BYKdb

Dataset for cluster orphancd of phylum planctomycetes

[Download (right click)] [Edit] [Sequences] [Repertoires]

183 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A356AE44      ------------------------------------------------------------
A0A1G2XSU7      ------------------------------------------------------------
A0A350KD81      ------------------------------------------------------------
A0A2E3Z6T8      ------------------------------------------------------------
A0A257WQ92      ------------------------------------------------------------
A0A356ETW1      ------------------------------------------------------------
A0A3L7NJY1      ------------------------------------------------------------
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      ------------------------------------------------------------
A0A524HC32      ------------------------------------------------------------
A0A660VT66      ------------------------------------------------------------
A0A0S8H0S8      ------------------------------------------------------------
A0A177PV03      ------------------------------------------------------------
A0A1G2YIM0      ------------------------------------------------------------
A0A1G2ZG92      ------------------------------------------------------------
A0A1G3A0W0      ----------------------------MNPAEKEFQPQTDPIVQERDYSNGPGKESRSS
A0A353BE27      ------------------------------------------------------------
A0A5C6BPW1      ---------------------------------------MMQSNQEPNHYRNGNAGVPAY
A0A1I3GSP0      ------------------------------------------------------------
A0A517QJV1      ------------------------------------------------------------
A0A3C1QS25      MRRHACPTLLLDPYVWVHRACLVGTTGTSCECRARISPTRLKLAPPNRCPGRGPRYTEGS
A0A5C6FX55      ---------------------------------MNRQFSVLSPPSERTPSCGGILYYFNE
A0A3L7UX05      ---------------------------------MIGPKIPMNNHQNEAMNQSLSPQLPVH
A0A5C6DS51      ------------------------------------------------------------
A0A5C6DSL6      ------------------------------------------------------------
A0A3M1VG27      ---------------------------------MNDDVPFRFADGVAGAPAVSTDRITTV
A0A518GC22      ------------------------------------------------------------
A0A3L7Q373      ----------------------------------------------------MWWRLPET
A0A3E0PW54      ---------------------------------MVGFRPPGESGTAFALTVSRPPVAPSA
A0A1Z8MHR4      ------------------------------------------------------------
A0A5C6EHJ0      ------------------------------------------------------------
A0A5C6F1H9      ------------------------------------------------------------
A0A255QXY0      ------------------------------------------------------------
A0A517SYI0      ------------------------------------------------------------
A0A518HX54      ------------------------------------------------------------
A0A5B9MF59      ------------------------------------------------------------
A0A2A2WC24      ------------------------------------------------------------
A0A518KYW8      ------------------------------------------------------------
A0A5C5YZZ0      ------------------------------------------------------------
A0A518JLD2      ------------------------------------------------------------
A0A5M6DJ15      ----------------------------------------MEFINGNGSGDGDDRGLLTE
A0A3L7P7S7      ------------------------------------------------------------
A0A517N8M1      ---------------------------------MKATPLPEPRFSDSRLSDPSTAFGSSA
A0A5C6CW01      ---------------------------------MKQSSDRGLAYSQAPAITGADRSMSDT
A0A5C6BXS9      ---------------------------------MQVIPEPESDRST--------------
M5U569          ---------------------------------MSILSEFQSDRSGSYQTLGSPATGVGM
L7CND7          ------------------------------------------------------------
A0A0J1B8S4      -------------------------------------MTPNSNSTDPTAGKRGPNSFASY
F2ARR3          ---------------------------------MELPSNASSDSRSQGASTRGKEAFASY
K5D8H6          ---------------------------------MELPSNASSDSRSQGASTRGKEAFASY
M2AKU0          ---------------------------------MELPSNASSDSRSQGASTRGKEAFASY
A0A5B1CKI2      ------------------------------------------------------------
A0A5C6EG84      ------------------------------------------------------------
A0A5C6F2X4      ------------------------------------------------------------
A0A5C5XTV6      ----------------------------------------------------------MQ
A0A5C6AAB1      ----------------------------------------------------------MQ
M5T8W8          ------------------------------------------------------------
M5SF00          ------------------------------------------------------------
A0A2G1WDS1      -------------------------------------MTPNSNSTDSTAGKRGPNSFVSY
Q7UVS9          -------------------------------------MTPNSNSTEPSAGKRGPNSFASY
A0A5C6B601      ------------------------------------------------------------
A0A517PFU1      ------------------------------------------------------------
A0A5B9M8J9      ------------------------------------------------------------
A0A2A2WFP6      ------------------------------------------------------------
A0A518L8N2      ------------------------------------------------------------
A0A518HQN9      ------------------------------------------------------------
A0A5M6D8H8      ------------------------------------------------------------
A0A5B1CRW9      ------------------------------------------------------------
A0A5C6EI46      ------------------------------------------------------------
A0A2E7D3V4      ------------------------------------------------------------
A0A2S8F9B8      ----------------------------------------------------------MT
A0A368KP63      ----------------------------------------------------------MS
A0A2E0SHG0      ------------------------------------------------------------
A0A518CQB8      ------------------------------------------------------------
A0A5B9PER9      ------------------------------------------------------------
A0A517QSM4      -----------------------------------------------------METQLTS
A0A355GJI7      ------------------------------------------------------------
A0A1Z8MCI4      ------------------------------------------------------------
A0A517SYL7      ------------------------------------------------------------
A0A3L7P0L2      ------------------------------------------------------------
A0A142XL75      ------------------------------------------------------------
A0A517SCC8      ------------------------------------------------------------
A0A3A0DR44      ---------------------------------------------------MSSPHVSES
A0A358MY60      ---------------------------------------------------------MDK
A0A517MNB1      ---------------------------------------------------------MDN
A0A517XRC2      ----------------------------------------------MARSNNGENPPTGP
A0A142YJ13      ------------------------------------MGTPGPNALHAEELPTVLPRREEA
A0A517Z7D3      ------------------------------------------------------------
A0A5C1AGE3      --------------------------------------MRRSPEGDQQGNAALAQYSAPT
A0A142XAP8      --------------------------------------MARPIAGDPPMMQPPYQVPQ--
A0A2Z3HEL7      --------------------------------------MARPIAGDPPASPPPAPFPT--
A0A1N6KY57      -----------------------------------------------------MMLNSNP
L0DK20          -----------------------------------------------------MMSNSNF
A0A660UUK3      ------------------------------------------------------------
A0A517ZHG5      --------------------------------------MMQSNQEPNHYRNGNAGVPAYT
A0A1Z8MPL5      ------------------------------------------------------------
A0A5C6C1R5      -----------------------------------------MDNHHLNGTGVPAVLEPSR
A6BZU4          ------------------------------------------------------------
A0A2D5GZ77      ------------------------------------------------------------
A0A3D3R1Z6      ------------------------------------------------------------
A0A517XG00      ------------------------------------------------------------
A0A1G2YRE4      ------------------------------------------------------------
A0A353Z859      --------------------------------------------------------MSTD
A0A2D6ST10      -------------------------------------------MDHTTRTSDTSAPAAGN
A0A177QX42      ------------------------------------------------------------
A0A517SHR0      ------------------------------------------------------------
A0A2E0AW64      ------------------------------------------------------------
A0A351FZ59      ------------------------------------------------------------
A0A660V239      ------------------------------------------------------------
A0A177Q3B7      ------------------------------------------------------------
A0A2E0X6Y6      ------------------------------------------------------------
A0A518GFD7      -----------------------------------------------------------M
A0A5C5VZJ8      ------------------------------------------------MSESEVHDTTQP
A0A518GE37      ------------------------------------------------------------
A0A5C6F3H8      ---------------------------------------------MTTSRKKNAKPTHSK
A0A5C5X072      -----------------------------------------------------------M
A0A5C5WUQ3      ------------------------------------------------------------
A0A5C6E697      --------------------------------------------------------MNDT
A0A5C5Z1A3      ------------------------------------------------------------
A0A5C6D2P7      -------------------------------------------------------MNDHK
A0A5B9ML17      ------------------------------------------------------------
A0A517LX75      ------------------------------------------------------------
A0A354GX32      -----------------------------------------------------MMPHDPN
A0A5C1AAF0      ----------------------------------------------------MALNEQLT
A0A5C6B3S0      ----------------------------------------------------------MS
A0A518GIZ9      ------------------------------------------------------------
A0A1C3EBY9      ------------------------------------------------------------
D5SX64          ------------------------------------------------------------
A0A517Z0U7      ------------------------------------------MDRNGDPQYVPEPGTPGN
A0A2S8FCC0      ----------------------------------------------MSTDQTSLPVERTN
A0A1Z8MBT6      ----------------------------------MPSERFWTPLQIVLMTTESTSNIASR
A0A517SXN9      ----------------------------------MPSERFWTPLQIVLMTTESTSNIASR
A0A518HFL0      ----------------------------------------------------MDTADSPR
A0A5Q3LBQ3      ------------------------------------------------------------
A0A3B8ZJM2      ------------------------------------------------------------
A0A1U7CLW1      ----------------------------------MEPFRSSSFINGIPTVLSQEQGASAP
A0A142WPR7      ------------------------------------------------------------
A0A3M1TFJ0      --------------------------------------------------MDSR------
A0A517P477      -----------------------------------------------MAAARTP------
A0A517T4K9      ------------------------------------------------------------
A0A2Z3GZZ5      -----------------------------------------------MADTDK-------
A0A4V0I6L6      -----------------------------------------------MATLNPLLDPASQ
A0A255QXF5      -----------------------------------------------MQQHTPRQHQGAP
A0A518KBI5      -------------------------------------------------MSDHTKTDETQ
A0A5C5V6Q5      -------------------------------------------------MSKHEHPTEPN
A0A517MY49      -----------------------------------------------MNIDQDPAHR---
A0A2E6AG00      ------------------------------------------------MTRQSTSSV---
A0A1G3A880      ------------------------------------------------------------
A0A2E8ATT1      ------------------------------------------------MSRDSHYNE---
A0A518KYQ0      -----------------------------------------------MDHQSNQLQPYHA
A0A5B9QX47      -----------------------------------------------MTTHAPPKGIP--
M5T666          ------------------------------------------------------------
M5U6N6          ------------------------------------------------------------
A0A517M0G2      -----------------------------------------------MQKTPTSSPQAAS
A0A5C6AST1      -----------------------------------------------MNPG-SGP---RS
A0A5C6C951      -----------------------------------------------MSPHPNGPDSRRQ
A0A5C6C5T3      -----------------------------------------------MSHNHNNLGGHAS
A0A2A2W6A9      -----------------------------------------------MDHQSNQLQPYHT
A0A518HQS9      -----------------------------------------------MDHQSNQLQPYHN
A0A5M6DFE6      -------------------------------------------------MVAQNSTGTHS
A0A5C6F286      -----------------------------------------------MATSRKKTTTPNR
A0A517NGN1      -------------------------------------------------------MHPSR
M5RUI3          -----------------------------------------------MQSNANRVNGNDR
M5S2L2          ------------------------------------------------------------
A0A523CME0      ------------------------------------------------------------
A0A354PCV3      ------------------------------------------------------------
A0A354PHB4      ------------------------------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A538RV31      ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
                                                                            

A0A356AE44      ------------------------------------------------------------
A0A1G2XSU7      ------------------------------------------------------------
A0A350KD81      ------------------------------------------------------------
A0A2E3Z6T8      ------------------------------------------------------------
A0A257WQ92      ------------------------------------------------------------
A0A356ETW1      ------------------------------------------------------------
A0A3L7NJY1      ------------------------------------------------------------
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      ------------------------------------------------------------
A0A524HC32      ------------------------------------------------------------
A0A660VT66      ------------------------------------------------------------
A0A0S8H0S8      ------------------------------------------------------------
A0A177PV03      ------------------------------------------------------------
A0A1G2YIM0      --MNDIEKISAGRIISTELAGYGTMASNASNSEG------------------------AS
A0A1G2ZG92      --------------------------------------------------------MEFL
A0A1G3A0W0      EIVLSAEEIINPPHVTPWPNRLMRAGGSGPSVPL------------------------AN
A0A353BE27      -----MSDVVLDQRNVNGQPSPVPGGAPEAQSEGS-----------------------NF
A0A5C6BPW1      TNGGGGGGGALVPVGNGMDPSPAPMAGNEGAGQV------------------------DP
A0A1I3GSP0      --MTAPQKQPNAAAEFDFAPFGFHKATAGRSID-------------------------IV
A0A517QJV1      --------------------MSGNSASSRASID-------------------------IG
A0A3C1QS25      DISTGIHHGSTPGDGPLFPRFGWSTFVAQMPVEGRPAWAEMGPPMGTEPESQ------RF
A0A5C6FX55      IRMSTNELSNRPYSNSPAMMQAPIAMMDRDGADGGKNE--------------------MP
A0A3L7UX05      QQGYGQGAALWNAHQHDSHEPENQSKGMN-----------------------------LA
A0A5C6DS51      --------------------MPSNSSEQNVGHQS------------------------VE
A0A5C6DSL6      --------------------MRPQSSEQAVGNQS------------------------IE
A0A3M1VG27      QRPGDVATPGAPSPPIELMRRQ------------------------------------QF
A0A518GC22      -----MSDVAMDQPRTNGQLAIPGAPEAAPQEGS------------------------SF
A0A3L7Q373      SDVTQRSQLPVVAPSIDFAPLGFQKSNDGRSID-------------------------IV
A0A3E0PW54      RHSHERTDMPAPQHNVDFAPLGYRQPDEGK----------------------------SI
A0A1Z8MHR4      -------MLDMPPSTPVGFDTSGAYGSQNQSPAN------------------------GE
A0A5C6EHJ0      ---MNQQAKPREVTSREMSDKRPPQQPMPQSALA------------------------SI
A0A5C6F1H9      ---MNQMQSQDETRSPDLADRRGREMAASPVGGG------------------------HL
A0A255QXY0      -------MLPLHSSTSSNDLRSIADGS---QDEH------------------------GQ
A0A517SYI0      ----------MPPSTPVGFDTSGAYGSQNQSPAN------------------------GE
A0A518HX54      -------MLEPSPPHVHADTFHARQPD-DIGRLQ------------------------GE
A0A5B9MF59      -------MLDQTTTQPGNYEASVSLGP-SQEHHH------------------------GE
A0A2A2WC24      ---MYSSMLDQTSPQPVNYDSSVTLDP-AQEQHH------------------------GE
A0A518KYW8      -------MLDQTSPQPVNYDSSVTLDP-AQEQHH------------------------GE
A0A5C5YZZ0      ----------MQPAPPSSTNRSGSELMNNMQSAS------------------------DV
A0A518JLD2      ---------------------------------------------------------MQI
A0A5M6DJ15      PRSLRTSRPRVNGSSPVMPPPVVQGTIDDDEPQF------------------------DP
A0A3L7P7S7      ------------------------MSQEGGRLPE------------------------DA
A0A517N8M1      QPE----------------------------QQ-------------------------AI
A0A5C6CW01      S------------------------------AD-------------------------ST
A0A5C6BXS9      -----------AVGSYPTHAPAWEGGK----HE-------------------------TT
M5U569          PEGPSG-------------------------DS-------------------------GP
L7CND7          ------------------MNEGWRSGGSAEPAD-------------------------AG
A0A0J1B8S4      PSQNAGTMGLAATGSYPAMNEGWGSADQG---D-------------------------AS
F2ARR3          PSPNPGAMGLAAQGSYPAMNTGWQPTHQAA-NE-------------------------TA
K5D8H6          PSPNPGAMGLAAQGSYPAMNTGWQPTHQAT-NE-------------------------TA
M2AKU0          PSPNPGAMGLAAQGSYPAMNTGWQPTHQAT-NE-------------------------TA
A0A5B1CKI2      -----MQATAPPSPQLAQKLDPF--STAPGTNAQ------------------------PV
A0A5C6EG84      -----MKVQQLTEPRFSDPSGAF--AAPSEAEDK------------------------AV
A0A5C6F2X4      -----MKAQQLTEPRFSDPNQGL--TASAQTENQ------------------------AV
A0A5C5XTV6      VIPESESDRPTPVGAYPAPAPSWQGGKP-----E------------------------TT
A0A5C6AAB1      ANPDSDFERPVVMGAYPAQNPGWQGDSAAAAGGD------------------------SA
M5T8W8          ------------------------MSTPDGPSVD------------------------SA
M5SF00          -------MGQAAMGSYPAMNEGW-GSSGSSQTAE------------------------SA
A0A2G1WDS1      PSQNAGTMGQAAMGSYPAMNEGW-GSSGSAQTAE------------------------SA
Q7UVS9          PSQNAGTMGQAAMGSYPAMNEGW-GSSGSAQTAE------------------------SA
A0A5C6B601      ------------MLEQDIHQINDAAAGEDLPGLS------------------------GE
A0A517PFU1      MPSFAASGSSFPGEDPQAEGYGRGGDGPNAPRSHAVTGYDANGGWGAQSAGGDAATEEGF
A0A5B9M8J9      ---------MLDHSTPHLHSHAGRLMDQDVELPQ------------------------GE
A0A2A2WFP6      ---------MLEQLPPHVHSDTGHAMERDGGRLQ------------------------GE
A0A518L8N2      -------------------------MERDGGRLQ------------------------GE
A0A518HQN9      ---------MLDQASPHSAIQDANGSADLLPEHH------------------------GE
A0A5M6D8H8      ---------MLDQTSPSQQTHEISGAIDSVQDVQ------------------------GE
A0A5B1CRW9      ----------------------MTKPSKTISMVT------------------------GE
A0A5C6EI46      ----------------------MADANKSMGLSP------------------------NE
A0A2E7D3V4      ---------MDNSENRPVERPFEFAVLSENSDKP------------------------KV
A0A2S8F9B8      NGNLVIPSDRDRHASKADVPGAVIGMRPPEENGM------------------------QF
A0A368KP63      NGNLVIPSDNNRQAASVNVPGRVVDVRSSDEDSN------------------------RM
A0A2E0SHG0      ------------------MPTAPLPETLSSQSPL------------------------HG
A0A518CQB8      ------------------MPTTPPPEQQTSQSPL------------------------QG
A0A5B9PER9      -MEPNNNQIGQYQNPNQMGSPMGMPPVMMAQDDD------------------------EA
A0A517QSM4      DSSSSLTSVNPVHEVAQPRATSVGPHPNQGNEAI------------------------DT
A0A355GJI7      ------------------------------------------------------------
A0A1Z8MCI4      ---------------------MDDLDKIETSQAI------------------------GL
A0A517SYL7      ---------------------MDDLDKIETSQAI------------------------GL
A0A3L7P0L2      --------MNKRSSLPVAEPDVDFAPLGYHKSQE------------------------GR
A0A142XL75      ---------------------------------M------------------------TG
A0A517SCC8      ---MNEVEPVNMPQNARSSESVEFAPLGVVSGNK------------------------GR
A0A3A0DR44      ALIAQTAGPPALLRPPPIQFGGPPKPAPQTGAGI------------------------TI
A0A358MY60      VKSIIDQQAV--PALPRSGAGQPMPQPAADSVNF------------------------DP
A0A517MNB1      RITPSNEYRVDRSAAPRGPVERRVEPPAAKGQEF------------------------DP
A0A517XRC2      LQPYNNPPGGMLAPGGGPYGPSVTIPGGTGKTPP------------------------TP
A0A142YJ13      VAHGEMMIPVDRIAQRSVAVPSNLEPAPGTTDAP------------------------DL
A0A517Z7D3      ----------MSTQTPTHESDIEFAPLGHASSSP------------------------GK
A0A5C1AGE3      YSIPGG-AYSAAPSPV------SLPSPVGNRNVP------------------------TF
A0A142XAP8      ---SGG-PVPVALSPFNYTNQPNIPGPAVA-ATP------------------------TP
A0A2Z3HEL7      ---PGGVPAPVAPSPFSYTNQPSLPGPTVS-SAP------------------------TP
A0A1N6KY57      GSRPDSVNLPATIPPHRKDSFADSSAVMGSSTSL------------------------DP
L0DK20          GPQPNSANLPAVVPPHRAEVFSVSSPPAGPVAGL------------------------DP
A0A660UUK3      ------MADLERYENRMVQQEVVQFDGPPDGHEG------------------------SV
A0A517ZHG5      NGGGGGGGGALVPVGNGMEPSPASMGGNEGAGQV------------------------DP
A0A1Z8MPL5      ------------------------------------------------------------
A0A5C6C1R5      GQRSSSSGQSISYADNSSGWSESPRAEVESQENF------------------------DP
A6BZU4          ------MNTDFQPLDQQSDFAIDGMEENAEVNSS------------------------GP
A0A2D5GZ77      ------MNTDFQPLDQQSDFGIDGMEENAEVNSS------------------------GP
A0A3D3R1Z6      ------MNTDFQPLDQQSDFGIDGMEENAEVNSS------------------------GP
A0A517XG00      ------MNTDFQPLDQQSDFGIDGMEENAEVNSS------------------------GP
A0A1G2YRE4      ------MNNLEKYADRLLEQKLVNTGTPPEFNGQ------------------------GS
A0A353Z859      QMNGQGAMVPVRRNEVGMPGPAVGGAPANSGIVV------------------------DQ
A0A2D6ST10      ETNGANDNGTLSVPAPLVLPLSVVNAADGEEATV------------------------NF
A0A177QX42      -MFHLEIRVSTTTTDWQAP---NNPALEEQPNEK------------------------GL
A0A517SHR0      --------MSTTTTDWQAPTPITPSATEEQPTDK------------------------GL
A0A2E0AW64      -----------MNLSTSQPPPLNSSTESESAAQL------------------------SP
A0A351FZ59      -----------MNLSTSQPPPLNSSTESESAAQL------------------------SP
A0A660V239      ------MDELQRYQPQPLGQEVVQFEGPVEDQSD------------------------ST
A0A177Q3B7      ----------------------MSGPDSGRATAP------------------------SP
A0A2E0X6Y6      --------------MNSELDSNLAQEGPASSEIV------------------------SA
A0A518GFD7      VTDRVNGTNGQRTNAQQQIVVARPVKGGPEPSGP------------------------NL
A0A5C5VZJ8      VRALAKAGPIGPAGALAAPLIIDADAGAAPSTPV------------------------SL
A0A518GE37      -------------------MQNPATAKNASPPAF------------------------DP
A0A5C6F3H8      PTHSKLSGTVPSAAPRSSSKARAHAPVDSESSSF------------------------DP
A0A5C5X072      TQHLNHQGSRTSIVGPPRAKAAANSPSNDAAKAF------------------------DP
A0A5C5WUQ3      --------MNTNYISSERATETSYRPSARPENQF------------------------DP
A0A5C6E697      QQLTKTSPHAREETTKAVPSRTVSTPPKDAAAAF------------------------DP
A0A5C5Z1A3      --------------------MTASN--SGASTQF------------------------DP
A0A5C6D2P7      ATSGHAGRIAPPPLPTAVPSKSIAA--TSSAGQF------------------------DP
A0A5B9ML17      -----------MNQSVVVSAPIARNQPKTEAKAF------------------------DP
A0A517LX75      -------------------MNESETHRIAEQDSF------------------------EI
A0A354GX32      AMKTKTASPAGPITPAAASTEQAAPAPPGLSAPP------------------------GA
A0A5C1AAF0      PVAKSVDVVVHRAELIGGTGAGSAPAVGAPGLAL------------------------TP
A0A5C6B3S0      TDPLPNGQSQMIVLPHDLDWGDDQDAGNRDSSGG------------------------GL
A0A518GIZ9      --------------MRQTPQDSELASSFETEGEG------------------------GL
A0A1C3EBY9      --------------MRQTPQDSELASSFETEGEG------------------------GL
D5SX64          --------------MRQTPQDSELASSFETEGEG------------------------GL
A0A517Z0U7      GHMVEPPVPAHAPPQPVQVMGGNPAGEEQQEGGI------------------------QI
A0A2S8FCC0      REIRFDSPIDLTPGSSNEFPHINDVVEMDDTGGT------------------------GI
A0A1Z8MBT6      -------------------QSSHSNASTGEGAPI------------------------DP
A0A517SXN9      -------------------QSSHSNASTGEGASI------------------------DP
A0A518HFL0      PGHELARLTELPPALRVPPPPASRTSSPGGGLPI------------------------NP
A0A5Q3LBQ3      --------MATKAILPAIRQAPALPAETNPAQPI------------------------TA
A0A3B8ZJM2      ------------------------------------------------------------
A0A1U7CLW1      TPVELLPVDRIVPGYGASLKAVEPPPGLSEMPDL------------------------DG
A0A142WPR7      ------------------MGIRGDFEDELSEKSD------------------------ER
A0A3M1TFJ0      -------------------ESQLGRLEDEDELHE------------------------DL
A0A517P477      -------------------RPPVSQPVADEHFQI------------------------DW
A0A517T4K9      ---------MLPALPAGQVPAITTAMMPAESRPI------------------------DH
A0A2Z3GZZ5      -------------------NTAAPPDDDEPASGL------------------------NP
A0A4V0I6L6      SS-----------------ASIILPPVAAEPPAE------------------------QP
A0A255QXF5      -------------------YHFNGPSSGPDSGGF------------------------DP
A0A518KBI5      LPIRRVD-NGIVKHDAYHRHPRPVNNSGPAPSHF------------------------TP
A0A5C5V6Q5      FMLQRVDQSGSPQPIATQSNSRHWSAPQNAPQQF------------------------TP
A0A517MY49      -------------------EDNDSTSTSELLKTF------------------------MR
A0A2E6AG00      -------------------SNLLPTTGSHVLHNA------------------------MW
A0A1G3A880      -----------------------------MVYAV------------------------LY
A0A2E8ATT1      -------------------QN----STSEAVRAV------------------------LR
A0A518KYQ0      G------------------PVVRVPASSEPTNSF------------------------DP
A0A5B9QX47      -------------------GYSAGSPGAAPPFQF------------------------DP
M5T666          ------------------------------------------------------------
M5U6N6          ------------------------------------------------------------
A0A517M0G2      QFRNHARP-----------PVRAAHGAPSGSTDL------------------------DP
A0A5C6AST1      NGVRTYE------------GLRRPDEKPNSGYEF------------------------DP
A0A5C6C951      NSSGRAK------------VKRSAHGNDKSNIEF------------------------DP
A0A5C6C5T3      VPGTQG-------------RTLPAPSGDAAAKAF------------------------DP
A0A2A2W6A9      G------------------PVGRMPVSNEPPNAF------------------------DP
A0A518HQS9      G------------------PVVRMSASSESPNAF------------------------DP
A0A5M6DFE6      MTLHTNQPGHGHPGHGPGHHRPGHPGHGHSSNAF------------------------DP
A0A5C6F286      NPETGADRDQARPRRKGPVMTGPPSRAATDETSF------------------------DP
A0A517NGN1      S------------------ASSASIGDAASGASF------------------------DP
M5RUI3          P------------------IGRLSGPSAGANSQF------------------------DP
M5S2L2          ------------------------------------------------------------
A0A523CME0      ------------------------------------------------------------
A0A354PCV3      ------------------------------------------------------------
A0A354PHB4      ------------------------------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A538RV31      ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
                                                                            

A0A356AE44      ------------------------------------------------------------
A0A1G2XSU7      ------------------------------------------------------------
A0A350KD81      ---------------------------------------------------MAQQFLMGQ
A0A2E3Z6T8      ------------------------------------------------------------
A0A257WQ92      ------------SLQWKAPVGSAAADGQTTT--------------------NVHQERVLA
A0A356ETW1      --------------------MLPSGDGKEIL--------------------DPATKRALY
A0A3L7NJY1      -------------------DLVDTGDKTNSL--------------------SVVSETIKL
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      -------------------------------------MDYKDSPEFNP------------
A0A524HC32      -----------------------------------------------MPGDKDKTDAVVS
A0A660VT66      ------------------------------------------------------------
A0A0S8H0S8      --------------VLQAALERCGGAGLKIL-----------------------------
A0A177PV03      -------------------MVLGDAASALATKGLSSLEGLSQSEILAV------------
A0A1G2YIM0      MNLWPAICRHW-RALLVTFMIAAGMGTPLIW--FAVKPMYESAGAIRI---SPIVPSILF
A0A1G2ZG92      KIWEILSRRKWIFISAFLGFFGIVVIGTILI-----TPTYKAKAKLIIETSDTISSLLSS
A0A1G3A0W0      DILGSFLRFKW--TVLFVFLLVSAPAIAIIW--MQIVPKYRARAEVRV---RPIVPHLVF
A0A353BE27      DFVQILWRWKW-LPILGSIV--GACLGFLYF--SRLPETFEAAARVQV---ISSIPAPVK
A0A5C6BPW1      KALLNAFRRRW-FLAVTVGLFCGGSAAAAVY--LLVPPNYVASSIIYI---DATPGSVLQ
A0A1I3GSP0      SFVLSLWK----PMAIGLFL--GLLVGVGLY--LMMGPVYSATTSVLV------------
A0A517QJV1      RFLLSIWK----PLILGGCL--GGMAGIGMY--LFLGPIYSANTQVLV------------
A0A3C1QS25      DFLAMAWRRKW-LIAFGLMV--GLGLGFLAY--KQQTPIYTSVAKVMI---TPKNPATVI
A0A5C6FX55      NIGAAMWRYRW-AVALPTML--GMVAGFLLF--LRTNETFRATTQIMI---ESNRPAVMD
A0A3L7UX05      TVWRSIRRYWWQAGLLWVIS--SGVLMFLAF--TSVKPTFLSFALLRV---EPPRASILG
A0A5C6DS51      LDIIGLIRRRWYHLVLGTVF--GVGVGLLYF--YATTPMYESHIEILV---GQRSSEMAS
A0A5C6DSL6      LDFIGLFRRRWHHLLIGICV--GIAIGLLYF--YSTTPMYESRIEILV---GQRSSEMAN
A0A3M1VG27      DPLEIGLRYRV-WIGLAILA--GLLLGGLAY--WKFGPTYDAKAQILV---SRKASIHLK
A0A518GC22      DIVQILWRWKW-LPILGSIV--GACLGFLYF--SRQPATYEAAALVQV---VSSTPTQTR
A0A3L7Q373      RFAMSIWK----SLAIGLMA--GCGLGVLAY--LYSGPTYVAETQIMV------------
A0A3E0PW54      DILKFTMSIRN-MLIAGLAV--GLLVGVGVY--MCLGPAYQADTRIEV---SQKSAIPMD
A0A1Z8MHR4      SVLTILWRYKW-LIGMLLLA--GLIIGYWNY--KRTPTTFLSSTQLMF---KSETPLSLD
A0A5C6EHJ0      DFAKIAWNSKY-LLILGMLL--GLGCGYFYF--SRTPATYRSAAQVQI---VESTARNLP
A0A5C6F1H9      DYAKVAWNARY-LLALGTLI--GLAVGYFHF--TRQPAMYRSAAQVQI---VESLARNLP
A0A255QXY0      AVLSILWRFRY-LVAICVVI--GVGVGHWYH--RQKPAQYQATSKLMF---RSDAPMALD
A0A517SYI0      SVLTILWRYKW-LIGMLLLA--GLIIGYWNY--KRTPTTFLSSTQLMF---KSETPLSLD
A0A518HX54      PIGTVLWRYKW-LIGVLLPI--GTLLGYWVN--RQKPMTYRATTRLMF---KSDTPLTLD
A0A5B9MF59      TILTVLWRFKW-LLTAFVAV--GTSVGYWMY--KQKPTTYRATTQLMF---KSDTPISLD
A0A2A2WC24      TILTVLWRFKW-LLAAFVAI--GTSIGYWMY--KQKPTTYRATTQLMF---KSDTPISLD
A0A518KYW8      TILTVLWRFKW-LLAAFVAI--GTSIGYWMY--KQKPTTYRATTQLMF---KSDTPISLD
A0A5C5YZZ0      SVGGVLWRRKG-LILFLILC--GLGGGYWFF--TQQEETFRAGATIEVY--SQNVQTNTG
A0A518JLD2      DWVKLIWGGRW-LLLLGLLV--GLGAGYFHF--KTLPPEFLSSSDVQIIESTTNKNMAVD
A0A5M6DJ15      AVIRHSVRRRWPLALIFGLMLAPLLAGAAWI--ALKPKDMAVAVLKID---SVAAPLIFQ
A0A3L7P7S7      MNIFRMLQQRMGLIAVLAVL--GLVAGGLFT--LRMLPAYAASVDVMV---VKKKGAMAS
A0A517N8M1      NVAAAVWRYRW-AVAIPVLI--GAVCGLMIY--LQLPETYRSTTRLMI---ESDKSTMLD
A0A5C6CW01      NLLASLWRYRW-AVILPAIV--GATAGFLLY--LKTPETFRASTRLIV---ESDRPAILD
A0A5C6BXS9      DMLAAVWRYRW-AVLIPAVL--GLVGGLLMY--LKTPETFQSSTRLMF---EANRPAVIN
M5U569          DMLAAIWRYRW-AVIIPAIL--GAAGGFIAF--LKTPETFKSATRLMF---ESDRPAVLD
L7CND7          DLMGAIWRYRW-AAFVPAIL--GAVIGFLVF--VKTPETFQSGTLLMF---ESDRAAVID
A0A0J1B8S4      DLLGAIWRYRW-AAMGPTIL--GAMIGFLVF--IKTPETFQSATLLMF---ESDRPAVID
F2ARR3          DIAAAIWRYRW-AVLIPTIL--GLVAGFLAF--VKTPETYQSATRLMF---ESDRPAVMD
K5D8H6          DIAAAIWRYRW-AVLIPTIL--GLVAGFLVF--VKTPETYQSATRLMF---ESDRPAVMD
M2AKU0          DIAAAIWRYRW-AVLIPTIL--GLVAGFLVF--VKTPETYQSATRLMF---ESDRPAVMD
A0A5B1CKI2      NVAEVLWRYRW-AVALPVVV--GAVVGLLIY--LQLPETYRSTTRLMI---ESDQAAVLD
A0A5C6EG84      NIADAVWRYRW-AVAIPVVV--GAVCGLLIY--LQLPETYRSTTRLMI---ESDNQAVLE
A0A5C6F2X4      NIADAVWRYRW-AVALPVIV--GAVCGLLIY--LQLPETYRSTTRLMI---ESDNKAMLE
A0A5C5XTV6      DMLSAIWRYRW-AVLIPTVI--GFVCGLLLY--LKTPETYQSSTRLMF---ESHRPAVID
A0A5C6AAB1      DLVAAIWRYRW-AVIVPGIL--GLLFGFLFY--IKTPETFQASTRLMF---ESDRPVVLD
M5T8W8          DMVASIWRYRW-AVIIPAIL--GAAGGFIAF--LKTPETFKSATRLMF---ESDRPAVLD
M5SF00          DLMGAIWRYRW-AALVPTIL--GAVIGFLVF--VKTPETFQSGTLLMF---ESDRPAVID
A0A2G1WDS1      DLMGAIWRYRW-AALVPTIL--GAVIGFLVF--VKTPETFQSGTLLMF---ESDRPAVID
Q7UVS9          DLMGAIWRYRW-AALVPTIL--GAVIGFLVF--VKTPESFQSGTLLMF---ESDRPAVID
A0A5C6B601      SMLTVLWRFKW-LLVIFTAV--GLGVGYWVY--QRKPTTYMASSKLMF---RSDKPLILN
A0A517PFU1      QLGRLLRRRWW-VLLLGLAS--GLGGGYLYD--LYQPPVYQSVAELTV---SARRTALPG
A0A5B9M8J9      TIATVLWRYKW-LIGILLPL--GTLLGYWVN--CQKPTTYRATTKLML---KSDTPLTLD
A0A2A2WFP6      AIGTVLWRYKW-LIGILLPI--GTLLGYWVN--RHKPVTYRATTRLMF---KTDTPLTLD
A0A518L8N2      AIGTVLWRYKW-LIAILLPI--GTLLGYWVN--RQKTVTYRATTRLMF---KTDTPLTLD
A0A518HQN9      SILAVFWRFKP-LILVLVII--GTGVGYWRY--HEKPTTYRATSQLMF---KSDTPISLD
A0A5M6D8H8      SILTVLWRFKW-LLGVFLAA--GTGVGYWIY--KQKPTTYRATTQLMF---KSDTPLTLD
A0A5B1CRW9      IDPIGMIRRRWRLLTFGAVM--GVLLSGLYF--QTAKKSYQSSVEVLV---GQRSSEMTN
A0A5C6EI46      LDISGMIRRRWRLLVFGMVV--GVGLSILYF--KTAPRVYESSIEVLV---GQRSSEMTN
A0A2E7D3V4      EFDVVQIALRH-KKIISIGVICGLVIGHLAY--KQAGPEYEATVKILV---SKKADVMDK
A0A2S8F9B8      GQVLHSLRRQW-LAAVVLGLLCAAPIAVGAW--LLQSPTYTSSAYLRI---SASEQPLAF
A0A368KP63      GQVVHSLRRQW-LASVVLGVLLAVPIGVGVW--LLQAPKYSSSAYLRI---SANDQPLAF
A0A2E0SHG0      ILDVLSILRRR-IGIILFFVVVGVALGTLGI--LQLKEKWKSEAQIHI---IRRDPNLAT
A0A518CQB8      VLDVLSIIRRR-KGIILFGIIVGAALGTLAI--LKLPEKWESQAQIHI---IRHDPNLAT
A0A5B9PER9      AFDFWGVLNRR-KWLVFLGLVTGLALGALVY--AKSETIYESVASVKI---EPRNKPSIR
A0A517QSM4      RALLNSVRRNW-FVATLLGLIFGTGAAVATW--VYVPAPYQAFFEFHI---NSVESKILF
A0A355GJI7      ------------------------------------------------------------
A0A1Z8MCI4      GLILQTARRHL-LWVLPTGFVLCALVFLLLH--DWKVDRYQASHWVEI---APNHVAFSD
A0A517SYL7      GLILQTARRHL-LWVLPTGFVLCTLVFLLLH--DWKVDRYQASHWVEI---APNHVAFSD
A0A3L7P0L2      SIDIVRFAISM-WKYLIAGLVLGCGMGGLAY--LYMGPVYVAGTKITV---SKKATVGET
A0A142XL75      RAILNAVKRRP-FTLLGVALLAAGTGAAVWL--FLPLPKATAATVFHV---SAQAPSVLG
A0A517SCC8      SIDIARFALSL-WKPMVLGLVAGCLMGLGAY--SYLGPTFEANTQVKV---SQKASLPSS
A0A3A0DR44      GFVYRSFQHWW-RVAIPAGLVCALLAGAAVW--LTWTPKYRAYAIIEI---PDRGGVLLP
A0A358MY60      RVLVSTWRHCW-FWATPLGVALGCAAAFTVY--ASFVPMFKASHM--L---EANQDYIVF
A0A517MNB1      RLIWVTFRRCW-LWAVPLGLALASVAAYAVF--ATFVPMYQATHL--L---EKNQDYVVF
A0A517XRC2      LGLLNALRRRW-VLATFLGLLVGSALGTGVW---FILPGGKHTARATV---QLRPSTVES
A0A142YJ13      IGLLRALRRRW-RLAFLGGLSCASLAAAAAF-YYLPSPKYTTSSLVHV---AEKRPREIF
A0A517Z7D3      SIDIINFTLSI-WKPLALGIVAGGILGVLMY--LRMGPVYEANTRILV---SQRAAVADS
A0A5C1AGE3      MGLLNALKRRW-VLASFLGLLVAAAAAVALW-IAAPQGKHQVKALLEI---TPENVGLMP
A0A142XAP8      LGLLNAFRRRW-VLGTFIGGLVAVAVAVGIW-LALPTGKHQVRALVQL---QPKQVEFV-
A0A2Z3HEL7      SGLWNAFRRRW-VLSTFVGALVAAAVAVGAW-LAMPAGKHQVRALVQL---QPQHAYIT-
A0A1N6KY57      FMLLKALRRRW-AMALGIGLVGAGVIGFTTY-LLVPAAKYTARSMLHV---NSVQPRILL
L0DK20          VAMLKALRRRW-PLALGAGLLGGAVLAFATY-FLVPPAKYTARSMLHV---SSTQPRILL
A0A660UUK3      TELIVPILRRW-YVIMATFIVVCGIGVPAIW--FGMEQKYETTGSIRI---SPIVSRILF
A0A517ZHG5      KALLNAFRRRW-FLAVTVGLFCGGSAAAAVY--LLVPPNYVASSIVYI---DATPGTVLQ
A0A1Z8MPL5      -------------------MLFAIPAGLGTW--FLVPVNYTAHSL--M---QSRRNTLIF
A0A5C6C1R5      LSVFHSLRRHW-PVALLTGLLLAPPMAVVGW--FLLAPKDTAMAYLRI---DSVDSLLVF
A6BZU4          GVDIVRLLLRN-KYLLVLGLATGLLLGQAAY--MKLGPIFSANTKIQV---SQKNPVPIK
A0A2D5GZ77      GVDIVRLLLRN-KYLLVLGLATGLLLGQAAY--MKLGPIFSANTKIQV---SQKNPVPIK
A0A3D3R1Z6      GVDIVRLLLRN-KYLLVLGLATGLLLGQAAY--MKLGPIFSANTKIQV---SQKNPVPIK
A0A517XG00      GVDIVRLLLRN-KYLLVLGLATGLLLGQAAY--MKLGPIFSANTKIQV---SQKNPVPIK
A0A1G2YRE4      PDLIKGILHRW-YILLLGFSIMCAIGLPAIW--LSIKPQYTVTGALRF---SPVLMNILT
A0A353Z859      NTVLAAMRRRW-LIATALGLTGALVGAATTW--LLIPVTYTTRAELRV---KAVNYTP--
A0A2D6ST10      HVLWGAFRRRW-LLASVLGLIFGVAAAAAAW--ELLPAPFTATAQVRI---NSFDPFFFF
A0A177QX42      DFFTAIMGRKF-LVVAFIGIGLGLGHLHF----TRQPPVFASFAKVMV---LRPQSVLPN
A0A517SHR0      DVFNAIMGRKF-LVVAFIGIGIALGHLYY----TRQPPVYASFAKVMV---LRPQTSMST
A0A2E0AW64      MLVLEAARRWW-AIATPVGLLAGLIVAAILY--LQFEPLYEAKALLRI---TTPISFDGS
A0A351FZ59      MLVLEAARRWW-AIATPVGLLAGLIVAAILY--LQFEPLYEAKALLRI---TTPISFDGS
A0A660V239      MNLAAAILRRW-PVLVATFVVVCAVGVPAIW--FLVEKKYDTEGAIQI---SPVESPILF
A0A177Q3B7      WELLRAFRRCW-FPATSLGLLVALLAAGAVW--YLLPNRFTATTLLHV---SAQEPTILA
A0A2E0X6Y6      AMRFLRLIRRR-QNVLLVALALCSAVGAAVY--IAAPRYYASTAKLLI---IEQKSDQLA
A0A518GFD7      SAALGSLRRWW-WIGLPLGVLLGVAGAVAGW--LAMVPKYAASAYLRI---DSDNRPLLF
A0A5C5VZJ8      AMLW-----RF-KWTIAGTFMLCAAAGLGLI-WTAIRPAYSASGVIHI---KPVRDDLLS
A0A518GE37      WLLWIAFRKHW-GWVLPMGFLFASAAGLAVW--SQFVPEFEATHI--M---EANRDYVLA
A0A5C6F3H8      WILWVTFRRCW-PWAVPAGMVLAGVAAMFVL--QGFVPRYEATHL--L---VANDEYVVF
A0A5C5X072      WIIWVTFRRCW-PWAVPVGAALAGIAAFVVM--QGFVPEYRASYL--L---ESNEDYVVF
A0A5C5WUQ3      WILWVTFRQCW-PWAVPCGAILSAITAFVVL--QNFTPTYRASHL--L---EANDDFVVF
A0A5C6E697      WILWVTFRRCW-FWALPLGILLGGFSVYYVN--RTFVPTYRASHL--L---EANEDFVVF
A0A5C5Z1A3      WILWVTFRRCW-FWVLPIGAVLAALASFGVL--STFVPTYRANAL--L---QANQDWIVF
A0A5C6D2P7      WLIWHTFRRCW-PWALPIGIILAGAAALAVQ--RTFVPEYRAQHL--L---EANEDYVVF
A0A5B9ML17      WLLWVTLRRCW-YWAVPVGLVLACLAAFSVL--ATFEPRFRAQHL--I---EANQDYILY
A0A517LX75      DILRLLRRRWP-LLLFGLLVGVGVAVAYQMNARVSYESNMEILIALRS---SELTNSGTS
A0A354GX32      TAVWYAIRRRW-LTILVLGLGLGSLGAAAAW--YIMPAKYTATATLRL---NPQSPRGVN
A0A5C1AAF0      GALLRALRRRL-ILALAVGVVLAAVAATAVW-VYLPPPKPRVSAKLYV---DYSQRGTLF
A0A5C6B3S0      TSVLHAFRRRW-LLATALGICGGLMASFTAW--RLTAPTYSTASLLRV---ASQDAPLVF
A0A518GIZ9      SIDWMNLVFRY-RWWLCAGVVLGLGLGIAAY--MKLGPEYMAIGQVMV---SRRNAVPLK
A0A1C3EBY9      SIDWMNLVFRY-RWWLCAGVVLGLGLGIAAY--IKLGPEYMAIGQVMV---SRRNAVPLK
D5SX64          SIDWMNLVFRY-RWWLCAGVVLGLGLGIAAY--IKLGPEYMAIGQVMV---SRRNAVPLK
A0A517Z0U7      SAVLAAFRRRW-FTAISLGLVLGAAAAATVW--YVTPVTYTSYAE--L---QFDLTPFYF
A0A2S8FCC0      SHVFHAVRRRW-LPAFSIGVLLAAVAATSVW--LLDVPEYTARALLRI---SSRHGTLLK
A0A1Z8MBT6      WIIWVTFRRCW-VWAVPIGLVIGTIGAVMVL--KSFQPEYTARYI--V---AANQDWVIY
A0A517SXN9      WIIWVTFRRCW-VWAVPIGLVIGTIGAVMVL--KSFQPEYTARYI--V---AANQNWVLY
A0A518HFL0      RLVLRGLARHW-WQALALWVVGTAALATLVY--LRYEPTYRSSSMLRI---ETDPANPYV
A0A5Q3LBQ3      TFVANSLRQWW-WAFVPAALGLALASATAIM--MFFEPVYEASAWIQI---AEREPYIAF
A0A3B8ZJM2      ------------------------------------------------------------
A0A1U7CLW1      LLR--ALRRRW-LFALLGGLLCSSLSAAAVY-LYLPPPKYTARALVHV---AEKRPRELF
A0A142WPR7      TVNFLALTWRY-LWLLILFGGVGTGAAYLHF--LKQPPIYQSSSTVLV---TGDRQQQAN
A0A3M1TFJ0      WVYLQTLRRQL-PLVLVVA---GACTLLATLRTLRLPAVYAATASLRL---------VRE
A0A517P477      RPAVAGLKRFW-YVAVLVGLPLGAGGAYAAW--IYIPAPYVASAELYM---RSYVDRVAF
A0A517T4K9      RGLWSAFRRRW-LWATLGGGIVGLCAAAVVY--FMMETPYHAFAEIRM---KSVQERLLF
A0A2Z3GZZ5      LHLVM---RRW-QF-LAVGLIIGGVLGALIY--STSAPQYQSTAQVLV---VKKGVEVTK
A0A4V0I6L6      NVLFAVLRR-W-PWLV-LGLAVGCVLGLLFH--MQRTPVYQSTAELMV---VKSRPDMVA
A0A255QXF5      WLIWVTFRRCW-HWAVPAGLVLGSIAAFGVL--STFEPQFEAGYR--L---EANKDWLLD
A0A518KBI5      KFLLWVFSRSW-KVVVPVGVLLAAATAAVLL--YTYVPQFAASGLIKI---EDIQPYVAF
A0A5C5V6Q5      KFLVWVFLRHW-KLVVPSGLVLAAAAVSALL--WTYQPDYLATGLVRI---EDTQPYIAF
A0A517MY49      FARILRLRQKT-VLATLVLSCLLGGCYYTFA--TRYFQSSAELLI--I---EQYRDQLS-
A0A2E6AG00      LVRSVRYRKHY-LIGALVASGLVGAVYFFTA--DRIYEASSQLLV--Q---QMSPVVASG
A0A1G3A880      FLRVVRYRRSV-MVTALLITGLLGGLYFTTA--TRYYEADASLLI--L---QTGGDVLTP
A0A2E8ATT1      FLRVIRYRKSY-LIVALTTAVLLGSVYYFTA--ARIYEAKASLLI--T---QSSPDVWNG
A0A518KYQ0      WLLWITLRRCW-FWAIPIGIVLATVAAFLVL--QTFVPMYRASHH--L---AANKDWLID
A0A5B9QX47      WLIWVTFRRCW-MWALPCGLVLAGIAAYVVQ--RDFVPRYRASHL--L---EASQDYVLF
M5T666          --------------------------------------------M--L---EANEDFVVF
M5U6N6          ------------------------------M--LGFVPRYQATHL--L---EANEDFVVF
A0A517M0G2      KLLWVTIRHCW-IWATPIGLALAAAAAFAVF--SGFVPVYKASHL--L---EVNQDFVVF
A0A5C6AST1      RLIWVTIRRCW-LWATPIGLALAALAAYGVY--ATFVPIYQATHL--M---EANQDFVVF
A0A5C6C951      KLLWVTVRRCW-LWATPIGLSLAAAAAFIVY--SRFVPIYQATHL--L---EANQDYVVF
A0A5C6C5T3      WILWVTFRRCW-PWAIPLGAALAGIAAFVVI--RGFVPRYQASYL--L---EANEDFVVF
A0A2A2W6A9      WLLWITLRRCW-YWAFPVGIVLGVIAAFVVL--QSFVPRFRATHQ--L---AANKDWLID
A0A518HQS9      WLLWITLRRCW-YWAIPVGVVLAVIAAFAVL--QSFVPQFQATHH--L---AANKDWLID
A0A5M6DFE6      WLIWVTLRRTW-YWAVPVGLVLASVAAFAVL--KQFVPRYESSAL--L---EASRDYVAF
A0A5C6F286      WIIWVTFRRCW-AWAIPAGAVLAGLTAMAVL--RGFVPRYEASHL--L---VANDEYVVF
A0A517NGN1      WMLWVTVRRCW-FWAVPIGLVLASLAGFVVL--KTFVPRYKAIHL--L---EANQDYVVF
M5RUI3          WILWVTFRRNW-LWAVPVGMVLASLAAFGVF--KSFVPVYRASHL--L---EANSQWVVF
M5S2L2          ------------------------------------------------------------
A0A523CME0      ------------------------------------------------------MSKIEG
A0A354PCV3      ------------------------------------------------------RINQTL
A0A354PHB4      ------------------------------------------------------RINQTL
A0A356ESF4      ------------------------------------------------------------
A0A538RV31      ---------------------------------------------------REKQGKDGE
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
                                                                            

A0A356AE44      ------------------------------------------------------------
A0A1G2XSU7      ------------------------------------------------------------
A0A350KD81      TR----------------------------------------------------------
A0A2E3Z6T8      ------------------------------------------------------------
A0A257WQ92      AE----------------------------------------------------------
A0A356ETW1      FA----------------------------------------------------------
A0A3L7NJY1      LA----------------------------------------------------------
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      -----------------------------------------------------VKKANIF
A0A524HC32      RE--------------------------------------------------------LL
A0A660VT66      --------------------------------------------VCR-------------
A0A0S8H0S8      ------------------------------------------------------------
A0A177PV03      -----------------------------------------------------------L
A0A1G2YIM0      SD------------------------------RDSEQAMPNYMNFMN-------TQAELI
A0A1G2ZG92      LG-----------------------------TKGTKIGGVIPPKTGKTGSTDYETDIALA
A0A1G3A0W0      --------------------------------RTDENGAIPFYDSFV------NTQVSYM
A0A353BE27      NP---------------------------------YFSGGQEVNRID--ESMI------I
A0A5C6BPW1      DN----------------------------------SSFSSDFDTFK--RTQMFRALSRV
A0A1I3GSP0      --------------------------------SKKASVPANNGEANR--YGERGDHVQLI
A0A517QJV1      --------------------------------SKKASVPINDGEANR--FGDRGDHVELI
A0A3C1QS25      IP---------------------------------GFEGMPSGPGVK--QDHE-------
A0A5C6FX55      TM------------------------------TGEMVGGVPSIEIVQ--A--Q------L
A0A3L7UX05      PS--------------------------------MNTLGIDQIKRTH--MQLI------K
A0A5C6DS51      --------------------------------NGTMSNAQASGDSIH--EDLLATHMRLF
A0A5C6DSL6      --------------------------------SGTMSNAQASGDTIH--EDLLATHMRLF
A0A3M1VG27      SD-----------------------------------------DLRT--YGERSEHVALI
A0A518GC22      MD--------------------------FYDPRGSAITRVDESMVIR--S----------
A0A3L7Q373      ----------------------------------SKKASISDQEARR--YGDRGEHVRVI
A0A3E0PW54      ER---------------------------------------SINFSG--E--RTEHVHLI
A0A1Z8MHR4      TA------------------------------TGLVQGGVPSGNLME--S--L------V
A0A5C6EHJ0      VD------------------------------S--LDAGLKSRNLSD--EALV------M
A0A5C6F1H9      VD------------------------------G--LDTGLKGRNLGD--EAIV------M
A0A255QXY0      TS------------------------------TGLIRGGLPSGQLLK--S--L------I
A0A517SYI0      TA------------------------------TGLVQGGVPSGNLME--S--L------V
A0A518HX54      TS------------------------------TGMVRGGIPSGNLMQ--S--L------I
A0A5B9MF59      SN------------------------------TGIVRGGIPSGNLMQ--S--L------V
A0A2A2WC24      SN------------------------------TGIVRGGIPSGKLMQ--S--L------I
A0A518KYW8      SN------------------------------TGIVRGGIPSGKLMQ--S--L------I
A0A5C5YZZ0      SV------------------------------VENLTESAPSLAFIQ--A--E------M
A0A518JLD2      GV---------------------------------------EVAASR--S--LADEALVM
A0A5M6DJ15      T-------------------------------ADQSGGGRGSYELYK--N--TQSQL--I
A0A3L7P7S7      DFRTAMLDDYVAIQVTIIKSDRVLREAAQLLQQGEIAGGVAQATDTA--G--APKTDAPT
A0A517N8M1      SM------------------------------TGEIVGGVPGLDIVE--S--Q------L
A0A5C6CW01      SM------------------------------TGDVIGGVPSVDILS--S--H------L
A0A5C6BXS9      TM------------------------------TGDIVGGVPSVEILR--S--Q------L
M5U569          TM------------------------------TGDVLGGVPSIDILR--S--Q------L
L7CND7          TM------------------------------TGDLIGGVPSIEILR--S--Q------L
A0A0J1B8S4      TM------------------------------TGDRIGGVPSIEIIR--A--Q------L
F2ARR3          TM------------------------------TGDVLGGVPSIDILR--S--Q------L
K5D8H6          TM------------------------------TGDVVGGVPSIDILR--S--Q------L
M2AKU0          TM------------------------------TGDVVGGVPSIDILR--S--Q------L
A0A5B1CKI2      PI------------------------------NGDMVGGVPSLDIVQ--S--Q------L
A0A5C6EG84      SK------------------------------SGDVVGGVPGLDIVE--S--Q------L
A0A5C6F2X4      SM------------------------------SGEVIGGVPGLDIVE--S--Q------L
A0A5C5XTV6      TM------------------------------TGDIVGGVPSVDILR--S--Q------L
A0A5C6AAB1      SM------------------------------TGDVMGGVPSIDILR--S--Q------L
M5T8W8          TM------------------------------TGDVLGGVPSIDILR--S--Q------L
M5SF00          TM------------------------------TGDLIGGVPSIDILR--S--Q------L
A0A2G1WDS1      TM------------------------------TGDLIGGVPSIDILR--S--Q------L
Q7UVS9          TM------------------------------TGDLIGGVPSIDILR--S--Q------L
A0A5C6B601      SQ------------------------------TGVMEGGIPSGNIMQ--S--V------I
A0A517PFU1      SE------------------------------GG---GGEPEELAGE--A--LGNYLYRA
A0A5B9M8J9      TA------------------------------TGVVRGGIPSGNLMQ--S--L------I
A0A2A2WFP6      TS------------------------------TGLVRGGIPSGNLMQ--S--L------I
A0A518L8N2      TS------------------------------TGLVRGGIPSGNLMQ--S--L------I
A0A518HQN9      SN------------------------------TGIVRGGIPSGKLMQ--S--L------I
A0A5M6D8H8      AA------------------------------SGSIRGGIPSGNLMQ--S--L------I
A0A5B1CRW9      RG------------------------------TISDGSAGSDSLGED--Q--LATHMRLF
A0A5C6EI46      RG------------------------------TISSTSGGTEGMGED--E--LATHMRLF
A0A2E7D3V4      DN------------------------------LADTKGAGGRGEHIA-----------LI
A0A2S8F9B8      RT------------------------------VEQAGR----DDYRTFKS---TQRQ-LM
A0A368KP63      KT------------------------------VEQAAR----NDFRTFKN---TQVQ-LM
A0A2E0SHG0      EA------------------------------AESTSP----GDFRRMEDELANQMK-IM
A0A518CQB8      EG------------------------------SENSSP----NDFRRMEDELANQMK-IM
A0A5B9PER9      NH------------------------------RQVEYG----PEVAQ------VAHDKLI
A0A517QSM4      ET------------------------------SEAQSNF---NTYKQ------TQMR-KV
A0A355GJI7      ----------------------------------------------------------ML
A0A1Z8MCI4      VR------------------------------ARG-------GSDAK------GEEA-LL
A0A517SYL7      VR------------------------------ARG-------GSDAK------GEEA-LL
A0A3L7P0L2      EA------------------------------RLYGGRSEHISAIKS------DEVVRIA
A0A142XL75      QA------------------------------DGQANF----VSYRA------SQIA-TI
A0A517SCC8      DQ------------------------------AR--------RYGDR------GEHVYLI
A0A3A0DR44      TS------------------------------PDTS------PRFAQ------TQLR-SI
A0A358MY60      EN------------------------------VLAES-----SNLEA------TEKQ-II
A0A517MNB1      EG------------------------------VMPTS-----ANLAG------SERQ-LI
A0A517XRC2      GK------------------------------GQVEDF----DSFRR------SQMY-LV
A0A142YJ13      ET------------------------------RESDVGY---RTYQE------TQLI-LV
A0A517Z7D3      PR------------------------------ETN-------LTGER------SEHVDLI
A0A5C1AGE3      GA------------------------------NQQNDSNT--SNFKE------NQMVLI-
A0A142XAP8      ---------------------------------NKTQEDF--EAYRR------HQMFLL-
A0A2Z3HEL7      ---------------------------------NKGQEDF--EWYRR------RQIYLLT
A0A1N6KY57      TT------------------------------GEVHTEY---GAYQR------TQLA-LL
L0DK20          KV------------------------------GENETDF---VAYQR------TQLA-LL
A0A660UUK3      ND------------------------------SDSDRPMPNYANFMT------TEAE-RI
A0A517ZHG5      DS------------------------------SSFSSDF---DTFKR------TQMF-RA
A0A1Z8MPL5      DV------------------------------QNAE------ESGWE------AQEQ-LI
A0A5C6C1R5      QT------------------------------ADRLNAGRDSFSMYK------NTQAQLI
A6BZU4          DG------------------------------EIQT------FGELT------AHID-VI
A0A2D5GZ77      DG------------------------------EIQT------FGELT------AHID-VI
A0A3D3R1Z6      DG------------------------------EIQT------FGELT------AHID-VI
A0A517XG00      DG------------------------------EIQT------FGELT------AHID-VI
A0A1G2YRE4      GE------------------------------QNSA------QISML------TEAE-LI
A0A353Z859      -G------------------------------GGLKQGEELRGEVYR------QTLGRMV
A0A2D6ST10      KV------------------------------DNQTPRF---ETYKQ------TQMI-LV
A0A177QX42      ED------------------------------PERGTKKSANAVNLL------ENHQYLL
A0A517SHR0      GR------------------------------DDR-TTNSINSVDLL------ENHQYLL
A0A2E0AW64      KN------------------------------KAD-------RSFLA------NQFA-VL
A0A351FZ59      KN------------------------------KAD-------RSFLA------NQFA-VL
A0A660V239      ET------------------------------EERLPNY---QNFMN------TQAQ-LF
A0A177Q3B7      TS------------------------------EAHTDF----GLYQK------AQAA-LI
A0A2E0X6Y6      SV------------------------------NDADGS----DNTMA------TQRE-IV
A0A518GFD7      ET------------------------------VDQAGGGVSGFKLYK------STQQQIM
A0A5C5VZJ8      GR------------------------------QDVMPMY---ESFRQ------TQAS-FV
A0A518GE37      -Q------------------------------SLHNTS----RDLAR------SERQ-LI
A0A5C6F3H8      -D------------------------------NVMKYS----KDLAR------TETA-LI
A0A5C5X072      -K------------------------------GVMPQV----ENLAR------TEKS-LF
A0A5C5WUQ3      -K------------------------------GVMPTV----DDLAN------TEKS-LF
A0A5C6E697      -K------------------------------GVMPTI----NDLAR------TEKP-LF
A0A5C5Z1A3      -K------------------------------GVMPTL----TDLAR------TEKS-LF
A0A5C6D2P7      -Q------------------------------GVMPMV----KDLAR------TETS-LF
A0A5B9ML17      -R------------------------------DVFNTV----RDLAG------TEKT-IF
A0A517LX75      SD------------------------------GGIDSTVLH-SDMLA------THIE-LL
A0A354GX32      ET------------------------------SED-------YTNLR------SYLAGWV
A0A5C1AAF0      EH------------------------------PD--------SPLNQ------QTQINVL
A0A5C6B3S0      -K------------------------------TVDQASVSSFDIYKR------TQRE-LL
A0A518GIZ9      EQ------------------------------SAMG------DWGER------SEHIALI
A0A1C3EBY9      EQ------------------------------SAIG------DWGER------SEHIALI
D5SX64          EQ------------------------------SAIG------DWGER------SEHIALI
A0A517Z0U7      GD------------------------------RETGEANGDLRSFKG------TMMR-LA
A0A2S8FCC0      QN------------------------------GEANGDF---EVYKL------TQRQ-LI
A0A1Z8MBT6      -K------------------------------GINEAP----RDLAA------SEKTWVI
A0A517SXN9      -K------------------------------GINEAP----RDLAA------SEKTWVI
A0A518HFL0      TN------------------------------GGPPV-----RSDLQ------TQIQ-LI
A0A5Q3LBQ3      DT------------------------------PLES------HRFVE------TQVG-LM
A0A3B8ZJM2      ------------------------------------------MDPKK-------------
A0A1U7CLW1      ET------------------------------RESEVGF---RTYQE------TQVI-LV
A0A142WPR7      -P------------------------------LGTESGFAQGITQTM------PHQM-LI
A0A3M1TFJ0      PP------------------------------DPIQAKY---AYRWD------G------
A0A517P477      ST------------------------------SEQQASF---RTRKQ------TNQK-LL
A0A517T4K9      NT------------------------------AEAQTSF---QTFKQ------TQMK-LV
A0A2Z3GZZ5      -E------------------------------GDGRIV----EDHVA------TQVT-LI
A0A4V0I6L6      -G------------------------------GAGDARVQYLEDYIG------PQVI-LL
A0A255QXF5      -R------------------------------GVMPTP----DDLAK------SEGP-II
A0A518KBI5      QQ------------------------------AAVGSNN---GSFIR------TQIE-LM
A0A5C5V6Q5      EK------------------------------ASVGSAN---SAFVR------TQIE-LM
A0A517MY49      -S------------------------------AGNHRSS---ENTMA------THSK-IV
A0A2E6AG00      -P------------------------------IGQVGXX---XGMLP------TYEK-LF
A0A1G3A880      -S------------------------------LSVDGAK---QEIIP------TYCQ-LI
A0A2E8ATT1      -A------------------------------ASSEVGR---HGLIP------TYEQ-LF
A0A518KYQ0      -R------------------------------GVLPAP----EDLAK------SERL-LL
A0A5B9QX47      -K------------------------------NLLPTAG---SNLSG------TERT-IL
M5T666          -K------------------------------GVMPVV----KDLAR------TENS-LF
M5U6N6          -K------------------------------GVMPVV----KDLAR------NEKS-LF
A0A517M0G2      -K------------------------------GIMPTP----RNLVA------SERP-LV
A0A5C6AST1      -R------------------------------GVMPTS----SNLAA------TEKQ-LI
A0A5C6C951      -Q------------------------------GVMPTS----RNLAA------TERQ-LI
A0A5C6C5T3      -K------------------------------GVMPVM----ENMAR------TEKN-LF
A0A2A2W6A9      -R------------------------------GVMPTP----DNLSS------SERM-LI
A0A518HQS9      -S------------------------------GVMPTP----DDLAR------SEKT-LI
A0A5M6DFE6      -K------------------------------GVMPAL----DDIAR------TEKP-LI
A0A5C6F286      -N------------------------------NVMKVS----KDLAR------TETA-LI
A0A517NGN1      -K------------------------------GVMPMV----DDLVR------TERA-LF
M5RUI3          -K------------------------------DVIPVI----EDIAA------TEKP-LF
M5S2L2          ------------------------------------------------------------
A0A523CME0      AL----------------------------------------------------------
A0A354PCV3      SR----------------------------------------------------------
A0A354PHB4      SR----------------------------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A538RV31      RL----------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
                                                                            

