9PER9      PNLPMLLGL--GGLLG-SLFG-----FG----LGC-LVELADKTFHNPSEIIRQL-----
A0A517QSM4      SKKYKMAGM--AGLAA-LGLI-----AG----GII-FLDYRRRRVSTAEEITENL-----
A0A355GJI7      KRQLKFLMA--GAAGG-LGLI-----LA----FSY-FREMRDTTMKSVDEIRNQL-----
A0A1Z8MCI4      NSNTKRQLL--AYPLV-FAAL-----FG----LGL-TVEVFSQRFXRARNVTEIT-----
A0A517SYL7      NSNTKRQLL--AYPLV-FAAL-----FG----LGL-TVEVFSQRFSRARNVTEIT-----
A0A3L7P0L2      KRVMKIVGA--CGILG-LLSV-----FC----LAY-FREWYDTTLKTVEETRTVI-----
A0A6M5YVJ1      SRRKKFAVA--AVLGV-LFVG-----FA----GVV-LWEQRTARVTHPDDVTVAL-----
A0A2E0SHG0      TSLLLGILP--GAFFG-FIFG-----GL----MAA-VIDLADSTFRSPEQIRETL-----
A0A518CQB8      VSILYGIIP--GGFVG-MMFG-----LL----LAF-VIDLADSTFRSPEQIRNTL-----
A0A517SCC8      KRFLKIVGA--CTLAG-IAAV-----FG----LAY-FREWYDTSLRSLDEVSETA-----
A0A3A0DR44      AWPYKPLIL--FCGAA-FVLP-----FF----VVV-GWEKLSRRIADADQLSSES-----
A0A358MY60      PLPFKNMIL--AGLLG-LAAP-----FS----LGL-LLELRAKRVSDAETLTAGN-----
A0A517MNB1      PVPVKKMVV--AGGAA-FMIP-----FL----LGL-LLEFRSQRICDASGFDGQS-----
A0A7C1EH96      GKKKKLVAA--APFGG-LAAG-----MA----LAF-LLAKLDRRVHTPDDVARRV-----
A0A142YJ13      MKRYKLSGA--AGAGA-LVAF-----LG-----CLSLLEFRSRKVDMPDEVSDRL-----
A0A517Z7D3      TRPIKIVGM--FSMMG-VMAV-----FV----LLY-YREWSDISIRTLADVRSLV-----
A0A1N6KY57      TRKFKLAGV--AGCGA-FALA-----L-----LGISFWESSARRVDSASDVVQCL-----
L0DK20          ARQLKMAGV--AGCGA-FALA-----L-----IGVSFWEFQSRRIDSAADVIKSL-----
A0A3L7UX05      DKRWRFMAM--APLGM-FLAV-----AS----LCV-LVEVRSGRVSNPDDLTNRS-----
A0A517XRC2      KQKVMLSGA--VGVAG-FLGV-----LA----LIA-LLEWRNRRVDGVDQVVTEL-----
A0A6M5YH47      NRKLLMSSV--GGLGA-FFGV-----VF----LVS-FLEWRTRRVDGVDQVVNEL-----
A0A660UUK3      SKRKKLALA--TPFGG-IALG-----VF----LAF-LLAKADKRLRGAQDVVKRV-----
A0A517ZHG5      ESLYKKSAM--AGLGV-FGLF-----VA----AIV-WFEFQAKRIDTLGDVTGGL-----
A0A1Z8MPL5      SKRDQLTLV--ASFGA-LLLG-----IG----APT-LLDVIRRKVSSVNQMSEGL-----
A0A5C1AGE3      RQKMLYSGM--IGVAM-FLVV-----LT----LVA-FLEWRTRRVDGVDQVVNEI-----
A0A2Z3HEL7      NKKLAMSSV--GGLGA-FLTV-----VL----LIS-FLEWRTRRVDGVDQVVTEL-----
A0A142XAP8      NKKIVLSSA--GGAVS-FFGV-----IL----LVS-FLEWRSRRVDGVDQVVNEL-----
A0A6P2DEK1      NKKIVMSSA--GGFVS-FFGV-----IL----LVS-FLEWRSRRVDGVDQVVNEL-----
A0A5C6C1R5      KKRYVGTAG--LGFIG-FCLP-----F-----LGFIGLDLTKKRVNSVSGVGREL-----
A6BZU4          KRQLKFLMA--GAGAG-LGLI-----LA----FSY-FREMRDTTMKSVDEIRNQL-----
A0A2D5GZ77      KRQLKFLMA--GAGAG-LGLI-----LA----FSY-FREMRDTTMKSVDEIRNQL-----
A0A3D3R1Z6      KRQLKFLMA--GAGAG-LGLI-----LA----FSY-FREMRDTTMKSVDEIRNQL-----
A0A517XG00      KRQLKFLMA--GAGAG-LGLI-----LA----FSY-FREMRDTTMKSVDEIRNQL-----
A0A1G2YRE4      DKRAKYSAA--LLFGA-LFCG-----MG----LAF-LKDKTDQRLRTPDDITKRI-----
A0A353Z859      AKKIMATTA--VGGGL-FGLI-----F-----LGILFLDLRTRRINSLDDIVTGL-----
A0A2D6ST10      KKKITGAAA--AGFGV-FGLF-----VA----AIV-FLEYRSHRISRLEEVVDGL-----
A0A177QX42      PSMVQSLGF--GGIGG-LLAA-----IA----IAL-LLETADKSFRNPDEISRQL-----
A0A517SHR0      PSMPQALGF--GGFGG-LLAA-----IA----IAL-LLETADKSFRNPDEISRQL-----
A0A2E0AW64      IAPWKNMLM--GGGIA-LLIP-----FG----LAV-LWELRVGRITDSKQIEKQS-----
A0A351FZ59      IAPWKNMLM--GGGIA-LLIP-----FG----LAV-LWELRVGRITDSKQIEKQS-----
A0A660V239      GKRRKLAAA--LGFGG-LALG-----AL----LAL-LLDKADKSLHDPKDVVRRV-----
A0A177Q3B7      RFRAKALLG--AAFGA-LLLA-----IG----LMT-WREYSFRRVELAEEITQHL-----
A0A2E0X6Y6      PRLKMVVVG--ALAGG-LFLG-----SL----IIY-VQDVLDDRFGSPEEMAAQL-----
A0A518GFD7      KKRFAVAGA--GGGLG-LLLP-----LV----LLV-GWDLTRRKVDNLEGVSHSL-----
A0A5C5VZJ8      DKRVKLSAA--ALFGA-LIAG-----LG----AGF-VRLRFSATVTSMRDVSRPL-----
A0A518GE37      EIPFKKVIM--AGGAA-FLLP-----FA----LAL-LLEFRMKRLTHVGGIEAQN-----
A0A5C6F3H8      TVPYKKLAM--ASSVA-FMVP-----FL----IGL-IFEYRVQRVTDASSFTRSG-----
A0A5C5X072      SKPYKKLVM--ASAGA-FVIP-----FL----LGL-LWEFKVQRLTDAESHDKTG-----
A0A5C5WUQ3      TIPVKQLGL--ASTVA-FVAP-----FL----LGL-LLELRIQRVTDGNAVQKHF-----
A0A5C6E697      PIPLKKMAV--FGLGA-MMIP-----FL----FGL-LWEVRVHRVTHSTAVGH-------
A0A5C5Z1A3      EIPVKKMAV--AGLAA-MMIP-----FL----IGL-LWELRVQRVTDSSMCDG-------
A0A5C6D2P7      SLPVKQMAV--FGGGA-LMIP-----FL----LGL-LWELRVRRVTDSSMCTS-------
A0A5B9ML17      DIPVKKLLV--ASGGA-FAIP-----LL----LGL-LWEFKTNRVTDTHVLDSSQ-----
A0A517LX75      PNPLVVLSL--GSFAG-LLLG-----SC----GAL-WADYSDQTFRDPGDLERSL-----
A0A7C5W7B3      SLVYVLALL--VGLFA-GAAV-----MY--------FMENMDTTIHSVENAETIA-----
A0A2S8F9B8      KRPLMITAA--AAFAG-FMLP-----AG----LLL-LRDFSKKHLSDLPTTRDEL-----
A0A354GX32      DKRIKAAGG--AFLGL-FGLV-----F-----LGVVATEFRTRRVYKSEDVSQGL-----
A0A142XL75      NRRLKYTVL--AALAV-FGIG-----FA----GTI-GLETRARRVTDTDDVTKAL-----
A0A6P2D5D5      NRRLKFTVL--AALAV-FGLG-----LA----GAI-GWETRARRVIDTDDVTKAL-----
A0A5C1AAF0      ARKMQFAGF--AGAAA-LGFV-----CL----VVS-LFEFRNQRVDSIASVGLAT-----
A0A7C7T8W8      SSPIKTMTA--ASSCA-FVVP-----FL----LAL-VFELRARHLSFADQVATET-----
A0A5C6B3S0      MTRYSMAGL--AGVVG-MAFP-----L-----FGIIFWDTRKKCINSPEEISGQM-----
A0A368KP63      KRPIMITAA--AALAG-LVLP-----GG----LLV-LRDFQKKRLSDLPTTRDEL-----
A0A518GIZ9      EWVLKRLLK--IVGAG-MVAG-----MGLIISLIV-LKEFLSNQVRTVREVRQLL-----
A0A1C3EBY9      EWVLKRLLK--IVGAG-MVAG-----MGLIISLIV-LKEFLSNQVRTVREVRQLL-----
D5SX64          EWVLKRLLK--IVGAG-MVAG-----MGLIISLIA-LKEFLSNQVRTVREVRQLL-----
A0A517Z0U7      GKREKMAGV--AGFGV-FGLL-----VA----AIV-WLEMAAKRINSVDELEAAS-----
A0A2S8FCC0      PRSYAMVGV--AGVFG-FMLP-----VA-----GFVFWDLRSQRINVPSDVSDNL-----
A0A1Z8MBT6      EVPTKKLAM--VALAG-FCVP-----FG----LGL-LWELHTKRITDSHHIE-AL-----
A0A517SXN9      EVPTKKLAM--VALAG-FCVP-----FG----LGL-LWELHTKRITDSHHIE-AL-----
A0A518HFL0      NKRDKYLAV--TPLAM-LGLV-----LG----LVT-LVELRSGRVSGAEDLTGRL-----
A0A5Q3LBQ3      ALPVKKLGI--AMLGS-LGLP-----LL----ICV-FWERTVRRVSEAKQLGQDL-----
A0A3B8ZJM2      PFSSTYTAA--GALAG-ILLM-----SF----VAL-LMDMADRSYRSPDEIVSDL-----
A0A1U7CLW1      PLRRCKLST--IVGAG-VFLA-----FV----GCVSLWEFQSRKIDVPDEVAFRL-----
A0A142WPR7      PVMARYLAL--GAVAG-IAVG-----YL----LAY-LLELNDRSFRDPEEVQTSL-----
A0A3M1TFJ0      PNHVRNVLV----GAL-LGLF-----AGVLAALGLDRFSDRVRSLAEAQRLGP-------
A0A517P477      GKRIKTAVL--VGGGG-VGFG-----MALAAGLGF-LFTSVQRTQDLKGNLAI-------
A0A517T4K9      GRKLKLASV--AGFGM-FGLI-----FI----GVI-WIESLTRRVCSLNTVVDEL-----
A0A7C6B2Q1      DKRIQLATL--AGFAG-FVLP-----GV----VLL-WWDVRRKPVNTPQDVLRVA-----
A0A7C4QPD3      RKRLLATVG--GAGAG-LTLV-----LL----VVV-ALEMHACRISDLAAVRGRI-----
A0A2Z3GZZ5      PVLLRSLLL--GLGIG-ALLG-----CG----LMV-LAETRDKSFRSPAEIRRRL-----
A0A4V0I6L6      PVLLQSLML--GAVLG-LLLG-----GG----LAL-RAELVDRGFRSPEDVRRRL-----
A0A7C4QQT3      ALSLKRLLK--FWGAG-GMLG-----ALLVAGLCV-VRELRDSRLKDVKALRLCL-----
A0A255QXF5      DMPFKKMLA--AGGAG-FFVP-----FL----LGL-LWEFRVKRITDSHELERSQ-----
A0A518KBI5      AAPWKKLVL--ACGLA-MAAP-----FG----LAV-LREASLRRVSDAEQLFEDT-----
A0A5C5V6Q5      SAPWKKIFL--ACGVG-MLAP-----FG----LVL-LREVTLRRVADAEQLYEDT-----
A0A517MY49      PRLKNVVLG--SIFAG-FALG-----CL----VVY-VQDVLDDRFSSPEELTAQL-----
A0A2E6AG00      PRLANVFVX--SLLGG-TLIG-----IG----LVY-VIDALDDHVRSPDELKDQL-----
A0A1G3A880      PRLMTVALL--VLVIG-LLGG-----GI----SVY-VLDILDDRFRSADELRLRL-----
A0A2E8ATT1      PRLAFVGVL--CLTFG-LGGG-----TG----LIY-VLDLLDDRFRSPEELQEQL-----
A0A7C2JZW2      KKRYLATIA--GAGGG-VGLV-----AA----LLL-LLELSIQRIFESSQIRTRT-----
A0A518KYQ0      AVPFKKMIM--AGGAG-FAIP-----FL----IGL-AWEFRTKRITDSLDLEKSH-----
A0A5B9QX47      KIPYKKMFM--ASAGA-MALP-----FL----LGL-LWEFRVRRISDGSTLSKMT-----
M5T666          AMPYKKLGM--ASAVA-FMVP-----FL----FGL-LWELKVQRLTDAETHDKTG-----
M5U6N6          KMPYKKLLM--ASAIA-FAVP-----FF----LGL-LWEYKIQRLTDAETHDKNH-----
A0A517M0G2      PMPTKKMIV--AAGGA-FAIP-----FF----LGL-LWELRSQKICDSAKLE-SK-----
A0A5C6AST1      PMPTKNMAV--AGAGA-FAIP-----FL----LGL-LWEFRSQRICDAAALG-SK-----
A0A5C6C951      PMPTKNMVV--VAAGA-FAIP-----FL----LGL-LWEFRTQRISDATTLE-SK-----
A0A5C6C5T3      AVPYKKLAL--ASAGA-FVIP-----FL----IGL-LWEFKVQRLTDAETHDKTG-----
A0A2A2W6A9      AVPVKKMLM--AGGGA-FAIP-----FL----IGL-FWEFMTKRITDSKDLERSL-----
A0A518HQS9      AVPFKKMVM--AGGGA-FAIP-----FL----IGL-LWEFRTKRITDSLDLEKSH-----
A0A5M6DFE6      NVPVKKMAM--AGGAC-FLIP-----FV----FGL-LWEMRTNRVTDIQVLEKTG-----
A0A5C6F286      TAPYKKLAM--VSSVA-FLIP-----FL----IGL-AFEYRVQRVTDASSFSKAG-----
A0A517NGN1      SIPTKKILM--ASGAC-FAIP-----FL----VGL-LWEMRTQRITDANAVDRCA-----
M5RUI3          SVPTKKLIA--VSGGA-FCIP-----FL----LGL-LWELRVQRVTDSAAVDRSQ-----
A0A660VT66      PKVKLNLAA--GLLLG-LVLA-----VL----ASL-LMEYFDDSIRSSDEALDCLREVTG
A0A7C2VEF7      PQKTRIMAI--ALILG-LMFG-----GA----LAL-VRDWMDIRLRSADEVSAIL-----
A0A0S8H0S8      PNRPHAAAM--ALGLG-LILG-----VM----LAL-LAARLDHRIHSAADVPAVL-----
A0A7C2ZTD2      -DKRIKYTM--ALIFGAMALG-----ML----SAF-LRDKADLSLHTPDDVVKHI-----
A0A2E3Z6T8      PQIRLIAAV--CLLGG-TCVG-----VV----MAY-AQDVLADRFNSPEELTLQL-----
A0A257WQ92      EELSMKRIL--KFVGG-GGVAGMFLIAG----ICL-LRELRDLRIMSVGELRRAT-----
A0A7C1U6X6      DRRVVFTAM--ALFMG-LGMG-----GG----VAF-LRASRNQTIYAPKDMPPTL-----
A0A7C7UXI5      PRLVVVAFL--AVTLG-LAVG-----LA----VVY-VQDLLDDRFRSPEELQLQL-----
A0A7C3SFJ0      KRKYRMMWF--LSAAA-FGVA-----VL----GVA-GVDFLSRRVNSSAEVAYGL-----
A0A7C7WWF7      PKLSLVVVL--AALGG-LSFG-----LG----VIY-VLDLMDDRFRSPEDLKDQL-----
A0A356ETW1      PRLAFVALV--AIVSG-LGIG-----FA----AVY-VLDVLDDRFRDIDDMQQQL-----
A0A3L7NJY1      PRLAIVGIL--SLMVG-TAGG-----LL----IIW-VLDILDDRFRTPEELKLQL-----
A0A523CME0      ALSQDAVSI-----------------------------------IQQTEASELMM-----
A0A354PCV3      EFPLKKMAM--AGGAA-MAVP-----FF----FAL-LWEL---RVRRVTDSSMSG-----
A0A354PHB4      ELPLKKMGL--VGGAA-MAVP-----FF----LGL-LWEL---RVRRVTDSSMCG-----
A0A356ESF4      PDRRRVALL--ALAAG-LALG-----LL----AVH-VLDTLDDRFRGIDDLQNQL-----
A0A538RV31      DEKKQAIIAGGAGAAA-MALV-----FL----VIA-YWEFLARRIITGDDVVYGL-----
                                                                            

M5S2L2          ------------------------------------------------------------
A0A2Z3GYP4      ----------MADAAGN-------------------------------------------
A0A7C2VXA0      -SL-SSAARRNWPRSAD-------------------------------------------
A0A7C3AA48      -GV-VPTMSRKL------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      -DL-GIHVVGSLPLVHK-------------------------------------------
A0A2D6A9B6      -DG---------VLVIV-------------------------------------------
A0A2G6JGH3      -AN-DEERGDATPFVLV-------------------------------------------
A0A7C5PFV3      -GG-EFELDGEETFVLL-------------------------------------------
A0A7C3QGD2      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A1V6CUG1      -AP-PIIQSVGAAKVIG--------------------------------H----------
A0A3M1SE88      -RT-PVMAVIRRMKPRE--------------------------------FLGPKSL----
A0A7C2ZUK5      -GG-TKTSPSPAPTVNT-------------------------------------------
A0A660WB30      -DR-PVLAAIPSLDIGR--------------------------------FHTPENLFFRT
A0A660W9Z7      ---------------RR-------------------------------------------
A0A3M1R9K7      -GL-DLLGTVPLVPAKA-------------------------------------------
A0A3L7PH51      -GL-PMLAMIRKMEPME-------------------------------------------
A0A3N5UQY5      -RL-PVLGGGPAMSRRK-------------------------------------------
A0A7C2JY73      -TQ-PLLGTIVKFATAA-------------------------------------------
A0A356AE44      -DT-PILGTLPSIANPA-------------------------------------------
A0A1G2XSU7      -GV-RIIGTTTSRDKIK-------------------------------------------
A0A350KD81      -HL-PILGEVPSFAESD-------------------------------------------
A0A2D6SRY7      -GL-PTFGLIPQIPEKP-------------------------------------GSGPS-
A0A1G3C300      -GV-TLLGLVERAKQSK-------------------------------------ENKDA-
A0A524HC32      -RI-PILGMIPQIKTDN-------------------------------------SGIES-
A0A177PV03      -GL-AVVGHIPIVEPVG-------------------------------------HVPGT-
A0A1G2YIM0      -GL-RIIGTTVSSENID-------------------------------------KALLP-
A0A1G2ZG92      -SL-NFLGIIPNTKLLK-------------------------------------DMSII-
A0A1G3A0W0      -QV-PFLGYVPVLPVRR-------------------------------------FPQKP-
A0A353BE27      -GV-SVLGHIPVMN----------------------------------------------
A0A5C6BPW1      -NL-RIMGALPQMPRWA-------------------------------------SQKSS-
A0A1I3GSP0      -HE-PLMGSVPTFSSST-------------------------------------DLDRI-
A0A517QJV1      -ET-TLLGSIPKFATTP-------------------------------------DSERL-
A0A3C1QS25      -AL-PILGHIPFI--------------------------------------------PK-
A0A5C6FX55      -GT-SVLTHVPFF--KK-------------------------------------RVTKRG
A0A5C6DS51      -AA-PAIAHVPRF------------------------------------------DLRK-
A0A5C6DSL6      -NA-PAIAHVPKF------------------------------------------DFRK-
A0A3M1VG27      -AV-PVLGGIPEF---------------------------------------------T-
A0A518GC22      -GV-TVLGHIPVM---------------------------------------------N-
A0A3L7Q373      -KA-PLMGAIPRFRLSG-------------------------------------ALKRG-
A0A3E0PW54      -PV-SVLGEVPEY--------------------------------------------SP-
A0A7C3TAH2      -RI-PVIGTVT-------------------------------------------------
A0A1Z8MHR4      -RL-PVLSHIPLD--DS-------------------------------------MVQSA-
A0A5C6EHJ0      -RL-PIIGHVPV-------------------------------------------LKPH-
A0A5C6F1H9      -RL-PIIGHVPV-------------------------------------------LKPH-
A0A255QXY0      -RA-PVLTHIPVD--SS-------------------------------------RVKAH-
A0A517SYI0      -RL-PVLSHIPLD--DS-------------------------------------MVQSA-
A0A518HX54      -QA-PVLTHIPFD--AG-------------------------------------RSHKR-
A0A5B9MF59      -RL-PVLTHIPLD--EG-------------------------------------RIQQG-
A0A2A2WC24      -RL-PVLTHIPLD--EG-------------------------------------RIQQG-
A0A518KYW8      -RL-PVLTHIPLD--EG-------------------------------------RIQQG-
A0A5C5YZZ0      -GL-PILAHLPVMLTPR-------------------------------------KLRKK-
A0A518JLD2      -GL-PVIGHIPVL--K-----------------------------------------RW-
A0A5M6DJ15      -GL-PILGSVPRE--RQ-------------------------------------ISAQF-
A0A3L7P7S7      -GI-PVLGHLPLF--P------------------------------------------P-
A0A517N8M1      -GV-PVLTHIPFF--KG-------------------------------------KLKKV-
A0A5C6CW01      -AV-PVLTHVPFF--KG-------------------------------------RIRKP-
A0A5C6BXS9      -GA-PVLTHVPFF--KG-------------------------------------KVRKG-
M5U569          -GA-PILTHVPFF--KG-------------------------------------RVRKA-
L7CND7          -GA-PILTHVPFF--KG-------------------------------------RVKRK-
A0A0J1B8S4      -GA-PILTHVPFF--KG-------------------------------------RVRRA-
F2ARR3          -GA-PILTHVPFF--KG-------------------------------------RVRHK-
K5D8H6          -GA-PILTHVPFF--KG-------------------------------------RVRHK-
M2AKU0          -GA-PILTHVPFF--KG-------------------------------------RVRHK-
A0A5B1CKI2      -GV-PVLTHIPFF--KG-------------------------------------KLKKL-
A0A5C6EG84      -GV-PVLTHIPFF--KG-------------------------------------KVKKS-
A0A5C6F2X4      -GV-PVLTHIPFF--KG-------------------------------------KVKKS-
A0A5C5XTV6      -GA-PILTHVPFF--KG-------------------------------------KVRKS-
A0A5C6AAB1      -GA-PILTHVPFF--KG-------------------------------------KVRKG-
M5T8W8          -GV-PILTHIPFF--KG-------------------------------------RVRKS-
M5SF00          -GA-PILTHVPFF--KG-------------------------------------RVKRK-
A0A2G1WDS1      -GA-PILTHVPFF--KG-------------------------------------RVKRK-
Q7UVS9          -GA-PILTHVPFF--KG-------------------------------------RVKRK-
A0A5C6B601      -RL-PVLSHIPLD--ES-------------------------------------RVQQG-
A0A517PFU1      -GL-PLLGHVPEI--PP-------------------------------------RTLKE-
A0A5B9M8J9      -QS-PVLTHIPVD--AA-------------------------------------RAPKR-
A0A2A2WFP6      -QA-PVLTHIPFD--GG-------------------------------------RRQNR-
A0A518L8N2      -QA-PVLTHIPVD--GG-------------------------------------RSPKR-
A0A518HQN9      -RL-PVLTHIPLD--EG-------------------------------------RIQQG-
A0A5M6D8H8      -RL-PVLTHIPLD--EG-------------------------------------PVRPA-
A0A5B1CRW9      -GA-AVIAHVPRM--PV-------------------------------------RELRK-
A0A5C6EI46      -KA-AVIAHVPRL--NL-------------------------------------RTLRK-
A0A2E7D3V4      -QF-PVLGGVPEFAAIS-------------------------------------LMDQM-
A0A5B9PER9      -NV-PLIGHVPVIGQSK-------------------------------------RYLVE-
A0A517QSM4      -RI-RILGVIPILPRTI-------------------------------------IKAVD-
A0A355GJI7      -HL-PILGEVPCFADSD-------------------------------------AAVDE-
A0A1Z8MCI4      -QL-SLLGELAKFPRWG-------------------------------------SKSGR-
A0A517SYL7      -QL-SLLGELAKFPRWG-------------------------------------SRSGR-
A0A3L7P0L2      -GA-AVMGAIPHFRGGA-------------------------------------VSDRL-
A0A6M5YVJ1      -GV-RLIGAVPPAGPAQ-------------------------------------DGTHA-
A0A2E0SHG0      -RS-PVLAHIPRLNVRR-------------------------------------ITKLA-
A0A518CQB8      -NT-AVLAHVPRLNVRR-------------------------------------LTKLA-
A0A517SCC8      -GT-QLLGAVPTFKTTP-------------------------------------EAERA-
A0A3A0DR44      -TL-SIIGEIAQLPTRP-------------------------------------VLSGG-
A0A358MY60      -LA-P-FGEVAKLPSKV-------------------------------------GQGKR-
A0A517MNB1      -LA-PVIGEVARLPSRA-------------------------------------GSSKR-
A0A7C1EH96      -GV-RIIGTTTGPEHVS-------------------------------------RKLLG-
A0A142YJ13      -GL-RIIGDLPRLDHAR-------------------------------------LDDPS-
A0A517Z7D3      -QS-PIFGAVPSFRPQL-------------------------------------FRVPD-
A0A1N6KY57      -GM-DLFGTLPILPRRR-------------------------------------LMLGS-
L0DK20          -GM-NLFGTLPAIPKRS-------------------------------------RGMKL-
A0A3L7UX05      -RL-EVLGVVPPLPNPR-------------------------------------SARKL-
A0A517XRC2      -GM-RVIGTVPAFPNRA-------------------------------------SLKAA-
A0A6M5YH47      -GM-RVIGTVPAFPNRA-------------------------------------NLKAA-
A0A660UUK3      -GV-RIIGTTTSSRHID-------------------------------------RSMIT-
A0A517ZHG5      -NL-RIMGALPQMPRWA-------------------------------------SQKSS-
A0A1Z8MPL5      -GI-RVLGNLPLLDKPK-------------------------------------RRLGF-
A0A5C1AGE3      -GM-RVIGTIPAFPSRQ-------------------------------------SIKTG-
A0A2Z3HEL7      -GM-RVIGTVPVFPNRA-------------------------------------SLQAA-
A0A142XAP8      -GM-RVIGTVPAFPNRA-------------------------------------SLQAA-
