BYKdb

Dataset for cluster orphancd of phylum planctomycetes

[Download (right click)] [Edit] [Sequences] [Repertoires]

234 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A523CME0      ------------------------------------------------------------
A0A7Y3UKB3      ------------------------------------------------------------
A0A7C2JY73      ------------------------------------------------------------
A0A836W298      ------------------------------------------------------------
A0A354PCV3      ------------------------------------------------------------
A0A354PHB4      ------------------------------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A538RV31      ------------------------------------------------------------
A0A1G2XSU7      ------------------------------------------------------------
A0A350KD81      ------------------------------------------------------------
A0A356AE44      ------------------------------------------------------------
A0A7Z9UBD9      ------------------------------------------------------------
A0A257WQ92      ------------------------------------------------------------
A0A2E3Z6T8      ------------------------------------------------------------
A0A7Y2AF64      ------------------------------------------------------------
A0A7C1U6X6      ------------------------------------------------------------
A0A7C7UXI5      ------------------------------------------------------------
A0A7C3SFJ0      ------------------------------------------------------------
A0A7X7YIF4      ------------------------------------------------------------
A0A7C7WWF7      ------------------------------------------------------------
A0A7V3JIB0      ------------------------------------------------------------
A0A356ETW1      ------------------------------------------------------------
A0A3L7NJY1      ------------------------------------------------------------
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      ------------------------------------------------------------
A0A177PV03      ------------------------------------------------------------
A0A1G2YIM0      ------------------------------------------------------------
A0A1G3A0W0      ----------------------------------------------MNPAEKEFQPQTDP
A0A7V7D8F5      ------------------------------------------------------------
A0A432MFP3      ----------------------------------------------------------MD
A0A518HFL0      ----------------------------------------------------------MD
A0A3L7UX05      ---------------------------------------------MIGPKIPMNNHQNEA
A0A2E0SHG0      ------------------------------------------------------------
A0A2S8F9B8      ------------------------------------------------------------
A0A368KP63      ------------------------------------------------------------
A0A518CQB8      ------------------------------------------------------------
A0A7C4QPD3      ---METGDNDNTSASVNGAL--------------------------------------RV
A0A7C2JZW2      -----MGGDSVLSPSEVAAR--------------------------------------SP
A0A836RF42      MSVEIEGETDILKLSYRGARADDCKKILEEIIASYEDYLQTDRDTLTRTALELFNRAKSE
A0A7D8YCU5      ------------------------------------------------------------
A0A353BE27      ------------------------------------------------------------
A0A5C6BPW1      ---------------------------------------------------------MMQ
A0A1I3GSP0      ------------------------------------------------------------
A0A517QJV1      ------------------------------------------------------------
A0A3C1QS25      MRRHACPTLLLDPYVWVHRACLVGTTGTSCECRARISPTRLKLAPPNRCPGRGPRYTEGS
A0A5C6FX55      ----------------------------------------------MNRQFSVLSPPSER
A0A5C6DS51      ------------------------------------------------------------
A0A5C6DSL6      ------------------------------------------------------------
A0A3M1VG27      ------------------------------------------------------------
A0A518GC22      ------------------------------------------------------------
A0A3L7Q373      ------------------------------------------------------------
A0A3E0PW54      ------------------------------------------------------------
A0A7C3TAH2      ------------------------------------------------------------
A0A1Z8MHR4      ------------------------------------------------------------
A0A5C6EHJ0      ------------------------------------------------------------
A0A5C6F1H9      ------------------------------------------------------------
A0A255QXY0      ------------------------------------------------------------
A0A517SYI0      ------------------------------------------------------------
A0A518HX54      ------------------------------------------------------------
A0A5B9MF59      ------------------------------------------------------------
A0A2A2WC24      ------------------------------------------------------------
A0A518KYW8      ------------------------------------------------------------
A0A5C5YZZ0      ------------------------------------------------------------
A0A518JLD2      ------------------------------------------------------------
A0A5M6DJ15      ------------------------------------------------------MEFING
A0A3L7P7S7      ------------------------------------------------------------
A0A517N8M1      ----------------------------------------------MKATPLPEPRFSDS
A0A5C6CW01      ----------------------------------------------MKQSSDRGLAYSQA
A0A5C6BXS9      ----------------------------------------------MQVIPEPESDRST-
M5U569          ----------------------------------------------MSILSEFQSDRSGS
L7CND7          ------------------------------------------------------------
A0A0J1B8S4      --------------------------------------------------MTPNSNSTDP
F2ARR3          ----------------------------------------------MELPSNASSDSRSQ
K5D8H6          ----------------------------------------------MELPSNASSDSRSQ
M2AKU0          ----------------------------------------------MELPSNASSDSRSQ
A0A5B1CRW9      ------------------------------------------------------------
A0A5C6EI46      ------------------------------------------------------------
A0A5B1CKI2      ------------------------------------------------------------
A0A5C6EG84      ------------------------------------------------------------
A0A5C6F2X4      ------------------------------------------------------------
A0A7W5DXF4      ------------------------------------------------------------
A0A5C5XTV6      ------------------------------------------------------------