A0A356AE44      ------------NIHHQ--------------------------------RVDAIATERVK
A0A1G2XSU7      ------------------------------------------------------------
A0A350KD81      ------------------------------------------------------------
A0A2E3Z6T8      ------------MHYGP-------------------------------------------
A0A257WQ92      ------------------------------------------------------------
A0A356ETW1      ------------------------------------------------------------
A0A3L7NJY1      ------------------------------------------------------------
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      SIKELTRGNSSPTVRKP------------EPGKES--------------QEPETPVKYDV
A0A524HC32      KQQKLFDY----------------------------------------------------
A0A660VT66      ------------SLRER----------------------------GKLSPDLATPDDLLD
A0A0S8H0S8      -------------------------------------------------QGRPNPVAYLK
A0A177PV03      KGGFGANR----VFKDG-------------------------------------------
A0A1G2YIM0      ASFQVLNR----AADDL------------KTKNVA--------------MVGRDPFTFLR
A0A1G2ZG92      KIRPLIEK----LISLL------------NIKDRHGKTIRPDKLTELSLISKLKNKVLPR
A0A1G3A0W0      RSSTVLQR----VLDQP------------AIRQTQWYKNPRSSLMQRFYGNKAPPLERLR
A0A353BE27      RSQAVLRL----AVSLG------------RLGEQPEFV-------GL---ASEDIVSALQ
A0A5C6BPW1      VLDTALNE----PVRNQ------------TLKKY----------------GFKTIGDLPL
A0A1I3GSP0      QTDLIVER----AFKDH------------GLNEIPALA-------NAY-DPLREVT----
A0A517QJV1      KSDLIIEP----AFKKH------------GLNSVPALA-------TAY-DPYKNIR----
A0A3C1QS25      HDAVLTST----TFIRD------------SVVSNPELD-------QQV-PSIAGLSPEMK
A0A5C6FX55      FSDEVIRG----AFENP------------EMIQYHESL-------DE---GDGPWARFVE
A0A3L7UX05      APDVLSDA----VSEYP------------EIVQLPELK-------NS-----------AS
A0A5C6DS51      LSRKNVAN----AIETG------------NLKATETIR-------QVL-SEDGNPIDYII
A0A5C6DSL6      LSRKNIAN----AIETA------------NLKKIASIG-------TVL-ADGGSPIDYIV
A0A3M1VG27      MSPMIVRK----AVALR------------RLDRLPSLA------------TKKDPVAAII
A0A518GC22      --QTVLRR----AVQLG------------RLTEQSEFL-------GM---QTDEVVATLM
A0A3L7Q373      ATDIIARI----AYEKY------------GLNQISNFA-------GA-----YDPLKAVW
A0A3E0PW54      KSDAIVSR----AVRDH------------GLGELPAFQ------------KSKDPVMDII
A0A1Z8MHR4      ISDAIVKR----VAMSP------------QLRQSPSMR-------GR---SEAQVVSAIR
A0A5C6EHJ0      RSEQILRR----AAEIG------------ELSTTPEFA-------GY---SSEQIAAVVG
A0A5C6F1H9      RSEQILRR----AAELG------------ELSTAPEFA-------GM---APEQIAAAIG
A0A255QXY0      NSRAIVGR----VKNDR------------QLREVAAVR-------GL---TDREVMRLVR
A0A517SYI0      ISDAIVKR----VAMSP------------QLRQSPSMR-------GR---SEAQVVSAIR
A0A518HX54      SSDAIAGR----VHLNE------------QLRSIPALR-------EL---TNDQFIALVR
A0A5B9MF59      TSDAIVNR----VASNP------------ELKSIPSLQ-------SN---TDQQIVSMVR
A0A2A2WC24      TSDAIVRR----VAANP------------ELKSIPSLE-------SS---SETQIVSMVR
A0A518KYW8      TSDAIVRR----VAANP------------ELKSIPSLE-------SS---TETQIVSLVR
A0A5C5YZZ0      TSDEVLKS----AIEIG------------QLTAFEETP-------A----DVGALIALIR
A0A518JLD2      RSEFILRR----AAELP------------EIVESAEFA-------GL---GPEQIAGLMG
A0A5M6DJ15      KTSEVLAT----ALKNE------------EVRRLSLIR-------SKP-DPEQWLAE---
A0A3L7P7S7      GTVSATVN----RFQGK------------EIQDLIDYL-------RA-------------
A0A517N8M1      FSDRVMEA----AFENP------------KLHPFHKQF-------EN---ESKAFTSQAL
A0A5C6CW01      YSDRVVKM----AFDNP------------EMVPLQERF-------GG---DPTRYNGTAR
A0A5C6BXS9      FSDTVMEN----AFRNP------------SFEIFRDRF-------QN---RSGSFAGMSA
M5U569          FSDTVTKN----AFEDD------------SFDAFRAKF-------ND---DPRAFAGMSS
L7CND7          FSDKVTEY----AFENE------------NMVVFQESL-------GG---RPSGLAGLAF
A0A0J1B8S4      FSDEVNRS----ALSDG------------NMNVFREQF-------HG---SPVELAALAS
F2ARR3          FSDIVLAK----TFADE------------NMRPFRDRF-------EN---NPNLFAGLAN
K5D8H6          FSDTVLNK----TFNDE------------NMRPFRDRF-------EN---NANLFAGLAN
M2AKU0          FSDTVLNK----TFNDE------------NMRPFRDRF-------EN---NANLFAGLAN
A0A5B1CKI2      FSDRVMQM----TFNAP------------RLRPFQEEF-------EG---RVGAFVEESL
A0A5C6EG84      FSDRVMAT----AFGNE------------RMRPFQVEF-------ES---NLREFNEVAI
A0A5C6F2X4      FSDRVLAA----TFANP------------RMRPFQSEF-------ES---HQAMFNDIAL
A0A5C5XTV6      FSDSVVKR----AFEDP------------HFEIFQDQF-------SG----PGAFGGMSA
A0A5C6AAB1      FSDSVTRN----AFQHA------------AFEVFRGQF-------EN---QPGVFGGTAS
M5T8W8          FSDTVTKN----AFEDE------------SFEVFRSKF-------GD---NPAGFAGASG
M5SF00          LSDKVTRN----AFENE------------SMEVFRESL-------GG---HPSALLGLAN
A0A2G1WDS1      LSDKVTRN----AFENE------------SMEVFRESL-------GG---HPSALLGLAN
Q7UVS9          LSDKVTRN----AFENE------------SMEVFRESL-------GG---HPSALLGLAN
A0A5C6B601      TSDSIMAS----VAQDP------------ALTLLPSMT-------GK---SVAQIAATIR
A0A517PFU1      QTGPLVAR----AVRER------------RLDELPAFK-------GA---GSP--VGRIL
A0A5B9M8J9      SSDAISGR----VELDD------------QLRSIPKLR-------DL---SDDQFVALVR
A0A2A2WFP6      SSDAIAGR----VHLSE------------QLRSIPALR-------EL---TDDQFVALVR
A0A518L8N2      SSDAIAGR----VHLNE------------QLRSIPALR-------EL---TNDQFIAMVR
A0A518HQN9      TSDAIVGR----VASNP------------EVKSIPSLE-------SS---TEKQIAAMVR
A0A5M6D8H8      TSDGIVSR----VASHH------------ELKSIPSMQ-------GK---DAKSVASMIR
A0A5B1CRW9      VARKVVAK----AIEMG------------ELNQFKSFA-------QIA-RNGGSAVDHII
A0A5C6EI46      VARKVLTE----AIKLG------------SLDELDTFR-------KAR-ENDQSLVDHIL
A0A2E7D3V4      MSPLIVGA----AIEEA------------GLDG-L----------PSM-LTSGDPEEDIV
A0A2S8F9B8      ITPFVLNK----ALSRE---------DIMNLPVV---------------RENENPLEWLQ
A0A368KP63      ITPFVLSK----ALGKD---------GIINLPVI---------------AENENPLEWLQ
A0A2E0SHG0      SSYKIVSA----GLESGLE-EDGKPVNLLTCPSLL----------EEV-KEGETVVDYVI
A0A518CQB8      SSHKIVKA----ALEAGLKNEDGTPINMMNLPSIM----------EEL-ADDQNPIDYVI
A0A5B9PER9      VQRLMVEQ----CLNDD------------GGKLRLLNS-------FDE-IPKDDIAEYVI
A0A517QSM4      TGEYVLNA----ALRDP------------EISN-L----------PTL-KEQQHPTDWLE
A0A355GJI7      IQKNRLER----------------------------------------------------
A0A1Z8MCI4      KSPMVLES----VLAQP------------FIKELK----------PTT-DGGPRNLAYLV
A0A517SYL7      KSPMVLES----VLAQP------------FIKELK----------PTT-DGGPRNLAYLV
A0A3L7P0L2      YEKYGLKE--------------------------------------IF-GNDKDPLKSIW
A0A142XL75      KRQRTLNN----VIKVP------------AVEN-L----------AIV-RKSPNPVAWLD
A0A517SCC8      KSDAICQR----ALDEF------------GLNK-L----------PAF-EGADDAAKEIS
A0A3A0DR44      ASSVVLTP----ALADP------------EIAK-I----------PEI-KRQVAPLEFLE
A0A358MY60      LSDIVLDD----VVSKA------------DIQA-V-----------GF-SDPVQSVNTIR
A0A517MNB1      YTDMVLDE----VLAKP------------EIQS-L----------PAF-ADTQLAKDTMR
A0A517XRC2      KSRDLINR----TIAEP------------KVAS-L----------QTI-READDPVALLE
A0A142YJ13      KSRKVLEA----AIAPP------------AIAA-L----------PIV-RNSVDPIEWLS
A0A517Z7D3      MSDDIVQR----AMDKF------------GLRE-L----------PAF-KTAYDPLMDVL
A0A5C1AGE3      KTRTILTR----VVQNE------------KLKD-T----------QLV-KTSDDPAKVIE
A0A142XAP8      KSRDVFTR----ALADP------------AVSS-L----------DTV-KQSEDPVAMLE
A0A2Z3HEL7      KDRDLFNR----VLADP------------AVSS-L----------ALV-KTADDPVAMLE
A0A1N6KY57      HSRLVLSS----ALKQP------------EVAK-L----------PIL-TKVSDPIEWLE
L0DK20          KSRLVLGT----ALKDP------------EVAK-L----------EVI-TKAVDPIEWLE
A0A660UUK3      AGPTVLNR----VADEL------------SGKK-L----------TLL-EGSVDPVLTLR
A0A517ZHG5      LQRVVLDTALSEPVRNS------------ELKRYGFKTIGDL---PLI-KAQAFPIDWLE
A0A1Z8MPL5      RGYRVLNTALNDGLMEL------------EYIK------------EAQ-EDGIDPIDYLA
A0A5C6C1R5      KTPFVLNE----ALAVP------------EVRD-L----------PEI-KEKPSPLQWLS
A6BZU4          KSPRIVGE----AVKEA------------KLNQ-L----------STL-AGEKDPTQDII
A0A2D5GZ77      KSPRIVGE----AVKEA------------KLNQ-L----------STL-AGEKDPTQDII
A0A3D3R1Z6      KSPRIVGE----AVKEA------------KLNQ-L----------STL-AGEKDPTQDII
A0A517XG00      KSPRIVGE----AVKEA------------KLNQ-L----------STL-AGEKDPTQDII
A0A1G2YRE4      TSERVIQR----VADNL------------ANRNLS----------FFE-AESTDLAGKMK
A0A353Z859      QGPIVLKQ----VVRRE------------EVAK-L----------PTI-TDQEDPLIFFE
A0A2D6ST10      RSPLVLMA----ALRSP------------ELAGLS----------EWT-DPGQNTQEWLE
A0A177QX42      TQPKILKG-----AVDP------------PIKDDASEEEKKHAKEASL-SRLASLAASSN
A0A517SHR0      TQPTIIKG-----AVDP------------TLPEGATDEEKLASKESGL-LKLPTLAGQSK
A0A2E0AW64      YSVVTLEP----LLADK------------EIAT-I----------PDL-VEADDPIAELK
A0A351FZ59      YSVVTLEP----LLADK------------EIAT-I----------PDL-VEADDPIAELK
A0A660V239      RRNNVLNQVADELADMD------------IVFFRD----------TGD-LVLALREAILD
A0A177Q3B7      SSRLVLNA----VLKRD------------AIASLA----------ILP-RDPEKQIAWLQ
A0A2E0X6Y6      VSPVVLRRAIERLAPED------------RIDLVD-----------------EAPHEWID
A0A518GFD7      LTPFVLNA----ALRDG------------ELSS-L----------PII-AQHDDPVSWLQ
A0A5C5VZJ8      TNAEVRNG----VLEDS------------AVKGLSWFAARPLTFWDRL-ISADPVEQRFD
A0A518GE37      TNALVLDP----VLADP------------ALKK-A----------PSL-SNPLTAERQIR
A0A5C6F3H8      LNPIVLVP----ALADP------------SLHD-V----------PSL-SNPATAEAHLR
A0A5C5X072      QNSIVLDP----VLADP------------TLRS-A----------PSL-SDPNSAEGKLR
A0A5C5WUQ3      FNPIVIDP----VLADP------------EIRR-A----------PSL-ADPDTAEVNLR
A0A5C6E697      FNPIILDP----VLSDP------------EFRI-A----------PSL-SDPGKAEAAMR
A0A5C5Z1A3      FNPIVIDP----VLADP------------DLRR-A----------PSL-SDPDTAEVNLR
A0A5C6D2P7      FNPIVLDP----VLADP------------ENRM-A----------PSL-SDPESAEQSLQ
A0A5B9ML17      FDEIVLRP----VLSDP------------ELRA-A----------PSL-SDPEEAERNIR
A0A517LX75      TSPLILNDAIK-VGRFD------------ELESYI----------EAR-REGTSALSLLQ
A0A354GX32      KSDPVLDA----TLKKQ------------EVGDLS----------EIK-AQGEGRVAWMK
A0A5C1AAF0      KSEAVITA----ALRNP------------EVNK-T----------ELI-SQQADPVDWLA
A0A5C6B3S0      KSDFVLAA----ALRKK------------DVME-S----------RVI-QSQIDPAEWLK
A0A518GIZ9      MSPMIASE----AVRLG------------QLDK-L----------QTF-AGESDPTQMVL
A0A1C3EBY9      MSPMIASE----AVRLG------------KLDK-L----------KTF-AGESDPTQMVL
D5SX64          MSPMIASE----AVRLG------------QLDK-L----------KTF-AGESDPTQMVL
A0A517Z0U7      TYPFVLVA----ALREP------------GVHQ-C----------PTI-REQRDPEAWLE
A0A2S8FCC0      RGSFVINA----ALRDT------------EVLR-L----------PMV-EQEPDPVAWLQ
A0A1Z8MBT6      DHPGVIQA----VMGDQ------------TVCK-A----------PSL-ADPTTRETNLR
A0A517SXN9      DHPGVIQA----VMGDQ------------TVCK-A----------PSL-ADPTTRETNLR
A0A518HFL0      TSANVLTS----AVSDP------------DVSK-L----------PSV-IQSEDAVGYIR
A0A5Q3LBQ3      RSPLILGP----VVSKP------------EVAQ-M----------PEI-LQEEAPIEWLS
A0A3B8ZJM2      ----------------------------------G----------VDV-SPAEKSERTIT
A0A1U7CLW1      KSRKVLEA----ALNPP------------AIAS-L----------PTV-RKLLDPIDWLS
A0A142WPR7      GSPLVVRK----AVETH------------DLRK-H----------PAF-AGESDPASRIV
A0A3M1TFJ0      IPQEYLNS----EIRDM------------TSLS-L----------ARA-VIESNSVIARQ
A0A517P477      RSREVLTA----ALRNA------------EVAN-T----------PTL-QEVPDPVVHLQ
A0A517T4K9      KSPFVLNA----ALRRP------------EVAR-L----------TTV-RGENHPVDWLE
A0A2Z3GZZ5      KSEKIRLA----AAAKA------------RAAGGA----------GLP-ADDRAVADMIG
A0A4V0I6L6      GSEAILKVAAERRLDEQ------------KPFQ-N----------PPP-DGVAERVAYMK
A0A255QXF5      ASPIVLSS----ILAND------------TLHQ------------FSL-ADPESREQHLK
A0A518KBI5      RSPVVLRE----VLSDQ------------RVGA-A----------SHL-NKTPDRLSHLR
A0A5C5V6Q5      RSPLVIRE----VLSEA------------SVGK-A----------EHL-VAKPDKLKHIK
A0A517MY49      RSPKVIQGA---IERLP------------QKYRGD----------LKN-KASKDWVSAIS
A0A2E6AG00      ASAVVLNGAIXRIVEMP------------TDLQCD----------LKN-YPREDWVRXLR
A0A1G3A880      ESAVVLQGA---IARLG------------PQHQVD----------FRG-QPRDQWIEILE
A0A2E8ATT1      SSAVILNGATQRLARLP------------AALRVD----------FLS-VPRDKWIDVLR
A0A518KYQ0      TSPIVLSQ----VINNP------------ELQAFS----------LND-PDPDVREQALL
A0A5B9QX47      LNSIVLDP----VLEDA------------SLRK-A----------PSL-SDPLIAEQNLR
M5T666          FNPIVLDP----VLADP------------SLRN-V----------PTL-VDPATAEANLR
M5U6N6          FNPIVLDP----VLADP------------QLRS-A----------PSL-SDAETAEAQLR
A0A517M0G2      LNALVLEE----VKNDP------------EVQAFY----------GSE-TPLNVGQ--LR
A0A5C6AST1      TTDLVLDN----VLTDP------------EIQA-T----------GHF-VNMDDAKHSLR
A0A5C6C951      TTDLVLDS----VLADA------------EVQA-T----------GLF-QNSEAAKNALR
A0A5C6C5T3      TNPIVLDP----VLADP------------SLRT-A----------PSL-SNPETAEANLR
A0A2A2W6A9      TSPIVLSQ----VLDNP------------EFQAFS----------LQD-PDPDVRDQKLR
A0A518HQS9      TSPIVLSQ----VIDKP------------ELQAYG----------LQD-PDPDVREQTLI
A0A5M6DFE6      VNPVVLDP----ILQDP------------ELRN-A----------PSL-SDPEQAEQNLR
A0A5C6F286      LNPIVLDP----VLADS------------SLHD-V----------PSL-SDPATAEANLR
A0A517NGN1      LNPIVLDP----VLSDP------------DLRS-A----------PSL-SDPETAEAQLR
M5RUI3          FNSIILDP----VLADP------------ALRK-A----------PSL-ADPEYAEVSLR
M5S2L2          ------------------------------------------------------------
A0A523CME0      ------------------------------------------------------------
A0A354PCV3      ------------------------------------------------------------
A0A354PHB4      ------------------------------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A538RV31      ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
                                                                            

A0A356AE44      VELLYEEIS---------------------------------------------------
A0A1G2XSU7      ------------------------------------------------------------
A0A350KD81      ------------------------------------------GQA---------------
A0A2E3Z6T8      ------------------------------------------------------------
A0A257WQ92      -----EQRR---------------------------------------------------
A0A356ETW1      -----DELS---------------------------------------------------
A0A3L7NJY1      -----AEYS---------------------------------------------------
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      -----DDAL-------------------INNYLSKLTVQMTGNSD---------------
A0A524HC32      ----------------------------MAENLQASPSR---KSM---------------
A0A660VT66      ----------------------------AVEVQPRPRSR---------------------
A0A0S8H0S8      -----EALK-------------------I------EAGK---KDD---------------
A0A177PV03      ----------------------------V-------------TNN---------------
A0A1G2YIM0      DAASNGRLI-------------------I------EPAK---KSE---------------
A0A1G2ZG92      PYIEVNQYK---------------------------------DAD---------------
A0A1G3A0W0      -----DTLS-------------------V------RPRQ---RTE---------------
A0A353BE27      -----DVGS-------------------PLVIEPADKDD---QTT---------------
A0A5C6BPW1      LKGQTFEID-------------------WLEARLSASGR---DEE---------------
A0A1I3GSP0      -----EGLS-------------------VSRSAGQESSF---DNV---------------
A0A517QJV1      -----EGMA-------------------VSRSAGQENSF---DNV---------------
A0A3C1QS25      LFQIQEGLE-------------------VDLEKDSEN-----------------------
A0A5C6FX55      MVKKDEVLE-------------------LEPEVSDVKTA---QSV---------------
A0A3L7UX05      -----PEYV-------------------MDKKINVIDRV---NSE---------------
A0A5C6DS51      -----EQME-------------------VGR-GGEGAAE---NAM---------------
A0A5C6DSL6      -----EQME-------------------VGR-GGEGSAE---NAM---------------
A0A3M1VG27      -----TELK-------------------AKRVAGTDQSF---LNI---------------
A0A518GC22      -----DEES-------------------PLIIEPADKDD---STT---------------
A0A3L7Q373      -----EDLQ-------------------VKRVAGQESSF---DNI---------------
A0A3E0PW54      -----DSLT-------------------VKRSAGSDQSF---VNL---------------
A0A1Z8MHR4      -----GSVR-------------------FHTITAVKDSR---DRM---------------
A0A5C6EHJ0      -----GLD---------------------LVVGSADENI---DSS---------------
A0A5C6F1H9      -----DAS---------------------LSIGSAGSSI---GSS---------------
A0A255QXY0      -----QRIR-------------------FDSVTDLKDSH---DRL---------------
A0A517SYI0      -----GSVR-------------------FHTITAVKDSR---DRM---------------
A0A518HX54      -----RGIR-------------------FQTITDLKDSR---DRL---------------
A0A5B9MF59      -----GGIR-------------------FQTLTDQSDSR---DRM---------------
A0A2A2WC24      -----SGIR-------------------FQTLTDQGDSR---DRM---------------
A0A518KYW8      -----SGIR-------------------FQTLTDQSDSR---DRM---------------
A0A5C5YZZ0      -----KNLR-------------------LQAPFDGAESR---DRT---------------
A0A518JLD2      -----GR----------------------ALTIGPATEE---SNS---------------
A0A5M6DJ15      --------E-------------------LQVDFPGRSEL---MAV---------------
A0A3L7P7S7      -----GVGI-------------------IKAKEAGSTTA---SNN---------------
A0A517N8M1      -----RSME-------------------LEPEVDDVRTA---QSV---------------
A0A5C6CW01      -----GGLS-------------------LTVEGTGGRVA---QSF---------------
A0A5C6BXS9      -----SALK-------------------FHTDLQDARSA---SSL---------------
M5U569          -----KALQ-------------------FSPDVQGTRSA---SSL---------------
L7CND7          -----ESLK-------------------FETDIEDARSA---SSL---------------
A0A0J1B8S4      -----KMLE-------------------FETDLKDERSA---SSL---------------
F2ARR3          -----GALE-------------------FETDLQGVRGA---SSI---------------
K5D8H6          -----GALE-------------------FETDLQGVRGA---SSI---------------
M2AKU0          -----GALE-------------------FETDLQGVRGA---SSI---------------
A0A5B1CKI2      -----ESLE-------------------LEPEVEDVKTA---QSV---------------
A0A5C6EG84      -----KSLE-------------------LEPEVDDLRTA---QSV---------------
A0A5C6F2X4      -----NSLE-------------------LEPEVDDLRTA---QSV---------------
A0A5C5XTV6      -----GALR-------------------FQTDLQDGRMA---SSL---------------
A0A5C6AAB1      -----KSLK-------------------FNTDLQDVRSG---SSL---------------
M5T8W8          -----EALQ-------------------FNADVQDTRSA---SSL---------------
M5SF00          -----KALK-------------------FETDIQDARSA---SSL---------------
A0A2G1WDS1      -----KALK-------------------FETDIQDARSA---SSL---------------
Q7UVS9          -----NALK-------------------FETNIQDARSA---SSL---------------
A0A5C6B601      -----SGVR-------------------FQTITNAADSR---DRM---------------
A0A517PFU1      -----KGLE-------------------GGQVPGTR------------------------
A0A5B9M8J9      -----GGIR-------------------FQTMTDLKDSR---DRM---------------
A0A2A2WFP6      -----RGIQ-------------------FQTITDLKDSR---DRL---------------
A0A518L8N2      -----GGIQ-------------------FQTITDLKDSR---DRL---------------
A0A518HQN9      -----SGIH-------------------FQTLTDQSDSR---DRM---------------
A0A5M6D8H8      -----KGIK-------------------FQTLTDVSDSR---DRM---------------
A0A5B1CRW9      -----QNIE-------------------VER-GGEGSAQ---DAM---------------
A0A5C6EI46      -----ENIE-------------------VER-GGEGAAA---DAM---------------
A0A2E7D3V4      -----DGLK-------------------V------ERSA---GHDRSLLN----------
A0A2S8F9B8      -----EALV-------------------V------SFPG---DAE---------------
A0A368KP63      -----KELQ-------------------V------RFPG---DAE---------------
A0A2E0SHG0      -----QHLF-------------------L------STQG---EEG---------------
A0A518CQB8      -----DNLY-------------------L------SLQG---EEG---------------
A0A5B9PER9      -----NNLV-------------------V-------------TPDPEAPY----------
A0A517QSM4      -----KNLK--------------------------VTSP---ASE---------------
A0A355GJI7      ------------------------------------------------------------
A0A1Z8MCI4      -----ENVA-------------------L------TSKG---AQG---------------
A0A517SYL7      -----ENVA-------------------L------TSKG---AQG---------------
A0A3L7P0L2      -----ENLV-------------------V------VRES---GQETSFDN----------
A0A142XL75      -----HAIK-------------------I------DAPA---NSE---------------
A0A517SCC8      -----ERLT-------------------V------KRTS---GQDSSFDN----------
A0A3A0DR44      -----ETLK-------------------V------SGEG---GSE---------------
A0A358MY60      -----DGLG-------------------I------ETAG---TQT---------------
A0A517MNB1      -----KYMR-------------------V------SGAG---SAS---------------
A0A517XRC2      -----TGVR-------------------V------DGSI---APD---------------
A0A142YJ13      -----QQVQ-------------------V------EFPR---GSE---------------
A0A517Z7D3      -----DSLS-------------------A------QRSA---GRDSSFVN----------
A0A5C1AGE3      -----DMLR--------------------------LRWE---APD---------------
A0A142XAP8      -----DTIR--------------------------VAVA---APE---------------
A0A2Z3HEL7      -----DAVR--------------------------VSVA---APE---------------
A0A1N6KY57      -----NELK-------------------V------DFAP---GSE---------------
L0DK20          -----KELQ-------------------V------DFAS---GSE---------------
A0A660UUK3      -----QAANNGGIE--------------I------ATQR---HSE---------------
A0A517ZHG5      -----ARLS--------------------------ASGR---QEE---------------
A0A1Z8MPL5      -----NVLI-------------------IEVPDSEKEMKGYGGQ----------------
A0A5C6C1R5      -----ESLR-------------------V------EFPG---KGE---------------
A6BZU4          -----DSLK-------------------V------KRIS---GNDRAFLN----------
A0A2D5GZ77      -----DSLK-------------------V------KRIS---GNDRAFLN----------
A0A3D3R1Z6      -----DSLK-------------------V------KRIS---GNDRAFLN----------
A0A517XG00      -----DSLK-------------------V------KRIS---GNDRAFLN----------
A0A1G2YRE4      -----QKLTGDNTKLDAVTKLKRAISSGV------ISAKAVRNTE---------------
A0A353Z859      -----KNMR-------------------V------TNP----ATE---------------
A0A2D6ST10      -----ENLE-------------------V-------SSR---ASE---------------
A0A177QX42      -----PA---------------------ATIATGLRVIRSEVSED---------------
A0A517SHR0      -----PSVI-------------------STIAGGMRVQRSEVSED---------------
A0A2E0AW64      -----RNLS-------------------I--------KSAYRDSN---------------
A0A351FZ59      -----RNLS-------------------I--------KSAYRDSN---------------
A0A660V239      -----GVII-------------------I------EPER---NTE---------------
A0A177Q3B7      -----AELK-------------------V------DYKT---GPE---------------
A0A2E0X6Y6      -----RLAA-------------------L------SSSSVTRRTN---------------
A0A518GFD7      -----EKLE-------------------V------TFPG---DGE---------------
A0A5C5VZJ8      -----DDVN-------------------V------IVPP---GKQ---------------
A0A518GE37      -----KRLS-------------------I------GNAG---TDN---------------
A0A5C6F3H8      -----SNLT-------------------I------KSGG---DPK---------------
A0A5C5X072      -----KNLS-------------------I------SSGG---TDS---------------
A0A5C5WUQ3      -----KNLT-------------------V------GNGG---TRA---------------
A0A5C6E697      -----KNLT-------------------V------ASAG---TAA---------------
A0A5C5Z1A3      -----KNLK-------------------I------SSDG---TPT---------------
A0A5C6D2P7      -----RNLS-------------------V------ASGG---TST---------------
A0A5B9ML17      -----KNLN-------------------I------SHGG---SRA---------------
A0A517LX75      -----KNLL-------------------V----ERGGEGDARGAS---------------
A0A354GX32      -----SAAL-------------------V------DDKT---GLQ---------------
A0A5C1AAF0      -----KELM-------------------V------DYPS---GDE---------------
A0A5C6B3S0      -----ANLG-------------------V------GFPG---EAE---------------
A0A518GIZ9      -----DDLK-------------------V------KRVA---GQDRSYLN----------
A0A1C3EBY9      -----DDLK-------------------V------KRVA---GQDRSYLN----------
D5SX64          -----DDLK-------------------V------KRVA---GQDRSYLN----------
A0A517Z0U7      -----DAIE-------------------V------SAVG----EQ---------------
A0A2S8FCC0      -----SALS-------------------V------NFPD---NAE---------------
A0A1Z8MBT6      -----KNLS-------------------V------AGAG---TKD---------------
A0A517SXN9      -----KNLS-------------------V------AGAG---TKD---------------
A0A518HFL0      -----EAIK-------------------V------SPLP---GGS---------------
A0A5Q3LBQ3      -----ERIH-------------------V------KSVG---DSE---------------
A0A3B8ZJM2      -----DQLK-------------------I-------------------------------
A0A1U7CLW1      -----GVLM-------------------V------DFPR---GSE---------------
A0A142WPR7      -----RGLN-------------------V-----LADSK---TPD---------------
A0A3M1TFJ0      -----LAED-------------------I------GSED---PNALAMAFLAGVDVHPEE
A0A517P477      -----KHLS-------------------V------GSPG---AE----------------
A0A517T4K9      -----QEVE-------------------V------SSP----ATE---------------
A0A2Z3GZZ5      -----TGLT-------------------V--VRDKDSAGPTIGSG---------------
A0A4V0I6L6      -----ARFA-------------------VARVKEAGSNT---PSN---------------
A0A255QXF5      -----QRLK-------------------I------HGGG---TKS---------------
A0A518KBI5      -----KNLQ-------------------I------KQVG---GSE---------------
A0A5C5V6Q5      -----ENLS-------------------I------RQIG---GSE---------------
A0A517MY49      -----ANLS-------------------T------SITR---KTN---------------
A0A2E6AG00      -----EQXT-------------------V------RSFR---STH---------------
A0A1G3A880      -----DNLT-------------------A------VAIR---RTN---------------
A0A2E8ATT1      -----ANVS-------------------A------RSVR---NTN---------------
A0A518KYQ0      -----SNLT-------------------I------GNSG---TRS---------------
A0A5B9QX47      -----RNIS-------------------I------SSGG---AAT---------------
M5T666          -----KNLS-------------------V------SSGG---TES---------------
M5U6N6          -----ENLS-------------------V------SSGG---TEA---------------
A0A517M0G2      -----SSVG-------------------L------SNAG---SST---------------
A0A5C6AST1      -----KNLG-------------------I------GNAG---TNS---------------
A0A5C6C951      -----AGLS-------------------I------GNAG---VDS---------------
A0A5C6C5T3      -----KNLS-------------------I------GSGG---TDS---------------
A0A2A2W6A9      -----SSLS-------------------I------GSAG---SRS---------------
A0A518HQS9      -----SNLS-------------------I------RGGG---TRS---------------
A0A5M6DFE6      -----DNLS-------------------I------RSAG---SKS---------------
A0A5C6F286      -----ANLK-------------------I------KGGG---DPK---------------
A0A517NGN1      -----KNLS-------------------V------QSAG---AKT---------------
M5RUI3          -----ENLK-------------------V------TSGG---NRR---------------
M5S2L2          ------------------------------------------------------------
A0A523CME0      ------------------------------------------------------------
A0A354PCV3      ------------------------------------------------------------
A0A354PHB4      ------------------------------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A538RV31      ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
                                                                            

A0A356AE44      ---SRLST--------LKAAIE-----RGESHEALMLLVKTF----LQKDQTSNSQTVVS
A0A1G2XSU7      ---MVQTT--------TSNV-------ANLEQVLITAKQHLA------------------
A0A350KD81      ----------------ANGNTS------------------------EGQIASPGTSQVDR
A0A2E3Z6T8      ------------------------------------------------------------
A0A257WQ92      ---LNLLR-------------------KATLQSRLKSVETAV----------ANNEPRDA
A0A356ETW1      ---KIERK-------------------RIDLQPTLARVQTAV----------RNGED---
A0A3L7NJY1      ---EARRA-------------------TEESRTRAASLNRAI----------ANGED---
A0A2D6SRY7      ---FELVG--------LLRK-------SEVNQDLYTRLLQKY------------------
A0A1G3C300      ---IISIS--------FTGT-H-----PETLAKMCNMHAKKF----LETHLELRFAASQD
A0A524HC32      ---LIEVS--------FTSP-D-----PKLSQVVVNTLVDEF----IGWKMEQKFEASRM
A0A660VT66      ---IVELS--------VYST-D-----PEAAAEYANTIARTF--------IEFYSRENRE
A0A0S8H0S8      ---IICVS--------LDSP-Y-----PSEADLLVNNIVEAF----VSSSPGGNRSTARE
A0A177PV03      ---VLYLS--------FRGT-N-----RDDCQVILDAIMQKY----DTYLKSKYERLNDK
A0A1G2YIM0      ---LIRIV--------MSSK-N-----PREGEQVVNAIIRAY----MAVEVSNSVRGGDE
A0A1G2ZG92      ---MLEIA--------AYSP-N-----PFEAANMSNKLATLY----IEDRLERKREEYKA
A0A1G3A0W0      ---IIDVD--------FVDP-S-----ANEAKLIVDTVLEQY----IRYIAEMSNENEEE
A0A353BE27      ---LIRIA--------YVSE-D-----AETAAKVVHAVVEGY----EKYLADEYKTVGEE
A0A5C6BPW1      ---FFAIK--------MEYS-EKPEELAEIVNAITQVYYRDI----ANETKLNDKKRITK
A0A1I3GSP0      ---L-SIT--------YLHP-D-----KRIARAVVQAMVEAY----RDYLEDTRDENAQQ
A0A517QJV1      ---F-DIS--------FDHP-D-----KEIAKTVVQAIVESY----RDYLHETRDENSRQ
A0A3C1QS25      ---LYLVS--------FSSP-N-----QEDCDRVLWGVLNGY----QEYLNRKYKATGQE
A0A5C6FX55      ---VALLH--------FDSP-N-----PDLSTAAVTAFSQSL----QQYYNKKYSNSRDE
A0A3L7UX05      ---LIEVQ--------MVGT-S-----PQNATDIVNAVVRSY----LKQAGRWANETTTA
A0A5C6DS51      ---VLSAS--------FRAP-H-----PDDAAMILAAVYSSY----QTYVESHSQNTSRE
A0A5C6DSL6      ---VLSAT--------YRDP-N-----PDDAATILAAVFASY----EDYVESHSKNTSRE
A0A3M1VG27      ---I-ELT--------YSNR-Y-----AQDAVAVLDAIVAAY----SQYLQESQKEHTNE
A0A518GC22      ---LIEIS--------YISQ-D-----AEVAAKVVSAIVDGY----EGYLAEEYKTVGIE
A0A3L7Q373      ---L-SIA--------YQSK-D-----PKLAKQVVESIVAAY----GDWLEAQKDNNARD
A0A3E0PW54      ---I-DIS--------YLHP-D-----KNAAGAVVRGLVAAY----EDYLEAKQDSNSQE
A0A1Z8MHR4      ---IVGLN--------YQSQ-D-----PYACVAAINGFYSAI----RQHFDAERQATIKE
A0A5C6EHJ0      ---VFQIR--------YDST-S-----ATTTQRVVQSIVDAY----ASHLQDQYRNIGQE
A0A5C6F1H9      ---VFQIQ--------FNST-S-----PSTSQRVVQAVTDAY----ASHLKEQFRNVGQE
A0A255QXY0      ---IAVLS--------FEHD-D-----PQVCEAAVDAVSRAI----GAHFQEERESTINE
A0A517SYI0      ---IVGLN--------YQSQ-D-----PYACVAAINGFYSAI----RQHFDAERQATIKE
A0A518HX54      ---IAAVH--------FDGH-D-----PEVCVAAVNAVSDAI----RSHFQEERELRVNE
A0A5B9MF59      ---IAALN--------FDGR-D-----PQVCVAAVKAVSQAI----SEHFERERQSTINE
A0A2A2WC24      ---IAALN--------FDGR-D-----PQVCVATVNAVSQAI----SQHFERERQSTINE
A0A518KYW8      ---IAALN--------FDGR-D-----PQVCVATVNAVSQAI----SQHFERERQSTINE
A0A5C5YZZ0      ---MVEVT--------FESG-D-----ATVATAIVNAVVEAY----NEYVNGRHRRNIEN
A0A518JLD2      ---VFRVQ--------FVSD-S-----PVISKLVVQALVDAY----GLHLQDQYRNVSQE
A0A5M6DJ15      ---SLSAD--------DAKA-A-----AVVLDAVVQAYMSEV----ANGERKQRDSRLKE
A0A3L7P7S7      ---VLKVS--------FQSG-S-----STECVQALKAVIKGY----KNYLDKEYNLADDQ
A0A517N8M1      ---VALLH--------FESE-N-----RELCQPVVQAFSESL----QAFYNENYKSSRGD
A0A5C6CW01      ---VAVLS--------FEHS-D-----AELCEASVKAFSDAM----QTFFNERQKSSRSE
A0A5C6BXS9      ---VATLS--------FEGT-D-----PDLCEAAVKSFSSSL----QKMFAEKHKTSRSE
M5U569          ---VATLA--------FESS-D-----RELCLGAVKAYSSAL----QRLFAEKHKSSRTE
L7CND7          ---VATLT--------FDHS-D-----PELCEAAVKAYSAAV----QQLFSEKHKSSRGE
A0A0J1B8S4      ---VAQMT--------FENT-D-----PELCEAAIKAYSAAL----QKLFADKHKSSRSE
F2ARR3          ---VANMT--------FEHT-D-----PELCEAAIRAFSSSF----QQFFADRHKSSRSE
K5D8H6          ---VANMT--------FEHT-D-----PELCEAAIRAFSASF----QQFFADRHKSSRSE
M2AKU0          ---VANMT--------FEHT-D-----PELCEAAIRAFSASF----QQFFADRHKSSRSE
A0A5B1CKI2      ---VTLMH--------FESE-N-----EELCKAAVESFSESL----QSFYNENYKSNRGD
A0A5C6EG84      ---VALLH--------FESD-V-----EELCQPVVQSFSESL----QAYYNENYKSNRGD
A0A5C6F2X4      ---VALLH--------FESD-V-----EELCQPVVQSFSESL----QDYYNENYKSNRGD
A0A5C5XTV6      ---VATLS--------FHGA-D-----PDLCEGAVEAYSAAL----QEMFAEKHRSSRGE
A0A5C6AAB1      ---VASMS--------FEHT-D-----PELCEAAVKAYSAAI----QQLFAEKHKSSRSE
M5T8W8          ---VATLA--------FEST-D-----SELCVGAVKAYSAAL----QKLFAEKHKSSRTE
M5SF00          ---VASLS--------FEHS-D-----PELCEAAVKAYSAAL----QQLFAEKHKSSRGE
A0A2G1WDS1      ---VASLT--------FEHS-D-----PELCEASVKAYSAAL----QQLFAEKHKSSRGE
Q7UVS9          ---VASLS--------FEHS-D-----PELCEAAVKAYSAAL----QQLFAEKHKSSRGE
A0A5C6B601      ---IASLS--------FEGG-D-----PALCVAAVNVMSAAI----SDHFDAERESQLDN
A0A517PFU1      ---VLQLT--------YSGG-S-----PEETGAVLDAVVATF----VEEVREEGQSGIRE
A0A5B9M8J9      ---IAALH--------FDGN-D-----PQVCVAAVNAVCDAI----GDHFQEEREQRVNE
A0A2A2WFP6      ---IAAVH--------FDGH-D-----PEVCVAAVNAVSDSI----RSHFQEERELRVNE
A0A518L8N2      ---IAAVH--------FDGH-D-----PEVCVAAVNAVSDSI----RSHFQEERELRVNE
A0A518HQN9      ---IAALN--------FDGR-D-----PQLCVATVNAVSQAI----SQHFERERQSTINE
A0A5M6D8H8      ---IAALH--------FDGP-D-----PQVCVAVVNAASEAI----GEHFEAERESTINE
A0A5B1CRW9      ---VLRVF--------YRAE-E-----PEEAALVLSAVYNSY----KAYIDSQDQDSSKL
A0A5C6EI46      ---VLRVF--------YHAS-N-----PEESATVLAAVFQSY----KRYIDSQDQDNSKL
A0A2E7D3V4      ---VLDIT--------YKNR-N-----KDDARQILEAVVDAY----EAYLKNSQQEHNSE
A0A2S8F9B8      ---ILQVS--------LTNA-D-----RQAAMKLVNAVVGAY----KDEVIESERLARVQ
A0A368KP63      ---ILQVS--------MSSA-D-----PTTAMKIVNAVVGAY----QEEVIESERMARVR
A0A2E0SHG0      ---NVAVSGGHWIYATFEHT-N-----KEDTPRVLQAILNAY----QDHVEETYRNPVND
A0A518CQB8      ---NIAVNGGHWIYVTFEHT-N-----EADTPRVLKAILAAY----QEHITETYQNPVNE
A0A5B9PER9      ---IYEIR--------YTSP-D-----KSDAPTVVNNLLQTYEETLIRQYETDKNLFVSE
A0A517QSM4      ---FFRLE--------LEGD-R-----PKDLAMIVNAVADAF----LTEVVNKERTSRQD
A0A355GJI7      ------------------------------------------------------------
A0A1Z8MCI4      ---RYAIS--------FIDN-D-----PVAAKQLSDAIAESF----MAVRTLLDSTQISN
A0A517SYL7      ---RYAIS--------FIDN-D-----PVAAKQLSDAIAESF----MAVRTLLDSTQLSN
A0A3L7P0L2      ---ILNIS--------FTSA-D-----KVEAKKVVSAVIDAY----ADWLEAKRGSGSQL
A0A142XL75      ---YMRVS--------LEGD-D-----ATESKIILEHLKTAY----LADVDLRDNGAKWS
A0A517SCC8      ---LIDIT--------YLYP-D-----PNVAKAVVEAIVKAY----DAYLKANLETNSAE
A0A3A0DR44      ---LYRIE--------YVGE-N-----AKDAATIVNGVIRVY----LGKLVADEKTRREE
A0A358MY60      ---LLRIT--------YADP-D-----PNIAALVCNEVAASF----LEQRERLDNRRVID
A0A517MNB1      ----LTIS--------YQDP-D-----PQHAALICNEIVEAY----LARREQFDNERVAN
A0A517XRC2      ---LMQVS--------FNGN-N-----RDDLVKIVDALVGKY----VDDANNAVRKNLMD
A0A142YJ13      ---ILSIS--------ITANGP-----PSDLSMLVNSVTEAY----LSQIVEQDRLERVA
A0A517Z7D3      ---LIDLK--------YAHP-D-----KDVAKKVIAAMVAAY----DDYLEETRKTNSSE
A0A5C1AGE3      ---LMAVT--------MNGD-R-----PDELKEVLDVLVQTF----KAESSAKETERRRA
A0A142XAP8      ---ILEVT--------LTGN-N-----IEDMKVILDHVVRRY----VDDATVLDRKQRDD
A0A2Z3HEL7      ---MLEVT--------LTGN-H-----LDDMKVLLDRLIKRY----LDDTNAFDNRSRTE
A0A1N6KY57      ---ILRIS--------ISAE-K-----PDLPMLLVNAVTQAY----LDEIVDVEMKQSRQ
L0DK20          ---ILRIS--------INGE-K-----PHEPMLLVNAVTQAY----IDEIVDVETKQRRQ
A0A660UUK3      ---LITIK--------MISR-F-----PREAEQIVDAFIRSY----MNIVRAEEGRSDDN
A0A517ZHG5      ---FFAIK--------MEYSEK-----PEELAEIVNAITQVY----YRDIANESKLLDKK
A0A1Z8MPL5      ---ILRIS--------MRGD-D-----PDQLKQILEAVTDAY----LEEVVTEERAEWLK
A0A5C6C1R5      ---VMTIA--------LETE-D-----PKASTIIVDAVVKAY----MNEAVLDERNERMQ
A6BZU4          ---ILTLT--------YENP-N-----AKDARLVTQAVVDAY----KRYLHEVREENTED
A0A2D5GZ77      ---ILTLT--------YENP-N-----AKDARVVTQAIVDAY----KRYLHEVREENTED
A0A3D3R1Z6      ---ILTLT--------YENP-N-----AKDARVVTQAIVDAY----KRYLHEVREENTED
A0A517XG00      ---ILTLT--------YENP-N-----AKDARLVTQAVVDAY----KRYLHEVREENTED
A0A1G2YRE4      ---LLKLT--------MVSK-K-----SEEAQQIINAFINAY----MAVEVSSSSEEQDR
A0A353Z859      ---FLQMS--------LTGN-N-----PADLAPILNAVVEVF----LREVAQREAQERTK
A0A2D6ST10      ---FISIS--------LSGE-R-----PTELKDTVNAVMGAY----LQEEVAGAAAARRE
A0A177QX42      ---VLEIS--------YVGP-N-----AGDCKKILDSVLASY----KRWLESTQAGNRKV
A0A517SHR0      ---VLEIS--------YSGP-N-----AGDCKRILIAVLDSY----KTWLQSTQAGSRAE
A0A2E0AW64      ---QWYLT--------YRST-D-----PQVAAMLANRIYESF----IRTKGDFDVSLRSA
A0A351FZ59      ---QWYLT--------YRST-D-----PQVAAMLANRIYESF----IRTKGDFDVSLRSA
A0A660V239      ---LIKIK--------MTTQ-Y-----PDQAEKVIDALIRAY----KARAVTDEVKGEDQ
A0A177Q3B7      ---FMRLS--------LTAE-R-----AADVKTLVGEITDVY----LKEVVYKERTRKLE
A0A2E0X6Y6      ---LIDVK--------FRSK-R-----PDTAAAVVRAIIDSY----LEWVRDTHQGAAGA
A0A518GFD7      ---VMQVT--------LETQ-S-----PADCVKIVNGVVDAY----MKEVVGNERSQRRQ
A0A5C5VZJ8      ---LIEVS--------ISTP-W-----PGEAAVLVNKILENY----KRNYEDRQSAEDNT
A0A518GE37      ---LLTIS--------YRDT-D-----KVMAAAVCNAVAESY----LQVRRRFDDERMGN
A0A5C6F3H8      ---SLEIR--------YEDT-D-----PEVAKNVCNAVAKSY----LRQRDSFDAARVTN
A0A5C5X072      ---RLVVS--------YTDT-D-----REAAAMVCNAIVDSY----LRQRDSFDDTRVNN
A0A5C5WUQ3      ---RLVVS--------YEDS-D-----REAAAMVCNAVVDSY----LRQRDAFDNARMTN
A0A5C6E697      ---RLIVS--------YEDT-D-----PEAAALICNAIVESY----LRQRDSFDNSRVNN
A0A5C5Z1A3      ---QLLVS--------YEDT-D-----REAAANVCNAVVESY----LRQRDDFDNIRVSN
A0A5C6D2P7      ---RLVVS--------YKDT-D-----PEAAALVCNAVVESY----LRQRDSFDSTRVSN
A0A5B9ML17      ---RMIVS--------YEDA-N-----REYAAKVCNAIVEAY----MMQRKALDGRRVAI
A0A517LX75      ---VLNAS--------YRNP-N-----PADAEHVLTVVYERY----CHYVESQTRNVGEE
A0A354GX32      ---VLRLS--------LSGD-Q-----PDEMAKVVNEWAATC----DSLYTASEEAKIKE
A0A5C1AAF0      ---IVRIS--------LVTM-Q-----TDDGVKIVDAVKTAY----LDEFVNKSAKARRQ
A0A5C6B3S0      ---IMQVS--------LASQ-E-----PKGLNTVVNAVVNAY----LEEIVQKERDLKRE
A0A518GIZ9      ---VLDVT--------FQSA-S-----ADDARHVVKAVIDAY----ASYLNESRSEKTTE
A0A1C3EBY9      ---VLDVT--------FQSA-S-----ADDARHVVKAVIDAY----ASYLNESRSEKTTE
D5SX64          ---VLDVT--------FQSA-S-----ADDARHVVKAVIDAY----ASYLNESRSEKTTE
A0A517Z0U7      ---FMRIS--------LTGE-R-----PADLKTIVEAVTNAF----VTQVVDQQLQDRRL
A0A2S8FCC0      ---IMEVR--------LSGE-N-----SKAISKIVNAVVQAY----MDEVVDAEAISRTT
A0A1Z8MBT6      ---KMMIK--------YTDT-D-----RDAAAAVCNAVVAEY----LQRRAEFDGTQSRR
A0A517SXN9      ---KMMIK--------YTDT-D-----RDAAAAVCNAVVAEY----LQRRAEFDGTQSRR
A0A518HFL0      ---LIEVS--------AESR-L-----RHEAATIVNAVVDAF----LKEDATWADARNRG
A0A5Q3LBQ3      ---LFEVR--------FEGP-N-----AAHAQLITNEVVNTY----LKMRNEDDNAQTQR
A0A3B8ZJM2      -------S--------YIAG-D-----PDTAMAVVNAIVLGY----QKFLDEEYKFVDDE
A0A1U7CLW1      ---ILSIS--------MTASCP-----PLDLSTLVNAIADSY----LTEIVDKERLARVE
A0A142WPR7      ---VIRMS--------FRDS-D-----PEVCQVALEAVLDGY----RSYLGETHQTTSKD
A0A3M1TFJ0      TTYVVDVT--------YTSS-H-----EERCALYANALAEAY----TRQRKSLWGQKTRQ
A0A517P477      ---FISVG--------LSGE-H-----AEDLPVIINGVVDAY----MKEVVVGSMDDREG
A0A517T4K9      ---FIRIS--------LRGE-H-----PADLAAIVNAVTTCY----MEEIVNSEENRRGE
A0A2Z3GZZ5      ---VLNLT--------LREP-D-----PELCKRLLEAVIAAYQAELYSIYEKASQDRIAT
A0A4V0I6L6      ---VLQLS--------FKSL-H-----PADAPKYLRAIIAAY----KDELTGVYEDASVR
A0A255QXF5      ---TMVVT--------YTDA-D-----KNFSAEVCNAIVGAY----LQKRDEYDNLRISR
A0A518KBI5      ---LYEVS--------YSAP-S-----PQEASDVVGAVIQQY----FARQSDEGYRRVQR
A0A5C5V6Q5      ---LYDVS--------YTSP-S-----AQESQDIVAAVIKKY----FVLQSDEQYKQVQR
A0A517MY49      ---FIDVR--------YRSK-Q-----AESAAAVVQAVVNSY----LEFVRQNHRSAASD
A0A2E6AG00      ---IIEIR--------YRSQ-R-----ADAAEAVVGAIVDAC----LEFMDEYHRNVASE
A0A1G3A880      ---IIRVS--------YQSR-S-----ASAAVAVIRAVMQSY----FDFIEKTHRGTAGQ
A0A2E8ATT1      ---IIELS--------CRSR-D-----PAAGEAVVGAVVDSY----LEFIERNHKDVSVE
A0A518KYQ0      ---TLSIS--------YRDI-D-----KRFAADVCNAIVEAY----LQKRDEYDNRRIGR
A0A5B9QX47      ---RMVVS--------YTDT-D-----QQAAAMVCNAIVDSY----LRQRNAFDSSRMRN
M5T666          ---RLVVS--------YTDT-D-----REAAAVVCNAVVDSY----LRQRDSFDDTRVNN
M5U6N6          ---RLVVG--------YTDT-D-----REAAAMVCNAVVESY----LRQRDSFDDTRINN
A0A517M0G2      ---LLSIQ--------FEHE-D-----PVAAATICNKITHSF----LSIRDRLDNDRVSN
A0A5C6AST1      ---LLSIS--------FKHP-D-----PQTAALVCNKVTEAY----LTQRDRLDSERVSN
A0A5C6C951      ---LLTIS--------FKHA-D-----PEVAALVCNKVTEAY----LVQRDRLDGERVSN
A0A5C6C5T3      ---RLVVS--------YTDT-D-----REAAAQVCNAIVESY----LRQRDSFDNTRVNN
A0A2A2W6A9      ---TLTVS--------YTDT-D-----KQFAADVCNAIVESY----LQKRDEFDNRRIGR
A0A518HQS9      ---AMSIS--------YIDS-D-----KKFAADVCNAVVEAY----LQKRDEYDNRRIGR
A0A5M6DFE6      ---RMEVS--------YTDT-D-----REYAQKICTAIVVSY----LSQRDSMDTNRVNS
A0A5C6F286      ---SLEVR--------YQDT-D-----RDAAARVCNAVVESY----LRQRDSFDDARVND
A0A517NGN1      ---QMLVS--------YEDS-D-----RDMAAKVCNAVVNAY----LRQRDAFDSKRTNN
M5RUI3          ---HLVVS--------YEDS-D-----GVAAATVCNAVVDSY----LRQRDAFDQARMVK
M5S2L2          ------------------------------------------------------------
A0A523CME0      ---------------------R--------------------------------------
A0A354PCV3      ---------------------N--------------------------------------
A0A354PHB4      ---------------------N--------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A538RV31      ---------------------R--------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
                                                                            