A0A6P2DEK1      -GM-RVIGTVPAFPNRA-------------------------------------SLQAA-
A0A5C6C1R5      -SV-PILGSVPRHRKIH-------------------------------------EVLTN-
A6BZU4          -HL-PILGEVPSFAESD-------------------------------------AVVDD-
A0A2D5GZ77      -HL-PILGEVPSFAESD-------------------------------------AVVDD-
A0A3D3R1Z6      -HL-PILGEVPSFAESD-------------------------------------AVVDD-
A0A517XG00      -HL-PILGEVPSFAESD-------------------------------------AVVDD-
A0A1G2YRE4      -HI-PVIGTTTSLHNIK-------------------------------------PALIP-
A0A353Z859      -RL-PVIGSVPLIPSSR-------------------------------------GGKNS-
A0A2D6ST10      -GM-RIVGNIPTMPRAS-------------------------------------SRRPT-
A0A177QX42      -RL-PVIGHIPELAADR-------------------------------------DWKMV-
A0A517SHR0      -RL-PVIGHIPELAADR-------------------------------------DWKIV-
A0A2E0AW64      -QL-PVLAEIARFPSHA-------------------------------------DGQRH-
A0A351FZ59      -QL-PVLAEIARFPSHA-------------------------------------DGQRH-
A0A660V239      -GV-RIIGTTTSPKNVD-------------------------------------KLLLG-
A0A177Q3B7      ----PVVACLPRLEASA-------------------------------------TLAAG-
A0A2E0X6Y6      -GV-GVLTVVGNLKTLV-------------------------------------GEGFD-
A0A518GFD7      -SL-STFGTVPMVDRDP-------------------------------------LVSPG-
A0A5C5VZJ8      -QQ-TLIGSVPLRRGVS-------------------------------------AEVLT-
A0A518GE37      -LA-PVLGEIARIPGGA-------------------------------------RSTQG-
A0A5C6F3H8      -DMVPIMGEVARLPSGS-------------------------------------RSQKG-
A0A5C5X072      -LLAPVVGEVSRLPAGS-------------------------------------GSRKA-
A0A5C5WUQ3      -GMAPVVGEIARLPAGT-------------------------------------HGGRA-
A0A5C6E697      ---LDVMGEVAKLPTGN-------------------------------------KNSKA-
A0A5C5Z1A3      ---LIVVGEVAKLPAGP-------------------------------------RSSRG-
A0A5C6D2P7      ---LAVVGEVSRLPSGP-------------------------------------QSSRS-
A0A5B9ML17      -AIAPVIGELARSPSTT-------------------------------------ASRGS-
A0A517LX75      -GA-SVLAHVPRFQITR---------------------------------------KEK-
A0A7C5W7B3      -AA-RVLGEIPFFSADP-------------------------------------FIFPE-
A0A2S8F9B8      -GL-EILGTIPKLPRGI-------------------------------------VRKPK-
A0A354GX32      -GL-PLMGTVPALSAKV-------------------------------------RATAP-
A0A142XL75      -GV-RLLGTVPAAGQES-------------------------------------GKPGA-
A0A6P2D5D5      -GV-RLLGTVPVAGQES-------------------------------------SKSGR-
A0A5C1AAF0      -GL-PTLGTIPWFPSNV-------------------------------------HRQSG-
A0A7C7T8W8      -QL-PVLAEVSRVPTRL-------------------------------------VSGRE-
A0A5C6B3S0      -SL-EVIGSLPLISQRK-------------------------------------MRRVN-
A0A368KP63      -GL-EILGTIPRLPRGI-------------------------------------TRKPK-
A0A518GIZ9      -PE-AYLGAVTSFDP-----------------------------------------EQS-
A0A1C3EBY9      -PE-AYLGAVTSFDP-----------------------------------------EQS-
D5SX64          -PE-AYLGAVTSFDP-----------------------------------------EQS-
A0A517Z0U7      -NL-QVMATIPLMPRWV-------------------------------------SRGDD-
A0A2S8FCC0      -RM-NVLGAIPLVPQRV-------------------------------------LAQSR-
A0A1Z8MBT6      -AVPPVIGELARAPRAS-------------------------------------GARQS-
A0A517SXN9      -AVAPVIGELARAPRAS-------------------------------------GARQS-
A0A518HFL0      -S--AEIFAVPPLPSAR-------------------------------------SADRN-
A0A5Q3LBQ3      -KV-ESVWEIASLPVRS-------------------------------------RNA---
A0A3B8ZJM2      -GK-PVLGHIPAMDLPN-------------------------------------IKKVV-
A0A1U7CLW1      -GL-RIIGDLPKLNGPR-------------------------------------RGDQK-
A0A142WPR7      -GL-PVVGHIPVIELAR-------------------------------------ADRRS-
A0A3M1TFJ0      ----PVLGAVPELSDVS-------------------------------------GRELD-
A0A517P477      ----DLFGTLPHLPRGG-------------------------------------AGAGA-
A0A517T4K9      -RM-RVIGGVPLVPRNV-------------------------------------TGSPK-
A0A7C6B2Q1      -GT-DVWGTIPLLPPRA-------------------------------------MRAIV-
A0A7C4QPD3      -NV-PVLGSVPVIPYNV-------------------------------------RGATP-
A0A2Z3GZZ5      -GL-AVVGHIPRIRTVP-------------------------------------ALSLE-
A0A4V0I6L6      -GL-PILAHVPVIRANQ-------------------------------------PNEVT-
A0A7C4QQT3      -RQ-PVLGTVVRFTQGV-------------------------------------EPGAP-
A0A255QXF5      -MLAPVIGELARAPSAT-------------------------------------GSRNS-
A0A518KBI5      -RL-RILGEISTFPTRR-------------------------------------VAANP-
A0A5C5V6Q5      -RL-RVLGEISVFPSRR-------------------------------------VAANP-
A0A517MY49      -GT-PVLAMVRKLDPL-----------------------------------------PG-
A0A2E6AG00      -GL-PILAMIRXLPSTL----------------------------------------AT-
A0A1G3A880      -GV-PVLAMVRQLPNA-----------------------------------------GV-
A0A2E8ATT1      -EL-PVLAMIGNLEVG-----------------------------------------NE-
A0A7C2JZW2      -NL-PLLGTVPLIPPGF---------------------------------------RNP-
A0A518KYQ0      -LIAPVIGELARAPRAA-------------------------------------VGRNS-
A0A5B9QX47      -GLAPVVGEVSRLPAGS---------------------------------------GSR-
M5T666          -QLAPVLGEVARLPAGA---------------------------------------GAV-
M5U6N6          -DLAPVLGEIARLPAGH---------------------------------------GAA-
A0A517M0G2      -LMAPIMGEVAKLPPKF---------------------------------------GSR-
A0A5C6AST1      -DLAPVIGEVARIPTKV---------------------------------------GVG-
A0A5C6C951      -DVAPVIGEVARLPSKI---------------------------------------GVG-
A0A5C6C5T3      -LLAPVLGEVSRLPAGS---------------------------------------GSQ-
A0A2A2W6A9      -ALAPVIGELARAPRGS-------------------------------------TGRNS-
A0A518HQS9      -TLAPVVGELARAPRAA-------------------------------------SGRNS-
A0A5M6DFE6      -GLAPIVGELARSPAGQ-------------------------------------NGRGS-
A0A5C6F286      -DMVPIMGEVARLPTGS---------------------------------------RSQ-
A0A517NGN1      -VLAPVVGELTRAPIDP---------------------------------------RNS-
M5RUI3          -SLAPVVGEIAQLPSGA---------------------------------------RNG-
A0A660VT66      DQA-CILGYVQRLPGRS-------------------------------------------
A0A7C2VEF7      -GV-PVLGVIPTMTDVRTITAHGRQAWLNFKPVAFGLCQRIHTIISTGIAGSRAKTTGVI
A0A0S8H0S8      -GL-PLLGAVPTIRRRR-------------------------------------------
A0A7C2ZTD2      -GI-RILGTTTSPHAIK-------------------------------------------
A0A2E3Z6T8      -GV-PVLAMVKKLDALN-------------------------------------------
A0A257WQ92      -NY-SLLGTISRFTSVI-------------------------------------------
A0A7C1U6X6      -QA-PFLGYIPLTRIKK-------------------------------------------
A0A7C7UXI5      -GV-SLLALLQEFEPLA-------------------------------------------
A0A7C3SFJ0      -GL-RVVGDLPVISGRH-------------------------------------------
A0A7C7WWF7      -GV-PVLAIVRKLETMV-------------------------------------------
A0A356ETW1      -GV-PVLSLIRRLDVPE-------------------------------------------
A0A3L7NJY1      -ST-QILSMIPRLEQLP-------------------------------------------
A0A523CME0      -GT-RSFSPKFKIDS---------------------------------------------
A0A354PCV3      -GL-SLVGEVARMPA---------------------------------------------
A0A354PHB4      -GL-SLVGEVARMPA---------------------------------------------
A0A356ESF4      -RT-TVLAVLPKL----------------------------------------------R
A0A538RV31      -GW-RLVGAIPDLPSRQ----------------------------------------RRN
                                                                            

M5S2L2          -------------------------------------------------DIQ--------
A0A2Z3GYP4      ----------AVELDSGLATVHSAMSPEA---EAYRGVRTALFFST---HGE--------
A0A7C2VXA0      ----------KDVVNRGQKAHLKPKSVVA---EAYRTIRTGVFFGI---PKE--------
A0A7C3AA48      -----------TVATRGRTVHMDSTSPVA---EAYRTIRTAVFFSV---PKG--------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ----------RRLLPNPVYNGSVPDDIRAVLHESVDNIRTTLIHRA---KKD--------
A0A2D6A9B6      ----------ERTVNPYLVCFHEPNGFRS---EQIRALRNRLTVMN---PDG--------
A0A2G6JGH3      ----------DRVVDPYLVCFHEPRGFRA---EQFRALRSKLLVMN---PER--------
A0A7C5PFV3      ----------DRVVDPYLVLFHNPSGFRA---EQYRALRNKLIFLN---PEG--------
A0A7C3QGD2      ---------------ERSLVRAAARSPIV---EVFNTAAALIESHA---RQA--------
A0A3D4PLL5      ---------------------------------------------------E--------
M5RD30          ------------------------------------------------------------
A0A1V6CUG1      ----------NGSFSEVLVTHHDRGGRIT---EEYRSLRTHLLAQY---PDE--------
A0A3M1SE88      ------------------QVVAEPDSPES---EGFRTLRTALALSE---SDA--------
A0A7C2ZUK5      ----------FEGWDERLVAASRNFSGVV---ESFRKLRTRILYPV---EDD--------
A0A660WB30      KRVVEADLESGMLYDRNYVREIRHRSIAT---EQIRKLRLRMN-TT---TGE--------
A0A660W9Z7      ----------VERFQFSPECSFSHSSEIG---EKFREIRANLQVLQ---VDR--------
A0A3M1R9K7      ----------AKQLHSEGKRYHHWRAIFT---ESVRGIAARLIRQA---KED--------
A0A3L7PH51      ----------GTGMELI-VTHMQPNSVES---ESFRSLRNFITFSN---EAT--------
A0A3N5UQY5      ----------SVPVRGR-KVLLEPSSREA---EAFRIVRTAVFFGA---PNG--------
A0A7C2JY73      -----PRRPEFGRLHPALRYLHSPNSLEA---ECYRTLRSALNVVC---EAS--------
A0A356AE44      ---KNLQAARETGLAPMLYYYHDPGSPEA---EACRSVRATFFVRA---ADV--------
A0A1G2XSU7      --------------------KAMWPRQLA---DDYHSICINLGLMN---NCT--------
A0A350KD81      ------AVVDDSEFAPALWYYYRPASREA---ESFRSLRTSLLLKT---DRS--------
A0A2D6SRY7      ---LAERGRRKRVRPDRLISSMELGSIAM---EAYRCLRTNIQFAA---PDT--------
A0A1G3C300      --------------NLELLTSEAPKSVFS---ETIRNIRTGIMLST---TDT--------
A0A524HC32      ------------------TFVRHPRTMFS---EAIRSSRVSIQLSG---ADT--------
A0A177PV03      ---------PATAMESILCTYYQPKSVQA---EAFRGIRTALYFSL---RSG--------
A0A1G2YIM0      -------------------------AKLA---DDYQAIRANLGLFN---EEK--------
A0A1G2ZG92      -------------------SKLNPTLPVV---EAYRTIRNSIQYAS---LDK--------
A0A1G3A0W0      -------------FGKSLCEQKYAQDRMA---ESIRLVRTALLSRL---GGP--------
A0A353BE27      ---LSKVKKSVEAVDPAVCAIHHSKGRVA---EAYRSVRTGLYFSN---KGK--------
A0A5C6BPW1      ---KAKKTAKSAFWHSVL----------T---ESIDAARTVLIRDA---NVE--------
A0A1I3GSP0      --------AQQRGLSPALCYYHRPGSREA---EAYRSVRTTLFVSM---RE---------
A0A517QJV1      --------AKETGLTSALVFLHRPGSREA---EAFRTIRTTLFHGL---RN---------
A0A3C1QS25      ---SKQKQTEGITFDGTAISVHQPKSKIS---EAYRAVRTALFFSN---RQR--------
A0A5C6FX55      SGQNADKDSPYKELDPCLAVLHSPSSVAA---ESVRSLRTATYFEL---AGV--------
A0A5C6DS51      ---MNIPSPSETSLAPSLITSHCPRSAEA---EVYRVARTSLMIKA---SGQ--------
A0A5C6DSL6      ---LPMPAPGETPLAPSLVTEHCPRSAEA---EVYRVARTSLMIKS---RGQ--------
A0A3M1VG27      ---ATEHGPPTARKCAQWYRLY-PRSGEA---EAFRVVRTRLLVSL---HDE--------
A0A518GC22      ---ISKVKKSVEAVDPSICAIHHSKGRVA---EAYRSVRTGLFFSN---NGK--------
A0A3L7Q373      ---TTSNG-----LSPSLVYYHRPGSREA---EAFRSIRTTLFHST---KES--------
A0A3E0PW54      ---SAAAARSASALDPRLCYYHRPGSREA---EAYRSVRMAVLRNQ---PES--------
A0A7C3TAH2      --------------DTTIPSPQQAAAHVA---EDLQTIRTNIGLQV---DGV--------
A0A1Z8MHR4      ---K-VGDPHVDQLDPKLAVVHRPYSAAA---EAVRGVRTAMLFEQ---RQF--------
A0A5C6EHJ0      ---KFEKGEPGENLDSRLVTFFNGKGQKA---EAFRAIRTAIYFSN---QSG--------
A0A5C6F1H9      ---KVEPGEVGEHLDSRLVTFFSGKGQKA---EAFRAIRTAIYFSN---QSG--------
A0A255QXY0      ---DSMDGENGSSLCDKISVVHRPHSPAA---EAVRAVRTAIMLER---KKN--------
A0A517SYI0      ---K-VGDPHVDQLDPKLAVVHRPYSAAA---EAVRGVRTAMLFEQ---RQF--------
A0A518HX54      ---KQMPTDSIARLDPKLAVIHRPHSPAA---EAVRAVRTAMLLDR---RQT--------
A0A5B9MF59      ---KGMVDSAISNLDPKLSVVHRPYSPAA---EAVRGVRTAMLFDR---RQF--------
A0A2A2WC24      ---KGLVDSEIAKLDPKLSVVHRPYSPAA---EAVRGVRTAMLFDR---RQY--------
A0A518KYW8      ---KGLVDSEIAKLDPKLSVVHRPYSPAA---EAVRGVRTAMLFDR---RQY--------
A0A5C5YZZ0      ---TSQKASAFPKTASIVTVLHEPHAPCS---EAFRSIRTNLFSTA---GGA--------
A0A518JLD2      ---KVDADHVGAALDSRLCTFFQRKGMNS---EAFRALRTAVFFSN---QSG--------
A0A5M6DJ15      ---NDDN------------FVHGAFGNSV---NSI----VAMLVNK---AKF--------
A0A3L7P7S7      ---MDEEEKALCKVDPTLICFHNPKSQEA---EFFRGLRTALYFST---QGH--------
A0A517N8M1      ---AKGETNPYEKFDPSLAVVHMPASIPA---EAIRSCRTSVFFEL---TG---------
A0A5C6CW01      ---TKDEINPYKDLDPGMAVLHQPASVAA---EAIRSCRTAIFFEL---AGI--------
A0A5C6BXS9      ---KPDNPNPFEELDPHLAVVHTPSSVPA---EAIRSCRTSIFFEL---AGV--------
M5U569          ---KPDNPNPFEKLDPYLAVVHQPASVPA---ESIRSCRTSIFFEL---SGI--------
L7CND7          ---KGEASNPFELLDPHLAVVHAPSSVAS---ESIRSCRTSVLFEM---AGI--------
A0A0J1B8S4      ---KGETSNPFEQLDAHLAVVHAPSSVAS---EAIRSCRTSVLFEM---AGI--------
F2ARR3          ---KGDKSNPFEHLDPHLAVVHAPSSVAS---ESIRSCRTSVLFEM---AGI--------
K5D8H6          ---KGDKSNPFEHLDPHLAVVHAPSSVAS---ESIRSCRTSVLFEM---AGI--------
M2AKU0          ---KGDKSNPFEHLDPHLAVVHAPSSVAS---ESIRSCRTSVLFEM---AGI--------
A0A5B1CKI2      ---GKDEVNPYEKLDPALAVIHMPASVPA---EAIRSFRTSVFFET---SGP--------
A0A5C6EG84      ---IKGDMNPYEKFDGSLAVVHMPASIPA---EAIRSCRTSVFFEL---AGS--------
A0A5C6F2X4      ---VKGDINPYEKFDQSLAVVHMPASIPA---EAIRSCRTSVFFEL---TGSGSWGSAEK
A0A5C5XTV6      ---KIDNPNPFEELDPHLAVVHTPSSVPA---EAIRSCRTSIFFEL---AGI--------
A0A5C6AAB1      ---KPESPNPFEQLDPHLAVVHAPSSVPA---ESVRSCRTSLFFEL---ARV--------
M5T8W8          ---KPDHPNPFEKLDPYLAVVHQPASVPA---EAIRSCRTSIFFDL---SNV--------
M5SF00          ---KGEASNPFELLDPHLAVVHAPSSVAS---ESIRSCRTSVLFEL---AGV--------
A0A2G1WDS1      ---KGEASNPFELLDPHLAVVHAPSSVAS---ESIRSCRTSVLFEL---AGV--------
Q7UVS9          ---KGEASNPFELLDPHLAVVHAPSSVAS---ESIRSCRTSVLFEL---AGV--------
A0A5C6B601      ---KTVMDKELSRLDPKLSVVHRPYSSSA---EAIRGIRTALFFDR---RAY--------
A0A517PFU1      ---GKRIREGVP--DAGLSTVLRPKSQLA---ESYRAVRTGLLSAA---RN---------
A0A5B9M8J9      ---GPGPTGSIEQLDSKLAVIHRPHSPAA---EAVRAVRTAMLLDR---RQN--------
A0A2A2WFP6      ---KQMPTNSIARLDPKLAVIHRPHSPAA---EAVRAVRTAMLLDR---RQT--------
A0A518L8N2      ---KQMPTNSIARLDPKLAVIHRPHSPAA---EAVRAVRTAMLLDR---RQT--------
A0A518HQN9      ---KGLVDSEIAKLDPKLSVVHRPYSPAA---EAVRGVRTAMLFDR---RQY--------
A0A5M6D8H8      ---AGTVAPEIAELDPQLSVVHRPYSPAS---EAVRAVRTAMLFDH---RQY--------
A0A5B1CRW9      ---AAKAGSAL---DPSLMAYHSPRSQES---EIFRVGRTSMMIAN---RKD--------
A0A5C6EI46      ---AAIAGSQL---DPSLLTYHTPRSAEA---EIFRVGRTSLMIAN---RKD--------
A0A2E7D3V4      ------LYEQSPLQPSLCYFHRPGSS-EA---EAYRSVRTALFVSG---SGR--------
A0A5B9PER9      ------GSAIEPIVCSYHRPKSQ----VS---EAFRAVRTSLFFNT---QNH--------
A0A517QSM4      ------DGKRKLSSQQVALRSV-----LK---EAIDSTRAVLLRDP---RMK--------
A0A355GJI7      ------SEFAPALWYYYRPASR-----EA---EAFRSLRTSLLLKT---DRS--------
A0A1Z8MCI4      ------QF-------------------YE---RSVMALALRLGCLK---VLS--------
A0A517SYL7      ------QF-------------------YE---RSVMALAVRLGCLK---VLS--------
A0A3L7P0L2      ------AVQNGLSPALVYFHRPGSR--EA---EAYRSSRTTLYHST---KDS--------
A0A6M5YVJ1      ------V--------------------LV---EAIDATRTMLLSGG---PDS--------
A0A2E0SHG0      ------DRGSRLSPVLVTHHIPQSP--EA---EIFRALRTNLYYGT---HGS--------
A0A518CQB8      ------DKKSKLSPVLVTYHIPQSP--EA---EIFRSLRTNLYFGT---HGQ--------
A0A517SCC8      ------ARNSRLHPRLCYSHHPGSR--EA---ESFRTIRTALLFAC---QEH--------
A0A3A0DR44      ------AASR--------RKIRRDLGLFQ---ESVDGLRTCLLLSE---ATS--------
A0A358MY60      ------QRV------------------FE---ESIDTLRANLMLSK---QTK--------
A0A517MNB1      ------QRV------------------FE---ESIDTLRANLMLSK---DTR--------
A0A7C1EH96      ------RQ-------------------LV---DDYQTIRANLGLLD---GDG--------
A0A142YJ13      ------GRDRDR---------------LV---QSIDAVRTMLLSVE---RQH--------
A0A517Z7D3      ------TSRLGAELFYYHHPGSR----EA---EAFRSIRTTLYASL---DGT--------
A0A1N6KY57      ------GAAQHRRWGSM----------LI---ESVDAARTALLHVS---RTE--------
L0DK20          ------REAESVRWRSM----------LV---ESVDAARTTLLHFS---RTE--------
A0A3L7UX05      ------MGGIDE------TRLRRQLVEYI---QSIDHLRVAISASL---GSTH-------
A0A517XRC2      ------EAAGNANWRFI----------LN---ESINSTRTMLLHTA---RSQ--------
A0A6M5YH47      ------VEAGGANWRFV----------LN---ESINSTRTMLLHTA---RTQ--------
A0A660UUK3      ------QQ-------------------LS---DDYQTIRANLGLFN---GHE--------
A0A517ZHG5      ------KAKKTAKSAFWHSV-------LT---ESIDAARTVLIRDA---NVE--------
A0A1Z8MPL5      ------RAPTPEAIEDLQVT-------ME---ESIDGLRAMLLHLP---AAK--------
A0A5C1AGE3      ------EADANQNWRFI----------LN---ESVNSTRTMLLHTA---KTQ--------
A0A2Z3HEL7      ------VEAGGANWRFV----------LN---ESINSTRTMLLHTA---KSQ--------
A0A142XAP8      ------TEAGGANWRFV----------LN---ESINSTRTMLLHTA---KAQ--------
A0A6P2DEK1      ------TEAGGANWRFV----------LN---ESINSTRTMLLHTA---KAQ--------
A0A5C6C1R5      ------ENFSDCE--------------FG---NSVSSIVAMLVNMS---RFD--------
A6BZU4          ------SEFAPALWYYYRPASR-----EA---ESFRSLRTSLLLKT---DRS--------
A0A2D5GZ77      ------SEFAPALWYYYRPASR-----EA---ESFRSLRTSLLLKT---DRS--------
A0A3D3R1Z6      ------SEFAPALWYYYRPASR-----EA---ESFRSLRTSLLLKT---DRS--------
A0A517XG00      ------SEFAPALWYYYRPASR-----EA---ESFRSLRTSLLLKT---DRS--------
A0A1G2YRE4      ------DQ-------------------IA---GEYQTIRANMGLLS---KNE--------
A0A353Z859      ------EGGGGQRWQGA----------LI---ESIDSARVMLLRRA---SLE--------
A0A2D6ST10      ------GDNRGKTAFWNSV--------LS---ESIDSARTVLLRDA---KVD--------
A0A177QX42      ------KDAQVDSSISVHHRPKSR---LA---ESYRAVRAAIFFGT---RGQ--------
A0A517SHR0      ------KDAKVDSSISVHHRPKSR---LA---ESYRAVRAAIFFGM---RGQ--------
A0A2E0AW64      ------S-----------RRVTRQLRLFE---ESVHHLRTSLVLSR---PLE--------
A0A351FZ59      ------S-----------RRVTRQLRLFE---ESVHHLRTSLVLSR---PLE--------
A0A660V239      ------RQ-------------------LA---DDYQAIRANLGLLD---GGG--------
A0A177Q3B7      ------ANGTHARDLV-----------FV---EHVDAARTSLLHLA---KHG--------
A0A2E0X6Y6      ------LV----------HAYVSPNKPET---EAFRTLRTALTLSP---Q----------
A0A518GFD7      ------QAKKGRDYQRAVE--------LA---EAIDSVAAMVLHRA---AVE--------
A0A5C5VZJ8      ------NCPI-----------------QT---ESVRVLRTAFLNRL---KQA--------
A0A518GE37      ------HRL------------------FE---ESIDALRANLLFKL---E----------
A0A5C6F3H8      ------RRV------------------FE---ESIDTLRANLFLSM---DTS--------
A0A5C5X072      ------RRV------------------FE---ESIDSLRANLFLSV---DTR--------
A0A5C5WUQ3      ------RRV------------------FE---ESVDTLRSNLFHSL---ATK--------
A0A5C6E697      ------RRV------------------FE---ESVDSLRANLLLST---DWK--------
A0A5C5Z1A3      ------RRV------------------FE---ESIDSLRANLFLSK---QWE--------