A0A5C6AAB1      ------------------------------------------------------------
M5T8W8          ------------------------------------------------------------
M5SF00          ------------------------------------------------------------
A0A2G1WDS1      --------------------------------------------------MTPNSNSTDS
Q7UVS9          --------------------------------------------------MTPNSNSTEP
A0A5C6B601      ------------------------------------------------------------
A0A517PFU1      ------------------------------------------------------------
A0A5B9M8J9      ------------------------------------------------------------
A0A2A2WFP6      ------------------------------------------------------------
A0A518L8N2      ------------------------------------------------------------
A0A518HQN9      ------------------------------------------------------------
A0A5M6D8H8      ------------------------------------------------------------
A0A1G2ZG92      ------------------------------------------------------------
A0A2E7D3V4      ------------------------------------------------------------
A0A5B9PER9      ------------------------------------------------------------
A0A517QSM4      ------------------------------------------------------------
A0A355GJI7      ------------------------------------------------------------
A0A1Z8MCI4      ------------------------------------------------------------
A0A517SYL7      ------------------------------------------------------------
A0A3L7P0L2      ------------------------------------------------------------
A0A6M5YVJ1      ------------------------------------------------------------
A0A832M9Q8      ------------------------------------------------------------
A0A7W0MCI8      ------------------------------------------------------------
A0A517SCC8      ------------------------------------------------------------
A0A358MY60      ------------------------------------------------------------
A0A517MNB1      ------------------------------------------------------------
A0A3A0DR44      ------------------------------------------------------------
A0A142YJ13      ------------------------------------------------------MGTPGP
A0A517Z7D3      ------------------------------------------------------------
A0A7X7KCE7      ------------------------------------------------------------
A0A1N6KY57      ------------------------------------------------------------
L0DK20          ------------------------------------------------------------
A0A517XRC2      ------------------------------------------------------------
A0A6M5YH47      ------------------------------------------------------------
A0A660UUK3      ------------------------------------------------------------
A0A517ZHG5      --------------------------------------------------------MMQS
A0A1Z8MPL5      ------------------------------------------------------------
A0A7C1EH96      ------------------------------------------------------------
A0A5C1AGE3      ------------------------------------------------------MRRSPE
A0A2Z3HEL7      ------------------------------------------------------MARPIA
A0A142XAP8      ------------------------------------------------------MARPIA
A0A6P2DEK1      ------------------------------------------------------MARPIA
A0A5C6C1R5      ----------------------------------------------------------MD
A0A1G2YRE4      ------------------------------------------------------------
A6BZU4          ------------------------------------------------------------
A0A2D5GZ77      ------------------------------------------------------------
A0A3D3R1Z6      ------------------------------------------------------------
A0A517XG00      ------------------------------------------------------------
A0A353Z859      ------------------------------------------------------------
A0A2D6ST10      ------------------------------------------------------------
A0A177QX42      ------------------------------------------------------------
A0A517SHR0      ------------------------------------------------------------
A0A2E0AW64      ------------------------------------------------------------
A0A351FZ59      ------------------------------------------------------------
A0A660V239      ------------------------------------------------------------
A0A177Q3B7      ------------------------------------------------------------
A0A2E0X6Y6      ------------------------------------------------------------
A0A518GFD7      ------------------------------------------------------------
A0A518GE37      ------------------------------------------------------------
A0A5C6F3H8      ------------------------------------------------------------
A0A5C5X072      ------------------------------------------------------------
A0A5C5WUQ3      ------------------------------------------------------------
A0A5C6E697      ------------------------------------------------------------
A0A5C5Z1A3      ------------------------------------------------------------
A0A5C6D2P7      ------------------------------------------------------------
A0A5B9ML17      ------------------------------------------------------------
A0A5C5VZJ8      ------------------------------------------------------------
A0A517LX75      ------------------------------------------------------------
A0A7X7YXL7      ------------------------------------------------------------
A0A7W1FH76      ------------------------------------------------------------
A0A7C5W7B3      ------------------------------------------------------------
A0A7V2IPP1      ------------------------------------------------------------
A0A142XL75      ------------------------------------------------------------
A0A6P2D5D5      ------------------------------------------------------------
A0A7C7T8W8      ------------------------------------------------------------
A0A5C6B3S0      ------------------------------------------------------------
A0A354GX32      ------------------------------------------------------------
A0A518GIZ9      ------------------------------------------------------------
A0A1C3EBY9      ------------------------------------------------------------
D5SX64          ------------------------------------------------------------
A0A517Z0U7      -----------------------------------------------------------M
A0A2S8FCC0      ------------------------------------------------------------
A0A1Z8MBT6      ------------------------------------------------------------