A0A356AE44      GATERQQLDTQLIPLLLEEQTALKRYGS--------------------------------
A0A1G2XSU7      --------------------------------------------------P---------
A0A350KD81      ARTALETHLMPLLIQKNRLERDFQK-----------------------------------
A0A2E3Z6T8      ------------------------------------------------------------
A0A257WQ92      LEVLIRRFLAQDGAAGSEFQQQQ---QQD-------------------------------
A0A356ETW1      ---LRRHWITVADVVGQEMMMRSFGLSPA-------------------------------
A0A3L7NJY1      ---ILQFAMEALDSAGRQLIEQSMGLGSS-------------------------------
A0A2D6SRY7      --------------------------------------------------E---------
A0A1G3C300      AVKWLQDQLVDKKLKVEEAEEALILYKEKQNIVG--------------------------
A0A524HC32      ARDFLMMQIDQAKIHLEKAEEDLNRFAKKAGIVS--------------------------
A0A660VT66      SLSFYTTQLKALEAQIADCNERINDFIHR-------------------------------
A0A0S8H0S8      ILKTLRSEKARQAEELTANFQAMEEFKRANGIIS----------------L---------
A0A177PV03      TVREVLNIIKELKKGMDETKQKEDAWLAKNPPPT----------------E---------
A0A1G2YIM0      KLSVLEDEYRTLTDKLQRQRKIVRQMAEE---------------------F---------
A0A1G2ZG92      AKIFIKCQMKEVKEEYYKSLSALSDFKIS-------------------------------
A0A1G3A0W0      LYRQLSERHTSLRSEIQGHEEFVANLSKT---------------------L---------
A0A353BE27      IAQLMEGAHADLTKRMRELSESASQFKEANPDIV----------------F---------
A0A5C6BPW1      LVELSVDYEQQTKKKLDEIAKLGRRLGITNEEEL----------------S---------
A0A1I3GSP0      LYKSLLERQQQLENDVKSLEAEYQKFRHDAPVFL----------------K---------
A0A517QJV1      MYDTLLNRQKKLSDEIAKLEKDYREFRVSAPVFL----------------K---------
A0A3C1QS25      LKGILDDLKRNYDAKAEELQAKIQEQVEAHGEKL----------------A---------
A0A5C6FX55      LKRFITEATDKVQPQLDKYESIYAQFRKESDLFF----------------D---------
A0A3L7UX05      QIGKLTRELERRNKEVEDLRNNIKLLGSE-------------------------------
A0A5C6DS51      AAELIEAARVQNEMELVTADNEYRDFISKVPVLL----------------E---------
A0A5C6DSL6      AANLIEKAQNDNKKELELADIEYREFIKNVPVLL----------------E---------
A0A3M1VG27      LLTLIHTATVDLRKQLEAKQQEYLRFRAEAPFLW----------------R---------
A0A518GC22      IEQLISGARDQLSNRLKQLTQQTHDFMLRAPEVI----------------W---------
A0A3L7Q373      LYETKLTQKNALDEERKALEKEYSQWRADVPFYI----------------N---------
A0A3E0PW54      LRESLARRQTELAEEIERLQSEYHAFRADSPYYL----------------P---------
A0A1Z8MHR4      IENLVNNARNKLLPDQEKLEQEYRRFRETAPLQW----------------D---------
A0A5C6EHJ0      TIDLIQTARNDVLTKLDKLEAEFSEFKKSSGLIF----------------R---------
A0A5C6F1H9      TIDLIQTARNDVLAKLDTLEGEFSDFKKSSGLIY----------------R---------
A0A255QXY0      FTRLINKAQDKLLPQQLALERDYKEFRREAPLEW----------------D---------
A0A517SYI0      IENLVNNARNKLLPDQEKLEQEYRRFRETAPLQW----------------D---------
A0A518HX54      FEQLVSQAQEKLLPQQAELEEAYKTFREGAPLEW----------------D---------
A0A5B9MF59      VGELVRNAMDKLIREQKDLESEYLTFRNNADLEW----------------D---------
A0A2A2WC24      VGELVRNAMDKLIREQKDLESEYLTFRDNADLEW----------------N---------
A0A518KYW8      VGELVRNAMDKLIREQKDLESEYLTFRDNADLEW----------------N---------
A0A5C5YZZ0      VVEFFREGRDSILPKLDELENEFTEFRSTAPLEW----------------N---------
A0A518JLD2      TLDLIESAQKDVSKKLTALEEDYAKFKTSSNLIY----------------H---------
A0A5M6DJ15      LREIYDERSEAIRRERQDLQLRAESLGTSDSESL----------------SIAQQMSVQR
A0A3L7P7S7      FMTRLERSSTVARREAQQLREDLRLIEEQ--LQK----------------N---------
A0A517N8M1      LIKLISTGMEQLHPKMLELESRYREFRRDAPLAW----------------D---------
A0A5C6CW01      LLQLISVAIEQLHPKMTDLEKQYRDFRRDAPLAW----------------N---------
A0A5C6BXS9      LMRLITVATDQLQPKMAKLEQQYRDFRTQAPLVW----------------N---------
M5U569          LLRLITLATDQLQPKMTELEQRYRDFRTSAPLVW----------------N---------
L7CND7          LLRLIEDATKVLQPKLSELEENYREFRTNASLVW----------------D---------
A0A0J1B8S4      LLKLISIATNQMQPKMAELESRYREFRQDAPLVW----------------D---------
F2ARR3          LMSLISVATDQLQPKLTELEERYREFRTNAPLVW----------------D---------
K5D8H6          LMSLISVATDQLQPKLTELEERYREFRTNAPLVW----------------D---------
M2AKU0          LMSLISVATDQLQPKLTELEERYREFRTNAPLVW----------------D---------
A0A5B1CKI2      LIRLISTGMEQLHPKMLELENRYRTFRRDAPLAW----------------N---------
A0A5C6EG84      LINLIAKGMEQLHPKMLDLEARYREFRRDAPLAW----------------D---------
A0A5C6F2X4      LINLIAKGMEQLHPKMLDLESRYREFRRDAPLAW----------------D---------
A0A5C5XTV6      LIRLITVATDQLQPKMDLIEERYRKFRIEAPLVW----------------N---------
A0A5C6AAB1      LMRLISVATDQLQPKMTELEQRYRDFRTTAPLVW----------------N---------
M5T8W8          LLRLITMATDQLQPKMVELEKRYRDFRTDAPLVW----------------N---------
M5SF00          LLRLIRDATDNLQPKLSELEEDYRAFRTKASLVW----------------N---------
A0A2G1WDS1      LLRLIRDATDNLQPKLSELEKDYRAFRTKASLVW----------------N---------
Q7UVS9          LLRLIRDATDNLQPKLSELEKDYRAFRTKASLVW----------------N---------
A0A5C6B601      LGKLVNQAYNDLLPKYEELVEEYHEFQENSPLKW----------------D---------
A0A517PFU1      AIRLISEARDQVLRDLEAAEAAHREFERTSPLVR----------------G---------
A0A5B9M8J9      FEQLVSSAQEKLLPQQAELEESYKVFREGAPLEW----------------D---------
A0A2A2WFP6      FEQLVSQAQEKLLPQQAELEEAYKSFRESAPLEW----------------D---------
A0A518L8N2      FEQLVSQAQEKLLPQQAELEEAYKTFREGAPLEW----------------D---------
A0A518HQN9      VGELVRNAMDKLIREQKDLESEYLTFRDNADLEW----------------N---------
A0A5M6D8H8      FSRLIDDAQQKLLPQQRMLEEEYKSFRENARLEW----------------N---------
A0A5B1CRW9      AVELIEAARETHERELIEADETYRGYVASVPVLL----------------E---------
A0A5C6EI46      AVELIEAARETHEQELSDADAAYRDFVASVPVLL----------------E---------
A0A2E7D3V4      TRELIDEANVKLEAQLQAKMAAYVDFRQS--APL-----------QWKRPP---------
A0A2S8F9B8      RLENLERVYNETETKARQKRSDLRQLAET--LGT----------------S---------
A0A368KP63      RLDNLERVYNETEAKARSKRSDLRTLAET--LGT----------------S---------
A0A2E0SHG0      AAENIRADFKKAEEEWESIQAKYKNFVESSQFYT----------------S---------
A0A518CQB8      AAQVIGGVANKAREEWEGIREKYKTFMESSQIYT----------------T---------
A0A5B9PER9      LRKYQDNFNNRFAVAIAERKKWDDQYDAL--RIN----------------G---------
A0A517QSM4      RLRQLQGFYRDINEELGLKRTQLEGIAQS--LKT----------------T---------
A0A355GJI7      ------------------------------------------------------------
A0A1Z8MCI4      VRESLRPAISEWESTVLNQQERLQLAARS--AGI----------------P---------
A0A517SYL7      VRESLRPAISEWESTVLNQQERLQLAARS--AGI----------------P---------
A0A3L7P0L2      LYKTLLDQKKMMDEERTRLEDEYEKWRGE--SPF----------------Y---------
A0A142XL75      RLQKLEETKRGYRSELEKFHKQIDTIAAA--LGT----------------K---------
A0A517SCC8      LFTNLTRQLKDAEQTIRDLDKEYHDWRNN--APFFLSTPVIV--------T---------
A0A3A0DR44      MLVQLENVKLKREAEIRSIREKIVEIEKT--VVGK---------------V---------
A0A358MY60      LESWLTPSIDLWKAEVQGHERRISELSKS--TLG----------------F---------
A0A517MNB1      LESWLSPSIDLWKEEVAGHGRRVRELSKA--AYG----------------F---------
A0A517XRC2      KADRLEKLIGDLRAKVEQDEREIKRKAE----------------------F---------
A0A142YJ13      RFERLKGLFSDYQKDLSGKRAKFKELAGS--VGT----------------S---------
A0A517Z7D3      LYEALTRREKDLQARIDELEQAYLQFRDE--SPWHASTPPIV--------T---------
A0A5C1AGE3      QKDILVKLREKYQKDIDD-------IMRA--GHL----------------R---------
A0A142XAP8      QSAALQATLTSIEKKLSDQKSKLELAGRT--NGT----------------T---------
A0A2Z3HEL7      EREHLRNRRSEVQNEIAQGERVIEFTARN--LGV----------------N---------
A0A1N6KY57      RYDLLKSTWNRYQENLREKRQQLKGLTEL--AGS----------------D---------
L0DK20          RYDLLKETWNRYQENLKEKRKELKRLTEL--AGS----------------D---------
A0A660UUK3      KLNILEEQKRTLDTKIDTQAKEINTLLDE---------------------F---------
A0A517ZHG5      RIAMLIELSDDYEQETKKKLDEIAKLGRR--LGI----------------T---------
A0A1Z8MPL5      QKDVLQAQYLEKVDELRLKREDLQELAKT--VGT----------------S---------
A0A5C6C1R5      RVNSLEEVYAEAEGKVRARRAEIRKLADT--LGT----------------G---------
A6BZU4          IIQQLKQAEKQIATELKLKKSEYQKFREN--APL-----------YWESTP---------
A0A2D5GZ77      IIQQLKQAEKQIATELKLKKSEYQKFREN--APL-----------YWESTP---------
A0A3D3R1Z6      IIQQLKQAEKQIATELKLKKSEYQKFREN--APL-----------YWESTP---------
A0A517XG00      IIQQLKQAEKQIATELKLKKSEYQKFREN--APL-----------YWESTP---------
A0A1G2YRE4      KLNLLDAERKLLEDKLRSTNDSIRQLGTE---------------------Y---------
A0A353Z859      IVNSIDAAKADTRAKLGDFIKTKERLVKK--LGG--------------------------
A0A2D6ST10      RLTKLENLFAKRRAELETKRRRTETLSEQ--TGA----------------I---------
A0A177QX42      LEEILVSAKGDLDRRLGENRQKYDDF------------------------R---------
A0A517SHR0      LESLLKSGKTELEDRLANNRTEYDRF------------------------R---------
A0A2E0AW64      LLSRLEELRKDKEDDVDRLRQDFRNEAIR--NLN----------------W---------
A0A351FZ59      LLSRLEELRKDKEDDVDRLRQDFRNEAIR--NLN----------------W---------
A0A660V239      TLAILDEERRSLEDQKQRQRDELRQLAQE---------------------F---------
A0A177Q3B7      RLKHLQEIQSKYEESLRSHRETVRKLILA--LGS----------------G---------
A0A2E0X6Y6      EKRRLTEKLARREQELEEFEAGLRALRRQ--VGH----------------L---------
A0A518GFD7      RLESLEIVHAEAESKVRIKRAELKSLATL--LGT----------------G---------
A0A5C5VZJ8      DVRALERAAADLKRRIEARADEIKVVRKD--LN-----------------L---------
A0A518GE37      VEAWLVQPIEQWKRNVESLRANLAELTKS--ANG----------------Y---------
A0A5C6F3H8      IEEWLEPEIQQWEQRVEERQARVQTLSEQ--TLG-----------FA---P---------
A0A5C5X072      LERWLEPEIQRWEQEVDERQKRVAALSQK--TLG-----------YA---P---------
A0A5C5WUQ3      LEMWLEPEIQRWEQQVEERQLKVTRLSEQ--TLG-----------FA---P---------
A0A5C6E697      LERWLEPEIQRWKQEVTERQRLVQSLSKQ--TLG-----------YA---P---------
A0A5C5Z1A3      LGRWLEPEIQRWEQEVEERRQSVNRLSQQ--TLG-----------YA---P---------
A0A5C6D2P7      LERWLEPEIQRWEREVSDRQRVVQSLSEQ--TLG-----------YS---P---------
A0A5B9ML17      LEELLDPEIDHWKGQVEQHKARVRELTIG--MKG-----------YD---P---------
A0A517LX75      AASLIQQAQQTNETELRQATQEYTRFVAT--SAG-----------LL---D---------
A0A354GX32      RIKQVLKNYQDGTTHLRNKKNELQARRDL--LGL----------------K---------
A0A5C1AAF0      RLDRLQALQTTAHESLKRKQATVRKLAEA--VGS----------------T---------
A0A5C6B3S0      RLNKLESIYEDANEQVRQKRNELKRLVEI--HGS----------------G---------
A0A518GIZ9      VFKTAQEAHDTLQKSLREKEEAYLKFRES--AP------------LQ---W---------
A0A1C3EBY9      VFKTAQDAHDTLQKSLREKEEAYLKFRES--AP------------LQ---W---------
D5SX64          VFKTAQEAHDTLQKSLREKEEAYLKFRES--AP------------LQ---W---------
A0A517Z0U7      KLTELKELLGREQTELDRQQSALRRLDKE--LA-----------------P---------
A0A2S8FCC0      RLSSLERAYSETENDLRSKRSEFRRLADT--LGT----------------G---------
A0A1Z8MBT6      LISVIEKQIDELDVEISAKEAEVRQYEVE--AQG-----------FS---S---------
A0A517SXN9      LISVIEKQIDELDVEISAKEAEVRQYEVE--AQG-----------FS---S---------
A0A518HFL0      SIVRLESYREELEAEIEGLQQGLFRLVQQ--SENPEMMQRNLDKLLS---P---------
A0A5Q3LBQ3      VIELLEGQKEQRSQNVMRLRENVRELSKQ--TTG-----------QD---P---------
A0A3B8ZJM2      VIKLFNEVKKKLDQDLVAHKNGYDKFLVD--IKQ-----------QGVLFN---------
A0A1U7CLW1      RLERLKELFADYQKDLTEKRLKFKEMAGS--IGT----------------S---------
A0A142WPR7      VAELIKEAKDVLLKQLETKEDEYHKFRQD--APL-----------LF---A---------
A0A3M1TFJ0      TEASVAVVVSRLGATLAASRKKLEEFLSS--NQT-----------PLFERQ---------
A0A517P477      KLANLRQVLATAEDALDLKRKQYQQFVEA--SQG-----------GV---A---------
A0A517T4K9      RLRRLERIQSNLEEELRTKYMSQRRLAET--L-------------HT---S---------
A0A2Z3GZZ5      LDRLLEAVKGQRKAAGEHRITHLTELR---------------------------------
A0A4V0I6L6      QLKLLDEQIARLKRGLNDTRVQLDEAERK--LRG-----------VI---D---------
A0A255QXF5      LVQYLGRQIDELKRRVEEQKEAVAKFARE--ASG-----------AA---P---------
A0A518KBI5      VVDLLEKERTRRQLEVERLQTYVIDLSRE--VTG-----------KD---P---------
A0A5C5V6Q5      VVDLLEKERVRRKLEVDRLQQYVVELSKE--VTG-----------KD---P---------
A0A517MY49      QLVHLEKQRATLEAELDEKQNQLQVHRER--VGH-----------LA---I---------
A0A2E6AG00      VVAILHKERKEVEQQLVTRDRQLLNTKRS--LGD-----------LG---M---------
A0A1G3A880      IMDVLGQEKVRVEAKLDEKKAALLAARRN--FGD-----------LG---I---------
A0A2E8ATT1      VVTILEKERQVTEAKLEQKKRSLLELKRQ--IKD-----------FG---L---------
A0A518KYQ0      LENWLTPQVEQLKRKVEEQEKLVAQLAKE--SHG-----------VA---P---------
A0A5B9QX47      LERWLEPETTRWEQEVESRQLRVQELSAR--LMG-----------YA---P---------
M5T666          LERWLEPEIQRWEQEVEERQQRVHMLSEK--ALG-----------FA---P---------
M5U6N6          LERWLEPEIQRWEQEVESRQQRVHMLSEK--ALG-----------FA---P---------
A0A517M0G2      LESWLTPSIDQWKNEVHVHGERVRDLSKV--VIG-----------YD---P---------
A0A5C6AST1      LESWLAPSIDLWKSEVQSHEKRVRELSKT--ALG-----------FD---P---------
A0A5C6C951      LESWLAPSIELWKSEVQAHEKRVRELSKA--ALG-----------FD---P---------
A0A5C6C5T3      LERWLDPEIQRWEQEVDERRKRVQLLKQK--SFG-----------YA---P---------
A0A2A2W6A9      LESWLTPQVEQLRRKVEEREHLVSQLAKE--AHG-----------VA---P---------
A0A518HQS9      LEQWLTPQVEQLKRKVEEQEKLVSQLAKE--AHG-----------VA---P---------
A0A5M6DFE6      LINYLTPAIRDREKKVQEKQDIVQKLSEK--TLG-----------YN---P---------
A0A5C6F286      VERWLEPEILRWEQEVEKRQSLVQALSEE--ALG-----------FS---P---------
A0A517NGN1      LERWLEPEIQRWEAEVSNRQSRVQSLSER--TLG-----------FN---P---------
M5RUI3          VERGLEPEIQRWQQEVEQRHHRVQKLSET--LVG-----------FA---P---------
M5S2L2          ------------------------------------------------------------
A0A523CME0      ------------------------------------------------------------
A0A354PCV3      ------------------------------------------------------------
A0A354PHB4      ------------------------------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A538RV31      ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
                                                                            

A0A356AE44      ------------------------------------------------------------
A0A1G2XSU7      ------------------------------------------------------------
A0A350KD81      ------------------------------------------------------------
A0A2E3Z6T8      ------------------------------------------------------------
A0A257WQ92      -------------------------------------------------------IAIFE
A0A356ETW1      -------------------------------------------------------DIQTQ
A0A3L7NJY1      -------------------------------------------------------DALHV
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      -----------------------------LGETAGIIEQK-------------------L
A0A524HC32      -------------------------------------------------------LDSKL
A0A660VT66      -----------------------------NGLITPEMWKA---------------FREEL
A0A0S8H0S8      -----------------------------ADGKGSI-------------------MAQRL
A0A177PV03      -----------------------------VSETLLTNLRT---------------RRSNE
A0A1G2YIM0      -----------------------------GTSALTGRQDM---------------MLQQV
A0A1G2ZG92      -----------------------------KKTVNLDTETQNLINKIATLQGEYEDNEKTI
A0A1G3A0W0      -----------------------------GTATPGELVSS---------------KRVRL
A0A353BE27      -----------------------------IGDDVNDPYHA---------------TWETL
A0A5C6BPW1      --------------------------------LDIAADNA---------------FTRQL
A0A1I3GSP0      -----------------------ASPIVSINGMPAPAQNQ---------------YETEL
A0A517QJV1      -----------------------ASPIVGANGVPVPPQSR---------------YEAEL
A0A3C1QS25      ---------------------------FWNAEGIINLEQQ---------------RMQEL
A0A5C6FX55      -----------------------------EQGNAINPHRV---------------RVQEL
A0A3L7UX05      -----------------------------LGAADPELIKD---------------RSRLT
A0A5C6DS51      ------------------------------GDQVRDVHKN---------------RLDQL
A0A5C6DSL6      ------------------------------GDQVRDLHKN---------------RLDQL
A0A3M1VG27      ----------------------RPTVADESSQDVISVHID---------------EVQKI
A0A518GC22      -----------------------------TGDEATDPYSV---------------NFLKL
A0A3L7Q373      ------------------------------TTPAVTAQGT---------------PLAQQ
A0A3E0PW54      ----------------------------------TPPTVA---------------VNGSV
A0A1Z8MHR4      -----------------------------LDGQAINPHRE---------------RQVML
A0A5C6EHJ0      ------------------------------GNETTSLHRD---------------NADRY
A0A5C6F1H9      ------------------------------GNDTTSIHRD---------------NADRF
A0A255QXY0      -----------------------------TQGNVINPHRQ---------------HYDHL
A0A517SYI0      -----------------------------LDGQAINPHRE---------------RQVML
A0A518HX54      -----------------------------PNGQVVNPHRQ---------------RQFQL
A0A5B9MF59      -----------------------------VEGQAINPYRE---------------RQFQL
A0A2A2WC24      -----------------------------VEGQAINPYRE---------------RQFQL
A0A518KYW8      -----------------------------VEGQAINPYRE---------------RQFQL
A0A5C5YZZ0      -----------------------------GKGEAINPYRD---------------DAIRL
A0A518JLD2      -----------------------------DDKIASVHREN---------------SGVYL
A0A5M6DJ15      YGQIQSELGKVNFNLLRAEGELEAYQQLLAGMEATRAKLE---------------KELDA
A0A3L7P7S7      -----------------------------TTSGVVN-------------------RQKLL
A0A517N8M1      -----------------------------SEGKAINPHRE---------------RQLFL
A0A5C6CW01      -----------------------------SQGEAINPHRE---------------SQLFL
A0A5C6BXS9      -----------------------------EQGVAVNPHRE---------------RQLYL
M5U569          -----------------------------EEGKAVNPHRE---------------RQLYL
L7CND7          -----------------------------ENGKAINPHRE---------------RQLYL
A0A0J1B8S4      -----------------------------ENGQAINPHRE---------------RQLYL
F2ARR3          -----------------------------QNGAAINPHRE---------------RQLYL
K5D8H6          -----------------------------QNGAAINPHRE---------------RQLYL
M2AKU0          -----------------------------QNGAAINPHRE---------------RQLYL
A0A5B1CKI2      -----------------------------AEGLAINPHRE---------------RQLFL
A0A5C6EG84      -----------------------------SEGIAINPHRE---------------RQLFL
A0A5C6F2X4      -----------------------------SQGIAINPHRE---------------RQLFL
A0A5C5XTV6      -----------------------------ERGDATNPHRE---------------RQLYL
A0A5C6AAB1      -----------------------------EKGEAVNPHRE---------------RQLFL
M5T8W8          -----------------------------EEGKAVNPHRE---------------RQLYL
M5SF00          -----------------------------ENGEAINPHRE---------------RQLYL
A0A2G1WDS1      -----------------------------ENGEAINPHRE---------------RQLYL
Q7UVS9          -----------------------------ENGEAINPHRE---------------RQLYL
A0A5C6B601      -----------------------------KDRQVINPHRE---------------RQLRL
A0A517PFU1      -----------------------------PDGQPLNPHAA---------------DLLAL
A0A5B9M8J9      -----------------------------PDGQVVNPHRQ---------------RQFQL
A0A2A2WFP6      -----------------------------PNGQVVNPHRH---------------RQFQL
A0A518L8N2      -----------------------------PNGQVVNPHRH---------------RQFQL
A0A518HQN9      -----------------------------VEGQAINPYRE---------------RQFQL
A0A5M6D8H8      -----------------------------LEGQAINPHRE---------------QQFRL
A0A5B1CRW9      -----------------------------GD-KVRDVHKE---------------RLSDM
A0A5C6EI46      -----------------------------GD-KVRDIHKE---------------RLSDM
A0A2E7D3V4      -----------------------------GTESSPADVVNVHQDRLEAIDAERRKNLLER
A0A2S8F9B8      -----------------------------DSETLSLAQQG---------------SVQHY
A0A368KP63      -----------------------------DSDTLSLAQQG---------------SVQHY
A0A2E0SHG0      -----------------------------DSDSVNV-------------------YLNTL
A0A518CQB8      -----------------------------TGDTVNV-------------------YLNSL
A0A5B9PER9      -----------------------------NSNIHAVMVVQ---------------LAKSM
A0A517QSM4      -----------------------------DPEILSSKRQL---------------EYEYY
A0A355GJI7      ------------------------------------------------------------
A0A1Z8MCI4      -----------------------------LDEMTQ--------------------QREFL
A0A517SYL7      -----------------------------LDELTQ--------------------QREFL
A0A3L7P0L2      -----------------------------ISSSPVVSAQGVPTSMPSPYQANLQDLVTRR
A0A142XL75      -----------------------------DEATLMTFDSF---------------LRDEL
A0A517SCC8      -----------------------------AQGTAMPGQSP---------------YMVEL
A0A3A0DR44      -----------------------------PAKGDTGAAGS---------------VLSPV
A0A358MY60      -----------------------------DPNNPVESLEY---------------DLSTL
A0A517MNB1      -----------------------------DPTMRVEGLEN---------------DLSVL
A0A517XRC2      -----------------------------NGTIGIEDTNK---------------QLSTL
A0A142YJ13      -----------------------------DKTASAVRQQM---------------MVEHL
A0A517Z7D3      -----------------------------ANGMVAAGQSP---------------YQARV
A0A5C1AGE3      -----------------------------GDMNAPQTPEM---------------FNEKV
A0A142XAP8      -----------------------------GAEATSNALAL---------------LQKQH
A0A2Z3HEL7      -----------------------------GTGDANGSTQL---------------LHIKF
A0A1N6KY57      -----------------------------NKSTIATIHQH---------------ELDRL
L0DK20          -----------------------------DKKTIANIHQH---------------ELDRL
A0A660UUK3      -----------------------------GTEELDGRQEI---------------MLQTV
A0A517ZHG5      -----------------------------SEEELSLDIAA---------------DNAFS
A0A1Z8MPL5      -----------------------------DPDTANATQQL---------------LLDQI
A0A5C6C1R5      -----------------------------DSESLSIAQQL---------------SVERY
A6BZU4          -----------------------------GSEAAVAGSTNVHQERVKAIDNERRLNLLKL
A0A2D5GZ77      -----------------------------GSEAAVAGSTNVHQERVKAIDNERRLNLLKL
A0A3D3R1Z6      -----------------------------GSEAAVAGSTNVHQERVKAIDNERRLNLLKL
A0A517XG00      -----------------------------GSEAAVAGSTNVHQERVKAIDNERRLNLLKL
A0A1G2YRE4      -----------------------------GSXXXIDRQDM---------------KLRRV
A0A353Z859      -----------------------------DNETAAEAAKA---------------RESFY
A0A2D6ST10      -----------------------------TEGQRDWKYQN---------------DLAIQ
A0A177QX42      -----------------------------NTATLIFQDNK---------------GINYY
A0A517SHR0      -----------------------------NKAQLLFQDNK---------------GINYY
A0A2E0AW64      -----------------------------DPYAVAQTESD---------------PGASA
A0A351FZ59      -----------------------------DPYAVAQTESD---------------PGASA
A0A660V239      -----------------------------GSTELTSRQEM---------------MLQQV
A0A177Q3B7      -----------------------------DAQVLAVKQRY---------------AAEAL
A0A2E0X6Y6      -----------------------------AVSSKDGLTDP---------------IIQQA
A0A518GFD7      -----------------------------DAESLTVAQQN---------------ALQQY
A0A5C5VZJ8      -----------------------------GAGSPAEVVVK---------------RQVAL
A0A518GE37      -----------------------------DPFKESSPRER---------------DASQM
A0A5C6F3H8      -----------------------------GKAIEKAENES---------------NLALL
A0A5C5X072      -----------------------------GQSVDRNDSEA---------------HMSRV
A0A5C5WUQ3      -----------------------------GQRLDVIEDQS---------------SLSLM
A0A5C6E697      -----------------------------GENAASLESDS---------------NLSLM
A0A5C5Z1A3      -----------------------------GRATSVAENND---------------NMSLL
A0A5C6D2P7      -----------------------------GERVSTLEDSS---------------SFSLM
A0A5B9ML17      -----------------------------GSPLGFSRNES---------------RLALL
A0A517LX75      -----------------------------GEELRSVPHE-------------------RL
A0A354GX32      -----------------------------DPLTLGKELDS---------------TQDLL
A0A5C1AAF0      -----------------------------RPENVAMQQQL---------------AHEQY
A0A5C6B3S0      -----------------------------SSDALSLKQQN---------------TLQQY
A0A518GIZ9      -----------------------------RAPIGAIAADG---------------TSGAT
A0A1C3EBY9      -----------------------------RAPIGAIAADG---------------TSGAT
D5SX64          -----------------------------RAPIGAIAADG---------------TSGAT
A0A517Z0U7      -----------------------------NETQVDAMQQA---------------KLDLR
A0A2S8FCC0      -----------------------------DTASLSLVQQN---------------ALQQF
A0A1Z8MBT6      -----------------------------NNQVSVIEDQS---------------QTSRL
A0A517SXN9      -----------------------------NNQVSVIEDQS---------------QTSRL
A0A518HFL0      -----------------------------GASGDGISGNP---------------DLEVE
A0A5Q3LBQ3      -----------------------------FGPNPVSEVIS---------------LEHPL
A0A3B8ZJM2      -----------------------------VTEPVNHFFEA---------------AMRNQ
A0A1U7CLW1      -----------------------------DKQAAAVRQQM---------------MVEHL
A0A142WPR7      -----------------------------KEEGAKNIHQE---------------RLAGI
A0A3M1TFJ0      -----------------------------EELLIQQIDAN---------------NRALE
A0A517P477      -----------------------------STIMAEQRHAG---------------LQELR
A0A517T4K9      -----------------------------DSETVTVKHQL---------------DLEYF
A0A2Z3GZZ5      -------------------------------GITTEDVSS---------------VRTRV
A0A4V0I6L6      -----------------------------PATGAVLVPGI---------------SQETP
A0A255QXF5      -----------------------------GERVAEIESAE---------------SFLLI
A0A518KBI5      -----------------------------FGQN-VVDVEK---------------AISPL
A0A5C5V6Q5      -----------------------------FGHNTLMDVDK---------------AISPL
A0A517MY49      -----------------------------SSEDNVVEPM-----------------IQAA
A0A2E6AG00      -----------------------------RDASNSLHPL-----------------VQRV
A0A1G3A880      -----------------------------KPGGQVVHPL-----------------VQRA
A0A2E8ATT1      -----------------------------REGS--IHPE-----------------VQRV
A0A518KYQ0      -----------------------------GERVAALENSD---------------SFSVI
A0A5B9QX47      -----------------------------TERVDAMEDKN---------------SFSMM
M5T666          -----------------------------GRNVDRAESES---------------SMSRL
M5U6N6          -----------------------------GQNLDRAESES---------------NLSRL
A0A517M0G2      -----------------------------THRVEGLEND-----------------LSVL
A0A5C6AST1      -----------------------------TQRVEGLEND-----------------LSIL
A0A5C6C951      -----------------------------TQRVEGLEND-----------------LSIL
A0A5C6C5T3      -----------------------------GQSIGRSDSEA---------------HATRM
A0A2A2W6A9      -----------------------------GEKVAALENSD---------------SLSVA
A0A518HQS9      -----------------------------GERVAAIENSD---------------SIALV
A0A5M6DFE6      -----------------------------SAPLSSMENQH---------------SISLF
A0A5C6F286      -----------------------------GHALDRAENDT---------------NVALL
A0A517NGN1      -----------------------------AARLSVAEDES---------------SLALF
M5RUI3          -----------------------------GQKIAALENES---------------NMTLM
M5S2L2          ------------------------------------------------------------
A0A523CME0      ------------------------------------------------------------
A0A354PCV3      ------------------------------------------------------------
A0A354PHB4      ------------------------------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A538RV31      ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
                                                                            

A0A356AE44      ------------------------------------------------------------
A0A1G2XSU7      ------------------------------------------------------------
A0A350KD81      ------------------------------------------------------------
A0A2E3Z6T8      ------------------------------------------------------------
A0A257WQ92      SRLLPLILEEKQLLRD----FGP-------------------------------------
A0A356ETW1      ASLEQTLLADQALLESMRGRVGM-------------------------------------
A0A3L7NJY1      QRINEELLDLRSRLRDANLKYGV-------------------------------------
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      EGLKSNLTEIKIEKIKLKALSDQIKQYSKDPTLTKLIPEIV-------------------
A0A524HC32      NSIYRQLEELNSVITVAEADMI--------------------------------------
A0A660VT66      TRLRSEVAQQRNDLRIRTRRCK--------------------------------------
A0A0S8H0S8      GELSAALTVAEVEAILAKAEYD--------------------------------------
A0A177PV03      TILRDSLQRQVKDLDHAIKIG---------------------------------------
A0A1G2YIM0      TMLQSEMTRIQTQKLSLEAQIM--------------------------------------
A0A1G2ZG92      LESRRKIVDSNKKLKEMEKFRKESKELT--------------------------------
A0A1G3A0W0      DQTKARLNELKQSIALLEWKKKALIDDSNNVAFA--------------------------
A0A353BE27      HKKLIDIRSRKSEIDALTTQVRKSLNKGHSPESLMRLLAMVSGGGTA-------------
A0A5C6BPW1      QDQWFNHTILRNKLRLETQITEKIGDSLEENPDI--------------------------
A0A1I3GSP0      ASIETAQNENLRKRSSIQARLATLDRKLKDNASR--------------------------
A0A517QJV1      SSIEEEQNEGQIKQSGIEAKLSELKRRRERGDSR--------------------------
A0A3C1QS25      DAHIRQLELQKTEYQSQLDRIAQLEEEGKTQAVIVFILEQH---EKI-------------
A0A5C6FX55      MADRGKLVQEYVDAELTYRSIKQTVEGAEDPRL---AFTIV---SQL-------------
A0A3L7UX05      LEDYTRMSRDLSQLEFERITAESRVERLRGELA---QPPVI---AQR-------------
A0A5C6DS51      EQELTDVRSSLAEAKSRLIVISSYAKRDDTNDVN--DLDKL---ALL-------------
A0A5C6DSL6      EKELAEVRSSLAEAKSRLIVISSYADQSKESGVD--DLDKL---ALL-------------
A0A3M1VG27      QQALSGVTVEQTVVRSKIRALEEAIASGRSPRELTALVKLF---LYS-------------
A0A518GC22      NSKITELRVERGRLESVYSQALKAIESGRSPETIMMLLTQL---NNA-------------
A0A3L7Q373      SIYQAKLSDVITRQSANEALLRSTRSKIG-------ILKEM---MAN-------------
A0A3E0PW54      IPGKNPYQARVEKIGTDLSRNRVLQSEIASRIATLEELQAS---GES-------------
A0A1Z8MHR4      QKNRLDLEQQLRLLSSDLRLAQKTIQRHQDPAIVAQVIGLL---GSL-------------
A0A5C6EHJ0      MAQRQNLLIQKAKISGLLAAARKAMIENQPNEAILLALNSS---LKI-------------
A0A5C6F1H9      MAQRQDLLIQKAKLSSLLSSTRKAMEEEQPYEAILMALNSS---FQA-------------
A0A255QXY0      QTMRQGLERRRRQLGTELTFVTNMRTQQRHPELVARVISEL---SDE-------------
A0A517SYI0      QKNRLDLEQQLRLLSSDLRLAQKTIQRHQDPAIVAQVIGLL---GSL-------------
A0A518HX54      QSFRDQLEQKQRQLDCELRFAESMRSRHKNPLMVAMIIGQL---SDV-------------
A0A5B9MF59      QTYRTELEQKKRELNSDLRLAVNTRKLHSDPVLVAQIIGHL---GSV-------------
A0A2A2WC24      QSYRTDLEQKKRELNSDLRLAINTRKLHSDPVLVAQIIGHL---GSV-------------
A0A518KYW8      QSYRTELEQKKRELNSDLRLAINTRKLHSDPVLVAQIIGHL---GSV-------------
A0A5C5YZZ0      EESLHALETQSRQLNSKLRLIREAVKDGTNNYAILQEVQYL---LED-------------
A0A518JLD2      SQIQSLTLERAKLNSVMDSAKLAISEEKPLESVLMSLRNLA---VDD-------------
A0A5M6DJ15      MRKSNAAGEQAESKGSNIAKQDGESSAADSEKLVADSVPPM---DQI-------------
A0A3L7P7S7      QEKSNGLMNRLDRVRARQEELTDQMRLAG-------TLSQT---DLL-------------
A0A517N8M1      VGSRSEVVEKLRQKSVEVAAIESIIRESGDDPLL--GLSII---GEL-------------
A0A5C6CW01      TGKRSELNEQMRQKATQLAAVESIYSQ-ANDHLI--AMAVI---SKL-------------
A0A5C6BXS9      TGRRSELFEELRQRSVELTAIETISKE-AKDPLV--RLSII---GQL-------------
M5U569          TERRSELFEQARQKSIELASIKSIAKE-GKDPTV--SLSII---GQL-------------
L7CND7          TARRSELFETLRSESVELSAIESIARE-ADDPLV--RLSII---GQL-------------
A0A0J1B8S4      TARRSELFEELRKKAIELTAIDSISNE-AKDPLV--RLSII---GQL-------------
F2ARR3          TERRSELFEHLRQKSIELTAIQSIADE-AEDPIV--GLSII---GQL-------------
K5D8H6          TERRSELFEHLRQKSIELTAIQSIADE-AEDPIV--GLSII---GQL-------------
M2AKU0          TERRSELFEHLRQKSIELTAIQSIADE-AEDPIV--GLSII---GQL-------------
A0A5B1CKI2      VGRRSEIDEIARQKKTEVAALKSIVSQSGQDPIL--GLNII---GEL-------------
A0A5C6EG84      VGRRSEVVEKLREKAVEVAALESIIRESKSDPLL--ALNII---GEL-------------
A0A5C6F2X4      VGRRSEVTEKLREKAVEVAAIESIIRESKSDPLL--GLNII---GEL-------------
A0A5C5XTV6      TGRRSQLDEELRQKSVELTAIESIAREAS-DPLV--GMSVI---GQL-------------
A0A5C6AAB1      TERRSELYELMRQKATELAAMTTISKEAK-DPEI--GLSII---GQL-------------
M5T8W8          TERRSELFEQARQKSIELAAIQSIAEEGK-DPLV--SLSII---GQL-------------
M5SF00          TERRSELFETLRSQSVELSAVESIAREAD-DPLV--RLSII---GQL-------------
A0A2G1WDS1      TGRRSELFETLRSQSVELSAVESIAKEAE-DPLV--RLSII---GQL-------------
Q7UVS9          TERRSELFETLRSQSVELSAVESIAKEAD-DPLV--RLSII---GQL-------------
A0A5C6B601      QAEREDLESEAMKYERELKTADLIRQQNP-DPIM--VAQMI---GGS-------------
A0A517PFU1      DRARDELSLELSNLTAEV------------ESIR--SSMEV---GGR-------------
A0A5B9M8J9      QAFRDELEQKQRELDCELRFAESMKRRHK-NPLM--VALII---GQL-------------
A0A2A2WFP6      QSFRDQLEQKQRQLDGELRFAESMRSRHK-NPLM--VAMII---GQL-------------
A0A518L8N2      QSFRDQLEQKQRQLDGELRFAESMRSRHK-NPLM--VAMII---GQL-------------
A0A518HQN9      QSYRTELEHKKRELNSDLRLAINTRKLHR-DPVL--VAQII---GHL-------------
A0A5M6D8H8      QAHRTELQQRMRQINSELRFATSTFKRHD-DPVL--VAQII---GQM-------------
A0A5B1CRW9      ETELNEVRSLLAESSSRLQVIQAAQLSND-DAVNADMGQLA---LLS-------------
A0A5C6EI46      ETELNKVRSSLAENESRLQVILTEAEERG-DELAGEMDQLA---LLS-------------
A0A2E7D3V4      EDLQSKIAVFEEAIASGQSMES--------------------------------------
A0A2S8F9B8      GLVRNELAQVRFDLMRSEGELDFLTSSNKAKMEAQAVAGNATAEPGKQENSGTGQTPAED
A0A368KP63      GLVRNELAQVRFDLMRAQGELDFLTSSNSSSQAADKAQAEPSKEVEKTVSGENAALPVGS
A0A2E0SHG0      NDYETQLRLLQFQRYASESRLEIIKESLKPENREKYNDFQRLALISAESVERMGLILSVE
A0A518CQB8      NDYETQLRLLQFERYAAESRLEIIKESLEPENMERFTDYQRLALVDSKHVERLGLLLSVE
A0A5B9PER9      QAMREELGKLQNERAKNERAAA------------LGPAGISARIWEMRE-----------
A0A517QSM4      GQLREEFTRLRFELMQANIQLA-----------------------ARQP-----------
A0A355GJI7      ------------------------------------------------------------
A0A1Z8MCI4      ASLKRAHMDATMQLKAVQQELS--------------------------------------
A0A517SYL7      ASLKRAHMDATMQLKAVQQELS--------------------------------------
A0A3L7P0L2      NLNRDQLRKTKIKIDQLKEMMA----------------NPEERETLQAW-----------
A0A142XL75      RLAQRDLQNARENLELAKPTPK-----------IGINSLDEEGAALTLP-----------
A0A517SCC8      DRINTAVRDNMLKRTAVEAKLK--------------------------------------
A0A3A0DR44      FALQQRLVEIEADREVLNAQIA--------------------------------------
A0A358MY60      SNLRKEVQDMRVQESWLETAVT-------------------RQLDTNAT-----------
A0A517MNB1      GSLRRDLADLIVEESILEAKIA-------------------MRKAGGKD-----------
A0A517XRC2      KLMETQLSQEVAALKTINQDNE--------------------------L-----------
A0A142YJ13      GLARQELMRLQSDVRRSQARLN--------------------------------------
A0A517Z7D3      ERIRQDRNENDIRKAEIQSRIS--------------------------------------
A0A5C1AGE3      KDVGDELRKARSAKREAEVKLA-------------------------AL-----------
A0A142XAP8      VEADALFVGAGREIEKAEAELK-------------------------VV-----------
A0A2Z3HEL7      GELDRMFTAANHELGDLQSQLS-------------------------VY-----------
A0A1N6KY57      GRAEDELSRIQSELRSLRIESE--------------------------------------
L0DK20          GRAEDELARVQSELRGLRVEHE--------------------------------------
A0A660UUK3      ARLQDDLDGVTIRRIELEAQVN--------------------------------------
A0A517ZHG5      RELQQQYFDLTIMRYNLKLETR--------------------------------------
A0A1Z8MPL5      LYLRRQISEVREQSVQKQRDLR--------------------------------------
A0A5C6C1R5      GHVQTELGKVNFDLMRTQGEVEAYQQLSERMRRQAELIATELESRAKAN-----------
A6BZU4          TELKSKIDSLKAAIASGESKET-------------------------LE-----------
A0A2D5GZ77      TELKSKIDSLKAAIASGESKET-------------------------LE-----------
A0A3D3R1Z6      TELKSKIDSLKAAIASGESKET-------------------------LE-----------
A0A517XG00      TELKSKIDSLKAAIASGESKET-------------------------LE-----------
A0A1G2YRE4      TALQSTLTAVEARRISLEAQVQ--------------------------------------
A0A353Z859      ADIRKQSVMAKIEKTKINAELS--------------------------------------
A0A2D6ST10      RSLIAEFRQVKVQLINLRFDQT--------------------------------------
A0A177QX42      EERLRKIEDERHQKMIALQELQ--------------------------A-----------
A0A517SHR0      EERLRKIEDERHLKMLELQQLS--------------------------V-----------
A0A2E0AW64      LSYEKQLAKLAIDQAIVQYQIE--------------RAQGIHQKVEENL-----------
A0A351FZ59      LSYEKQLAKLAIDQAIVQYQIE--------------RAQGIHQKVEENL-----------
A0A660V239      TSLRNELINVNIRRISLETQIQ--------------------------------------
A0A177Q3B7      GQAERELLQTQSELRRARLAGE--------------------------------------
A0A2E0X6Y6      LRVNEMLMDAQQQRLQLQATLA--------------------------------------
A0A518GFD7      GLMQEKLSTIQFALMQAEGEMK-----------LASEFDQRLRTQAAEL-----------
A0A5C5VZJ8      DERRAELWTLRKEIALDEKRLE--------------------------------------
A0A518GE37      VQVRSELSNIEAEKTVTRGRIN--------------------------A-----------
A0A5C6F3H8      TQLRSEIGDLKIELSLFDAGL---------------YDGGNLAASPVLA-----------
A0A5C5X072      AALRSQIGDLKIELALFDAIVE--------------APLPLDSDESLAA-----------
A0A5C5WUQ3      THLRSQIADLSVQLAIDDAQIA--------------MQDDSEPLPSLVA-----------
A0A5C6E697      ARLRDEIADLNVQLAVMDAQLA--------------MHDKE--GSDFEP-----------
A0A5C5Z1A3      AKLRADIADLTVELSIADAQLA--------------MKGEAQSAMVLDV-----------
A0A5C6D2P7      TRLRQQIAELNVEISVLDAQQA--------------MKDSGVLVSGDPM-----------
A0A5B9ML17      NGYESQINDLRVDIFELEGKLQ---------LEEMEQANHVKEDAGEFV-----------
A0A517LX75      KGIEQELAEIRSQLAYAKSRYE--------------------------------------
A0A354GX32      KTPQSQRLLLELDLAKSESELS--------------------ILNERIK-----------
A0A5C1AAF0      GTAQREYVKLQSDLRRLRLEESSLKAG---------------------------------
A0A5C6B3S0      AIVRNELTKLHFESMRARGELETLKKQVIG------------------------------
A0A518GIZ9      NVHQERVIAVEEQRRL--------------------------------------------
A0A1C3EBY9      NVHQERVIAVEEQRRL--------------------------------------------
D5SX64          NVHQERVIAVEEQRRL--------------------------------------------
A0A517Z0U7      VELRKQLGAVRLQIIEQEIILQ--------------------------------------
A0A2S8FCC0      AALRSELTKVQLELLRARANVLGMEPREAPVEKDAVVAKKPVVDGDKEA-----------
A0A1Z8MBT6      RELIDQRFELEQQISLIEQDLESIEAGEN------PLAVISGDLLEEMD-----------
A0A517SXN9      RELIDQRFELEQQISLIEQDLESIEAGEN------PLAVISGDLLEEMD-----------
A0A518HFL0      LSEYQRLHQSLLELEYEEIEAK--------------------------------------
A0A5Q3LBQ3      GNLQKRLTEAEVHREVMEARLK--------------------------------------
A0A3B8ZJM2      QQLTAKRLEANQIKSILDTVETAMKSGDFRAQELLLLINDSSDLVKSTI-----------
A0A1U7CLW1      GLARQELLKLNSDVRKSQARLN--------------------------------------
A0A142WPR7      EQARSALL----------------------------------------------------
A0A3M1TFJ0      AVRRDRIA----------------------------------------------------
A0A517P477      TMLRGEVTRTELELIRERAKQSYRDSVDDEFELGDEQLAALVADLPEY------------
A0A517T4K9      SELRKKLAETRFELTRAKIQLA--------------------------------------
A0A2Z3GZZ5      SALRDQARALRTDISNLDAQVE--------------------------------------
A0A4V0I6L6      ERVQQRISD---------------------------------------------------
A0A255QXF5      EKLRSQISNLEIQLAMIDAGVS-------------IRNPSADDNIDDLP-----------
A0A518KBI5      ASLHQQLTEIEVRIEILKAELQ--------------------------------------
A0A5C5V6Q5      ASLHSQLTDVEVRIEILHAEIQ--------------------------------------
A0A517MY49      MSLNEAALEAKQKRLELQAKLD--------------------------------------
A0A2E6AG00      VQINDSLIEAQQKRIRLQATYD--------------------------------------
A0A1G3A880      VRLNEALVEAQEKRVELQSALA--------------------------------------
A0A2E8ATT1      LQLNKAIMEVQEERLQLQASLT--------------------------------------
A0A518KYQ0      RNLRSQISDLEIEIALLDAGVG-------------IRNPLSSSELGESS-----------
A0A5B9QX47      QSLHSQVANLTYELAVLDAHHAMRE----------ELRGEQGLESPED------------
M5T666          ADLRSQVGELEIELALFDATKDLPV----------ALPPSETAQLPDA------------
M5U6N6          SDLRAQIGELKIELALFDATEDFP-----------ALPLENTSSSPQAI-----------
A0A517M0G2      AGLRTDLSNMIVEESILEAKVAMNA----------AMGEESANTDLDRS-----------
A0A5C6AST1      GSLRRDLANFIVEESVLEAKVAM------------HNAGIPDKTDIDVK-----------
A0A5C6C951      TGLRRDLANYIVEESILEAKVAM------------HEAGVSGESDRNIE-----------
A0A5C6C5T3      SELRSQVGDLKIKLALFDVMAAELPALEVGGSKVPDPAPAAA------------------
A0A2A2W6A9      QKLRNQISDLEIELAMLDAGVG-------------IRNPSESDDIIVPS-----------
A0A518HQS9      EKLRGEISDLEIELALMDAGIG-------------IRNPSASDNIIVPS-----------
A0A5M6DFE6      GQLQSQISSLEAEIEMLDAIEKGQR----------QDRENLASNGENLD-----------
A0A5C6F286      TQLRSEIGDLKIELAMFDAGLADSG----------FSAGGAAKTGLTPG-----------
A0A517NGN1      AELRSKITDIEVKLSVLDASEAMANEVEIENVSDLAAADSVSVMDLDAA-----------
M5RUI3          AELRSRISDLRVKIAIADASRVS------------AAGEAEFVPPVEAA-----------
M5S2L2          ------------------------------------------------------------
A0A523CME0      ------------------------------------------------------------
A0A354PCV3      ------------------------------------------------------------
A0A354PHB4      ------------------------------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A538RV31      ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
                                                                            

A0A356AE44      ------------------------------------------------------------
A0A1G2XSU7      ------------------------------------------------------------
A0A350KD81      ------------------------------------------------------------
A0A2E3Z6T8      ------------------------------------------------------------
A0A257WQ92      ------------------------------------------------------------
A0A356ETW1      ------------------------------------------------------------
A0A3L7NJY1      ------------------------------------------------------------
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      --------------------------------------------------KDGSINTLKA
A0A524HC32      --------------TKMAAYQQALGDETSNLPQVLKSNLVANLKD-----KYAQLRSEYE
A0A660VT66      --------------------------------------------------EIEKVRSEGG
A0A0S8H0S8      --------------AARAMMNDPGRMRYFAEQGSRSHLAQAGPDD-----AELAAAINQM
A0A177PV03      --------------------------------------------------QGAEMFNDMR
A0A1G2YIM0      -----------------------MLEKAEEETLPLEKVLTMKNEILRNDAQEQSLSSQIS
A0A1G2ZG92      --------------------------------------------------RSDALKSLQT
A0A1G3A0W0      ------------------------------SSPAIQSEYSDDEEW-----RKLDYDVRAM
A0A353BE27      --------------SANGAWDLEVFRQEQAQTRIRTDEMSRRLEQ--------------E
A0A5C6BPW1      ------------------------------QADLIDTLIERDPKM-----VDLSIK---A
A0A1I3GSP0      ----------------EELEFWVMHSLSTGT-AGAGGGNGGGGASIAGPPEKGALD---S
A0A517QJV1      ----------------ESLEFWVTYSLSTGTGAGKSASSGGGAGALSGPPEKAALD---Q
A0A3C1QS25      --------------KEDK--------------------------------EKNSEE---T
A0A5C6FX55      --------------LD------RPLSLPKELDATRLAMGADDGEL-----ASMEVQ---E
A0A3L7UX05      --------------QNLQDAVYQAFYADRDVADLADALDDAKARL--------------D
A0A5C6DS51      --------------SQKEVTRLKLFLDMT-RGETQSVAFQMDQPL-----RAEAARAQYN
A0A5C6DSL6      --------------SQKEVTRLKLFLDMT-RGETQSVAFQADQPL-----RAEAARAQYN
A0A3M1VG27      --------------EGHKNAAEAFAAPAD---------------------APDVVR---T
A0A518GC22      --------------SLTALDSTYSQLLQIDDNDLKNRLNSKSAQI-----EQ-------Q
A0A3L7Q373      --------------PEERESIQTYIMSSLAASSSPGGEGGSGAGLVSTPTGKAELD---Q
A0A3E0PW54      --------------REALEFFVIHWMSQGKSSSGDGESGGGGGSLLTEPPVRAELD---K
A0A1Z8MHR4      --------------NHEGMTGIKRALNGENQ-------RQDDLTL-----QRLEVQ---R
A0A5C6EHJ0      --------------A-DGDVDLSKAMSPESRWELEKIRKKPLLSA-----AERFRQ---E
A0A5C6F1H9      --------------TDDAAADFTRSMSPEQKWELEKIRSKPLLNA-----GERMRQ---E
A0A255QXY0      --------------AHD-LGDVPFGMRKLMD-------VKEDIGI-----QQIEIE---K
A0A517SYI0      --------------NHEGMTGIKRALNGENQ-------RQDDLTL-----QRLEVQ---R
A0A518HX54      --------------FED-SRLMLNGRSSGSL-------ATDDLEM-----QKIEVE---K
A0A5B9MF59      --------------VDD-FEPLKQIVGPGSA-------TTDDLTL-----KKLEVE---R
A0A2A2WC24      --------------VNE-FEPLRQIVGPGNA-------APDDLTL-----KKLEVE---R
A0A518KYW8      --------------VNE-FEPLRQIVGPGNA-------APDDLTL-----KKLEVE---R
A0A5C5YZZ0      --------------VK--------------DIDTIQQVIEADVPN-----SEWELQ---T
A0A518JLD2      --------------SK------QDLANDAVALKMSSIERKRIVDQ-----LRTSARIREE
A0A5M6DJ15      --------------PE--------------------EMRLTEVEV-----STILAS---D
A0A3L7P7S7      --------------PG-----------------------VGDSPA-----SEVNLTRNQE
A0A517N8M1      --------------LD------KKFSLPN-SQGRLSDLQQGDSQL-----ASNNLA---Q
A0A5C6CW01      --------------LN------VNLELSNVENEITRNLVDADVEL-----AQLKLD---Q
A0A5C6BXS9      --------------VG------RTFAIPQ-ATHFNQDMRESDTEL-----KQLELD---Q
M5U569          --------------VG------TTFDIPE-VMQTRQDLREGDAEL-----KQLELD---Q
L7CND7          --------------LG------KTFKIPD-SAQISQNMREGDAQL-----AQIELD---Q
A0A0J1B8S4      --------------IG------KNFEIPD-SKRISQDMRDGDVEL-----AQIELD---Q
F2ARR3          --------------IG------KTFEVPG-KAVFNQNVREGDEEL-----AQIKLD---Q
K5D8H6          --------------IG------KTFEVPG-KAVFNQNVREGDEEL-----AQIKLD---Q
M2AKU0          --------------IG------KTFEVPG-KAVFNQNVREGDEEL-----AQIKLD---Q
A0A5B1CKI2      --------------LG------KQFSLPN-SGSRLGELQQGDRIL-----ATIGLD---K
A0A5C6EG84      --------------LG------KSFSMPS-TQGRLEDLQQGDAEL-----AKNNLA---Q
A0A5C6F2X4      --------------LG------KSFTMPN-SQGRLEDLQQGDAEL-----AKNNLA---Q
A0A5C5XTV6      --------------VG------KTFTLPQ-ATQFNRDLRESDTEL-----QQLQLD---Q
A0A5C6AAB1      --------------TG------KQFDISS-SAPLTQNMREGDMRL-----AQIELD---Q
M5T8W8          --------------VG------KTFKIPE-TLQTRQDLREGDAQL-----KQLELD---Q
M5SF00          --------------MG------KTFEMPE-SNQISQNMRDGDAEL-----AQIELD---Q
A0A2G1WDS1      --------------MG------KTFEMPE-SNQISQNMRDGDAEL-----AQIELD---Q
Q7UVS9          --------------MG------KTFEMPE-SNEISQNMRDGDAQL-----AQIELD---Q
A0A5C6B601      --------------AGL-GDPNRFSEIQS-PMAANVLGLGDDLEL-----ERLGVE---Q
A0A517PFU1      --------------RAA-LAQMASLKRES-AGENPAI---AELGF-----EEQHLD----
A0A5B9M8J9      --------------SDV-FEDSRLMLKGE-STADLTT---DDLEL-----QKIEVE---K
A0A2A2WFP6      --------------SDV-FEDSRLMLNGK-STDSLAT---DDLEM-----QKIEVE---K
A0A518L8N2      --------------SDV-FEDSRLMLNGK-STDRLAT---DDLEM-----QKIEVE---K
A0A518HQN9      --------------GSV-VDEFEPLRQIV-GPGNTAP---DDLTL-----KKLEVE---R
A0A5M6D8H8      --------------GSD-NDGFDFVSRVD-QSPNPVP---GDLEL-----QKIEIE---R
A0A5B1CRW9      --------------QNE-VERLQFFVNMA-RGGARSEAFQAEQPM-----RQEVAKAHYN
A0A5C6EI46      --------------EKE-VDRLKFFLDMT-RGSSQSEKFQAEAPV-----RQEVAKAQYN
A0A2E7D3V4      --------------LTMLVKFYISTSEKAVAPQTIVTGLPGQ--E-----NTAQLLPLLI
A0A2S8F9B8      KGNSANSSGEEDADGSSDASEEIDLESIEYSETEMNEAIASD--P-----ISVKLQAELE
A0A368KP63      DQALVADAATVEGEQSEEIEPQL-------SEVEMNEAISSD--P-----ISVKLQAELD
A0A2E0SHG0      NLGVQIATNT----ATTEVSQANQILRAKTADTEFDTLVSA----------RLSLAERQS
A0A518CQB8      NLEISVATNA----ATSEAFQAQQYTRAETANTEFDKLLSA----------RLDLKAKKT
A0A5B9PER9      --------------QQQLSGERYQPQRGSQTATLRMRLLEAEANA-----ELIRQKVGTG
A0A517QSM4      --------------SLAADGDVNSVSLPAAEPPPVPQELLNERIN-----SSPEYQRISN
A0A355GJI7      ------------------------------------------------------------
A0A1Z8MCI4      --------------------SLPDADLSDSEGVRVAELEDGEATD-----LTRLRAGLVA
A0A517SYL7      --------------------SLPDADLSDSEGVRVAELEDGEATD-----LTRLRAGLVA
A0A3L7P0L2      --------------IMNSISSSSSGGPGAEGGSSGGGLLSSPAGK-----MELDQQLLMA
A0A142XL75      --------------WDLGVVEIVPPLSPAELRAQIDAEIRQD--A-----QLKQLAEAAA
A0A517SCC8      ---------------------------------TLKDMLARNEPR-----EAIQMRVLWS
A0A3A0DR44      -----------------AYGQPVASKPPKIPDDVLDVEVKMH--P-----EVREQSRVIS
A0A358MY60      --------------PFNLNE---ELLVPEPTNADIKRFVENS--Q-----EVTRQRGIVA
A0A517MNB1      --------------IREVVKTLPEITIPEPTSAEIARYVSSD--G-----EVAKHRGLLA
A0A517XRC2      --------------LLEKVKEKVEQAKTDKTKLDADTLMLRDWVA-----KHPRVDTLVK
A0A142YJ13      --------------VLKSQPTVATTSNQDFASVEVREATSPD--P-----KMMLIQDRIS
A0A517Z7D3      ---------------------------------VLQDMIDKGESR-----ETLEFF-VLQ
A0A5C1AGE3      --------------DDQVKAANDEAAS-------LQTKKFTD--E-----QIEAAL----
A0A142XAP8      --------------QKQLED--KDPKT-PPDPAIVTQLVAAD--V-----RVKAAKSAYT
A0A2Z3HEL7      --------------QDQLEERKRDPKKFAADTQLLKLAVARD--K-----RVVAANELWQ
A0A1N6KY57      -----------------VLHEKAALNQMMVTPAMIADAISRD--R-----SIELLKDKEA
L0DK20          -----------------VLQEDVARNSSMITPAMIVDAINRD--H-----SIEVLKEREA
A0A660UUK3      -------------------------MYEKDVSEPLPEINRLQEQS-----AYINTDPTMQ
A0A517ZHG5      ---------------ITEKIGDTVEENPDIQAEMIETLIDRD--P-----KMADLLVKAD
A0A1Z8MPL5      ---------------AYEQQVGSLALAGSILPEDIEAELSEN--E-----DLAEYQVSIA
A0A5C6C1R5      --------------AADSEEGEEDQESSVLTAYETDRILSSDRDY-----QSLLAMARSL
A6BZU4          --------------LLAQQFLMGQTRGQAANGNTSEGQIASPGTS-----QVDRARTALE
A0A2D5GZ77      --------------LLAQQFLMGQTRGQAANGNTSEGQIASPGTS-----QVDRARTALE
A0A3D3R1Z6      --------------LLAQQFLMGQTRGQAANGNTSEGQIASPGTS-----QVDRARTALE
A0A517XG00      --------------LLAQQFLMGQTRGQAANGNTSEGQIASPGTS-----QVDRARTALE
A0A1G2YRE4      -----------------------FLEQIKEQSITPEDMLRIR--N-----ENINSDPMVQ
A0A353Z859      -----------------LRERQEKIEGKDLDEQLIDLHLDRR--N-----EVLSAAYTVE
A0A2D6ST10      ---------------------HLENDKASGQPAEVPDDVLEAALS-----RDPQYAAASK
A0A177QX42      --------------TRNAMKDALSRGASKEALLLMANMLKPNGDE-----KSDPAASLQP
A0A517SHR0      --------------QRNAMKDALARGASKEALLLMANMLK-NDPE-----KSNQTESLQA
A0A2E0AW64      --------------NAQSESIEISDTDLATMVDQSADMLQHN--E-----DLARAQAAIK
A0A351FZ59      --------------NAQSESIEISDTDLATMVDQSADMLQHN--E-----DLARAQAAIK
A0A660V239      -----------------------VQEGGLQEVATPGSLIERQ--N-----AIVNSDPIIQ
A0A177Q3B7      --------------VKRRRIKAITEKGLSGSATPIDLEVDAD--P-----SIQTLLAHKA
A0A2E0X6Y6      ---------------------------------AVEEAVATG--A-----DVFQHLAGLE
A0A518GFD7      --------------AADSQSEEGGLVAAREPQSDVSESLLRT--P-----DVLRLEDDIA
A0A5C5VZJ8      -----------------RAKAQHAASTDAGDAAPDPAAAEKAAFE-----RNAEWRGLRR
A0A518GE37      --------------LQSQADNPSEEKLPPLNPRDIDYLVAED--S-----QVQKAKLALE
A0A5C6F3H8      --------------AAPMVVPEAVVKRGKPSESEIASHLEAD--P-----RVAELVQKVN
A0A5C5X072      --------------ATPAIAP-TEIQKQVIRERDIENGIDAD--A-----KVRAAKAVVN
A0A5C5WUQ3      --------------STPFVPPAISIQKQVPTESQIAQFVAND--A-----EVREAEMVYR
A0A5C6E697      --------------EAEILAETALSAARKPSEANIMALVNAD--P-----EVLEAKSRIA
A0A5C5Z1A3      --------------NSTFVPPIIKVQRREPTEDDIAKIVQRK--P-----EVVNARERIR
A0A5C6D2P7      --------------SDSLVIP-------EPSEGEIASWVNAD--T-----DVVEAKSMIQ
A0A5B9ML17      --------------PEAFIPPPSEVTRNVIGPGDIANYVNSD--E-----SVVEALQQIG
A0A517LX75      ------------------MIDDLEGAKQEGEPTDIERLALLS--A-----KEIDRLKLFI
A0A354GX32      --------------APEKLTVSETAVEEALNKEMKDDNLTKAQLE-----GLVKDQADLA
A0A5C1AAF0      -----------------------AVVPRTPAESAIKQYVDSD--P-----VVKDLEKRQA
A0A5C6B3S0      -----------------------PALPDAVPNAEIDAYIAAD--A-----SVMVLENKVA
A0A518GIZ9      -----------------------NLLRRTEINSRMQALQKA---Q-----DQGESTSTME
A0A1C3EBY9      -----------------------NLLRRTEINSRIQALQKA---Q-----DQGESTSTME
D5SX64          -----------------------NLLRRTEINSRMQALQKA---Q-----DQGESTSTME
A0A517Z0U7      ---------------------TIEGTQEEGVELAIPEAVVDSQLL-----EDPGFQKLYR
A0A2S8FCC0      --------------PEASVAN--SDEESEEIDFELERIMAAD--E-----VMVAFKSQIM
A0A1Z8MBT6      --------------EQDFTPPRSMVKKRLVTRPVLDQAISQX--R-----KVVTQKGVVD
A0A517SXN9      --------------EQDFTPPRSMVKKRLVTRPVLDQAIGQH--R-----KVVTQKGVVD
A0A518HFL0      --------------------------------------------A-----ELEAVRREAG
A0A5Q3LBQ3      -----------------VYQEAIHARPVELSQMEVEESVERN--V-----EVQELKTKLA
A0A3B8ZJM2      --------------FDQLFEDQDLAGKAMLESEKLEQSELLLLQG-----ELDHLLEKYG
A0A1U7CLW1      ----------------VLASKPELEPTSNQTVSTLDTLSTAEVDP-----QVMELRSRLA
A0A142WPR7      ----------------------------------IALHEKTAELD-----SLKNAMARGG
A0A3M1TFJ0      ------------------------------------------------------LDASLE
A0A517P477      --------------------------------------------K-----QAEEVARAAE
A0A517T4K9      ----------------VLENARKEAEERNRASEETESVADDK--K-----SVTDTDGNSS
A0A2Z3GZZ5      ----------------------------------LVSRTGPAPED-----RQLAFVQLTA
A0A4V0I6L6      -------------------------NRSAQNARELEKIVIENRLK-----QIRDAGKTRA
A0A255QXF5      --------------MTHFVPPYIPVVKGKIDDSDVQDFIEKD--E-----SVKLANERYE
A0A518KBI5      ----------------SIEETPIVTQTHEDRTGSIDLEVSMH--A-----EVRQREQAIL
A0A5C5V6Q5      ----------------SLEESEVTIAPHADRAGAIDLEVNMA--P-----EVVQRERALT
A0A517MY49      ---------------------------------SVKESVEQG--E-----TIN---LGAD
A0A2E6AG00      ---------------------------------AVQLAMREG--R-----DLRQYVTAVE
A0A1G3A880      ---------------------------------AIQNAVRSG--A-----DLQHHLLSVE
A0A2E8ATT1      ---------------------------------SVRSAVRSG--K-----DLRQHLINLE
A0A518KYQ0      --------------IEEFVPAVEKVKRGTIDPKRLSDFISRD--K-----EVNRTKEMYE
A0A5B9QX47      -----------------------SVKRIEPTPEAIAQTVANN--P-----SVKEAQAHIA
M5T666          --------------PVVPTLAETEVQKAAIREADIQEAIEGD--V-----KVREASRVVG
M5U6N6          --------------PSVPAVADIKVQKRIVNESDIKSAVEDD--V-----KVREAKRVVD
A0A517M0G2      --------------KVR-----------TPYPEEIDQYVEAD--P-----SVVTNRKLLA
A0A5C6AST1      --------------LPELIIP-------EPTSAEIERFVSND--S-----TVKRHAARIA
A0A5C6C951      --------------LPKLEIP-------EPTTAEIDRYVESS--A-----EVSRYENRVA
A0A5C6C5T3      ----------------------VEIQKATVSEREIENAIDGD--A-----KVKAARAVVD
A0A2A2W6A9      --------------VAEFVPPEIRVQRGEIDPKRLAAMVENS--R-----DVFLAKERYE
A0A518HQS9      --------------VAEFVPPVIQVERGEIDPDRLESLILND--K-----VVARAQEMYE
A0A5M6DFE6      --------------YPKFVPPIIDVRRDILDPDEVNAMAEND--P-----AVVEARQRYN
A0A5C6F286      --------------SVEAIVVKRAEPRESQILAAIEN----D--S-----KVRETVRKVD
A0A517NGN1      --------------GVAFVPVRREVRRQSISSNDVDRMAQTD--A-----DVLQARKKAA
M5RUI3          --------------VIPSAVVERHVPSEQEILNAINQ----D--A-----KVSEALSRVA
M5S2L2          ------------------------------------------------------------
A0A523CME0      ------------------------------------------------------------
A0A354PCV3      ------------------------------------------------------------
A0A354PHB4      ------------------------------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A538RV31      ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
                                                                            