A0A5C6D2P7      ------RRV------------------FE---ESIDSLRSNLFLST---EWK--------
A0A5B9ML17      ------KG----------RRI------FQ---ESVDTMRANIFLSK---HTQ--------
A0A517LX75      ------KAAKQSKLSPLCRTVFAPHSTEA---EVLRMARTGLFVHT---GRS--------
A0A7C5W7B3      ------NPTTR----------------TA---NVFSLLRNHLRYSD---TNH--------
A0A2S8F9B8      ------SL---------SVDLGSFEDQVR---DSSDSVAATILRRA---ADQ--------
A0A354GX32      ------VAGDQSMGP------------MI---ESMDGIRTRLLHAG---RSE--------
A0A142XL75      ------PPPS-----------------LV---EAIDATRTMLVHGT---DEP--------
A0A6P2D5D5      ------PAPS-----------------LV---EAIDATRTMLVHGT---DEP--------
A0A5C1AAF0      ------VK------KEYWHSV------LT---ESMASTQMFLRHAG---NVG--------
A0A7C7T8W8      ------------------RKLGLRRAMFE---ESIDQLRISLLMAE---KAQ--------
A0A5C6B3S0      ------HQ----------NQRTHWMGRLT---EAVDSVAAVFIRKA---RLE--------
A0A368KP63      ------AL---------AVNLGPFEDRVR---DSSDSVAATILRRA---ATQ--------
A0A518GIZ9      ------RLDPVQNVHPSLRYLRSPASIEA---ENYRTIRTSLLVTA---EAL--------
A0A1C3EBY9      ------RLDPVQNVHPSLRYLRSPASIEA---ENYRTIRTSLLVTA---EAL--------
D5SX64          ------RLDPVQNVHPSLRYLRSPASIEA---ENYRTIRTSLLVTA---EAL--------
A0A517Z0U7      ------RT---HHKAAYWHSV------LT---ESIDAARTLLLRNS---QLS--------
A0A2S8FCC0      ------KN---SKKQQYWKSL------IA---ESIGGIVARLFRQS---GAN--------
A0A1Z8MBT6      ------RG----------RRV------FX---ESVDSLRANLALSQ---DTR--------
A0A517SXN9      ------RG----------RRV------FE---ESVDSLRANLALSQ---DTR--------
A0A518HFL0      ------RLEGPGHDPKFEQ--------FV---QQLDHLRVALCGEG---GHDG-------
A0A5Q3LBQ3      ------------------RRAGRARGLFE---ESVDSLRTGLVLSE---PLR--------
A0A3B8ZJM2      ------DTVDPSLITIHHSRGR-----IA---EAFRSVRTGLFFSS---RGS--------
A0A1U7CLW1      ------QIERDR---------------LV---QSIDAVRTMLLNAG---RHQ--------
A0A142WPR7      ------NDAVHPSLVTFHRPKSR----LA---EAYRAVRTSLYFRT---RGE--------
A0A3M1TFJ0      ------RYALSNPSSA-----------YA---EAFRRARVQL--------NATGAFPSE-
A0A517P477      ------GQRGSDWNEA-----------LK---ESVDAARVVLLRKL---GDGRGQTPESR
A0A517T4K9      ------PDDDARRVFWKSR--------LT---ESIDAARTMILKES---ENS--------
A0A7C6B2Q1      ------DERVRSKKHRRWRQM------FV---ESVRKVAARLIREA---DQD--------
A0A7C4QPD3      ------RR--QRMAAAYWRSV------LS---EAFDQIRTVLLHSP---RLN--------
A0A2Z3GZZ5      ------PATYDPLLVAALRPKSS----EA---EAYRGLRTQLYFST---QGR--------
A0A4V0I6L6      ------PAAAVDPTLVVWLRPKTA---EA---EAVRGLRTQLLFSV---ANR--------
A0A7C4QQT3      ------LA---ARAHPMLRYLRAPHSLEA---ENFRSLRTALGVIC---ETR--------
A0A255QXF5      ------KG----------RRV------FE---ESVDSLRANLALSK---DTR--------
A0A518KBI5      ------RQ--------IPRKLRKEMFAFA---ESIDALRMSLTFSA---DSE--------
A0A5C5V6Q5      ------RR--------LPRRIQKEMYSFA---ESIDSLRMSLTFCA---PSE--------
A0A517MY49      ------EGVATIHTATMPNAV------ET---ESFRTLRTSLTLSP---T----------
A0A2E6AG00      ------TGVNALHVATTPDSV------ES---EAFRTLRTTIAFAG---D----------
A0A1G3A880      ------PGWAGVQANAAPDAV------ES---EAFRTLRTALAFSP---H----------
A0A2E8ATT1      ------LGLGALQVHASPDAV------ES---EAFRTLRTTLAFSE---S----------
A0A7C2JZW2      ------RTAKQRLTATYWRDV------LQ---EAFDGVQSIVRHNE---RCA--------
A0A518KYQ0      ------KS----------RRV------FE---ESVDALRANLALSK---DTR--------
A0A5B9QX47      ------RS----------RRL------FE---ESIDTLRSNLFLSV---RTR--------
M5T666          ------KG----------RRV------FE---ESIDTLRANLFLSV---DTR--------
M5U6N6          ------KG----------RRV------FE---ESIDTLRANLFLSM---DTR--------
A0A517M0G2      ------KG----------RRV------FE---ESIDTLRANLLLSK---ETS--------
A0A5C6AST1      ------KR----------QRV------FE---ESIDTLRANLMLSK---DTQ--------
A0A5C6C951      ------KR----------QRV------FE---ESIDTLRANLMLSR---DTV--------
A0A5C6C5T3      ------KA----------RRV------FE---ESIDSLRSNLFLSV---DTR--------
A0A2A2W6A9      ------KS----------RRI------FE---ESVDTLRANLALSK---DTR--------
A0A518HQS9      ------KS----------RRV------FE---ESVDALRANLALSK---DTR--------
A0A5M6DFE6      ------RG----------RRV------FQ---ESVDTLRANLFLSE---STR--------
A0A5C6F286      ------KR----------RRV------FE---ESIDTLRANLFLSM---DTN--------
A0A517NGN1      ------KG----------RRI------FE---ESVDALRANLFLSQ---QTR--------
M5RUI3          ------RG----------RRI------FE---ESVDALRANLFLSL---DTK--------
A0A660VT66      ----------EDPRENDRICERMPRSVFA---EVYRNLRTSLIFSF---KEE--------
A0A7C2VEF7      SPTSDGDIGKQDIAVRGQKVHIKPKSVIA---EAYRTIRTAVFFGV---PRG--------
A0A0S8H0S8      -----------SLQSGAQTVLMDPASPAA---EAYRDIRTAVCFGV---REG--------
A0A7C2ZTD2      -----------EAYLQDQVV------------GDYQTIRANLGLMD---GGG--------
A0A2E3Z6T8      -----GENL------ETIHTHACPNAPET---EAFRTLRTVLSL-----SEQ--------
A0A257WQ92      -----DPHVIRGGMHSALRYLLAPRSMEA---ESYRSLRTALNVTS---DNA--------
A0A7C1U6X6      -----SLGK------PLHEEIRRIRDDKV---ESVRLVRTALLSRL---NGQ--------
A0A7C7UXI5      -----ERGI------GALHAHVRPDAVET---EAFRTLRTALSL-----ARG--------
A0A7C3SFJ0      -----RRQL------ALDGRGSPLYGLLA---DSIDNIRTALLYQA---SRE--------
A0A7C7WWF7      -----DAGA------ESLHVHIAPQSVEA---EAFRTLRTTLSF-----SGP--------
A0A356ETW1      -----TSGL------EAIQLHVAPASTES---EAFRTLRTALAL-----ADR--------
A0A3L7NJY1      -----GAGF------EAVLSHLKPHSKDV---EAFRALRTSIEF-----SPE--------
A0A523CME0      -------NHVDERIVSYYDFLGKQTWEGP---VMVHFRRLQISLNKMLRNVG--------
A0A354PCV3      ----GTRGTKDRRIF-------------Q---ESVDTLRSNLFLST---RWK--------
A0A354PHB4      ----GTRSTKERRIF-------------Q---ESVDALRSNLFLSS---SWK--------
A0A356ESF4      VANGAGIDSLQVHVA-------------P---DTRESEGFRTLRTALALRDR--------
A0A538RV31      LTLDGEANKHWNSLL-------------T---ESVDAARALLLRTA---RTE--------
                                                                            

M5S2L2          ---GGKVIQVTSPLPGDGKTTLAGNLACSIAQS-GKRVLVIDCDLRRP------------
A0A2Z3GYP4      ---RHKVIQVTSPHMGDGKTTLIINLAVSIAQ-AGRKVLLLDADLRRP------------
A0A7C2VXA0      ---EAKTILVTSPAPGDGKSTLVSNLAITMAQ-AGQKTIIVDADFRKP------------
A0A7C3AA48      ---QARTLLVTSPSAGDGKSTLVSNLCIAMAQ-ADQKVLLIDADFRKP------------
A0A3L7SU85      --------------AGDGKSTTSANLAISIAQ-SGKKIVLLDADFRKP------------
A0A3M1RAJ8      ---GLKVVMVTSGVAREGKSTVASQLAASLAR-AGRKTVLIDGDLRRP------------
A0A2D6A9B6      ---SARSLVITSAIQGEGKTATALNLAMSMTELQDHRILVLDCDLRKP------------
A0A2G6JGH3      ---APRSVVITSAIQGEGKSSSAINLALAFAELEDQRAVLLDFDFRKP------------
A0A7C5PFV3      ---LSRSLVVTSAIKEEGKSTTLLNLGLAFAELEGQSAIILDFDLRLP------------
A0A7C3QGD2      ---SARLYAVTSAVPGEGKSTVTCNLAVALAR-AGSRVLLVDADLRKA------------
A0A3D4PLL5      ---NHQRISITSTQPSDGKTTVISNTAVAFAQ-AGKKTLVIDGDMRRP------------
M5RD30          --------MMTSPHPGDGKSTTISNLAISLAQ-TGKRVLLIDADMRRP------------
A0A1V6CUG1      ---RF-CLLITSAMAGEGKTVTAANLAMVMAERIDRKTILVDCDLRKK------------
A0A3M1SE88      ---D--TIVVSSTEPGDGKSTVAANLAAAFAQ-AGKKTLLIDGDLRRP------------
A0A7C2ZUK5      ---VPRSILIISADAQEGKSFVCANLGISLAHSVAQHALMIDCDLRRP------------
A0A660WB30      ---RVRTILVTSALAGEGKSTVAANLAVAISQMIGEHVLLVDGDLRRP------------
A0A660W9Z7      ---SVKTLVFSSAHHKEGKTHTVVNTARFLSQHENRHTLLMDCDLRRP------------
A0A3M1R9K7      ---ETRVVLVTSAFGGEGKTTVASQLAISLAE-MGQKTILIDFDLRRP------------
A0A3L7PH51      ---QRLVVTSTEPG--DGKTTTLANLAVAFAQ-AGKKTLLIDADLRRPGMTQLLDLKGPR
A0A3N5UQY5      ---KAKTTLITSPGMEDGKSTLVSNLAIAMAR-AGQKTLILDADLRKP------------
A0A7C2JY73      ---DLKVVQISSPEPGDGKTTTVANLALAAAQS-GKRVLLVDADLRRP------------
A0A356AE44      ---DAHIIQFTSSEPGDGKTTTISNLGISIAQA-GKRVLLIDADLRKP------------
A0A1G2XSU7      ---IPNKLVISSASPREGKSTLAVNLATNLAKI-GKKVLLIDGDLRKP------------
A0A350KD81      ---GAKVLQMTSAEPGDGKTTSISNLALAIAQT-GRKVLIIDADLRRP------------
A0A2D6SRY7      ---KTPCYLVTSAGPGEGKSLTTSNLAIAIAQL-GRRVVLVDADMRRP------------
A0A1G3C300      ---PHKSLLITSTKQGEGKSFIAANLAIAFAQT-GKKTLLVDTDFRKP------------
A0A524HC32      ---RCKSFLITSGIPNEGKTTIAANLALSFAVA-GERVMLIDVDLRKP------------
A0A177PV03      ---DYKVIQITSPEARDGKTTLSANLAVSIAQS-GKKVVLLDADFRKP------------
A0A1G2YIM0      ---IPHILAITSARPQEGKTTFAINLASSMAKA-GARVLLVDGDLRKP------------
A0A1G2ZG92      ---PMKTIVVTSSMESEGKSSMSSNISITYSME-KKKVILVDLDLRRP------------
A0A1G3A0W0      ---RNTALLITSAVAGTGKSYFTMTLGESLARA-GKKVLMIDADLRKM------------
A0A353BE27      ---ALKVIQVTSPVPGDGKSTLSSNISVTMAQS-GRRVLLIDADLRRP------------
A0A5C6BPW1      ---STRLVMVGSAISGEGKTTLSCHLAASLARV-GRNTLLVDCDFRKS------------
A0A1I3GSP0      ---DHKVVQVSSAAPGEGKSTTAANLAIAIAQS-GKKVLLVDCDLRRP------------
A0A517QJV1      ---NEKVLQITSAEPGDGKSTIAVNTALAMAQA-GKRVLLIDCDLRRP------------
A0A3C1QS25      ---DIKVIQVTSPSPGDGKSTLALNLAVSIAQS-GQKVLLVDADLRRP------------
A0A5C6FX55      -Q-GGKILQVTSPLPGDGKSTIAGNLACAIAQS-GKSVLVIDCDLRRP------------
A0A5C6DS51      ---EAQVLMMSSPHPGDGKSTTIANLAISFAQT-GKRVLLIDSDLRRP------------
A0A5C6DSL6      ---GTQVLMMSSPHPGDGKSTTIANLAISFAQT-GKRVLLIDSDLRRP------------
A0A3M1VG27      ---HHRVLQITSPEPNDGKTTVACNLALAVAQS-GKRVLLLDADLRRP------------
A0A518GC22      ---ALKVLQVTSPVPGDGKSTLACNIAVTMAQS-GRRVLLIDADLRRP------------
A0A3L7Q373      ---QDKLIQITSAEPGDGKSTTAANLAIAIAQS-GKRVLLIDADLRRP------------
A0A3E0PW54      ---GGQAVQMTSAEPGDGKSVSAANLSLAIAKS-GKRVLLIDADMRRP------------
A0A7C3TAH2      ---VPRRLVVTSPGVQEGKTSLAINLATSLARS-GRRVLLVDGDLRKP------------
A0A1Z8MHR4      ---NSKVFQVTSPLPGDGKSTLVGNIGCLVAQS-GKRTLLIDLDLRSP------------
A0A5C6EHJ0      ---NNQVLQMTSSTPSDGKSTIAANVAVAIAQS-GRKVLLLDGDLRRP------------
A0A5C6F1H9      ---NNQVLQMTSSTPSDGKSTIAANVAVAIAQS-GRRVLLMDGDLRRP------------
A0A255QXY0      ---GSQVFQITSPLPGDGKSTLAANVGCSIAQT-GKTTLLIDLDLRSP------------
A0A517SYI0      ---NSKVFQVTSPLPGDGKSTLVGNIGCLVAQS-GKRTLLIDLDLRSP------------
A0A518HX54      ---DSKVFQITSPLPGDGKSTLAANVGCSIAQS-GKRTLLIDLDLRSP------------
A0A5B9MF59      ---DSKVFQITSPLPGDGKSTLAANVGCSVAQS-GKRTLLIDLDLRSP------------
A0A2A2WC24      ---NSKVFQITSPLPGDGKSTLAANVGCSVAQS-GKRTLLIDLDLRSP------------
A0A518KYW8      ---NSKVFQITSPLPGDGKSTLAANVGCSVAQS-GKRTLLIDLDLRSP------------
A0A5C5YZZ0      -P-EYQVIQVTSALPGDGKSTIVANLAASVARA-NKRVLIIDADLRRP------------
A0A518JLD2      ---DNQILQITSATPSDGKTTTAGNLAITMAQA-GKSVLILDADLRRP------------
A0A5M6DJ15      -E-DANIIMVSSAVSGEGKSTLARSLWRGLAEA-KYRTVIVDFDLRRP------------
A0A3L7P7S7      ---GHQVLQATSPVAGDGKSTTAANLAISIAQS-GKKIVLLDADFRKP------------
A0A517N8M1      -Q-RGKVIQVTSPLPGDGKSTIAGNLACSIAQS-GKRTLVIDCDLRRP------------
A0A5C6CW01      -D-GGKVVQVTSPLPGDGKTTVAGNLACSIAQS-GKRVLVIDCDLRRP------------
A0A5C6BXS9      -P-TGKILQVSSPLPGDGKSTISGNLACSIAQS-GKRTLLIDCDLRRP------------
M5U569          -P-GGKILQVTSPLPGDGKSTIAGNLACSIAQS-GKKTLLIDCDLRRP------------
L7CND7          -P-GGKIIQVTSPLPGDGKSTIAGNLACSIAQS-GKRTLIIDCDLRRP------------
A0A0J1B8S4      -H-GGKIIQVTSPLPGDGKSTIAGNLACSIAQS-GKRTLIIDCDLRRP------------
F2ARR3          -S-GGKIIQVTSPLPGDGKSTIAGNLACSIAQS-GKRTLIIDCDLRRP------------
K5D8H6          -P-GGKIIQVTSPLPGDGKSTIAGNLACSIAQS-GKRTLIIDCDLRRP------------
M2AKU0          -P-GGKIIQVTSPLPGDGKSTIAGNLACSIAQS-GKRTLIIDCDLRRP------------
A0A5B1CKI2      ---GCKVIQVTSPLPGDGKSTIAGNLACSMAQS-GKRVLVIDSDLRRP------------
A0A5C6EG84      ---GGKVIQVTSPLPGDGKSTIAGNLACSIAQS-GKRTLVIDCDLRRP------------
A0A5C6F2X4      SP-GGRVIQVTSPLPGDGKSTIAGNLACSIAQS-GKRTLVIDCDLRRP------------
A0A5C5XTV6      -Q-GGKILQVSSPLPGDGKSTISGNLACSIAQS-GKRTLLIDCDLRRP------------
A0A5C6AAB1      -P-GGKIIQVTSPLPGDGKSTIAGNLACSIAQS-GKRTLLIDCDLRRP------------
M5T8W8          -P-GGKIIQVTSPLPGDGKSTIAGNLACSIAQS-GKKTLLIDCDLRRP------------
M5SF00          -E-GGKVLQVTSPLPGDGKSTIAGNLACSIAQS-GKRTLIIDCDLRRP------------
A0A2G1WDS1      -E-GGKVLQVTSPLPGDGKSTIAGNLACSIAQS-GKRTLIIDCDLRRP------------
Q7UVS9          -E-GGKVLQVTSPLPGDGKSTIAGNLACSIAQS-GKRTLIIDCDLRRP------------
A0A5C6B601      ---DSKVFQITSPLPGDGKSTIAANIGCSIAQS-GKKVLLIDLDLRSP------------
A0A517PFU1      ---GVKVVQVTSPDRGDGKSTLTANVAVTLGRV-GKRTVLVDVDLRRP------------
A0A5B9M8J9      ---DSKVFQITSPLPGDGKSTLAANVGCSIAQS-GKRTLLIDLDLRSP------------
A0A2A2WFP6      ---DSKVFQITSPLPGDGKSTLAANVGCSIAQS-GKRTLLIDLDLRSP------------
A0A518L8N2      ---DSKVFQITSPLPGDGKSTLAANVGCSIAQS-GKRTLLIDLDLRSP------------
A0A518HQN9      ---NSKVFQITSPLPGDGKSTLAANVGCSVAQS-GKRTLLIDLDLRSP------------
A0A5M6D8H8      ---DSRVFQVTSPLPGDGKSTLAANVGCSIAQS-GKKTLLLDLDLRSP------------
A0A5B1CRW9      ---SVQTMMVTSPQPGDGKSTTIANMAISFAQT-GKRVLLIDADMRRP------------
A0A5C6EI46      ---SVQTIMVTSPQPGDGKSTTISNLAISFAQA-GKRVLLIDADMRRP------------
A0A2E7D3V4      ----SQAIQVSSPEPGDGKTTFISNLAIAIAQS-GRKVLLIDADLRRP------------
A0A5B9PER9      ---QHSVIQITSPTPGDGKSTLASNLAVSIAQS-GKRVLLVDADMRRP------------
A0A517QSM4      ---VMNTILITSASDGEGKTSNACHLAASLARS-GRKVVLVDCDMRRP------------
A0A355GJI7      ---GAKVLQMTSAEPGDGKTTSISNLALAIAQT-GRKVLIVDADLRRP------------
A0A1Z8MCI4      ---AGKVVGVVSGVSGEGKSTVTFGLACMLGHSKHLKVLVIDADVRKP------------
A0A517SYL7      ---AGKVVGVVSGVSGEGKSTVTFGLACMLGHSKHLKVLVIDADVRKP------------
A0A3L7P0L2      ---QDKIIQITSAEPGDGKSTTAANLAIAIAQS-GKKVLLIDADLRRP------------
A0A6M5YVJ1      ---DLRVVVVASAIAGEGKTSLSGHLAISLARA-GSRTLLIDGDLRAP------------
A0A2E0SHG0      ---TPKVVQFTSPNPKDGKSVTTANLAISLAQT-GKSVLLIDCDMRLP------------
A0A518CQB8      ---SPKVVQITSPNPKDGKSVTTANLAISLAQT-GKSVLLIDCDMRLP------------
A0A517SCC8      ---NVRLLQFSSAEPGDGKTTTISNLAIAIAQS-GKKVLLIDADMRRP------------
A0A3A0DR44      ---SHRVFAVTSAVSGEGKTSLVSQLAISLARATGKRVLIVDADLRSP------------
A0A358MY60      ---DARTVTVASSMSGEGKSSVSSQLAISLAKACGETVLLVDADLRSP------------
A0A517MNB1      ---DVRTISVASSLSGEGKSSVSSQLAISLAKACGETILLIDADLRKP------------
A0A7C1EH96      ---ETKMLVITSPGMGDGKSTLAVNLATSFARS-GRKTLLIDGDLRKP------------
A0A142YJ13      ---SFQVVMVTSATKGEGKTSLSCHLATSLARA-GRRTLLIDCDLRKP------------
A0A517Z7D3      ---DDRLLQISSPEPGDGKSTTAANLAIAMAQS-GKRVLLVDGDLRRP------------
A0A1N6KY57      ---SVRVVMIASALGGEGKTSLASHLATSLARA-GRRTLLVDGDLRRP------------
L0DK20          ---SVRVVMVASALSGEGKTSLSSHLATSLARA-GRRTLLIDGDLRRP------------
A0A3L7UX05      ---EHQSILITSAFGGEGKTTLSAQLAGRCANA-GLSTVVVDGDLRNP------------
A0A517XRC2      ---SMQVVMVTSATQGEGKTSLSSQLASSMATA-GMRTLIVDCDLRNP------------
A0A6M5YH47      ---SMQVVMVTSATQGEGKTSLTSQLATSMATA-GMRTLIVDCDLRNP------------
A0A660UUK3      ---STKVLVVTSPGVGDGKTTFAINIALSFAQS-GEKVLLIDGDLRKP------------
A0A517ZHG5      ---STRLVMVGSAISGEGKTTLSCHLAASLARV-GRNTLLVDCDFRKS------------
A0A1Z8MPL5      ---DVRTLMVTSALANEGKTTVASALATSMGRS-GRRTLLIDGDLRCP------------
A0A5C1AGE3      ---SMQVIMVTSAMQGEGKTSLSSQLATSMATA-GLRTLIVDCDLRNP------------
A0A2Z3HEL7      ---SMQVVMVTSATQGEGKTSISSQLATSMATA-GMRTLIVDCDLRNP------------
A0A142XAP8      ---AMQVVMVTSATQGEGKTSLASQLATSMATA-GMRTLIVDCDLRNP------------
A0A6P2DEK1      ---AMQVVMVTSATQGEGKTSLASQLATSMATA-GMRTLIVDCDLRNP------------
A0A5C6C1R5      ---RASVLMVTSGVSGEGKTTLATSLWRGLTQA-SYRTILIDFDLRRP------------
A6BZU4          ---GAKVLQMTSAEPGDGKTTSISNLALAIAQT-GRKVLIIDADLRRP------------
A0A2D5GZ77      ---GAKVLQMTSAEPGDGKTTSISNLALAIAQT-GRKVLIVDADLRRP------------
A0A3D3R1Z6      ---GAKVLQMTSAEPGDGKTTSISNLALAIAQT-GRKVLIVDADLRRP------------
A0A517XG00      ---GAKVLQMTSAEPGDGKTTSISNLALAIAQT-GRKVLIVDADLRRP------------
A0A1G2YRE4      ---MPKILVITSPWMREGKTTLSINLATSLAKS-GKKVLLIDGDLRKP------------
A0A353Z859      ---NAKVVMVSSAVTSEGKTTMACHMGTSLARA-GYRTVVVDVDLRRP------------
A0A2D6ST10      ---SLKAVMICSAVGGEGKSTLSCHLATSLARA-GRKVLLIDCDLRRP------------
A0A177QX42      ---THRVLQITSANSGDGKTTLCSNLASAIAMS-GKKVLLVDGDLRRP------------
A0A517SHR0      ---SHRVLQVTSANSGDGKTTLCCNLASAIAMS-GKRCLLVDCDLRRP------------
A0A2E0AW64      ---DIQVLAVTSSVSGEGKTTLAAQLAMSIARASGQPTLLIDGDMRAP------------
A0A351FZ59      ---DIQVLAVTSSVSGEGKTTLAAQLAMSIARASGQPTLLIDGDMRAP------------
A0A660V239      ---ASKIIVVTSPGIGDGKTTFAVNLATSFAQS-GEKVLLIDGDLRKP------------
A0A177Q3B7      ---EVQAILVTSAVGGEGKTSLACQLAASLARA-GFQTLLIDGDMRRP------------
A0A2E0X6Y6      ---AHSRLLVSSSEPSDGKTTVALNLAVTFAQA-GRRTLIIDADLRKP------------
A0A518GFD7      ---KRQVFMVSSALAGEGKSTISCQLSRSLAKS-GKRVLLVDFDLRRP------------
A0A5C5VZJ8      ---GCSVVQFTSVGPRTGKSTLVGMLGRSLAAA-GKRVLLVDGDVRRG------------
A0A518GE37      ---GARTIAVTSAMSSEGKSSVASQLAISLAKTSQTTVLLIDADLRSP------------
A0A5C6F3H8      ---NVRSIAVVSGMSGEGKSSVSSQLALSIAKATGETVLLVDGDLRCP------------
A0A5C5X072      ---HTRSIAVVSSMSGEGKSSVASQLALSMAKSTGETVLLVDGDLRRP------------
A0A5C5WUQ3      ---NIRSIAVASSMTSEGKSSVASQLAISIAKATGETVLLVDADLRCP------------
A0A5C6E697      ---HVRSIAVVSSVSGEGKSSVASQLALSIANATAETVLLVDADLRCP------------
A0A5C5Z1A3      ---GTRSIAVASSVSGEGKSSVASQLAISIAKATGETVLLVDADVRCP------------
A0A5C6D2P7      ---DTRTIAVVSSVSGEGKSSVASQLALSIAKATGNTVLLVDADLRCP------------
A0A5B9ML17      ---HSRSIAIVSSMSGEGKSTAASQLAISLAKSSGKTVLLVDADMRCP------------
A0A517LX75      ---LDKVMLVTSPMPGDGKSTMIVNLAAAIAKA-GKSVLLVDADLRRP------------
A0A7C5W7B3      ---PEKAFAVTSPRPGDGKSFVAVNLAISFAQE-GNRTVLVDCDLRHP------------
A0A2S8F9B8      ---QCQVLLISSAMPREGKSSLACHLAISLAHA-GRKVVVVDFDLRRP------------
A0A354GX32      ---TLRVVMVASAVSGEGKTTLASHLAASLARG-GRRTLLVDGDLRNP------------
A0A142XL75      ---DLRVLVVTSAVSGEGKTSLTGHLAISLARA-GFRTLLVDGDLRSP------------
A0A6P2D5D5      ---DLRVFVVTSAVSGEGKTSLTGHLAISLARA-GFRTLLVDGDLRAP------------
A0A5C1AAF0      ---LPRILLIASAEKGEGKTLLSTHLAAGFARN-GVKTLLIDGDLRKP------------
A0A7C7T8W8      ---GKKVFSMSSSVSGEGKTSIASQLALSIARSQNLPVLLIDADMRAP------------
A0A5C6B3S0      ---QHSVIMITSALAGEGKTTLASQLAVSLAAS-GQRTVLVDCDLRRS------------
A0A368KP63      ---KCQVLLISSAMPQEGKSSLTCHLAISLANA-GRRVVIVDFDLRRP------------
A0A518GIZ9      ---NAQVIQVGSPEPGDGKTTLVSNLALALASS-GKRVLLIDADLRRP------------
A0A1C3EBY9      ---NTQVIQVGSPEPGDGKTTLVSNLALALASS-GKRVLLIDADLRRP------------
D5SX64          ---NAQVIQVGSPEPGDGKTTLVSNLALALASS-GKRVLLIDADLRRP------------
A0A517Z0U7      ---GTRTVMIASATGGEGKSTLSCHLATSLARA-GRSVLLVDCDIRRP------------
A0A2S8FCC0      ---KNRVVMISSALAGEGKTTLAGQIAYALAES-GARTVLVDFDLRRP------------
A0A1Z8MBT6      ---TARSFCIASSMSGEGKSTAASQLAISLAKSSGKTVLIIDADLRCP------------
A0A517SXN9      ---TARTFCIASSMSGEGKSTAASQLAISLAKSSGKTVLIIDADLRCP------------
A0A518HFL0      ---RGRCVLITSAVGGEGKTTLAAQLAVRCAEA-GASTVLIDADLRRA------------
A0A5Q3LBQ3      ---DARVLAVTSAISREGKTSLSSELAVSIAQATGEPTLLIDGDMRSP------------
A0A3B8ZJM2      ---ELKVVQITSPVPGDGKSTLSSNLAVAMAQS-GRRVLLIDADFRRP------------
A0A1U7CLW1      ---PFRVVLVTSALKGEGKTSLSCHLATSLARG-GRKTLLMDCDLRKP------------
A0A142WPR7      ---PLKVIQVTSPNPGDGKSTLSGNLAISIAQT-GKRVLLMDADFRRP------------