A0A356AE44      -------------------------------GHPDVINVRKRIDLV-----KSYYRQMGI
A0A1G2XSU7      -------------------------------TNPELARKESLLNAL-----KQRLEELRQ
A0A350KD81      -------------------------------NHPDLDAVNRSIETIINLYRRQGLDISAD
A0A2E3Z6T8      -------------------------------NHPRIIELQQDVRSL-----DQYINNYHS
A0A257WQ92      -------------------------------DHPDVKLKRQTIQTA-----LDFYRRQGV
A0A356ETW1      -------------------------------SHPSMIAQQEKVRLA-----REYLQRNQE
A0A3L7NJY1      -------------------------------NHPRIVAINDEILVK-----ESYLQQLPM
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      KYADLQANKTM--------LSEKYGE-----KHPNIANIDLQLKEV-----ENRIKLETL
A0A524HC32      DLKTTFHD-----------------------DYPSVKNLKARMNSI-----AARIEKEET
A0A660VT66      DLSNLLFLQ----------------------EDPLLAEMRKEILSL-----EKELSIARL
A0A0S8H0S8      QLQLVALKRQRTE------------------GHPAVQALQAQLARA-----RQRQAKADK
A0A177PV03      RVSAHPQTGNTKLDEKLWELYMQMAL-----LQADYGEGHPQIQSV-----KRQIEAVRA
A0A1G2YIM0      QLEQALIVANQTLTA----------------ENPEIKRRSELLENM-----KKKLRAREE
A0A1G2ZG92      KLDGYLVDIAQKSVEY--------TK-----EHPDYKILEKEIETA-----KELIKNEKK
A0A1G3A0W0      KLQIANSGLTS--------------------KHPDMIRMEKNLEFV-----EESLRLRQM
A0A353BE27      QLNPLRIQLEV--------FSNQLGE-----EHPSVATLRAQVQGL-----EKQLEKIRE
A0A5C6BPW1      DAIEATIRRYE--------ETLKDTE-----NNSVLKSARREQKTT-----QEAIAKYRE
A0A1I3GSP0      QLLTARLLEQR--------LLHSLGD-----DHTQVRNVRRQINTILDFYTRQGLTPPDL
A0A517QJV1      QFLTARLLEQG--------LLHSLGA-----DHTDVRNVRRQIDTILNSYAQQGLTPPAY
A0A3C1QS25      DILELRLNLER--------LLFKFGE-----DHPEVKIV------------RNEIRAWEE
A0A5C6FX55      ELAPLKADRDA--------LAAELGK-----GHPHVKVLDNKIASL-----EKALDRLGQ
A0A3L7UX05      KLNKVSRGQDV--------------------SHREMNDRITDLKSK-----IKVLWERRR
A0A5C6DS51      RLLDLLQKERT--------MVDVYGA-----NHPLVESTQQEIQVI-----RQFIAQNAP
A0A5C6DSL6      RLLDLLQKERT--------MVDVYGA-----NHPLVESTRQEIQVI-----KQFIEQNAP
A0A3M1VG27      QLVPLYLEEQR--------LLSEFGE-----DHPDVIAVRQRMEAL-----RRLARRTAA
A0A518GC22      ILFPLQVEERV--------LLDSVGA-----GHPSVGIVQKKVESV-----KRQIAELRE
A0A3L7Q373      QLLVNRMLERR--------LLLVLGE-----NHADVRNVRRQTETILDFYYRQGLTPPNL
A0A3E0PW54      RFLDLQLMRDR--------LTVQLGK-----DHPNVIKLHQQLATL-----TD-------
A0A1Z8MHR4      KLIPLQIKRDQ--------MELQFGP-----SHPEVKSIALQIESS-----QRKLNELNQ
A0A5C6EHJ0      RLLPLELERET--------LVESVGR-----DHPAIDTINKRIAVI-----EKMIETVGE
A0A5C6F1H9      SLLPLQLERES--------LVDTVGR-----DHPAIDTINKRIALI-----EKTIEKVEE
A0A255QXY0      SLVPLKIKLEQ--------MQMAFGA-----SHPEVVSLSTQIEAS-----QRRLHELNL
A0A517SYI0      KLIPLQIKRDQ--------MELQFGP-----SHPEVKSIALQIESS-----QRKLNELNQ
A0A518HX54      KLVPLVIRREQ--------LEMAYGR-----SHPEVKSIVMQIESS-----QSKLNELIA
A0A5B9MF59      TLIPLQIKRDQ--------LELAYGS-----SHPEVKSIAMQIESS-----QNKLNEINQ
A0A2A2WC24      ALIPLQIKRDQ--------LELAYGA-----SHPEVKSIAMQIESS-----QNKLNELNQ
A0A518KYW8      TLIPLQIKRDQ--------LELAYGA-----SHPEVKSIAMQIESS-----QNKLNELNQ
A0A5C5YZZ0      KLMGLRVRADT--------LASQFAP-----NHPQRIAIEQELKMT-----EKAFREIQK
A0A518JLD2      KLLPLEIERKK--------LSRSFGS-----GHVAIKSLDEEIQVV-----KRLILDAVQ
A0A5M6DJ15      NIYQRLYNESRQVKDEIELYRLEYGEGMVRHQVGRLERLEKELERR-----REDLVRIAQ
A0A3L7P7S7      IRILERKVKQL--------ARTGLGK-----DHPDVKNLNDEIKDI-----REYIDQMAK
A0A517N8M1      ELVPLMIERDK--------FEAEFGP-----SHPSVKVLDAQLSTM-----RRELQKLVQ
A0A5C6CW01      QLVPLIIERNK--------MANEFGA-----SHPTVKQLDTELSLM-----KSELRRIVV
A0A5C6BXS9      KLVPLMIERNK--------YAAEFGE-----QHPTVKALDTELTMM-----KSELTRLVT
M5U569          QLVPLIIERNK--------YAAEFGD-----SHPTVKQLDVELKMM-----KSELKRLIT
L7CND7          QLVPLMIERNK--------FAAEFGE-----QHPTVKALDAELTMM-----KSELKRLVK
A0A0J1B8S4      QLVPLMIERNK--------FAAEFGE-----QHPTVKALDAELTMM-----KRELKRLIT
F2ARR3          QLVPLMIERHK--------FAAEFGE-----QHPTVKALDAELTMM-----KSELKRLVK
K5D8H6          QLVPLMIERHK--------FAAEFGE-----QHPTVKALDAELTMM-----KSELKRLVK
M2AKU0          QLVPLMIERHK--------FAAEFGE-----QHPTVKALDAELTMM-----KSELKRLVK
A0A5B1CKI2      ELVPMIIERDK--------YAAEFGP-----EHPTVRNLDAQLESM-----KTEMKKLVE
A0A5C6EG84      ELVPLMIERNK--------FEAEYGP-----SHPSVKVLDSQLETM-----RSELKKLVE
A0A5C6F2X4      ELVPLMIERNK--------FESEYGP-----SHPSVKVLDSQLETM-----RSELQRLVE
A0A5C5XTV6      KLVPLMIERNR--------YAAEFGD-----QHPTVKALDTELTVM-----KSELKRLIT
A0A5C6AAB1      QLVPLMIERNK--------YAAEFGD-----SHPTVKQLDAELTMM-----KSELKRLVT
M5T8W8          QLVPLIIERNK--------FAAEFGE-----QHPTVKQLDVELKMM-----KSELKRLVT
M5SF00          QLVPLMIERNK--------FAAEFGE-----QHPTVKALDAELSMM-----KRELKRLVK
A0A2G1WDS1      QLVPLMIERNK--------FAAEFGE-----QHPTVKALDAELSMM-----KRELKRLVK
Q7UVS9          QLVPLMIERNK--------FAAEFGE-----QHPTVKALDAELTMM-----KSELKRLVK
A0A5C6B601      QLVPLETERAE--------LISQFGD-----NHPQVVSITSKIENI-----RRRLNELES
A0A517PFU1      ----LILQLEE--------ARETKGE-----NHPDIKRLENRVAA-------------LR
A0A5B9M8J9      KLIPLEIQREQ--------LELAYGR-----SHPEVKSIVMQIESS-----QSKLNELIG
A0A2A2WFP6      KLVPLVIRREQ--------LEMAYGR-----SHPEVKSVAMQIESS-----QSKLNGLIA
A0A518L8N2      KLVPLVIRREQ--------LEMAYGR-----SHPEVKSIVTQIESS-----QSKLNELIA
A0A518HQN9      ALIPLQIKRDQ--------LELAYGA-----SHPEVKSIAMQIESS-----QNKLNELNQ
A0A5M6D8H8      SLIPLEIKREQ--------LELAYGE-----SHPEVKSITMQIDSS-----QKKLNELSE
A0A5B1CRW9      RLLDLIQKERA--------LSDTFGS-----GHPLVEAARQETALT-----RQFITANTP
A0A5C6EI46      RLLDLIQREKA--------LSDTFGK-----GHPLVEATRQETEIT-----RQFIAANAP
A0A2E7D3V4      QEQRLLR---------------------------DLGADHPDVQSV-----QSEIALVKA
A0A2S8F9B8      RFEEAKYTLTPAAYER------------------YRQTNEAAISTL-----ESRLEKRRE
A0A368KP63      RFEEPQYTLTPAAYQR------------------YRETNSAAIKSL-----ESRLKERRE
A0A2E0SHG0      EFGANHPKVREA---------------------------EENLRDL-----EMLLDRSKE
A0A518CQB8      EYADNHPKVIEA---------------------------EENLQDL-----EKFLVEKKD
A0A5B9PER9      HPDHEAAVVSINIVKK------------------QLAEMEEENSKN-----SADLDILPD
A0A517QSM4      SIRELEWSITDKSQNL--------GE-----KHPDRVRLNTHIERQ-----RLLAEELKK
A0A355GJI7      ----------------------------------DFQKNHPDLDAV-----NRSIETIIN
A0A1Z8MCI4      EKHRIIVEDSENVFKE------------------GLVRIEAKIRDI-----DEQLSLRKA
A0A517SYL7      EKHRIIVEDSENVFKE------------------GLVRIEAKIRDI-----DEQLSLRKA
A0A3L7P0L2      RLLERRLLL-------------------------VLGPNHGDVRNV-----RRQIDTILD
A0A142XL75      SAKERLNKVKERYQEG---------E-----RPPTVIKAEDDLKAA-----ELRRDKHRD
A0A517SCC8      LSTGTVAAGGAEGGGGGGGGGGSILA-----SPPGKAELDSQLLAA-----RLLEHRLLY
A0A3A0DR44      AMRLQLEDIEKKSRQG--------KQ-----SS-SYKDYAALIVRA-----EKELATLQD
A0A358MY60      EQETILRSLEKNGLKN--------LR-----QE-YYNEVSRKVTEA-----EKKLASARE
A0A517MNB1      DREKKIRGMEDAGFAS--------LR-----QD-HYEDLKKQADEL-----RKQVQAAEK
A0A517XRC2      QKLAREIDLGQAKTAAG------TVP-----DAPVVLALDAEVKQL-----QKAIDKART
A0A142YJ13      ELRGRQARLSRNARKG--------NA-----DP-AAQALEREIKQL-----ARTLESHRN
A0A517Z7D3      WFSSGSAATQGSGGAG--------LT-----EPPGKAQLDNRLLEA-----QLLLSRLMQ
A0A5C1AGE3      ----------LRDKEP--------AL-----VG-FQAELEVAQAKL-----KARQGAYKD
A0A142XAP8      ARKEYADKEATKATNP--------DL-----DD-GIATLRAEVKKL-----EA---EVKG
A0A2Z3HEL7      AANDLYTKE-LKNSNP--------E------NA-YIQELKAAADKY-----KK---ALDD
A0A1N6KY57      LVQRAIDRVSHLVRNR--------ND-----P--AVKKHRDDLEAI-----HVALAAQRR
L0DK20          AAQKAIDRIYHIARNK--------SD-----P--SLKKHRDELEAA-----RTAMVAQRR
A0A660UUK3      TLVANIRQYEAQIITD--------KQ-----TMTDNNPELQNRIAI-----LESFKKRME
A0A517ZHG5      AIEANIRRYEETLKDT--------EN-----NS-VLKSARREQETT-----QEAIAKYRE
A0A1Z8MPL5      ELQAELDAYKQIYRDS--------SA-----E--AIKSREAEITRL-----QEEQAGFAQ
A0A5C6C1R5      EEEIELYKTRYGKGMI--------QY-----KIDRFDRLTSDAKER-----EATLLKLAA
A6BZU4          THLMPLLIQKNRLER-------------------DFQKNHPDLDAV-----NRSIETIIN
A0A2D5GZ77      THLMPLLIQKNRLER-------------------DFQKNHPDLDAV-----NRSIETIIN
A0A3D3R1Z6      THLMPLLIQKNRLER-------------------DFQKNHPDLDAV-----NRSIETIIN
A0A517XG00      THLMPLLIQKNRLER-------------------DFQKNHPDLDAV-----NRSIETIIN
A0A1G2YRE4      ELTRNIVSLERDLITA--------KQ-----MFAASNPIIKQKQDL-----LEAFRSRIE
A0A353Z859      KEREALSRREGKGPAS------------------SVEEYARRLREA-----EAKLKEVRE
A0A2D6ST10      KVAELERRVQQNDVEL--------SE-----THPTLVKFKKQLADA-----QKHQQELQE
A0A177QX42      KVDPFMEKMMPLLLER--------DT-----LLERVGESHPQVKML-----DRKIESLRG
A0A517SHR0      RMDPFMKEVTPLLVER--------ET-----LLETVGEGHPQIRKL-----DKRIEALRG
A0A2E0AW64      LLRKELAEIEQIAAGD--------PA-----NLPRYQSAQRQIALQ-----QEQIEKLDA
A0A351FZ59      LLRKELAEIEQIAAGD--------PA-----NLPRYQSAQRQIALQ-----QEQIEKLDA
A0A660V239      ALTNSIMQYEELIVVG--------QQ-----TMTPGNPELKQRREI-----LKTLKERLG
A0A177Q3B7      RVEKDIERIEQVSVRG--------RR-----EP-AMKPLLDQSAAL-----DAQLEKRRK
A0A2E0X6Y6      ESVAAQMLQMTLGISE--------QD-----MT-MLAEQESRLLKT-----QEELQDAVN
A0A518GFD7      RIQSQLTVMRASVGPG--------HP-----SA---RALTVELEAR-----QELLDKRRE
A0A5C5VZJ8      ELQTARDNLAAGLRRW--------DE-----GHYKIQSLKNEVTRV-----EQQVAALET
A0A518GE37      DVKTKIRNIEREERQE--------LF-----AD-RYARLKEDVPRL-----EEDIRNAEV
A0A5C6F3H8      RYRASVLDMEVNDMVR--------VN-----RD-YYKELNKNLASA-----ESELQSERR
A0A5C5X072      RYTSIILDIEVKDMVR--------IS-----RD-YYNDMKKNLEDA-----RDKLQDERD
A0A5C5WUQ3      KYQGMVLEMEISDLVR--------VR-----RD-YYLEIKAKRDSL-----EYSLEAKKS
A0A5C6E697      RYKKISLDMEQNDLVR--------IR-----RE-YYNENLARISEW-----EEVLKKAQE
A0A5C5Z1A3      RYEGMILNMEDTDLVR--------IN-----RS-YYDELKAKKNES-----EKKLQAAMD
A0A5C6D2P7      RYKSIAMNMEDSDLVR--------IQ-----GE-YYRETLDKVKKW-----EQTLEESRQ
A0A5B9ML17      RYEAQIVRMEDLGTWR--------LN-----QT-HFAELKKKRDEW-----EATLKTAKA
A0A517LX75      EVTKGEVDSQQFQIDQ--------PM-----RSAALDAEYEKVLSL-----ILREQALTA
A0A354GX32      ELQRRLIPADRENGP-------------------GVGQLRDRISLI-----QNLVTQKKE
A0A5C1AAF0      QIEARVRETERVATKA--------VA-----EV-AAKKAQDDLTAL-----SKDLKEARA
A0A5C6B3S0      NLNAMIAKINEEIKSG--------SK-----EY-HIERLQAQLNTA-----EESLKSHRA
A0A518GIZ9      MLIRRFIANDGSGAEL--------QQ-----QQQEISAFENRLLPL-----ILEEEKLLR
A0A1C3EBY9      MLIRRFIANDGSGAEL--------QQ-----QQQEISAFENRLLPL-----ILEEEKLLR
D5SX64          MLIRRFIANDGSGAEL--------QQ-----QQQEISAFENRLLPL-----ILEEEKLLR
A0A517Z0U7      STRQKEVQLSTLRDRL--------KE-----GHALITKAEDDLAAL-----EAQLEAYRE
A0A2S8FCC0      QLENEILAIEQTAAPK--------IQ-----NQ-YVSRLRDKISEL-----EEQVSLRKD
A0A1Z8MBT6      RHQAALIAIKADRRFG--------PG-----YV-GIQETEDLLVTA-----QTELDRLMD
A0A517SXN9      RHQAALIAIKADRRFG--------PG-----YV-GIQETEDLLVTA-----QSELDRLMD
A0A518HFL0      GTDPRIWVERRIEQVF--------LS-----DP-DVRSLREGLKDI-----QVQIDEAQG
A0A5Q3LBQ3      TMRVMMLDTERRAADP--------EK-----SS-TYRKLAGDYKET-----QASLEEIRE
A0A3B8ZJM2      EKHPNIRRIRSTIASV--------EK-----KIAHAKEAESRLEQA-----AAELNQKRN
A0A1U7CLW1      ELRRKHASVKRISRQG--------NV-----DP-SILAIQREIKLV-----TGELEGRRQ
A0A142WPR7      NREALALIINANKESR--------EN-----GLPQEKSPVTELFPL-----LLDEQMLLE
A0A3M1TFJ0      TIRRVLEQGRPLDMAP--------PV-----AQSPVVSMLRRNLAE-----AELELA---
A0A517P477      TYVGKLERSKGADSTS--------PT-----LATARAEATRRQAEL-----KELQVSLRP
A0A517T4K9      DSESTHNIPEELILAR--------LA-----QEPQLESQATEVLQL-----ERQLETLKD
A0A2Z3GZZ5      QYRAPVVPNAANGGEL--------TG-----TA-ALRALEFERREL-----TQATGLGKD
A0A4V0I6L6      ERLATMAKLGIANDRP--------FL-----FG-DVKDPESMLAHL-----KYKKGELGT
A0A255QXF5      RHRREVVNLEVAEGWR--------RA-----QA-YYADQQKLRDEW-----KTKLDEARA
A0A518KBI5      ALESQMRQIQQLTKQW--------RE-----NG-SYKSLSDARKHA-----RTELTEFKA
A0A5C5V6Q5      GIADQMRHYQRVSKRY--------EQ-----NA-NYKALAEQYQRF-----KDELAGYKA
A0A517MY49      STAGQEMLLASLGLSS--------RD-----TR-VLAEQDKRLLTA-----EEELRNIEP
A0A2E6AG00      PVVGREVMLAALGLNQ--------HD-----VD-AVAELDQQLVAD-----RTKLANIRV
A0A1G3A880      EAVGREILLTGLGFNT--------RD-----AA-VQANMERSLLEY-----QSEMKSMQQ
A0A2E8ATT1      PVVGDRLISSALGLSP--------LS-----SQ-LVNDMERKLIED-----RSKLAMYRG
A0A518KYQ0      IYRKQVIELEVSERWR--------FD-----KD-RYARLQTERDQW-----EEKHALARK
A0A5B9QX47      RYKKIMLEMEDNGRIR--------VA-----RD-HYEDMQSRRDEW-----TAKLEQATK
M5T666          RYQAILLDLEVKDMVR--------VS-----RD-YYNQMKENLADA-----QSKLDQERQ
M5U6N6          RYSAIVLDLEVKDMVR--------VS-----RD-YYNQMRKNMEEA-----ERKLAQERT
A0A517M0G2      ERESRVRNLEDRGLAP--------LR-----QE-YHKELKEKAAEQ-----QRELDNAVA
A0A5C6AST1      QQEAIVRSIEDRDMVR--------IS-----RD-YYNDLKSKIADT-----QKELDKAKE
A0A5C6C951      QLQGMIRSMEDGDLVR--------IQ-----RD-HYEGLKTQLADT-----EDDLRQARI
A0A5C6C5T3      RYNAVVLDLEIQDMVR--------IS-----KD-YYLDMKQNLEDA-----KDTLKQERD
A0A2A2W6A9      IYRKQVLELEISERWR--------FD-----KE-RYARLQKDRDEW-----EAKLASAKQ
A0A518HQS9      IYRKQVLELEISERWR--------FD-----KE-RYARLQKDRDEW-----EAKLASARE
A0A5M6DFE6      YFKDRVFDMENNDVAR--------MR-----KE-YYREMMDQRDEW-----EEKLLAFRK
A0A5C6F286      RYRAMILDLEVKDMVR--------VS-----RT-YYNELIRSLAEA-----ESKLEGIRQ
A0A517NGN1      YYEGLRLNMEASDLVR--------IN-----RE-HYRGIVADQALW-----EGKVEEALT
M5RUI3          HYKAILLELEDSDIVR--------IR-----RE-YYEEMQGKRDEW-----TANLETLKA
M5S2L2          ------------------------------------------------------------
A0A523CME0      ------------------------------------------------------------
A0A354PCV3      ------------------------------------------------------------
A0A354PHB4      ------------------------------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A538RV31      ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
                                                                            

A0A356AE44      DLPTMTTKVNP-------------------------------------------------
A0A1G2XSU7      QADKNFDEMAE-------------------------------------------------
A0A350KD81      NLESGEFQVAK-------------------------------------------------
A0A2E3Z6T8      GAGDRLEAMGK-------------------------------------------------
A0A257WQ92      RLPEERRQQQA-------------------------------------------------
A0A356ETW1      RAAESISRLQN-------------------------------------------------
A0A3L7NJY1      LQQQRMQDMAR-------------------------------------------------
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      SLITKVETDYN-------------------------------------------------
A0A524HC32      IIFRAIQNEYL-------------------------------------------------
A0A660VT66      SYGPKHSKILS-------------------------------------------------
A0A0S8H0S8      KFAENHLALCA-------------------------------------------------
A0A177PV03      LYYGAKAKEVE-------------------------------------------------
A0A1G2YIM0      ELTKNFNDMLT-------------------------------------------------
A0A1G2ZG92      VALNSVSISID-------------------------------------------------
A0A1G3A0W0      QLNERWHHRPQ--------DVPGTPS--------------------------TIAQWRNQ
A0A353BE27      GERLYKEELEK------------------------------------------------N
A0A5C6BPW1      ELRPVIEQKIR-------------------------------------------------
A0A1I3GSP0      KQTGKGPISSR-------------------------------------------------
A0A517QJV1      QRSSNNPADAR-------------------------------------------------
A0A3C1QS25      LMISRGISLPG-------------------------------------------------
A0A5C6FX55      SRSSRIGQLMD-------------------------------------------------
A0A3L7UX05      SALEKQLAQEG-------------------------------------------------
A0A5C6DS51      AEEPVRDNKLD-------------------------------------------------
A0A5C6DSL6      AETQANENKLD-------------------------------------------------
A0A3M1VG27      DDSLDRLDTGD-------------------------------------------------
A0A518GC22      SE-----------------QQVDSEM-------------------------------DRM
A0A3L7Q373      GTPGQTAAPGT-------------------------------------------------
A0A3E0PW54      -------------------FYRQKGH-------------------------------TPP
A0A1Z8MHR4      LMSNRIAELQA--------KNQNDPE-------------------------------SQR
A0A5C6EHJ0      NETKLNAELDE--------AMKAAAA-------------------------------AES
A0A5C6F1H9      NEKRLNAELDE--------AMKAAAA-------------------------------EAS
A0A255QXY0      MGQQRRKEIAP--------ED--LPT-------------------------------EDG
A0A517SYI0      LMSNRIAELQA--------KNKNDPE-------------------------------SQR
A0A518HX54      QVDRRRKELSE--------QSQQIDE-------------------------------ADG
A0A5B9MF59      QMTSRIAELRA--------QSQTVDY-------------------------------DKE
A0A2A2WC24      QMSERIAELRA--------QSQRVDY-------------------------------DKE
A0A518KYW8      QMSERIAELRA--------QSQRTDY-------------------------------DKE
A0A5C5YZZ0      TRDSVQAETID-------------------------------------------------
A0A518JLD2      TEERSIAELESAWAELDELASNQPTT-------------------------------NP-
A0A5M6DJ15      TRKYKEMNPEG--------EQIAGYA-------------------------------NLT
A0A3L7P7S7      GIVPKGPDGKA--------SSLLGLG-------------------------------E--
A0A517N8M1      EKTSRVMELMS--------ETLA----------------------------------DP-
A0A5C6CW01      DQTKRLMEIKK--------ENEIKTI-------------------------------DP-
A0A5C6BXS9      EQTQRIIQLMD--------ENRVEGI-------------------------------DP-
M5U569          EQAERIVELME--------ANKVEGV-------------------------------DP-
L7CND7          EQSDRIVELME--------QNKVEGV-------------------------------DP-
A0A0J1B8S4      EQSERIVELME--------QNKVEGI-------------------------------DP-
F2ARR3          EQSERLVELME--------QNKVEGV-------------------------------DP-
K5D8H6          EQSERLVELME--------QNKVEGV-------------------------------DP-
M2AKU0          EQSERLVELME--------QNKVEGV-------------------------------DP-
A0A5B1CKI2      DQTDRVMELIG--------ETL---V-------------------------------DP-
A0A5C6EG84      AKTSRVMELMS--------ETL---A-------------------------------DP-
A0A5C6F2X4      EKTTRVMTLMS--------ESL---A-------------------------------DP-
A0A5C5XTV6      EQTQRILQLME--------ESRGQGV-------------------------------DP-
A0A5C6AAB1      EQTERIVELME--------ENKVDGV-------------------------------DP-
M5T8W8          EQAERIVELME--------QNRVEGV-------------------------------DP-
M5SF00          EQSERIVELME--------QNKVEGV-------------------------------DP-
A0A2G1WDS1      EQSERIVELME--------QNKVEGV-------------------------------DP-
Q7UVS9          EQSERIVELME--------QNKVEGV-------------------------------DP-
A0A5C6B601      QKAARQAQLRA--------EIKTTDI-------------------------------NTL
A0A517PFU1      RIEADRAGLQA--------GPDGTEG-------------------------------PSS
A0A5B9M8J9      QVDRRRKELSD--------QGQRIAG-------------------------------GEG
A0A2A2WFP6      QVDRRRKELSE--------QSQQGAD-------------------------------ADG
A0A518L8N2      QVDRRRKELSE--------QSQQIAE-------------------------------ANG
A0A518HQN9      QMSERIAELRA--------QSQRVDY-------------------------------DKA
A0A5M6D8H8      RISQRRAELNA--------QSSRTDL-------------------------------GAE
A0A5B1CRW9      ETNGVKKD----------------------------------------------------
A0A5C6EI46      ETKARETK----------------------------------------------------
A0A2E7D3V4      YYRQQGIPIPG--------ADVVPGA----------------------------------
A0A2S8F9B8      HLVLLIKERLA--------QQLLEGR----------------------------------
A0A368KP63      HLELLVKERIA--------QDLAAQA----------------------------------
A0A2E0SHG0      EI----------------------------------------------------------
A0A518CQB8      DV----------------------------------------------------------
A0A5B9PER9      EI----------------------------------------------------------
A0A517QSM4      QIEKRILAEIA--------ANEDKSI----------------------------------
A0A355GJI7      LYRRQGLDISA--------DNLESGE----------------------------------
A0A1Z8MCI4      QASSEAEAVLR--------DKAGKAA----------------------------------
A0A517SYL7      QASLEAETVLR--------DKAGKAA----------------------------------
A0A3L7P0L2      FYHRQGLTPPN--------LGTSDAS----------------------------------
A0A142XL75      ELGTTLAREVQ--------KKHAQQE----------------------------------
A0A517SCC8      VLGPNHNDVVD--------VRRQIDA--------------------IVKMYAQNGFAPPV
A0A3A0DR44      EVRAQLELRNS--------VVSTADR----------------------------------
A0A358MY60      AAEAQAVKAIS--------DDLRQAA----------------------------------
A0A517MNB1      VARDRAPEVLQ--------KHAMELA----------------------------------
A0A517XRC2      EVLPDVRAALQ--------EYGEEML----------------------------------
A0A142YJ13      TAQRALSAEPE--------RFESSPV----------------------------------
A0A517Z7D3      HLADDHPSVLR--------LKEQIGS------------------ILSFYKRKGLAPPHVD
A0A5C1AGE3      ADNPRIVEVQD--------EIKDIIA----------------------------------
A0A142XAP8      AEKLAATEALE-------------VA----------------------------------
A0A2Z3HEL7      VQNQVTTEAET-------------AL----------------------------------
A0A1N6KY57      KLYPIVTKQLQ--------DMGRDSD----------------------------------
L0DK20          KLYPIVEQQLQ--------EIGRDDD----------------------------------
A0A660UUK3      ERREELVKDFD--------DRYKQEV----------------------------------
A0A517ZHG5      ELRPIIEQKIR--------ESGNAQN----------------------------------
A0A1Z8MPL5      QLRNEILAAVR--------RGERKSD----------------------------------
A0A5C6C1R5      EEKGRKIAQGE--------MGQIDLS-------------------------------LSP
A6BZU4          LYRRQGLDISA--------DNLESGE----------------------------------
A0A2D5GZ77      LYRRQGLDISA--------DNLESGE----------------------------------
A0A3D3R1Z6      LYRRQGLDISA--------DNLESGE----------------------------------
A0A517XG00      LYRRQGLDISA--------DNLESGE----------------------------------
A0A1G2YRE4      EQRQKASEDFN--------NVASEEI----------------------------------
A0A353Z859      ELRPKVIEELK--------ERSQLEE----------------------------------
A0A2D6ST10      ELKPQIAQQIL--------GGMAASG----------------------------------
A0A177QX42      LLREEAGAKGS--------KLDLLSI----------------------------------
A0A517SHR0      LLRQETGDSGP--------KRDLLSI----------------------------------
A0A2E0AW64      ARQPLRESLME--------VARKDRQ----------------------------------
A0A351FZ59      ARQPLRESLME--------VARKDRQ----------------------------------
A0A660V239      QRRKEVAQEFD--------KNFEAEL----------------------------------
A0A177Q3B7      LLRPEVVKRFA--------DRAVRDL----------------------------------
A0A2E0X6Y6      YYGPNHPRISE--------LKRQEQT----------------------------LIAYLR
A0A518GFD7      YAREAALESLA--------KTNAESM----------------------------------
A0A5C5VZJ8      DLRDRLTNGRG--------DPDTGDF----------------------------------
A0A518GE37      AARPQVISTLQ--------GLVAERE----------------------------------
A0A5C6F3H8      EARDRTIEKLE--------RFAEDEY---------ERQKVAAK-------RTSEWQQEQF
A0A5C5X072      LARTRVEEELQ--------RVVDEDY---------RQRKAVAE-------RTLAWQEEQQ
A0A5C5WUQ3      KAEKLAIAVLT--------KRAEEDY---------QRQMAEAE-------AKLTAMKQLH
A0A5C6E697      VAREAATAKLE--------QLAADEL---------KFAQSEQI-------RQ----KEIG
A0A5C5Z1A3      AARQQALVEVQ--------KLADEDF---------KLQEEEAK-------TK----IELA
A0A5C6D2P7      AARVVALEKLN--------ELAKDQL---------ERSRIEAK-------LQ----QQLG
A0A5B9ML17      AAETKAATELE--------ALADADY---------EHQQKQWE-------EKVAALRAAH
A0A517LX75      DFGDDHPLVQR--------VRDEVAS--------------------------VKRFIREK
A0A354GX32      VQRPGMERQLR--------AKALDDL----------------------------------
A0A5C1AAF0      KARVDYTTGVA--------QLSELES----------------------------------
A0A5C6B3S0      ELRSELLEHWN--------ARPESVS----------------------------------
A0A518GIZ9      DFGPDHPEVKA--------VRKSIDTTLDFYRKHGLRMPDDMT-----------------
A0A1C3EBY9      DFGPDHPEVKA--------VRKSIDTTLDFYRKHGLRMPDDMT-----------------
D5SX64          DFGPDHPEVKA--------VRKSIDTTLDFYRKHGLRMPDDMT-----------------
A0A517Z0U7      TQLPQIRQQLQ--------SRIADVP----------------------------------
A0A2S8FCC0      QLTKDKEQWSV--------ATHRAEL----------------------------------
A0A1Z8MBT6      SVKDEVRQELE--------QQFEAQY---------QQDLEDEG-------KELERLEDAW
A0A517SXN9      SVKDEVRQELE--------QQFEAQY---------QQDLEDEG-------KELERLEDAW
A0A518HFL0      RIRNPADPAVS--------RLKVQQQ-------------------------RLLERYNQL
A0A5Q3LBQ3      ELRARVVSEME--------SHERSVR----------------------------------
A0A3B8ZJM2      RSKNKMLNSEV--------ASNDQPIDPPSDTTPGDASATAVTDSPNEVEKAIASTDSDS
A0A1U7CLW1      ELRAAAAEFNR--------A----------------------------------------
A0A142WPR7      TLGPDHPKVTA--------VQKRIEI---------TRKYLTES-------------LAEE
A0A3M1TFJ0      GLEQRYGENWP--------QVRAARA---------RRDQLKLL-----------------
A0A517P477      HVKEQLKNSWE--------AQGEAGD---------QKLSETI------------------
A0A517T4K9      RVKEDHPELAR--------VAAKLEA---------GQKEYEKL----------------E
A0A2Z3GZZ5      HPRVLAVDARI--------AVLKEEL---------ARPPAAGG-----------------
A0A4V0I6L6      RLGPGHPEMAA--------LNSQIKV---------LEEEVAAR-----------------
A0A255QXF5      EASARAISVLN--------ADLEADY---------QQRLRERD-------DEIERQRKEF
A0A518KBI5      ALREQLLAARE--------S----------------------------------------
A0A5C5V6Q5      NLRRKLLLSTR--------S----------------------------------------
A0A517MY49      FYGPNHPRVRE--------LQTQIIN---------INQFLANY-----------------
A0A2E6AG00      HYGDRHPKVQD--------XLKSIRD---------TQNYLENY-----------------
A0A1G3A880      FLGPAHPRLTE--------VAERVRA---------TEQYLTAY-----------------
A0A2E8ATT1      HYGPNHPQVRQ--------LQHSLQL---------AQAHREEY-----------------
A0A518KYQ0      AASERAIDIME--------AELD---------------------------EELERARAEY
A0A5B9QX47      DAQEQALAYLN--------QKADEDF---------EARKAAAI-----------------
M5T666          VARDRALKELQ--------RLVEEDF---------RQRKEVAERAFAWQQEQLKKQQQEM
M5U6N6          LARDRATKELQ--------RIVEEEY---------ERQKEVVARTFAWQKEQLAKQQEEL
A0A517M0G2      AARQRAPEAIT--------ERLRRTA---------ERTYKESL-------AER-------
A0A5C6AST1      VARAKAADEIK--------SLATEVA---------QRERAAQI-------AQMQFST---
A0A5C6C951      DVRSTAVAEIK--------SDALELA---------ERNRKAQL-------AQLEFKR---
A0A5C6C5T3      SARTRVTKELE--------RIVDEDY---------RQRKAVAE-------RTLEWQQEQQ
A0A2A2W6A9      AASEAAVQILE--------DEIEEDY---------QQQLALAE-------KEKERLRAEF
A0A518HQS9      TASKTAVRILE--------DEIEEDY---------QRQLELAE-------LEKERLRAEF
A0A5M6DFE6      EARTRAEKAMK--------ERIEFDY---------QRRLKDAE-------GDIERQKIAF
A0A5C6F286      EARPRAIAKLD--------QIAEEQY---------QRDLANAE-------REMEFQREQL
A0A517NGN1      AARERVQAELE--------DRAETIY---------KQELAAVD-------AEVQLQRDQF
M5RUI3          GARERVVAMLN--------ERADAEY---------ERQKIAAK-------ARIESLKEGF
M5S2L2          ------------------------------------------------------------
A0A523CME0      ------------------------------------------------------------
A0A354PCV3      ------------------------------------------------------------
A0A354PHB4      ------------------------------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A538RV31      ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
                                                                            

A0A356AE44      -----VTGEPELVTGNDPIATYVVALEQQQA-------ELKNRIGELQKLFDRSADQAKD
A0A1G2XSU7      ------------KEFKESDMLEIQEYKYKLE-------QISLHQQQLRDMLVHEDSKTIE
A0A350KD81      ------------TKDVDFVNVYLKSMEQQLK-------ELENRELELTKIFDQETELAKK
A0A2E3Z6T8      ---------------SIPKEVVVNLLRQSTQ-------QAIEKEKQIRQAYQQARAEAAA
A0A257WQ92      --------DGSAPGEVDFVALYAESVRQELA-------ELDVRDQHLAQLVEDESVKARG
A0A356ETW1      --------EQLGPLLVEM-------VRQQLR-------EAVEQEQSLRVQFQAAQADASR
A0A3L7NJY1      --------NELGPRLLQY-------INQQLQ-------KNEENELAIFARLESEQVKAQN
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      --------------------------------------VLLASEESYEKAYNEQSLVVFD
A0A524HC32      --------------------------------------TAQRIVAAMKERIEQQKKLVLG
A0A660VT66      ---LEASLAKQKQILNDTAEQLAESYISETE-------DRKVLLDEMEQELRDSEARAQR
A0A0S8H0S8      ---------------------------QRLS-------AAQQKQGEIRAALVDQQKQAEQ
A0A177PV03      ---------MPKPGPDDPARWHLQSLKRELV-------AAQANLDEIEKQCNAAEYKARA
A0A1G2YIM0      ------------KEIARNRVYKLKESRAELE-------RINAYEEKLMAMLSKHNVQTIE
A0A1G2ZG92      -------------PIYDELSKNLIDAHIDKN-------IAIAKKGLLQKYINAYQEELLN
A0A1G3A0W0      TINVLGAPVTIANSGMPDLDEDSAGVERQLA-------QTKHEEQLLAAEIDKQQVEFDT
A0A353BE27      GDALARKTGAEIRSIEERLEERLLALEEQSE-------VFRLEEEELANQAERERRSSRE
A0A5C6BPW1      -------------ESGNAPNPGDLPAEEQIA-------RLDVILEQLKEELDNRKIQKTQ
A0A1I3GSP0      ----------SAALGLDLVSVYRDTLQGQLK-------ELELDNQNLALLHTDAQKKAKQ
A0A517QJV1      ----------NHE-GMDLISVYEETLKSQLE-------ELKSIAKNLDIMREDAEKKAKD
A0A3C1QS25      ----------TGDNRADFVALYKISLTEQVR-------SIDYELVAFRAQFEEHRARAME
A0A5C6FX55      ------DEERKTKQALQAISAVQATAKTKVD-------MLKQRLDLLTKEIESEAAKGRL
A0A3L7UX05      -----------AGQSTSTLDRELRDAENQYQ-------DLIVREQAIRKNMQESKLTLEN
A0A5C6DS51      --------------PKGMLSTYTRLLTNDVS-------EYEIREKVLVETCEEELRLAKE
A0A5C6DSL6      --------------PKGMLSTYTRLLTNDVA-------EYEIREKVLVETSDQELIEAKK
A0A3M1VG27      ---------------SSLVDVYLAGLREQDA-------ELTHRRQQLEKLYEEKLRVAKQ
A0A518GC22      KLEMQTRTGARIRSMEERLTAGTDMLAEQIA-------ALQLEEEHLQRDAAEEKKKSRE
A0A3L7Q373      -----------VAINEGLSQQYLKVLESRVE-------ELQADQIALKSAYDDAEKTARM
A0A3E0PW54      RSHGPGADTTDDAGPIDLVAAYIRIQQQELM-------HRQDLEQRLTADLASAESEAKA
A0A1Z8MHR4      PRD------ASKNAASVMVDAYVNGITERIN-------ILDEDMQSIDVQIERERQLADE
A0A5C6EHJ0      SLL-PSGEYDPRDRILEKVRFAVGALRQEMD-------AMDSELQVVTDAYEDEMTQART
A0A5C6F1H9      SFQNPDEDLEPRNRAMEQVRFAVGALRQEMD-------ALDSELTVVSDAYEAEMTQARA
A0A255QXY0      SSP------TNKSNASELVDAFICGLQERLK-------VTQKEIDDLDLQIEAEKRAADE
A0A517SYI0      PRD------ASKNAASVMVDAYVNGITERIN-------ILDEDMQSIDVQIERERQLADE
A0A518HX54      STQ------AQVARAGEAVDAYIRGLSERLR-------VANEDLSEVDRKIDTEKLAADE
A0A5B9MF59      ARK------ARDERARTAVDAYIRGIEAQLT-------VLAQDMADIDLQIEQQKDEADK
A0A2A2WC24      ARE------ARDERARMAVDAYIRGLEAQLT-------VLAQDMSDIDLQIEQQKDEADK
A0A518KYW8      ARE------ARDERARMAVDAYIRGLEAQLT-------VLAQDMSDIDLQIEQQKDEADK
A0A5C5YZZ0      VAA------QRNEAAKTLLIMYVSSIRKKIQ-------LIDEDIADTNSRLTEVRDRALK
A0A518JLD2      -----------EDELRRQVRLVFDSMTQKLQ-------SVEQEIGEIQTAYHTAVEAAKA
A0A5M6DJ15      GEQ------RAKALQIQELDQQIKTQKRAIESRKIAAGVLKQQSERINDDLVKMDEEVKE
A0A3L7P7S7      -----------DEIFSNKAQGLLKHYSERIE-------EHETELAKVKDESQSLQEELDK
A0A517N8M1      -----------RERAVEAVNAVVLASKAQID-------LLKAQIKELDGQITVERQDAAK
A0A5C6CW01      -----------KEKAKEAISAVLIAAKAELD-------LLKNQILELDKQIVDERAAAIE
A0A5C6BXS9      -----------GVRAQESVDVILIAAKAEVD-------LLKEQIAEIDAQVTTEKSEAIK
M5U569          -----------AARAREAVDVILYASEAEVE-------LLRQQIKELDSQIATEKSEAVK
L7CND7          -----------AKRAEEAVNVILTASRAEVQ-------LLQQQISEIDSQIASERIEATK
A0A0J1B8S4      -----------AKRAEEAVNVVLIASRAEVN-------LLEQQIGEIDLQIASERKEAIK
F2ARR3          -----------AKRAMEAVSVILTASNAEVQ-------LLRQQISEIDAQVNAEKSEAVK
K5D8H6          -----------AKRAMEAVSVILTASNAEVQ-------LLRQQISEIDAQVNAEKSEAVK
M2AKU0          -----------AKRAMEAVSVILTASNAEVQ-------LLRQQISEIDAQVNAEKSEAVK
A0A5B1CKI2      -----------VQRAKEALAAIVMASEAQVD-------LLTEQRKELDDQISEERLGASK
A0A5C6EG84      -----------RERAVEAVSAVVLASKAQVE-------LLNSQVRELDEQIAVERQSAAK
A0A5C6F2X4      -----------RERAIEAVNAVVLASKAQVA-------LLTSQVKELDSQIEDERTEAAK
A0A5C5XTV6      -----------SVRAKESVDVILIASRAEVA-------LLNEQISEIEAQIETEKKKAIE
A0A5C6AAB1      -----------AKRAAEAVSVILTASNAEVN-------LLKQQITDLEEQIAVEKGEAIK
M5T8W8          -----------AARAQEAVDVILFASNAEVE-------LLQQQIAELDQQIANEKSEAVQ
M5SF00          -----------RKRAEEAVNVILTASRAEVQ-------LLKQQISEIDSQIASERIEAMK
A0A2G1WDS1      -----------RKRAEEAVNVILTASRAEVQ-------LLKQQISEIDSQIADERIEAMK
Q7UVS9          -----------RKRAEEAVNVILTASRAEVQ-------LLKQQISEIDSQIAGERIEAMK
A0A5C6B601      RLK------ERQERASSFVAAYMGGLAQRLT-------VLQEDMRELDQKIATEEALADQ
A0A517PFU1      F-----------------LDLYVAARVERAR-------VLQSQIDKLDERYAETREAAED
A0A5B9M8J9      FQK------AQLARAGEAVDAYIRGLSERLR-------VANEDLGVIDQKISVEKQAADE
A0A2A2WFP6      STQ------AQVVRAGEAVDAYIRGLSERLR-------VANEDLAEVDRKIEAEKLAADE
A0A518L8N2      STQ------AQVVRAGEAVDAYIRGLSERLR-------VANEDLAEVDRKIDAEKLAADE
A0A518HQN9      ARE------ARDERARMAVDAYIRGLEAQLT-------VLAQDMSDIDLQIEKQKDEADK
A0A5M6D8H8      AQK------ARTEHAREIVEAHIRGLQERLL-------VMQDDLSQLDDQIAVEKRAADE
A0A5B1CRW9      -----------DLDPTEMVNTYVMLLKNDIA-------EYEKRKSLLLAESQKEMLLAKQ
A0A5C6EI46      -----------TMDAEEMLKTYVMLLRNDIS-------ELQKRKTILMEEAEREMLAAKE
A0A2E7D3V4      ------DKKTPKSADANLVTTYMASLRQQWK-------ALANKNVRLDSLYDDEAKKAKE
A0A2S8F9B8      --SRQGSIANNGLVVPAEVDNSLPELRVHLG-------VLRQQEKTLAKEVAELENEVRT
A0A368KP63      --KGEIARKGSSILAVPEVDNTLPDLRVRVG-------VLKQQEETLAAEVAVLEKEVRT
A0A2E0SHG0      --PDPSATNPEPIEPIQLVSAYVTQLEKDLE-------DIKQREEMLKQYRDAAESQAKL
A0A518CQB8      --PPPSTEALTPIDTSDLIRAYVSLLEKDLE-------DLLRQETTLVTFRDMAEAKAKE
A0A5B9PER9      ------------------------IFERKTA-------EIDQSIKDVSRMLAEQDEQWQM
A0A517QSM4      -----------------------VELQSRVK-------ILEAEKNHLEQELSALKIKEAG
A0A355GJI7      -------FQVAETKDVDFVNVYLKSMEQQLK-------ELENRELELTKLFTQESELAKK
A0A1Z8MCI4      --------------------------KQQIA-------DLELRIKTLNDGINAEKARLAG
A0A517SYL7      --------------------------KQQIA-------DLELRIKTLNDGINAEKARLAG
A0A3L7P0L2      ------TRNAQGAAGADLAQTYLTILKSRLE-------ELEDEQVRLVEDYKEAEKTAKE
A0A142XL75      -------------------ILRRAETRKQIR-------ILEKRFALAKEKHDNILRKISQ
A0A517SCC8      METLNDEQKPAAVASADLASTYVDVLQDQLE-------ELDSNSRLLEQEQKSSMERAKS
A0A3A0DR44      -------------------GQEAVQWRQRLT-------ALDAEHALLKRRYDEYMKSLSE
A0A358MY60      ----ERARTIASKKAVIKTKQDAVNAKEELA-------KLKARRALLEVEYDNERARLQQ
A0A517MNB1      ----QRERESQLANLEVSTKASLASQEVQLA-------ELKSKRSILQQEYDLEKGRLEQ
A0A517XRC2      -------------------KAKHAELQEQLT-------LDRARLERKERTLTELTKNAGN
A0A142YJ13      ------------------QDTRSREVEEYLD-------ILREQEKSLVQEIAGLESQMSS
A0A517Z7D3      DSLKAAPPAGQTEEGVDLVTSFMQLQKQKLV-------ELDHRDKLLAKSLEEAEIEAKR
A0A5C1AGE3      --------RRAALTSQRRSDVETKLRAERRD-------EIEKGQRLIQIERTTAQSNLTK
A0A142XAP8      --------RAIDTANKKKRAEELAYTIEVKK-------GVREKHRL---ERDGLQRVIAT
A0A2Z3HEL7      --------RFSDLAERQKKVSDLADQIAIKE-------KVRNGLRT---ERDTAKKTIES
A0A1N6KY57      -------------------ESKEILVQHRCV-------ILEKIEAALQDDVKRLTERSRS
L0DK20          -------------------DSNKALIPHRIS-------ILSKLEAVLASDVKRLSERSLS
A0A660UUK3      ---------------EARRNYAKVQVKAQLA-------QTIEHEKKIREELDRYDTATIG
A0A517ZHG5      --------------------PDDLPAEERIA-------RMDVILEQLKEELDNRKIQKTQ
A0A1Z8MPL5      ------------------AQYNHERLEAESI-------EANNYLASLQAEYSKLALQVQE
A0A5C6C1R5      EDQKLAQRHARLLADAEEHDKRIVARGIQVG-------ILQQQKERIEHDLVELDSEAKK
A6BZU4          -------FQVAKTKDVDFVNVYLKSMEQQLK-------ELENRELELTKIFDQETELAKK
A0A2D5GZ77      -------FQVAKTKDVDFVNVYLKSMEQQLK-------ELENRELELTKIFDQETELAKK
A0A3D3R1Z6      -------FQVAKTKDVDFVNVYLKSMEQQLK-------ELENRELELTKIFDQETELAKK
A0A517XG00      -------FQVAKTKDVDFVNVYLKSMEQQLK-------ELENRELELTKIFDQETELAKK
A0A1G2YRE4      ---------------AKVNKEKTLNLKTELE-------QTKVHEKHLREVLAQEDTQVIE
A0A353Z859      -------------------VLSTQALQRRLQ-------LLEITIDGLDKQLVYEDESRNN
A0A2D6ST10      -------------------EMSNLERKKLIG-------DLLAWQAELEKKIDEHKTTLTK
A0A177QX42      ---------------------HLESLDERIN-------AYENEVAQLNSAFDNIKGDALK
A0A517SHR0      ---------------------HLESLDERIT-------SLQNEVAELNTGFEDVKAKALS
A0A2E0AW64      -----GAWKTYQQEVISRQKEEVARLQEQTE-------QMAIEERVVTEKYQAEIEEIQN
A0A351FZ59      -----GAWKTYQQEVISRQKEEVARLQEQTE-------QMAIEERVVTEKYQAEIEEIQN
A0A660V239      ---------------AKNRDRRLAELKIQLA-------QTIEYEERIRAKLAQQDKDTIG
A0A177Q3B7      -------------------QAEFASLEERAS-------LLQDLETSLVETVERLRKQTQA
A0A2E0X6Y6      DYRSNLGNRFAGGDSGEAGEATLKMLRQALA-------EAQRREQRLTETFASARQAAAE
A0A518GFD7      LPLGQQQSATNRTPLGALTQQDLISRASHIE-------VLKQQEALLQEKVDVLSDETRK
A0A5C5VZJ8      ------------------ALTDPRVIELRLS-------RLRDEEAVLAGLLDEEEARYEN
A0A518GE37      ---------------ALKRAEQIEEFQLQLD-------ELDIRQAALQKEYEVEKSRLEK
A0A5C6F3H8      AAQAKELAQQSSKIQSEVSAAEKASRERQRF-------AIVSRLEILQAQYNEESERLEK
A0A5C5X072      KKQQDLSKQERKRAQERSQKAFAKEREKSRK-------AMVAKLDVLQTQYNEERERLEQ
A0A5C5WUQ3      EVELDAARSHDSLKRNHQDNMNTALKKRDRA-------ALVAKLGILQKQYDEERDRMEQ
A0A5C6E697      VRL------------------KKVSEKKNRQ-------QLQSRLSVLQNQYEAERMRLEQ
A0A5C5Z1A3      RREFEQGLKLASLDHQSEGRIAMEAEKQQRD-------GLETRLQMIEKQYDAERTRLEQ
A0A5C6D2P7      AQD------------------RVASKQQTRQ-------QLQMKLDVLNKQYEEERIRMEQ
A0A5B9ML17      EEKQRLDRQNRALVDAQLRTETTRQYRRMIT-------EKKEKIKIIQRQLDQESEKFTT
A0A517LX75      APGDLEALESKEMKPAQILEAYSSLLANDIN-------ELTKRQQHLVEEAKTERVLAKE
A0A354GX32      ------------VNEAAKTKGHIEGDKNQLL-------TLGKKISELESQVANLRAGGQT
A0A5C1AAF0      -------------------KTRVTQLSEQIA-------FQEELGKVLVTEIDRLGKSIKS
A0A5C6B3S0      -------------------NDGSDELRAKIA-------ILAAQEKQLQQEVNELENEAKQ
A0A518GIZ9      ---PGPDGKPLIKERANLVQNYMETLRQQLK-------ELDIREQQLNVLFELESNKAKE
A0A1C3EBY9      ---PGPDGKPLIKERANLVQNYMETLRQQLK-------ELDIREQQLNVLFELESNKAKE
D5SX64          ---PGPDGKPLIKERANLVQNYMETLRQQLK-------ELDIREQQLNVLFELESNKAKE
A0A517Z0U7      --------------------DSAGQIRQRID-------LLRKMEDGYTEEINALKVEERH
A0A2S8FCC0      -----------------------NKARSEVA-------ILEQMEKQLDESVQLFEKEAKQ
A0A1Z8MBT6      AKNRDLQIKNASKSSAGQRELVVKRLQFDLG-------RRKRQLEMVKNEYQIEGDKRSK
A0A517SXN9      AKNRDLQIKNASKSSAGQRELVVKRLQFDLG-------RRKRQLEMVNNEYQIEGDKRSK
A0A518HFL0      WADLEPALRAQLAAEETNPTQLVRKAEAQLL-------ALQQKRELMKQRLDRIEPSTRS
A0A5Q3LBQ3      -------------------DDQLLSLQSELD-------STRLMEELLSRRYEEELGKVKK
A0A3B8ZJM2      SVSPEDEAPDVEEQVNLYLQISLNSLTQRYK-------SLKLEEEEIQRWIDEDTAKSQI
A0A1U7CLW1      -------------EPAAIPDARLEEVKEYLE-------ILHEQEKSLIDEIASLESQMSS
A0A142WPR7      RKNAGENPMLKGGKRPDLVSLYLESLQHEVD-------VIQTKQKEMNLLFDQEKEAAKS
A0A3M1TFJ0      ----------------------------LRQ-------EIDTILGQLESQRQQRLSEEEG
A0A517P477      ------------------------------A-------QLESFRNNLRQQLEENQIEERQ
A0A517T4K9      QQLRPAIIEDLILQRERQSEATLTGVQSQIE-------LLQAEYDYLTKELENQKADEKR
A0A2Z3GZZ5      -------------PVLDELGAHILWVEQKRR-------TAGRQLVQLEAQLSKDEETMKR
A0A4V0I6L6      -----------GGPAEDELERYRRKLETELG-------AISAQLDILARRIDADEETARN
A0A255QXF5      ADLADIKQAELARRADYMSEHEAENLKQGRE-------RLERQLAVLQKQYDAEADRLRK
A0A518KBI5      -------------DRQVGGQSVADHKREELA-------SLEIQERTLRRRFEKELANVQE
A0A5C5V6Q5      -------------ERPFGGSTVVDEKRKELA-------ALQIQQRSLKTRFQAELKSVQD
A0A517MY49      --GSNAGKILNAERRDELGSIVINKLQQDVS-------QAMQQERQLTSSFEEARDVASK
A0A2E6AG00      --QQSVADRAERTQAEQLQSFLXGMVKQEVD-------QASAHESQLKIEYVEARDSAVQ
A0A1G3A880      --QTRVSERLTQLKDTRLGPMLIQMLSQALA-------NASQREMALRDSFETARAEAVR
A0A2E8ATT1      --HAKVQKHMEKVQERELGPLLISMLEEKLF-------EAWTFEKGLLKEYQALEESALT
A0A518KYQ0      VASSIAKQKQHARRAELMSDQEKAEIAERRE-------QLVKRLDVLESQYKAESDILRQ
A0A5B9QX47      ------------VERERKRAAQIAADEQERK-------SLVAKLEIAQSLYDEERERMSQ
M5T666          KRLQDKSAEERKVAQKAYAAAQAKERDNQRK-------VLVAKLDILKAQHDEERERMEQ
M5U6N6          KKQQANSAEEQKAAQQAYIAAQERERERQRK-------ALLAKLNILQAQHDEERERLEQ
A0A517M0G2      ---------------KAASFAQRESINQQLV-------DLKARRAIIQQEYDIEKSRLEQ
A0A5C6AST1      ---------------KANMESNRKSEQEQLA-------ALKAKRAIIQQEYDEEKARLEQ
A0A5C6C951      ---------------KAELKLGQQSDQQRLA-------ELKAKRAITQQEYDNEKARLEK
A0A5C6C5T3      KRQLALTEQERKLEETKNREAQLKERERSRK-------EMVAELNVVQSEYDEERERLEQ
A0A2A2W6A9      PAKVKAKQEELERRAEIMSDQEKQQIADRRE-------QMVKRLAVLQEQYEAEADLLRQ
A0A518HQS9      AANADAKKAELERRSELMSEQEKLLIGDRRD-------QLVKRLQVLQDQYKTESDRLRQ
A0A5M6DFE6      QNEYRRSLADRDRQNQAELERQKWQDQEKRR-------QLVARLASVREQYEQERERMKK
A0A5C6F286      LARLKQEGRESEQMKEARAAAVRMEHDAQRK-------VIASRLDILQSQYSEERQRLEK
A0A517NGN1      LADQQLAKRKAVAMRQAAMKIDQETAQLARK-------ELEARLAVLNTHYDRERVRLEQ
M5RUI3          EAQRKSKIEAARVEWQRELQKRYADEKKEYE-------ALATQLDVLQKQYDDERSRLEQ
M5S2L2          ------------------------------------------------------------
A0A523CME0      --------------------------------------KSKTELKKRKDRESASFTEKEK
A0A354PCV3      --------------------------------------QLETKLTVLRKQYEEEVARLEQ
A0A354PHB4      --------------------------------------QLETKLTVLRKQYEEEVARLEQ
A0A356ESF4      ------------------------------------------------------------
A0A538RV31      --------------------------------------MLEEMEKKLREELDKMASDVKS
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
                                                                            