A0A3M1TFJ0      ---GCGVLVCVSGVPREGKTLCSVNLAVAEAQA-GRRTLLVDGDMRNP------------
A0A517P477      LDAGGRVVLISSAVASEGKTTLSCHLAASLART-GRRVVLVDADLRRP------------
A0A517T4K9      ---GLQVVLIASALGGEGKSTLACHLSSSLARA-GRKTLLIDGDMRRP------------
A0A7C6B2Q1      ---GLKLVMVSSAMAGEGKTTLAGQLALTLAQM-GKKTIIVDFDLRRP------------
A0A7C4QPD3      ---GVKTIMVAGSGIAEGKTSTTTQLALSLARS-GFRVLLIDGDLRRP------------
A0A2Z3GZZ5      ---GHQVIQVTSPTPGDGKSTLAANLALSVAQS-GKRTILVDCDLRKP------------
A0A4V0I6L6      ---NHQVIQVTSPMSGDGKSTTAANLAIALARA-DKRVVLVDCDFRKP------------
A0A7C4QQT3      ---QAKVIQVSSPEPGDGKTTTVVNLAVAVAQS-GRRVLLIDADLRRP------------
A0A255QXF5      ---DARTFAIVSSMSGEGKSTAVSQLAISLAKASGKTVLIIDADMRCP------------
A0A518KBI5      ---QQRIVAITSANSGEGKSSVSVALGMSFANATRRRTLIIDGDMRDP------------
A0A5C5V6Q5      ---RNRVIALTSAVSGEGKTSVSVALAMSFANATGAKTLLVDGDMRDP------------
A0A517MY49      ---SCERLLISSSEPGDGKTTVSANLAVAFAKA-GKRTLVIDADLRKP------------
A0A2E6AG00      ---DLKCVAVSSSEPGDGKTTVVANLGATFAQA-NXTTLMIDADLRKP------------
A0A1G3A880      ---ATERIAVSSSEPGDGKTTVLVNLAVSFAQA-GKRTLLIDADLRRP------------
A0A2E8ATT1      ---DTECIAVTSSEPGDGKTTVLANLGLVWAQV-GKKTLLIDADMRRP------------
A0A7C2JZW2      ---AARTIMVASSCEGEGKSTSAAQLALSFARA-GYRVLLIDGDLRRP------------
A0A518KYQ0      ---HARSFAVVSSMSGEGKSTAVSQLAISLAKSSGNTVLIVDCDMRCP------------
A0A5B9QX47      ---DTRSIAVASSMSGEGKSSVASQLAISIAKATGELVLLVDADLRCP------------
M5T666          ---ETRSIAIVSSMSGEGKSSVASQLALSIAKATGETVLLVDADLRCP------------
M5U6N6          ---NTRSIAVVSSMSGEGKSSVASQLALSIAKATGETVLLVDADLRCP------------
A0A517M0G2      ---GVRTLTIASSMSGEGKSSVASQLAISVAKASGKTVLLIDGDLRSP------------
A0A5C6AST1      ---GVRTIAIASSMSGEGKSSVASQLAISLAKACGKTVLLIDADLRSP------------
A0A5C6C951      ---GVRSITIASSMSGEGKSSVSSQLAISLAKACGKTVLLIDADLRSP------------
A0A5C6C5T3      ---HIRSIAVVSSMSGEGKSSVASQLALSMAKSTGETVLLVDGDLRRP------------
A0A2A2W6A9      ---HARSFAVVSSMSGEGKSTAVSQLAISLAKSSGKTVLIIDCDMRCP------------
A0A518HQS9      ---HARSFAVVSSMSGEGKSTAVSQLAISLAKSSGKTVLIIDCDMRCP------------
A0A5M6DFE6      ---DARSFAIVSSMSGEGKSTAASQLAISLAKATGKTVLLIDADMRCP------------
A0A5C6F286      ---KTRSIAVVSGMSGEGKSSVSSQLALSIAKATGGTVLLVDGDLRCP------------
A0A517NGN1      ---GARTIAICSSMSGEGKSTAAAQLAVSLAKASNKTVLLVDGDTRCP------------
M5RUI3          ---HTRSIAVVSSMSGEGKSSVASQLALSIAKATDQTVLLVDADLRYP------------
A0A660VT66      ---GPKSILVTSPGSLEGKSTIVSNLGIAFAQN-GQKTVIIDGDLRKP------------
A0A7C2VEF7      ---EARTILITSPDAGDGKSTLVSNLAIAMAQA-GQKTLILDADFRKP------------
A0A0S8H0S8      ---QVKTLLVTSAQAGDGKTTLVSNLGIAMAQA-AQRTLILDADLRNP------------
A0A7C2ZTD2      ---IPNKLVITSAGPGEGKSTLAINLATSLARA-DKRVLLIDGDLRKP------------
A0A2E3Z6T8      ---NCERILISSSEPGDGKTTISANLSVALAQA-GHRTLVIDADLRRP------------
A0A257WQ92      ---HANVILVTSPETGDGKTTTISNLAIAMAQS-GKRVLLVDADLRRP------------
A0A7C1U6X6      ---GRTTVLIASAAEGTGKSTFTMMLGKSLAQS-GKKVIMIDADLRRM------------
A0A7C7UXI5      ---QVRSLVISSSEPGDGKTTVSANLAAVYAQA-GKRTLLVDADMRRP------------
A0A7C3SFJ0      ---GIKVTLITSALAREGKTTVATQLAASLGRT-GRSTLLVDGDLRRP------------
A0A7C7WWF7      ---EMQRVTISSAEPGDGKTTVLANLGASFGQS-GKRTLLIDADLRKP------------
A0A356ETW1      ---ELNRIVVTSAEPGDGKTTIIANLATCYAQS-NKKTLLIDADLRRP------------
A0A3L7NJY1      ---ETRRLVCTSTEPGDGKTTVSSNLAVAFAQS-GRRTLLIDADMRRP------------
A0A523CME0      ---RSKVLIVASATQKEGKSTIALNTAITLCNN-NNKVVIIDCDLRKP------------
A0A354PCV3      ---GTRSIAVVSSISSEGKSSIASQLSVSIAKATGKTVLLVDADLRRP------------
A0A354PHB4      ---DTRSIAVVSSISSEGKSSVASQLALSIAKATGETVLLVDADLRRP------------
A0A356ESF4      ---EARRLVVCSAEPGDGKTTVLANLGVSFAQA-QRKTLLIDADLRRP------------
A0A538RV31      ---AVRTVMVTSAVAGEGKTSLSCHLASSLARA-GRKTLLIDCDLRRP------------
                                 **:                  :::* * *              

M5S2L2          -----Q----ITDNF-AM------QS-KMGLS--------NVLN--------GDC-DP--
A0A2Z3GYP4      -----R----VHRAF-GL------TS-RIGLA--------EVLT--------GTA-EL--
A0A7C2VXA0      -----M----QHNIF-EI------DSGKKGLA--------DVLT--------QEI-SL--
A0A7C3AA48      -----M----QHGIF-EV-------TREPGVS--------NIMA--------GTH-TI--
A0A3L7SU85      -----R----VHKIF-RL------EQPEVGLA--------SVVN--------GDA-TL--
A0A3M1RAJ8      -----R----MHRVL-KQ------DL-APGLS--------EYLR--------GEA-AL--
A0A2D6A9B6      -----S----VETFL-GL------NR-GPGLA--------DLLQ--------GST-SL--
A0A2G6JGH3      -----S----VETLL-GL------NQ-EPGLT--------ELLM--------GRL-AL--
A0A7C5PFV3      -----S----VERLL-GL------NP-EPGLT--------DLML--------GRI-PL--
A0A7C3QGD2      -----T----QHQLL-NV------AN-DPGLS--------SYLI--------GATDEI--
A0A3D4PLL5      -----G----LTAVF-AL------KG-QAGLS--------TILR--------DTA-SI--
M5RD30          -----V----IAGLF-GL------EG-EPGLT--------NVLF--------DST-QF--
A0A1V6CUG1      -----K----LTAML-GC------K-QQAGMA--------ELLQ--------GKA-TL--
A0A3M1SE88      -----G----LTAML-GY------R-GESGLS--------RALQ--------SNE-DI--
A0A7C2ZUK5      -----S----LAGLF-GL------DNNSRGLV--------DYLR--------GEE-DF--
A0A660WB30      -----D----LHNFF-GL------P-PKPGLA--------EYLE--------YDL-DL--
A0A660W9Z7      -----K----IKEHV-LV------D-CEYSLE--------DVLT--------GKC-EL--
A0A3M1R9K7      -----S----LDGVF-GI------E-NDRGVS--------EILR--------GEA-KW--
A0A3L7PH51      GLAQVL----NDKKL-DI------DIAERCLE--------NVFH----------------
A0A3N5UQY5      -----I----QHRIF-DI------NHQEQCLC--------SVLE--------GKV-KL--
A0A7C2JY73      -----M----LHTLF-AL------PN-DIGLT--------DVLS--------GEI-EL--
A0A356AE44      -----M----VHQLF-GM------RE-EIGLS--------ECLS--------GEI-EM--
A0A1G2XSU7      -----D----IAKYL-KL------DNKGKGMH--------QLL---------ADF-KL--
A0A350KD81      -----T----IHKLF-GL------AN-SIGLG--------DVLN--------GEI-DA--
A0A2D6SRY7      -----V----LHGLF-GV------ER-GPGLS--------EILV--------GNA-TW--
A0A1G3C300      -----R----QHKIF-GI------DL-KPGLS--------NHFI--------GEI-DY--
A0A524HC32      -----S----LHNVF-----IPSTPVNGNGLS--------SFLA--------AMT-DQ--
A0A177PV03      -----R----MHEIF-GV------SA-DVGVA--------SVIA--------GTA-KL--
A0A1G2YIM0      -----D----IAKIL-NI------ETGHNALR--------KVLL--------GYN-TL--
A0A1G2ZG92      -----T----AHKFF-KI------SN-NNGIT--------NILS--------GGF-SL--
A0A1G3A0W0      -----G----LTRRF-NL------AG-KAGFI--------ESLR--------SRS-AD--
A0A353BE27      -----R----VAKIF-GI------DS-EIGVA--------AVVG--------GKV-EV--
A0A5C6BPW1      -----N----VHRVF-GV------EE-HPGLS--------EVLL--------GTA-SL--
A0A1I3GSP0      -----T----QHTLF-QV------PQ-EVGLT--------DVLL--------REI-DW--
A0A517QJV1      -----T----LHHLL-GL------PQ-EIGFT--------DVLL--------NEI-QW--
A0A3C1QS25      -----R----QHKVI-GE------NA-EHGFA--------AVLR--------GDL-AV--
A0A5C6FX55      -----Q----LTDNF-VM------QD-QLGLT--------NVLN--------GEC-EW--
A0A5C6DS51      -----V----VAGLF-GL------EG-RLGLA--------DVLK--------GDS-TL--
A0A5C6DSL6      -----V----VAGLF-GL------EG-QPGLA--------DVLN--------GQC-SL--
A0A3M1VG27      -----S----IHKAL-GL------RQ-DIGVT--------DILR--------GEI-DW--
A0A518GC22      -----R----VAKIF-GI------DS-DVGVA--------AVVG--------GKC-EI--
A0A3L7Q373      -----T----MHTLF-GL------SQ-DIGLA--------DVLQ--------NEI-QW--
A0A3E0PW54      -----T----VHELF-RI------KQ-DIGLS--------EVLL--------GEI-EW--
A0A7C3TAH2      -----D----VAILM-GI---PVPAP-GSGES--------IEVD------------GF--
A0A1Z8MHR4      -----R----LSLRF-NL------ST-NVGLT--------NVLN--------GEL-AP--
A0A5C6EHJ0      -----R----VGKLL-GI------ES-EIGTAWAIEQCGPGSTD--------SNV-AI--
A0A5C6F1H9      -----R----VGKVM-GI------EN-DKGTAWAIEQCEADAAG--------LDD-RI--
A0A255QXY0      -----R----LSLRF-NL------QS-DKGLA--------NVLN--------GEI-GI--
A0A517SYI0      -----R----LSLRF-NL------ST-NVGLT--------NVLN--------GEL-AP--
A0A518HX54      -----R----LSLRF-NL------ET-KIGLA--------NVLN--------GEL-GV--
A0A5B9MF59      -----R----LSLRF-NL------EA-QTGLT--------NVLN--------GEL-GP--
A0A2A2WC24      -----R----LSLRF-NL------EA-KTGLT--------NVLN--------GEL-GP--
A0A518KYW8      -----R----LSLRF-NL------EA-KTGLT--------NVLN--------GEL-GP--
A0A5C5YZZ0      -----T----QAKVF-GV------QP-SAGLT--------GLLN--------GEI-EF--
A0A518JLD2      -----R----IAKLF-DL------RA-DKGLA--------WAIEQITLSKEIDDL-MI--
A0A5M6DJ15      -----S----LHVDL-GC------EP-GIGVS--------DIVA--------ASA-NW--
A0A3L7P7S7      -----R----VHKIF-KL-----DQP-EVGLA--------SVVS--------GDA-TL--
A0A517N8M1      -----Q----LTDNF-DM------AD-LSGLS--------EVLN--------GEC-EA--
A0A5C6CW01      -----Q----ITDNF-AM------KS-KLGLS--------NVLN--------GDC-DP--
A0A5C6BXS9      -----Q----ITDNF-GS------AE-KQGLT--------DVLN--------GTC-DH--
M5U569          -----Q----ITDNF-AS------AE-QLGLI--------DVLN--------GHC-EH--
L7CND7          -----Q----VTDNF-AM------AD-QLGLV--------DVLN--------GKC-EH--
A0A0J1B8S4      -----Q----VTDNF-AK------AD-QLGLV--------DVLS--------GKC-EH--
F2ARR3          -----Q----VTDNF-AM------AD-QLGLV--------DVLN--------GKC-EH--
K5D8H6          -----Q----VTDNF-AM------AD-QLGLV--------DVLN--------GKC-EH--
M2AKU0          -----Q----VTDNF-AM------AD-QLGLV--------DVLN--------GKC-EH--
A0A5B1CKI2      -----Q----LTDFF-SL------AE-QKGLT--------DVLN--------GDC-EV--
A0A5C6EG84      -----Q----LTDNF-DM------AD-QRGLT--------HVLN--------CEC-EP--
A0A5C6F2X4      -----Q----LTDNF-DM------AD-QKGLT--------DVLN--------CEC-DA--
A0A5C5XTV6      -----Q----ITNNF-DS------AE-KQGLT--------DVLN--------GTC-DH--
A0A5C6AAB1      -----Q----ITDNF-NG------SE-KLGLI--------DVLS--------GKC-DH--
M5T8W8          -----Q----ITDNF-DS------AE-QLGLI--------DVLN--------GHC-EH--
M5SF00          -----Q----VTDNF-AM------AD-QLGLV--------DVLN--------GKC-EH--
A0A2G1WDS1      -----Q----VTDNF-AM------AD-QLGLV--------DVLN--------GKC-EH--
Q7UVS9          -----Q----VTDNF-AM------AD-QLGLV--------DVLN--------GKC-EH--
A0A5C6B601      -----R----MSLRF-NL------QS-DVGLT--------NVLN--------GEM-SP--
A0A517PFU1      -----R----VRRMF-GLPQVAADNP-GVGTA--------EVIA--------DPD-KL--
A0A5B9M8J9      -----R----LSLRF-NL------DT-NVGLA--------NVLN--------GEL-PA--
A0A2A2WFP6      -----R----LSLRF-NL------ET-KIGLA--------NVLN--------GEL-SA--
A0A518L8N2      -----R----LSLRF-NL------ET-KIGLA--------NVLN--------GEL-SA--
A0A518HQN9      -----R----LSLRF-NL------EA-KTGLT--------NVLN--------GEL-GP--
A0A5M6D8H8      -----R----MSLRF-NL------ES-GKGLT--------NVLN--------GEM-DV--
A0A5B1CRW9      -----V----VAKLF-GL------QH-DPGLS--------DFLG--------GSM-PF--
A0A5C6EI46      -----V----ISKLF-GI------DD-RKGLS--------DFLA--------GRV-EF--
A0A2E7D3V4      -----T----VNQLF-GL------PQ-DIGTC--------DVLL--------GDI-EL--
A0A5B9PER9      -----R----QHSTF-GI------TS-KEGFA--------TVLG--------GQS-HW--
A0A517QSM4      -----T----VHRVF-RL------NS-AHGFC--------EILR--------GDK-PL--
A0A355GJI7      -----T----IHKLF-GL------AN-SVGLG--------DVLT--------GEI-DA--
A0A1Z8MCI4      -----S----LHSLF-DV------SN-EVGLV--------DVLM--------QRS-EL--
A0A517SYL7      -----S----LHSLF-DV------SN-EVGLV--------DVLM--------QRS-EL--
A0A3L7P0L2      -----T----MHTLF-AL------PQ-DIGLT--------DVLL--------SEV-DW--
A0A6M5YVJ1      -----T----AQRVF-GG------PL-APGLC--------EVLR--------GEI-GA--
A0A2E0SHG0      -----M----VDKLF-GL------DT-SVGLS--------SVLR--------GEA-EI--
A0A518CQB8      -----M----VDKLF-GL------ST-TVGLS--------DVLR--------GEA-EI--
A0A517SCC8      -----T----VHDMF-RL------SQ-EAGLS--------DVLL--------SEI-EW--
A0A3A0DR44      -----N----LHEIF-EI------HL-EPGLA--------GVLR--------KEC-EI--
A0A358MY60      -----D----QHDIF-GL------EM-GPGLA--------GVMA--------GDA-NL--
A0A517MNB1      -----D----QHAIF-GL------EM-GPGLT--------RVLS--------EDV-KL--
A0A7C1EH96      -----D----IAGML-NL------SAGHRGIQ--------DYLF--------G-I-DL--
A0A142YJ13      -----S----LHEIF-EV------PS-EPGLC--------EVLS--------GEI-GW--
A0A517Z7D3      -----T----LHKLF-KL------RS-DIGLV--------DVLS--------GDV-DA--
A0A1N6KY57      -----S----VHELF-DQ------PC-VPGFS--------EVLR--------DEI-EL--
L0DK20          -----S----AHELF-DQ------PC-VPGFS--------EVLR--------NEV-NI--
A0A3L7UX05      -----T----LTRTL-EA------TD-MPGLT--------NLLK--------GQS-NI--
A0A517XRC2      -----S----IHKLF-DL------PL-TPGVS--------EVLC--------QEV-DP--
A0A6M5YH47      -----S----VQKLF-EL------PL-GPGVS--------EVLR--------QEV-DV--
A0A660UUK3      -----D----IADML-NL------PKGLRGLQ--------DMLF--------GK--SL--
A0A517ZHG5      -----N----VHRVF-GV------EE-QPGLS--------EVLL--------GTA-SL--
A0A1Z8MPL5      -----S----AHRFL-EM------PL-DEGLA--------EVLR--------GDV-AI--
A0A5C1AGE3      -----S----MHRLF-DL------PL-APGCS--------EILL--------SEL-DV--
A0A2Z3HEL7      -----C----VMKLF-EV------PL-TPGVS--------EVLR--------EEV-DV--
A0A142XAP8      -----S----IMKLF-EL------PL-APGVS--------EVLR--------QEV-DV--
A0A6P2DEK1      -----S----IMKLF-EL------PL-APGVS--------EVLR--------QEV-DV--
A0A5C6C1R5      -----S----LHENL-GY------EL-GVGVS--------DAVG--------GNV-DW--
A6BZU4          -----T----IHKLF-GL------AN-SIGLG--------DVLN--------GEI-DA--
A0A2D5GZ77      -----T----IHKLF-GL------AN-SIGLG--------DVLN--------GEI-DA--
A0A3D3R1Z6      -----T----IHKLF-GL------AN-SIGLG--------DVLN--------GEI-DA--
A0A517XG00      -----T----IHKLF-GL------AN-SIGLG--------DVLN--------GEI-DA--
A0A1G2YRE4      -----D----IAYLL-NL------PKSTKGLK--------DVLL--------G-T-EF--
A0A353Z859      -----T----VHRVF-DV------AG-DPGVC--------EVLS--------GAA-KP--
A0A2D6ST10      -----S----ICRVF-DL------PQ-IPGVC--------ELLR--------GES-SL--
A0A177QX42      -----R----IHKLF-GL------DL-ERGLS--------SVIR--------DGM-DL--
A0A517SHR0      -----R----VHKLF-GV------SI-DVGVA--------SVVR--------DGM-DV--
A0A2E0AW64      -----D----LYDVF-EI------PN-QPGFA--------DLLE--------DHN-SL--
A0A351FZ59      -----D----LYDVF-EI------PN-QPGFA--------DLLE--------DHN-SL--
A0A660V239      -----D----IAEML-NL------PKGSRGLQ--------DLLF--------GK--EF--
A0A177Q3B7      -----A----CHRVF-GA------PA-SPGFS--------ELLR--------NEN-SL--
A0A2E0X6Y6      -----G----LTTRL-SL------KR-DAGVA--------ELLL--------ADG-EI--
A0A518GFD7      -----S----LHSYL-EL------SE-GPGVS--------ELLH--------GST-KL--
A0A5C5VZJ8      -----S----LTAAF-RA------AG-TAGLL--------DDLS--------APS-PT--
A0A518GE37      -----D----QHDLF-GL------PN-EPGLC--------KLLG--------GQS-KL--
A0A5C6F3H8      -----D----QHEIF-GL------EM-GDGFA--------GVLS--------GKT-TL--
A0A5C5X072      -----D----QHEIF-GL------EM-GPGLT--------GVLS--------DKS-TL--
A0A5C5WUQ3      -----D----QHSLF-GL------DI-GPGLA--------GVLS--------GEV-EF--
A0A5C6E697      -----D----QHRLF-GL------EM-GPGLC--------SVLD--------GTT-SL--
A0A5C5Z1A3      -----D----QHRLF-GL------DM-GAGLS--------GVLS--------GQT-TL--
A0A5C6D2P7      -----D----QHRLF-GL------EM-GPGLS--------AVLS--------GKA-KL--
A0A5B9ML17      -----D----QHDHF-GI------SL-EPGLS--------GVLT--------NQA-TL--
A0A517LX75      -----T----LHKLL-GV------EA-SMGLA--------EYLR--------GDG-DL--
A0A7C5W7B3      -----DKNVYQEALLVQA------HQ-QHGLI--------HMLE--------NPD-IL--
A0A2S8F9B8      -----S----MHAIF-DC------PI-SPGVG--------ELLV--------NHV-KL--
A0A354GX32      -----A----AHKLF-GM------AA-GPGFS--------ELLR--------GEV-EP--
A0A142XL75      -----T----AHRVF-DA------PL-APGLC--------EILR--------GST-SV--
A0A6P2D5D5      -----T----VHRVF-DA------PL-APGLC--------EILR--------GSA-SI--
A0A5C1AAF0      -----S----AHGAF-GV------PS-GPGLA--------ELLR--------DEV-LD--
A0A7C7T8W8      -----S----QHNIF-NC------NI-GPGLT--------DVFD--------GTA-TL--
A0A5C6B3S0      -----V----LHQLF-EA------NL-QPGLS--------EWLS--------GRA-DV--
A0A368KP63      -----S----MHRIL-GL------PI-GPGVS--------DLLA--------GQA-EL--
A0A518GIZ9      -----M----ATRLF-GL------RP-DPGLV--------DVLQ--------GEI-AL--
A0A1C3EBY9      -----M----ATRLF-GL------RP-DPGLV--------DVLQ--------GEI-AL--
D5SX64          -----M----ATRLF-GL------RP-DPGLV--------DVLQ--------GEI-AL--
A0A517Z0U7      -----S----IHRVF-DF------EN-SPGIC--------DVLR--------QEV-PL--
A0A2S8FCC0      -----A----LDISF-DI------EL-TPGVT--------ELLS--------GEV-EF--
A0A1Z8MBT6      -----D----QHDIF-GL------AL-EPGLS--------DVVE--------EKS-TL--
A0A517SXN9      -----D----QHDIF-GL------AL-EPGLS--------DVVG--------EKS-TL--
A0A518HFL0      -----T----LGRLF-EV------PD-CPGLS--------DVLR--------GDA-QL--
A0A5Q3LBQ3      -----D----IHTIF-EI------PM-EPGLS--------KVLD--------YQC-DV--
A0A3B8ZJM2      -----R----LQKLF-GF------DA-DVGVA--------QLVA--------GQC-EL--
A0A1U7CLW1      -----S----LHDVF-DF------PS-GPGLG--------DILR--------GEI-GW--
A0A142WPR7      -----R----IHKLI-GQ------NT-SLGVS--------SVIA--------GTA-EL--
A0A3M1TFJ0      -----R----VHKVF-AA------DP-APGLR--------NALE--------EGE-GL--
A0A517P477      -----S----THRVF-GC------ES-GPGLS--------DVLR--------GEK-SA--
A0A517T4K9      -----S----VHEVF-DI------PL-GPGLS--------EVLL--------GDI-DA--
A0A7C6B2Q1      -----A----IHDVF-NV------PL-SPGVS--------EVLR--------AEI-SL--
A0A7C4QPD3      -----T----LEREF-NL------PR-QRGFC--------ELLA--------GSI-SL--
A0A2Z3GZZ5      -----R----VHKLFAGA------DATGTGLA--------EVIA--------GVR-PL--
A0A4V0I6L6      -----R----VHKLF-GL------EKPATGLA--------SVVA--------DRA-DL--
A0A7C4QQT3      -----S----CHRLL-GV------SL-DIGLS--------DVLK--------GEI-AP--
A0A255QXF5      -----D----QHDVF-GL------PL-EPGLN--------EVLR--------EVV-PF--
A0A518KBI5      -----S----VTDLL-DV------PA-GPGLC--------EVLG--------GKL-SL--
A0A5C5V6Q5      -----S----INDLV-DA------EP-GPGLY--------EVLS--------SRC-SI--
A0A517MY49      -----G----MTALL-GL------KS-QHGVA--------DLLL--------SDE-PI--
A0A2E6AG00      -----G----MTRLF-EL------RG-QEGLS--------DLLR--------SDV-DV--
A0A1G3A880      -----G----LTTLL-GM------KG-AAGVS--------DVLR--------GDG-EV--
A0A2E8ATT1      -----G----LSRLL-DM------RG-TSGLS--------DVLR--------GEG-AV--
A0A7C2JZW2      -----S----LEKEF-GI------GT-GPGLC--------EVLD--------GRV-TL--
A0A518KYQ0      -----D----QHDVF-GL------AL-EPGLN--------EVLR--------KAV-PL--
A0A5B9QX47      -----D----QHDIF-GL------EM-GPGLC--------GVLS--------EEA-TL--
M5T666          -----D----QHEIF-GL------EM-GPGFT--------SVLS--------KES-QL--
M5U6N6          -----D----QHEIF-GL------DM-GRGLT--------SLLA--------KQT-EL--
A0A517M0G2      -----D----QHAIF-GL------DL-GPGLS--------KVLS--------GDI-EL--
A0A5C6AST1      -----D----QHDIF-GL------EM-GPGLA--------KVLS--------GEA-TF--
A0A5C6C951      -----D----QHAIF-GL------EM-GAGLS--------KVLS--------GEV-DF--
A0A5C6C5T3      -----D----QHEIF-GI------EM-GPGFT--------GVLA--------GKS-TL--
A0A2A2W6A9      -----D----QHDVF-GL------AL-EPGLN--------EVLR--------KAA-PL--
A0A518HQS9      -----D----QHDVF-GL------AL-EPGLN--------EVLR--------KVV-PM--
A0A5M6DFE6      -----D----QHDVF-GL------TL-EPGLS--------GVLL--------NEV-KF--
A0A5C6F286      -----D----QHEIF-GL------EM-GVGFA--------GVLA--------GKA-TL--
A0A517NGN1      -----D----LHDVF-GI------DL-SPGLT--------GVLG--------GRV-EL--
M5RUI3          -----D----QHEIF-GL------EM-GPGLS--------GVLS--------QTA-TL--
A0A660VT66      -----R----LHRTF-EA------DN-SVGLS--------TVLA--------GKA-SL--
A0A7C2VEF7      -----M----QHNIF-EF------EN-NRGLS--------GVLA--------GTI-AL--
A0A0S8H0S8      -----M----QHEVF-DV------AC-EPGLT--------GLLA--------GTA-GL--
A0A7C2ZTD2      ----------------DI------A----NLL--------NLPK--------GSR-GL--
A0A2E3Z6T8      -----G----FTTLM-QL------KG-QPGVA--------DLLT--------SPE-TP--
A0A257WQ92      -----S----VHTLF-NL------PT-DIGLA--------DVLA--------GEI-QG--
A0A7C1U6X6      -----T----LSKRF-GL------AD-EPGFM--------ESLR--------ARS-----
A0A7C7UXI5      -----G----LTPLL-DL------KG-PKGLS--------GVLR--------HEA-PV--
A0A7C3SFJ0      -----S----AHRIF-DL------PQ-SPGLC--------EVLR--------NEA-RL--
A0A7C7WWF7      -----G----LSTMF-CY------RK-MPGLS--------DFLQ--------SEE-PI--
A0A356ETW1      -----G----LTNLM-QM------RQ-QEGLS--------TVLR--------SNA-HV--
A0A3L7NJY1      -----G----LSTLL-GL------RD-DFGLS--------RLLR--------STD-NL--
A0A523CME0      -----S----INRLL-GF------IP-DKGVS--------DYLS--------EDL-DL--
A0A354PCV3      -----D----QHRLF-GV------EM-GPGLS--------GVLA--------GTT-PL--
A0A354PHB4      -----D----QHRLF-GV------QM-GPGLV--------AVLA--------GKT-PL--
A0A356ESF4      -----G----LTSML-DL------RG-AEGLS--------NLLG--------GNG-KVGA
A0A538RV31      -----S----VHQLF-DM------PV-EPGFS--------GVLR--------GDV-DL--
                                                                            

M5S2L2          --SEA----CQQTPLST---------LQ-VMPSGP-IPANPA--EALTLP-EMGELIEL-
A0A2Z3GYP4      --A----DAIQMTAIPN---------LS-VLPCGR-RPSNPA--ELLTTP-AFEDVLDD-
A0A7C2VXA0      --K----EAIEHGPVPG---------LD-ILHCGM-ELPNPS--EVLNSV-LFGGMLQE-
A0A7C3AA48      --D----QSVRPSGVPG---------LD-ILPCGP-DVPNPS--EMLNSE-TFTDMMAK-
A0A3L7SU85      --Q----EAIHTCEVPG---------LH-LIPCGP-RPANPS--ELLTSP-RFSEVIEE-
A0A3M1RAJ8      --E----EIVRETDRDN---------LW-LIPAGR-CDTEAL--QALARS-DPERLFEV-
A0A2D6A9B6      --D----EAIRPSGIPG---------LD-IIGAGS-RPKNPS--ELAASR-RVDELLGQ-
A0A2G6JGH3      --H----QAIRNSGVES---------FD-LIGPGG-MPTNPS--ELLSSR-RIDELIAR-
A0A7C5PFV3      --R----SAIRNAGKPG---------LD-FIGAGL-QKVHPA--EFLSSG-KVEELLST-
A0A7C3QGD2      --D----TVIFPTEVEN---------LS-LLPSGP-LLQSPA--PYLRSE-RFRALLPE-
A0A3D4PLL5      --EESALKHITKTRLEN---------LD-VISAGP-RPSNPV--ELLTSE-RFEELIGW-
M5RD30          --D----KCIQSTPIET---------LS-VMAHGS-RTSEPA--ELLESF-RLSGLLRS-
A0A1V6CUG1      --RDV----VVPTVYPN---------LF-FLPPGN-AAGNVG--ELMGRP-ELMEIVGE-
A0A3M1SE88      --EEAAVKTIRSTGIEN---------LD-LLPAGP-RALHPA--ELLSGS-RLAELLAW-
A0A7C2ZUK5      --ARL----VHGTGLPD---------LS-IMPAGL-PPDNPA--ELVSSE-RMADLLNE-
A0A660WB30      --SQL----LVKTDFDK---------LT-MLQAGK-VPANST--ELLNSE-KMRHLIME-
A0A660W9Z7      --ADA----LVYSEQDN---------LA-VLPTRH-GQHNAT--ELLETP-AMKKVIAD-
A0A3M1R9K7      --QQV----CRDSGIEN---------LD-IIPAGQ-WSYRGM--AVLANG-VVGGLFRS-
A0A3L7PH51      ------------LGVEG---------LD-FMPSGP-RPANPS--ELLSSE-RFSDIIAW-
A0A3N5UQY5      --SQA----IQPTQVPG---------LS-LLTCGY-GIGNPA--EVLNSP-QFAKLLAY-
A0A7C2JY73      --LNA----VRPGGVDT---------LS-VLPAGR-PPTNPA--ELLTSS-GFAQTLAE-
A0A356AE44      --ANA----IQDSRIEN---------LH-ILSAGA-IPAKPA--ELLSSS-KLHYLLGQ-
A0A1G2XSU7      --RDL----LLYSDVPG---------LS-VLTAEP-CDISII--NRLIHHKNMVEFINE-
A0A350KD81      --QTA----IRETRVTH---------LS-ILTAGM-LPENPS--EMLMSR-GFSELVKQ-
A0A2D6SRY7      --QEN----LRSTSVEG---------LH-VLPAGQ-SPPNPA--ELLASE-RTRTLIRE-
A0A1G3C300      --ESI----IKHVNIPH---------LN-IITCGL-IPPNPS--ELLGSH-SMEKFCDN-
A0A524HC32      --VYS----YNKFHKN----------LK-VILSGP-VSPNPV--ELLASK-RFQILLQG-
A0A177PV03      --KDA----VKPTAVEG---------LS-ILPCGP-RPANPA--ELLTSP-AFEQLLAD-
A0A1G2YIM0      --DES----VWPMPSVG---------LDVLISDGN-DSYDAF--ELLTRS-QTPSRLKA-
A0A1G2ZG92      --DET----IVHTDVSG---------LD-LLTSGP-IPPDPS--SLIESQ-KLRDIVNK-
A0A1G3A0W0      --KRH----IFPTDTFG---------LN-IMPAGK-HNDGAV--IEETANGAFKACMSQ-
A0A353BE27      --DDA----ICAGPVAN---------LS-ILPGGK-RPANPA--EILSSE-RFRNMIDM-
A0A5C6BPW1      --EEA----IKSPSDDG---------PD-VLPAGQ-FNSQLL--AALAQD-GLGKIFEE-
A0A1I3GSP0      --QNA----VRPTQIEN---------LS-LMTAGL-CPENPA--ELLSTG-TLQVMLRR-
A0A517QJV1      --QNA----IRETPSEN---------LS-VITAGL-CPENPA--EILSQV-NLPALLNE-
A0A3C1QS25      --AEA----AIETQVPG---------LY-FIPCGE-RPSNPA--ELLTSP-KLPEFIEI-
A0A5C6FX55      --QEA----CHSTPLGH---------LD-VMPSGP-IPANPA--EALTLP-EMAETLEQ-
A0A5C6DS51      --AEA----ASKTSVEN---------LD-VMPHGT-ETSVPA--ELLQSN-RMGLLLQS-
A0A5C6DSL6      --AQS----VTHSSVEN---------LD-IMPHGT-ETSVPA--ELLQSN-KMSLLIQA-
A0A3M1VG27      --QTA----VQHTVENN---------LD-VLPAGL-PVDNPA--ELLSSH-AFRHLLQT-
A0A518GC22      --EDG----IHVGPVAN---------LS-IMPGGK-RPANPA--EILSSQ-RFKNMVDV-
A0A3L7Q373      --VNA----VRSTRLEN---------LS-VLTAGR-CPSNPA--ELLSSL-RLGETLRA-
A0A3E0PW54      --MNA----LRETPVEG---------LS-VMTAGA-CPENPA--ELLTAS-DLDGLLRA-
A0A7C3TAH2      --CYV----LCKTGIPE---------LDSLVPAGA-PAADPY--EVISST-DLAHKVDL-
A0A1Z8MHR4      --EEA----VCHSPIDN---------LD-ILPCGP-LPANPA--EALALA-EVAEVFRW-
A0A5C6EHJ0      --DAA----IHPSLVAN---------LS-VMTAGE-RPDNPS--ELLSSP-NFDRLLSV-
A0A5C6F1H9      --QAA----ITRSVVAN---------LS-VMTAGE-RPDNPS--ELLSSP-NFDRLLNL-
A0A255QXY0      --SEA----IHETSIDY---------LD-VLPCGP-LPANPA--EALTMP-DLVEIIAW-
A0A517SYI0      --EEA----VCHSPIDN---------LD-ILPCGP-LPANPA--EALALA-EVAEVFRW-
A0A518HX54      --AQA----VHQTPIEN---------LD-ILPCGP-LPANPA--EALTLA-ELADVFQW-
A0A5B9MF59      --AEA----VHQSPIEN---------LD-ILPCGP-LPANPA--EALTLA-ELAEVFQW-
A0A2A2WC24      --AEA----IHQSPIEN---------LD-ILPCGP-LPANPA--EALTLA-ELAEVFQW-
A0A518KYW8      --AEA----IHQSPIEN---------LD-ILPCGP-LPANPA--EALTLA-ELAEVFQW-
A0A5C5YZZ0      --KDA----IVETDAEN---------LF-VLPSGP-KPNNPA--EALMLP-EFGQILDE-
A0A518JLD2      --NEA----IQDTVVPN---------LS-AMVAGN-PPDNPS--ELVTSE-AFEQILSA-
A0A5M6DJ15      --KEC----VRRQSQLR---------YY--MSAGS-VENVNL--AAAAQE-SIPRLFDE-
A0A3L7P7S7      --QEA----IHTCAVPG---------LH-LMPCGP-RPANPS--ELLTSP-KFVEVIDE-
A0A517N8M1      --MDA----CRQTPLRN---------LF-VMPSGA-IPANPA--EALTLP-DMQNMIEM-
A0A5C6CW01      --SEA----CHETPLST---------LQ-VMPSGP-IPANPA--EALTLP-EMGELIEL-
A0A5C6BXS9      --VDA----IHDTPLAT---------LK-LMPSGP-IPANPA--EALSLP-EMSELLDL-
M5U569          --IEA----IHDTPLAT---------LK-LMPSGP-IPANPA--EALTLS-EMGELLEL-
L7CND7          --VDA----AHDTPLST---------LK-MMPSGP-IPANPA--EALTLP-EMSELLDV-
A0A0J1B8S4      --VDA----AHDTPLST---------LK-MMPSGP-IPANPA--EALTLP-EMSELLDV-
F2ARR3          --IDA----AHDTPLST---------LK-MMPSGP-IPANPA--EALTLP-EMSELLDV-
K5D8H6          --VDA----AHDTPLST---------LK-MMPSGP-IPANPA--EALTLP-EMSELLDV-
M2AKU0          --VDA----AHDTPLST---------LK-MMPSGP-IPANPA--EALTLP-EMSELLDV-
A0A5B1CKI2      --SDG----CHSTPLNN---------LF-VMPSGP-VPANPA--EALTLP-EMGSMLEV-
A0A5C6EG84      --LDA----CHATPLRN---------LF-VMPSGA-IPANPA--EALTLP-EMGNMMEM-
A0A5C6F2X4      --LDA----CHVTPLRN---------LF-VMPSGA-IPANPA--EALTLP-EMSNMMEM-
A0A5C5XTV6      --GDA----IHDTPLAT---------LK-LMPSGP-IPANPA--EALSLP-EMSELLDM-
A0A5C6AAB1      --IEA----IHDTPLAP---------LK-LMPSGP-IPANPA--EALSLP-EMSELLEL-
M5T8W8          --IEA----IHQTPLAT---------LK-IMPSGP-IPANPA--EALTLT-EMGELLEL-
M5SF00          --VDA----AHDTPLST---------LK-MMPSGP-IPANPA--EALTLP-EMSELLDV-
A0A2G1WDS1      --VDA----AHDTPLST---------LK-MMPSGP-IPANPA--EALTLP-EMSELLDV-
Q7UVS9          --VDA----AHDTPLST---------LK-MMPSGP-IPANPA--EALTLP-EMSELLDV-
A0A5C6B601      --GAA----VHETPIEN---------LD-IMACGP-LPANPA--EALTIA-ELSDVFDW-
A0A517PFU1      --DEA----LVESGQPG---------LW-LLPCAA-RPDHPA--ELLSSE-AYETFLDV-
A0A5B9M8J9      --GRA----VHQTPIEN---------LD-ILPCGP-LPANPA--EALTLA-ELADVFQW-
A0A2A2WFP6      --AQA----VHQTPIEN---------LD-ILPCGP-LPANPA--EALTLA-ELADVFQW-
A0A518L8N2      --AQA----VHQTPIEN---------LD-ILPCGP-LPANPA--EALTLA-ELADVFQW-
A0A518HQN9      --AEA----VHQSPIEN---------LD-ILPCGP-LPANPA--EALTLA-ELAEVFQW-
A0A5M6D8H8      --TEA----IHTTPIEN---------LD-ILPCGP-LPANPA--EALTLA-ELGEVLAW-
A0A5B1CRW9      --VDV----ISASEVPN---------LD-VMPNGS-PTAEPA--ELLESH-QLMRLFQH-
A0A5C6EI46      --ADG----VVETEVQN---------LH-IMPNGS-NTSEPA--ELLESH-RLMRLFQN-
A0A2E7D3V4      --PNA----VKESGIEG---------LQ-ILTAGT-PVGSPA--ELLSSA-RMASTIEA-
A0A5B9PER9      --KDC----VFEVAEIEG--------MS-IMPCGS-KPSNPA--ELCSSP-QVKDLIDE-
A0A517QSM4      --EGA----AQPTPTPG---------LS-VIPAGR-VDSAAL--QALAEG-GAGQIFKH-
A0A355GJI7      --QTA----IRETRVSH---------LS-ILTAGM-LPENPS--EMLMSR-AFSELVNQ-
A0A1Z8MCI4      --DDA----IVAVGK-----------LD-FLPAGR-LSAPPF--GIFSEG-NVSGFIDS-
A0A517SYL7      --DDA----IVAVGK-----------LD-FLPAGR-LSAPPF--GIFSEG-NVSGFIDS-
A0A3L7P0L2      --FNA----VRTTRLEN---------LS-VLTAGL-CPPNPA--ELLSSS-RLPDMLNA-
A0A6M5YVJ1      --VAA----VRPTDVPG---------LS-VLTAGE-WTLVTR--QALVGN-GWRAVKEQ-
A0A2E0SHG0      --PDA----IQETEVEN---------LT-ALPCGP-VPENPA--ELLNQE-SFSRLLAV-
A0A518CQB8      --QDA----VQETEVKG---------LT-ALVCGP-VPDNPA--ELLNQE-SFTSLLAV-
A0A517SCC8      --VNV----IKTTPFAT---------LS-VMTAGL-SPENPA--ELLSGS-GFGALMRQ-
A0A3A0DR44      --TDA----IVEEVAEG---------VH-LLPAGR-VATSPH--NYLGNG-AIPKLVAQ-
A0A358MY60      --ADA----VDDTLGEL---------VH-VLPAGR-MTLSPH--RLLSSE-GMRTLLDE-
A0A517MNB1      --EDA----VDKSLGDL---------VH-VLPAGL-MHQSPH--RLLNSS-AIRDLLDQ-
A0A7C1EH96      --QKT----LYPVEGMP---------LF-VLASDD-RNIQDA--FELLSLPDTAARMRK-
A0A142YJ13      --EGV----VRETEVRD---------LS-LILAGR-CNPEAI--ELLPRQ-PLPDLIIA-
A0A517Z7D3      --ETA----MQETAVEG---------LR-VLVAGA-PPANPA--EALSSA-RLGRTLHE-
A0A1N6KY57      --IDA----VQPTLISG---------LS-LLTAGF-SDSDSI--QTLASR-DLRAMFDQ-
L0DK20          --ADA----IQPTAASG---------LS-LLTAGL-SDNETI--QALACR-DLRVMFDQ-
A0A3L7UX05      --DKC----LVRIGEGGG--------FH-LLPAGT-IHGDPS--RILESA-KLGKIMAH-
A0A517XRC2      --SDA----VQPTAVPN---------LW-VIPAGQ-CSTRVI--AALAQGHPLETLFNR-
A0A6M5YH47      --SDA----VQATAVPN---------LW-VITAGQ-CSNATI--AALAQGHPMETLFNR-
A0A660UUK3      --AES----VYELSPTG---------LH-ILAADR-RNCSDA--LDLLRQTHTVDCMKN-
A0A517ZHG5      --EEA----IKSPSDDG---------PD-VLPAGQ-FNSQLL--AALAQD-GLGKIFEE-
A0A1Z8MPL5      --ENA----IRPSRMPG---------LR-FLSAGH-CDPTSL--QALTKK-NLSEIFEK-
A0A5C1AGE3      --SDA----VQPTTVPN---------LW-VIPAGQ-CSNRVI--SALAQGHQLESLFNR-
A0A2Z3HEL7      --SDA----VQATAVPN---------LW-VIPAGQ-CSNATI--AALAQGHPLETLFNR-
A0A142XAP8      --SDA----VQATAVPN---------LW-VIPAGH-CSNATI--AALAQGNPLKTLFNR-
A0A6P2DEK1      --SDA----VQATAVPN---------LW-VIPAGH-CSNATI--AALAQGNPLKTLFNR-
A0A5C6C1R5      --KDA----VHATSPN----------AF-FMTAGS-SRPVNL--SAVGAK-TLPQLFSE-
A6BZU4          --QTA----IRETRVTH---------LS-ILTAGM-LPENPS--EMLMSR-GFSELVKQ-
A0A2D5GZ77      --QTA----IRETRVTH---------LS-ILTAGM-LPENPS--EMLMSR-GFSELVKQ-
A0A3D3R1Z6      --QTA----IRETRVTH---------LS-ILTAGM-LPENPS--EMLMSR-GFSELVKQ-
A0A517XG00      --QTA----IRETRVTH---------LS-ILTAGM-LPENPS--EMLMSR-GFSELVKQ-
A0A1G2YRE4      --EQA----VSSIRSTG---------LN-VLAMHS-CHRVDA--YELVASPETANIINK-
A0A353Z859      --ADV----IQESTQPN---------LF-VIPAGI-LASESL--RNLAQD-GLGALMEH-
A0A2D6ST10      --DDC----TREVAPEG---------LS-VIPAGK-IDHTVL--RLLAED-AVGELFEN-
A0A177QX42      --PDA----VQTTLVPN---------LD-VMTVGP-RVDNPA--ELLLSP-QFTELVQQ-
A0A517SHR0      --PDA----IQSTLVPN---------LD-VMTVGP-RVENPA--ELLLSP-EFTVLVQQ-
A0A2E0AW64      --GGY----VTKWDEH----------CH-VLPAGQ-LTSSPH--RLLANG-AFSGMLKE-
A0A351FZ59      --GGY----VTKWDEH----------CH-VLPAGQ-LTSSPH--RLLANG-AFSGMLKE-
A0A660V239      --AKL----VYNTGAVG---------MD-VLAADR-RNVSDA--LDLLGKPRTGECIEQ-
A0A177Q3B7      --EEV----LQATPLDH---------LT-LMAAGR-WNYQTS--QFLARE-RMPDILAA-
A0A2E0X6Y6      --ADN----APRFVQKTVVER-----LD-VIPTGL-RRQNPA--ELLGSV-RFAELLAW-
A0A518GFD7      --THA----IQETTTRN---------LH-VITAGG-ELCSVT--ECESDG-SLAALLNK-
A0A5C5VZJ8      --VTV----HSTDTPN----------LS-LVPVGR-IAKPED--AELFANGAFGRLLEA-
A0A518GE37      --SDC----IDKSLGDL---------VH-VIPAGR-LHANPH--NLLTKS-KMEKLFAD-
A0A5C6F3H8      --IEA----VDTSLGAL---------IH-VLPAGR-LTASPH--RLMSPS-GMKDFVDH-
A0A5C5X072      --DDA----VDKSLGSL---------IH-VLPAGP-LSASPH--RLISPK-KFETFVKE-
A0A5C5WUQ3      --EQA----IDSTLGHL---------IH-VMPAGP-LKANPH--RLINQA-SMKKFLDQ-
A0A5C6E697      --SDA----VDTSLGER---------FH-LLPAGL-LKTSPH--RTIGPE-AFNRFMNE-
A0A5C5Z1A3      --TEA----IDTSLGDL---------IH-VLPAGK-LTTSPH--RMLNPK-AMKAFISD-
A0A5C6D2P7      --SDA----TDKSLGDL---------VH-LLPAGP-LSSSPH--RLINPD-TMRAFISQ-
A0A5B9ML17      --DEA----IQTELGDL---------IH-ILPAGR-LKASPH--RLMSPE-SMKSLVSD-
A0A517LX75      --ESA----TVQTEVAG---------LD-FISHGH-HPSDPA--ELLESF-GMERLIAE-
A0A7C5W7B3      --PEN----ILSATEITE--------LV-VVGAGG-VAHNPP--RLLRSE-AFANLLKM-
A0A2S8F9B8      --DEA----IQPTNIPN---------VD-LIPAGS-SEQSIP--RSATSG-RLAELYRE-
A0A354GX32      --GQV----VQNTPLEN---------LS-LLAAGA-CDHQAL--QALAQEGILRNVFDE-
A0A142XL75      --LEA----VRPTGIPG---------LS-ALTAGQ-WTLATR--HALVGD-RWRETKDQ-
A0A6P2D5D5      --AEA----VRPTGIPG---------LS-ALTAGQ-WTLATR--HAIVGD-RWRVTKDE-
A0A5C1AAF0      --RDV----IREVRAN----------LF-FIPAGA-CDDASL--CALARG-VLAADFRR-
A0A7C7T8W8      --DET----IVQWDDF----------VS-VLPAGE-LTRNPN--ALLTYE-SLTALLEK-
A0A5C6B3S0      --ISV----IQPTGIEN---------LS-LVAAGR-RNESTL--GQLAGD-EIENVFQT-
A0A368KP63      --ADV----VKATDIPN---------VS-FLPAGV-EEQSIS--RGATSG-VLDAILGD-
A0A518GIZ9      --ENA----IVETVVEG---------LT-ILPSGR-PPHNPA--ELLEGG-PLRQLIAK-
A0A1C3EBY9      --ENA----IVETVVEG---------LT-ILPSGR-PPHNPA--ELLEGG-PLRQLMAK-
D5SX64          --ENA----IVETVVEG---------LT-ILPSGR-PPHNPA--ELLEGG-PLRQLIAK-
A0A517Z0U7      --EEA----IKQGSPDG---------LS-ILPAGK-VDQTVL--RLLAQD-ELGNLFKE-
A0A2S8FCC0      --DDA----IQQTGIGT---------LD-IVAAGD-WGHNSL--RELTSD-RMDSFFKS-
A0A1Z8MBT6      --DDA----INRELGDL---------IH-ILPAGR-LKASPH--RILTTE-AVQGLIAR-
A0A517SXN9      --DDA----INRELGDL---------IH-ILPAGR-LKSSPH--RILTTE-AVQDLIAQ-
A0A518HFL0      --EDA----LVPISQVGG--------CQ-LLPAGS-PEPNPN--RILRGK-NFAPMLER-
A0A5Q3LBQ3      --QDA----IVTDWGEG---------VH-LLPAGR-LHKSPH--KLLGNA-SFATILKN-
A0A3B8ZJM2      --DDA----TYTTCVAN---------LS-IMPGGK-RPNNPA--ELLSSS-RFAELIEI-
A0A1U7CLW1      --TDA----VRQTPVPG---------LS-LIFAGR-CDPATI--DLLPRE-DFPNLLQE-
A0A142WPR7      --VDA----IQDTPVEN---------LA-VLGCGP-RPDNPA--ELLTGK-RFDELLGV-
A0A3M1TFJ0      --EFL----Q-STDVEN---------LY-LLPAGQ-GEENAA--NLLGSGEAFARLIGG-
A0A517P477      --EEV----EIPLHGSE---------LR-LIPAGD-VCDTAL--AGFGTA-AMAECLDD-
A0A517T4K9      --EDA----ITSPNADA---------PF-ILPAGK-FDRTVL--RQLSMG-KAEQIVES-
A0A7C6B2Q1      --QDA----IQATSIEN---------LY-VLSAGY-WSPHRL--AVLTNG-VLGAMFRQ-
A0A7C4QPD3      --ADA----IHPSPLAE---------LD-LLPAGS-LDDNVR--GLLARG-AQAQLLQS-
A0A2Z3GZZ5      --ADG----IVASGAPG---------LD-LLPCGP-RPANPA--ELLGSP-QFQRVLAE-
A0A4V0I6L6      --GDA----IRACEVEN---------LS-LLPCGP-IPANPA--ELLTSP-RFQDVLSD-
A0A7C4QQT3      --LNA----IQQTAIEH---------LA-LLTAGQ-VPANPA--ELLASP-QLTELFRD-
A0A255QXF5      --EQA----INKELGDL---------VH-VLPAGR-LKASPH--RLLSTS-SMRDLLDQ-
A0A518KBI5      --NEA----IQPVPATEH--------LF-VLRAGS-CAGAPH--HLAQPQ-RLQKLVEA-
A0A5C5V6Q5      --SDA----IRPAKGTDN--------LY-VLRAGD-CDDSPH--RVAQPA-RIAALVSR-
A0A517MY49      --AEQ----VGNYLHHTEVPG-----LD-VVPAGI-RRTNPA--ELLSTD-QFVELLAW-
A0A2E6AG00      --RDR----AASLICKTSCEC-----LH-VLPSGS-RPLDPT--GLLASN-QFGELLAW-
A0A1G3A880      --ARL----AAQCVCRSAVAG-----LD-VLGSGP-RRPNPS--ELLAGP-RFADLLAW-
A0A2E8ATT1      --GEI----CERLVQSADVPH-----LD-ILPCGP-RPADPV--ELLSGT-RIVDLLGW-
A0A7C2JZW2      --DQA----ICHTELQE---------LD-LLLAGQ-LTDKVR--GMLARD-EHAPLFRE-
A0A518KYQ0      --KEA----INRELGDL---------VH-VLPAGH-LKASPH--RLISPD-SMKELMDE-
A0A5B9QX47      --KDA----VDTSLGDL---------IH-VLPAGH-LTSSPH--RLINPS-AMRDFVDR-
M5T666          --VDA----VDSSLGNL---------IH-LLPAGR-LNASPH--RLISPA-NVTAFVDA-
M5U6N6          --KDV----VDTSLGNL---------IH-LLPAGR-LSASPH--RLINPA-NIDNFVSS-
A0A517M0G2      --KDA----VDTSLGEL---------VH-VLPAGK-MHQSPH--RLVSAS-SIRDLLDQ-
A0A5C6AST1      --DEA----VDRTLGDL---------VH-VMPAGH-MNMSPH--RLLNAS-ALRELLDD-
A0A5C6C951      --DNA----IDRSLGDL---------VH-VMPAGQ-LDMSPH--RLLNAS-ALRDLLDR-
A0A5C6C5T3      --DGA----VNSSLGRL---------IH-ILPAGQ-LSASPH--RLVSPT-SIKSFVDD-
A0A2A2W6A9      --KEA----INRELGDL---------VH-VLPAGR-LKASPH--RLISPD-SMKELMDE-
A0A518HQS9      --KEA----INRELGDL---------VH-VLPAGH-LKASPH--RLVSPD-SMKELMDE-
A0A5M6DFE6      --EDA----VRTELGDL---------IH-VLPAGR-LKASPH--RLMSPA-KMRELIDQ-
A0A5C6F286      --AEA----VDTSLGGL---------IH-VLPAGR-LTASPH--RLVSPS-GIRDFIDD-
A0A517NGN1      --KDA----INRSLGNL---------VH-VLPAGR-LDASPH--RLITQS-GIETLIEQ-
M5RUI3          --EEA----VDTSLGSL---------LH-VLPAGR-LDRSPH--RLISES-SMRDFVDR-
A0A660VT66      --DEA----IRPTAVPL---------LD-IIPSGF-VPPLPS--ELLSGE-ALPRMLDE-
A0A7C2VEF7      --QDA----IQAGPIEE---------LD-ILSCGP-EVPNPS--EILNSD-AFAEILKEQ
A0A0S8H0S8      --QDA----IRFSGVER---------LD-VLPCGA-APDRPA--EMLHSP-AFRQMLAE-
A0A7C2ZTD2      --QDM----LFGKEFDRAVCSIPSIGLD-VLAADSRNADDAY--DLLALP-VVRQQINA-
A0A2E3Z6T8      --AQSAPPLIHSTIVKD---------LD-VLPAGL-RRPNPA--ELLSSK-AFIELLAW-
A0A257WQ92      --LNA----LRPTFVEN---------LQ-VLPAGQ-PPANPA--ELISTP-RLTQFLKS-
A0A7C1U6X6      ----VDQRYIFATETPG---------LS-ILPGGI-PNGDGSVFEGTANG-AFKACIDQ-
A0A7C7UXI5      --PDVVSEHIRPDVLPN---------LD-VLPAGP-RPTNPA--ELLATD-RFHELLAW-
A0A7C3SFJ0      --EDV----IRPTRVPG---------VW-LLPAGR-WDISAI--QALVND-ELHEQFAK-
A0A7C7WWF7      --DNACKSRIQETAVTG---------MH-VFPCGP-KPADPA--ELLSRS-RFDELVAW-
A0A356ETW1      --ADLCVALIQPTGIER---------LD-VLPSGP-RPANPA--ELLAGP-RFLELIDW-
A0A3L7NJY1      --ETSISQNLRVTVVEG---------LD-VISCGP-RPVNPA--ELLAGD-RFANLLAW-
A0A523CME0      --EEC----SATGLMPG---------LT-VIPAGN-RQANVC--ELLASD-KMGSFASR-
A0A354PCV3      --LDA----VNTSLGHL---------IH-LLPAGE-LTASPH--RLMSPQ-RLQAFMKD-
A0A354PHB4      --LDA----VNTSLGHL---------IH-LLPAGE-LTASPH--RLMSPQ-RLQAFMKN-
A0A356ESF4      AAAAV----IRPSGIAG---------LD-MLPSGP-RFANPA--ELLAQP-RLAELLAW-
A0A538RV31      --SEV----IRPTPAKN---------LW-VVPAGQ-CDVHTL--EALAQE-ALASVLAR-
                                              .                             