A0A356AE44      FAQY--------------EEREQTLSDELKRIKSLHDIVANRVE-------------VLS
A0A1G2XSU7      LGRK--------------QLAMQDVKEQLDNSKDMYSTIQKRIG-------------ELE
A0A350KD81      VGDF--------------QVVDQSYNEEIAQLKSQRDNIFKQLL-------------VEK
A0A2E3Z6T8      YSGS--------------LVQFRALERAVARDEAKSDILTDKIA-------------NID
A0A257WQ92      VAKF--------------QAKDEAMHAELARLRDLWGQLVTQVN-------------QVS
A0A356ETW1      RTGQ--------------IARLTMLQREVKRLYDLSDALVSQIA-------------SLD
A0A3L7NJY1      LTQI--------------LTRLADVDREIERLYTQQSDYQNHAD-------------GIS
A0A2D6SRY7      ---------------------------------------------------------EAR
A0A1G3C300      LNRK--------------ITVYRRLQREADSERAFYDILLKRMK-------------ESN
A0A524HC32      LNER--------------ATQYSIIAREVDTNKAIYQSLLERAK-------------EIE
A0A660VT66      MLTL--------------LQSYTKLERDLKSSQSLYDIVLQKMK-------------ESD
A0A0S8H0S8      MDAR--------------LARCALLEAAFKRSLRMNELLDSRIS-------------EVA
A0A177PV03      REEW--------------IKQEARFKESALSARQSYEEVGKRLN-------------ELQ
A0A1G2YIM0      LGRK--------------QLAMQDQKDQFALTEEMYNTIRRRIQ-------------ELE
A0A1G2ZG92      IPLK--------------DSENSKLELTLTINKDMYQNLLEYLM-------------TVS
A0A1G3A0W0      LFAT--------------AQSLEKANNDLNHKRDLFEAVRQRMD-------------QKT
A0A353BE27      LQGM--------------LDGYRILQTDRDAVSELLTAYTEKLQ-------------EID
A0A5C6BPW1      IVTD--------------SFELQQLQKEAAKLEARTDEIDNKID-------------ELK
A0A1I3GSP0      AEMF--------------EVEDQRRKDEIAQKKQQLERMFDQIA-------------EYD
A0A517QJV1      AELY--------------QVEDQRLKDDLSIKKAQLSQVFNQIA-------------TYD
A0A3C1QS25      LNQV--------------DLSLKNLLDQKKYQESVITSVVDRLQ-------------QVD
A0A5C6FX55      LADK--------------EVDYIALQNKIEGTRELVTQVSESMA-------------RVD
A0A3L7UX05      DESK--------------ELQLAFRRTDLARAESTLDSVQRALE-------------QLQ
A0A5C6DS51      VENA--------------FLEGSAKKAKLVRAQARYDEVIRRLQ-------------ELN
A0A5C6DSL6      VENA--------------FLEGSAKKAILVRAQARYDEVIRRLQ-------------ELN
A0A3M1VG27      FAHI--------------LEQDQAYRDQIQSIKSTLDVVISRMQ-------------EIE
A0A518GC22      LQIM--------------LGEDRVIKAELEAVNTLLAGYTEKLQ-------------EIS
A0A3L7Q373      ASTY--------------EVTDQQYKDDIARMKKDLDLALKQLS-------------DLD
A0A3E0PW54      AGLF--------------EVEDQKRKDEIARHKKQWQDVIVELE-------------SFG
A0A1Z8MHR4      LKKA--------------EENDASFNRRLETIHALRFQLEQQLA-------------ALN
A0A5C6EHJ0      ESDS--------------EIRSAQFVREIERQQQLYDRIVARLD-------------EVN
A0A5C6F1H9      ESDS--------------EIRSAQFVREIDRQQQLYDRIVARLD-------------EVN
A0A255QXY0      LKHF--------------EEDESSYKRRIASVQGMLIQLEEQLA-------------GLK
A0A517SYI0      LKKA--------------EENDASFNRRLETIHALRFQLEQQLA-------------ALN
A0A518HX54      LKKY--------------EDTDASFRRRIASLQGMLIQLEQQLA-------------ALE
A0A5B9MF59      LKIV--------------EERDASFNRRIETMRGLETQLEQQLA-------------ALN
A0A2A2WC24      LKIV--------------EERDASFNRRIETMRGLETQLEQQLA-------------ALN
A0A518KYW8      LKIV--------------EERDASFNRRIETMRGLETQLEQQLA-------------ALN
A0A5C5YZZ0      LIAF--------------ENKNSSFLRSIARYQETLQSFDSQLE-------------KAN
A0A518JLD2      ESIA--------------ESRSEQYVREIERQQQLYDRIVARLD-------------EVN
A0A5M6DJ15      LGKS--------------SMEIEMKRSEIASLSDVLTRLAAEIE-------------RTS
A0A3L7P7S7      HKAL--------------ENRKLEMSRRLEQLTRDSETIEFNKQ-------------QYA
A0A517N8M1      LAQF--------------EQENQAQLREIERTRDLLNQLEEQMA-------------RVT
A0A5C6CW01      LAKY--------------EQDNVAMLRELERNRDLMDQLEEQMA-------------RVS
A0A5C6BXS9      LAKY--------------EQENMALLREIERNRELSNQLEEQMA-------------RIE
M5U569          LARY--------------EQENNAILREIERNRELINQLEEQMA-------------RVE
L7CND7          LAQD--------------EQENASMLRQIDRNRELINQLDEQMA-------------RVE
A0A0J1B8S4      LAQF--------------EQENTALLREIDRNRELINHLEEQMA-------------RVE
F2ARR3          LAKF--------------EQDNTALLREIDRNRELINQLEEQMA-------------RVE
K5D8H6          LAKF--------------EQDNTALLREIDRNRELINQLEEQMA-------------RVE
M2AKU0          LAKF--------------EQDNTALLREIDRNRELINQLEEQMA-------------RVE
A0A5B1CKI2      LAQY--------------EQENQAQLREIERTRELLEQLEEQMA-------------KVS
A0A5C6EG84      LAQF--------------EQENHAQLREIERTRELLDQLEEQMA-------------RVN
A0A5C6F2X4      LAQF--------------EQENQAQLREIERTRELLNQLEEQMA-------------RVN
A0A5C5XTV6      IAKF--------------EQENMAILREMERNQALINQLDEQMA-------------RIE
A0A5C6AAB1      LAKF--------------EQENSAILREIERNRELINQLEEQMA-------------RVE
M5T8W8          LAKY--------------EQENNAILREIDRNRELIDQLEEQMA-------------RVE
M5SF00          LAQD--------------EQENASMLRQIDRNRELINQLDEQMA-------------RVE
A0A2G1WDS1      LAQD--------------EQENASMLRQIDRNRELINQLDEQMA-------------RVE
Q7UVS9          LAQD--------------EQENASMLRQIDRNRELINQLDEQMA-------------RVE
A0A5C6B601      LHKA--------------ENTDKAFNRKMDFLKGMLDELDQRIE-------------ELD
A0A517PFU1      VRDA--------------ESRERELRDRRNRHADLYAALVADVD-------------QLD
A0A5B9M8J9      LKKF--------------EDTDASFRRRIASIQGMLIQLEQQLA-------------ALE
A0A2A2WFP6      LKKF--------------EDTDASFRRRIASLQGMLIQLEQQLA-------------ALE
A0A518L8N2      LKKF--------------EDTDASFRRRIASLQGMLIQLEQQLA-------------ALE
A0A518HQN9      LKIV--------------EERDASFNRQIETMRGLETQLEQQLA-------------ALN
A0A5M6D8H8      LKEQ--------------EQNDASYRRRIESIRGMTIQLEQQMS-------------ALK
A0A5B1CRW9      IEAD--------------FMKATSLRAKMQRAQQRYDEVVERLQ-------------ELK
A0A5C6EI46      VEAS--------------FMESNSLKAKLARAQSRYDQVIVRLQ-------------ELN
A0A2E7D3V4      FSKF--------------EAEDQKFVEEIARIKSLQAVIVKRLA-------------EMG
A0A2S8F9B8      FGRS--------------SVEVEMMRSEIESLDEIVQQLNAEIE-------------RTK
A0A368KP63      YGRS--------------SVEVEMMRSEIEGLDSIVQQLSAEIE-------------RTK
A0A2E0SHG0      VANF--------------KLNQELLSDE----RELKKELRSVSI-------------QRL
A0A518CQB8      VATF--------------KLNEELLRDE----KELKKELFTNSN-------------RRL
A0A5B9PER9      HNNE--------------AIKLSKIEQEITRLDEQLKEIGASQRLGAELLLQISPDGDIS
A0A517QSM4      EGTA--------------AFNLEELKREITHMETTESRFRTEIE-------------ALL
A0A355GJI7      VGNF--------------QVIDQSYNEEIAQLKSQRDNIFKQLL-------------VER
A0A1Z8MCI4      EQSK--------------WNAIQFELDNVEVSKDVLISLRRREA-------------ALK
A0A517SYL7      EQSK--------------WNAIQFELDNVEVSKDVLISLRRREA-------------ALK
A0A3L7P0L2      ASSY--------------EVIDQRYKDDIARKKKELDAILTQIT-------------HFD
A0A142XL75      TNDY--------------KIELSTIQFSIGQTEKLNQSLGETIE-------------RLK
A0A517SCC8      GMLL--------------EKDDRDWKERIADQKKFRDDLQMKLA-------------SFN
A0A3A0DR44      SGGD--------------AVRLQFKYADLERESSVFNLIAQRKL-------------QVE
A0A358MY60      KGGN--------------AVELLFAKEDREIASQLLGMMQQRLA-------------AIK
A0A517MNB1      KGGD--------------AADLRFAQEDREIAVGILAKLNERLA-------------AIR
A0A517XRC2      IAKT--------------GFDIQSLTRGLEPMKKRLDTLEDQKI-------------QIV
A0A142YJ13      LNVK--------------TMDVHWLDEEIEVASSTAKTVGAEVQ-------------SMT
A0A517Z7D3      ASLF--------------ELEDQKRKDEIERVKDQLKTALTQLS-------------TFA
A0A5C1AGE3      YSQAVTELESRLEVMNRMGIEVIKQDREIKPKMEQKQKIEEQIE-------------QLN
A0A142XAP8      TAAG--------------GLSIDEDRKNLQPQREMHDKIQSQLI-------------QLQ
A0A2Z3HEL7      TAGG--------------GASIDALRKNLEPQRALLSRLDEQLL-------------QLS
A0A1N6KY57      IGQN--------------SVDLFSIQEEIANADEIARLIGKEVE-------------ALT
L0DK20          ITQN--------------SVDLFSVQEEIANADEIARTIGKEVE-------------ALT
A0A660UUK3      LGRK--------------QLNIDDKKAELARTREIFNTVCNRIS-------------EIV
A0A517ZHG5      IVTD--------------SFELQQLQKEAAKLEARTDEINNKID-------------VLK
A0A1Z8MPL5      IGEY--------------SADLERRQDELVHLTQVTNELGYELE-------------KLD
A0A5C6C1R5      LGRS--------------SIDIEMMRAEIASLDDVLNRLGSEIE-------------RTR
A6BZU4          VGDF--------------QVVDQSYNEEIAQLKSQRDNIFKQLL-------------VEK
A0A2D5GZ77      VGDF--------------QVVDQSYNEEIAQLKSQRDNIFKQLL-------------VEK
A0A3D3R1Z6      VGDF--------------QVVDQSYNEEIAQLKSQRDNIFKQLL-------------VEK
A0A517XG00      VGDF--------------QVVDQSYNEEIAQLKSQRDNIFKQLL-------------VEK
A0A1G2YRE4      IGRR--------------QLNIEDLQFQQNLDQETYDTVRRRIR-------------DLE
A0A353Z859      KLAW--------------QMELDELNKSIEQFRTIYNRLQEEGE-------------RAR
A0A2D6ST10      NNIF--------------NAELNRLDQDIAQDGALIDAIATQIE-------------QIE
A0A177QX42      MQGE--------------QRTNERLNEEHANLKQTYEALVSKLV-------------SLD
A0A517SHR0      MQED--------------QRIDQRLTEEHNHLKQLYDALVAKIT-------------TLD
A0A2E0AW64      AKGR--------------TFDMVQLQTSLERAEEQALAFQDRED-------------RLR
A0A351FZ59      AKGR--------------TFDMVQLQTSLERAEEQALAFQDRED-------------RLR
A0A660V239      MGRK--------------QFVIDDKKDQLARTTARLEDTKKRID-------------QIR
A0A177Q3B7      ATVG--------------QSDIESFRTEIAQSEKIADRIGSEVE-------------RLK
A0A2E0X6Y6      HSGH--------------IVEIERLEGQVEWTKTQREAILAQLQ-------------QVE
A0A518GFD7      LGQS--------------SIDVELMRAEIAGLEDVLQHVGGEIE-------------RTS
A0A5C5VZJ8      ASRL--------------ASRLVEVEREVEADTHELDNLEKQLN-------------IRE
A0A518GE37      QGGE--------------TAEIFFAREDYEQAAEILSQLNNRLA-------------TLR
A0A5C6F3H8      FGGT--------------TAQLQFAQDELAVASGVLKKLRDRVA-------------AIK
A0A5C5X072      YGGM--------------TAELRFANDELVVASGVLTKLRGRVA-------------AIR
A0A5C5WUQ3      FGGA--------------TAALQFAQEELSVATDVLRKLRDRTA-------------AIQ
A0A5C6E697      FGGA--------------TAELQFAQEELSVANDVLRKLRDRVA-------------AIR
A0A5C5Z1A3      FGGT--------------TAELQFAQEQLDVANEVLIQLRSRDA-------------AIK
A0A5C6D2P7      FGGA--------------TAELQFAQEELAVANDVLKKLRDRVA-------------AIR
A0A5B9ML17      LLDD--------------SAKLQFAQDDLRRASLLLNKLEDRKA-------------AIK
A0A517LX75      VESE--------------YLEGKALKARMVRAQQRYDEVMERLQ-------------EIQ
A0A354GX32      AGKS--------------NGDVDGLQAEVNALDAEVKKSGEELA-------------SLD
A0A5C1AAF0      INTA--------------NLDLEAEKIEIQTAEDLYAKVAAAIS-------------THL
A0A5C6B3S0      FGKS--------------SIDVEMMRSEMSALEQVLSSIGEEIE-------------RSK
A0A518GIZ9      YARF--------------QAEDQAMTAELNRLRSLWGQLVDRMS-------------QLT
A0A1C3EBY9      YARF--------------QAEDQAMTAELNRLRGLWGQLVDRMS-------------QLT
D5SX64          YARF--------------QAEDQAMTAELNRLRSLWGQLVDRMS-------------QLT
A0A517Z0U7      LAVS--------------WVDRQILADTVDSLKEKVNRFSDTIY-------------KRE
A0A2S8FCC0      FGRS--------------SIDVEMMRTEIDSLEGILSRLGHEIE-------------NTK
A0A1Z8MBT6      RVND--------------SWDVDKHVNHLAMLRERYAAAEQRLD-------------AIK
A0A517SXN9      RVND--------------SWDVDKHVNHLAMLRERYAAAEQRLD-------------AIK
A0A518HFL0      EGIE--------------QLKVSFAATDLRQRRIMLDQVNRRIE-------------MLE
A0A5Q3LBQ3      SSGQ--------------SLELVFALAELEREEKVFELIAARTL-------------ALR
A0A3B8ZJM2      VQGF--------------LLTHESIKNQAEKLDKIQEVLSDKLK-------------GVE
A0A1U7CLW1      LNVK--------------SMDFHWLEDEIAVASDTAKMVGAEVQ-------------SMT
A0A142WPR7      LVAY--------------EVRDESLRNEIARTSKLFEGVVKRLD-------------EIS
A0A3M1TFJ0      LSQR--------------AQQLREQSRQLARRARLYESLKKEVE-------------ANE
A0A517P477      AGKE--------------SVGLRRLEAELLRKEELVNLLATEAE-------------RRE
A0A517T4K9      TGTL--------------SYELETVNKAIEQTEKIVQNVKDEIQ-------------RLQ
A0A2Z3GZZ5      AGGL--------------LDLAEAMAVQSQHADAEIMRLEAERL-------------ARQ
A0A4V0I6L6      MAPV--------------QQAIRNNEEKLKQTAAELQAAEKEKD-------------RVS
A0A255QXF5      RDNN--------------NVALEFAKTDLQQSRAMLQKVTERLD-------------SIQ
A0A518KBI5      GGGK--------------GAELEFAKAELAREEKVFELIAARKL-------------ALQ
A0A5C5V6Q5      SGGK--------------GAELEFAKAELAREEKVFEMIAARKL-------------ALQ
A0A517MY49      HSAD--------------LATLENLEREKGRLESSYDAVKDQIR-------------SVG
A0A2E6AG00      XHXQ--------------IEELAIAEREVERLRSLHHTLQDRIA-------------NID
A0A1G3A880      LNGD--------------LAQLEILEHDVEQLRSFHDVLVNQIA-------------NTD
A0A2E8ATT1      LNDD--------------MAELTITERDVERLSRLHDTLLERIS-------------NID
A0A518KYQ0      RDGV--------------SVALLFAQDDLERTRSMLHRITDRLA-------------SIQ
A0A5B9QX47      YGGA--------------TAELSFARQELEVANDVLSKLRGRVA-------------AIQ
M5T666          FGGT--------------TAELQFANDELVVASDVLTKLRGRVA-------------AIR
M5U6N6          YGGT--------------TAELQFANDELTVASDVLTKLRGRVA-------------AIR
A0A517M0G2      RGGK--------------AADLRFATEDREIAAGILGQLNQRLA-------------AIR
A0A5C6AST1      HGGD--------------AADLHFAQEDREIAVGILGQLNQRLA-------------AIR
A0A5C6C951      QGGN--------------SADLKFAQEDREVAVGILAQLNQRVA-------------AIR
A0A5C6C5T3      YGGM--------------TAELEFAEDEQAVASDVLTKLRGRVA-------------AIR
A0A2A2W6A9      RDGN--------------SVALQFAQDDLARSRTMLHRIMDRLE-------------SIQ
A0A518HQS9      RDGN--------------SVALQFANDDLERSRSMLHRIVDRLE-------------SIQ
A0A5M6DFE6      YSGA--------------SAELEFAQQELAIERETLQTLRNRID-------------AIR
A0A5C6F286      FGGT--------------TAQLQFAQDELDVASGLLKKLRDRVA-------------AIH
A0A517NGN1      LGGD--------------AAELQFAEEDLAVGNGVLDKLRQRVA-------------EIR
M5RUI3          FGGA--------------SADLQLAIDEKQIAMDVLGKLKIRAA-------------AIR
M5S2L2          ------------------------------------------------------------
A0A523CME0      KGEN--------------NSEIERFTKKGQNLKR-DSKMAGSKS-------------YIK
A0A354PCV3      FGGM--------------TAELQFAQAELEVANDVLKKLRDRVA-------------AIR
A0A354PHB4      FGGM--------------TAELQFAQEELEVANDVLKKLRDRVA-------------AIR
A0A356ESF4      ------------------MTELENKERDLKRLQTWNEQLLNKLT-------------DLN
A0A538RV31      DARR--------------GVELESLKEQIESTDKISQRLHQMID-------------EEQ
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
                                                                            

A0A356AE44      -----------LAS-----DEGYQLTQIS------PSRAEPDIKHVIKIVGG--CLVMTL
A0A1G2XSU7      ---------MERKR-----LARISVAYLA--------NTAPYQDRRMQYSLA--ITMGSL
A0A350KD81      ---------V-SQG-----NSGYTLTQLA------PVKDELVIKRQLKFLMA--GAGAGL
A0A2E3Z6T8      ---------F-RQN-----QAPIRATVVR----EPIANNNPVTPQIRLIAAV--CLLGGT
A0A257WQ92      ---------I-ERD-----GNGYVMKQIA-----------PVKEELSMKRIL--KFVGG-
A0A356ETW1      ---------L-RQD-----GHDVRAKVTA----PPVANHRPVSPRLAFVALV--AIVSGL
A0A3L7NJY1      ---------L-NKD-----TF-IRTKIAS----KPTVPTRPVSPRLAIVGIL--SLMVGT
A0A2D6SRY7      ---------I-AEA-----AEVGTAQLVD----PALPPGGPFRPNTSVNVFL--GALLGL
A0A1G3C300      ---------I-AGD-----LQTSNVSILD----PAMEPRTPIGASRNSQIMK--GVMIGL
A0A524HC32      ---------S-MSG-----VSASNIQKVD----RALLPIFSVKPNVKLTLLF--AIVVGL
A0A660VT66      ---------L-TAQ-----GGVKPIEVID----EAVVPHRPYYPKVKLNLAA--GLLLGL
A0A0S8H0S8      ---------L-ASD-----VGPMFIRVLE----EASSGDEPTRPNRPHAAAM--ALGLGL
A0A177PV03      ---------L-SKN-----FGGVTADVIE-----PATPALKVAPVPAKIFIV--AMMLGL
A0A1G2YIM0      ---------MERKR-----PARISIAFNA--------DSMLAKDKRPKYVVA--NIFGSG
A0A1G2ZG92      ---------I-AES-----MTLSNIRLIE----AAIEPYKPHFPRRYLNFAI--ALFLSV
A0A1G3A0W0      -----------MER-----DIPPSIEVLS----KAFVPSQPHSDRRMVFMAM--ALILGV
A0A353BE27      ---------L-MPK-----MGQRTLKRLD----MPN-TGLFYGPKVIKYLVG--GAAVGF
A0A5C6BPW1      ---------IELDA-----PDRINVAQWA----EV--PRIKDWESLYKKSAM--AGLGVF
A0A1I3GSP0      ---------I-TRG-----QEGYRLQQIS----QV--RIERSMKRVIKLVGT--CGVMGI
A0A517QJV1      ---------V-SKE-----QEGYRMKQIA----QV--RIERSLKRVIKIVGM--FGFLGI
A0A3C1QS25      ---------V-TGD-----KEGFNYEILE----PPT-FAEQTEPSLLKVFAV--AGFLGL
A0A5C6FX55      ---------MSTST-----ESETRVVELI----AAK-GAYLVAPILWKLVGI--GGFLGL
A0A3L7UX05      ---------F--ES-----QGQTQISLIQ----TARPIGLPSNDKRWRFMAM--APLGMF
A0A5C6DS51      ---------L-AGS-----YAGFSTDLLA----SPESARNPSWPKLPIVVVL--GAMLGM
A0A5C6DSL6      ---------L-AGS-----YAGFSTDLLA----SPEAATVPSWPSLPIAIVV--GAMLGL
A0A3M1VG27      ---------L-IKD-----NRGYALRTVA----EP--KAEVSIKRPLKFLGA--GLFGSL
A0A518GC22      ---------L-MPK-----VGQRTLKRLN----MPS-IGWFYGPTLPKYLLG--GAAVGF
A0A3L7Q373      ---------Q-NKA-----QEGYKMSRTN----DV--RVDRSLKQTIKIVGA--FGVMGL
A0A3E0PW54      ---------V-RKE-----QEGYRVNQIA----QV--RVEKSIKRIIKIVGA--MGCLGV
A0A1Z8MHR4      ---------L-AHV-----NDGIMVKQIQ----ETS-PAIRVGPELTRYLLI--YGLFGL
A0A5C6EHJ0      ---------L-MSG-----GDGLKVFPLN----TAK-LGYQVAPSLAKSLIL--GGFLGS
A0A5C6F1H9      ---------L-MSG-----GDGLKVFPLN----TAK-LGYQFAPSMPKSLIL--GGLLGG
A0A255QXY0      ---------L-IDM-----DGGIIVDQLW----GSG-GAARIGPDQKKDLLA--GGMIGF
A0A517SYI0      ---------L-AHV-----NDGIMVKQIQ----ETS-PAIRVGPELTRYLLI--YGLFGL
A0A518HX54      ---------L-IDI-----NGGILVEPLL----ATG-KAHPTGPDLRKDVAV--FTMLGL
A0A5B9MF59      ---------L-ADV-----KGGILVEPLL----DTG-QAYVTGPDLRKDLIL--YGMLGL
A0A2A2WC24      ---------L-ADV-----KGGILVEPLL----DTG-QAYETGPDLKKDLVL--FGMLGL
A0A518KYW8      ---------L-ADV-----KGGILVEPLL----DTG-QAYETGPDLKKDLVL--FGMLGL
A0A5C5YZZ0      ---------L-PSL-----NSGLHVNVLR----PAG-LGYLVGPILSRALVL--GGFLGL
A0A518JLD2      ---------L-ISE-----GEGLKVIPLN----TAN-YGYQIAPVMLKSLVM--GGFLGT
A0A5M6DJ15      ---------I--EL-----NAQPRVTVVD----DARARTNSGSKKRVLASGV--MGFAGL
A0A3L7P7S7      ---------M-TKD-----HGGYDAQELG----RIPELGGEVPSRKSLIVVA--GGIFGV
A0A517N8M1      ---------I-SED-----ERGTRVIELT----APS-LAYKVGPSLLKTVGG--GSILGI
A0A5C6CW01      ---------L-TEE-----EGGTRVQELT----APS-RAGRVGPNLTRTLAM--GTFIGL
A0A5C6BXS9      ---------L-TEE-----EGGLRVSELR----APS-GAYRIGPNMAKMLSV--GALLGV
M5U569          ---------L-TEE-----EGGVQVTELS----APS-NAYRVGPNMAKMLSF--GTFIGL
L7CND7          ---------L-TEE-----EGGLQVSELR----APS-RAYRTGPNLVKMLGI--GTFLGL
A0A0J1B8S4      ---------L-VEE-----EGGIRVTELV----APS-TAYVIGPSIIKTLGI--GTIAGL
F2ARR3          ---------L-TEE-----EGGLRLTELR----APT-RAYRVGPNMLLMLGI--GLGVGL
K5D8H6          ---------L-TEE-----EGGLRLTELR----APT-RAYRVGPNMLLMLGI--GLGAGL
M2AKU0          ---------L-TEE-----EGGLRLTELR----APT-RAYRVGPNMLLMLGI--GLGAGL
A0A5B1CKI2      ---------I-GKD-----ERGTRVIELT----APS-LAYKVGPSILKTVGL--GSLLGI
A0A5C6EG84      ---------L-VED-----ERGTRVIELT----APS-LAYKVGPSLIKTVGA--GSILGI
A0A5C6F2X4      ---------L-VED-----ERGTRVVELT----APS-LAYKVGPSLIKTVGA--GSILGI
A0A5C5XTV6      ---------L-SEE-----DGGLQVTSLR----APG-NAYRIGPNMAKMLTI--GTLLGI
A0A5C6AAB1      ---------L-TDE-----EGGVRVSELT----APS-SAYRVGPNMVKMLGI--GTFLGL
M5T8W8          ---------L-TEE-----EGGVRVSELS----APS-SAYRVGPSMAKMLGI--GTFLGI
M5SF00          ---------L-TEE-----EGGIQVSELR----APS-RAYRTGPNLVKMLGI--GTFLGL
A0A2G1WDS1      ---------L-TEE-----EGGIQVSELR----APS-RAYRTGPNLVKMLGI--GTFLGL
Q7UVS9          ---------L-TEE-----EGGVQVSELR----APS-RAYRIGPNLMKMLGI--GTFLGL
A0A5C6B601      ---------L-ANT-----NGGIVVEPLL----NTG-NAYVTGPDLKKDLIL--FGMLGL
A0A517PFU1      ---------L-LKD-----ADTVRVTPIV----PPG-PGRPARAPLIRALAA--GGALGL
A0A5B9M8J9      ---------L-IDI-----NGGILVQPLL----ATG-KAHPTGPDLKKDLAV--FAMLGL
A0A2A2WFP6      ---------L-IDI-----NGGILVEPLL----ATG-KAHRTGPDLKKDLAV--FTMLGL
A0A518L8N2      ---------L-IDI-----NGGILVEPLL----ATG-KAHRTGPDLKKDLAV--FAMLGL
A0A518HQN9      ---------L-ADV-----KGGILVEPLL----DTG-QAYETGPDLKKDLVL--FGMLGL
A0A5M6D8H8      ---------L-VDV-----NGGIIVEPLL----STG-QAYVTGPDLKRDLIL--YGMLGL
A0A5B1CRW9      ---------L-SRS-----YAGFSTDLLA----SAEVPMNPVWPRLPIVLAL--GLMGGL
A0A5C6EI46      ---------L-SRS-----YAGFSTDLLA----SAEVPRNAVWPKLPIVLAV--GVGAGL
A0A2E7D3V4      ---------L-VAK-----NYGYKLKQIS------PVRDQLVFKRKLKFWFM--GLAMAM
A0A2S8F9B8      ---------I-ELR-----QAP-RITLLSEAKLGVVSDKKRP----LMITAA--AAFAGF
A0A368KP63      ---------I-ELR-----GTP-RITLLSKAEPGTVTDKKRP----IMITAA--AALAGL
A0A2E0SHG0      ---------N-DIA-----LLE-DYDLLQVHSMGNLNEVRSAKTSLLLGILP--GAFFGF
A0A518CQB8      ---------E-DIS-----LLE-DYELLKVQSMGNIDDVKSAKVSILYGIIP--GGFVGM
A0A5B9PER9      ---------N-SNG-----NDGYRFERLA-----NALEGQAVWPNLPMLLGL--GGLLGS
A0A517QSM4      ---------I-EIQ-----AKQ-RITENR----RASTPHTPQMSKKYKMAGM--AGLAAL
A0A355GJI7      ---------V-SQG-----NSGYMLTQLA------PVKDELVIKRQLKFLMA--GAAGGL
A0A1Z8MCI4      ---------T-EGG-----YKD-VVSSLA----SASLPETPLENSNTKRQLL--AYPLVF
A0A517SYL7      ---------T-EGG-----YKD-VVSSLA----SASLPETPLENSNTKRQLL--AYPLVF
A0A3L7P0L2      ---------L-NKD-----QEGYTLSRTN------DVRVDRSMKRVMKIVGA--CGILGL
A0A142XL75      ---------V-ELG-----APS-RVTCSE----EPFIVTGIEGNRRLKYTVL--AALAVF
A0A517SCC8      ---------Q-TRD-----QEGYRMEQIA------QVRVGKSMKRFLKIVGA--CTLAGI
A0A3A0DR44      ---------T-ETH-----NPA-KVIVRS----DAQIPPAPIEAWPYKPLIL--FCGAAF
A0A358MY60      ---------I-ERR-----RGS-GLHTVD----AAKPPTRPVVPLPFKNMIL--AGLLGL
A0A517MNB1      ---------T-ERR-----RGM-TIQTLA----AAKPPNKPLVPVPVKKMVV--AGGAAF
A0A517XRC2      ---------I-ERG-----MES-RVSVRE----AAVLILNENLKQKVMLSGA--VGVAGF
A0A142YJ13      ---------V-EMQ-----APP-RIRLIE----KASIPTLSDPMKRYKLSGA--AGAGAL
A0A517Z7D3      ---------Q-YKD-----QEGYRLKQIA------PIRVDRSRTRPIKIVGM--FSMMGV
A0A5C1AGE3      ---------L-WLS-----SGG-RIEIRE----KAVIMYNHNQRQKMLYSGM--IGVAMF
A0A142XAP8      ---------V-AAL-----QSG-RVSARG----GAEKIPNNNQNKKIVLSSA--GGAVSF
A0A2Z3HEL7      ---------T-GEG-----RT--RASARG----EAEKIPNNNQNKKLAMSSV--GGLGAF
A0A1N6KY57      ---------V-ELQ-----APP-RIRLLE----KAELPRTKDETRKFKLAGV--AGCGAF
L0DK20          ---------V-ELQ-----APA-RIRLLE----KAELPRTKDEARQLKMAGV--AGCGAF
A0A660UUK3      ---------M-EQK-----RPA-RISIAE------MASSVPAQSKRKKLALA--TPFGGI
A0A517ZHG5      ---------I-ELG-----APD-RIKVAQ----WAEVPRIKDWESLYKKSAM--AGLGVF
A0A1Z8MPL5      ---------L-ELR-----ANQSRVRRVD---GGVRKPKTGDTSKRDQLTLV--ASFGAL
A0A5C6C1R5      ---------I-ELN-----SGS-RVAVIS----EATPVADSSSKKRYVGTAG--LGFIGF
A6BZU4          ---------V-SQG-----NSGYTLTQLA------PVKDELVIKRQLKFLMA--GAGAGL
A0A2D5GZ77      ---------V-SQG-----NSGYTLTQLA------PVKDELVIKRQLKFLMA--GAGAGL
A0A3D3R1Z6      ---------V-SQG-----NSGYTLTQLA------PVKDELVIKRQLKFLMA--GAGAGL
A0A517XG00      ---------V-SQG-----NSGYTLTQLA------PVKDELVIKRQLKFLMA--GAGAGL
A0A1G2YRE4      ---------L-ERK-----RPA-RVSVAY----NADISGIQDKRAKYSAALL----FGAL
A0A353Z859      ---------M-TMS-----NLM-RVEKFR----DAVTPTQPDMAKKIMATTA--VGGGLF
A0A2D6ST10      ---------V-EIE-----NSPKRIMEFR----KADAPQRRDQKKKITGAAA--AGFGVF
A0A177QX42      ---------L-AKD-----AMAMQAEITS-----EPSPGVQIGPSMVQSLGF--GGIGGL
A0A517SHR0      ---------L-SKS-----AAPMQADILS-----EPTPGIQIGPSMPQALGF--GGFGGL
A0A2E0AW64      ---------L-ESK-----NLD-SITLLK----SASPPVKPAVIAPWKNMLM--GGGIAL
A0A351FZ59      ---------L-ESK-----NLD-SITLLK----SASPPVKPAVIAPWKNMLM--GGGIAL
A0A660V239      ---------L-ESK-----RPS-RISV------AYGASSVPARGKRRKLAAA--LGFGGL
A0A177Q3B7      ---------L-EVD-----APQ-RVHLIE----EPVVMESASTRFRAKALLG--AAFGAL
A0A2E0X6Y6      ---------S-LAG-----QAPIKASVVR----EPLPDPRPVSPRLKMVVVG--ALAGGL
A0A518GFD7      ---------I-ELK-----TAS-RIKLLS----SADRAIAPDLKKRFAVAGA--GGGLGL
A0A5C5VZJ8      ---------M-RRA---------TEVTVA----MSTAVAKPPVDKRVKLSAA--ALFGAL
A0A518GE37      ---------T-ERG-----RGS-SVSTMA----AAKVPSWPIEEIPFKKVIM--AGGAAF
A0A5C6F3H8      ---------T-ERR-----QDG-AVRTLA----EATAPKSPIETVPYKKLAM--ASSVAF
A0A5C5X072      ---------T-ERR-----QDG-AVRTLA----AATPPKAPVESKPYKKLVM--ASAGAF
A0A5C5WUQ3      ---------T-ERR-----QDG-AVRTLA----SATPPKNPTETIPVKQLGL--ASTVAF
A0A5C6E697      ---------T-ERR-----QDG-AVRSIA----KATPPRTPVEPIPLKKMAV--FGLGAM
A0A5C5Z1A3      ---------T-ERR-----QDG-AVRTLA----AATPPKTPVEEIPVKKMAV--AGLAAM
A0A5C6D2P7      ---------T-ERR-----QDG-AVRTLA----AATPPRTPIESLPVKQMAV--FGGGAL
A0A5B9ML17      ---------T-ERT-----QAD-AVRSVS----PATPPGHPVEDIPVKKLLV--ASGGAF
A0A517LX75      ---------L-TTN-----YAGFSTDLLS-----APVVGTQVWPNPLVVLSL--GSFAGL
A0A354GX32      ---------S-SLP-----VTP-RLTVTE----AAAPPMSPASDKRIKAAGG--AFLGLF
A0A5C1AAF0      ---------A-END-----APS-RVAHLE----NARVERVNTEARKMQFAGF--AGAAAL
A0A5C6B3S0      ---------V-ELRDQIDSTGGSRVTLFS----SAYAPRRGKSMTRYSMAGL--AGVVGM
A0A518GIZ9      ---------I-DKE-----SSGYTLRQ------TGPIKDEWVLKRLLKIVGA--GMVAGM
A0A1C3EBY9      ---------I-DKE-----SSGYTLRQ------TGPIKDEWVLKRLLKIVGA--GMVAGM
D5SX64          ---------I-DKE-----SSGYTLRQ------TGPIKDEWVLKRLLKIVGA--GMVAGM
A0A517Z0U7      ---------I-ELE-----KAGVPIVVRR----PAEVPKKPDGGKREKMAGV--AGFGVF
A0A2S8FCC0      ---------I-ELK-----SDS-RVSVLQ----EAQPPKSK-NPRSYAMVGV--AGVFGF
A0A1Z8MBT6      ---------T-ESE-----NMS-RVQPIA----AATPPTKPNEEVPTKKLAM--VALAGF
A0A517SXN9      ---------T-ESE-----NMS-RVQPIA----AATPPTKPNEEVPTKKLAM--VALAGF
A0A518HFL0      ---------Y-ESR-----GSE-PIIVIS----EAKPGGPPVTNKRDKYLAV--TPLAML
A0A5Q3LBQ3      ---------T-EMR-----APA-RVNLLK----EAEIPPKPIEALPVKKLGI--AMLGSL
A0A3B8ZJM2      ---------L-FQN-----SSNRKILQEL----IPSMPGAYYGPFSSTYTAA--GALAGI
A0A1U7CLW1      ---------V-EMQ-----APP-RIRLIE----KASVPTMNDPLRRCKLSTI--VGAGVF
A0A142WPR7      ---------L-VKG-----YGGYEMSVLS-------PPTEGFLTGPVMARYLALGAVAGI
A0A3M1TFJ0      RFYEEFIQQQ-KDI-----SAYSRVNVAEVRIVDPALAAVRVGPNHVRNVLV--GALLGL
A0A517P477      ---------F-EIS-----NATPPIAVQE----DAVVPRTRNDGKRIKTAVLVGGGGVGF
A0A517T4K9      ---------I-ELQ-----SPS-RIALHR----KAEPPRTRETGRKLKLASV--AGFGMF
A0A2Z3GZZ5      ---------A-TLG-----AGGYSAEQIT----RPGSGHK-VAPVLLRSLLL--GLGIGA
A0A4V0I6L6      ---------G-SRS-----AGAYEVRDVT----KPADGGQ-VAPVLLQSLML--GAVLGL
A0A255QXF5      ---------L-ESQ-----RGS-SVISVA----KATPPTRPVEDMPFKKMLA--AGGAGF
A0A518KBI5      ---------T-ESK-----APA-RVEVVD----EVTASPVPLEAAPWKKLVL--ACGLAM
A0A5C5V6Q5      ---------T-ETN-----APA-RVRVMG----PIVASPTPVESAPWKKIFL--ACGVGM
A0A517MY49      ---------G-LQV-----QAPIRAIAVS----EPRPEYRPVSPRLKNVVLG--SIFAGF
A0A2E6AG00      ---------X-NQN-----QADVRVEVVS----DPKGRQTPVSPRLANVFVX--SLLGGT
A0A1G3A880      ---------L-RQE-----HGDIRATVVK----EPMASQQPVSPRLMTVALL--VLVIGL
A0A2E8ATT1      ---------M-TQH-----RANVRVSVVS----EPAASRMPVSPRLAFVGVL--CLTFGL
A0A518KYQ0      ---------M-ESK-----RGS-SVMSIS----QATPPSRPVEAVPFKKMIM--AGGAGF
A0A5B9QX47      ---------T-ERR-----QDG-AVRSLA----AAKPPSRPIEKIPYKKMFM--ASAGAM
M5T666          ---------T-ERR-----QDG-AVRTLA----SATPPKSPVEAMPYKKLGM--ASAVAF
M5U6N6          ---------T-ERR-----QDG-AVRTLA----SATPPKSPVEKMPYKKLLM--ASAIAF
A0A517M0G2      ---------T-ERR-----RGS-GLHTLA----EATPPLAPVEPMPTKKMIV--AAGGAF
A0A5C6AST1      ---------T-ERR-----RGS-GVHTLA----AATVPTRPIEPMPTKNMAV--AGAGAF
A0A5C6C951      ---------T-ERR-----RGS-GVHTMA----AANTPTRPIEPMPTKNMVV--VAAGAF
A0A5C6C5T3      ---------T-ERR-----QDG-AVRTLA----AATPPRAPVEAVPYKKLAL--ASAGAF
A0A2A2W6A9      ---------M-ESK-----RGS-SVLSIS----EAVPPSRPVEAVPVKKMLM--AGGGAF
A0A518HQS9      ---------M-ESK-----RGS-SVISIA----AATPPSRPVEAVPFKKMVM--AGGGAF
A0A5M6DFE6      ---------T-ESE-----HEG-VVRLLA----DATEPRSPVENVPVKKMAM--AGGACF
A0A5C6F286      ---------T-ERR-----QDG-AVRTLA----VARPPKSPIETAPYKKLAM--VSSVAF
A0A517NGN1      ---------T-ERR-----QDG-AVRSLA----EATPPRAPVESIPTKKILM--ASGACF
M5RUI3          ---------T-EKQ-----QGG-SVQTLA----AATPPRIPLESVPTKKLIA--VSGGAF
M5S2L2          ------------------------------------------------------------
A0A523CME0      ---------S-AIE-----KKGEEVPSRY----DPLPDDSRQYALSQDAVSI--------
A0A354PCV3      ---------T-ERR------QDGAVRLLA----SATPPRTPVAEFPLKKMAM--AGGAAM
A0A354PHB4      ---------T-ERR------QDGAVRLLT----SATPPKTPVAELPLKKMGL--VGGAAM
A0A356ESF4      ---------I-RRD-----GQEVRIEVVQ----EPQVASAPAIPDRRRVALL--ALAAGL
A0A538RV31      ---------I-NLT-----AQDRIARLGS----DPTPDTRRTLDEKKQAIIAGGAGAAAM
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A2Z3GYP4      -------------------MADAAGN----------------------------------
A0A1V6CUG1      -------------------MANVWDAIKK----HQAEQEQQRAAADQVSAETEAAPREAW
A0A3M1SE88      ------------------------------------------------------------
A0A660WB30      -------------------GRNGEGADVK----RFAASLPLVHSSPKFALIMVLAGVGGV
A0A660W9Z7      ----------------------------M----SNESLGKLNNLISTALDLQKEHRPSGS
A0A3M1R9K7      --------------------------VEI----VQEAQQPRVADQDRQIQLTVLAGLGGF
A0A3L7PH51      -----------------------------------------------------------M
A0A3N5UQY5      -----------------------------------------------------MALLCGL
                                                                            

A0A356AE44      MSTYAFLFLR-------EMRDTSLKSLADLRAIVDT-P-----ILGTLPSIANP------
A0A1G2XSU7      VFGLGLALIT-------NKLDLRLKTPDDITKRIGV-R-----IIGTTTSRDKIKKAMWP
A0A350KD81      GLILAFSYFR-------EMRDTTMKSVDEIRNQLHL-P-----ILGEVPSFAES------
A0A2E3Z6T8      CVGVVMAYAQ-------DVLADRFNSPEELTLQLGV-P-----VLAMVKKLDAL------
A0A257WQ92      -GGVAGMFLIAGICLLRELRDLRIMSVGELRRATNY-S-----LLGTISRFTSV------
A0A356ETW1      GIGFAAVYVL-------DVLDDRFRDIDDMQQQLGV-P-----VLSLIRRL---------
A0A3L7NJY1      AGGLLIIWVL-------DILDDRFRTPEELKLQLST-Q-----ILSMIPRL---------
A0A2D6SRY7      VLGIAQAFLL-------EHIDNSVHSVRELEKAMGL-P-----TFGLIPQIPEKPGSGPS
A0A1G3C300      ALGIGLAFFL-------DYLDNTVKSTEDVENYLGV-T-----LLGLVERAKQS------
A0A524HC32      LGGLGCAFLA-------EYIADTITDPEEINDRYRI-P-----ILGMIPQIKTD------
A0A660VT66      VLAVLASLLM-------EYFDDSIRSSDEALDCLREVTGDQACILGYVQRLPGR------
A0A0S8H0S8      ILGVMLALLA-------ARLDHRIHSAADVPAVLGL-P-----LLGAVPTIRRR------
A0A177PV03      LLGAGLAFVA-------EAMDQNFHTLEEIRERLGL-A-----VVGHIPIVEPV------
A0A1G2YIM0      FLAILIALVF-------DKLDRRVHTTEDITRRLGL-R-----IIGTTVSSENIDKALLP
A0A1G2ZG92      FWGLVLSLFV-------EYIDNTIKTPEDIKHIKSL-N-----FLGIIPNTKLL------
A0A1G3A0W0      GAGGGMGLLR-------ANRRQTVYVPDDMPYAMQV-P-----FLGYVPVLPVR------
A0A353BE27      ILLSGLAVLM-------DLADRSYKNPSEISTDLGV-S-----VLGHIPVM--------N
A0A5C6BPW1      GLFVAAIVWF-------EFQAKRIDTLGDVTGGLNL-R-----IMGALPQMPRWASQKSS
A0A1I3GSP0      AIIFCLAYFR-------EWYDTSLKTLDDVTTFTHE-P-----LMGSVPTF-----SSST
A0A517QJV1      GLVFILSYFR-------EWMDTRIKNVDELCKLSET-T-----LLGSIPKF-----ATTP
A0A3C1QS25      LGGVGIAYLV-------DLADKTFRSPDDIAQSLAL-P-----ILGHIPFI-------PK
A0A5C6FX55      ALGAGMAFLL-------EKNANTFRDPDEIAASLGT-S-----VLTHVPFF--KKRVTKR
A0A3L7UX05      LAVASLCVLV-------EVRSGRVSNPDDLTNRSRL-E-----VLGVVPPL--PNPRSAR
A0A5C6DS51      FLGSSSALAA-------ELLDTTFRDVEDLEKTLAA-P-----AIAHVPRF-----DLRK
A0A5C6DSL6      FLGSASALTS-------EILDTTFRDVEDLERALNA-P-----AIAHVPKF-----DFRK
A0A3M1VG27      VAVTAMIYLR-------EVRSRSLRSLEELRNALAV-P-----VLGGIPEF--------T
A0A518GC22      VLLSGLAVLM-------DLADRSYRNPSEIATDLGV-T-----VLGHIPVM--------N
A0A3L7Q373      LAVFGMAYFR-------EWYDTTLKSIEEVRSIVKA-P-----LMGAIPRFRLSGALKRG
A0A3E0PW54      AVVFGLSYLK-------EWTDMTLRTADELKALVPV-S-----VLGEVPEY-------SP
A0A1Z8MHR4      GISGLLAMTF-------EASAKMFRSAEEVHSDLRL-P-----VLSHIPLD--DSMVQSA
A0A5C6EHJ0      MLAFGLAVLR-------ELSDRSYHSARDIAEHTRL-P-----IIGHVPV------LKPH
A0A5C6F1H9      MLAFGLALLR-------EMSDRSYHSARDIAEHTRL-P-----IIGHVPV------LKPH
A0A255QXY0      ILGGILSILI-------EFWSMTFRSADEVQRALRA-P-----VLTHIPVD--SSRVKAH
A0A517SYI0      GISGLLAMTF-------EASAKMFRSAEEVHSDLRL-P-----VLSHIPLD--DSMVQSA
A0A518HX54      GLSGLLALLL-------EAGAKTFRSAEAIQHELQA-P-----VLTHIPFD--AGRSHKR
A0A5B9MF59      ALSGLLAMVF-------ESTAKMFRSAEEVQRELRL-P-----VLTHIPLD--EGRIQQG
A0A2A2WC24      GLSGLLAMIF-------ESTAKMFRSAEEVQRELRL-P-----VLTHIPLD--EGRIQQG
A0A518KYW8      GLSGLLAMIF-------ESTAKMFRSAEEIQRELRL-P-----VLTHIPLD--EGRIQQG
A0A5C5YZZ0      VLGAALAFLW-------DWSERTFRSPDEISTSLGL-P-----ILAHLPVMLTPRKLRKK
A0A518JLD2      VLAFGLAFLR-------EISDRSYRSPQEVSEHTGL-P-----VIGHIPVL--K----RW
A0A5M6DJ15      CLPLLGFIGL-------DVRSKLVNDSESVSREAGL-P-----ILGSVPRE--RQISAQF
A0A3L7P7S7      AIGGGLAWLM-------ERADRTFRSPDDIRKRLGI-P-----VLGHLPLF--P-----P
A0A517N8M1      LLGCGLALLL-------EKNANTFRDPDEIADILGV-P-----VLTHIPFF--KGKLKKV
A0A5C6CW01      VIGAGLALLL-------EMNANTFRDPEEISALLAV-P-----VLTHVPFF--KGRIRKP
A0A5C6BXS9      AVGMGLALLL-------EKNANTFRDPDEVIAAVGA-P-----VLTHVPFF--KGKVRKG
M5U569          AAGCGLALLL-------EKNANTFRDPDEIAEAVGA-P-----ILTHVPFF--KGRVRKA
L7CND7          ALGCGLALLL-------EKNANTFRDPEEIIAAVGA-P-----ILTHVPFF--KGRVKRK
A0A0J1B8S4      IIGCGLALLL-------EKNANTFRDPEEIVAAVGA-P-----ILTHVPFF--KGRVRRA
F2ARR3          LLGCGLALLL-------EKNANTFRDPEEIVTAVGA-P-----ILTHVPFF--KGRVRHK
K5D8H6          LLGCGLALLL-------EKNANTFRDPEEIVTAVGA-P-----ILTHVPFF--KGRVRHK
M2AKU0          LLGCGLALLL-------EKNANTFRDPEEIVTAVGA-P-----ILTHVPFF--KGRVRHK
A0A5B1CKI2      MLGSGLALLL-------EKNANTFRDPDEISEELGV-P-----VLTHIPFF--KGKLKKL
A0A5C6EG84      LLGCGLAILL-------EKNANTFRDPDEIADILGV-P-----VLTHIPFF--KGKVKKS
A0A5C6F2X4      LLGCGLAILL-------EKNANTFRDPDEIADILGV-P-----VLTHIPFF--KGKVKKS
A0A5C5XTV6      AAGLGLALLL-------EKNANTFREPDEVVAAVGA-P-----ILTHVPFF--KGKVRKS
A0A5C6AAB1      ALGCGLALLL-------EKNANTFRDPEEIATAVGA-P-----ILTHVPFF--KGKVRKG
M5T8W8          ALGCGLALLL-------EKNANTFRDPDEIAEAIGV-P-----ILTHIPFF--KGRVRKS
M5SF00          ALGCGLALLL-------EKNANTFRDPEEIIAAVGA-P-----ILTHVPFF--KGRVKRK
A0A2G1WDS1      ALGCGLAVLL-------EKNANTFRDPEEIIAAVGA-P-----ILTHVPFF--KGRVKRK
Q7UVS9          ALGCGLAVLL-------EKNANTFRDPEEIIAAVGA-P-----ILTHVPFF--KGRVKRK
A0A5C6B601      GLSGLMAMLF-------EAGAKMFRSAEEIQKELRL-P-----VLSHIPLD--ESRVQQG
A0A517PFU1      AVAFGLSYLL-------EQSDRRFTGPAELRAEFGL-P-----LLGHVPEI--PPRTLKE
A0A5B9M8J9      GLSGLLALLF-------ETTAKTFRSADAIERELQS-P-----VLTHIPVD--AARAPKR
A0A2A2WFP6      GLSGLLALLF-------EAGAKTFRSAEAIQQELQA-P-----VLTHIPFD--GGRRQNR
A0A518L8N2      GLSGLLALLF-------EAGAKTFRSAEAIQHELQA-P-----VLTHIPVD--GGRSPKR
A0A518HQN9      GLSGLLAMIF-------ESTAKMFRSAEEIQRELRL-P-----VLTHIPLD--EGRIQQG
A0A5M6D8H8      GASGLLALLF-------EASAKMFRSAEEIQRELRL-P-----VLTHIPLD--EGPVRPA
A0A5B1CRW9      AMGSLLVLAA-------ETFDSTFSSVEELERATGA-A-----VIAHVPRM--PVRELRK
A0A5C6EI46      ALGLLLTLAA-------ETFDSTFGSVTDLESTTKA-A-----VIAHVPRL--NLRTLRK
A0A2E7D3V4      SAVGAVIYWR-------EWRDTTLKTFDDVRQSMQF-P-----VLGGVPEFAAI------
A0A2S8F9B8      MLPAGLLLLR-------DFSKKHLSDLPTTRDELGL-E-----ILGTIPKLPRG------
A0A368KP63      VLPGGLLVLR-------DFQKKRLSDLPTTRDELGL-E-----ILGTIPRLPRG------
A0A2E0SHG0      IFGGLMAAVI-------DLADSTFRSPEQIRETLRS-P-----VLAHIPRLNVR------
A0A518CQB8      MFGLLLAFVI-------DLADSTFRSPEQIRNTLNT-A-----VLAHVPRLNVR------
A0A5B9PER9      LFGFGLGCLV-------ELADKTFHNPSEIIRQLNV-P-----LIGHVPVIGQS-KRYLV
A0A517QSM4      GLIAGGIIFL-------DYRRRRVSTAEEITENLRI-R-----ILGVIPILPRT--IIKA
A0A355GJI7      GLILAFSYFR-------EMRDTTMKSVDEIRNQLHL-P-----ILGEVPCFADS--DAAV
A0A1Z8MCI4      AALFGLGLTV-------EVFSQRFXRARNVTEITQL-S-----LLGELAKFPRW------
A0A517SYL7      AALFGLGLTV-------EVFSQRFSRARNVTEITQL-S-----LLGELAKFPRW------
A0A3L7P0L2      LSVFCLAYFR-------EWYDTTLKTVEETRTVIGA-A-----VMGAIPHFRGG------
A0A142XL75      GIGFAGTIGL-------ETRARRVTDTDDVTKALGV-R-----LLGTVPAAGQESGKPGA
A0A517SCC8      AAVFGLAYFR-------EWYDTSLRSLDEVSETAGT-Q-----LLGAVPTFKTT------
A0A3A0DR44      VLPFFVVVGW-------EKLSRRIADADQLSSESTL-S-----IIGEIAQLPTR-----P
A0A358MY60      AAPFSLGLLL-------ELRAKRVSDAETLTAGNLA-P------FGEVAKLPSK------
A0A517MNB1      MIPFLLGLLL-------EFRSQRICDASGFDGQSLA-P-----VIGEVARLPSR------
A0A517XRC2      LGVLALIALL-------EWRNRRVDGVDQVVTELGM-R-----VIGTVPAFPNR------
A0A142YJ13      VAFLGCLSLL-------EFRSRKVDMPDEVSDRLGL-R-----IIGDLPRLDHA------
A0A517Z7D3      MAVFVLLYYR-------EWSDISIRTLADVRSLVQS-P-----IFGAVPSFRPQ-LFRVP
A0A5C1AGE3      LVVLTLVAFL-------EWRTRRVDGVDQVVNEIGM-R-----VIGTIPAFPSR------
A0A142XAP8      FGVILLVSFL-------EWRSRRVDGVDQVVNELGM-R-----VIGTVPAFPNR------
A0A2Z3HEL7      LTVVLLISFL-------EWRTRRVDGVDQVVTELGM-R-----VIGTVPVFPNR------
A0A1N6KY57      ALALLGISFW-------ESSARRVDSASDVVQCLGM-D-----LFGTLPILPRR------
L0DK20          ALALIGVSFW-------EFQSRRIDSAADVIKSLGM-N-----LFGTLPAIPKR------
A0A660UUK3      ALGVFLAFLL-------AKADKRLRGAQDVVKRVGV-R-----IIGTTTSSRHIDRSMIT
A0A517ZHG5      GLFVAAIVWF-------EFQAKRIDTLGDVTGGLNL-R-----IMGALPQMPRW----AS
A0A1Z8MPL5      LLGIGAPTLL-------DVIRRKVSSVNQMSEGLGI-R-----VLGNLPLLDKPKRRLGF
A0A5C6C1R5      CLPFLGFIGL-------DLTKKRVNSVSGVGRELSV-P-----ILGSVPRHRKIHEVLTN
A6BZU4          GLILAFSYFR-------EMRDTTMKSVDEIRNQLHL-P-----ILGEVPSFAES--DAVV
A0A2D5GZ77      GLILAFSYFR-------EMRDTTMKSVDEIRNQLHL-P-----ILGEVPSFAES--DAVV
A0A3D3R1Z6      GLILAFSYFR-------EMRDTTMKSVDEIRNQLHL-P-----ILGEVPSFAES--DAVV
A0A517XG00      GLILAFSYFR-------EMRDTTMKSVDEIRNQLHL-P-----ILGEVPSFAES--DAVV
A0A1G2YRE4      FCGMGLAFLK-------DKTDQRLRTPDDITKRIHI-P-----VIGTTTSLHNIKPALIP
A0A353Z859      GLIFLGILFL-------DLRTRRINSLDDIVTGLRL-P-----VIGSVPLIPSS------
A0A2D6ST10      GLFVAAIVFL-------EYRSHRISRLEEVVDGLGM-R-----IVGNIPTMPRA------
A0A177QX42      LAAIAIALLL-------ETADKSFRNPDEISRQLRL-P-----VIGHIPELAADRDWKMV
A0A517SHR0      LAAIAIALLL-------ETADKSFRNPDEISRQLRL-P-----VIGHIPELAADRDWKIV
A0A2E0AW64      LIPFGLAVLW-------ELRVGRITDSKQIEKQSQL-P-----VLAEIARFPSH------
A0A351FZ59      LIPFGLAVLW-------ELRVGRITDSKQIEKQSQL-P-----VLAEIARFPSH------
A0A660V239      ALGALLALLL-------DKADKSLHDPKDVVRRVGV-R-----IIGTTTSPKNVDKLLLG
A0A177Q3B7      LLAIGLMTWR-------EYSFRRVELAEEITQHL---P-----VVACLPRLEAS------
A0A2E0X6Y6      FLGSLIIYVQ-------DVLDDRFGSPEEMAAQLGV-G-----VLTVVGNLKTL------
A0A518GFD7      LLPLVLLVGW-------DLTRRKVDNLEGVSHSLSL-S-----TFGTVPMVDRD------
A0A5C5VZJ8      IAGLGAGFVR-------LRFSATVTSMRDVSRPLQQ-T-----LIGSVP-----------
A0A518GE37      LLPFALALLL-------EFRMKRLTHVGGIE-AQNLAP-----VLGEIARIPGG------
A0A5C6F3H8      MVPFLIGLIF-------EYRVQRVTDASSFTRSGDMVP-----IMGEVARLPSG------
A0A5C5X072      VIPFLLGLLW-------EFKVQRLTDAESHDKTGLLAP-----VVGEVSRLPAG------
A0A5C5WUQ3      VAPFLLGLLL-------ELRIQRVTDGNAVQKHFGMAP-----VVGEIARLPAG------
A0A5C6E697      MIPFLFGLLW-------EVRVHRVTHSTAVGH----LD-----VMGEVAKLPTG------
A0A5C5Z1A3      MIPFLIGLLW-------ELRVQRVTDSSMCDG----LI-----VVGEVAKLPAG------
A0A5C6D2P7      MIPFLLGLLW-------ELRVRRVTDSSMCTS----LA-----VVGEVSRLPSG------
A0A5B9ML17      AIPLLLGLLW-------EFKTNRVTDTHVLDSSQAIAP-----VIGELARSPST------
A0A517LX75      LLGSCGALWA-------DYSDQTFRDPGDLERSLGA-S-----VLAHVPRFQIT------
A0A354GX32      GLVFLGVVAT-------EFRTRRVYKSEDVSQGLGL-P-----LMGTVPALSAK------
A0A5C1AAF0      GFVCLVVSLF-------EFRNQRVDSIASVGLATGL-P-----TLGTIPWFPSN------
A0A5C6B3S0      AFPLFGIIFW-------DTRKKCINSPEEISGQMSL-E-----VIGSLPLISQRKMRRVN
A0A518GIZ9      GLIISLIVLK-------EFLSNQVRTVREVRQLLPE-A-----YLGAVTSFDPE-QSRLD
A0A1C3EBY9      GLIISLIVLK-------EFLSNQVRTVREVRQLLPE-A-----YLGAVTSFDPE-QSRLD
D5SX64          GLIISLIALK-------EFLSNQVRTVREVRQLLPE-A-----YLGAVTSFDPE-QSRLD
A0A517Z0U7      GLLVAAIVWL-------EMAAKRINSVDELEAASNL-Q-----VMATIPLMPRWVSRGDD
A0A2S8FCC0      MLPVAGFVFW-------DLRSQRINVPSDVSDNLRM-N-----VLGAIPLVPQRVLAQSR
A0A1Z8MBT6      CVPFGLGLLW-------ELHTKRITDSHHIE-ALAVPP-----VIGELARAPRA------
A0A517SXN9      CVPFGLGLLW-------ELHTKRITDSHHIE-ALAVAP-----VIGELARAPRA------
A0A518HFL0      GLVLGLVTLV-------ELRSGRVSGAEDLTGRLS--A-----EIFAVPPLPSA------
A0A5Q3LBQ3      GLPLLICVFW-------ERTVRRVSEAKQLGQDLKV-E-----SVWEIASLPVR------
A0A3B8ZJM2      LLMSFVALLM-------DMADRSYRSPDEIVSDLGK-P-----VLGHIPAMDLPNIKKVV
A0A1U7CLW1      LAFVGCVSLW-------EFQSRKIDVPDEVAFRLGL-R-----IIGDLPKLNGP------
A0A142WPR7      AVGYLLAYLL-------ELNDRSFRDPEEVQTSLGL-P-----VVGHIPVIELA-RADRR
A0A3M1TFJ0      FAGVLAALGL-------DRFSDRVRSLAEAQRLGP--P-----VLGAVPELSDV------
A0A517P477      GMALAAGLGF--------LFTSVQRTQDLKGNLAI--D-----LFGTLPHLPRG------
A0A517T4K9      GLIFIGVIWI-------ESLTRRVCSLNTVVDELRM-R-----VIGGVPLVPRN------
A0A2Z3GZZ5      LLGCGLMVLA-------ETRDKSFRSPAEIRRRLGL-A-----VVGHIPRIRTV-PALSL
A0A4V0I6L6      LLGGGLALRA-------ELVDRGFRSPEDVRRRLGL-P-----ILAHVPVIRANQPNEVT
A0A255QXF5      FVPFLLGLLW-------EFRVKRITDSHELERSQMLAP-----VIGELARAPSA------
A0A518KBI5      AAPFGLAVLR-------EASLRRVSDAEQLFEDTRL-R-----ILGEISTFPTR------
A0A5C5V6Q5      LAPFGLVLLR-------EVTLRRVADAEQLYEDTRL-R-----VLGEISVFPSR------
A0A517MY49      ALGCLVVYVQ-------DVLDDRFSSPEELTAQLGT-P-----VLAMVRKLDPL-PGEGV
A0A2E6AG00      LIGIGLVYVI-------DALDDHVRSPDELKDQLGL-P-----ILAMIRXLPSTLATTGV
A0A1G3A880      LGGGISVYVL-------DILDDRFRSADELRLRLGV-P-----VLAMVRQLPNA-GVPGW
A0A2E8ATT1      GGGTGLIYVL-------DLLDDRFRSPEELQEQLEL-P-----VLAMIGNLEVG-NELGL
A0A518KYQ0      AIPFLIGLAW-------EFRTKRITDSLDLEKSHLIAP-----VIGELARAPRA------
A0A5B9QX47      ALPFLLGLLW-------EFRVRRISDGSTLSKMTGLAP-----VVGEVSRLPAG------
M5T666          MVPFLFGLLW-------ELKVQRLTDAETHDKTGQLAP-----VLGEVARLPAG------
M5U6N6          AVPFFLGLLW-------EYKIQRLTDAETHDKNHDLAP-----VLGEIARLPAG------
A0A517M0G2      AIPFFLGLLW-------ELRSQKICDSAKLE-SKLMAP-----IMGEVAKLPPK------
A0A5C6AST1      AIPFLLGLLW-------EFRSQRICDAAALG-SKDLAP-----VIGEVARIPTK------
A0A5C6C951      AIPFLLGLLW-------EFRTQRISDATTLE-SKDVAP-----VIGEVARLPSK------
A0A5C6C5T3      VIPFLIGLLW-------EFKVQRLTDAETHDKTGLLAP-----VLGEVSRLPAG------
A0A2A2W6A9      AIPFLIGLFW-------EFMTKRITDSKDLERSLALAP-----VIGELARAPRG------
A0A518HQS9      AIPFLIGLLW-------EFRTKRITDSLDLEKSHTLAP-----VVGELARAPRA------
A0A5M6DFE6      LIPFVFGLLW-------EMRTNRVTDIQVLEKTGGLAP-----IVGELARSPAG------
A0A5C6F286      LIPFLIGLAF-------EYRVQRVTDASSFSKAGDMVP-----IMGEVARLPTG------
A0A517NGN1      AIPFLVGLLW-------EMRTQRITDANAVDRCAVLAP-----VVGELTRAPID------
M5RUI3          CIPFLLGLLW-------ELRVQRVTDSAAVDRSQSLAP-----VVGEIAQLPSG------
M5S2L2          ------------------------------------------------------------
A0A523CME0      -----------------------IQQTEASELMMGT-R-----SFSPKFKIDS-------
A0A354PCV3      AVPFFFALLW-------EL---RVRRVTDSSMSGGL-S-----LVGEVARMPA-------
A0A354PHB4      AVPFFLGLLW-------EL---RVRRVTDSSMCGGL-S-----LVGEVARMPA-------
A0A356ESF4      ALGLLAVHVL-------DTLDDRFRGIDDLQNQLRT-T-----VLAVLPKL---------
A0A538RV31      ALVFLVIAYW-------EFLARRIITGDDVVYGLGW-R-----LVGAIPDLPSRQ-----
A0A2D6A9B6      ----------------------------------------------------MSEPETNP
A0A2G6JGH3      ----------------------------------------------------MSEEPQEE
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      ---------------------------------------------------STHQLTYDL
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A1V6CUG1      RVTPAADAAP-------APAPAPASQDAKAPALQAP-P-----IIQSVGAAKVIGH----
A0A3M1SE88      ----------------------RFRSIEEMQLQLRT-P-----VMAVIRRMKPREFLGPK
A0A660WB30      VLGGALTLLA-------EMTDHTVKRPTDLRRIVDR-P-----VLAAIPSLDIGRFHTPE
A0A660W9Z7      GAAAGTVVEP-------HSLPSTETDMEEFRRTI-------------------RR-----
A0A3M1R9K7      ACPVALILWW-------DTRGKRINTPAEVVRTTGL-D-----LLGTVPLVPAKA-----
A0A3L7PH51      ALGLGLIYVL-------DALDDRFRSPDELQWQLGL-P-----MLAMIRKMEPME-----
A0A3N5UQY5      VLGGGIAAAR-------DWIDQTIRSTEEISTIFRL-P-----VLGGGPAMSRRK-----
                                                                            