M5S2L2          LRDEFD--YLILDTPPLLVVTDPSITA--SMVDGVLLALRVRRKSKPNAKESVNILRSVG
A0A2Z3GYP4      LRAAYD--YVLVDSPPLLAVSDPCVVA--PRVDGLVLTIRVTKNGRPAAERARDLLVRLK
A0A7C2VXA0      LAQTYD--RVIIDSPPVGLVADSQILA--ATCDIVLLVLRAEKSTRRHSLYAKDSLMGVG
A0A7C3AA48      LSTRYD--RVVVDAPPVLPVTDACILG--ALCDVTLLVLRADKSTRKTAQQARDGLLSVG
A0A3L7SU85      LRKLYD--IVMVDTPPILAVSDPSIVA--PRVDGVLMVMRVTRNGRPAAEQAAEILGTLG
A0A3M1RAJ8      LRREFD--FVVVDTSPLLTAADSLAVG--RFMDGVLLSVIRDNSRLPLLLEAYQRLEEVE
A0A2D6A9B6      LKEQYN--YVLLDTPPIVPISDAGILS--AKSDGTLVVVALERAARRMVKEALEQLESVG
A0A2G6JGH3      LKEEYS--LIILDTPPAIPLTDAGVLS--AKCDGTILVVGLERAPRKLSKEARKQLVESG
A0A7C5PFV3      LKEEYN--YVLIDSPPALPFTDAGILS--AKADGTLLVVKLEVSSKKLTKMALQNLQELG
A0A7C3QGD2      LRERFD--FLFVDLPPVRSAADGLHVV--GLADAVLLVLAAGETRKDDATAAKRLVRGAQ
A0A3D4PLL5      AEGVYD--QILIDAPPSLAVTDPAIIG--RLVDGIILTVRPDRNKRRMIIRAAESVTSLG
M5RD30          CEQRFD--IVLVDAPPLLAVADPAIIA--PQVDGVLMTVRVLKNNRRSVERAGNVLEEIG
A0A1V6CUG1      LRRKYD--YVLFDTPPINVVSDAGILS--KAANEALLVVRMHRTHRESVDKALRLLHATN
A0A3M1SE88      VENVYD--QVVIDSPPVLAAGDTAILG--RLADGVLLVVQPEKNRRRVILRAAEYLTVLK
A0A7C2ZUK5      AVNGYVDGFILLDCPPFQAVSESAVLA--QLVDKVVLVVRWGKAGRENVKKLVEQVGR--
A0A660WB30      VKSRYPDRYIVVDSPPVLSTPEPDVLG--SQVDGIVLVVRAGMTPREMVEDVLLSLNP--
A0A660W9Z7      VREMFD--FVLIDTSPTLSTTDPMVLG--AMCDAVIIVVKAGSTQRESVEHAISLMYQAN
A0A3M1R9K7      LREQYD--FVIVDGSPVLPVADTRFVS--MHVDGVVMSVLRDVSRMPKVHAAYRTLAAFD
A0A3L7PH51      AEQIYD--QILIDAPPVLAVTDPSIIG--RIVDGAIVIVRPDKNRRKMVTRAIDSFRASG
A0A3N5UQY5      LGRAYD--RIIVDAPPVTAVTDAQILG--ALCDFTILVLRADRSTREITQRAIEALRGVG
A0A7C2JY73      ARREFD--LVFVDGPPLLAVSDPCIIG--QQTDGLLLVLRLGKTSLQAVRQARDLAQTHA
A0A356AE44      AKREYD--FVLVDSPPVLAVSDPCITA--QSVDTVMLIVRLHKNRRPSVKRALEIFEAHE
A0A1G2XSU7      ISRIFD--HVIIDTPPVLAAVDALLWA--SMVDGVILTSLAGHTETPDLKDTIERLKQIN
A0A350KD81      LRNEYD--YILIDTPPLVVVSDPSVIA--SIVDGVLLVVRIDKNRRGVIRKVQQIIQTNG
A0A2D6SRY7      LSDNFD--LVLVDSPPALPLTDASVLS--TEVNGVFLVVRAGMASLEAARRAKASLQNVG
A0A1G3C300      VRNRFD--IIIFDTPPTMTVTDAVVLS--RNVDGVVFVIKSGQTPKELTRRALLQYKNSK
A0A524HC32      LSSRYD--RVILDGPPYLGFADVLVLS--KQVDGIVLVSSMGETSRRTIEHFRKKMSIVN
A0A177PV03      LRKEYD--FVLVDTPPLLAVSDPSAVA--PRVDGVLLVVRFSKNARPSARRAKEILESMR
A0A1G2YIM0      IAAHYE--HVIIDTPPVLAVPDAIIWA--KMADAVVLASYAGHTQGPDVQRSLERLRAAG
A0A1G2ZG92      LKEMYD--MVIIDTPPVMAVNDATVVG--RIADGILLVIESGRATFSIVDHIKELFTKAG
A0A1G3A0W0      LRQWYD--FILLDSTPILPVADAMILS--SQVDGTIMVERELVSQRGTQIDALMRLTSGG
A0A353BE27      LRDKFD--VIVVDTPPLLAVSDPGAVA--GIVDGVLMTMRLRRNVKPLALRAKSILEGVG
A0A5C6BPW1      LKKKYE--FVVVDSSPVLPVTDSLMVA--QHVDAVILSIRRDVSRRPKVAATRDRLAMLG
A0A1I3GSP0      AREEYD--VVLLDSPPILAVSDPCIIS--PHADGLLLVVRMKKTKRATVQRVHETLQSHG
A0A517QJV1      MRSEYD--FIILDSPPVLAVSDPAILS--PHVDGISLVARLKKNKRAAIVRAMETLRVHG
A0A3C1QS25      ARQQYD--YVIIDSPPLLAVTDPSVIA--PRVDAVVLTFRLRKNIKLTSDRARDILASVG
A0A5C6FX55      LREHYD--YVLVDTPPLLVVTDPSILA--SMVDGVLLTLRVRRKSKLNAREAVNILSSVG
A0A5C6DS51      ARNQYD--IVLVDAPPVLAVADPAIVA--PLVDGVILTVRVCKNGRRPVERASRILSDIG
A0A5C6DSL6      ARKEYD--IVLIDAPPVLAVADPAIVA--PLVDGVILTVRVCKNGRRAVERAGRILREIN
A0A3M1VG27      LRVEYD--LVVVDSAPVLAVTDPCVVA--SLTDVVLFVVRLNKSRHSSTRRALELMHAHG
A0A518GC22      LRDKFD--MIVIDTPPLLAVSDPGAVA--GIVDGVLMTMRLRRNVKPLAVRAKSILESVG
A0A3L7Q373      IRGDYD--IVIIDTPPILAVSDPAIIA--PLVDGLLLVVRMGKNKRATAQRSRELIDSHG
A0A3E0PW54      AREEYD--VVIVDTPPVLAVSDPSIVA--PHADGVVLIVRMEKNKRAAIRRTLETLGGLD
A0A7C3TAH2      FGKQYD--HIIIDTPPVLAFPDALIWT--RMAGAVVIVSRIGKTATTDIEEARSRLVQTK
A0A1Z8MHR4      ARENYD--YVIVDTPPLLMVSDPAVVT--TYVDSTILVMRIRRRCRPNAREAVAMLRSAG
A0A5C6EHJ0      LRTKFD--MIIVDTPPLLAVSDPANLA--SRVDGVLLVVRLRKNIKPAVAQASRMLETLE
A0A5C6F1H9      LRKQYD--MIIVDTPPLLAVSDPANLA--SRVDGVILVVRLRKNIKPAVAQATRMLETLD
A0A255QXY0      ARDRYD--CIIVDTPPLLMVSDPSIVA--SYVDAAIMVMRIAHRCKPNAKEALSMLRWSG
A0A517SYI0      ARENYD--YVIVDTPPLLMVSDPAVVT--TYVDSTILVMRIRRRCRPNAREAVAMLRSAG
A0A518HX54      ARANYD--FIIVDTPPLLMVSDPTIVT--TYVDAAILVMRIRRRCKPNAKEAVAMLRWTG
A0A5B9MF59      AREHYD--FVIVDTPPLLMVSDPAVVT--TYVDASMLVMRIRRRCKPNAKEAISMLRAAG
A0A2A2WC24      ARENYD--FVIVDTPPLLMVSDPAVVT--TYVDAAMLVMRIRRRCKPNAKEAISMLRAAG
A0A518KYW8      ARENYD--FVIVDTPPLLMVSDPAVVT--TYVDAAMLVMRIRRRCKPNAKEAISMLRAAG
A0A5C5YZZ0      ARMQFD--LIIVDTPPLLSVTDASNVA--THMDGVMVVMRIGRNIKPMSKRATTLLRMLH
A0A518JLD2      LRVKFD--LIIIDTPPMLAVSDPSNVV--RRADGVILVARLRKNVKPVVAQASRMLETLE
A0A5M6DJ15      LRIHFD--FVIVDTPPILPVVDTRVIG--EHVDGCVLAVMRDRSRTPQLIAAAETLRAHG
A0A3L7P7S7      LRKMYD--IVLIDTPPILAVSDPSIVA--PRVDGVLLVMRITRNGRPAAEQAAEVLGTLG
A0A517N8M1      LREKFD--YVMLDTPPLLVVTDPSITA--SLVDGVIVALRIRRKSRHNAKESISILRSVG
A0A5C6CW01      LREDYD--YVILDTPPLLVVTDPSITA--GMADGVIMALRIRRKSKPNAKESVNILRSVG
A0A5C6BXS9      LRYEFD--YIVLDTPPLLVVTDPSILA--SMVDGVVLALKIRRKSKPNVKEAANILRNVG
M5U569          LRDEFD--YIIVDTPPLLVVTDPSILA--SMVDVVVMTLKIRRKSKPNLKEAANILRNVG
L7CND7          LREEYD--YIILDTPPLLVVTDPSITA--SMTDGVVMALKVRRKSKPNAKEAASILANVG
A0A0J1B8S4      LREEYD--YIILDTPPLLVVTDPSITA--SMTDGVVMALKVRRKSKPNAKEAASILANVG
F2ARR3          LREEYD--YIILDTPPLLVVTDPSITA--SMTDGVVMALKVRRKSRPNAKEAASILANVG
K5D8H6          LREEYD--YIILDTPPLLVVTDPSITA--SMTDGVVMALKVRRKSRPNAKEAASILANVG
M2AKU0          LREEYD--YIILDTPPLLVVTDPSITA--SMTDGVVMALKVRRKSRPNAKEAASILSNVG
A0A5B1CKI2      LKQKFD--YIIVDTPPLLVVTDPSIIA--SLVDGVVMALRVRRKSRHNSKESINILRSVG
A0A5C6EG84      LREKFD--YILLDTPPLLVVTDPSITA--SLVDGVVVALRIRRKSRHNAKESLSILRSVH
A0A5C6F2X4      LREKYD--YILLDTPPLLVVTDPSITA--SMVDGVVVALRIRRKSRHNARESINILRSVS
A0A5C5XTV6      LREEFD--YIVLDTPPLLVVTDPSILA--SMVDGVVVALKIRRKSKPNVKEAATILRNVG
A0A5C6AAB1      LREEYD--YIVLDTPPLLVVTDPSILA--SMVDGVVMALKIRRKSKPNTKEAAGILRTVG
M5T8W8          LRDEFD--YIIVDTPPLLVVTDPSIMA--SLVDAVVMTLKIRRKSKPNLKEAATILRTVG
M5SF00          LREEYD--YIILDTPPLLVVTDPSITA--SMTDGVVMALKVRRKSKPNAKEAASILANVG
A0A2G1WDS1      LREEYD--YIILDTPPLLVVTDPSITA--SMTDGVVMALKVRRKSKPNAKEAASILANVG
Q7UVS9          LREEYD--YIILDTPPLLVVTDPSITA--SMTDGVVMALKVRRKSKPNAKEAASILANVG
A0A5C6B601      ARANYD--FVIVDTPPLLMVSDPAVVT--TYVDAAMLVMRIRRRCKPNAKESVAMLRSAG
A0A517PFU1      LRQKFD--FILLDSPPVLAVSDPAATA--RLADGVVVVTRLHPRTRRRLGECLDTLDQAG
A0A5B9M8J9      ARENYD--FIIVDTPPLLMVSDPAIVT--TYVDAALLVIRIRRRCRPNAKEAAAMLRWSG
A0A2A2WFP6      ARANYD--FIIVDTPPLLMVSDPTVVT--TYVDAAILVMRIQRRCKPNAKEAVAMLRWTG
A0A518L8N2      ARANYD--FIIVDTPPLLMVSDPTIVT--TYVDAAILVMRIQRRCKPNAKEAVAMLRWTG
A0A518HQN9      ARDNYD--FVIVDTPPLLMVSDPAVVT--TYVDAAMLVMRIRRRCKPNAKEAISMLRAAG
A0A5M6D8H8      ARKHYD--FVIVDTPPLLMVSDPAVVT--SYVDAAMLVLRIRRRCKPNAKEAVAMLRSAG
A0A5B1CRW9      ACDSYD--LVLVDAPPVLAVADPAIIA--PFVDSVLLTVRVIKNGRGIVDDAIRILDDIQ
A0A5C6EI46      ACESYD--LVMIDAPPVLAVADPAIIA--PYVDSVLLTVRVTKNGRGTVEDAVRILNDIQ
A0A2E7D3V4      AKAEYD--FVLVDTPPLLAVSDPCIVA--PYTDGLLMVVCVGKNKRTTTRRAADLLDTHN
A0A5B9PER9      MRTEYD--FVIIDTPPLLAVTDACPIA--ARVDGVVLCIRIKKNVRISAERSTEMLRNLG
A0A517QSM4      LTEDYD--YVIVDSAPILPVADTLLLA--QDVDGVILTIRRDVSRLGNVAAAQQRLEMIG
A0A355GJI7      LRKEYD--YVLIDTPPLVVVSDPSVIA--SIVDGVLLVVRIDKNRRGVIRKVQQIIQTNG
A0A1Z8MCI4      LREHYD--LILVDTSPLNLTPETMLVA--ESFDHAIVSFMRDKSRAAYAAKMLDKLELLD
A0A517SYL7      LREHYD--LILVDTSPLNLTPETMLVA--ESFDHAIVSFMRDKSRAAYAAKMLDKLELLG
A0A3L7P0L2      AKKSYD--VIIIDTPPILAVSDPAIVS--PHIDGLIMVVRMGKNKRAAAERAREMIDAHG
A0A6M5YVJ1      LRAAFD--FVVVDTSPLLLVSDALLLA--READGVVVSVLMGVSQVALTEEAVSRLQTVR
A0A2E0SHG0      VREQYD--FVVIDSPPLLVVSDATAVA--PRADVVILNLRFKKNGRPEALRAIEILNGVA
A0A518CQB8      VREQYD--YVIIDSPPLLVVSDATAIA--PRVDSVILNLRFKKNGRPEATRAMEILQSVD
A0A517SCC8      VRDEYD--IVLIDSPPVLAVTDPCVIA--PQTDAMVLVVRMEKNKRASVTHTREQLDSYG
A0A3A0DR44      LREVYD--FVVIDTPPILCASESLVIA--KAADGTLLCALRDVSRSRQVRLASDRLNMAG
A0A358MY60      ALQNYK--YVIVDTAPVLSAGETLAVA--AQTDATLVCVMRDVSRSDAVLRSSKRLEAAG
A0A517MNB1      ALAKYR--YVVIDTAPVLAAGETLAIA--AETDATLVCMMRDLSRTDTAIRSQRRLEAAG
A0A7C1EH96      LRDEFD--YIIIDTPPALAFADAMVWA--KMADGVIMTSFVGHTSQTEMKQATKRLQEIK
A0A142YJ13      LREQYE--FIIVDSSPVLLVTDTLIIS--QHIDAVLFSVLRDVSQLPQIRAAFDWLTSMG
A0A517Z7D3      LRGECD--YIIVDTPPILAVSDPCIIS--PHCDGMLLVIRADKNQRPAVRRTQEILAAHG
A0A1N6KY57      LKEQFD--FLVIDSSPVLPVADALLIG--QHVDAVIFSIMRDVSRIPTVQAAYDRLARLG
L0DK20          LKEHYD--FIVVDSSPVLPVADALLIG--QHVDAVLFSIMRDVSRIPKVHEAYERLAKLG
A0A3L7UX05      LRENFQ--VVIVDSAPVLPVPDALLFG--RWVQGIVIAVRYDTSRFPMIERAYKRLSTLK
A0A517XRC2      LRGQFD--FVVVDSCPVLPVADALLIG--QHVDGVVFSIMQDISQLPKVMVASEKLHQLS
A0A6M5YH47      LRGQFD--FIIVDSCPVLPVADALLIA--QHVDGVVFSIMQDVSQLPKVMTATEKLNQLN
A0A660UUK3      IRNEYD--HVIIDTPPVLASADPLVWA--KMADAVIMACFAEHTSRPDLREAIERLEQIG
A0A517ZHG5      LKKKYE--FVVVDSSPVLPVTDSLMVA--QHVDAVILSIRRDVSRRPKVAATRDRLAMLG
A0A1Z8MPL5      LVDEFE--YIVVDSAPVLSVVDSLLIG--QQCDAAILSILRDKSRIVPVYETNERLRTTQ
A0A5C1AGE3      LRGQFD--FIVVDSCPVLPVADTLLIG--QHVDGVLISILQDISQLPKVLDASDRLSQLN
A0A2Z3HEL7      LRGQFD--FVIVDSCPVLPVADALLIA--QHVDGVVFSIMQDISQLPKVMTASEKLTQLN
A0A142XAP8      LRGQFD--FVIVDSCPVLPVADALLIA--QHVDGVVFSIMQDVSQLPKVVTASEKLTQLN
A0A6P2DEK1      LRGQFD--FVIVDSCPVLPVADALLIA--QHVDGVVFSIMQDVSQLPKVVTASEKLTQLN
A0A5C6C1R5      LRAEYD--FVIVDTPPVLPVVDTRVIG--EHVDAAVLSVMKDKSRIPQVVAAHETLKAHG
A6BZU4          LRNEYD--YILIDTPPLVVVSDPSVIA--SIVDGVLLVVRIDKNRRGVIRKVQQIIQTNG
A0A2D5GZ77      LRNEYD--YILIDTPPLVVVSDPSVIA--SIVDGVLLVVRIDKNRRGVIRKVQQIIQTNG
A0A3D3R1Z6      LRNEYD--YILIDTPPLVVVSDPSVIA--SIVDGVLLVVRIDKNRRGVIRKVQQIIQTNG
A0A517XG00      LRNEYD--YILIDTPPLVVVSDPSVIA--SIVDGVLLVVRIDKNRRGVIRKVQQIIQTNG
A0A1G2YRE4      LSPKYD--YIIIDSPPVLLFPDALMWA--KIAGSVMLTSFAGQTTTQDLREANQRLTQIN
A0A353Z859      LRAEFD--FVIVDSSPLLQVTDPLLAA--QSVDGVIVSIRRDVSQMPKVSSAIEKLQMMG
A0A2D6ST10      VKKQYD--FVIIDSAPVLFVTDSLLIA--QHVDGVLFAVRRDISRAMKVASAQQRLSMLG
A0A177QX42      LREKYD--FVLIDTPPILIVTDPAAVA--AHVDGVILVVRNTKRSRPQTRRVRETLDLIG
A0A517SHR0      LREKYD--FVLMDTPPILIVTDPAAVA--AHVDGVILVVRNTKRCRPQTRRVRETLDLIG
A0A2E0AW64      ARATYK--HIVIDTPPILAAGESMVMA--KAADATILCAKRDVTRMEQLKKSRERLKGAG
A0A351FZ59      ARATYK--HIVIDTPPILAAGESMVMA--KAADATILCAKRDVTRMEQLKKSRERLKGAG
A0A660V239      VSADYD--HVIIDTPPVLAFSDALLWA--RMADGVILTSFVDRTSRLDLKEAIERLEQAD
A0A177Q3B7      LRQQYE--YIVIDSAPVLPLVDSLLLA--QHVDGVVLSVLRRVSQLPLFESAVERLQSVG
A0A2E0X6Y6      AEANYD--QVLVDCPPVLAVSDAQVVG--RLVDGAVIVVRPDKNHRRMVIRAVENFAATG
A0A518GFD7      LRSHYD--LVIIDTPPVLPVIDARVIG--KYTDGVIFTLVRDRSRLPNAARACDLLKSYG
A0A5C5VZJ8      WKKAYD--VVLVDSAPLLMASESVMLA--QRVDGTIMVIREQHCRRHGLTEVIELLDSAG
A0A518GE37      LESEYR--YIVVDTAPVLPASETLAAT--SACDATLLCAMRDISRTDHVKRTQNRLLASG
A0A5C6F3H8      ALSHYS--YVVMDTAPVLSAGETLAVA--SAVDASLICVMRDVSRIDNVTRTTRRLEAAG
A0A5C5X072      ALEVYQ--YVVIDTAPVLAAGESLAIA--SAVDSTLICVMRDVSLKENVVRTTRRLEAAG
A0A5C5WUQ3      ALESYS--FVVFDTAPVLAAGETLAVV--SVVESTLVCVMRDVSRLDNVGRAMRRIQASG
A0A5C6E697      ACKRYR--YVVIDTAPVLSAAETLTVG--AAADATLLCVMRDVSRQDATQLTARRLQAAG
A0A5C5Z1A3      AMEKYT--YVVVDTSPVLSAGETLAIA--SAVESTLMCMMRDVSRMDSVRLATRRLEAAG
A0A5C6D2P7      ALKQYK--FVVVDTAPVLSAGESLAVA--ASVDSTLLCVMRDLSRVETVQLTTRRLQAAG
A0A5B9ML17      ILDRYE--YVIFDTAPVLSAGETLSVA--ASVDTTLVCAMRDVTRMDSVIRTTHRLESAG
A0A517LX75      ARQEYD--YVFIDTPPLLAVADPLIIA--AQVDSALLVVRVQKNGRRPVERSRELLVSSK
A0A7C5W7B3      LQEQFD--VVILDTPPVIAVVDAGVIA--EQVRGVLVVARWGITRNHELKGAVERVRHVR
A0A2S8F9B8      LRSLYD--FVIVDAGPVLGAPSTRLLAQPQYADGVILSIFKDVSQVTLVEDAKRILTSFG
A0A354GX32      LKEQYD--FLIVDVSPILPVADALLIG--EHADAVLLSVLRNVSRLPAVHAAQQRLASLG
A0A142XL75      LKAEFD--FVVVDTSPLLLVSDTLLLA--READGVVVSVLMGVSQVALVDEAVTRLQAVR
A0A6P2D5D5      LKSNFD--FVIVDTSPLLLVSDTLLLA--READGVVVSVLMGVSQIALVDEAVARLLAVR
A0A5C1AAF0      FLSDYE--VVIIDSSPLMLVADALHFA--KRADGVILTVRNDYSRVALVQETVRRLRQIA
A0A7C7T8W8      VRDDYS--YILIDCPPLLAATEAYVIA--RASDGVLLCCMRDVSRTLQVRKAYERLIAVG
A0A5C6B3S0      LRAGFD--FIVVDGSPVLPVVDARLIG--QHVDSVVLSVLRDVSCAPRISAACEILRSFK
A0A368KP63      LRKRYD--FVIVDAGPVLGSPSTRLLAQPQYVDGVILSVFKDVSQVTQVEDAKRVLTSFG
A0A518GIZ9      ARTFAD--IVLIDAPPVLAVSDACIIG--QHVDGYLLTVRLGKNRRPMLRRSRDLLLAHH
A0A1C3EBY9      ARTLAD--IVLIDAPPVLAVSDACIIG--QHVDGYLLTVRLGKNRRPMLKRSRDLLLAHH
D5SX64          ARTLAD--IVLIDAPPVLAVSDACIIG--QHVDGYLLTVRLGKNRRPMLRRSRDLLLAHH
A0A517Z0U7      LAAEYD--FIIIDSAPVLPVTDSLLIA--QHVDAVMFSVRRDVSRAAKVAAAVQRLSMLG
A0A2S8FCC0      LRSQYD--YVIVDGSPILPVVDARLIG--QYVDGVVMAVLRDVSRGAKVQAARDLLSVFG
A0A1Z8MBT6      CMEEYE--YVIFDSAPILAAGETLAIA--AVVDSTLMCVMRDVTRTDSVLRSTRRLEAAG
A0A517SXN9      CMEEYE--YVIFDSAPILAAGETLAIA--AVVDSTLMCVMRDVTRTDSVLRSTRRLEAAG
A0A518HFL0      LRRSFD--VVIIDTSPVLPVPDALILG--RLADGAVIATRHDQSRFPAVERANGLLTGAG
A0A5Q3LBQ3      LSRIYR--YIIIDCPPILPASEAMVIA--KAADATLVCAKRDLSRVEQVEAAFERLHVAG
A0A3B8ZJM2      VREKYD--IVIIDTPPLLAVSDPSVVA--SVVDGVVICMRLRRNVKPLATRAFRVLESVD
A0A1U7CLW1      LRDQFD--FIIVDSSPLLLVTDALIVS--QHVDAVLLSVLRAVSQLPQIYAASERLASMG
A0A142WPR7      LREQYD--FVIIDTPPLLAVTDPSAVA--PRVDAVIVTLRIAKRTRSEARRAMEVLGSVG
A0A3M1TFJ0      LRQRFD--RIVIDTPPVAAFSDGVLMA--VAADAVVLVVSARTSRRSASQLAVVELSRVG
A0A517P477      LRARYD--IVIVDSPPALPVSDGLMLA--EHVDGVMFAVRRGVTRLRNVAAALERFQAVG
A0A517T4K9      LRGQYD--LIILDSSPILPVTDTLLLA--PAADGVVFSIRRDVSRVSKVSAASERLAMLD
A0A7C6B2Q1      LREDFN--FVIVDGTPVLPVADTRFIS--THCDGVVLSVIRDYSRAPLVRSAKQILESFR
A0A7C4QPD3      VQERYN--FVVIDSSPVLVAPEALMIA--RHVDGVILIVRRDVTQLHKLESALRRFEMIG
A0A2Z3GZZ5      LRERYE--FVIVDSPPLMAVADPAIVA--PQADGVLVVFRMTKTARPAAERAREVLAGVG
A0A4V0I6L6      LRASYD--FVLLDTPPVLAVSDPAAVA--PRADGVIIVFRMTPAAGPNTERAKEELVAVS
A0A7C4QQT3      VRDDYD--LIFVDTPPLLAVSDPCIIA--RQTDGLLLVVRLGKNTVQAASRARELIQTND
A0A255QXF5      ALEKYE--YVIVDTAPVLSAGESLAVA--SAVDSTLVCVMRDLTRMDSVVRTTHRLEASG
A0A518KBI5      LRGDFR--TIVIDTPPVLGASEALSLC--RSADMTVVCARRGVSRIRQIKIASEKLENAG
A0A5C5V6Q5      LRNEFS--TVVIDTPPVLGASEALSFC--RSADMTAMCTLRGKSRGRQIRLALDQLESAG
A0A517MY49      ADSQYD--QVLVDCPPVLAVSDAQIVG--RHVDAAILVVRPEKNPRHMVIRAVESFQSTN
A0A2E6AG00      AEARYD--QILIDCPPTLVASDAAIAG--RIAGGLMLVVQPAKNHRRSVFRCVEETRSVG
A0A1G3A880      AESQYE--QILVDSPPVLAASDAQILG--RLVDGVLLVVQPDSNRRRVVERAVESFAALG
A0A2E8ATT1      AQSRYD--QILIDCPPIMAASDAAIVG--HLADGIMLVVQPEKNHRRVVFRAVASLLGMR
A0A7C2JZW2      LSQQYS--FVFVDSAPVLASADTMSLA--KHVDGVVMVVRKDVTRLRRLEASLHRFEMIG
A0A518KYQ0      ALESYQ--YVILDTAPVLSAGETLAVA--SVVDSTLVCVMRDLTRMDSVVRTTHRLEASG
A0A5B9QX47      ALADYR--FVVVDTAPVLAAGETLAVA--SAVDSTLLCVMRDVSRTENLTRSMRRLEASG
M5T666          ALESYE--YVVFDTAPVLAAGETLAIA--SAVDSTLICVMRDVSRKESVLRTTRRLEASG
M5U6N6          ALEQYQ--YVVFDTAPVLAAGETLAIT--AVVDSTLICVMRDVSRKESVVRTTRRLEASG
A0A517M0G2      ALEKYS--FVIFDTAPVLAAGETLAIA--SETDATLVCVMRDVSRTDSVVRSSRRLEASG
A0A5C6AST1      ALAQYS--YVVVDTAPVLAAGETLAVA--AETDATLVCVMRDVSRTDTVVRSSRRLEAAG
A0A5C6C951      ALEHYS--YVVIDTAPVLAAGETLAIA--AETDATLVCVMRDVSRSDTVVRSSRRLEAAG
A0A5C6C5T3      ALLTYR--YVVIDTAPVLAAGESLAIA--SAVDATLICVMRDVSLKENVLRTTRRLQAAG
A0A2A2W6A9      ALESYQ--YVILDTAPVLSAGETLAVA--STVDSTLVCVMRDLTRLDSVVRTTHRLEASG
A0A518HQS9      ALDSYQ--YVILDTAPVLSAGETLAIA--SVVDSTLVCVMRDLTRMDSVVRTTHRLEASG
A0A5M6DFE6      ALKRYD--FVIVDTAPVLSASETLAVA--ASVDTTLVCAMRDVTRKDSVVRTTHRLEAAG
A0A5C6F286      ALSQYS--YVVMDTAPVLSAGETLAVA--SAVDATLICVMRDVSRIDNVTRTTRRLEAAG
A0A517NGN1      ALQQYD--FIVFDTAPVLSAGETLALA--AATDVTLLCVMRDRTRMDSLERTSRRLESAG
M5RUI3          ALEKYS--FVVIDTAPVLSASESLAVA--SSVDSTLLCVMRDVSRMDNVNRSMRRLDASG
A0A660VT66      LKKRYD--WIIIDTPP-GIVTDPVILS--AHVDGTVLVVRNDSTSRKFLRHFATLLRQGD
A0A7C2VEF7      LTKHYD--RIIIDSPPIGPVADSQILA--AICDITLLVLRAEKSTRKHSVAARDVLLSVG
A0A0S8H0S8      LSGRYD--RIVIDSPPVVSVTDSRILG--AICEVTVLVLRAEKSTHPVAQQAIEDLLDVG
A0A7C2ZTD2      AGKKYD--HVIIDTPPVLAFPDALLLA--KIADAVVLTSFAGQTTAPDLRKARERLAEIN
A0A2E3Z6T8      AESKYD--RVIVDCPPVLAVSDAQIVG--RLVDGAILVVRPEKNHRRSVMRAVESFHATG
A0A257WQ92      VRDEFD--MVLIDSPPLLAVSDPCAIA--RHADGLLLVVRLGKTSLVTARRAQELVKTHG
A0A7C1U6X6      LRRHYD--IVLLDSSPILPVADAAILS--SQVDGTIMVERELVSRRTNVVDALARLDSAG
A0A7C7UXI5      AETVYD--QVIIDSPPAM-VADAAIIG--RLVDGLVLVMQPEKNPRRMVTRIVESLSSLE
A0A7C3SFJ0      LREGFD--FILIDSGPVLTDSDALLLG--RYVDGVLLSVLRDVSRVPYVYEACQRIRAVN
A0A7C7WWF7      AEQNYD--QVLIDCPPVMAASDAAIVG--RRTDGLLLVVQPAKNHRRLVIRAVEHLQSME
A0A356ETW1      ASTVYD--QILIDSPPTLATSDSAVIG--RLVDGTILVVQPEKNHRRAVIRAVEGLLSLR
A0A3L7NJY1      AETRYE--QIIVDAPPVLAVSDPAIVG--RLVDAVVLVVRPDKDRRRMVIRAAETLQSLG
A0A523CME0      MRELFD--YVIIDTPPVLAFPDTAILA--PLSDGIVFVINNKTTKKSLAKRAIESLHE--
A0A354PCV3      ALNSYT--YVVVDTAPVLSAGETLAIA--ATVESTLLCLMRDVSRLDSIRQTTRRLEAAG
A0A354PHB4      ALNTYT--YVVVDTAPVLAAGETLAIA--ATAESTLLCLMRDVSRLESIRQTTRRLEAAG
A0A356ESF4      ADKVYD--QVLIDSPPVLAASDAAVIG--RLVDGVVLVVRPEKNCRRNVLRAAETFATLN
A0A538RV31      VKEQFD--FILIDSSPVLPVADALIIG--QHVDGVLFSLLRDVSRFPNVYAAYERLSSLG
                         :..*  *     .              .                       

M5S2L2          ANIFGIVINNS-----------------------------DESGASDGYKGYGY------
A0A2Z3GYP4      VNCLGVVVNGV------------------------------GKQGAMAGYGYD-------
A0A7C2VXA0      GNILGVVVNDV----------------------------------PRKHGRYG-------
A0A7C3AA48      ARILGAVVNDV----------------------------------HRGKGRYG-------
A0A3L7SU85      AKVLGVVINGY---------------------------------DPREAGKYG-------
A0A3M1RAJ8      LPLLGVVVNGG----------------------------------PAGRYRSY-------
A0A2D6A9B6      AQLLGTFVVGI------------------------------RGADPATDERYR-------
A0A2G6JGH3      AHLLGSFVVGV------------------------------RGADPSKDPRYG-------
A0A7C5PFV3      GNVLGTFVLGI------------------------------RGADPSTDPRYG-------
A0A7C3QGD2      GKLAGCILNKA----------------------------------EIQTRGYY-------
A0A3D4PLL5      GNLLGVVVNGL----------------------------------SDSRGEYG-------
M5RD30          VTPTAIIVNGS----------------------------------DAESKAYG-------
A0A1V6CUG1      AKLVGLVLTHR---------------------------------R-FIIPSYL-------
A0A3M1SE88      IRLVGLVVNRT---------------------------------AKERVPGYD-------
A0A7C2ZUK5      DKIIGIVFNSF---------------------------------EMNILDRKM-------
A0A660WB30      DKVLGIVMNDV---------------------------------RSGVGRYYS-------
A0A660W9Z7      AKVLGVVLTQV---------------------------------K-NHIPKYL-------
A0A3M1R9K7      AKILGAIVTG------------------------------------NPGEAYY-------
A0A3L7PH51      VKVIGLVANHV---------------------------------EVSSNSDYG-------
A0A3N5UQY5      GRLLGIVVNQV---------------------------------H-RDGGRYG-------
A0A7C2JY73      LNVVGAVANGL-------------------------------------------------
A0A356AE44      IPLLGVIANGL----------------------------QDGSGDYQYRGGYG-------
A0A1G2XSU7      VNLLGIVLSNV----------------------------------KYNQIYYP-------
A0A350KD81      IKVTGLLANGV-----------QSGK-------------------------FGD------
A0A2D6SRY7      ARLLGVIFNGA-----------------------------CVQEGLGLPGHYR-------
A0A1G3C300      SDLLGIILNLV-----------------------DVSKGGYYSYYYSHYYKYG-------
A0A524HC32      GTILGCIANKV---------------------------------NQSKTYGYGSY-----
A0A177PV03      ADVVGVVVNGY----------------------------------GRNGSGYGYDAYRYG
A0A1G2YIM0      VKIIGTVLNSV-----------RINKSYNE------------------------------
A0A1G2ZG92      LNTIGIVLNKF-------------------------------------------------
A0A1G3A0W0      GQLLGTVFVGS-----------SDSKD---------------------------------
A0A353BE27      ANLLGVVINGV-------SSEAGYGYNYDYNDYRYAYKYGSN-----YRSGYG-------
A0A5C6BPW1      VPVLGAVVIGL----------DGETSGYRS--------------------GYGG------
A0A1I3GSP0      VQVYGVIANDF--------QPTTSGES-----------------------GYDY------
A0A517QJV1      ANVHGLIANGL--------DMESASES-----------------------GYGY------
A0A3C1QS25      AEILGVVVNGI--------GGQAGYGDYK---------YSKYGRNYAYNYRYGSYGNYGQ
A0A5C6FX55      GNLIGTVINNS--------DEASSSDGYR---------------------GYGY------
A0A5C6DS51      IRPLAIVVNGV---------SNNAKATY----------------------GYGN------
A0A5C6DSL6      IQPLAIVVNGV---------SNNAKATY----------------------GYGD------
A0A3M1VG27      ARILGVVGNCL-------PDDGEDSELYT-------------------------------
A0A518GC22      ANLLGVVINGV-------SSEAGYGYNYDYNDYRYAYKYGSN-----YRSGYG-------
A0A3L7Q373      IPLYGVVANDI--------DYTADGGQEF-------------------------------
A0A3E0PW54      VELLGVVANGV----------SPAADDYRA------------------------------
A0A7C3TAH2      ARVIGTVVNKV-------------------------------------------------
A0A1Z8MHR4      ASILGVVINKM--------DEFTGKSYYRSSAS------GSY-----QSIGYG-------
A0A5C6EHJ0      ANVLGIIVNGV--------GSRAARGYGKYSGSEGEYNYGSS-----YQYGYG-------
A0A5C6F1H9      ANVLGIVVNGV--------GSRAARGYGKSSEAEGNYNYGSS-----YQYGYG-------
A0A255QXY0      TRVIGVVINKL--------S--PRNQAYKASAS------GGY-----QSIGYG-------
A0A517SYI0      ASILGVVINKM--------DEFTGKSYYRSSAS------GSY-----QSIGYG-------
A0A518HX54      SRVMGVVINKF--------TAPHSTASYQSSAC------GSY-----QSIGYG-------
A0A5B9MF59      ARVMGVVVNEI--------DEVSGGASYKTSAS------GSY-----QSIGYG-------
A0A2A2WC24      ARVMGVVVNEI--------DDVSGGASYKSSAS------GSY-----QSIGYG-------
A0A518KYW8      ARVMGVVVNEI--------DDVSGGASYKSSAS------GSY-----QSIGYG-------
A0A5C5YZZ0      VNIIGIIVNAV--------GDSGYSATYSQAWS------DSYGGQPGSEYGYSS------
A0A518JLD2      ANVLGIVINGVGSREAGAYGKSSGREGYY--NQ------GEY-----YKYGYG-------
A0A5M6DJ15      TPIMGVVVNGC--------NDGSNDNSY--------------------------------
A0A3L7P7S7      AKVLGVIVNGY--------DPRESDKYGY---------------------GYGYGYKYSY
A0A517N8M1      AKILGVVINNS--------DEAGASDGYR---------------------GYGY------
A0A5C6CW01      ANLFGVVINNS--------DEAGTSDGYK---------------------GYGY------
A0A5C6BXS9      ASIIGVVINNS--------DESSASDGYK---------------------GYGY------
M5U569          ARLVGVVVNNS--------DESSSSDGYK---------------------GYGY------
L7CND7          AKLLGVVINAS--------DEGANNDGYK---------------------GYGY------
A0A0J1B8S4      AKLLGVVINAS--------DEAGNNDGYK---------------------GYGY------
F2ARR3          AKLLGVVINAS--------DEGSNNDGYK---------------------GYGY------
K5D8H6          AKLLGVVINAS--------DEGSNNDGYK---------------------GYGY------
M2AKU0          AKLLGVVINAS--------DEGSNNDGYK---------------------GYGY------
A0A5B1CKI2      ARVLGVVINNS--------DEAGASDGYR---------------------GYGY------
A0A5C6EG84      ARILGIVINNS--------DEAGSSDGYR---------------------GYGY------
A0A5C6F2X4      ARILGIVINNS--------DEAGASDGYR---------------------GYGY------
A0A5C5XTV6      ARVLGIVINNS--------DESSASDGYR---------------------GYGY------
A0A5C6AAB1      ARLIGVVVNNS--------DESGSSDGYK---------------------GYGY------
M5T8W8          ARLIGVVVNNS--------DESGSSDGYK---------------------GYGY------
M5SF00          AKLLGVVINAS--------DEGANNDGYK---------------------GYGY------
A0A2G1WDS1      AKLLGVVINAS--------DEGANNDGYK---------------------GYGY------
Q7UVS9          AKLLGVVINSS--------DEGSNNDGYK---------------------GYGY------
A0A5C6B601      VRIVGVVVNKI--------DEVSGSASYKASAS------GSY-----QSIGYG-------
A0A517PFU1      ARVLGLVVN-----------AVPAGGEYTREVQ------GGY-----YG-GYG-------
A0A5B9M8J9      SRVMGVVINKF--------TATHSTASYQSSAS------GSY-----QSIGYG-------
A0A2A2WFP6      SRVMGVVINKF--------TAPRSMASYQSSAS------GSY-----QSIGYG-------
A0A518L8N2      SRVMGVVINKF--------TAPHSTASYQSSAS------GSY-----QSIGYG-------
A0A518HQN9      ARVMGVVVNEI--------DDVSGGASYKSSAS------GSY-----QSIGYG-------
A0A5M6D8H8      ARVMGVVVNKM--------DEISGGASYKSSAS------GSY-----QSIGYG-------
A0A5B1CRW9      IQPTAVIVNGI--------D---------KNVS------RSY-----QYGGYGR------
A0A5C6EI46      ITPAAVIVNGI--------D---------RNAL------KTY-----AYGGYGK------
A0A2E7D3V4      VEVLGVIANSI-----------EQTQGNSYT--------------------YS-------
A0A5B9PER9      ANCLGLVVNGV-----------GQQSGYGSQYTYGAYRAGYSYNGYGYGYGYG-------
A0A517QSM4      VPPIGSILIGL-----------DE---------------------------FA-------
A0A355GJI7      IKVAGILANSV-----------KSGK-----------PGD-----------YD-------
A0A1Z8MCI4      SNVVGAVFSGT-----------PIRE-------------------------YK-------
A0A517SYL7      SNVVGAVFSGT-----------PIRE-------------------------YK-------
A0A3L7P0L2      IRLYGVIVNDI-----------DYSV-----------E-------------DG-------
A0A6M5YVJ1      AKLTGVIANGV-----------RSAA-----------HE------------YT-------
A0A2E0SHG0      ANILGVTMTGY-----------DSQS-----------GGYYSGGKY-----AS-------
A0A518CQB8      ADVLGVTMTGY-----------DSQG-----------GQYYSASKY-----TS-------
A0A517SCC8      VRLLGAIANDA-----------SHAA-----------QR------------DG-------
A0A3A0DR44      VNLMGAVLSGT-----------SARR-------------------------YA-------
A0A358MY60      ANVVGTVFSGV-----------PSRQ-------------------------YA-------
A0A517MNB1      ANVVGSVFSGV-----------PYQQ-------------------------YS-------
A0A7C1EH96      ANIIGTVVNNV-----------KTSH-----------SYRR----------YG-------
A0A142YJ13      VRILGAVVSGV-----------PAG--------------------------SK-------
A0A517Z7D3      VRLHGVVVNAL-----------DAEK-----------D-------------EG-------
A0A1N6KY57      IRMLGAIVTGE-----------QTDH-------------------------YG-------
L0DK20          IRMLGAIVTGE-----------QSDH-------------------------YG-------
A0A3L7UX05      VPVLGAVVNGV-----------RNAS-----------ATYGGYG-------YG-------
A0A517XRC2      INLLGAVVNGV-----------HMGS-----------AY------------YA-------
A0A6M5YH47      IPLVGAVVNGI-----------K--Q-----------DV------------YS-------
A0A660UUK3      VRVLGTVLNNV-----------RVGS-----------SY------------YR-------
A0A517ZHG5      VPVLGAVVIGL-----------DGET-----------SGYRSGY-------GG-------
A0A1Z8MPL5      IPVLGCVFNGQ-----------QNNI-----------FSPGY---------YT-------
A0A5C1AGE3      IPLLGAVVNGI-----------KTDI-------------------------HA-------
A0A2Z3HEL7      IPLVGAVVNGI-----------KQDV-------------------------YS-------
A0A142XAP8      IQLVGAVVNGI-----------KQDV-------------------------YS-------
A0A6P2DEK1      IQMVGAVVNGI-----------KQDV-------------------------YS-------
A0A5C6C1R5      VPVMGVVVSGC-----------PSKN-----------GE------------YL-------
A6BZU4          IKVTGLLANGV-----------QSGK-----------FGD-----------YD-------
A0A2D5GZ77      IKVTGLLANGV-----------QSGK-----------FGD-----------YD-------
A0A3D3R1Z6      IKVTGLLANGV-----------QSGK-----------FGD-----------YD-------
A0A517XG00      IKVTGLLANGV-----------QSGK-----------FGD-----------YD-------
A0A1G2YRE4      VKVLGTVLGNV-----------QAQ--------------------------YS-------
A0A353Z859      IPVWGAVAIGV-----------DQSS-----------YGYGYGYGYGYGYGYG-------
A0A2D6ST10      VPMLGAVVIGL-----------DRDS-----------YG------------YN-------
A0A177QX42      ARVLGVVVNGI-----------SERA-----------AGYGYGDS------YS-------
A0A517SHR0      ARVLGVVVNGI-----------SERA-----------AGYGYGDS------YS-------
A0A2E0AW64      AEIVGCVFNDV-----------PPNR-------------------------YS-------
A0A351FZ59      AEIVGCVFNDV-----------PPNR-------------------------YS-------
A0A660V239      AKILGTVVNNV-----------KVTH-----------SYHRYG--------YG-------
A0A177Q3B7      VNLLGAVMNGM-----------SPKV-----------HA------------SR-------
A0A2E0X6Y6      CHIFGVVANGV-----------TADS-----------NGYGYGYG------YG-------
A0A518GFD7      IAVLGTVVIGG-----------RSTG-----------YQ------------GY-------
A0A5C5VZJ8      GTLLGTVFVGS-----------TTPS-----------GYASYN--------YY-------
A0A518GE37      TNVIGVVFSGV-----------PSSD-------------------------YA-------
A0A5C6F3H8      ASIAGTVFSGV-----------SARQ-------------------------YS-------
A0A5C5X072      ACVAGTVFSGV-----------SARQ-------------------------YG-------
A0A5C5WUQ3      ASIAGTVFSGV-----------TPRQ-------------------------YS-------
A0A5C6E697      ATVTGTVFSGV-----------ATQE-------------------------YS-------
A0A5C5Z1A3      ANMVGTVFSGV-----------TAQQ-------------------------YA-------
A0A5C6D2P7      ATLTGTVFSGV-----------TARQ-------------------------YA-------
A0A5B9ML17      ANVAGTIFSGV-----------TPRQ-------------------------YA-------
A0A517LX75      VNVAGIIVNGA-----------ERGD-----------KNFGYGEYVQP---YE-------
A0A7C5W7B3      GRVLGIALNQS-----------PSAE-----------PDY-----------YY-------
A0A2S8F9B8      APIIGTVLSGY-----------TSG--------------------------MY-------
A0A354GX32      IRVLGAVVIGE-----------GME-----------------------------------
A0A142XL75      AKVTGVIANGV-----------RHAA-----------HA------------YT-------
A0A6P2D5D5      AKVTGVIANGV-----------RHAA-----------HA------------YT-------
A0A5C1AAF0      APLLGVVVNGY-----------THGG-----------SG------------YG-------
A0A7C7T8W8      CDVMGLILSGV-----------PTYD-------------------------YA-------
A0A5C6B3S0      IPLMGAVVLGS-----------RAE---------------------------A-------
A0A368KP63      APILGTVLSGY-----------STG--------------------------MY-------
A0A518GIZ9      IPILGVVANGV-----------EPSD-----------REEMGYY-------AD-------
A0A1C3EBY9      IPILGVVANGV-----------EPSD-----------REEMGYY-------AD-------
D5SX64          IPILGVVANGV-----------EPSD-----------REEMGYY-------AD-------
A0A517Z0U7      VSILGAVAIGL-----------EDGG-----------SSNRYYGRYGYGYGYN-------
A0A2S8FCC0      VPFLGVVVVGT-----------TRE--------------------------DV-------
A0A1Z8MBT6      ANIVGTIFSGV-----------TPS------------K-------------YV-------
A0A517SXN9      ANIVGTIFSGV-----------TPS------------K-------------YV-------
A0A518HFL0      IPVLGVVVNGA-----------RGSD-----------RR------------FG-------
A0A5Q3LBQ3      ARPVGAVLNGV-----------PAR------------S-------------YL-------
A0A3B8ZJM2      AQVLGVVVNGV-----------STEA-----------A--------YGGYGYN-------
A0A1U7CLW1      VRILGAVVSGV-----------PLK--------------------------PN-------
A0A142WPR7      ANVLGVVVNGI-----------SSRK-----------G-----YGYSGSGNRG-------
A0A3M1TFJ0      REPVGVI---L-----------NQRP-----------GSDYGYYYGDLYYGYG-------
A0A517P477      VPVLGAVAIGM-----------DDEV-----------GR---------------------
A0A517T4K9      IPILGAVVIGI-----------DQSA-----------YG----VMYNERYRYA-------
A0A7C6B2Q1      VRVLGTVVTGS-----------SEDA-----------Y-------------YA-------
A0A7C4QPD3      VPVLGLLALGL-----------RDSS-----------PF----YGYGYGYGYG-------
A0A2Z3GZZ5      AHTIGVVVNAS-----------GDEG-----------RG----YGYGYGYGYE-------
A0A4V0I6L6      AHLLGVVVNAS-----------SEQ------------HA----NYGYG---YT-------
A0A7C4QQT3      MDLLGVVANCL-----------DAT------------DE----LAYAPHSQYY-------
A0A255QXF5      ANVVGTIFSGV-----------SHR------------Q-------------YA-------
A0A518KBI5      VSIVGSVLSGV-----------PPR------------G-------------YG-------
A0A5C5V6Q5      ASVSGSILSGV-----------P--------------S-------------YS-------
A0A517MY49      CEVLGIVANGL-----------TTE------------MG----G-------YG-------
A0A2E6AG00      VXVVGLIVNRL-----------TXX------------EG----RSY-----YG-------
A0A1G3A880      VELLGVVANRI-----------RPE------------SN----DRYDDGCAYA-------
A0A2E8ATT1      NKVIGIIANRI-----------QPQ------------DQ----RGY-----YG-------
A0A7C2JZW2      VPMLGLLSLGI-----------GDS------------A-------------TV-------
A0A518KYQ0      ANVVGTIFSGV-----------TPR------------Q-------------YS-------
A0A5B9QX47      ANIAGTVFSGV-----------SPR------------E-------------YA-------
M5T666          ASVAGTVFSGV-----------SAR------------Q-------------YG-------
M5U6N6          ASVAGTVFSGV-----------SAR------------Q-------------YA-------
A0A517M0G2      ANVAGTVFSGV-----------PSS------------Q-------------YA-------
A0A5C6AST1      ANVVGTVFSGV-----------PYS------------N-------------YA-------
A0A5C6C951      ANVVGTVFSGV-----------PYS------------N-------------YA-------
A0A5C6C5T3      ASVAGTVFSGV-----------SAR------------Q-------------YG-------
A0A2A2W6A9      ANVVGTIFSGV-----------TPR------------Q-------------YS-------
A0A518HQS9      ANVVGTIFSGV-----------TPR------------Q-------------YS-------
A0A5M6DFE6      ANVAGTIFNGV-----------TPR------------Q-------------YA-------
A0A5C6F286      ASIAGTVFSGV-----------SAR------------Q-------------YS-------
A0A517NGN1      ANVTGTIFSGV-----------TSR------------A-------------YA-------
M5RUI3          ATIAGTVFSGV-----------TAG------------Q-------------YA-------
A0A660VT66      SRITGLVVNDV-----------NVTEGYYDRY----------------------------
A0A7C2VEF7      GRLLGAIVNDV-----------PRKHGRYGYY----------------------------
A0A0S8H0S8      ARLLGAVINAV-----------PRGNRRYGRY----------------------------
A0A7C2ZTD2      VKVLGTVMSNV-----------RAGH----SY----------------------------
A0A2E3Z6T8      CHVFGVVANGL------------------------------SSDSSGYGYGYG-------
A0A257WQ92      LSVLGMVANDT------------------------------PAHDLNSYSADA-------
A0A7C1U6X6      GRLMGTV---F------------------------------VGSRENGHYGYG-------
A0A7C7UXI5      IKILGVVVNRL------------------------------SGKNSESYYGYG-------
A0A7C3SFJ0      LPLLGAVVNGV------------------------------GAQRYRAYYSYR-------
A0A7C7WWF7      SPLVGIVANRV------------------------------TNEQEDGYYGYG-------
A0A356ETW1      IPLLGLVVNHA------------------------------KGEERGGYYGYG-------
A0A3L7NJY1      CSLLGIVVNHL------------------------------TATDSGG-YGYG-------
A0A523CME0      CRVIGCVMNKC-----------EVSV-------------------------SE-------
A0A354PCV3      AKIVGTVFSGV-----------TSRQ-------------------------YA-------
A0A354PHB4      AKIVGTVFSGV-----------TSRQ-------------------------YS-------
A0A356ESF4      VPLLGIAVNQV-----------KAES-------------------------RA-------
A0A538RV31      IRMLGAVVNGV-----------RQDR----------------------------------
                    .                                                       

M5S2L2          -------YRYS----RYTNRYY--------------------------------------
A0A2Z3GYP4      -------YYRHAD-----------------------------------------------
A0A7C2VXA0      -------YYSSYGSYGGYGYYGRHGYYGRA------------------------------
A0A7C3AA48      -------YYYGYGYYG----YGHKKDGGAT------------------------------
A0A3L7SU85      -------YGYGYGYKYSYGYKYGYKYNYGY------------------------------
A0A3M1RAJ8      -------Y----------------------------------------------------
A0A2D6A9B6      -------YTWDGE-----------------------------------------------
A0A2G6JGH3      -------YSRGE------------------------------------------------
A0A7C5PFV3      -------YPETQW-----------------------------------------------
A0A7C3QGD2      -------Y----------------------------------------------------
A0A3D4PLL5      -------YGYGYG-----------------------------------------------
M5RD30          -------YSNHYR-----------------------------------------------
A0A1V6CUG1      -------YRYS-------------------------------------------------
A0A3M1SE88      -------AYDTAYDYHGRDESDDPVSADGV------------------------------
A0A7C2ZUK5      -------QDVGYHNYYSEKY----------------------------------------
A0A660WB30      -------PSYA-------------------------------------------------
A0A660W9Z7      -------Y--RYHYFNDMYADLYERLGDSG------------------------------
A0A3M1R9K7      -------HDPRYTHYIDAADEPEPVSADET------------------------------
A0A3L7PH51      -------YGYGYGYGYGYGHDTPPETGTDH------------------------------
A0A3N5UQY5      -------Y-YGGHYRLGRSNHKHGPDAKAH------------------------------
A0A7C2JY73      -------SGDDASSYAGRTAYYRQPPHSAERELEPAGV----------------------
A0A356AE44      -------GGYD-------KTPYQQNNDIPEFLAPTKTIIPS-------------------
A0A1G2XSU7      -------YGYGYYGKTNVIKDVKQEPADNIVIPEVK------------------------
A0A350KD81      -------YDYGSGPGYSDYYIVPPQVQTKQ------------------------------
A0A2D6SRY7      -------YSYS----HYSHYYHETDDDGEE------------------------------
A0A1G3C300      -------YGYGAEPPKEKRKREKREKKEINV-----------------------------
A0A524HC32      -------YKYYQAYNDSYDEEKKESREQIS------------------------------
A0A177PV03      YDQA---YGYGSNESGYYHEHEGSSRKPANGNGHGGGIVARLFRWLR-------------
A0A1G2YIM0      -------YGYGYYGAAKSGYAKRVHNRRAI------------------------------
A0A1G2ZG92      -------KAYEAGYYYYNRAYYK-------------------------------------
A0A1G3A0W0      -------YRYSSAY----------------------------------------------
A0A353BE27      -------YRYGY---GNYRYGYSEYSDTQD------------------------------
A0A5C6BPW1      -------YGYG----SRYGYGYQYNRSPEP------------------------------
A0A1I3GSP0      ---------------DSYGTYYRENQTPAA------------------------------
A0A517QJV1      ---------------ESYGSYYNEDESPKA------------------------------
A0A3C1QS25      PYGYGYGYGYGYDY-EEADKYYDEPVAPGG------------------------------
A0A5C6FX55      -------YRYS----RYAKKYYRRGGNAGE------------------------------
A0A5C6DS51      ---------YRADEYSYVGQYHREYAAHEP------------------------------
A0A5C6DSL6      ---------YRQEEYGYIGQYHRQYAAQEL------------------------------
A0A3M1VG27      ---------------AFYAPYCAAGADADT------------------------------
A0A518GC22      -------YRYGY---GNYRYGYTEDADTND------------------------------
A0A3L7Q373      ---------------SMYDRYYNEQTPELP------------------------------
A0A3E0PW54      ---------------NQYNSYYNPNQRPDH------------------------------
A0A7C3TAH2      ----RPEHRYN----RYRPDYYQAAQSGRQ------------------------------
A0A1Z8MHR4      ---------YG----DSYRRRYQHDAIAHD------------------------------
A0A5C6EHJ0      ---------YS----YGYTYGYTDGNKNNS------------------------------
A0A5C6F1H9      ---------YS----YGYSYGYRE---NNS------------------------------
A0A255QXY0      ---------YG----DKYRRRYQREVNSKD------------------------------
A0A517SYI0      ---------YG----DSYRRRYQHDAIAHD------------------------------
A0A518HX54      ---------YG----DRYRRRYQREVNAQD------------------------------
A0A5B9MF59      ---------YG----DKYRRRYQQEAKTQD------------------------------
A0A2A2WC24      ---------YG----DKYRRRYQQEAKTQD------------------------------
A0A518KYW8      ---------YG----DKYRRRYQQEAKTQD------------------------------
A0A5C5YZZ0      -------YRYG------SDRYLDASKEQTV------------------------------
A0A518JLD2      -------YSYGAIANDSSREYYEVEAPKQA------------------------------
A0A5M6DJ15      --------------------YYRR------------------------------------
A0A3L7P7S7      GYKYSYGYKYG----YNYSDYSSYTDEEGD------------------------------
A0A517N8M1      -------YRYG----RHTSRYYR--SGKGD------------------------------
A0A5C6CW01      -------YRYG----RYTNRYRRRNGSDTS------------------------------
A0A5C6BXS9      -------YRYT----RHTNRYYRKTADNGA------------------------------
M5U569          -------YRYG----RHTSRYYRKTKDNGP------------------------------
L7CND7          -------YRYG----RHTNRYYRKTADNGA------------------------------
A0A0J1B8S4      -------YRYG----RHTSRYYRKTANNGS------------------------------
F2ARR3          -------YRYG----RHTNRYYRKTADNGA------------------------------
K5D8H6          -------YRYG----RHTNRYYRKTADNGA------------------------------
M2AKU0          -------YRYG----RHTNRYYRKTADNGA------------------------------
A0A5B1CKI2      -------YRYA----RHTSRYYR--SAKGN------------------------------
A0A5C6EG84      -------YRYG----RHTSRYYR--SGKAG------------------------------
A0A5C6F2X4      -------YRYG----RHTSRYYR--AGKSG------------------------------
A0A5C5XTV6      -------YRYA----RQTNRYYRNTPENGP------------------------------
A0A5C6AAB1      -------YRYG----RHTSRYYRKTADNGA------------------------------
M5T8W8          -------YRYG----RHTSRYYRKTKDNGT------------------------------
M5SF00          -------YRYG----RHTNRYYRKTADNGA------------------------------
A0A2G1WDS1      -------YRYG----RHTNRYYRKTADNGA------------------------------
Q7UVS9          -------YRYG----RHTNRYYRKTADNGA------------------------------
A0A5C6B601      ---------YG----DKYRQRYQKEANATD------------------------------
A0A517PFU1      ---------YG----AMAGR--------DA------------------------------
A0A5B9M8J9      ---------YG----DRYRRRYQREVNAQD------------------------------
A0A2A2WFP6      ---------YG----DRYRRRYQREVNAQD------------------------------
A0A518L8N2      ---------YG----DRYRRRYQREVNAQD------------------------------
A0A518HQN9      ---------YG----DKYRRRYQQEAKTQD------------------------------
A0A5M6D8H8      ---------YG----DKYRRRYQQEAKVQD------------------------------
A0A5B1CRW9      -------NKY------GYVGRYHQDYAAKDVASDQPRVVTVNAKTIGSAATAVPVRPTFA
A0A5C6EI46      -------GKYG----GGYIGHYHADYAAKE------------------------------
A0A2E7D3V4      -------GGYA-------DYLAPSEQSLEL------------------------------
A0A5B9PER9      -------YGYG----QGGKYYDEDQKGRKV------------------------------
A0A517QSM4      -------DKYG----YYSRHYNTLDVS---------------------------------
A0A355GJI7      -------YGSG----PGYSDYYIVPPQAQA------------------------------
A0A1Z8MCI4      -------YQYG-------SYYYYGGKKAIE------------------------------
A0A517SYL7      -------YQYG-------SYYYYGGKKAIE------------------------------
A0A3L7P0L2      -------QTYN----EYEKYYDAAAPSLSA------------------------------
A0A6M5YVJ1      -------RAYR----AHESPALPVGGAGGP------------------------------
A0A2E0SHG0      -------YSAK----ESRSYYTNYTKTAAR------------------------------
A0A518CQB8      -------FGAK----ESRSYYTSYTKT-AR------------------------------
A0A517SCC8      -------YHYN----SYDVYYSAPAAPRKA------------------------------
A0A3A0DR44      -------STYG-------NYAYLEDSLS--------------------------------
A0A358MY60      -------YRYG-------DYRYL-TPKIDT------------------------------
A0A517MNB1      -------YRYG-------DYNYLMAPEANQ------------------------------
A0A7C1EH96      -------YGYG----YHYSAKKHPKRPAHK------------------------------
A0A142YJ13      -------HNYG-------SYPGPK------------------------------------
A0A517Z7D3      -------YDVQ----SYAAYYAEETAPTPA------------------------------
A0A1N6KY57      -------SNYL----PSGRA----------------------------------------
L0DK20          -------SKYG----YSARAQESV------------------------------------
A0A3L7UX05      -------YGYG----YGGSFGDGADEDVVT------------------------------
A0A517XRC2      -------YGYN----YVKQLPA--------------------------------------
A0A6M5YH47      -------YGYN----YVKQLPA--------------------------------------
A0A660UUK3      -------YGYG----YGADGGKAQRKAKAK------------------------------
A0A517ZHG5      -------YGYG----SRYGYGYQYNRSPEP------------------------------
A0A1Z8MPL5      -------YGYG----SPQPLGSDTESPS--------------------------------
A0A5C1AGE3      -------YGYN----YVKQLPA--------------------------------------
A0A2Z3HEL7      -------YGYN----YVKQLPA--------------------------------------
A0A142XAP8      -------YGYN----YVKQLPA--------------------------------------
A0A6P2DEK1      -------YGYN----YVKQLPA--------------------------------------
A0A5C6C1R5      -------YQY--------------------------------------------------
A6BZU4          -------YGSG----PGYSDYYIVPPQVQT------------------------------
A0A2D5GZ77      -------YGSG----PGYSDYYIVPPQVQT------------------------------
A0A3D3R1Z6      -------YGSG----PGYSDYYIVPPQVQT------------------------------
A0A517XG00      -------YGSG----PGYSDYYIVPPQVQT------------------------------
A0A1G2YRE4      -------FHRY-------DRYYQNPSSRKT------------------------------
A0A353Z859      -------YGYG----YGNSYGYGYGNRPRS------------------------------
A0A2D6ST10      -------SRYG-------RNYQSYQQYRQY------------------------------
A0A177QX42      -------YNYT-------TSYRSRSGKYYS------------------------------
A0A517SHR0      -------YNYT-------TSYRSKSGKYYS------------------------------
A0A2E0AW64      -------YRYG-------YYGYEDHGGI--------------------------------
A0A351FZ59      -------YRYG-------YYGYEDHGGV--------------------------------
A0A660V239      -------YGYG-------HATEDDRKRESD------------------------------
A0A177Q3B7      -------YHYE-------PASSTLAPESLL------------------------------
A0A2E0X6Y6      -------YGYG-------HDEDETDGFEED------------------------------
A0A518GFD7      -------YAYQ-------NRSVERKPKLIE------------------------------
A0A5C5VZJ8      -------GSYA-------QYGRSASTDATD------------------------------
A0A518GE37      -------YRYG-------DYHYTTANLPPP------------------------------
A0A5C6F3H8      -------YRYG-------DYHYALGDVPFG------------------------------
A0A5C5X072      -------YRYG-------NYHYALPDTMAT------------------------------
A0A5C5WUQ3      -------YRYG-------DYHYSAAGLAVQ------------------------------
A0A5C6E697      -------SRYG-------DYNYFMNAGVRS------------------------------
A0A5C5Z1A3      -------YRYG-------DYHYVMPDFNTP------------------------------
A0A5C6D2P7      -------YRYG-------DYHYAVSSSEAH------------------------------
A0A5B9ML17      -------YRYG-------DYNYSNFTNLPG------------------------------
A0A517LX75      -------YGYA-------TKYTKSYSSRDT------------------------------
A0A7C5W7B3      -------YMHS-------EADVPVAVQA--------------------------------
A0A2S8F9B8      -------YSYT-------NRPTSTVEVEQ-------------------------------
A0A354GX32      --------AYG-------QVRYPTKAPQAP------------------------------
A0A142XL75      -------HGYG-------TVDPVEHT-PAP------------------------------
A0A6P2D5D5      -------HGYG-------TIDPIDHNVPAP------------------------------
A0A5C1AAF0      -------YGYG-------YNRLAAAKTVEV------------------------------
A0A7C7T8W8      -------YRYG-------GYSRYYKKYYRQ------------------------------
A0A5C6B3S0      -------YYSD-------TNPLDTDDHFAD------------------------------
A0A368KP63      -------YSYT-------ARTKSTVEVAK-------------------------------
A0A518GIZ9      -------YNRN-------EAYFPQDQASVE------------------------------
A0A1C3EBY9      -------YNRN-------EAFFPQDQSLPE------------------------------
D5SX64          -------YNRN-------EAFFPQDQSSPE------------------------------
A0A517Z0U7      -------YGYR-------GSYHRTPANIS-------------------------------
A0A2S8FCC0      -------YDYT-------SRRDRKKRLVHV------------------------------
A0A1Z8MBT6      -------YRYG-------DYKYSNLVS---------------------------------
A0A517SXN9      -------YRYG-------DYKYSNLVS---------------------------------
A0A518HFL0      -------GGYA-------AYTYRTDRMPDP------------------------------
A0A5Q3LBQ3      -------YSYG-------RYALPTA-----------------------------------
A0A3B8ZJM2      -------YSYN-------DYRYSYRSSYGY------------------------------
A0A1U7CLW1      -------RYYG-------SYTSPQWNPVEE------------------------------
A0A142WPR7      -------YAYG-------EGKAGVYYSEEE------------------------------
A0A3M1TFJ0      -------YGYG-------PSQPP-------------------------------------
A0A517P477      -------YGYA-------PGRYPYAKHRQA------------------------------
A0A517T4K9      -------YGYP-------GTK---------------------------------------
A0A7C6B2Q1      -------HSYH-------TLLENTSGAPDD------------------------------
A0A7C4QPD3      -------YGYD-------PHTAEHHLELPS------------------------------
A0A2Z3GZZ5      -------YKYT-------SYKYSDSYNTDA------------------------------
A0A4V0I6L6      -------YKYD--------YQYSDSYTDQK------------------------------
A0A7C4QQT3      -------HVYQ-------AADEPVAVS---------------------------------
A0A255QXF5      -------YRYG-------DYRYSDYTDLLP------------------------------
A0A518KBI5      -------YAYA--------YGYGYRDDTQE------------------------------
A0A5C5V6Q5      -------YSYA--------YGYGFRNPTEH------------------------------
A0A517MY49      -------YGYG--------YGYGHEEEAEE------------------------------
A0A2E6AG00      -------DSYG--------YGYGDNEGD--------------------------------
A0A1G3A880      -------YGYG--------AAYRDEADQDG------------------------------
A0A2E8ATT1      -------YGYA--------YDYSSPEDENE------------------------------
A0A7C2JZW2      -------YTYN-------HYSGRTSRPSER------------------------------
A0A518KYQ0      -------YRYG-------DYKYSDFGQMLA------------------------------