A0A356AE44      ---AKNLQAARETGLAPMLYYYHDPGSPE------------------AEACRSVRATFFV
A0A1G2XSU7      RQ--------------------------L------------------ADDYHSICINLGL
A0A350KD81      ------DAVVDDSEFAPALWYYYRPASRE------------------AESFRSLRTSLLL
A0A2E3Z6T8      -----------NGENLETIHTHACPNAPE------------------TEAFRTLRTVLSL
A0A257WQ92      -----IDPHVIRGGMHSALRYLLAPRSME------------------AESYRSLRTALNV
A0A356ETW1      --------DVPETSGLEAIQLHVAPASTE------------------SEAFRTLRTALAL
A0A3L7NJY1      --------EQLPGAGFEAVLSHLKPHSKD------------------VEAFRALRTSIEF
A0A2D6SRY7      ----LAERGRRKRVRPDRLISSMELGSIA------------------MEAYRCLRTNIQF
A0A1G3C300      ---------KENKDANLELLTSEAPKSVF------------------SETIRNIRTGIML
A0A524HC32      -------------NSGIESTFVRHPRTMF------------------SEAIRSSRVSIQL
A0A660VT66      ----------SEDPRENDRICERMPRSVF------------------AEVYRNLRTSLIF
A0A0S8H0S8      -----------RSLQSGAQTVLMDPASPA------------------AEAYRDIRTAVCF
A0A177PV03      ----GHVPGTPATAMESILCTYYQPKSVQ------------------AEAFRGIRTALYF
A0A1G2YIM0      AK--------------------------L------------------ADDYQAIRANLGL
A0A1G2ZG92      --------------KDMSIISKLNPTLPV------------------VEAYRTIRNSIQY
A0A1G3A0W0      --------RFPQKPFGKSLCEQKYAQDRM------------------AESIRLVRTALLS
A0A353BE27      ----LSKVKKSVEAVDPAVCAIHHSKGRV------------------AEAYRSVRTGLYF
A0A5C6BPW1      ----KAKKTAKSAFWHSVL----------------------------TESIDAARTVLIR
A0A1I3GSP0      ----DLDRIAQQRGLSPALCYYHRPGSRE------------------AEAYRSVRTTLFV
A0A517QJV1      ----DSERLAKETGLTSALVFLHRPGSRE------------------AEAFRTIRTTLFH
A0A3C1QS25      ----SKQKQTEGITFDGTAISVHQPKSKI------------------SEAYRAVRTALFF
A0A5C6FX55      GSGQNADKDSPYKELDPCLAVLHSPSSVA------------------AESVRSLRTATYF
A0A3L7UX05      ----KLMGGIDETRLRRQLVEY-------------------------IQSIDHLRVAISA
A0A5C6DS51      ----MNIPSPSETSLAPSLITSHCPRSAE------------------AEVYRVARTSLMI
A0A5C6DSL6      ----LPMPAPGETPLAPSLVTEHCPRSAE------------------AEVYRVARTSLMI
A0A3M1VG27      ----ATEHGPPTARKCAQWYRLY-PRSGE------------------AEAFRVVRTRLLV
A0A518GC22      ----ISKVKKSVEAVDPSICAIHHSKGRV------------------AEAYRSVRTGLFF
A0A3L7Q373      ----TTSNG-----LSPSLVYYHRPGSRE------------------AEAFRSIRTTLFH
A0A3E0PW54      ----SAAAARSASALDPRLCYYHRPGSRE------------------AEAYRSVRMAVLR
A0A1Z8MHR4      ----K-VGDPHVDQLDPKLAVVHRPYSAA------------------AEAVRGVRTAMLF
A0A5C6EHJ0      ----KFEKGEPGENLDSRLVTFFNGKGQK------------------AEAFRAIRTAIYF
A0A5C6F1H9      ----KVEPGEVGEHLDSRLVTFFSGKGQK------------------AEAFRAIRTAIYF
A0A255QXY0      ----DSMDGENGSSLCDKISVVHRPHSPA------------------AEAVRAVRTAIML
A0A517SYI0      ----K-VGDPHVDQLDPKLAVVHRPYSAA------------------AEAVRGVRTAMLF
A0A518HX54      ----KQMPTDSIARLDPKLAVIHRPHSPA------------------AEAVRAVRTAMLL
A0A5B9MF59      ----KGMVDSAISNLDPKLSVVHRPYSPA------------------AEAVRGVRTAMLF
A0A2A2WC24      ----KGLVDSEIAKLDPKLSVVHRPYSPA------------------AEAVRGVRTAMLF
A0A518KYW8      ----KGLVDSEIAKLDPKLSVVHRPYSPA------------------AEAVRGVRTAMLF
A0A5C5YZZ0      ----TSQKASAFPKTASIVTVLHEPHAPC------------------SEAFRSIRTNLFS
A0A518JLD2      ----KVDADHVGAALDSRLCTFFQRKGMN------------------SEAFRALRTAVFF
A0A5M6DJ15      ----NDDN------------FVHGAFGNS------------------VNSI----VAMLV
A0A3L7P7S7      ----MDEEEKALCKVDPTLICFHNPKSQE------------------AEFFRGLRTALYF
A0A517N8M1      ----AKGETNPYEKFDPSLAVVHMPASIP------------------AEAIRSCRTSVFF
A0A5C6CW01      ----TKDEINPYKDLDPGMAVLHQPASVA------------------AEAIRSCRTAIFF
A0A5C6BXS9      ----KPDNPNPFEELDPHLAVVHTPSSVP------------------AEAIRSCRTSIFF
M5U569          ----KPDNPNPFEKLDPYLAVVHQPASVP------------------AESIRSCRTSIFF
L7CND7          ----KGEASNPFELLDPHLAVVHAPSSVA------------------SESIRSCRTSVLF
A0A0J1B8S4      ----KGETSNPFEQLDAHLAVVHAPSSVA------------------SEAIRSCRTSVLF
F2ARR3          ----KGDKSNPFEHLDPHLAVVHAPSSVA------------------SESIRSCRTSVLF
K5D8H6          ----KGDKSNPFEHLDPHLAVVHAPSSVA------------------SESIRSCRTSVLF
M2AKU0          ----KGDKSNPFEHLDPHLAVVHAPSSVA------------------SESIRSCRTSVLF
A0A5B1CKI2      ----GKDEVNPYEKLDPALAVIHMPASVP------------------AEAIRSFRTSVFF
A0A5C6EG84      ----IKGDMNPYEKFDGSLAVVHMPASIP------------------AEAIRSCRTSVFF
A0A5C6F2X4      ----VKGDINPYEKFDQSLAVVHMPASIP------------------AEAIRSCRTSVFF
A0A5C5XTV6      ----KIDNPNPFEELDPHLAVVHTPSSVP------------------AEAIRSCRTSIFF
A0A5C6AAB1      ----KPESPNPFEQLDPHLAVVHAPSSVP------------------AESVRSCRTSLFF
M5T8W8          ----KPDHPNPFEKLDPYLAVVHQPASVP------------------AEAIRSCRTSIFF
M5SF00          ----KGEASNPFELLDPHLAVVHAPSSVA------------------SESIRSCRTSVLF
A0A2G1WDS1      ----KGEASNPFELLDPHLAVVHAPSSVA------------------SESIRSCRTSVLF
Q7UVS9          ----KGEASNPFELLDPHLAVVHAPSSVA------------------SESIRSCRTSVLF
A0A5C6B601      ----KTVMDKELSRLDPKLSVVHRPYSSS------------------AEAIRGIRTALFF
A0A517PFU1      ----GKRIREGVP--DAGLSTVLRPKSQL------------------AESYRAVRTGLLS
A0A5B9M8J9      ----GPGPTGSIEQLDSKLAVIHRPHSPA------------------AEAVRAVRTAMLL
A0A2A2WFP6      ----KQMPTNSIARLDPKLAVIHRPHSPA------------------AEAVRAVRTAMLL
A0A518L8N2      ----KQMPTNSIARLDPKLAVIHRPHSPA------------------AEAVRAVRTAMLL
A0A518HQN9      ----KGLVDSEIAKLDPKLSVVHRPYSPA------------------AEAVRGVRTAMLF
A0A5M6D8H8      ----AGTVAPEIAELDPQLSVVHRPYSPA------------------SEAVRAVRTAMLF
A0A5B1CRW9      ----AAKAGSAL---DPSLMAYHSPRSQE------------------SEIFRVGRTSMMI
A0A5C6EI46      ----AAIAGSQL---DPSLLTYHTPRSAE------------------AEIFRVGRTSLMI
A0A2E7D3V4      --SLMDQMLYEQSPLQPSLCYFHRPGSSE------------------AEAYRSVRTALFV
A0A2S8F9B8      ---IVRKPKSLSVDLGSF-------EDQV------------------RDSSDSVAATILR
A0A368KP63      ---ITRKPKALAVNLGPF-------EDRV------------------RDSSDSVAATILR
A0A2E0SHG0      ---RITKLADRGSRLSPVLVTHHIPQSPE------------------AEIFRALRTNLYY
A0A518CQB8      ---RLTKLADKKSKLSPVLVTYHIPQSPE------------------AEIFRSLRTNLYF
A0A5B9PER9      EGSAIEPIVCSYHRPKSQ----------V------------------SEAFRAVRTSLFF
A0A517QSM4      VDDGKRKLSSQQVALRSV----------L------------------KEAIDSTRAVLLR
A0A355GJI7      DESEFAPALWYYYRPASR----------E------------------AEAFRSLRTSLLL
A0A1Z8MCI4      ----------GSKSGRQF----------Y------------------ERSVMALALRLGC
A0A517SYL7      ----------GSRSGRQF----------Y------------------ERSVMALAVRLGC
A0A3L7P0L2      ---AVSDRLAVQNGLSPALVYFHRPGSRE------------------AEAYRSSRTTLYH
A0A142XL75      PPPS------------------------L------------------VEAIDATRTMLVH
A0A517SCC8      ---PEAERAARNSRLHPRLCYSHHPGSRE------------------AESFRTIRTALLF
A0A3A0DR44      VLSGGAASRRKIRRDLGL----------F------------------QESVDGLRTCLLL
A0A358MY60      ---------VGQGKRQRV----------F------------------EESIDTLRANLML
A0A517MNB1      ---------AGSSKRQRV----------F------------------EESIDTLRANLML
A0A517XRC2      -ASLKAAEAAGNANWRFI----------L------------------NESINSTRTMLLH
A0A142YJ13      ------RLDDPSGRDRDR----------L------------------VQSIDAVRTMLLS
A0A517Z7D3      DTSRLGAELFYYHHPGSR----------E------------------AEAFRSIRTTLYA
A0A5C1AGE3      -QSIKTGEADANQNWRFI----------L------------------NESVNSTRTMLLH
A0A142XAP8      -ASLQAATEAGGANWRFV----------L------------------NESINSTRTMLLH
A0A2Z3HEL7      -ASLQAAVEAGGANWRFV----------L------------------NESINSTRTMLLH
A0A1N6KY57      -RLMLGSGAAQHRRWGSM----------L------------------IESVDAARTALLH
L0DK20          -SRGMKLREAESVRWRSM----------L------------------VESVDAARTTLLH
A0A660UUK3      QQ--------------------------L------------------SDDYQTIRANLGL
A0A517ZHG5      QKSSKAKKTAKSAFWHSV----------L------------------TESIDAARTVLIR
A0A1Z8MPL5      RAPTPEAIEDLQVT--------------M------------------EESIDGLRAMLLH
A0A5C6C1R5      ENFSDCE---------------------F------------------GNSVSSIVAMLVN
A6BZU4          DDSEFAPALWYYYRPASR----------E------------------AESFRSLRTSLLL
A0A2D5GZ77      DDSEFAPALWYYYRPASR----------E------------------AESFRSLRTSLLL
A0A3D3R1Z6      DDSEFAPALWYYYRPASR----------E------------------AESFRSLRTSLLL
A0A517XG00      DDSEFAPALWYYYRPASR----------E------------------AESFRSLRTSLLL
A0A1G2YRE4      DQ--------------------------I------------------AGEYQTIRANMGL
A0A353Z859      -RGGKNSEGGGGQRWQGA----------L------------------IESIDSARVMLLR
A0A2D6ST10      ----SSRRPTGDNRGKTAFWNSV-----L------------------SESIDSARTVLLR
A0A177QX42      KDAQVDSSISVHHRPKSR----------L------------------AESYRAVRAAIFF
A0A517SHR0      KDAKVDSSISVHHRPKSR----------L------------------AESYRAVRAAIFF
A0A2E0AW64      --ADGQRHSRRVTRQLRL----------F------------------EESVHHLRTSLVL
A0A351FZ59      --ADGQRHSRRVTRQLRL----------F------------------EESVHHLRTSLVL
A0A660V239      RQ--------------------------L------------------ADDYQAIRANLGL
A0A177Q3B7      --ATLAAGANGTHARDLV----------F------------------VEHVDAARTSLLH
A0A2E0X6Y6      -VGEGFDLVHAYVSPNKP----------E------------------TEAFRTLRTALTL
A0A518GFD7      ---------PLVSPGQAKKGRDYQRAVEL------------------AEAIDSVAAMVLH
A0A5C5VZJ8      -------------LRRGVSAEVLTNCPIQ------------------TESVRVLRTAFLN
A0A518GE37      ---------ARSTQGHRL----------F------------------EESIDALRANLLF
A0A5C6F3H8      ---------SRSQKGRRV----------F------------------EESIDTLRANLFL
A0A5C5X072      ---------SGSRKARRV----------F------------------EESIDSLRANLFL
A0A5C5WUQ3      ---------THGGRARRV----------F------------------EESVDTLRSNLFH
A0A5C6E697      ---------NKNSKARRV----------F------------------EESVDSLRANLLL
A0A5C5Z1A3      ---------PRSSRGRRV----------F------------------EESIDSLRANLFL
A0A5C6D2P7      ---------PQSSRSRRV----------F------------------EESIDSLRSNLFL
A0A5B9ML17      -TASRGS------KGRRI----------F------------------QESVDTMRANIFL
A0A517LX75      ---RKEKKAAKQSKLSPLCRTVFAPHSTE------------------AEVLRMARTGLFV
A0A354GX32      -------------VRATAPVAGDQSMGPM------------------IESMDGIRTRLLH
A0A5C1AAF0      -------------VHRQSGVKKEYWHSVL------------------TESMASTQMFLRH
A0A5C6B3S0      HQNQRTHWMGR-----------------L------------------TEAVDSVAAVFIR
A0A518GIZ9      PVQNVHPSLRYLRSPASI----------E------------------AENYRTIRTSLLV
A0A1C3EBY9      PVQNVHPSLRYLRSPASI----------E------------------AENYRTIRTSLLV
D5SX64          PVQNVHPSLRYLRSPASI----------E------------------AENYRTIRTSLLV
A0A517Z0U7      RTHHKAA------YWHSV----------L------------------TESIDAARTLLLR
A0A2S8FCC0      KNSKKQQ------YWKSL----------I------------------AESIGGIVARLFR
A0A1Z8MBT6      -SGARQS------RGRRV----------F------------------XESVDSLRANLAL
A0A517SXN9      -SGARQS------RGRRV----------F------------------EESVDSLRANLAL
A0A518HFL0      ---------RSADRNRLEGPGHDPKFEQF------------------VQQLDHLRVALCG
A0A5Q3LBQ3      -----SRNARRAGRARGL----------F------------------EESVDSLRTGLVL
A0A3B8ZJM2      DTVDPSLITIHHSRGR------------I------------------AEAFRSVRTGLFF
A0A1U7CLW1      ----RRGDQKQIERDRLV------------------------------QSIDAVRTMLLN
A0A142WPR7      SNDAVHPSLVTFHRPKSR----------L------------------AEAYRAVRTSLYF
A0A3M1TFJ0      --SGRELDRYALSNPSSA----------Y------------------AEAFRRARVQL--
A0A517P477      --GAGAGAGQRGSDWNEA----------L------------------KESVDAARVVLLR
A0A517T4K9      ----VTGSPKPDDDARRVFWKSR-----L------------------TESIDAARTMILK
A0A2Z3GZZ5      EPATYDPLLVAALRPKSS----------E------------------AEAYRGLRTQLYF
A0A4V0I6L6      PAAAVDPTLVVWLRPKTA----------E------------------AEAVRGLRTQLLF
A0A255QXF5      -TGSRNS------KGRRV----------F------------------EESVDSLRANLAL
A0A518KBI5      ---RVAA------NPRQIPRKLRKEMFAF------------------AESIDALRMSLTF
A0A5C5V6Q5      ---RVAA------NPRRLPRRIQKEMYSF------------------AESIDSLRMSLTF
A0A517MY49      ATIHTAT------MPNAV----------E------------------TESFRTLRTSLTL
A0A2E6AG00      NALHVAT------TPDSV----------E------------------SEAFRTLRTTIAF
A0A1G3A880      AGVQANA------APDAV----------E------------------SEAFRTLRTALAF
A0A2E8ATT1      GALQVHA------SPDAV----------E------------------SEAFRTLRTTLAF
A0A518KYQ0      -AVGRNS------KSRRV----------F------------------EESVDALRANLAL
A0A5B9QX47      -S--GSR------RSRRL----------F------------------EESIDTLRSNLFL
M5T666          -A--GAV------KGRRV----------F------------------EESIDTLRANLFL
M5U6N6          -H--GAA------KGRRV----------F------------------EESIDTLRANLFL
A0A517M0G2      -F--GSR------KGRRV----------F------------------EESIDTLRANLLL
A0A5C6AST1      -V--GVG------KRQRV----------F------------------EESIDTLRANLML
A0A5C6C951      -I--GVG------KRQRV----------F------------------EESIDTLRANLML
A0A5C6C5T3      -S--GSQ------KARRV----------F------------------EESIDSLRSNLFL
A0A2A2W6A9      -STGRNS------KSRRI----------F------------------EESVDTLRANLAL
A0A518HQS9      -ASGRNS------KSRRV----------F------------------EESVDALRANLAL
A0A5M6DFE6      -QNGRGS------RGRRV----------F------------------QESVDTLRANLFL
A0A5C6F286      -S--RSQ------KRRRV----------F------------------EESIDTLRANLFL
A0A517NGN1      -P--RNS------KGRRI----------F------------------EESVDALRANLFL
M5RUI3          -A--RNG------RGRRI----------F------------------EESVDALRANLFL
M5S2L2          ------------------------------------------------------------
A0A523CME0      --------------------------NHVDERIVSYYDFLGKQTWEGPVMVHFRRLQISL
A0A354PCV3      -----------------------GTRGTKDRRIF-------------QESVDTLRSNLFL
A0A354PHB4      -----------------------GTRSTKERRIF-------------QESVDALRSNLFL
A0A356ESF4      ------------------RVANGAGIDSLQVHVA-------------PDTRESEGFRTLR
A0A538RV31      ----------------RRNLTLDGEANKHWNSLL-------------TESVDAARALLLR
A0A2D6A9B6      ALTDG------VLVIVERTVNPYLVCFHEPNGFR-------------SEQIRALRNRLTV
A0A2G6JGH3      RANDEERGDATPFVLVDRVVDPYLVCFHEPRGFR-------------AEQFRALRSKLLV
A0A3L7SU85      ------------------------------------------------------------
A0A3M1RAJ8      GIHVVGSLPLVHKRRLLPNPVYNGSVPDDIRAVL-------------HESVDNIRTTLIH
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A2Z3GYP4      ----------------AVELDSGLATVHSAMSPE-------------AEAYRGVRTALFF
A0A1V6CUG1      ----------------NGSFSEVLVTHHDRGGRI-------------TEEYRSLRTHLLA
A0A3M1SE88      SL----------------------QVVAEPDSPE-------------SEGFRTLRTALAL
A0A660WB30      NLFFRTKRVVEADLESGMLYDRNYVREIRHRSIA-------------TEQIRKLRLRMN-
A0A660W9Z7      ----------------VERFQFSPECSFSHSSEI-------------GEKFREIRANLQV
A0A3M1R9K7      ----------------AKQLHSEGKRYHHWRAIF-------------TESVRGIAARLIR
A0A3L7PH51      ----------------GTGMELI-VTHMQPNSVE-------------SESFRSLRNFITF
A0A3N5UQY5      ----------------SVPVRGR-KVLLEPSSRE-------------AEAFRIVRTAVFF
                                                                            

A0A356AE44      RA---ADV-----------DAHIIQFTSSEPGDGKTTTISNLGISIAQA-GKRVLLIDAD
A0A1G2XSU7      MN---NCT-----------IPNKLVISSASPREGKSTLAVNLATNLAKI-GKKVLLIDGD
A0A350KD81      KT---DRS-----------GAKVLQMTSAEPGDGKTTSISNLALAIAQT-GRKVLIIDAD
A0A2E3Z6T8      SE---Q-------------NCERILISSSEPGDGKTTISANLSVALAQA-GHRTLVIDAD
A0A257WQ92      TS---DNA-----------HANVILVTSPETGDGKTTTISNLAIAMAQS-GKRVLLVDAD
A0A356ETW1      AD---REL-----------NR--IVVTSAEPGDGKTTIIANLATCYAQS-NKKTLLIDAD
A0A3L7NJY1      SP---EET-----------RR--LVCTSTEPGDGKTTVSSNLAVAFAQS-GRRTLLIDAD
A0A2D6SRY7      AA---PDT-----------KTPCYLVTSAGPGEGKSLTTSNLAIAIAQL-GRRVVLVDAD
A0A1G3C300      ST---TDT-----------PHKSLLITSTKQGEGKSFIAANLAIAFAQT-GKKTLLVDTD
A0A524HC32      SG---ADT-----------RCKSFLITSGIPNEGKTTIAANLALSFAVA-GERVMLIDVD
A0A660VT66      SF---KEE-----------GPKSILVTSPGSLEGKSTIVSNLGIAFAQN-GQKTVIIDGD
A0A0S8H0S8      GV---REG-----------QVKTLLVTSAQAGDGKTTLVSNLGIAMAQA-AQRTLILDAD
A0A177PV03      SL---RSG-----------DYKVIQITSPEARDGKTTLSANLAVSIAQS-GKKVVLLDAD
A0A1G2YIM0      FN---EEK-----------IPHILAITSARPQEGKTTFAINLASSMAKA-GARVLLVDGD
A0A1G2ZG92      AS---LDK-----------PMKTIVVTSSMESEGKSSMSSNISITYSME-KKKVILVDLD
A0A1G3A0W0      RL---GGP-----------RNTALLITSAVAGTGKSYFTMTLGESLARA-GKKVLMIDAD
A0A353BE27      SN---KGK-----------ALKVIQVTSPVPGDGKSTLSSNISVTMAQS-GRRVLLIDAD
A0A5C6BPW1      DA---NVE-----------STRLVMVGSAISGEGKTTLSCHLAASLARV-GRNTLLVDCD
A0A1I3GSP0      SM---RE------------DHKVVQVSSAAPGEGKSTTAANLAIAIAQS-GKKVLLVDCD
A0A517QJV1      GL---RN------------NEKVLQITSAEPGDGKSTIAVNTALAMAQA-GKRVLLIDCD
A0A3C1QS25      SN---RQR-----------DIKVIQVTSPSPGDGKSTLALNLAVSIAQS-GQKVLLVDAD
A0A5C6FX55      EL---AGV---------Q-GGKILQVTSPLPGDGKSTIAGNLACAIAQS-GKSVLVIDCD
A0A3L7UX05      SL---GST---------H-EHQSILITSAFGGEGKTTLSAQLAGRCANA-GLSTVVVDGD
A0A5C6DS51      KA---SGQ-----------EAQVLMMSSPHPGDGKSTTIANLAISFAQT-GKRVLLIDSD
A0A5C6DSL6      KS---RGQ-----------GTQVLMMSSPHPGDGKSTTIANLAISFAQT-GKRVLLIDSD
A0A3M1VG27      SL---HDE-----------HHRVLQITSPEPNDGKTTVACNLALAVAQS-GKRVLLLDAD
A0A518GC22      SN---NGK-----------ALKVLQVTSPVPGDGKSTLACNIAVTMAQS-GRRVLLIDAD
A0A3L7Q373      ST---KES-----------QDKLIQITSAEPGDGKSTTAANLAIAIAQS-GKRVLLIDAD
A0A3E0PW54      NQ---PES-----------GGQAVQMTSAEPGDGKSVSAANLSLAIAKS-GKRVLLIDAD
A0A1Z8MHR4      EQ---RQF-----------NSKVFQVTSPLPGDGKSTLVGNIGCLVAQS-GKRTLLIDLD
A0A5C6EHJ0      SN---QSG-----------NNQVLQMTSSTPSDGKSTIAANVAVAIAQS-GRKVLLLDGD
A0A5C6F1H9      SN---QSG-----------NNQVLQMTSSTPSDGKSTIAANVAVAIAQS-GRRVLLMDGD
A0A255QXY0      ER---KKN-----------GSQVFQITSPLPGDGKSTLAANVGCSIAQT-GKTTLLIDLD
A0A517SYI0      EQ---RQF-----------NSKVFQVTSPLPGDGKSTLVGNIGCLVAQS-GKRTLLIDLD
A0A518HX54      DR---RQT-----------DSKVFQITSPLPGDGKSTLAANVGCSIAQS-GKRTLLIDLD
A0A5B9MF59      DR---RQF-----------DSKVFQITSPLPGDGKSTLAANVGCSVAQS-GKRTLLIDLD
A0A2A2WC24      DR---RQY-----------NSKVFQITSPLPGDGKSTLAANVGCSVAQS-GKRTLLIDLD
A0A518KYW8      DR---RQY-----------NSKVFQITSPLPGDGKSTLAANVGCSVAQS-GKRTLLIDLD
A0A5C5YZZ0      TA---GGA---------P-EYQVIQVTSALPGDGKSTIVANLAASVARA-NKRVLIIDAD
A0A518JLD2      SN---QSG-----------DNQILQITSATPSDGKTTTAGNLAITMAQA-GKSVLILDAD
A0A5M6DJ15      NK---AKF---------E-DANIIMVSSAVSGEGKSTLARSLWRGLAEA-KYRTVIVDFD
A0A3L7P7S7      ST---QGH-----------GHQVLQATSPVAGDGKSTTAANLAISIAQS-GKKIVLLDAD
A0A517N8M1      EL---TG----------Q-RGKVIQVTSPLPGDGKSTIAGNLACSIAQS-GKRTLVIDCD
A0A5C6CW01      EL---AGI---------D-GGKVVQVTSPLPGDGKTTVAGNLACSIAQS-GKRVLVIDCD
A0A5C6BXS9      EL---AGV---------P-TGKILQVSSPLPGDGKSTISGNLACSIAQS-GKRTLLIDCD
M5U569          EL---SGI---------P-GGKILQVTSPLPGDGKSTIAGNLACSIAQS-GKKTLLIDCD
L7CND7          EM---AGI---------P-GGKIIQVTSPLPGDGKSTIAGNLACSIAQS-GKRTLIIDCD
A0A0J1B8S4      EM---AGI---------H-GGKIIQVTSPLPGDGKSTIAGNLACSIAQS-GKRTLIIDCD
F2ARR3          EM---AGI---------S-GGKIIQVTSPLPGDGKSTIAGNLACSIAQS-GKRTLIIDCD
K5D8H6          EM---AGI---------P-GGKIIQVTSPLPGDGKSTIAGNLACSIAQS-GKRTLIIDCD
M2AKU0          EM---AGI---------P-GGKIIQVTSPLPGDGKSTIAGNLACSIAQS-GKRTLIIDCD
A0A5B1CKI2      ET---SGP-----------GCKVIQVTSPLPGDGKSTIAGNLACSMAQS-GKRVLVIDSD
A0A5C6EG84      EL---AGS-----------GGKVIQVTSPLPGDGKSTIAGNLACSIAQS-GKRTLVIDCD
A0A5C6F2X4      EL---TGSGSWGSAEKSP-GGRVIQVTSPLPGDGKSTIAGNLACSIAQS-GKRTLVIDCD
A0A5C5XTV6      EL---AGI---------Q-GGKILQVSSPLPGDGKSTISGNLACSIAQS-GKRTLLIDCD
A0A5C6AAB1      EL---ARV---------P-GGKIIQVTSPLPGDGKSTIAGNLACSIAQS-GKRTLLIDCD
M5T8W8          DL---SNV---------P-GGKIIQVTSPLPGDGKSTIAGNLACSIAQS-GKKTLLIDCD
M5SF00          EL---AGV---------E-GGKVLQVTSPLPGDGKSTIAGNLACSIAQS-GKRTLIIDCD
A0A2G1WDS1      EL---AGV---------E-GGKVLQVTSPLPGDGKSTIAGNLACSIAQS-GKRTLIIDCD
Q7UVS9          EL---AGV---------E-GGKVLQVTSPLPGDGKSTIAGNLACSIAQS-GKRTLIIDCD
A0A5C6B601      DR---RAY-----------DSKVFQITSPLPGDGKSTIAANIGCSIAQS-GKKVLLIDLD
A0A517PFU1      AA---RN------------GVKVVQVTSPDRGDGKSTLTANVAVTLGRV-GKRTVLVDVD
A0A5B9M8J9      DR---RQN-----------DSKVFQITSPLPGDGKSTLAANVGCSIAQS-GKRTLLIDLD
A0A2A2WFP6      DR---RQT-----------DSKVFQITSPLPGDGKSTLAANVGCSIAQS-GKRTLLIDLD
A0A518L8N2      DR---RQT-----------DSKVFQITSPLPGDGKSTLAANVGCSIAQS-GKRTLLIDLD
A0A518HQN9      DR---RQY-----------NSKVFQITSPLPGDGKSTLAANVGCSVAQS-GKRTLLIDLD
A0A5M6D8H8      DH---RQY-----------DSRVFQVTSPLPGDGKSTLAANVGCSIAQS-GKKTLLLDLD
A0A5B1CRW9      AN---RKD-----------SVQTMMVTSPQPGDGKSTTIANMAISFAQT-GKRVLLIDAD
A0A5C6EI46      AN---RKD-----------SVQTIMVTSPQPGDGKSTTISNLAISFAQA-GKRVLLIDAD
A0A2E7D3V4      SG---SGR------------SQAIQVSSPEPGDGKTTFISNLAIAIAQS-GRKVLLIDAD
A0A2S8F9B8      RA---ADQ-----------QCQVLLISSAMPREGKSSLACHLAISLAHA-GRKVVVVDFD
A0A368KP63      RA---ATQ-----------KCQVLLISSAMPQEGKSSLTCHLAISLANA-GRRVVIVDFD
A0A2E0SHG0      GT---HGS-----------TPKVVQFTSPNPKDGKSVTTANLAISLAQT-GKSVLLIDCD
A0A518CQB8      GT---HGQ-----------SPKVVQITSPNPKDGKSVTTANLAISLAQT-GKSVLLIDCD
A0A5B9PER9      NT---QNH-----------QHSVIQITSPTPGDGKSTLASNLAVSIAQS-GKRVLLVDAD
A0A517QSM4      DP---RMK-----------VMNTILITSASDGEGKTSNACHLAASLARS-GRKVVLVDCD
A0A355GJI7      KT---DRS-----------GAKVLQMTSAEPGDGKTTSISNLALAIAQT-GRKVLIVDAD
A0A1Z8MCI4      LK---VLS-----------AGKVVGVVSGVSGEGKSTVTFGLACMLGHSKHLKVLVIDAD
A0A517SYL7      LK---VLS-----------AGKVVGVVSGVSGEGKSTVTFGLACMLGHSKHLKVLVIDAD
A0A3L7P0L2      ST---KDS-----------QDKIIQITSAEPGDGKSTTAANLAIAIAQS-GKKVLLIDAD
A0A142XL75      GT---DEP-----------DLRVLVVTSAVSGEGKTSLTGHLAISLARA-GFRTLLVDGD
A0A517SCC8      AC---QEH-----------NVRLLQFSSAEPGDGKTTTISNLAIAIAQS-GKKVLLIDAD
A0A3A0DR44      SE---ATS-----------SHRVFAVTSAVSGEGKTSLVSQLAISLARATGKRVLIVDAD
A0A358MY60      SK---QTK-----------DARTVTVASSMSGEGKSSVSSQLAISLAKACGETVLLVDAD
A0A517MNB1      SK---DTR-----------DVRTISVASSLSGEGKSSVSSQLAISLAKACGETILLIDAD
A0A517XRC2      TA---RSQ-----------SMQVVMVTSATQGEGKTSLSSQLASSMATA-GMRTLIVDCD
A0A142YJ13      VE---RQH-----------SFQVVMVTSATKGEGKTSLSCHLATSLARA-GRRTLLIDCD
A0A517Z7D3      SL---DGT-----------DDRLLQISSPEPGDGKSTTAANLAIAMAQS-GKRVLLVDGD
A0A5C1AGE3      TA---KTQ-----------SMQVIMVTSAMQGEGKTSLSSQLATSMATA-GLRTLIVDCD
A0A142XAP8      TA---KAQ-----------AMQVVMVTSATQGEGKTSLASQLATSMATA-GMRTLIVDCD
A0A2Z3HEL7      TA---KSQ-----------SMQVVMVTSATQGEGKTSISSQLATSMATA-GMRTLIVDCD
A0A1N6KY57      VS---RTE-----------SVRVVMIASALGGEGKTSLASHLATSLARA-GRRTLLVDGD
L0DK20          FS---RTE-----------SVRVVMVASALSGEGKTSLSSHLATSLARA-GRRTLLIDGD
A0A660UUK3      FN---GHE-----------STKVLVVTSPGVGDGKTTFAINIALSFAQS-GEKVLLIDGD
A0A517ZHG5      DA---NVE-----------STRLVMVGSAISGEGKTTLSCHLAASLARV-GRNTLLVDCD
A0A1Z8MPL5      LP---AAK-----------DVRTLMVTSALANEGKTTVASALATSMGRS-GRRTLLIDGD
A0A5C6C1R5      MS---RFD-----------RASVLMVTSGVSGEGKTTLATSLWRGLTQA-SYRTILIDFD
A6BZU4          KT---DRS-----------GAKVLQMTSAEPGDGKTTSISNLALAIAQT-GRKVLIIDAD
A0A2D5GZ77      KT---DRS-----------GAKVLQMTSAEPGDGKTTSISNLALAIAQT-GRKVLIVDAD
A0A3D3R1Z6      KT---DRS-----------GAKVLQMTSAEPGDGKTTSISNLALAIAQT-GRKVLIVDAD
A0A517XG00      KT---DRS-----------GAKVLQMTSAEPGDGKTTSISNLALAIAQT-GRKVLIVDAD
A0A1G2YRE4      LS---KNE-----------MPKILVITSPWMREGKTTLSINLATSLAKS-GKKVLLIDGD
A0A353Z859      RA---SLE-----------NAKVVMVSSAVTSEGKTTMACHMGTSLARA-GYRTVVVDVD
A0A2D6ST10      DA---KVD-----------SLKAVMICSAVGGEGKSTLSCHLATSLARA-GRKVLLIDCD
A0A177QX42      GT---RGQ-----------THRVLQITSANSGDGKTTLCSNLASAIAMS-GKKVLLVDGD
A0A517SHR0      GM---RGQ-----------SHRVLQVTSANSGDGKTTLCCNLASAIAMS-GKRCLLVDCD
A0A2E0AW64      SR---PLE-----------DIQVLAVTSSVSGEGKTTLAAQLAMSIARASGQPTLLIDGD
A0A351FZ59      SR---PLE-----------DIQVLAVTSSVSGEGKTTLAAQLAMSIARASGQPTLLIDGD
A0A660V239      LD---GGG-----------ASKIIVVTSPGIGDGKTTFAVNLATSFAQS-GEKVLLIDGD
A0A177Q3B7      LA---KHG-----------EVQAILVTSAVGGEGKTSLACQLAASLARA-GFQTLLIDGD
A0A2E0X6Y6      SP---Q-------------AHSRLLVSSSEPSDGKTTVALNLAVTFAQA-GRRTLIIDAD
A0A518GFD7      RA---AVE-----------KRQVFMVSSALAGEGKSTISCQLSRSLAKS-GKRVLLVDFD
A0A5C5VZJ8      RL---KQA-----------GCSVVQFTSVGPRTGKSTLVGMLGRSLAAA-GKRVLLVDGD
A0A518GE37      KL---E-------------GARTIAVTSAMSSEGKSSVASQLAISLAKTSQTTVLLIDAD
A0A5C6F3H8      SM---DTS-----------NVRSIAVVSGMSGEGKSSVSSQLALSIAKATGETVLLVDGD
A0A5C5X072      SV---DTR-----------HTRSIAVVSSMSGEGKSSVASQLALSMAKSTGETVLLVDGD
A0A5C5WUQ3      SL---ATK-----------NIRSIAVASSMTSEGKSSVASQLAISIAKATGETVLLVDAD
A0A5C6E697      ST---DWK-----------HVRSIAVVSSVSGEGKSSVASQLALSIANATAETVLLVDAD
A0A5C5Z1A3      SK---QWE-----------GTRSIAVASSVSGEGKSSVASQLAISIAKATGETVLLVDAD
A0A5C6D2P7      ST---EWK-----------DTRTIAVVSSVSGEGKSSVASQLALSIAKATGNTVLLVDAD
A0A5B9ML17      SK---HTQ-----------HSRSIAIVSSMSGEGKSTAASQLAISLAKSSGKTVLLVDAD
A0A517LX75      HT---GRS-----------LDKVMLVTSPMPGDGKSTMIVNLAAAIAKA-GKSVLLVDAD
A0A354GX32      AG---RSE-----------TLRVVMVASAVSGEGKTTLASHLAASLARG-GRRTLLVDGD
A0A5C1AAF0      AG---NVG-----------LPRILLIASAEKGEGKTLLSTHLAAGFARN-GVKTLLIDGD
A0A5C6B3S0      KA---RLE-----------QHSVIMITSALAGEGKTTLASQLAVSLAAS-GQRTVLVDCD
A0A518GIZ9      TA---EAL-----------NAQVIQVGSPEPGDGKTTLVSNLALALASS-GKRVLLIDAD
A0A1C3EBY9      TA---EAL-----------NTQVIQVGSPEPGDGKTTLVSNLALALASS-GKRVLLIDAD
D5SX64          TA---EAL-----------NAQVIQVGSPEPGDGKTTLVSNLALALASS-GKRVLLIDAD
A0A517Z0U7      NS---QLS-----------GTRTVMIASATGGEGKSTLSCHLATSLARA-GRSVLLVDCD
A0A2S8FCC0      QS---GAN-----------KNRVVMISSALAGEGKTTLAGQIAYALAES-GARTVLVDFD
A0A1Z8MBT6      SQ---DTR-----------TARSFCIASSMSGEGKSTAASQLAISLAKSSGKTVLIIDAD
A0A517SXN9      SQ---DTR-----------TARTFCIASSMSGEGKSTAASQLAISLAKSSGKTVLIIDAD
A0A518HFL0      EG---GHDG----------RGRCVLITSAVGGEGKTTLAAQLAVRCAEA-GASTVLIDAD
A0A5Q3LBQ3      SE---PLR-----------DARVLAVTSAISREGKTSLSSELAVSIAQATGEPTLLIDGD
A0A3B8ZJM2      SS---RGS-----------ELKVVQITSPVPGDGKSTLSSNLAVAMAQS-GRRVLLIDAD
A0A1U7CLW1      AG---RHQ-----------PFRVVLVTSALKGEGKTSLSCHLATSLARG-GRKTLLMDCD
A0A142WPR7      RT---RGE-----------PLKVIQVTSPNPGDGKSTLSGNLAISIAQT-GKRVLLMDAD
A0A3M1TFJ0      ------NATGAFPSE----GCGVLVCVSGVPREGKTLCSVNLAVAEAQA-GRRTLLVDGD
A0A517P477      KL---GDGRGQTPESRLDAGGRVVLISSAVASEGKTTLSCHLAASLART-GRRVVLVDAD
A0A517T4K9      ES---ENS-----------GLQVVLIASALGGEGKSTLACHLSSSLARA-GRKTLLIDGD
A0A2Z3GZZ5      ST---QGR-----------GHQVIQVTSPTPGDGKSTLAANLALSVAQS-GKRTILVDCD
A0A4V0I6L6      SV---ANR-----------NHQVIQVTSPMSGDGKSTTAANLAIALARA-DKRVVLVDCD
A0A255QXF5      SK---DTR-----------DARTFAIVSSMSGEGKSTAVSQLAISLAKASGKTVLIIDAD
A0A518KBI5      SA---DSE-----------QQRIVAITSANSGEGKSSVSVALGMSFANATRRRTLIIDGD
A0A5C5V6Q5      CA---PSE-----------RNRVIALTSAVSGEGKTSVSVALAMSFANATGAKTLLVDGD
A0A517MY49      SP---T-------------SCERLLISSSEPGDGKTTVSANLAVAFAKA-GKRTLVIDAD
A0A2E6AG00      AG---D-------------DLKCVAVSSSEPGDGKTTVVANLGATFAQA-NXTTLMIDAD
A0A1G3A880      SP---H-------------ATERIAVSSSEPGDGKTTVLVNLAVSFAQA-GKRTLLIDAD
A0A2E8ATT1      SE---S-------------DTECIAVTSSEPGDGKTTVLANLGLVWAQV-GKKTLLIDAD
A0A518KYQ0      SK---DTR-----------HARSFAVVSSMSGEGKSTAVSQLAISLAKSSGNTVLIVDCD
A0A5B9QX47      SV---RTR-----------DTRSIAVASSMSGEGKSSVASQLAISIAKATGELVLLVDAD
M5T666          SV---DTR-----------ETRSIAIVSSMSGEGKSSVASQLALSIAKATGETVLLVDAD
M5U6N6          SM---DTR-----------NTRSIAVVSSMSGEGKSSVASQLALSIAKATGETVLLVDAD
A0A517M0G2      SK---ETS-----------GVRTLTIASSMSGEGKSSVASQLAISVAKASGKTVLLIDGD
A0A5C6AST1      SK---DTQ-----------GVRTIAIASSMSGEGKSSVASQLAISLAKACGKTVLLIDAD
A0A5C6C951      SR---DTV-----------GVRSITIASSMSGEGKSSVSSQLAISLAKACGKTVLLIDAD
A0A5C6C5T3      SV---DTR-----------HIRSIAVVSSMSGEGKSSVASQLALSMAKSTGETVLLVDGD
A0A2A2W6A9      SK---DTR-----------HARSFAVVSSMSGEGKSTAVSQLAISLAKSSGKTVLIIDCD
A0A518HQS9      SK---DTR-----------HARSFAVVSSMSGEGKSTAVSQLAISLAKSSGKTVLIIDCD
A0A5M6DFE6      SE---STR-----------DARSFAIVSSMSGEGKSTAASQLAISLAKATGKTVLLIDAD
A0A5C6F286      SM---DTN-----------KTRSIAVVSGMSGEGKSSVSSQLALSIAKATGGTVLLVDGD
A0A517NGN1      SQ---QTR-----------GARTIAICSSMSGEGKSTAAAQLAVSLAKASNKTVLLVDGD
M5RUI3          SL---DTK-----------HTRSIAVVSSMSGEGKSSVASQLALSIAKATDQTVLLVDAD
M5S2L2          ---MADIQ-----------GGKVIQVTSPLPGDGKTTLAGNLACSIAQ-SGKRVLVIDCD
A0A523CME0      NKMLRNVG-----------RSKVLIVASATQKEGKSTIALNTAITLCNN-NNKVVIIDCD
A0A354PCV3      ST---RWK-----------GTRSIAVVSSISSEGKSSIASQLSVSIAKATGKTVLLVDAD
A0A354PHB4      SS---SWK-----------DTRSIAVVSSISSEGKSSVASQLALSIAKATGETVLLVDAD
A0A356ESF4      TALALRDR-----------EARRLVVCSAEPGDGKTTVLANLGVSFAQA-QRKTLLIDAD
A0A538RV31      TA---RTE-----------AVRTVMVTSAVAGEGKTSLSCHLASSLARA-GRKTLLIDCD
A0A2D6A9B6      MN---PDG-----------SARSLVITSAIQGEGKTATALNLAMSMTELQDHRILVLDCD
A0A2G6JGH3      MN---PER-----------APRSVVITSAIQGEGKSSSAINLALAFAELEDQRAVLLDFD
A0A3L7SU85      ------------------------------AGDGKSTTSANLAISIAQ-SGKKIVLLDAD
A0A3M1RAJ8      RA---KKD-----------GLKVVMVTSGVAREGKSTVASQLAASLAR-AGRKTVLIDGD
A0A3D4PLL5      -------E-----------NHQRISITSTQPSDGKTTVISNTAVAFAQ-AGKKTLVIDGD
M5RD30          ------------------------MMTSPHPGDGKSTTISNLAISLAQ-TGKRVLLIDAD
A0A2Z3GYP4      ST---HGE-----------RHKVIQVTSPHMGDGKTTLIINLAVSIAQ-AGRKVLLLDAD
A0A1V6CUG1      QY---PDE-----------RF-CLLITSAMAGEGKTVTAANLAMVMAERIDRKTILVDCD
A0A3M1SE88      SE---SDA-----------D--TIVVSSTEPGDGKSTVAANLAAAFAQ-AGKKTLLIDGD
A0A660WB30      TT---TGE-----------RVRTILVTSALAGEGKSTVAANLAVAISQMIGEHVLLVDGD
A0A660W9Z7      LQ---VDR-----------SVKTLVFSSAHHKEGKTHTVVNTARFLSQHENRHTLLMDCD
A0A3M1R9K7      QA---KED-----------ETRVVLVTSAFGGEGKTTVASQLAISLAE-MGQKTILIDFD
A0A3L7PH51      SN---EAT-----------QRLVVTSTEPG--DGKTTTLANLAVAFAQ-AGKKTLLIDAD
A0A3N5UQY5      GA---PNG-----------KAKTTLITSPGMEDGKSTLVSNLAIAMAR-AGQKTLILDAD
                                                 **:                  :::* *

A0A356AE44      LRKP-----------------MVHQLF-GM------RE-EIGLS--------ECLS----
A0A1G2XSU7      LRKP-----------------DIAKYL-KL------DNKGKGMH--------QLL-----
A0A350KD81      LRRP-----------------TIHKLF-GL------AN-SIGLG--------DVLN----
A0A2E3Z6T8      LRRP-----------------GFTTLM-QL------KG-QPGVA--------DLLT----
A0A257WQ92      LRRP-----------------SVHTLF-NL------PT-DIGLA--------DVLA----
A0A356ETW1      LRRP-----------------GLTNLM-QM------RQ-QEGLS--------TVLR----
A0A3L7NJY1      MRRP-----------------GLSTLL-GL------RD-DFGLS--------RLLR----
A0A2D6SRY7      MRRP-----------------VLHGLF-GV------ER-GPGLS--------EILV----
A0A1G3C300      FRKP-----------------RQHKIF-GI------DL-KPGLS--------NHFI----
A0A524HC32      LRKP-----------------SLHNVF-----IPSTPVNGNGLS--------SFLA----
A0A660VT66      LRKP-----------------RLHRTF-EA------DN-SVGLS--------TVLA----
A0A0S8H0S8      LRNP-----------------MQHEVF-DV------AC-EPGLT--------GLLA----
A0A177PV03      FRKP-----------------RMHEIF-GV------SA-DVGVA--------SVIA----
A0A1G2YIM0      LRKP-----------------DIAKIL-NI------ETGHNALR--------KVLL----
A0A1G2ZG92      LRRP-----------------TAHKFF-KI------SN-NNGIT--------NILS----
A0A1G3A0W0      LRKM-----------------GLTRRF-NL------AG-KAGFI--------ESLR----
A0A353BE27      LRRP-----------------RVAKIF-GI------DS-EIGVA--------AVVG----
A0A5C6BPW1      FRKS-----------------NVHRVF-GV------EE-HPGLS--------EVLL----
A0A1I3GSP0      LRRP-----------------TQHTLF-QV------PQ-EVGLT--------DVLL----
A0A517QJV1      LRRP-----------------TLHHLL-GL------PQ-EIGFT--------DVLL----
A0A3C1QS25      LRRP-----------------RQHKVI-GE------NA-EHGFA--------AVLR----
A0A5C6FX55      LRRP-----------------QLTDNF-VM------QD-QLGLT--------NVLN----
A0A3L7UX05      LRNP-----------------TLTRTL-EA------TD-MPGLT--------NLLK----
A0A5C6DS51      LRRP-----------------VVAGLF-GL------EG-RLGLA--------DVLK----
A0A5C6DSL6      LRRP-----------------VVAGLF-GL------EG-QPGLA--------DVLN----
A0A3M1VG27      LRRP-----------------SIHKAL-GL------RQ-DIGVT--------DILR----
A0A518GC22      LRRP-----------------RVAKIF-GI------DS-DVGVA--------AVVG----
A0A3L7Q373      LRRP-----------------TMHTLF-GL------SQ-DIGLA--------DVLQ----
A0A3E0PW54      MRRP-----------------TVHELF-RI------KQ-DIGLS--------EVLL----
A0A1Z8MHR4      LRSP-----------------RLSLRF-NL------ST-NVGLT--------NVLN----
A0A5C6EHJ0      LRRP-----------------RVGKLL-GI------ES-EIGTAWAIEQCGPGSTD----
A0A5C6F1H9      LRRP-----------------RVGKVM-GI------EN-DKGTAWAIEQCEADAAG----
A0A255QXY0      LRSP-----------------RLSLRF-NL------QS-DKGLA--------NVLN----
A0A517SYI0      LRSP-----------------RLSLRF-NL------ST-NVGLT--------NVLN----
A0A518HX54      LRSP-----------------RLSLRF-NL------ET-KIGLA--------NVLN----
A0A5B9MF59      LRSP-----------------RLSLRF-NL------EA-QTGLT--------NVLN----
A0A2A2WC24      LRSP-----------------RLSLRF-NL------EA-KTGLT--------NVLN----
A0A518KYW8      LRSP-----------------RLSLRF-NL------EA-KTGLT--------NVLN----
A0A5C5YZZ0      LRRP-----------------TQAKVF-GV------QP-SAGLT--------GLLN----
A0A518JLD2      LRRP-----------------RIAKLF-DL------RA-DKGLA--------WAIEQITL
A0A5M6DJ15      LRRP-----------------SLHVDL-GC------EP-GIGVS--------DIVA----
A0A3L7P7S7      FRKP-----------------RVHKIF-KL-----DQP-EVGLA--------SVVS----
A0A517N8M1      LRRP-----------------QLTDNF-DM------AD-LSGLS--------EVLN----
A0A5C6CW01      LRRP-----------------QITDNF-AM------KS-KLGLS--------NVLN----
A0A5C6BXS9      LRRP-----------------QITDNF-GS------AE-KQGLT--------DVLN----
M5U569          LRRP-----------------QITDNF-AS------AE-QLGLI--------DVLN----
L7CND7          LRRP-----------------QVTDNF-AM------AD-QLGLV--------DVLN----
A0A0J1B8S4      LRRP-----------------QVTDNF-AK------AD-QLGLV--------DVLS----
F2ARR3          LRRP-----------------QVTDNF-AM------AD-QLGLV--------DVLN----
K5D8H6          LRRP-----------------QVTDNF-AM------AD-QLGLV--------DVLN----
M2AKU0          LRRP-----------------QVTDNF-AM------AD-QLGLV--------DVLN----
A0A5B1CKI2      LRRP-----------------QLTDFF-SL------AE-QKGLT--------DVLN----
A0A5C6EG84      LRRP-----------------QLTDNF-DM------AD-QRGLT--------HVLN----
A0A5C6F2X4      LRRP-----------------QLTDNF-DM------AD-QKGLT--------DVLN----
A0A5C5XTV6      LRRP-----------------QITNNF-DS------AE-KQGLT--------DVLN----
A0A5C6AAB1      LRRP-----------------QITDNF-NG------SE-KLGLI--------DVLS----
M5T8W8          LRRP-----------------QITDNF-DS------AE-QLGLI--------DVLN----
M5SF00          LRRP-----------------QVTDNF-AM------AD-QLGLV--------DVLN----
A0A2G1WDS1      LRRP-----------------QVTDNF-AM------AD-QLGLV--------DVLN----
Q7UVS9          LRRP-----------------QVTDNF-AM------AD-QLGLV--------DVLN----
A0A5C6B601      LRSP-----------------RMSLRF-NL------QS-DVGLT--------NVLN----
A0A517PFU1      LRRP-----------------RVRRMF-GLPQVAADNP-GVGTA--------EVIA----
A0A5B9M8J9      LRSP-----------------RLSLRF-NL------DT-NVGLA--------NVLN----
A0A2A2WFP6      LRSP-----------------RLSLRF-NL------ET-KIGLA--------NVLN----
A0A518L8N2      LRSP-----------------RLSLRF-NL------ET-KIGLA--------NVLN----
A0A518HQN9      LRSP-----------------RLSLRF-NL------EA-KTGLT--------NVLN----
A0A5M6D8H8      LRSP-----------------RMSLRF-NL------ES-GKGLT--------NVLN----
A0A5B1CRW9      MRRP-----------------VVAKLF-GL------QH-DPGLS--------DFLG----
A0A5C6EI46      MRRP-----------------VISKLF-GI------DD-RKGLS--------DFLA----
A0A2E7D3V4      LRRP-----------------TVNQLF-GL------PQ-DIGTC--------DVLL----
A0A2S8F9B8      LRRP-----------------SMHAIF-DC------PI-SPGVG--------ELLV----
A0A368KP63      LRRP-----------------SMHRIL-GL------PI-GPGVS--------DLLA----
A0A2E0SHG0      MRLP-----------------MVDKLF-GL------DT-SVGLS--------SVLR----
A0A518CQB8      MRLP-----------------MVDKLF-GL------ST-TVGLS--------DVLR----
A0A5B9PER9      MRRP-----------------RQHSTF-GI------TS-KEGFA--------TVLG----
A0A517QSM4      MRRP-----------------TVHRVF-RL------NS-AHGFC--------EILR----
A0A355GJI7      LRRP-----------------TIHKLF-GL------AN-SVGLG--------DVLT----
A0A1Z8MCI4      VRKP-----------------SLHSLF-DV------SN-EVGLV--------DVLM----
A0A517SYL7      VRKP-----------------SLHSLF-DV------SN-EVGLV--------DVLM----
A0A3L7P0L2      LRRP-----------------TMHTLF-AL------PQ-DIGLT--------DVLL----
A0A142XL75      LRSP-----------------TAHRVF-DA------PL-APGLC--------EILR----
A0A517SCC8      MRRP-----------------TVHDMF-RL------SQ-EAGLS--------DVLL----
A0A3A0DR44      LRSP-----------------NLHEIF-EI------HL-EPGLA--------GVLR----
A0A358MY60      LRSP-----------------DQHDIF-GL------EM-GPGLA--------GVMA----
A0A517MNB1      LRKP-----------------DQHAIF-GL------EM-GPGLT--------RVLS----
A0A517XRC2      LRNP-----------------SIHKLF-DL------PL-TPGVS--------EVLC----
A0A142YJ13      LRKP-----------------SLHEIF-EV------PS-EPGLC--------EVLS----
A0A517Z7D3      LRRP-----------------TLHKLF-KL------RS-DIGLV--------DVLS----
A0A5C1AGE3      LRNP-----------------SMHRLF-DL------PL-APGCS--------EILL----
A0A142XAP8      LRNP-----------------SIMKLF-EL------PL-APGVS--------EVLR----
A0A2Z3HEL7      LRNP-----------------CVMKLF-EV------PL-TPGVS--------EVLR----
A0A1N6KY57      LRRP-----------------SVHELF-DQ------PC-VPGFS--------EVLR----
L0DK20          LRRP-----------------SAHELF-DQ------PC-VPGFS--------EVLR----
A0A660UUK3      LRKP-----------------DIADML-NL------PKGLRGLQ--------DMLF----
A0A517ZHG5      FRKS-----------------NVHRVF-GV------EE-QPGLS--------EVLL----
A0A1Z8MPL5      LRCP-----------------SAHRFL-EM------PL-DEGLA--------EVLR----
A0A5C6C1R5      LRRP-----------------SLHENL-GY------EL-GVGVS--------DAVG----
A6BZU4          LRRP-----------------TIHKLF-GL------AN-SIGLG--------DVLN----
A0A2D5GZ77      LRRP-----------------TIHKLF-GL------AN-SIGLG--------DVLN----
A0A3D3R1Z6      LRRP-----------------TIHKLF-GL------AN-SIGLG--------DVLN----
A0A517XG00      LRRP-----------------TIHKLF-GL------AN-SIGLG--------DVLN----
A0A1G2YRE4      LRKP-----------------DIAYLL-NL------PKSTKGLK--------DVLL----
A0A353Z859      LRRP-----------------TVHRVF-DV------AG-DPGVC--------EVLS----
A0A2D6ST10      LRRP-----------------SICRVF-DL------PQ-IPGVC--------ELLR----
A0A177QX42      LRRP-----------------RIHKLF-GL------DL-ERGLS--------SVIR----
A0A517SHR0      LRRP-----------------RVHKLF-GV------SI-DVGVA--------SVVR----
A0A2E0AW64      MRAP-----------------DLYDVF-EI------PN-QPGFA--------DLLE----
A0A351FZ59      MRAP-----------------DLYDVF-EI------PN-QPGFA--------DLLE----
A0A660V239      LRKP-----------------DIAEML-NL------PKGSRGLQ--------DLLF----
A0A177Q3B7      MRRP-----------------ACHRVF-GA------PA-SPGFS--------ELLR----
A0A2E0X6Y6      LRKP-----------------GLTTRL-SL------KR-DAGVA--------ELLL----
A0A518GFD7      LRRP-----------------SLHSYL-EL------SE-GPGVS--------ELLH----
A0A5C5VZJ8      VRRG-----------------SLTAAF-RA------AG-TAGLL--------DDLS----
A0A518GE37      LRSP-----------------DQHDLF-GL------PN-EPGLC--------KLLG----
A0A5C6F3H8      LRCP-----------------DQHEIF-GL------EM-GDGFA--------GVLS----
A0A5C5X072      LRRP-----------------DQHEIF-GL------EM-GPGLT--------GVLS----
A0A5C5WUQ3      LRCP-----------------DQHSLF-GL------DI-GPGLA--------GVLS----
A0A5C6E697      LRCP-----------------DQHRLF-GL------EM-GPGLC--------SVLD----
A0A5C5Z1A3      VRCP-----------------DQHRLF-GL------DM-GAGLS--------GVLS----
A0A5C6D2P7      LRCP-----------------DQHRLF-GL------EM-GPGLS--------AVLS----
A0A5B9ML17      MRCP-----------------DQHDHF-GI------SL-EPGLS--------GVLT----
A0A517LX75      LRRP-----------------TLHKLL-GV------EA-SMGLA--------EYLR----
A0A354GX32      LRNP-----------------AAHKLF-GM------AA-GPGFS--------ELLR----
A0A5C1AAF0      LRKP-----------------SAHGAF-GV------PS-GPGLA--------ELLR----
A0A5C6B3S0      LRRS-----------------VLHQLF-EA------NL-QPGLS--------EWLS----
A0A518GIZ9      LRRP-----------------MATRLF-GL------RP-DPGLV--------DVLQ----
A0A1C3EBY9      LRRP-----------------MATRLF-GL------RP-DPGLV--------DVLQ----
D5SX64          LRRP-----------------MATRLF-GL------RP-DPGLV--------DVLQ----
A0A517Z0U7      IRRP-----------------SIHRVF-DF------EN-SPGIC--------DVLR----
A0A2S8FCC0      LRRP-----------------ALDISF-DI------EL-TPGVT--------ELLS----
A0A1Z8MBT6      LRCP-----------------DQHDIF-GL------AL-EPGLS--------DVVE----
A0A517SXN9      LRCP-----------------DQHDIF-GL------AL-EPGLS--------DVVG----
A0A518HFL0      LRRA-----------------TLGRLF-EV------PD-CPGLS--------DVLR----
A0A5Q3LBQ3      MRSP-----------------DIHTIF-EI------PM-EPGLS--------KVLD----
A0A3B8ZJM2      FRRP-----------------RLQKLF-GF------DA-DVGVA--------QLVA----
A0A1U7CLW1      LRKP-----------------SLHDVF-DF------PS-GPGLG--------DILR----
A0A142WPR7      FRRP-----------------RIHKLI-GQ------NT-SLGVS--------SVIA----
A0A3M1TFJ0      MRNP-----------------RVHKVF-AA------DP-APGLR--------NALE----
A0A517P477      LRRP-----------------STHRVF-GC------ES-GPGLS--------DVLR----
A0A517T4K9      MRRP-----------------SVHEVF-DI------PL-GPGLS--------EVLL----
A0A2Z3GZZ5      LRKP-----------------RVHKLFAGA------DATGTGLA--------EVIA----
A0A4V0I6L6      FRKP-----------------RVHKLF-GL------EKPATGLA--------SVVA----
A0A255QXF5      MRCP-----------------DQHDVF-GL------PL-EPGLN--------EVLR----
A0A518KBI5      MRDP-----------------SVTDLL-DV------PA-GPGLC--------EVLG----
A0A5C5V6Q5      MRDP-----------------SINDLV-DA------EP-GPGLY--------EVLS----
A0A517MY49      LRKP-----------------GMTALL-GL------KS-QHGVA--------DLLL----
A0A2E6AG00      LRKP-----------------GMTRLF-EL------RG-QEGLS--------DLLR----
A0A1G3A880      LRRP-----------------GLTTLL-GM------KG-AAGVS--------DVLR----
A0A2E8ATT1      MRRP-----------------GLSRLL-DM------RG-TSGLS--------DVLR----
A0A518KYQ0      MRCP-----------------DQHDVF-GL------AL-EPGLN--------EVLR----
A0A5B9QX47      LRCP-----------------DQHDIF-GL------EM-GPGLC--------GVLS----
M5T666          LRCP-----------------DQHEIF-GL------EM-GPGFT--------SVLS----
M5U6N6          LRCP-----------------DQHEIF-GL------DM-GRGLT--------SLLA----
A0A517M0G2      LRSP-----------------DQHAIF-GL------DL-GPGLS--------KVLS----
A0A5C6AST1      LRSP-----------------DQHDIF-GL------EM-GPGLA--------KVLS----
A0A5C6C951      LRSP-----------------DQHAIF-GL------EM-GAGLS--------KVLS----
A0A5C6C5T3      LRRP-----------------DQHEIF-GI------EM-GPGFT--------GVLA----
A0A2A2W6A9      MRCP-----------------DQHDVF-GL------AL-EPGLN--------EVLR----
A0A518HQS9      MRCP-----------------DQHDVF-GL------AL-EPGLN--------EVLR----
A0A5M6DFE6      MRCP-----------------DQHDVF-GL------TL-EPGLS--------GVLL----
A0A5C6F286      LRCP-----------------DQHEIF-GL------EM-GVGFA--------GVLA----
A0A517NGN1      TRCP-----------------DLHDVF-GI------DL-SPGLT--------GVLG----
M5RUI3          LRYP-----------------DQHEIF-GL------EM-GPGLS--------GVLS----
M5S2L2          LRRP-----------------QITDNF-AM------Q-SKMGLS--------NVLN----
A0A523CME0      LRKP-----------------SINRLL-GF------I-PDKGVS--------DYLS----
A0A354PCV3      LRRP-----------------DQHRLF-GV------E-MGPGLS--------GVLA----
A0A354PHB4      LRRP-----------------DQHRLF-GV------Q-MGPGLV--------AVLA----
A0A356ESF4      LRRP-----------------GLTSML-DL------R-GAEGLS--------NLLG----
A0A538RV31      LRRP-----------------SVHQLF-DM------P-VEPGFS--------GVLR----
A0A2D6A9B6      LRKP-----------------SVETFL-GL------NR-GPGLA--------DLLQ----
A0A2G6JGH3      FRKP-----------------SVETLL-GL------NQ-EPGLT--------ELLM----
A0A3L7SU85      FRKP-----------------RVHKIF-RL------EQPEVGLA--------SVVN----
A0A3M1RAJ8      LRRP-----------------RMHRVL-KQ------DL-APGLS--------EYLR----
A0A3D4PLL5      MRRP-----------------GLTAVF-AL------KG-QAGLS--------TILR----
M5RD30          MRRP-----------------VIAGLF-GL------EG-EPGLT--------NVLF----
A0A2Z3GYP4      LRRP-----------------RVHRAF-GL------T-SRIGLA--------EVLT----
A0A1V6CUG1      LRKK-----------------KLTAML-GC------K-QQAGMA--------ELLQ----
A0A3M1SE88      LRRP-----------------GLTAML-GY------R-GESGLS--------RALQ----
A0A660WB30      LRRP-----------------DLHNFF-GL------P-PKPGLA--------EYLE----
A0A660W9Z7      LRRP-----------------KIKEHV-LV------D-CEYSLE--------DVLT----
A0A3M1R9K7      LRRP-----------------SLDGVF-GI------E-NDRGVS--------EILR----
A0A3L7PH51      LRRPGMTQLLDLKGPRGLAQVLNDKKL-DI------DIAERCLE--------NVFH----
A0A3N5UQY5      LRKP-----------------IQHRIF-DI------NHQEQCLC--------SVLE----
                 *                        .                                 

A0A356AE44      ----GEIEMANA-IQDSRIEN----LHIL-SAGAIPAKPAELLSSS-KLHYLLGQAKREY
A0A1G2XSU7      ----ADFKLRDL-LLYSDVPG----LSVL-TAEPCDISIINRLIHHKNMVEFINEISRIF
A0A350KD81      ----GEIDAQTA-IRETRVTH----LSIL-TAGMLPENPSEMLMSR-GFSELVKQLRNEY
A0A2E3Z6T8      -SPETPAQSAPPLIHSTIVKD----LDVL-PAGLRRPNPAELLSSK-AFIELLAWAESKY
A0A257WQ92      ----G----EIQ-GLNALRPTFVENLQVL-PAGQPPANPAELISTP-RLTQFLKSVRDEF
A0A356ETW1      ----SNAHVADL-CVALIQPTGIERLDVL-PSGPRPANPAELLAGP-RFLELIDWASTVY
A0A3L7NJY1      ----STDNLETS-ISQNLRVTVVEGLDVI-SCGPRPVNPAELLAGD-RFANLLAWAETRY
A0A2D6SRY7      ----GNATWQEN-LRSTSVEG----LHVL-PAGQSPPNPAELLASE-RTRTLIRELSDNF
A0A1G3C300      ----GEIDYESI-IKHVNIPH----LNII-TCGLIPPNPSELLGSH-SMEKFCDNVRNRF
A0A524HC32      ------AMTDQVYSYNKFHKN----LKVI-LSGPVSPNPVELLASK-RFQILLQGLSSRY
A0A660VT66      ----GKASLDEA-IRPTAVPL----LDII-PSGFVPPLPSELLSGE-ALPRMLDELKKRY
A0A0S8H0S8      ----GTAGLQDA-IRFSGVER----LDVL-PCGAAPDRPAEMLHSP-AFRQMLAELSGRY
A0A177PV03      ----GTAKLKDA-VKPTAVEG----LSIL-PCGPRPANPAELLTSP-AFEQLLADLRKEY
A0A1G2YIM0      ----GYNTLDES-VWPMPSVG----LDVLISDGNDSYDAFELLTRS-QTPSRLKAIAAHY
A0A1G2ZG92      ----GGFSLDET-IVHTDVSG----LDLL-TSGPIPPDPSSLIESQ-KLRDIVNKLKEMY
A0A1G3A0W0      ----SRSADKRH-IFPTDTFG----LNIM-PAGKHNDGAVIEETANGAFKACMSQLRQWY
A0A353BE27      ----GKVEVDDA-ICAGPVAN----LSIL-PGGKRPANPAEILSSE-RFRNMIDMLRDKF
A0A5C6BPW1      ----GTASLEEA-IKSPSDDG----PDVL-PAGQFNSQLLAALAQD-GLGKIFEELKKKY
A0A1I3GSP0      ----REIDWQNA-VRPTQIEN----LSLM-TAGLCPENPAELLSTG-TLQVMLRRAREEY
A0A517QJV1      ----NEIQWQNA-IRETPSEN----LSVI-TAGLCPENPAEILSQV-NLPALLNEMRSEY
A0A3C1QS25      ----GDLAVAEA-AIETQVPG----LYFI-PCGERPSNPAELLTSP-KLPEFIEIARQQY
A0A5C6FX55      ----GECEWQEA-CHSTPLGH----LDVM-PSGPIPANPAEALTLP-EMAETLEQLREHY
A0A3L7UX05      ----GQSNIDKCLVRIGEGGG----FHLL-PAGTIHGDPSRILESA-KLGKIMAHLRENF
A0A5C6DS51      ----GDSTLAEA-ASKTSVEN----LDVM-PHGTETSVPAELLQSN-RMGLLLQSARNQY
A0A5C6DSL6      ----GQCSLAQS-VTHSSVEN----LDIM-PHGTETSVPAELLQSN-KMSLLIQAARKEY
A0A3M1VG27      ----GEIDWQTA-VQHTVENN----LDVL-PAGLPVDNPAELLSSH-AFRHLLQTLRVEY
A0A518GC22      ----GKCEIEDG-IHVGPVAN----LSIM-PGGKRPANPAEILSSQ-RFKNMVDVLRDKF
A0A3L7Q373      ----NEIQWVNA-VRSTRLEN----LSVL-TAGRCPSNPAELLSSL-RLGETLRAIRGDY
A0A3E0PW54      ----GEIEWMNA-LRETPVEG----LSVM-TAGACPENPAELLTAS-DLDGLLRAAREEY
A0A1Z8MHR4      ----GELAPEEA-VCHSPIDN----LDIL-PCGPLPANPAEALALA-EVAEVFRWARENY
A0A5C6EHJ0      ----SNVAIDAA-IHPSLVAN----LSVM-TAGERPDNPSELLSSP-NFDRLLSVLRTKF
A0A5C6F1H9      ----LDDRIQAA-ITRSVVAN----LSVM-TAGERPDNPSELLSSP-NFDRLLNLLRKQY
A0A255QXY0      ----GEIGISEA-IHETSIDY----LDVL-PCGPLPANPAEALTMP-DLVEIIAWARDRY
A0A517SYI0      ----GELAPEEA-VCHSPIDN----LDIL-PCGPLPANPAEALALA-EVAEVFRWARENY
A0A518HX54      ----GELGVAQA-VHQTPIEN----LDIL-PCGPLPANPAEALTLA-ELADVFQWARANY
A0A5B9MF59      ----GELGPAEA-VHQSPIEN----LDIL-PCGPLPANPAEALTLA-ELAEVFQWAREHY
A0A2A2WC24      ----GELGPAEA-IHQSPIEN----LDIL-PCGPLPANPAEALTLA-ELAEVFQWARENY
A0A518KYW8      ----GELGPAEA-IHQSPIEN----LDIL-PCGPLPANPAEALTLA-ELAEVFQWARENY
A0A5C5YZZ0      ----GEIEFKDA-IVETDAEN----LFVL-PSGPKPNNPAEALMLP-EFGQILDEARMQF
A0A518JLD2      SKEIDDLMINEA-IQDTVVPN----LSAM-VAGNPPDNPSELVTSE-AFEQILSALRVKF
A0A5M6DJ15      ----ASANWKEC-VRRQSQLR----YY-M-SAGSVENVNLAAAAQE-SIPRLFDELRIHF
A0A3L7P7S7      ----GDATLQEA-IHTCAVPG----LHLM-PCGPRPANPSELLTSP-KFVEVIDELRKMY
A0A517N8M1      ----GECEAMDA-CRQTPLRN----LFVM-PSGAIPANPAEALTLP-DMQNMIEMLREKF
A0A5C6CW01      ----GDCDPSEA-CHETPLST----LQVM-PSGPIPANPAEALTLP-EMGELIELLREDY
A0A5C6BXS9      ----GTCDHVDA-IHDTPLAT----LKLM-PSGPIPANPAEALSLP-EMSELLDLLRYEF
M5U569          ----GHCEHIEA-IHDTPLAT----LKLM-PSGPIPANPAEALTLS-EMGELLELLRDEF
L7CND7          ----GKCEHVDA-AHDTPLST----LKMM-PSGPIPANPAEALTLP-EMSELLDVLREEY
A0A0J1B8S4      ----GKCEHVDA-AHDTPLST----LKMM-PSGPIPANPAEALTLP-EMSELLDVLREEY
F2ARR3          ----GKCEHIDA-AHDTPLST----LKMM-PSGPIPANPAEALTLP-EMSELLDVLREEY
K5D8H6          ----GKCEHVDA-AHDTPLST----LKMM-PSGPIPANPAEALTLP-EMSELLDVLREEY
M2AKU0          ----GKCEHVDA-AHDTPLST----LKMM-PSGPIPANPAEALTLP-EMSELLDVLREEY
A0A5B1CKI2      ----GDCEVSDG-CHSTPLNN----LFVM-PSGPVPANPAEALTLP-EMGSMLEVLKQKF
A0A5C6EG84      ----CECEPLDA-CHATPLRN----LFVM-PSGAIPANPAEALTLP-EMGNMMEMLREKF
A0A5C6F2X4      ----CECDALDA-CHVTPLRN----LFVM-PSGAIPANPAEALTLP-EMSNMMEMLREKY
A0A5C5XTV6      ----GTCDHGDA-IHDTPLAT----LKLM-PSGPIPANPAEALSLP-EMSELLDMLREEF
A0A5C6AAB1      ----GKCDHIEA-IHDTPLAP----LKLM-PSGPIPANPAEALSLP-EMSELLELLREEY
M5T8W8          ----GHCEHIEA-IHQTPLAT----LKIM-PSGPIPANPAEALTLT-EMGELLELLRDEF
M5SF00          ----GKCEHVDA-AHDTPLST----LKMM-PSGPIPANPAEALTLP-EMSELLDVLREEY
A0A2G1WDS1      ----GKCEHVDA-AHDTPLST----LKMM-PSGPIPANPAEALTLP-EMSELLDVLREEY
Q7UVS9          ----GKCEHVDA-AHDTPLST----LKMM-PSGPIPANPAEALTLP-EMSELLDVLREEY
A0A5C6B601      ----GEMSPGAA-VHETPIEN----LDIM-ACGPLPANPAEALTIA-ELSDVFDWARANY
A0A517PFU1      ----DPDKLDEA-LVESGQPG----LWLL-PCAARPDHPAELLSSE-AYETFLDVLRQKF
A0A5B9M8J9      ----GELPAGRA-VHQTPIEN----LDIL-PCGPLPANPAEALTLA-ELADVFQWARENY
A0A2A2WFP6      ----GELSAAQA-VHQTPIEN----LDIL-PCGPLPANPAEALTLA-ELADVFQWARANY
A0A518L8N2      ----GELSAAQA-VHQTPIEN----LDIL-PCGPLPANPAEALTLA-ELADVFQWARANY
A0A518HQN9      ----GELGPAEA-VHQSPIEN----LDIL-PCGPLPANPAEALTLA-ELAEVFQWARDNY
A0A5M6D8H8      ----GEMDVTEA-IHTTPIEN----LDIL-PCGPLPANPAEALTLA-ELGEVLAWARKHY
A0A5B1CRW9      ----GSMPFVDV-ISASEVPN----LDVM-PNGSPTAEPAELLESH-QLMRLFQHACDSY
A0A5C6EI46      ----GRVEFADG-VVETEVQN----LHIM-PNGSNTSEPAELLESH-RLMRLFQNACESY
A0A2E7D3V4      ----GDIELPNA-VKESGIEG----LQIL-TAGTPVGSPAELLSSA-RMASTIEAAKAEY
A0A2S8F9B8      ----NHVKLDEA-IQPTNIPN----VDLI-PAGSSEQSIPRSATSG-RLAELYRELRSLY
A0A368KP63      ----GQAELADV-VKATDIPN----VSFL-PAGVEEQSISRGATSG-VLDAILGDLRKRY
A0A2E0SHG0      ----GEAEIPDA-IQETEVEN----LTAL-PCGPVPENPAELLNQE-SFSRLLAVVREQY
A0A518CQB8      ----GEAEIQDA-VQETEVKG----LTAL-VCGPVPDNPAELLNQE-SFTSLLAVVREQY
A0A5B9PER9      ----GQSHWKDC-VFEVAEIEG---MSIM-PCGSKPSNPAELCSSP-QVKDLIDEMRTEY
A0A517QSM4      ----GDKPLEGA-AQPTPTPG----LSVI-PAGRVDSAALQALAEG-GAGQIFKHLTEDY
A0A355GJI7      ----GEIDAQTA-IRETRVSH----LSIL-TAGMLPENPSEMLMSR-AFSELVNQLRKEY
A0A1Z8MCI4      ----QRSELDDA-IVAVGK------LDFL-PAGRLSAPPFGIFSEG-NVSGFIDSLREHY
A0A517SYL7      ----QRSELDDA-IVAVGK------LDFL-PAGRLSAPPFGIFSEG-NVSGFIDSLREHY
A0A3L7P0L2      ----SEVDWFNA-VRTTRLEN----LSVL-TAGLCPPNPAELLSSS-RLPDMLNAAKKSY
A0A142XL75      ----GSTSVLEA-VRPTGIPG----LSAL-TAGQWTLATRHALVGD-RWRETKDQLKAEF
A0A517SCC8      ----SEIEWVNV-IKTTPFAT----LSVM-TAGLSPENPAELLSGS-GFGALMRQVRDEY
A0A3A0DR44      ----KECEITDA-IVEEVAEG----VHLL-PAGRVATSPHNYLGNG-AIPKLVAQLREVY
A0A358MY60      ----GDANLADA-VDDTLGEL----VHVL-PAGRMTLSPHRLLSSE-GMRTLLDEALQNY
A0A517MNB1      ----EDVKLEDA-VDKSLGDL----VHVL-PAGLMHQSPHRLLNSS-AIRDLLDQALAKY
A0A517XRC2      ----QEVDPSDA-VQPTAVPN----LWVI-PAGQCSTRVIAALAQGHPLETLFNRLRGQF
A0A142YJ13      ----GEIGWEGV-VRETEVRD----LSLI-LAGRCNPEAIELLPRQ-PLPDLIIALREQY
A0A517Z7D3      ----GDVDAETA-MQETAVEG----LRVL-VAGAPPANPAEALSSA-RLGRTLHELRGEC
A0A5C1AGE3      ----SELDVSDA-VQPTTVPN----LWVI-PAGQCSNRVISALAQGHQLESLFNRLRGQF
A0A142XAP8      ----QEVDVSDA-VQATAVPN----LWVI-PAGHCSNATIAALAQGNPLKTLFNRLRGQF
A0A2Z3HEL7      ----EEVDVSDA-VQATAVPN----LWVI-PAGQCSNATIAALAQGHPLETLFNRLRGQF
A0A1N6KY57      ----DEIELIDA-VQPTLISG----LSLL-TAGFSDSDSIQTLASR-DLRAMFDQLKEQF
L0DK20          ----NEVNIADA-IQPTAASG----LSLL-TAGLSDNETIQALACR-DLRVMFDQLKEHY
A0A660UUK3      ----GK-SLAES-VYELSPTG----LHIL-AADRRNCSDALDLLRQTHTVDCMKNIRNEY
A0A517ZHG5      ----GTASLEEA-IKSPSDDG----PDVL-PAGQFNSQLLAALAQD-GLGKIFEELKKKY
A0A1Z8MPL5      ----GDVAIENA-IRPSRMPG----LRFL-SAGHCDPTSLQALTKK-NLSEIFEKLVDEF
A0A5C6C1R5      ----GNVDWKDA-VHATSPN-----AFFM-TAGSSRPVNLSAVGAK-TLPQLFSELRAEY
A6BZU4          ----GEIDAQTA-IRETRVTH----LSIL-TAGMLPENPSEMLMSR-GFSELVKQLRNEY
A0A2D5GZ77      ----GEIDAQTA-IRETRVTH----LSIL-TAGMLPENPSEMLMSR-GFSELVKQLRNEY
A0A3D3R1Z6      ----GEIDAQTA-IRETRVTH----LSIL-TAGMLPENPSEMLMSR-GFSELVKQLRNEY
A0A517XG00      ----GEIDAQTA-IRETRVTH----LSIL-TAGMLPENPSEMLMSR-GFSELVKQLRNEY
A0A1G2YRE4      ----G-TEFEQA-VSSIRSTG----LNVL-AMHSCHRVDAYELVASPETANIINKLSPKY
A0A353Z859      ----GAAKPADV-IQESTQPN----LFVI-PAGILASESLRNLAQD-GLGALMEHLRAEF
A0A2D6ST10      ----GESSLDDC-TREVAPEG----LSVI-PAGKIDHTVLRLLAED-AVGELFENVKKQY
A0A177QX42      ----DGMDLPDA-VQTTLVPN----LDVM-TVGPRVDNPAELLLSP-QFTELVQQLREKY
A0A517SHR0      ----DGMDVPDA-IQSTLVPN----LDVM-TVGPRVENPAELLLSP-EFTVLVQQLREKY
A0A2E0AW64      ----DHNSLGGY-VTKWDEH-----CHVL-PAGQLTSSPHRLLANG-AFSGMLKEARATY
A0A351FZ59      ----DHNSLGGY-VTKWDEH-----CHVL-PAGQLTSSPHRLLANG-AFSGMLKEARATY
A0A660V239      ----GK-EFAKL-VYNTGAVG----MDVL-AADRRNVSDALDLLGKPRTGECIEQVSADY
A0A177Q3B7      ----NENSLEEV-LQATPLDH----LTLM-AAGRWNYQTSQFLARE-RMPDILAALRQQY
A0A2E0X6Y6      ----ADGEIADN-APRFVQKTVVERLDVI-PTGLRRQNPAELLGSV-RFAELLAWAEANY
A0A518GFD7      ----GSTKLTHA-IQETTTRN----LHVI-TAGGELCSVTECESDG-SLAALLNKLRSHY
A0A5C5VZJ8      ----APSPTVTV-HSTDTPN-----LSLV-PVGRIAKPEDAELFANGAFGRLLEAWKKAY
A0A518GE37      ----GQSKLSDC-IDKSLGDL----VHVI-PAGRLHANPHNLLTKS-KMEKLFADLESEY
A0A5C6F3H8      ----GKTTLIEA-VDTSLGAL----IHVL-PAGRLTASPHRLMSPS-GMKDFVDHALSHY
A0A5C5X072      ----DKSTLDDA-VDKSLGSL----IHVL-PAGPLSASPHRLISPK-KFETFVKEALEVY
A0A5C5WUQ3      ----GEVEFEQA-IDSTLGHL----IHVM-PAGPLKANPHRLINQA-SMKKFLDQALESY
A0A5C6E697      ----GTTSLSDA-VDTSLGER----FHLL-PAGLLKTSPHRTIGPE-AFNRFMNEACKRY
A0A5C5Z1A3      ----GQTTLTEA-IDTSLGDL----IHVL-PAGKLTTSPHRMLNPK-AMKAFISDAMEKY
A0A5C6D2P7      ----GKAKLSDA-TDKSLGDL----VHLL-PAGPLSSSPHRLINPD-TMRAFISQALKQY
A0A5B9ML17      ----NQATLDEA-IQTELGDL----IHIL-PAGRLKASPHRLMSPE-SMKSLVSDILDRY
A0A517LX75      ----GDGDLESA-TVQTEVAG----LDFI-SHGHHPSDPAELLESF-GMERLIAEARQEY
A0A354GX32      ----GEVEPGQV-VQNTPLEN----LSLL-AAGACDHQALQALAQEGILRNVFDELKEQY
A0A5C1AAF0      ----DEVLDRDV-IREVRAN-----LFFI-PAGACDDASLCALARG-VLAADFRRFLSDY
A0A5C6B3S0      ----GRADVISV-IQPTGIEN----LSLV-AAGRRNESTLGQLAGD-EIENVFQTLRAGF
A0A518GIZ9      ----GEIALENA-IVETVVEG----LTIL-PSGRPPHNPAELLEGG-PLRQLIAKARTFA
A0A1C3EBY9      ----GEIALENA-IVETVVEG----LTIL-PSGRPPHNPAELLEGG-PLRQLMAKARTLA
D5SX64          ----GEIALENA-IVETVVEG----LTIL-PSGRPPHNPAELLEGG-PLRQLIAKARTLA
A0A517Z0U7      ----QEVPLEEA-IKQGSPDG----LSIL-PAGKVDQTVLRLLAQD-ELGNLFKELAAEY
A0A2S8FCC0      ----GEVEFDDA-IQQTGIGT----LDIV-AAGDWGHNSLRELTSD-RMDSFFKSLRSQY
A0A1Z8MBT6      ----EKSTLDDA-INRELGDL----IHIL-PAGRLKASPHRILTTE-AVQGLIARCMEEY
A0A517SXN9      ----EKSTLDDA-INRELGDL----IHIL-PAGRLKSSPHRILTTE-AVQDLIAQCMEEY
A0A518HFL0      ----GDAQLEDA-LVPISQVGG---CQLL-PAGSPEPNPNRILRGK-NFAPMLERLRRSF
A0A5Q3LBQ3      ----YQCDVQDA-IVTDWGEG----VHLL-PAGRLHKSPHKLLGNA-SFATILKNLSRIY
A0A3B8ZJM2      ----GQCELDDA-TYTTCVAN----LSIM-PGGKRPNNPAELLSSS-RFAELIEIVREKY
A0A1U7CLW1      ----GEIGWTDA-VRQTPVPG----LSLI-FAGRCDPATIDLLPRE-DFPNLLQELRDQF
A0A142WPR7      ----GTAELVDA-IQDTPVEN----LAVL-GCGPRPDNPAELLTGK-RFDELLGVLREQY
A0A3M1TFJ0      ----EGEGLEFL-Q-STDVEN----LYLL-PAGQGEENAANLLGSGEAFARLIGGLRQRF
A0A517P477      ----GEKSAEEV-EIPLHGSE----LRLI-PAGDVCDTALAGFGTA-AMAECLDDLRARY
A0A517T4K9      ----GDIDAEDA-ITSPNADA----PFIL-PAGKFDRTVLRQLSMG-KAEQIVESLRGQY
A0A2Z3GZZ5      ----GVRPLADG-IVASGAPG----LDLL-PCGPRPANPAELLGSP-QFQRVLAELRERY
A0A4V0I6L6      ----DRADLGDA-IRACEVEN----LSLL-PCGPIPANPAELLTSP-RFQDVLSDLRASY
A0A255QXF5      ----EVVPFEQA-INKELGDL----VHVL-PAGRLKASPHRLLSTS-SMRDLLDQALEKY
A0A518KBI5      ----GKLSLNEA-IQPVPATEH---LFVL-RAGSCAGAPHHLAQPQ-RLQKLVEALRGDF
A0A5C5V6Q5      ----SRCSISDA-IRPAKGTDN---LYVL-RAGDCDDSPHRVAQPA-RIAALVSRLRNEF
A0A517MY49      ----SDEPIAEQ-VGNYLHHTEVPGLDVV-PAGIRRTNPAELLSTD-QFVELLAWADSQY
A0A2E6AG00      ----SDVDVRDR-AASLICKTSCECLHVL-PSGSRPLDPTGLLASN-QFGELLAWAEARY
A0A1G3A880      ----GDGEVARL-AAQCVCRSAVAGLDVL-GSGPRRPNPSELLAGP-RFADLLAWAESQY
A0A2E8ATT1      ----GEGAVGEI-CERLVQSADVPHLDIL-PCGPRPADPVELLSGT-RIVDLLGWAQSRY
A0A518KYQ0      ----KAVPLKEA-INRELGDL----VHVL-PAGHLKASPHRLISPD-SMKELMDEALESY
A0A5B9QX47      ----EEATLKDA-VDTSLGDL----IHVL-PAGHLTSSPHRLINPS-AMRDFVDRALADY
M5T666          ----KESQLVDA-VDSSLGNL----IHLL-PAGRLNASPHRLISPA-NVTAFVDAALESY
M5U6N6          ----KQTELKDV-VDTSLGNL----IHLL-PAGRLSASPHRLINPA-NIDNFVSSALEQY
A0A517M0G2      ----GDIELKDA-VDTSLGEL----VHVL-PAGKMHQSPHRLVSAS-SIRDLLDQALEKY
A0A5C6AST1      ----GEATFDEA-VDRTLGDL----VHVM-PAGHMNMSPHRLLNAS-ALRELLDDALAQY
A0A5C6C951      ----GEVDFDNA-IDRSLGDL----VHVM-PAGQLDMSPHRLLNAS-ALRDLLDRALEHY
A0A5C6C5T3      ----GKSTLDGA-VNSSLGRL----IHIL-PAGQLSASPHRLVSPT-SIKSFVDDALLTY
A0A2A2W6A9      ----KAAPLKEA-INRELGDL----VHVL-PAGRLKASPHRLISPD-SMKELMDEALESY
A0A518HQS9      ----KVVPMKEA-INRELGDL----VHVL-PAGHLKASPHRLVSPD-SMKELMDEALDSY
A0A5M6DFE6      ----NEVKFEDA-VRTELGDL----IHVL-PAGRLKASPHRLMSPA-KMRELIDQALKRY
A0A5C6F286      ----GKATLAEA-VDTSLGGL----IHVL-PAGRLTASPHRLVSPS-GIRDFIDDALSQY
A0A517NGN1      ----GRVELKDA-INRSLGNL----VHVL-PAGRLDASPHRLITQS-GIETLIEQALQQY
M5RUI3          ----QTATLEEA-VDTSLGSL----LHVL-PAGRLDRSPHRLISES-SMRDFVDRALEKY
M5S2L2          ----GDCDPSEA-----CQQTPLSTLQVM-PSGPIPANPAEALTLP-EMGELIELLRDEF
A0A523CME0      ----EDLDL-----EECSATGLMPGLTVI-PAGNRQANVCELLASD-KMGSFASRMRELF
A0A354PCV3      ----GTTPL-----LDAVNTSLGHLIHLL-PAGELTASPHRLMSPQ-RLQAFMKDALNSY
A0A354PHB4      ----GKTPL-----LDAVNTSLGHLIHLL-PAGELTASPHRLMSPQ-RLQAFMKNALNTY
A0A356ESF4      ----GNGKVGAA-AAAVIRPSGIAGLDML-PSGPRFANPAELLAQP-RLAELLAWADKVY
A0A538RV31      ----GDVDL-----SEVIRPTPAKNLWVV-PAGQCDVHTLEALAQE-ALASVLARVKEQF
A0A2D6A9B6      ----GSTSLD-----EAIRPSGIPGLDII-GAGSRPKNPSELAASR-RVDELLGQLKEQY
A0A2G6JGH3      ----GRLALH-----QAIRNSGVESFDLI-GPGGMPTNPSELLSSR-RIDELIARLKEEY
A0A3L7SU85      ----GDATLQ-----EAIHTCEVPGLHLI-PCGPRPANPSELLTSP-RFSEVIEELRKLY
A0A3M1RAJ8      ----GEAALE-----EIVRETDRDNLWLI-PAGRCDTEALQALARS-DPERLFEVLRREF
A0A3D4PLL5      ----DTASIEES-ALKHITKTRLENLDVI-SAGPRPSNPVELLTSE-RFEELIGWAEGVY
M5RD30          ----DSTQFD-----KCIQSTPIETLSVM-AHGSRTSEPAELLESF-RLSGLLRSCEQRF
A0A2Z3GYP4      ----GTAELADA-----IQMTAIPNLSVL-PCGRRPSNPAELLTTP-AFEDVLDDLRAAY
A0A1V6CUG1      ----GKATLRDV-----VVPTVYPNLFFL-PPGNAAGNVGELMGRP-ELMEIVGELRRKY
A0A3M1SE88      ----SNEDIEEA-AVKTIRSTGIENLDLL-PAGPRALHPAELLSGS-RLAELLAWVENVY
A0A660WB30      ----YDLDLSQL-----LVKTDFDKLTML-QAGKVPANSTELLNSE-KMRHLIMEVKSRY
A0A660W9Z7      ----GKCELADA-----LVYSEQDNLAVL-PTRHGQHNATELLETP-AMKKVIADVREMF
A0A3M1R9K7      ----GEAKWQQV-----CRDSGIENLDII-PAGQWSYRGMAVLANG-VVGGLFRSLREQY
A0A3L7PH51      --------------------LGVEGLDFM-PSGPRPANPSELLSSE-RFSDIIAWAEQIY
A0A3N5UQY5      ----GKVKLSQA-----IQPTQVPGLSLL-TCGYGIGNPAEVLNSP-QFAKLLAYLGRAY
                                            :                               

A0A356AE44      D--FVLVDSPPVLAVSDPCITAQS--VDTVMLIVRLHKNRRPSVKRALEIFEAHEIPLLG
A0A1G2XSU7      D--HVIIDTPPVLAAVDALLWASM--VDGVILTSLAGHTETPDLKDTIERLKQINVNLLG
A0A350KD81      D--YILIDTPPLVVVSDPSVIASI--VDGVLLVVRIDKNRRGVIRKVQQIIQTNGIKVTG
A0A2E3Z6T8      D--RVIVDCPPVLAVSDAQIVGRL--VDGAILVVRPEKNHRRSVMRAVESFHATGCHVFG
A0A257WQ92      D--MVLIDSPPLLAVSDPCAIARH--ADGLLLVVRLGKTSLVTARRAQELVKTHGLSVLG
A0A356ETW1      D--QILIDSPPTLATSDSAVIGRL--VDGTILVVQPEKNHRRAVIRAVEGLLSLRIPLLG
A0A3L7NJY1      E--QIIVDAPPVLAVSDPAIVGRL--VDAVVLVVRPDKDRRRMVIRAAETLQSLGCSLLG
A0A2D6SRY7      D--LVLVDSPPALPLTDASVLSTE--VNGVFLVVRAGMASLEAARRAKASLQNVGARLLG
A0A1G3C300      D--IIIFDTPPTMTVTDAVVLSRN--VDGVVFVIKSGQTPKELTRRALLQYKNSKSDLLG
A0A524HC32      D--RVILDGPPYLGFADVLVLSKQ--VDGIVLVSSMGETSRRTIEHFRKKMSIVNGTILG
A0A660VT66      D--WIIIDTPPGI-VTDPVILSAH--VDGTVLVVRNDSTSRKFLRHFATLLRQGDSRITG
A0A0S8H0S8      D--RIVIDSPPVVSVTDSRILGAI--CEVTVLVLRAEKSTHPVAQQAIEDLLDVGARLLG
A0A177PV03      D--FVLVDTPPLLAVSDPSAVAPR--VDGVLLVVRFSKNARPSARRAKEILESMRADVVG
A0A1G2YIM0      E--HVIIDTPPVLAVPDAIIWAKM--ADAVVLASYAGHTQGPDVQRSLERLRAAGVKIIG
A0A1G2ZG92      D--MVIIDTPPVMAVNDATVVGRI--ADGILLVIESGRATFSIVDHIKELFTKAGLNTIG
A0A1G3A0W0      D--FILLDSTPILPVADAMILSSQ--VDGTIMVERELVSQRGTQIDALMRLTSGGGQLLG
A0A353BE27      D--VIVVDTPPLLAVSDPGAVAGI--VDGVLMTMRLRRNVKPLALRAKSILEGVGANLLG
A0A5C6BPW1      E--FVVVDSSPVLPVTDSLMVAQH--VDAVILSIRRDVSRRPKVAATRDRLAMLGVPVLG
A0A1I3GSP0      D--VVLLDSPPILAVSDPCIISPH--ADGLLLVVRMKKTKRATVQRVHETLQSHGVQVYG
A0A517QJV1      D--FIILDSPPVLAVSDPAILSPH--VDGISLVARLKKNKRAAIVRAMETLRVHGANVHG
A0A3C1QS25      D--YVIIDSPPLLAVTDPSVIAPR--VDAVVLTFRLRKNIKLTSDRARDILASVGAEILG
A0A5C6FX55      D--YVLVDTPPLLVVTDPSILASM--VDGVLLTLRVRRKSKLNAREAVNILSSVGGNLIG
A0A3L7UX05      Q--VVIVDSAPVLPVPDALLFGRW--VQGIVIAVRYDTSRFPMIERAYKRLSTLKVPVLG
A0A5C6DS51      D--IVLVDAPPVLAVADPAIVAPL--VDGVILTVRVCKNGRRPVERASRILSDIGIRPLA
A0A5C6DSL6      D--IVLIDAPPVLAVADPAIVAPL--VDGVILTVRVCKNGRRAVERAGRILREINIQPLA
A0A3M1VG27      D--LVVVDSAPVLAVTDPCVVASL--TDVVLFVVRLNKSRHSSTRRALELMHAHGARILG
A0A518GC22      D--MIVIDTPPLLAVSDPGAVAGI--VDGVLMTMRLRRNVKPLAVRAKSILESVGANLLG
A0A3L7Q373      D--IVIIDTPPILAVSDPAIIAPL--VDGLLLVVRMGKNKRATAQRSRELIDSHGIPLYG
A0A3E0PW54      D--VVIVDTPPVLAVSDPSIVAPH--ADGVVLIVRMEKNKRAAIRRTLETLGGLDVELLG
A0A1Z8MHR4      D--YVIVDTPPLLMVSDPAVVTTY--VDSTILVMRIRRRCRPNAREAVAMLRSAGASILG
A0A5C6EHJ0      D--MIIVDTPPLLAVSDPANLASR--VDGVLLVVRLRKNIKPAVAQASRMLETLEANVLG
A0A5C6F1H9      D--MIIVDTPPLLAVSDPANLASR--VDGVILVVRLRKNIKPAVAQATRMLETLDANVLG
A0A255QXY0      D--CIIVDTPPLLMVSDPSIVASY--VDAAIMVMRIAHRCKPNAKEALSMLRWSGTRVIG
A0A517SYI0      D--YVIVDTPPLLMVSDPAVVTTY--VDSTILVMRIRRRCRPNAREAVAMLRSAGASILG
A0A518HX54      D--FIIVDTPPLLMVSDPTIVTTY--VDAAILVMRIRRRCKPNAKEAVAMLRWTGSRVMG
A0A5B9MF59      D--FVIVDTPPLLMVSDPAVVTTY--VDASMLVMRIRRRCKPNAKEAISMLRAAGARVMG
A0A2A2WC24      D--FVIVDTPPLLMVSDPAVVTTY--VDAAMLVMRIRRRCKPNAKEAISMLRAAGARVMG
A0A518KYW8      D--FVIVDTPPLLMVSDPAVVTTY--VDAAMLVMRIRRRCKPNAKEAISMLRAAGARVMG
A0A5C5YZZ0      D--LIIVDTPPLLSVTDASNVATH--MDGVMVVMRIGRNIKPMSKRATTLLRMLHVNIIG
A0A518JLD2      D--LIIIDTPPMLAVSDPSNVVRR--ADGVILVARLRKNVKPVVAQASRMLETLEANVLG
A0A5M6DJ15      D--FVIVDTPPILPVVDTRVIGEH--VDGCVLAVMRDRSRTPQLIAAAETLRAHGTPIMG
A0A3L7P7S7      D--IVLIDTPPILAVSDPSIVAPR--VDGVLLVMRITRNGRPAAEQAAEVLGTLGAKVLG
A0A517N8M1      D--YVMLDTPPLLVVTDPSITASL--VDGVIVALRIRRKSRHNAKESISILRSVGAKILG
A0A5C6CW01      D--YVILDTPPLLVVTDPSITAGM--ADGVIMALRIRRKSKPNAKESVNILRSVGANLFG
A0A5C6BXS9      D--YIVLDTPPLLVVTDPSILASM--VDGVVLALKIRRKSKPNVKEAANILRNVGASIIG
M5U569          D--YIIVDTPPLLVVTDPSILASM--VDVVVMTLKIRRKSKPNLKEAANILRNVGARLVG
L7CND7          D--YIILDTPPLLVVTDPSITASM--TDGVVMALKVRRKSKPNAKEAASILANVGAKLLG
A0A0J1B8S4      D--YIILDTPPLLVVTDPSITASM--TDGVVMALKVRRKSKPNAKEAASILANVGAKLLG
F2ARR3          D--YIILDTPPLLVVTDPSITASM--TDGVVMALKVRRKSRPNAKEAASILANVGAKLLG
K5D8H6          D--YIILDTPPLLVVTDPSITASM--TDGVVMALKVRRKSRPNAKEAASILANVGAKLLG
M2AKU0          D--YIILDTPPLLVVTDPSITASM--TDGVVMALKVRRKSRPNAKEAASILSNVGAKLLG
A0A5B1CKI2      D--YIIVDTPPLLVVTDPSIIASL--VDGVVMALRVRRKSRHNSKESINILRSVGARVLG
A0A5C6EG84      D--YILLDTPPLLVVTDPSITASL--VDGVVVALRIRRKSRHNAKESLSILRSVHARILG
A0A5C6F2X4      D--YILLDTPPLLVVTDPSITASM--VDGVVVALRIRRKSRHNARESINILRSVSARILG
A0A5C5XTV6      D--YIVLDTPPLLVVTDPSILASM--VDGVVVALKIRRKSKPNVKEAATILRNVGARVLG
A0A5C6AAB1      D--YIVLDTPPLLVVTDPSILASM--VDGVVMALKIRRKSKPNTKEAAGILRTVGARLIG
M5T8W8          D--YIIVDTPPLLVVTDPSIMASL--VDAVVMTLKIRRKSKPNLKEAATILRTVGARLIG
M5SF00          D--YIILDTPPLLVVTDPSITASM--TDGVVMALKVRRKSKPNAKEAASILANVGAKLLG
A0A2G1WDS1      D--YIILDTPPLLVVTDPSITASM--TDGVVMALKVRRKSKPNAKEAASILANVGAKLLG
Q7UVS9          D--YIILDTPPLLVVTDPSITASM--TDGVVMALKVRRKSKPNAKEAASILANVGAKLLG
A0A5C6B601      D--FVIVDTPPLLMVSDPAVVTTY--VDAAMLVMRIRRRCKPNAKESVAMLRSAGVRIVG
A0A517PFU1      D--FILLDSPPVLAVSDPAATARL--ADGVVVVTRLHPRTRRRLGECLDTLDQAGARVLG
A0A5B9M8J9      D--FIIVDTPPLLMVSDPAIVTTY--VDAALLVIRIRRRCRPNAKEAAAMLRWSGSRVMG
A0A2A2WFP6      D--FIIVDTPPLLMVSDPTVVTTY--VDAAILVMRIQRRCKPNAKEAVAMLRWTGSRVMG
A0A518L8N2      D--FIIVDTPPLLMVSDPTIVTTY--VDAAILVMRIQRRCKPNAKEAVAMLRWTGSRVMG
A0A518HQN9      D--FVIVDTPPLLMVSDPAVVTTY--VDAAMLVMRIRRRCKPNAKEAISMLRAAGARVMG
A0A5M6D8H8      D--FVIVDTPPLLMVSDPAVVTSY--VDAAMLVLRIRRRCKPNAKEAVAMLRSAGARVMG
A0A5B1CRW9      D--LVLVDAPPVLAVADPAIIAPF--VDSVLLTVRVIKNGRGIVDDAIRILDDIQIQPTA
A0A5C6EI46      D--LVMIDAPPVLAVADPAIIAPY--VDSVLLTVRVTKNGRGTVEDAVRILNDIQITPAA
A0A2E7D3V4      D--FVLVDTPPLLAVSDPCIVAPY--TDGLLMVVCVGKNKRTTTRRAADLLDTHNVEVLG
A0A2S8F9B8      D--FVIVDAGPVLGAPSTRLLAQPQYADGVILSIFKDVSQVTLVEDAKRILTSFGAPIIG
A0A368KP63      D--FVIVDAGPVLGSPSTRLLAQPQYVDGVILSVFKDVSQVTQVEDAKRVLTSFGAPILG
A0A2E0SHG0      D--FVVIDSPPLLVVSDATAVAPR--ADVVILNLRFKKNGRPEALRAIEILNGVAANILG
A0A518CQB8      D--YVIIDSPPLLVVSDATAIAPR--VDSVILNLRFKKNGRPEATRAMEILQSVDADVLG
A0A5B9PER9      D--FVIIDTPPLLAVTDACPIAAR--VDGVVLCIRIKKNVRISAERSTEMLRNLGANCLG
A0A517QSM4      D--YVIVDSAPILPVADTLLLAQD--VDGVILTIRRDVSRLGNVAAAQQRLEMIGVPPIG
A0A355GJI7      D--YVLIDTPPLVVVSDPSVIASI--VDGVLLVVRIDKNRRGVIRKVQQIIQTNGIKVAG
A0A1Z8MCI4      D--LILVDTSPLNLTPETMLVAES--FDHAIVSFMRDKSRAAYAAKMLDKLELLDSNVVG
A0A517SYL7      D--LILVDTSPLNLTPETMLVAES--FDHAIVSFMRDKSRAAYAAKMLDKLELLGSNVVG
A0A3L7P0L2      D--VIIIDTPPILAVSDPAIVSPH--IDGLIMVVRMGKNKRAAAERAREMIDAHGIRLYG
A0A142XL75      D--FVVVDTSPLLLVSDTLLLARE--ADGVVVSVLMGVSQVALVDEAVTRLQAVRAKVTG
A0A517SCC8      D--IVLIDSPPVLAVTDPCVIAPQ--TDAMVLVVRMEKNKRASVTHTREQLDSYGVRLLG
A0A3A0DR44      D--FVVIDTPPILCASESLVIAKA--ADGTLLCALRDVSRSRQVRLASDRLNMAGVNLMG
A0A358MY60      K--YVIVDTAPVLSAGETLAVAAQ--TDATLVCVMRDVSRSDAVLRSSKRLEAAGANVVG
A0A517MNB1      R--YVVIDTAPVLAAGETLAIAAE--TDATLVCMMRDLSRTDTAIRSQRRLEAAGANVVG
A0A517XRC2      D--FVVVDSCPVLPVADALLIGQH--VDGVVFSIMQDISQLPKVMVASEKLHQLSINLLG
A0A142YJ13      E--FIIVDSSPVLLVTDTLIISQH--IDAVLFSVLRDVSQLPQIRAAFDWLTSMGVRILG
A0A517Z7D3      D--YIIVDTPPILAVSDPCIISPH--CDGMLLVIRADKNQRPAVRRTQEILAAHGVRLHG
A0A5C1AGE3      D--FIVVDSCPVLPVADTLLIGQH--VDGVLISILQDISQLPKVLDASDRLSQLNIPLLG
A0A142XAP8      D--FVIVDSCPVLPVADALLIAQH--VDGVVFSIMQDVSQLPKVVTASEKLTQLNIQLVG
A0A2Z3HEL7      D--FVIVDSCPVLPVADALLIAQH--VDGVVFSIMQDISQLPKVMTASEKLTQLNIPLVG
A0A1N6KY57      D--FLVIDSSPVLPVADALLIGQH--VDAVIFSIMRDVSRIPTVQAAYDRLARLGIRMLG
L0DK20          D--FIVVDSSPVLPVADALLIGQH--VDAVLFSIMRDVSRIPKVHEAYERLAKLGIRMLG
A0A660UUK3      D--HVIIDTPPVLASADPLVWAKM--ADAVIMACFAEHTSRPDLREAIERLEQIGVRVLG
A0A517ZHG5      E--FVVVDSSPVLPVTDSLMVAQH--VDAVILSIRRDVSRRPKVAATRDRLAMLGVPVLG
A0A1Z8MPL5      E--YIVVDSAPVLSVVDSLLIGQQ--CDAAILSILRDKSRIVPVYETNERLRTTQIPVLG
A0A5C6C1R5      D--FVIVDTPPVLPVVDTRVIGEH--VDAAVLSVMKDKSRIPQVVAAHETLKAHGVPVMG
A6BZU4          D--YILIDTPPLVVVSDPSVIASI--VDGVLLVVRIDKNRRGVIRKVQQIIQTNGIKVTG
A0A2D5GZ77      D--YILIDTPPLVVVSDPSVIASI--VDGVLLVVRIDKNRRGVIRKVQQIIQTNGIKVTG
A0A3D3R1Z6      D--YILIDTPPLVVVSDPSVIASI--VDGVLLVVRIDKNRRGVIRKVQQIIQTNGIKVTG
A0A517XG00      D--YILIDTPPLVVVSDPSVIASI--VDGVLLVVRIDKNRRGVIRKVQQIIQTNGIKVTG
A0A1G2YRE4      D--YIIIDSPPVLLFPDALMWAKI--AGSVMLTSFAGQTTTQDLREANQRLTQINVKVLG
A0A353Z859      D--FVIVDSSPLLQVTDPLLAAQS--VDGVIVSIRRDVSQMPKVSSAIEKLQMMGIPVWG
A0A2D6ST10      D--FVIIDSAPVLFVTDSLLIAQH--VDGVLFAVRRDISRAMKVASAQQRLSMLGVPMLG
A0A177QX42      D--FVLIDTPPILIVTDPAAVAAH--VDGVILVVRNTKRSRPQTRRVRETLDLIGARVLG
A0A517SHR0      D--FVLMDTPPILIVTDPAAVAAH--VDGVILVVRNTKRCRPQTRRVRETLDLIGARVLG
A0A2E0AW64      K--HIVIDTPPILAAGESMVMAKA--ADATILCAKRDVTRMEQLKKSRERLKGAGAEIVG
A0A351FZ59      K--HIVIDTPPILAAGESMVMAKA--ADATILCAKRDVTRMEQLKKSRERLKGAGAEIVG
A0A660V239      D--HVIIDTPPVLAFSDALLWARM--ADGVILTSFVDRTSRLDLKEAIERLEQADAKILG
A0A177Q3B7      E--YIVIDSAPVLPLVDSLLLAQH--VDGVVLSVLRRVSQLPLFESAVERLQSVGVNLLG
A0A2E0X6Y6      D--QVLVDCPPVLAVSDAQVVGRL--VDGAVIVVRPDKNHRRMVIRAVENFAATGCHIFG
A0A518GFD7      D--LVIIDTPPVLPVIDARVIGKY--TDGVIFTLVRDRSRLPNAARACDLLKSYGIAVLG
A0A5C5VZJ8      D--VVLVDSAPLLMASESVMLAQR--VDGTIMVIREQHCRRHGLTEVIELLDSAGGTLLG
A0A518GE37      R--YIVVDTAPVLPASETLAATSA--CDATLLCAMRDISRTDHVKRTQNRLLASGTNVIG
A0A5C6F3H8      S--YVVMDTAPVLSAGETLAVASA--VDASLICVMRDVSRIDNVTRTTRRLEAAGASIAG
A0A5C5X072      Q--YVVIDTAPVLAAGESLAIASA--VDSTLICVMRDVSLKENVVRTTRRLEAAGACVAG
A0A5C5WUQ3      S--FVVFDTAPVLAAGETLAVVSV--VESTLVCVMRDVSRLDNVGRAMRRIQASGASIAG
A0A5C6E697      R--YVVIDTAPVLSAAETLTVGAA--ADATLLCVMRDVSRQDATQLTARRLQAAGATVTG
A0A5C5Z1A3      T--YVVVDTSPVLSAGETLAIASA--VESTLMCMMRDVSRMDSVRLATRRLEAAGANMVG
A0A5C6D2P7      K--FVVVDTAPVLSAGESLAVAAS--VDSTLLCVMRDLSRVETVQLTTRRLQAAGATLTG
A0A5B9ML17      E--YVIFDTAPVLSAGETLSVAAS--VDTTLVCAMRDVTRMDSVIRTTHRLESAGANVAG
A0A517LX75      D--YVFIDTPPLLAVADPLIIAAQ--VDSALLVVRVQKNGRRPVERSRELLVSSKVNVAG
A0A354GX32      D--FLIVDVSPILPVADALLIGEH--ADAVLLSVLRNVSRLPAVHAAQQRLASLGIRVLG
A0A5C1AAF0      E--VVIIDSSPLMLVADALHFAKR--ADGVILTVRNDYSRVALVQETVRRLRQIAAPLLG
A0A5C6B3S0      D--FIVVDGSPVLPVVDARLIGQH--VDSVVLSVLRDVSCAPRISAACEILRSFKIPLMG
A0A518GIZ9      D--IVLIDAPPVLAVSDACIIGQH--VDGYLLTVRLGKNRRPMLRRSRDLLLAHHIPILG
A0A1C3EBY9      D--IVLIDAPPVLAVSDACIIGQH--VDGYLLTVRLGKNRRPMLKRSRDLLLAHHIPILG
D5SX64          D--IVLIDAPPVLAVSDACIIGQH--VDGYLLTVRLGKNRRPMLRRSRDLLLAHHIPILG
A0A517Z0U7      D--FIIIDSAPVLPVTDSLLIAQH--VDAVMFSVRRDVSRAAKVAAAVQRLSMLGVSILG
A0A2S8FCC0      D--YVIVDGSPILPVVDARLIGQY--VDGVVMAVLRDVSRGAKVQAARDLLSVFGVPFLG
A0A1Z8MBT6      E--YVIFDSAPILAAGETLAIAAV--VDSTLMCVMRDVTRTDSVLRSTRRLEAAGANIVG
A0A517SXN9      E--YVIFDSAPILAAGETLAIAAV--VDSTLMCVMRDVTRTDSVLRSTRRLEAAGANIVG
A0A518HFL0      D--VVIIDTSPVLPVPDALILGRL--ADGAVIATRHDQSRFPAVERANGLLTGAGIPVLG
A0A5Q3LBQ3      R--YIIIDCPPILPASEAMVIAKA--ADATLVCAKRDLSRVEQVEAAFERLHVAGARPVG
A0A3B8ZJM2      D--IVIIDTPPLLAVSDPSVVASV--VDGVVICMRLRRNVKPLATRAFRVLESVDAQVLG
A0A1U7CLW1      D--FIIVDSSPLLLVTDALIVSQH--VDAVLLSVLRAVSQLPQIYAASERLASMGVRILG
A0A142WPR7      D--FVIIDTPPLLAVTDPSAVAPR--VDAVIVTLRIAKRTRSEARRAMEVLGSVGANVLG
A0A3M1TFJ0      D--RIVIDTPPVAAFSDGVLMAVA--ADAVVLVVSARTSRRSASQLAVVELSRVGREPVG
A0A517P477      D--IVIVDSPPALPVSDGLMLAEH--VDGVMFAVRRGVTRLRNVAAALERFQAVGVPVLG
A0A517T4K9      D--LIILDSSPILPVTDTLLLAPA--ADGVVFSIRRDVSRVSKVSAASERLAMLDIPILG
A0A2Z3GZZ5      E--FVIVDSPPLMAVADPAIVAPQ--ADGVLVVFRMTKTARPAAERAREVLAGVGAHTIG
A0A4V0I6L6      D--FVLLDTPPVLAVSDPAAVAPR--ADGVIIVFRMTPAAGPNTERAKEELVAVSAHLLG
A0A255QXF5      E--YVIVDTAPVLSAGESLAVASA--VDSTLVCVMRDLTRMDSVVRTTHRLEASGANVVG
A0A518KBI5      R--TIVIDTPPVLGASEALSLCRS--ADMTVVCARRGVSRIRQIKIASEKLENAGVSIVG
A0A5C5V6Q5      S--TVVIDTPPVLGASEALSFCRS--ADMTAMCTLRGKSRGRQIRLALDQLESAGASVSG
A0A517MY49      D--QVLVDCPPVLAVSDAQIVGRH--VDAAILVVRPEKNPRHMVIRAVESFQSTNCEVLG
A0A2E6AG00      D--QILIDCPPTLVASDAAIAGRI--AGGLMLVVQPAKNHRRSVFRCVEETRSVGVXVVG
A0A1G3A880      E--QILVDSPPVLAASDAQILGRL--VDGVLLVVQPDSNRRRVVERAVESFAALGVELLG
A0A2E8ATT1      D--QILIDCPPIMAASDAAIVGHL--ADGIMLVVQPEKNHRRVVFRAVASLLGMRNKVIG
A0A518KYQ0      Q--YVILDTAPVLSAGETLAVASV--VDSTLVCVMRDLTRMDSVVRTTHRLEASGANVVG
A0A5B9QX47      R--FVVVDTAPVLAAGETLAVASA--VDSTLLCVMRDVSRTENLTRSMRRLEASGANIAG
M5T666          E--YVVFDTAPVLAAGETLAIASA--VDSTLICVMRDVSRKESVLRTTRRLEASGASVAG
M5U6N6          Q--YVVFDTAPVLAAGETLAITAV--VDSTLICVMRDVSRKESVVRTTRRLEASGASVAG
A0A517M0G2      S--FVIFDTAPVLAAGETLAIASE--TDATLVCVMRDVSRTDSVVRSSRRLEASGANVAG
A0A5C6AST1      S--YVVVDTAPVLAAGETLAVAAE--TDATLVCVMRDVSRTDTVVRSSRRLEAAGANVVG
A0A5C6C951      S--YVVIDTAPVLAAGETLAIAAE--TDATLVCVMRDVSRSDTVVRSSRRLEAAGANVVG
A0A5C6C5T3      R--YVVIDTAPVLAAGESLAIASA--VDATLICVMRDVSLKENVLRTTRRLQAAGASVAG
A0A2A2W6A9      Q--YVILDTAPVLSAGETLAVAST--VDSTLVCVMRDLTRLDSVVRTTHRLEASGANVVG
A0A518HQS9      Q--YVILDTAPVLSAGETLAIASV--VDSTLVCVMRDLTRMDSVVRTTHRLEASGANVVG
A0A5M6DFE6      D--FVIVDTAPVLSASETLAVAAS--VDTTLVCAMRDVTRKDSVVRTTHRLEAAGANVAG
A0A5C6F286      S--YVVMDTAPVLSAGETLAVASA--VDATLICVMRDVSRIDNVTRTTRRLEAAGASIAG
A0A517NGN1      D--FIVFDTAPVLSAGETLALAAA--TDVTLLCVMRDRTRMDSLERTSRRLESAGANVTG
M5RUI3          S--FVVIDTAPVLSASESLAVASS--VDSTLLCVMRDVSRMDNVNRSMRRLDASGATIAG
M5S2L2          D--YLILDTPPLLVVTDPSITASM--VDGVLLALRVRRKSKPNAKESVNILRSVGANIFG
A0A523CME0      D--YVIIDTPPVLAFPDTAILAPL--SDGIVFVINNKTTKKSLAKRAIESLHE--CRVIG
A0A354PCV3      T--YVVVDTAPVLSAGETLAIAAT--VESTLLCLMRDVSRLDSIRQTTRRLEAAGAKIVG
A0A354PHB4      T--YVVVDTAPVLAAGETLAIAAT--AESTLLCLMRDVSRLESIRQTTRRLEAAGAKIVG
A0A356ESF4      D--QVLIDSPPVLAASDAAVIGRL--VDGVVLVVRPEKNCRRNVLRAAETFATLNVPLLG
A0A538RV31      D--FILIDSSPVLPVADALIIGQH--VDGVLFSLLRDVSRFPNVYAAYERLSSLGIRMLG
A0A2D6A9B6      N--YVLLDTPPIVPISDAGILSAK--SDGTLVVVALERAARRMVKEALEQLESVGAQLLG
A0A2G6JGH3      S--LIILDTPPAIPLTDAGVLSAK--CDGTILVVGLERAPRKLSKEARKQLVESGAHLLG
A0A3L7SU85      D--IVMVDTPPILAVSDPSIVAPR--VDGVLMVMRVTRNGRPAAEQAAEILGTLGAKVLG
A0A3M1RAJ8      D--FVVVDTSPLLTAADSLAVGRF--MDGVLLSVIRDNSRLPLLLEAYQRLEEVELPLLG
A0A3D4PLL5      D--QILIDAPPSLAVTDPAIIGRL--VDGIILTVRPDRNKRRMIIRAAESVTSLGGNLLG
M5RD30          D--IVLVDAPPLLAVADPAIIAPQ--VDGVLMTVRVLKNNRRSVERAGNVLEEIGVTPTA
A0A2Z3GYP4      D--YVLVDSPPLLAVSDPCVVAPR--VDGLVLTIRVTKNGRPAAERARDLLVRLKVNCLG
A0A1V6CUG1      D--YVLFDTPPINVVSDAGILSKA--ANEALLVVRMHRTHRESVDKALRLLHATNAKLVG
A0A3M1SE88      D--QVVIDSPPVLAAGDTAILGRL--ADGVLLVVQPEKNRRRVILRAAEYLTVLKIRLVG
A0A660WB30      PDRYIVVDSPPVLSTPEPDVLGSQ--VDGIVLVVRAGMTPREMVEDVLLSLNP--DKVLG
A0A660W9Z7      D--FVLIDTSPTLSTTDPMVLGAM--CDAVIIVVKAGSTQRESVEHAISLMYQANAKVLG
A0A3M1R9K7      D--FVIVDGSPVLPVADTRFVSMH--VDGVVMSVLRDVSRMPKVHAAYRTLAAFDAKILG
A0A3L7PH51      D--QILIDAPPVLAVTDPSIIGRI--VDGAIVIVRPDKNRRKMVTRAIDSFRASGVKVIG
A0A3N5UQY5      D--RIIVDAPPVTAVTDAQILGAL--CDFTILVLRADRSTREITQRAIEALRGVGGRLLG
                    :..*  *     .              .                           .