A0A5B9QX47      -------YRYG-------NYDYAIAGETNS------------------------------
M5T666          -------YRYG-------DYQYALGGEPQA------------------------------
M5U6N6          -------YRYG-------DYHYAIGGEPVA------------------------------
A0A517M0G2      -------YRYG-------DYRYFTARPEPQ------------------------------
A0A5C6AST1      -------YRYG-------DYRYLSPKPRA-------------------------------
A0A5C6C951      -------YRYG-------DYRYLTPKHDRV------------------------------
A0A5C6C5T3      -------YRYG-------NYHYALPDTMAT------------------------------
A0A2A2W6A9      -------YRYG-------DYKYSDFGQMLA------------------------------
A0A518HQS9      -------YRYG-------DYKYSDFGQMLA------------------------------
A0A5M6DFE6      -------YRYG-------DYTYAGAGEIPD------------------------------
A0A5C6F286      -------YRYG-------DYDYAIGDGSFG------------------------------
A0A517NGN1      -------YRYG-------DYHYSAIES---------------------------------
M5RUI3          -------YRYG-------SYHYAIAGETDA------------------------------
A0A660VT66      -------YRKGYYFAGDESGE---------------------------------------
A0A7C2VEF7      -------SGYGYYRGYGYYGDREKKEAAVV------------------------------
A0A0S8H0S8      -------SQYGY---------RRSHRRK--------------------------------
A0A7C2ZTD2      -------YRYGYSYYAENVRSRKNAKRAGI------------------------------
A0A2E3Z6T8      -------YGYSYDG------GYSHEEEQDM------------------------------
A0A257WQ92      -------Y-------------YRDVTPRQ-------------------------------
A0A7C1U6X6      -------YGYGY--------GYGQKKQYC-------------------------------
A0A7C7UXI5      -------YGYGYSYRYGHRYGYGQDEEAT-------------------------------
A0A7C3SFJ0      -------S------------YYPRPEENT-------------------------------
A0A7C7WWF7      -------YGHGYGY------GHSEDGDSS-------------------------------
A0A356ETW1      -------YGYGYEY----NGGYGNDEDDY-------------------------------
A0A3L7NJY1      -------YGYGYGY------GYGHDDPAD-------------------------------
A0A523CME0      -------Y-YGY----GYEYGNDS------------------------------------
A0A354PCV3      -------YRYG-----DYHYTVNDEDFGDVGIRASQDL----------------------
A0A354PHB4      -------YRYG-----DYHYTVNDEDFIDVGVRDSHDL----------------------
A0A356ESF4      -------GYYGYAPGHAYDYADSRGSNDDPGEQKDHFEAARRSAA---------------
A0A538RV31      ---------YGY----SYQYYYNKDHN---------------------------------
                                                                            

M5S2L2          ------------------------------------------------------------
A0A2Z3GYP4      --------------------------------------------------DYSAPYTTAD
A0A7C2VXA0      ---------------------------------GNREDDEA-------------------
A0A7C3AA48      ---------------------------------KRLAVASS-------------------
A0A3L7SU85      ---------------------------------NYTDYESYTDDEDEENEAANAEGKVQR
A0A3M1RAJ8      ------------------------------------------------------------
A0A2D6A9B6      -------------------------------------------AKE--------------
A0A2G6JGH3      ------------------------------------------------------------
A0A7C5PFV3      -------------------------------------------PEA--------------
A0A7C3QGD2      ----------------------------------------------------YSAAPAVE
A0A3D4PLL5      ----------------------------------------------------YGEGYGEG
M5RD30          -------------------------------------------SEEYSYTPYYHDTYAAS
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ---------------------------------P---------FDDDDEDIVPRRVA---
A0A7C2ZUK5      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ---------------------------------E----------PARKSRGKRRKRK---
A0A3M1R9K7      ---------------------------------G--------------------------
A0A3L7PH51      ---------------------------------E--------------DEQPYRRAA---
A0A3N5UQY5      ---------------------------------DTCIGMTLQPLEAGLSRSPVLRPS---
A0A7C2JY73      ------------------------------------------------------------
A0A356AE44      ------------------------------------------------------------
A0A1G2XSU7      ------------------------------------------------------------
A0A350KD81      ------------------------------------------------------------
A0A2D6SRY7      ---------------STEFGWRRWLLKCRRALSSQRGETWAASAKGQTTDPQTTNAQIAD
A0A1G3C300      ------------------------------------------------------------
A0A524HC32      ------------------------------------------------------------
A0A177PV03      ------------------------------------------------------------
A0A1G2YIM0      ------------------------------------------------------------
A0A1G2ZG92      ------------------------------------------------------------
A0A1G3A0W0      ------------------------------------------------------------
A0A353BE27      ----------------------------------LSVKQPGNPQ----------------
A0A5C6BPW1      ------------------------------------------------------------
A0A1I3GSP0      ------------------------------------------------------------
A0A517QJV1      ------------------------------------------------------------
A0A3C1QS25      ----------------------------KRRKRSAAIGNDGPKS----------------
A0A5C6FX55      ---------------------VVPKGSKKR----SGMVVSGRSTQNRVRPSEAMPTRNEA
A0A5C6DS51      ------------------------------------------------------------
A0A5C6DSL6      ------------------------------------------------------------
A0A3M1VG27      ------------------------AGEAADPSALAEASEAGRPSEEEAADRSSTPIASGA
A0A518GC22      ------------------------------------------------------------
A0A3L7Q373      ------------------------------SPLSRELLVGSQK-----------------
A0A3E0PW54      ------------------------------------------------------------
A0A7C3TAH2      ---------------------VERRPRTRPILLPVATAPAGQKDQKVLK-----------
A0A1Z8MHR4      ------------------AYVVRGYRPAGSDAQYDARYDSYAQSGPGMGGPSSGGVVPPG
A0A5C6EHJ0      ------------------YYEEE--PTGRKKAKAKKLAKSKLVVAPPKPGDKT-------
A0A5C6F1H9      ------------------YYEEDDKKKGKDRKKAQQIRKAAVVAPPTSPADDV-------
A0A255QXY0      ------------------TYMIKAKGSTHRVDGPELDLEADAVVDPV-------------
A0A517SYI0      ------------------AYVVRGYRPAGSDAQYDARYDSYAQSGPGMGGPSSGGVVPPG
A0A518HX54      ------------------TYVVTGTKNLERVDL-VAPSKASQPGKPHLHQVV--------
A0A5B9MF59      ------------------TYVVKGKQASER---PTSAGKVDDAVEPY-------------
A0A2A2WC24      ------------------TYVVKGRHASDPVSVPAAPVESGDPPGTYEGEIADPEFTDPE
A0A518KYW8      ------------------TYVVKGKHASDPVSVPAAPAESGHQPGTYEQEIADPEFTDSE
A0A5C5YZZ0      --------------------TVRGRHRAEK----AEPIGAGAGGESNGKG----------
A0A518JLD2      ----------------------------------APVQQTQHV-----------------
A0A5M6DJ15      ------------------------------------------------------------
A0A3L7P7S7      -----------------------GEGDDGKGGYDDRPRAPSLGSRVLPNVQPRVRTKRLT
A0A517N8M1      ------------------------KSSRRRS---EPRIISGRG----------AAI--AK
A0A5C6CW01      ------------------------KGRDSSRSNMAPVVVKGRG----------STSSRKA
A0A5C6BXS9      ------------------------RGGTLR----TPVMVSGRG----------SIEQSAN
M5U569          ------------------------KGGQPR----TPIVVSGRA----------VGLRASA
L7CND7          ------------------------KAGQRR----SPVVVSGRG----------SAARSAR
A0A0J1B8S4      ------------------------KAGTRR----TPVVVSGRG----------PAPRSAR
F2ARR3          ------------------------KAGQRR----SPVVVSGRG----------PAARSAR
K5D8H6          ------------------------KAGQRR----SPVVVSGRG----------SAARSAR
M2AKU0          ------------------------KAGQRR----SPVVVSGRG----------SAARSAR
A0A5B1CKI2      ------------------------KVRRDK----EPLIISGKG-----SQ----------
A0A5C6EG84      ------------------------KSQKQS----QPLIISGRG-----SR--------TA
A0A5C6F2X4      ------------------------KSHKPS----QPLIISGRG-----SKPQAKATSAKA
A0A5C5XTV6      ------------------------MGGKVR----TPVIVSGRGEMGQPVNGSPNPGSPNP
A0A5C6AAB1      ------------------------KSGQLR----TPVIVSGRG-------MTPVPRKANL
M5T8W8          ------------------------KGGQPR----TPIVVSGRA-------VGL---RASA
M5SF00          ------------------------KAGQRR----SPVVVSGRG-------SAA---RSAR
A0A2G1WDS1      ------------------------KAGQRR----SPVVVSGRG-------GGA---RSAR
Q7UVS9          ------------------------KAGQRR----SPVVVSGRG-------QAA---RSAR
A0A5C6B601      ------------------TYIVKGKSDEAP----TVVAPPDVSPTLITGSTNAESTPDES
A0A517PFU1      ------------------YYSDEGTSAPAA----PALIAATPADGDAATARRSTRTPDAA
A0A5B9M8J9      ------------------TYVVTGTKHLGR----VDKVSSDAAATLAKPHLRTAQPTDSN
A0A2A2WFP6      ------------------TYIVTGTKNLER----VDLVAPSNSSQPGKPHLRQVVPQDSA
A0A518L8N2      ------------------TYIVTGTKNLER----VDLVTASEATRPGKPHLQQTDSKSQS
A0A518HQN9      ------------------TYVVKGRHASDP----GAM--PGAPTGPVGEPGAYEREITDS
A0A5M6D8H8      ------------------TYVVKGKVASEP----AEVRRPARNGKPVASTVAGD-PVQAS
A0A5B1CRW9      QQASQSVNGTESDGLPRQQSSNHQNNMEKL----ESIIESGKTAKIDGPSKGRPTSPRGG
A0A5C6EI46      ------------------RSDVHRSDATRS----EPTPKNGRPATFAAASADLGSSVRRQ
A0A2E7D3V4      -------------------------------------------------QREAQQPTAQP
A0A5B9PER9      -------------------------------------------------DPNVAQRIESK
A0A517QSM4      ------------------------------------------------------------
A0A355GJI7      -------------------------------------------------KQADVPAKTKI
A0A1Z8MCI4      -------------------------------------------------MPVSKDACSGI
A0A517SYL7      -------------------------------------------------MPVSKDACSGI
A0A3L7P0L2      -------------------------------------------------QPQTELVGGRK
A0A6M5YVJ1      -------------------------------------------------HER--------
A0A2E0SHG0      -------------------------------------------------KSKA-------
A0A518CQB8      -------------------------------------------------KEKV-------
A0A517SCC8      -------------------------------------------------EEPVTV-----
A0A3A0DR44      ------------------------------------------------------------
A0A358MY60      ------------------------------------------------------------
A0A517MNB1      -------------------------------------------------PAIK-------
A0A7C1EH96      -------------------------------------------------TKKSKALLLSE
A0A142YJ13      ------------------------------------------------------------
A0A517Z7D3      -------------------------------------------------APAKTQSEPAN
A0A1N6KY57      ------------------------------------------------------------
L0DK20          ------------------------------------------------------------
A0A3L7UX05      -------------------------------------------------DAVDIDVEIVD
A0A517XRC2      ------------------------------------------------------------
A0A6M5YH47      ------------------------------------------------------------
A0A660UUK3      -------------------------------------------------RGRSLLLVAPK
A0A517ZHG5      -------------------------------------------------TPSQS------
A0A1Z8MPL5      ------------------------------------------------------------
A0A5C1AGE3      ------------------------------------------------------------
A0A2Z3HEL7      ------------------------------------------------------------
A0A142XAP8      ------------------------------------------------------------
A0A6P2DEK1      ------------------------------------------------------------
A0A5C6C1R5      ------------------------------------------------------------
A6BZU4          -------------------------------------------------KQADAPAKTKL
A0A2D5GZ77      -------------------------------------------------KQADAPAKTKL
A0A3D3R1Z6      -------------------------------------------------KQADAPAKTKL
A0A517XG00      -------------------------------------------------KQADAPAKTKL
A0A1G2YRE4      -------------------------------------------------AEQAKIQLLLP
A0A353Z859      -------------------------------------------------SAPAVPSESPS
A0A2D6ST10      -------------------------------------------------PR---------
A0A177QX42      -------------------------------------------------DERVGHSYYDD
A0A517SHR0      -------------------------------------------------DERVGNSYYDD
A0A2E0AW64      ------------------------------------------------------------
A0A351FZ59      ------------------------------------------------------------
A0A660V239      -------------------------------------------------ARKRAETLLLT
A0A177Q3B7      -------------------------------------------------DIDLSGVPSES
A0A2E0X6Y6      -------------------------------------------------SPVGHDDLTLA
A0A518GFD7      -------------------------------------------------N----------
A0A5C5VZJ8      ------------------------------------------------------------
A0A518GE37      -------------------------------------------------H----------
A0A5C6F3H8      -------------------------------------------------DSSSELSESSV
A0A5C5X072      ------------------------------------------------------------
A0A5C5WUQ3      -------------------------------------------------E----------
A0A5C6E697      ------------------------------------------------------------
A0A5C5Z1A3      -------------------------------------------------S----------
A0A5C6D2P7      ------------------------------------------------------------
A0A5B9ML17      -------------------------------------------------SAT--------
A0A517LX75      -------------------------------------------------EELATASR---
A0A7C5W7B3      ------------------------------------------------------------
A0A2S8F9B8      ------------------------------------------------------------
A0A354GX32      -------------------------------------------------AQ---------
A0A142XL75      -------------------------------------------------AISASPVTTER
A0A6P2D5D5      -------------------------------------------------AIAAGPATTER
A0A5C1AAF0      -------------------------------------------------EVKAEAR----
A0A7C7T8W8      -------------------------------------------------EFAENTQ----
A0A5C6B3S0      -------------------------------------------------ETSATIPEST-
A0A368KP63      ------------------------------------------------------------
A0A518GIZ9      -------------------------------------------------KPSIHRDLTIS
A0A1C3EBY9      -------------------------------------------------KSSTHRDLTIS
D5SX64          -------------------------------------------------KSSTHRDLTIS
A0A517Z0U7      ------------------------------------------------------------
A0A2S8FCC0      -------------------------------------------------G----------
A0A1Z8MBT6      ------------------------------------------------------------
A0A517SXN9      ------------------------------------------------------------
A0A518HFL0      -------------------------------------------------AGGPSAG----
A0A5Q3LBQ3      ------------------------------------------------------------
A0A3B8ZJM2      -------------------------------------------------GYGKYGKYGYG
A0A1U7CLW1      -------------------------------------------------EPS--------
A0A142WPR7      -------------------------------------------------HPASSLTSQS-
A0A3M1TFJ0      ------------------------------------------------------ARAGGS
A0A517P477      -------------------------------------------------RLLERTPAQAA
A0A517T4K9      ------------------------------------------------------------
A0A7C6B2Q1      -------------------------------------------------VEDIQPESTES
A0A7C4QPD3      -------------------------------------------------EATAG------
A0A2Z3GZZ5      -------------------------------------------------DEDGARLVPAP
A0A4V0I6L6      -------------------------------------------------K----------
A0A7C4QQT3      ------------------------------------------------------------
A0A255QXF5      -------------------------------------------------AGSNAE-----
A0A518KBI5      -------------------------------------------------QIESDDAGRR-
A0A5C5V6Q5      -------------------------------------------------SGGIEVSR---
A0A517MY49      -------------------------------------------------SAATRVPATTH
A0A2E6AG00      ------------------------------------------------------------
A0A1G3A880      -------------------------------------------------LIGA-------
A0A2E8ATT1      -------------------------------------------------QIST-------
A0A7C2JZW2      -------------------------------------------------EPGPPRNQGAA
A0A518KYQ0      -------------------------------------------------ETTHRN-----
A0A5B9QX47      ------------------------------------------------------------
M5T666          -------------------------------------------------T----------
M5U6N6          -------------------------------------------------T----------
A0A517M0G2      -------------------------------------------------TIENA------
A0A5C6AST1      ------------------------------------------------------------
A0A5C6C951      -------------------------------------------------PDAVATPTPAG
A0A5C6C5T3      ------------------------------------------------------------
A0A2A2W6A9      -------------------------------------------------ETAHRS-----
A0A518HQS9      -------------------------------------------------ETAHRN-----
A0A5M6DFE6      -------------------------------------------------YS---------
A0A5C6F286      -------------------------------------------------DSYHDEEQASS
A0A517NGN1      ------------------------------------------------------------
M5RUI3          ------------------------------------------------------------
A0A660VT66      ------------------------------------------------------------
A0A7C2VEF7      ------------------------------------------------------------
A0A0S8H0S8      ------------------------------------------------------------
A0A7C2ZTD2      ------------------------------------------------------------
A0A2E3Z6T8      ----------------------------------------VDTADTMMTPMPEIVQLPSI
A0A257WQ92      ------------------------------------------------------------
A0A7C1U6X6      ------------------------------------------------------------
A0A7C7UXI5      ------------------------------------------------------------
A0A7C3SFJ0      ------------------------------------------------------------
A0A7C7WWF7      ------------------------------------------------------------
A0A356ETW1      ------------------------------------------------------------
A0A3L7NJY1      ------------------------------------------------------------
A0A523CME0      ------------------------------------------------------------
A0A354PCV3      ------------------------------------------------------------
A0A354PHB4      ------------------------------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A538RV31      ------------------------------------------------------------
                                                                            

M5S2L2          --------------------------------------
A0A2Z3GYP4      HDEPGMGEGQPLTPPARLSSEPAGHVEPVANGPAHAPE
A0A7C2VXA0      --------------------------------------
A0A7C3AA48      --------------------------------------
A0A3L7SU85      GPSMASRVLPNLVPRIQTKRLPSKPASETKPPETPEST
A0A3M1RAJ8      ----------------RAYTIDVESREPKTAPRQPVGK
A0A2D6A9B6      --------------------------------------
A0A2G6JGH3      --------------------------------------
A0A7C5PFV3      --------------------------------------
A0A7C3QGD2      AGAAE---------------------------------
A0A3D4PLL5      HDDPTHDDEEEAIPMTQSNSHRPRKRFSRDESSDRYAA
M5RD30          DPQPNSIRLQNAV---GSQPVQPTKLMSRS--------
A0A1V6CUG1      --------------------------------------
A0A3M1SE88      --------------------------------------
A0A7C2ZUK5      --------------------------------------
A0A660WB30      --------------------------------------
A0A660W9Z7      --------------------------------------
A0A3M1R9K7      --------------------------------------
A0A3L7PH51      --------------------------------------
A0A3N5UQY5      --------------------------------------
A0A7C2JY73      --------------------------------------
A0A356AE44      --------------------------------------
A0A1G2XSU7      --------------------------------------
A0A350KD81      ---------------------------ADAPAKTKLTH
A0A2D6SRY7      PQAAALVTTTDPQTTDDETDEETDDETTERSRIVRSSS
A0A1G3C300      --------------------------------------
A0A524HC32      --------------------------------------
A0A177PV03      --------------------------------------
A0A1G2YIM0      ----------------------IVPVQEEKTEVTNAAS
A0A1G2ZG92      --------------------------------------
A0A1G3A0W0      --------------------------------------
A0A353BE27      --------------------------------------
A0A5C6BPW1      ---------------------------------TPSQS
A0A1I3GSP0      -------------------S-----KAKSAYVPQTAGK
A0A517QJV1      -------------------PQNPSQRPRPAEPTEIIKT
A0A3C1QS25      --------------------------------------
A0A5C6FX55      VAAAA------------------PVTRPNVSSDQQADS
A0A5C6DS51      -------------------MAAERLETQKRPTRPLVRA
A0A5C6DSL6      -------------------PVSEIIPKQKLTHRVNAPV
A0A3M1VG27      --------------------------------------
A0A518GC22      ------------------------------LSTADKEG
A0A3L7Q373      --------------------------------------
A0A3E0PW54      --------------------------AAESRQPVAADA
A0A7C3TAH2      --------------------------------------
A0A1Z8MHR4      HYPNG---------AEAPGLPPQPPQSSGGSYDSSIGS
A0A5C6EHJ0      --------------------------------------
A0A5C6F1H9      --------------------------------------
A0A255QXY0      ------------------DMAETGAVKTPTFK------
A0A517SYI0      HYPNG---------AEAPGLPPQPPQSSGGSYDSSIGS
A0A518HX54      -------------------PQNSSPGPLPKN-------
A0A5B9MF59      --DHA---------MIPPQPTAAGPSAVAKRHRANVRS
A0A2A2WC24      FTDRK---------ITAPDAAPFAPKVAPDRRRTNVRS
A0A518KYW8      FADRK---------ITSPDAAPFAPKVVPERRRTNVRS
A0A5C5YZZ0      --------------------------------------
A0A518JLD2      ---------------------PSACGADLTNHTS----
A0A5M6DJ15      --------------------------------------
A0A3L7P7S7      GGSPP----------------QNVPGDGEPE-------
A0A517N8M1      VMEQP-------------------------AQEELLDR
A0A5C6CW01      KKAVP-------------------LSMTGVD----SDV
A0A5C6BXS9      VAKAPVAEAPLAEAPVANLASPSINGHGPYETNNGSHN
M5U569          AAAKP----------------TSVAATTPINGKPEDDV
L7CND7          PIAVP----------------P--AVTSPTEQER-SDV
A0A0J1B8S4      PIAVP----------------P--TAMPPVEQERSSDV
F2ARR3          PIAVP----------------P--ATAPSIEREG-SDV
K5D8H6          PIAVP----------------P---TTPSVEQER-SDV
M2AKU0          PIAVP----------------P---TTASVEQER-SDV
A0A5B1CKI2      ---TS----------------SKPVAAVSASNSDELDG
A0A5C6EG84      PAAAQ----------------ATQTAMGYEGHDDHLDS
A0A5C6F2X4      TSAQA----------------ATPSTLGESTLKDLTD-
A0A5C5XTV6      VANIT----------------PAASRNGHASHDDTDES
A0A5C6AAB1      GATTA----------------VGSSPSKMNGRSASSE-
M5T8W8          AAAKP----------------TSVATSSTKNGTATDDV
M5SF00          PIAVP----------------PT-TPSVEQERS---DV
A0A2G1WDS1      PIAVP----------------PTVTSSTDQERS---DV
Q7UVS9          PIAVP----------------PATAPSIEQERS---DV
A0A5C6B601      YSSR----------------------------------
A0A517PFU1      RSR-----------------------------------
A0A5B9M8J9      A-------------------------------------
A0A2A2WFP6      SGPRP----------------L----------------
A0A518L8N2      H-------------------------------------
A0A518HQN9      EITDS----------------FAPTVVPERRRTNVRS-
A0A5M6D8H8      RGPAP----------------LAPPVLTERHSTPTHH-
A0A5B1CRW9      PAPVA----------------APVSSMPMTPSETV---
A0A5C6EI46      PAPIT----------------IPSGDAPPMADQSSKS-
A0A2E7D3V4      VA------------------------------------
A0A5B9PER9      TS------------------------------------
A0A517QSM4      --------------------------------------
A0A355GJI7      TH------------------------------------
A0A1Z8MCI4      GSVPX---------------------------------
A0A517SYL7      GSVPS---------------------------------
A0A3L7P0L2      --------------------------------------
A0A6M5YVJ1      --------------------------------------
A0A2E0SHG0      --------------------------------------
A0A518CQB8      --------------------------------------
A0A517SCC8      --------------------------------------
A0A3A0DR44      --------------------------------------
A0A358MY60      --------------------------------------
A0A517MNB1      --------------------------------------
A0A7C1EH96      VAESAEQ-------------------------------
A0A142YJ13      --------------------------------------
A0A517Z7D3      VTV-----------------------------------
A0A1N6KY57      --------------------------------------
L0DK20          --------------------------------------
A0A3L7UX05      --------------------------------------
A0A517XRC2      --------------------------------------
A0A6M5YH47      --------------------------------------
A0A660UUK3      SEQEDSK-------------------------------
A0A517ZHG5      --------------------------------------
A0A1Z8MPL5      --------------------------------------
A0A5C1AGE3      --------------------------------------
A0A2Z3HEL7      --------------------------------------
A0A142XAP8      --------------------------------------
A0A6P2DEK1      --------------------------------------
A0A5C6C1R5      --------------------------------------
A6BZU4          TH------------------------------------
A0A2D5GZ77      TH------------------------------------
A0A3D3R1Z6      TH------------------------------------
A0A517XG00      TH------------------------------------
A0A1G2YRE4      DTAVNETDKN----------------------------
A0A353Z859      DQSSQPPLN-----------------------------
A0A2D6ST10      --------------------------------------
A0A177QX42      SRKRR---------------------------------
A0A517SHR0      SRKRR---------------------------------
A0A2E0AW64      --------------------------------------
A0A351FZ59      --------------------------------------
A0A660V239      TEPKHETGHGSGS-------------------------
A0A177Q3B7      SES-----------------------------------
A0A2E0X6Y6      INGRRTADEDHDGHDAPIRPRRAA--------------
A0A518GFD7      --------------------------------------
A0A5C5VZJ8      --------------------------------------
A0A518GE37      --------------------------------------
A0A5C6F3H8      S-------------------------------------
A0A5C5X072      --------------------------------------
A0A5C5WUQ3      --------------------------------------
A0A5C6E697      --------------------------------------
A0A5C5Z1A3      --------------------------------------
A0A5C6D2P7      --------------------------------------
A0A5B9ML17      --------------------------------------
A0A517LX75      --------------------------------------
A0A7C5W7B3      --------------------------------------
A0A2S8F9B8      --------------------------------------
A0A354GX32      --------------------------------------
A0A142XL75      E-------------------------------------
A0A6P2D5D5      E-------------------------------------
A0A5C1AAF0      --------------------------------------
A0A7C7T8W8      --------------------------------------
A0A5C6B3S0      --------------------------------------
A0A368KP63      --------------------------------------
A0A518GIZ9      ASLVRQP-------------------------------
A0A1C3EBY9      ASPVRQP-------------------------------
D5SX64          ASPVRQP-------------------------------
A0A517Z0U7      --------------------------------------
A0A2S8FCC0      --------------------------------------
A0A1Z8MBT6      --------------------------------------
A0A517SXN9      --------------------------------------
A0A518HFL0      --------------------------------------
A0A5Q3LBQ3      --------------------------------------
A0A3B8ZJM2      KYGKYTSYSTGYIEDRQAEAAEVSTKNDADTQS-----
A0A1U7CLW1      --------------------------------------
A0A142WPR7      --------------------------------------
A0A3M1TFJ0      GA------------------------------------
A0A517P477      KI------------------------------------
A0A517T4K9      --------------------------------------
A0A7C6B2Q1      --------------------------------------
A0A7C4QPD3      --------------------------------------
A0A2Z3GZZ5      TR------------------------------------
A0A4V0I6L6      --------------------------------------
A0A7C4QQT3      --------------------------------------
A0A255QXF5      --------------------------------------
A0A518KBI5      --------------------------------------
A0A5C5V6Q5      --------------------------------------
A0A517MY49      ERPHYEVPADVQTVQYAPPVVPHSATEPAAPIRPRKAA
A0A2E6AG00      -------------XEPAADSSSSFSVXATPSQQIRRAA
A0A1G3A880      -----DRDHEPQGADEAIERPRPANEAADQIGPVKRVA
A0A2E8ATT1      -----SKPAAGTPQEQVSPDPASKPSGAKKRVVPRRAA
A0A7C2JZW2      VSADLVPA------------------------------
A0A518KYQ0      --------------------------------------
A0A5B9QX47      --------------------------------------
M5T666          --------------------------------------
M5U6N6          --------------------------------------
A0A517M0G2      --------------------------------------
A0A5C6AST1      --------------------------------------
A0A5C6C951      MPLHGGMNEQSVL-------------------------
A0A5C6C5T3      --------------------------------------
A0A2A2W6A9      --------------------------------------
A0A518HQS9      --------------------------------------
A0A5M6DFE6      --------------------------------------
A0A5C6F286      --------------------------------------
A0A517NGN1      --------------------------------------
M5RUI3          --------------------------------------
A0A660VT66      -------------------------GVRGIPGKELVRS
A0A7C2VEF7      --------------------------------------
A0A0S8H0S8      -----------------------------ASAPSE---
A0A7C2ZTD2      --------------NLLLPMQSSEDNINGTDSPNEKMN
A0A2E3Z6T8      ASEEHLPSASPQEHQSHETPFQTKSANSTTPLKPRRVA
A0A257WQ92      PVTREALVTQA---------------------------
A0A7C1U6X6      --------------------------------------
A0A7C7UXI5      EAAA-----------------GTERLKKPVRRSAREAA
A0A7C3SFJ0      PSPT----------------------------------
A0A7C7WWF7      ADG-----------GSDNGPEDDDRNDENGMVSPRRVA
A0A356ETW1      ADDVESEVTTATPRDAHFHDTDPDEGGRPGRIVPRRAA
A0A3L7NJY1      RDGVQTLPLHSSETDVRHVSDDKT----------KNAA
A0A523CME0      --------------------------------------
A0A354PCV3      --------------------------------------
A0A354PHB4      --------------------------------------
A0A356ESF4      --------------------------------------
A0A538RV31      --------------------------------------
                                                      

© 1998-2021Legal notice