A0A356AE44      ---VIANGL----------------------------QDGSGDYQYRGGYG---------
A0A1G2XSU7      ---IVLSNV----------------------------------KYNQIYYP---------
A0A350KD81      ---LLANGV------------------------------------QSGKFGD--------
A0A2E3Z6T8      ---VVANGL--------------------------------SSDSSGYGYG---------
A0A257WQ92      ---MVANDT------------------------------PAHDLNSYSADA---------
A0A356ETW1      ---LVVNHA------------------------------KGEERGGYYGYG---------
A0A3L7NJY1      ---IVVNHL------------------------------TATDSGG-YGYG---------
A0A2D6SRY7      ---VIFNGA-----------------------------CVQEGLGLPGHYR---------
A0A1G3C300      ---IILNLV-----------------------DVSKGGYYSYYYSHYYKYG---------
A0A524HC32      ---CIANKV---------------------------------NQSKTYGYGSY-------
A0A660VT66      ---LVVNDVNVTEGYYDRYYRKG-------------------------------------
A0A0S8H0S8      ---AVINAV-----------PRGN------------------------------------
A0A177PV03      ---VVVNGY----------------------------------GRNGSGYGYDAYRYGYD
A0A1G2YIM0      ---TVLNSV-----------RINKSYNE--------------------------------
A0A1G2ZG92      ---IVLNKF---------------------------------------------------
A0A1G3A0W0      ---TVFVGS-----------SDSKD-----------------------------------
A0A353BE27      ---VVINGV-------SSEAGYGYNYDYNDYRYAYKYGSN-----YRSGYG---------
A0A5C6BPW1      ---AVVIGL----------DGETSGYRS--------------------GYGG--------
A0A1I3GSP0      ---VIANDF--------QPTTSGES-----------------------GYDY--------
A0A517QJV1      ---LIANGL--------DMESASES-----------------------GYGY--------
A0A3C1QS25      ---VVVNGI--------GGQAGYGDYK---------YSKYGRNYAYNYRYGSYGNYGQPY
A0A5C6FX55      ---TVINNS--------DEASSSDGYR---------------------GYGY--------
A0A3L7UX05      ---AVVNGV----------RNASATYG---------------------GYG---------
A0A5C6DS51      ---IVVNGV---------SNNAKATY----------------------GYGN--------
A0A5C6DSL6      ---IVVNGV---------SNNAKATY----------------------GYGD--------
A0A3M1VG27      ---VVGNCL-------PDDGEDSELYT---------------------------------
A0A518GC22      ---VVINGV-------SSEAGYGYNYDYNDYRYAYKYGSN-----YRSGYG---------
A0A3L7Q373      ---VVANDI--------DYTADGGQEF---------------------------------
A0A3E0PW54      ---VVANGV----------SPAADDYRA--------------------------------
A0A1Z8MHR4      ---VVINKM--------DEFTGKSYYRSSAS------GSY-----QSIGYG---------
A0A5C6EHJ0      ---IIVNGV--------GSRAARGYGKYSGSEGEYNYGSS-----YQYGYG---------
A0A5C6F1H9      ---IVVNGV--------GSRAARGYGKSSEAEGNYNYGSS-----YQYGYG---------
A0A255QXY0      ---VVINKL--------S--PRNQAYKASAS------GGY-----QSIGYG---------
A0A517SYI0      ---VVINKM--------DEFTGKSYYRSSAS------GSY-----QSIGYG---------
A0A518HX54      ---VVINKF--------TAPHSTASYQSSAC------GSY-----QSIGYG---------
A0A5B9MF59      ---VVVNEI--------DEVSGGASYKTSAS------GSY-----QSIGYG---------
A0A2A2WC24      ---VVVNEI--------DDVSGGASYKSSAS------GSY-----QSIGYG---------
A0A518KYW8      ---VVVNEI--------DDVSGGASYKSSAS------GSY-----QSIGYG---------
A0A5C5YZZ0      ---IIVNAV--------GDSGYSATYSQAWS------DSYGGQPGSEYGYSS--------
A0A518JLD2      ---IVINGVGSREAGAYGKSSGREGYY--NQ------GEY-----YKYGYG---------
A0A5M6DJ15      ---VVVNGC--------NDGSNDNSY----------------------------------
A0A3L7P7S7      ---VIVNGY--------DPRESDKYGY---------------------GYGYGYKYSYGY
A0A517N8M1      ---VVINNS--------DEAGASDGYR---------------------GYGY--------
A0A5C6CW01      ---VVINNS--------DEAGTSDGYK---------------------GYGY--------
A0A5C6BXS9      ---VVINNS--------DESSASDGYK---------------------GYGY--------
M5U569          ---VVVNNS--------DESSSSDGYK---------------------GYGY--------
L7CND7          ---VVINAS--------DEGANNDGYK---------------------GYGY--------
A0A0J1B8S4      ---VVINAS--------DEAGNNDGYK---------------------GYGY--------
F2ARR3          ---VVINAS--------DEGSNNDGYK---------------------GYGY--------
K5D8H6          ---VVINAS--------DEGSNNDGYK---------------------GYGY--------
M2AKU0          ---VVINAS--------DEGSNNDGYK---------------------GYGY--------
A0A5B1CKI2      ---VVINNS--------DEAGASDGYR---------------------GYGY--------
A0A5C6EG84      ---IVINNS--------DEAGSSDGYR---------------------GYGY--------
A0A5C6F2X4      ---IVINNS--------DEAGASDGYR---------------------GYGY--------
A0A5C5XTV6      ---IVINNS--------DESSASDGYR---------------------GYGY--------
A0A5C6AAB1      ---VVVNNS--------DESGSSDGYK---------------------GYGY--------
M5T8W8          ---VVVNNS--------DESGSSDGYK---------------------GYGY--------
M5SF00          ---VVINAS--------DEGANNDGYK---------------------GYGY--------
A0A2G1WDS1      ---VVINAS--------DEGANNDGYK---------------------GYGY--------
Q7UVS9          ---VVINSS--------DEGSNNDGYK---------------------GYGY--------
A0A5C6B601      ---VVVNKI--------DEVSGSASYKASAS------GSY-----QSIGYG---------
A0A517PFU1      ---LVVN-----------AVPAGGEYTREVQ------GGY-----YG-GYG---------
A0A5B9M8J9      ---VVINKF--------TATHSTASYQSSAS------GSY-----QSIGYG---------
A0A2A2WFP6      ---VVINKF--------TAPRSMASYQSSAS------GSY-----QSIGYG---------
A0A518L8N2      ---VVINKF--------TAPHSTASYQSSAS------GSY-----QSIGYG---------
A0A518HQN9      ---VVVNEI--------DDVSGGASYKSSAS------GSY-----QSIGYG---------
A0A5M6D8H8      ---VVVNKM--------DEISGGASYKSSAS------GSY-----QSIGYG---------
A0A5B1CRW9      ---VIVNGI--------D---------KNVS------RSY-----QYGGYGR--------
A0A5C6EI46      ---VIVNGI--------D---------RNAL------KTY-----AYGGYGK--------
A0A2E7D3V4      ---VIANSI-----------EQT--------------------QGNSYTYS---------
A0A2S8F9B8      ---TVLSGY-----------TS----------------------------G---------
A0A368KP63      ---TVLSGY-----------ST----------------------------G---------
A0A2E0SHG0      ---VTMTGY-----------DSQ--------------------------SG---------
A0A518CQB8      ---VTMTGY-----------DSQ--------------------------GG---------
A0A5B9PER9      ---LVVNGV-----------GQQSGYGSQYTYGAYRAGYSYNGYGYGYGYG---------
A0A517QSM4      ---SILIGL-----------DE---------------------------FA---------
A0A355GJI7      ---ILANSV-----------KSGK-----------PGD-----------YD---------
A0A1Z8MCI4      ---AVFSGT-----------PIR-------------------------EYK---------
A0A517SYL7      ---AVFSGT-----------PIR-------------------------EYK---------
A0A3L7P0L2      ---VIVNDI-----------DYSV-----------E-------------DG---------
A0A142XL75      ---VIANGV-----------RHAA-----------HA------------YT---------
A0A517SCC8      ---AIANDA-----------SHAA-----------QR------------DG---------
A0A3A0DR44      ---AVLSGT-----------SAR-------------------------RYA---------
A0A358MY60      ---TVFSGV-----------PSR-------------------------QYA---------
A0A517MNB1      ---SVFSGV-----------PYQ-------------------------QYS---------
A0A517XRC2      ---AVVNGV-----------HMG---------------------SAYYAYG---------
A0A142YJ13      ---AVVSGV-----------PAG--------------------------SK---------
A0A517Z7D3      ---VVVNAL-----------DAE--------------------------KD---------
A0A5C1AGE3      ---AVVNGI-----------KTDI-----------HA------------YG---------
A0A142XAP8      ---AVVNGI-----------KQDV-----------YS------------YG---------
A0A2Z3HEL7      ---AVVNGI-----------KQDV-----------YS------------YG---------
A0A1N6KY57      ---AIVTGE-----------QTD-------------------------HYG---------
L0DK20          ---AIVTGE-----------QSD-------------------------HYG---------
A0A660UUK3      ---TVLNNV-----------RVGS-----------SY------------YR---------
A0A517ZHG5      ---AVVIGL-----------DGET-----------SGYRSGY-------GG---------
A0A1Z8MPL5      ---CVFNGQ-----------QNNI-----------FSPGY---------YT---------
A0A5C6C1R5      ---VVVSGC-----------PSKN-----------GE------------YL---------
A6BZU4          ---LLANGV-----------QSGK-----------FGD-----------YD---------
A0A2D5GZ77      ---LLANGV-----------QSGK-----------FGD-----------YD---------
A0A3D3R1Z6      ---LLANGV-----------QSGK-----------FGD-----------YD---------
A0A517XG00      ---LLANGV-----------QSGK-----------FGD-----------YD---------
A0A1G2YRE4      ---TVLGNV-----------QAQ--------------------------YS---------
A0A353Z859      ---AVAIGV-----------DQSS-----------YGYGYGYGYGYGYGYG---------
A0A2D6ST10      ---AVVIGL-----------DRD-----------------------SYGYN---------
A0A177QX42      ---VVVNGI-----------SERA-----------AGYGYGDSYSYNYTTS---------
A0A517SHR0      ---VVVNGI-----------SERA-----------AGYGYGDSYSYNYTTS---------
A0A2E0AW64      ---CVFNDV-----------PPN-------------------------RYS---------
A0A351FZ59      ---CVFNDV-----------PPN-------------------------RYS---------
A0A660V239      ---TVVNNV-----------KVT-------------------HSYHRYGYG---------
A0A177Q3B7      ---AVMNGM-----------SPKV-----------HA------------SR---------
A0A2E0X6Y6      ---VVANGV-----------TAD---------------------SNGYGYG---------
A0A518GFD7      ---TVVIGG-----------RST--------------------------GY---------
A0A5C5VZJ8      ---TVFVGS-----------TTP-------------------SGYASYNYY---------
A0A518GE37      ---VVFSGV-----------PSS------------D-------------YA---------
A0A5C6F3H8      ---TVFSGV-----------SAR------------Q-------------YS---------
A0A5C5X072      ---TVFSGV-----------SAR------------Q-------------YG---------
A0A5C5WUQ3      ---TVFSGV-----------TPR------------Q-------------YS---------
A0A5C6E697      ---TVFSGV-----------ATQ------------E-------------YS---------
A0A5C5Z1A3      ---TVFSGV-----------TAQ------------Q-------------YA---------
A0A5C6D2P7      ---TVFSGV-----------TAR------------Q-------------YA---------
A0A5B9ML17      ---TIFSGV-----------TPR------------Q-------------YA---------
A0A517LX75      ---IIVNGA-----------ERG------------DKNFGYGEYVQPYEYG---------
A0A354GX32      ---AVVIGE-----------GME-------------------------------------
A0A5C1AAF0      ---VVVNGY-----------THGG-----------SG------------YG---------
A0A5C6B3S0      ---AVVLGS-----------RAE---------------------------A---------
A0A518GIZ9      ---VVANGV-----------EPS------------------DREEMGYYAD---------
A0A1C3EBY9      ---VVANGV-----------EPS------------------DREEMGYYAD---------
D5SX64          ---VVANGV-----------EPS------------------DREEMGYYAD---------
A0A517Z0U7      ---AVAIGL-----------EDGG-----------SSNRYYGRYGYGYGYN---------
A0A2S8FCC0      ---VVVVGT-----------TRE-------------------------------------
A0A1Z8MBT6      ---TIFSGV-----------TPS------------K-------------YV---------
A0A517SXN9      ---TIFSGV-----------TPS------------K-------------YV---------
A0A518HFL0      ---VVVNGA-----------RGSD-----------RR------------FG---------
A0A5Q3LBQ3      ---AVLNGV-----------PAR------------S-------------YL---------
A0A3B8ZJM2      ---VVVNGV-----------STE-------------------AAYGGYGYN---------
A0A1U7CLW1      ---AVVSGV-----------PLKP-----------NR------------YY---------
A0A142WPR7      ---VVVNGI-----------SSR------------KGYGYSGSGNRGYAYG---------
A0A3M1TFJ0      ---VI---L-----------NQRP-----------GSDYGYYYGDLYYGYG---------
A0A517P477      ---AVAIGM-----------DDEV-----------GR-----------------------
A0A517T4K9      ---AVVIGI-----------DQSA-----------YG----VMYNERYRYA---------
A0A2Z3GZZ5      ---VVVNAS-----------GDEG-----------RG----YGYGYGYGYE---------
A0A4V0I6L6      ---VVVNAS-----------SEQ------------HA----NYGYG---YT---------
A0A255QXF5      ---TIFSGV-----------SHR------------Q-------------YA---------
A0A518KBI5      ---SVLSGV-----------PPR------------G-------------YG---------
A0A5C5V6Q5      ---SILSGV-----------P--------------S-------------YS---------
A0A517MY49      ---IVANGL-----------TTE------------MG----G-------YG---------
A0A2E6AG00      ---LIVNRL-----------TXX------------EG----RSY-----YG---------
A0A1G3A880      ---VVANRI-----------RPE------------SN----DRYDDGCAYA---------
A0A2E8ATT1      ---IIANRI-----------QPQ------------DQ----RGY-----YG---------
A0A518KYQ0      ---TIFSGV-----------TPR------------Q-------------YS---------
A0A5B9QX47      ---TVFSGV-----------SPR------------E-------------YA---------
M5T666          ---TVFSGV-----------SAR------------Q-------------YG---------
M5U6N6          ---TVFSGV-----------SAR------------Q-------------YA---------
A0A517M0G2      ---TVFSGV-----------PSS------------Q-------------YA---------
A0A5C6AST1      ---TVFSGV-----------PYS------------N-------------YA---------
A0A5C6C951      ---TVFSGV-----------PYS------------N-------------YA---------
A0A5C6C5T3      ---TVFSGV-----------SAR------------Q-------------YG---------
A0A2A2W6A9      ---TIFSGV-----------TPR------------Q-------------YS---------
A0A518HQS9      ---TIFSGV-----------TPR------------Q-------------YS---------
A0A5M6DFE6      ---TIFNGV-----------TPR------------Q-------------YA---------
A0A5C6F286      ---TVFSGV-----------SAR------------Q-------------YS---------
A0A517NGN1      ---TIFSGV-----------TSR------------A-------------YA---------
M5RUI3          ---TVFSGV-----------TAG------------Q-------------YA---------
M5S2L2          ---IVINNS--------------------------------DESGASD--G---------
A0A523CME0      ---CVMNKC--------------------------------EVSVSEY-YG---------
A0A354PCV3      ---TVFSGV--------------------------------TSRQYAYRYG---------
A0A354PHB4      ---TVFSGV--------------------------------TSRQYSYRYG---------
A0A356ESF4      ---IAVNQV--------------------------------KAESRAGYYG---------
A0A538RV31      ---AVVNGV--------------------------------RQDR----YG---------
A0A2D6A9B6      TFVVGIRGA--------------------------------DPATDER-YR---------
A0A2G6JGH3      SFVVGVRGA--------------------------------DPSKDPR-YG---------
A0A3L7SU85      ---VVINGY--------------------------------DPREAGK-YG---------
A0A3M1RAJ8      ---VVVNG---------------------------------GPAGR--------------
A0A3D4PLL5      ---VVVNG---------------------------------LSDSRGE-YG---------
M5RD30          ---IIVNG---------------------------------SDAESKA-YG---------
A0A2Z3GYP4      ---VVVNGV--------------------------------G-KQGAM-AG---------
A0A1V6CUG1      ---LVLTHR--------------------------------R-FIIPS-YL---------
A0A3M1SE88      ---LVVNRT--------------------------------AKERVPG-YD---------
A0A660WB30      ---IVMNDV--------------------------------RSGVGRY-YS---------
A0A660W9Z7      ---VVLTQV--------------------------------K-NHIPK-YL---------
A0A3M1R9K7      ---AIVTG-----------------------------------NPGEA-YY---------
A0A3L7PH51      ---LVANHV--------------------------------EVSSNSD-YG---------
A0A3N5UQY5      ---IVVNQV--------------------------------H-RDGGR-YG---------
                                                                            

A0A356AE44      -----GGYD-------KTPYQQNNDIPE--------------------------------
A0A1G2XSU7      -----YGYGYYGKTNVIKDVKQEPADNIVIPEVK--------------------------
A0A350KD81      -----YDYG--SGPGYSDYYIVPPQVQT--------------------------------
A0A2E3Z6T8      -----YGYG----YSYDGGYSHEEEQDM--------------------------------
A0A257WQ92      -----Y-------------YRDVTPRQP--------------------------------
A0A356ETW1      -----YGYG----YEYNGGYGNDEDDYA--------------------------------
A0A3L7NJY1      -----YGYG----YGY--GYGHDDPADR--------------------------------
A0A2D6SRY7      -----YSYS-----HYSHYYHETDDDGE--------------------------------
A0A1G3C300      -----YGYGAEPPKEKRKREKREKKEINV-------------------------------
A0A524HC32      -----YKYYQAYNDSYDEEKKESREQIS--------------------------------
A0A660VT66      -----YYFAGDESGEGVRGIPGKELVRS--------------------------------
A0A0S8H0S8      -----RRYGRYSQYGYRRSHRRKASAPSE-------------------------------
A0A177PV03      QA---YGYG----SNESGYYHEHEGSSRKPANGNGHGGGIVARLFRWLR-----------
A0A1G2YIM0      -----YGYGYYGAAKSGYAKRVHNRRAI--------------------------------
A0A1G2ZG92      -----KAYEAGYYYYNRAYYK---------------------------------------
A0A1G3A0W0      -----YRYSSAY------------------------------------------------
A0A353BE27      -----YRYGY---GNYRYGYSEYSDTQD--------------------------------
A0A5C6BPW1      -----YGYG----SRYGYGYQYNRSPEP--------------------------------
A0A1I3GSP0      -------------DSYGTYYRENQTPAA--------------------------------
A0A517QJV1      -------------ESYGSYYNEDESPKA--------------------------------
A0A3C1QS25      GYGYGYGYGYDY-EEADKYYDEPVAPGG--------------------------------
A0A5C6FX55      -----YRYS----RYAKKYYRRGGNAGE--------------------------------
A0A3L7UX05      -----YGYG----YGYGGSFGDGADEDV--------------------------------
A0A5C6DS51      -------YRADEYSYVGQYHREYAAHEP--------------------------------
A0A5C6DSL6      -------YRQEEYGYIGQYHRQYAAQEL--------------------------------
A0A3M1VG27      -------------AFYAPYCAAGADADT--------------------------------
A0A518GC22      -----YRYGY---GNYRYGYTEDADTND--------------------------------
A0A3L7Q373      -------------SMYDRYYNEQTPELP--------------------------------
A0A3E0PW54      -------------NQYNSYYNPNQRPDH--------------------------------
A0A1Z8MHR4      -------YG----DSYRRRYQHDAIAHD--------------------------------
A0A5C6EHJ0      -------YS----YGYTYGYTDGNKNNS--------------------------------
A0A5C6F1H9      -------YS----YGYSYGYRE---NNS--------------------------------
A0A255QXY0      -------YG----DKYRRRYQREVNSKD--------------------------------
A0A517SYI0      -------YG----DSYRRRYQHDAIAHD--------------------------------
A0A518HX54      -------YG----DRYRRRYQREVNAQD--------------------------------
A0A5B9MF59      -------YG----DKYRRRYQQEAKTQD--------------------------------
A0A2A2WC24      -------YG----DKYRRRYQQEAKTQD--------------------------------
A0A518KYW8      -------YG----DKYRRRYQQEAKTQD--------------------------------
A0A5C5YZZ0      -----YRYG------SDRYLDASKEQTV--------------------------------
A0A518JLD2      -----YSYGAIANDSSREYYEVEAPKQA--------------------------------
A0A5M6DJ15      ------------------YYRR--------------------------------------
A0A3L7P7S7      KYSYGYKYG----YNYSDYSSYTDEEGD--------------------------------
A0A517N8M1      -----YRYG----RHTSRYYR--SGKGD--------------------------------
A0A5C6CW01      -----YRYG----RYTNRYRRRNGSDTS--------------------------------
A0A5C6BXS9      -----YRYT----RHTNRYYRKTADNGA--------------------------------
M5U569          -----YRYG----RHTSRYYRKTKDNGP--------------------------------
L7CND7          -----YRYG----RHTNRYYRKTADNGA--------------------------------
A0A0J1B8S4      -----YRYG----RHTSRYYRKTANNGS--------------------------------
F2ARR3          -----YRYG----RHTNRYYRKTADNGA--------------------------------
K5D8H6          -----YRYG----RHTNRYYRKTADNGA--------------------------------
M2AKU0          -----YRYG----RHTNRYYRKTADNGA--------------------------------
A0A5B1CKI2      -----YRYA----RHTSRYYR--SAKGN--------------------------------
A0A5C6EG84      -----YRYG----RHTSRYYR--SGKAG--------------------------------
A0A5C6F2X4      -----YRYG----RHTSRYYR--AGKSG--------------------------------
A0A5C5XTV6      -----YRYA----RQTNRYYRNTPENGP--------------------------------
A0A5C6AAB1      -----YRYG----RHTSRYYRKTADNGA--------------------------------
M5T8W8          -----YRYG----RHTSRYYRKTKDNGT--------------------------------
M5SF00          -----YRYG----RHTNRYYRKTADNGA--------------------------------
A0A2G1WDS1      -----YRYG----RHTNRYYRKTADNGA--------------------------------
Q7UVS9          -----YRYG----RHTNRYYRKTADNGA--------------------------------
A0A5C6B601      -------YG----DKYRQRYQKEANATD--------------------------------
A0A517PFU1      -------YG----AMAGR--------DA--------------------------------
A0A5B9M8J9      -------YG----DRYRRRYQREVNAQD--------------------------------
A0A2A2WFP6      -------YG----DRYRRRYQREVNAQD--------------------------------
A0A518L8N2      -------YG----DRYRRRYQREVNAQD--------------------------------
A0A518HQN9      -------YG----DKYRRRYQQEAKTQD--------------------------------
A0A5M6D8H8      -------YG----DKYRRRYQQEAKVQD--------------------------------
A0A5B1CRW9      -----NKY------GYVGRYHQDYAAKDVASDQPRVVTVNAKTIGSAATAVPVRPTFAQQ
A0A5C6EI46      -----GKYG----GGYIGHYHADYAAKE--------------------------------
A0A2E7D3V4      -----GGYA-------DYLAPSEQSLEL--------------------------------
A0A2S8F9B8      -----MYYS---------------------------------------------------
A0A368KP63      -----MYYS---------------------------------------------------
A0A2E0SHG0      -----GYYS----GGKYASYSAKESRSY--------------------------------
A0A518CQB8      -----QYYS----ASKYTSFGAKESRSY--------------------------------
A0A5B9PER9      -----YGYG----QGGKYYDEDQKGRKV--------------------------------
A0A517QSM4      -----DKYG----YYSRHYNTLDVS-----------------------------------
A0A355GJI7      -----YGSG----PGYSDYYIVPPQAQA--------------------------------
A0A1Z8MCI4      -----YQYG-------SYYYYGGKKAIE--------------------------------
A0A517SYL7      -----YQYG-------SYYYYGGKKAIE--------------------------------
A0A3L7P0L2      -----QTYN----EYEKYYDAAAPSLSA--------------------------------
A0A142XL75      -----HGYG----TVDPVEHTPAPAISA--------------------------------
A0A517SCC8      -----YHYN----SYDVYYSAPAAPRKA--------------------------------
A0A3A0DR44      -----STYG-------NYAYLEDSLS----------------------------------
A0A358MY60      -----YRYG-------DYRYL-TPKIDT--------------------------------
A0A517MNB1      -----YRYG-------DYNYLMAPEANQ--------------------------------
A0A517XRC2      -----YNYV----KQLPA------------------------------------------
A0A142YJ13      -----HNYG---------SYPGPK------------------------------------
A0A517Z7D3      -----EGYD----VQSYAAYYAEETAPT--------------------------------
A0A5C1AGE3      -----YNYV----KQLPA------------------------------------------
A0A142XAP8      -----YNYV----KQLPA------------------------------------------
A0A2Z3HEL7      -----YNYV----KQLPA------------------------------------------
A0A1N6KY57      -----SNYL----PSGRA------------------------------------------
L0DK20          -----SKYG----YSARAQESV--------------------------------------
A0A660UUK3      -----YGYG----YGADGGKAQRKAKAK--------------------------------
A0A517ZHG5      -----YGYG----SRYGYGYQYNRSPEP--------------------------------
A0A1Z8MPL5      -----YGYG----SPQPLGSDTESPS----------------------------------
A0A5C6C1R5      -----YQY----------------------------------------------------
A6BZU4          -----YGSG----PGYSDYYIVPPQVQT--------------------------------
A0A2D5GZ77      -----YGSG----PGYSDYYIVPPQVQT--------------------------------
A0A3D3R1Z6      -----YGSG----PGYSDYYIVPPQVQT--------------------------------
A0A517XG00      -----YGSG----PGYSDYYIVPPQVQT--------------------------------
A0A1G2YRE4      -----FHRY-------DRYYQNPSSRKT--------------------------------
A0A353Z859      -----YGYG----YGNSYGYGYGNRPRS--------------------------------
A0A2D6ST10      -----SRYG-------RNYQSYQQYRQY--------------------------------
A0A177QX42      -----YRSR-------SGKYYSDERVGH--------------------------------
A0A517SHR0      -----YRSK-------SGKYYSDERVGN--------------------------------
A0A2E0AW64      -----YRYG-------YYGYEDHGGI----------------------------------
A0A351FZ59      -----YRYG-------YYGYEDHGGV----------------------------------
A0A660V239      -----YGYG-------HATEDDRKRESD--------------------------------
A0A177Q3B7      -----YHYE-------PASSTLAPESLL--------------------------------
A0A2E0X6Y6      -----YGYG--------YGYGHDEDETD--------------------------------
A0A518GFD7      -----QGYY-------AYQNRSVERKPK--------------------------------
A0A5C5VZJ8      -----GSYA-------QYGRSASTDATD--------------------------------
A0A518GE37      -----YRYG-------DYHYTTANLPPP--------------------------------
A0A5C6F3H8      -----YRYG-------DYHYALGDVPFG--------------------------------
A0A5C5X072      -----YRYG-------NYHYALPDTMAT--------------------------------
A0A5C5WUQ3      -----YRYG-------DYHYSAAGLAVQ--------------------------------
A0A5C6E697      -----SRYG-------DYNYFMNAGVRS--------------------------------
A0A5C5Z1A3      -----YRYG-------DYHYVMPDFNTP--------------------------------
A0A5C6D2P7      -----YRYG-------DYHYAVSSSEAH--------------------------------
A0A5B9ML17      -----YRYG-------DYNYSNFTNLPG--------------------------------
A0A517LX75      -----YATK-------YTKSYSSRDTEE--------------------------------
A0A354GX32      ------AYG-------QVRYPTKAPQAP--------------------------------
A0A5C1AAF0      -----YGYG-------YNRLAAAKTVEV--------------------------------
A0A5C6B3S0      -----YYSD-------TNPLDTDDHFAD--------------------------------
A0A518GIZ9      -----YNRN-------EAYFPQDQASVE--------------------------------
A0A1C3EBY9      -----YNRN-------EAFFPQDQSLPE--------------------------------
D5SX64          -----YNRN-------EAFFPQDQSSPE--------------------------------
A0A517Z0U7      -----YGYR-------GSYHRTPANIS---------------------------------
A0A2S8FCC0      --------D-------VYDYTSRRDRKK--------------------------------
A0A1Z8MBT6      -----YRYG-------DYKYSNLVS-----------------------------------
A0A517SXN9      -----YRYG-------DYKYSNLVS-----------------------------------
A0A518HFL0      -----GGYA-------AYTYRTDRMPDP--------------------------------
A0A5Q3LBQ3      -----YSYG-------RYALPTA-------------------------------------
A0A3B8ZJM2      -----YSYN-------DYRYSYRSSYGY--------------------------------
A0A1U7CLW1      -----GSYT-------SPQWNPVEEEPS--------------------------------
A0A142WPR7      -----EGKA-------GVYYSEEEHPAS--------------------------------
A0A3M1TFJ0      -----YGYG-------PSQPP---------------------------------------
A0A517P477      -----YGYA-------PGRYPYAKHRQA--------------------------------
A0A517T4K9      -----YGYP-------GTK-----------------------------------------
A0A2Z3GZZ5      -----YKYT-------SYKYSDSYNTDA--------------------------------
A0A4V0I6L6      -----YKYD--------YQYSDSYTDQK--------------------------------
A0A255QXF5      -----YRYG-------DYRYSDYTDLLP--------------------------------
A0A518KBI5      -----YAYA--------YGYGYRDDTQE--------------------------------
A0A5C5V6Q5      -----YSYA--------YGYGFRNPTEH--------------------------------
A0A517MY49      -----YGYG--------YGYGHEEEAEE--------------------------------
A0A2E6AG00      -----DSYG--------YGYGDNEGD----------------------------------
A0A1G3A880      -----YGYG--------AAYRDEADQDG--------------------------------
A0A2E8ATT1      -----YGYA--------YDYSSPEDENE--------------------------------
A0A518KYQ0      -----YRYG-------DYKYSDFGQMLA--------------------------------
A0A5B9QX47      -----YRYG-------NYDYAIAGETNS--------------------------------
M5T666          -----YRYG-------DYQYALGGEPQA--------------------------------
M5U6N6          -----YRYG-------DYHYAIGGEPVA--------------------------------
A0A517M0G2      -----YRYG-------DYRYFTARPEPQ--------------------------------
A0A5C6AST1      -----YRYG-------DYRYLSPKPRA---------------------------------
A0A5C6C951      -----YRYG-------DYRYLTPKHDRV--------------------------------
A0A5C6C5T3      -----YRYG-------NYHYALPDTMAT--------------------------------
A0A2A2W6A9      -----YRYG-------DYKYSDFGQMLA--------------------------------
A0A518HQS9      -----YRYG-------DYKYSDFGQMLA--------------------------------
A0A5M6DFE6      -----YRYG-------DYTYAGAGEIPD--------------------------------
A0A5C6F286      -----YRYG-------DYDYAIGDGSFG--------------------------------
A0A517NGN1      -----YRYG-------DYHYSAIES-----------------------------------
M5RUI3          -----YRYG-------SYHYAIAGETDA--------------------------------
M5S2L2          -----YKGYGYYRYSRYTNRYY--------------------------------------
A0A523CME0      -----Y----GYEYGNDS------------------------------------------
A0A354PCV3      ----------DYHYTVNDEDFGDVGIRA--------------------------------
A0A354PHB4      ----------DYHYTVNDEDFIDVGVRD--------------------------------
A0A356ESF4      -----YAPGHAYDYADSRGSNDDPGEQK--------------------------------
A0A538RV31      -----Y----SYQYYYNKDHN---------------------------------------
A0A2D6A9B6      -----YTWDGEAKE----------------------------------------------
A0A2G6JGH3      -----YSRGE--------------------------------------------------
A0A3L7SU85      -----YGYGYGYKYSYGYKYGYKYNYGY--------------------------------
A0A3M1RAJ8      -------------------------YRS--------------------------------
A0A3D4PLL5      -----YGYGYG--------------YGE--------------------------------
M5RD30          -----YSNHYRSE-----EYSYTPYYHD--------------------------------
A0A2Z3GYP4      -----YGYDYYRHADDYSAPYTTADHDE--------------------------------
A0A1V6CUG1      -----YRYS---------------------------------------------------
A0A3M1SE88      -----AYDTAYDYHGRDESDDPVSADGV--------------------------------
A0A660WB30      -----PSYA---------------------------------------------------
A0A660W9Z7      -----Y--RYHYFNDMYADLYERLGDSG--------------------------------
A0A3M1R9K7      -----HDPRYTHYIDAADEPEPVSADET--------------------------------
A0A3L7PH51      -----YGYGYGYGYGYGHDTPPETGTDH--------------------------------
A0A3N5UQY5      -----Y-YGGHYRLGRSNHKHGPDAKAH--------------------------------
                                                                            

A0A356AE44      ------------------------------------------------------------
A0A1G2XSU7      ------------------------------------------------------------
A0A350KD81      ------------------------------------------------------------
A0A2E3Z6T8      --------------------------------------VDTADTMMTPMPEIVQLPSIAS
A0A257WQ92      -----------------------------------------------------------V
A0A356ETW1      -----------------------------------------------------------D
A0A3L7NJY1      -----------------------------------------------------------D
A0A2D6SRY7      ------------ESTEFGWRRWLLKCRRALSSQRGETWAASAKGQTTDPQTTNAQIADPQ
A0A1G3C300      ------------------------------------------------------------
A0A524HC32      ------------------------------------------------------------
A0A660VT66      ------------------------------------------------------------
A0A0S8H0S8      ------------------------------------------------------------
A0A177PV03      ------------------------------------------------------------
A0A1G2YIM0      ------------------------------------------------------------
A0A1G2ZG92      ------------------------------------------------------------
A0A1G3A0W0      ------------------------------------------------------------
A0A353BE27      --------------------------------LSVKQPGNPQ------------------
A0A5C6BPW1      ------------------------------------------------------------
A0A1I3GSP0      ------------------------------------------------------------
A0A517QJV1      ------------------------------------------------------------
A0A3C1QS25      --------------------------KRRKRSAAIGNDGPKS------------------
A0A5C6FX55      -------------------VVPKGSKKR----SGMVVSGRSTQNRVRPSEAMPTRNEAVA
A0A3L7UX05      ------------------------------------------------------------
A0A5C6DS51      ------------------------------------------------------------
A0A5C6DSL6      ------------------------------------------------------------
A0A3M1VG27      ----------------------AGEAADPSALAEASEAGRPSEEEAADRSSTPIASGA--
A0A518GC22      ------------------------------------------------------------
A0A3L7Q373      ----------------------------SPLSRELLVGSQK-------------------
A0A3E0PW54      ------------------------------------------------------------
A0A1Z8MHR4      ----------------AYVVRGYRPAGSDAQYDARYDSYAQSGPGMGGPSSGGVVPPGHY
A0A5C6EHJ0      ----------------YYEEE--PTGRKKAKAKKLAKSKLVVAPPKPGDKT---------
A0A5C6F1H9      ----------------YYEEDDKKKGKDRKKAQQIRKAAVVAPPTSPADDV---------
A0A255QXY0      ----------------TYMIKAKGSTHRVDGPELDLEADAVVDPV---------------
A0A517SYI0      ----------------AYVVRGYRPAGSDAQYDARYDSYAQSGPGMGGPSSGGVVPPGHY
A0A518HX54      ----------------TYVVTGTKNLERVDL-VAPSKASQPGKPHLHQVV----------
A0A5B9MF59      ----------------TYVVKGKQASER---PTSAGKVDDAVEPY---------------
A0A2A2WC24      ----------------TYVVKGRHASDPVSVPAAPVESGDPPGTYEGEIADPEFTDPEFT
A0A518KYW8      ----------------TYVVKGKHASDPVSVPAAPAESGHQPGTYEQEIADPEFTDSEFA
A0A5C5YZZ0      ------------------TVRGRHRAEK----AEPIGAGAGGESNGKG------------
A0A518JLD2      --------------------------------APVQQTQHV-------------------
A0A5M6DJ15      ------------------------------------------------------------
A0A3L7P7S7      ---------------------GEGDDGKGGYDDRPRAPSLGSRVLPNVQPRVRTKRLTGG
A0A517N8M1      ----------------------KSSRRRS---EPRIISGRG----------AAI--AKVM
A0A5C6CW01      ----------------------KGRDSSRSNMAPVVVKGRG----------STSSRKAKK
A0A5C6BXS9      ----------------------RGGTLR----TPVMVSGRG----------SIEQSANVA
M5U569          ----------------------KGGQPR----TPIVVSGRA----------VGLRASAAA
L7CND7          ----------------------KAGQRR----SPVVVSGRG----------SAARSARPI
A0A0J1B8S4      ----------------------KAGTRR----TPVVVSGRG----------PAPRSARPI
F2ARR3          ----------------------KAGQRR----SPVVVSGRG----------PAARSARPI
K5D8H6          ----------------------KAGQRR----SPVVVSGRG----------SAARSARPI
M2AKU0          ----------------------KAGQRR----SPVVVSGRG----------SAARSARPI
A0A5B1CKI2      ----------------------KVRRDK----EPLIISGKG-----SQ------------
A0A5C6EG84      ----------------------KSQKQS----QPLIISGRG-----SR--------TAPA
A0A5C6F2X4      ----------------------KSHKPS----QPLIISGRG-----SKPQAKATSAKATS
A0A5C5XTV6      ----------------------MGGKVR----TPVIVSGRGEMGQPVNGSPNPGSPNPVA
A0A5C6AAB1      ----------------------KSGQLR----TPVIVSGRG-------MTPVPRKANLGA
M5T8W8          ----------------------KGGQPR----TPIVVSGRA-------VGL---RASAAA
M5SF00          ----------------------KAGQRR----SPVVVSGRG-------SAA---RSARPI
A0A2G1WDS1      ----------------------KAGQRR----SPVVVSGRG-------GGA---RSARPI
Q7UVS9          ----------------------KAGQRR----SPVVVSGRG-------QAA---RSARPI
A0A5C6B601      ----------------TYIVKGKSDEAP----TVVAPPDVSPTLITGSTNAESTPDESYS
A0A517PFU1      ----------------YYSDEGTSAPAA----PALIAATPADGDAATARRSTRTPDAARS
A0A5B9M8J9      ----------------TYVVTGTKHLGR----VDKVSSDAAATLAKPHLRTAQPTDSNA-
A0A2A2WFP6      ----------------TYIVTGTKNLER----VDLVAPSNSSQPGKPHLRQVVPQDSASG
A0A518L8N2      ----------------TYIVTGTKNLER----VDLVTASEATRPGKPHLQQTDSKSQSH-
A0A518HQN9      ----------------TYVVKGRHASDP----GAM--PGAPTGPVGEPGAYEREITDSEI
A0A5M6D8H8      ----------------TYVVKGKVASEP----AEVRRPARNGKPVASTVAGD-PVQASRG
A0A5B1CRW9      ASQSVNGTESDGLPRQQSSNHQNNMEKL----ESIIESGKTAKIDGPSKGRPTSPRGGPA
A0A5C6EI46      ----------------RSDVHRSDATRS----EPTPKNGRPATFAAASADLGSSVRRQPA
A0A2E7D3V4      -----------------------------------------------QREAQQPTAQPVA
A0A2S8F9B8      -----------------------------------------------YTNRPTSTVEVEQ
A0A368KP63      -----------------------------------------------YTARTKSTVEVAK
A0A2E0SHG0      -----------------------------------------------YTNYTKTAARKSK
A0A518CQB8      -----------------------------------------------YTSYTKT-ARKEK
A0A5B9PER9      -----------------------------------------------DPNVAQRIESKTS
A0A517QSM4      ------------------------------------------------------------
A0A355GJI7      -----------------------------------------------KQADVPAKTKITH
A0A1Z8MCI4      -----------------------------------------------MPVSKDACSGIGS
A0A517SYL7      -----------------------------------------------MPVSKDACSGIGS
A0A3L7P0L2      -----------------------------------------------QPQTELVGGRK--
A0A142XL75      -----------------------------------------------SPVTTERE-----
A0A517SCC8      -----------------------------------------------EEPVTV-------
A0A3A0DR44      ------------------------------------------------------------
A0A358MY60      ------------------------------------------------------------
A0A517MNB1      -----------------------------------------------PAIK---------
A0A517XRC2      ------------------------------------------------------------
A0A142YJ13      ------------------------------------------------------------
A0A517Z7D3      -----------------------------------------------PAAPAKTQSEPAN
A0A5C1AGE3      ------------------------------------------------------------
A0A142XAP8      ------------------------------------------------------------
A0A2Z3HEL7      ------------------------------------------------------------
A0A1N6KY57      ------------------------------------------------------------
L0DK20          ------------------------------------------------------------
A0A660UUK3      -----------------------------------------------RGRSLLLVAPKSE
A0A517ZHG5      -----------------------------------------------TPSQS--------
A0A1Z8MPL5      ------------------------------------------------------------
A0A5C6C1R5      ------------------------------------------------------------
A6BZU4          -----------------------------------------------KQADAPAKTKLTH
A0A2D5GZ77      -----------------------------------------------KQADAPAKTKLTH
A0A3D3R1Z6      -----------------------------------------------KQADAPAKTKLTH
A0A517XG00      -----------------------------------------------KQADAPAKTKLTH
A0A1G2YRE4      -----------------------------------------------AEQAKIQLLLPDT
A0A353Z859      -----------------------------------------------SAPAVPSESPSDQ
A0A2D6ST10      -----------------------------------------------PR-----------
A0A177QX42      -----------------------------------------------SYYDDSRKRR---
A0A517SHR0      -----------------------------------------------SYYDDSRKRR---
A0A2E0AW64      ------------------------------------------------------------
A0A351FZ59      ------------------------------------------------------------
A0A660V239      -----------------------------------------------ARKRAETLLLTTE
A0A177Q3B7      -----------------------------------------------DIDLSGVPSESSE
A0A2E0X6Y6      -----------------------------------------------GFEEDSPVGHDDL
A0A518GFD7      -----------------------------------------------LIEN---------
A0A5C5VZJ8      ------------------------------------------------------------
A0A518GE37      -----------------------------------------------H------------
A0A5C6F3H8      -----------------------------------------------DSSSELSESSVS-
A0A5C5X072      ------------------------------------------------------------
A0A5C5WUQ3      -----------------------------------------------E------------
A0A5C6E697      ------------------------------------------------------------
A0A5C5Z1A3      -----------------------------------------------S------------
A0A5C6D2P7      ------------------------------------------------------------
A0A5B9ML17      -----------------------------------------------SAT----------
A0A517LX75      -----------------------------------------------LATASR-------
A0A354GX32      -----------------------------------------------AQ-----------
A0A5C1AAF0      -----------------------------------------------EVKAEAR------
A0A5C6B3S0      -----------------------------------------------ETSATIPEST---
A0A518GIZ9      -----------------------------------------------KPSIHRDLTISAS
A0A1C3EBY9      -----------------------------------------------KSSTHRDLTISAS
D5SX64          -----------------------------------------------KSSTHRDLTISAS
A0A517Z0U7      ------------------------------------------------------------
A0A2S8FCC0      -----------------------------------------------RLVHVG-------
A0A1Z8MBT6      ------------------------------------------------------------
A0A517SXN9      ------------------------------------------------------------
A0A518HFL0      -----------------------------------------------AGGPSAG------
A0A5Q3LBQ3      ------------------------------------------------------------
A0A3B8ZJM2      -----------------------------------------------GYGKYGKYGYGKY
A0A1U7CLW1      ------------------------------------------------------------
A0A142WPR7      -----------------------------------------------SLTSQS-------
A0A3M1TFJ0      ----------------------------------------------------ARAGGSGA
A0A517P477      -----------------------------------------------RLLERTPAQAAKI
A0A517T4K9      ------------------------------------------------------------
A0A2Z3GZZ5      -----------------------------------------------DEDGARLVPAPTR
A0A4V0I6L6      -----------------------------------------------K------------
A0A255QXF5      -----------------------------------------------AGSNAE-------
A0A518KBI5      -----------------------------------------------QIESDDAGRR---
A0A5C5V6Q5      -----------------------------------------------SGGIEVSR-----
A0A517MY49      -----------------------------------------------SAATRVPATTHER
A0A2E6AG00      ------------------------------------------------------------
A0A1G3A880      -----------------------------------------------LIGA---------
A0A2E8ATT1      -----------------------------------------------QIST---------
A0A518KYQ0      -----------------------------------------------ETTHRN-------
A0A5B9QX47      ------------------------------------------------------------
M5T666          -----------------------------------------------T------------
M5U6N6          -----------------------------------------------T------------
A0A517M0G2      -----------------------------------------------TIENA--------
A0A5C6AST1      ------------------------------------------------------------
A0A5C6C951      -----------------------------------------------PDAVATPTPAGMP
A0A5C6C5T3      ------------------------------------------------------------
A0A2A2W6A9      -----------------------------------------------ETAHRS-------
A0A518HQS9      -----------------------------------------------ETAHRN-------
A0A5M6DFE6      -----------------------------------------------YS-----------
A0A5C6F286      -----------------------------------------------DSYHDEEQASS--
A0A517NGN1      ------------------------------------------------------------
M5RUI3          ------------------------------------------------------------
M5S2L2          ------------------------------------------------------------
A0A523CME0      ------------------------------------------------------------
A0A354PCV3      -------------------------------SQDL-------------------------
A0A354PHB4      -------------------------------SHDL-------------------------
A0A356ESF4      -------------------------------DHFEAARRSAA------------------
A0A538RV31      ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A3L7SU85      -------------------------------NYTDYESYTDDEDEENEAANAEGKVQRGP
A0A3M1RAJ8      -------------------------------YYRAYTIDVESREPKTA------------
A0A3D4PLL5      -------------------------------GYGEGHDDPTHDDEEEAIPMTQSNSHR--
M5RD30          -------------------------------TYAASDPQPNSIRLQNAV---GSQPVQ--
A0A2Z3GYP4      -------------------------------PGMGEGQPLTPPARLSSE-----------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      -------------------------------P---------FDDDDEDI-----------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      -------------------------------E----------PARKSRG-----------
A0A3M1R9K7      -------------------------------G----------------------------
A0A3L7PH51      -------------------------------E--------------DEQ-----------
A0A3N5UQY5      -------------------------------DTCIGMTLQPLEAGLSRS-----------
                                                                            

A0A356AE44      -------------------------FLAPTKTIIPS
A0A1G2XSU7      ------------------------------------
A0A350KD81      -----------------------KQADAPAKTKLTH
A0A2E3Z6T8      EEHLPSASPQEHQSHETPFQTKSANSTTPLKPRRVA
A0A257WQ92      TREALVTQA---------------------------
A0A356ETW1      DVESEVTTATPRDAHFHDTDPDEGGRPGRIVPRRAA
A0A3L7NJY1      GVQTLPLHSSETDVRHVSDDKT----------KNAA
A0A2D6SRY7      AAALVTTTDPQTTDDETDEETDDETTERSRIVRSSS
A0A1G3C300      ------------------------------------
A0A524HC32      ------------------------------------
A0A660VT66      ------------------------------------
A0A0S8H0S8      ------------------------------------
A0A177PV03      ------------------------------------
A0A1G2YIM0      --------------------IVPVQEEKTEVTNAAS
A0A1G2ZG92      ------------------------------------
A0A1G3A0W0      ------------------------------------
A0A353BE27      ------------------------------------
A0A5C6BPW1      -------------------------------TPSQS
A0A1I3GSP0      -----------------S-----KAKSAYVPQTAGK
A0A517QJV1      -----------------PQNPSQRPRPAEPTEIIKT
A0A3C1QS25      ------------------------------------
A0A5C6FX55      AAA------------------PVTRPNVSSDQQADS
A0A3L7UX05      -----------------------VTDAVDIDVEIVD
A0A5C6DS51      -----------------MAAERLETQKRPTRPLVRA
A0A5C6DSL6      -----------------PVSEIIPKQKLTHRVNAPV
A0A3M1VG27      ------------------------------------
A0A518GC22      ----------------------------LSTADKEG
A0A3L7Q373      ------------------------------------
A0A3E0PW54      ------------------------AAESRQPVAADA
A0A1Z8MHR4      PNG---------AEAPGLPPQPPQSSGGSYDSSIGS
A0A5C6EHJ0      ------------------------------------
A0A5C6F1H9      ------------------------------------
A0A255QXY0      ----------------DMAETGAVKTPTFK------
A0A517SYI0      PNG---------AEAPGLPPQPPQSSGGSYDSSIGS
A0A518HX54      -----------------PQNSSPGPLPKN-------
A0A5B9MF59      DHA---------MIPPQPTAAGPSAVAKRHRANVRS
A0A2A2WC24      DRK---------ITAPDAAPFAPKVAPDRRRTNVRS
A0A518KYW8      DRK---------ITSPDAAPFAPKVVPERRRTNVRS
A0A5C5YZZ0      ------------------------------------
A0A518JLD2      -------------------PSACGADLTNHTS----
A0A5M6DJ15      ------------------------------------
A0A3L7P7S7      SPP----------------QNVPGDGEPE-------
A0A517N8M1      EQP-------------------------AQEELLDR
A0A5C6CW01      AVP-------------------LSMTGVD----SDV
A0A5C6BXS9      KAPVAEAPLAEAPVANLASPSINGHGPYETNNGSHN
M5U569          AKP----------------TSVAATTPINGKPEDDV
L7CND7          AVP----------------P--AVTSPTEQER-SDV
A0A0J1B8S4      AVP----------------P--TAMPPVEQERSSDV
F2ARR3          AVP----------------P--ATAPSIEREG-SDV
K5D8H6          AVP----------------P---TTPSVEQER-SDV
M2AKU0          AVP----------------P---TTASVEQER-SDV
A0A5B1CKI2      -TS----------------SKPVAAVSASNSDELDG
A0A5C6EG84      AAQ----------------ATQTAMGYEGHDDHLDS
A0A5C6F2X4      AQA----------------ATPSTLGESTLKDLTD-
A0A5C5XTV6      NIT----------------PAASRNGHASHDDTDES
A0A5C6AAB1      TTA----------------VGSSPSKMNGRSASSE-
M5T8W8          AKP----------------TSVATSSTKNGTATDDV
M5SF00          AVP----------------PT-TPSVEQERS---DV
A0A2G1WDS1      AVP----------------PTVTSSTDQERS---DV
Q7UVS9          AVP----------------PATAPSIEQERS---DV
A0A5C6B601      SR----------------------------------
A0A517PFU1      R-----------------------------------
A0A5B9M8J9      ------------------------------------
A0A2A2WFP6      PRP----------------L----------------
A0A518L8N2      ------------------------------------
A0A518HQN9      TDS----------------FAPTVVPERRRTNVRS-
A0A5M6D8H8      PAP----------------LAPPVLTERHSTPTHH-
A0A5B1CRW9      PVA----------------APVSSMPMTPSETV---
A0A5C6EI46      PIT----------------IPSGDAPPMADQSSKS-
A0A2E7D3V4      ------------------------------------
A0A2S8F9B8      ------------------------------------
A0A368KP63      ------------------------------------
A0A2E0SHG0      A-----------------------------------
A0A518CQB8      V-----------------------------------
A0A5B9PER9      ------------------------------------
A0A517QSM4      ------------------------------------
A0A355GJI7      ------------------------------------
A0A1Z8MCI4      VPX---------------------------------
A0A517SYL7      VPS---------------------------------
A0A3L7P0L2      ------------------------------------
A0A142XL75      ------------------------------------
A0A517SCC8      ------------------------------------
A0A3A0DR44      ------------------------------------
A0A358MY60      ------------------------------------
A0A517MNB1      ------------------------------------
A0A517XRC2      ------------------------------------
A0A142YJ13      ------------------------------------
A0A517Z7D3      VTV---------------------------------
A0A5C1AGE3      ------------------------------------
A0A142XAP8      ------------------------------------
A0A2Z3HEL7      ------------------------------------
A0A1N6KY57      ------------------------------------
L0DK20          ------------------------------------
A0A660UUK3      QEDSK-------------------------------
A0A517ZHG5      ------------------------------------
A0A1Z8MPL5      ------------------------------------
A0A5C6C1R5      ------------------------------------
A6BZU4          ------------------------------------
A0A2D5GZ77      ------------------------------------
A0A3D3R1Z6      ------------------------------------
A0A517XG00      ------------------------------------
A0A1G2YRE4      AVNETDKN----------------------------
A0A353Z859      SSQPPLN-----------------------------
A0A2D6ST10      ------------------------------------
A0A177QX42      ------------------------------------
A0A517SHR0      ------------------------------------
A0A2E0AW64      ------------------------------------
A0A351FZ59      ------------------------------------
A0A660V239      PKHETGHGSGS-------------------------
A0A177Q3B7      S-----------------------------------
A0A2E0X6Y6      TLAINGRRTADEDHDGHDAPIRPRRAA---------
A0A518GFD7      ------------------------------------
A0A5C5VZJ8      ------------------------------------
A0A518GE37      ------------------------------------
A0A5C6F3H8      ------------------------------------
A0A5C5X072      ------------------------------------
A0A5C5WUQ3      ------------------------------------
A0A5C6E697      ------------------------------------
A0A5C5Z1A3      ------------------------------------
A0A5C6D2P7      ------------------------------------
A0A5B9ML17      ------------------------------------
A0A517LX75      ------------------------------------
A0A354GX32      ------------------------------------
A0A5C1AAF0      ------------------------------------
A0A5C6B3S0      ------------------------------------
A0A518GIZ9      LVRQP-------------------------------
A0A1C3EBY9      PVRQP-------------------------------
D5SX64          PVRQP-------------------------------
A0A517Z0U7      ------------------------------------
A0A2S8FCC0      ------------------------------------
A0A1Z8MBT6      ------------------------------------
A0A517SXN9      ------------------------------------
A0A518HFL0      ------------------------------------
A0A5Q3LBQ3      ------------------------------------
A0A3B8ZJM2      GKYTSYSTGYIEDRQAEAAEVSTKNDADTQS-----
A0A1U7CLW1      ------------------------------------
A0A142WPR7      ------------------------------------
A0A3M1TFJ0      ------------------------------------
A0A517P477      ------------------------------------
A0A517T4K9      ------------------------------------
A0A2Z3GZZ5      ------------------------------------
A0A4V0I6L6      ------------------------------------
A0A255QXF5      ------------------------------------
A0A518KBI5      ------------------------------------
A0A5C5V6Q5      ------------------------------------
A0A517MY49      PHYEVPADVQTVQYAPPVVPHSATEPAAPIRPRKAA
A0A2E6AG00      -----------XEPAADSSSSFSVXATPSQQIRRAA
A0A1G3A880      ---DRDHEPQGADEAIERPRPANEAADQIGPVKRVA
A0A2E8ATT1      ---SKPAAGTPQEQVSPDPASKPSGAKKRVVPRRAA
A0A518KYQ0      ------------------------------------
A0A5B9QX47      ------------------------------------
M5T666          ------------------------------------
M5U6N6          ------------------------------------
A0A517M0G2      ------------------------------------
A0A5C6AST1      ------------------------------------
A0A5C6C951      LHGGMNEQSVL-------------------------
A0A5C6C5T3      ------------------------------------
A0A2A2W6A9      ------------------------------------
A0A518HQS9      ------------------------------------
A0A5M6DFE6      ------------------------------------
A0A5C6F286      ------------------------------------
A0A517NGN1      ------------------------------------
M5RUI3          ------------------------------------
M5S2L2          ------------------------------------
A0A523CME0      ------------------------------------
A0A354PCV3      ------------------------------------
A0A354PHB4      ------------------------------------
A0A356ESF4      ------------------------------------
A0A538RV31      ------------------------------------
A0A2D6A9B6      ------------------------------------
A0A2G6JGH3      ------------------------------------
A0A3L7SU85      SMASRVLPNLVPRIQTKRLPSKPASETKPPETPEST
A0A3M1RAJ8      -------------------PRQPVGK----------
A0A3D4PLL5      -------------------PRKRFSRDESSDRYAA-
M5RD30          -------------------PTKLMSRS---------
A0A2Z3GYP4      -------------------PAGHVEPVANGPAHAPE
A0A1V6CUG1      ------------------------------------
A0A3M1SE88      -------------------VPRRVA-----------
A0A660WB30      ------------------------------------
A0A660W9Z7      -------------------KRRKRK-----------
A0A3M1R9K7      ------------------------------------
A0A3L7PH51      -------------------PYRRAA-----------
A0A3N5UQY5      -------------------PVLRPS-----------
                                                    

© 1998-2020Legal notice