A0A517SXN9      ------------------------------------------------------------
A0A7X7F3C7      ------------------------------------------------------------
A0A255QXF5      ------------------------------------------------------------
A0A518KYQ0      ------------------------------------------------------------
A0A5B9QX47      ------------------------------------------------------------
M5T666          ------------------------------------------------------------
M5U6N6          ------------------------------------------------------------
A0A517M0G2      ------------------------------------------------------------
A0A5C6AST1      ------------------------------------------------------------
A0A5C6C951      ------------------------------------------------------------
A0A5C6C5T3      ------------------------------------------------------------
A0A2A2W6A9      ------------------------------------------------------------
A0A518HQS9      ------------------------------------------------------------
A0A5M6DFE6      ------------------------------------------------------------
A0A5C6F286      ------------------------------------------------------------
A0A517NGN1      ------------------------------------------------------------
M5RUI3          ------------------------------------------------------------
A0A5C1AAF0      ------------------------------------------------------------
A0A3B8ZJM2      ------------------------------------------------------------
A0A1U7CLW1      ------------------------------------------------------MEPFRS
A0A5Q3LBQ3      ------------------------------------------------------------
A0A142WPR7      ------------------------------------------------------------
A0A517T4K9      ------------------------------------------------------------
A0A7C6B2Q1      ------------------------------------------------------------
A0A2Z3GZZ5      ------------------------------------------------------------
A0A4V0I6L6      ------------------------------------------------------------
A0A7C4QQT3      ------------------------------------------------------------
A0A7V9G5K3      ------------------------------------------------------------
A0A7W1JAD6      ------------------------------------------------------------
A0A518KBI5      ------------------------------------------------------------
A0A5C5V6Q5      ------------------------------------------------------------
A0A517P477      ------------------------------------------------------------
A0A518HFS8      ------------------------------------------------------------
A0A7Y5LUV4      ------------------------------------------------------------
A0A3M1TFJ0      ------------------------------------------------------------
A0A7Y5HGA4      ------------------------------------------------------------
A0A517MY49      ------------------------------------------------------------
A0A2E6AG00      ------------------------------------------------------------
A0A1G3A880      ------------------------------------------------------------
A0A2E8ATT1      ------------------------------------------------------------
A0A524HC32      ------------------------------------------------------------
A0A660VT66      ------------------------------------------------------------
A0A7C2ZTD2      ------------------------------------------------------------
A0A0S8H0S8      ------------------------------------------------------------
A0A7C2VEF7      ------------------------------------------------------------
A0A7V7D6N0      ------------------------------------------------------------
M5S2L2          ------------------------------------------------------------
A0A7V1EK28      ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A7C2VXA0      ------------------------------------------------------------
A0A7C3AA48      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A7C5PFV3      ------------------------------------------------------------
A0A7C3QGD2      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A7Z9UC46      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A7C2ZUK5      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ------------------------------------------------------------
A0A7X8YY48      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
                                                                            

A0A523CME0      ------------------------------------------------------------
A0A7Y3UKB3      ------------------------------------------------------------
A0A7C2JY73      ------------------------------------------------------------
A0A836W298      ------------------------------------------------------------
A0A354PCV3      ------------------------------------------------------------
A0A354PHB4      ------------------------------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A538RV31      ------------------------------------------------------------
A0A1G2XSU7      ------------------------------------------------------------
A0A350KD81      ------------------------------------------------------------
A0A356AE44      ------------------------------------------------------------
A0A7Z9UBD9      ------------------------------------------------------------
A0A257WQ92      ------------------------------------------------------------
A0A2E3Z6T8      ------------------------------------------------------------
A0A7Y2AF64      ------------------------------------------------------------
A0A7C1U6X6      ------------------------------------------------------------
A0A7C7UXI5      ------------------------------------------------------------
A0A7C3SFJ0      ------------------------------------------------------------
A0A7X7YIF4      ------------------------------------------------------------
A0A7C7WWF7      ------------------------------------------------------------
A0A7V3JIB0      ------------------------------------------------------------
A0A356ETW1      ------------------------------------------------------------
A0A3L7NJY1      ------------------------------------------------------------
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      ------------------------------------------------------------
A0A177PV03      ------------------------------------------------------------
A0A1G2YIM0      --------------------MNDIEKISAGRIISTELAGYGTMASNASNSEG--------
A0A1G3A0W0      IVQERDYSNGPGKESRSSEIVLSAEEIINPPHVTPWPNRLMRAGGSGPSVPL--------
A0A7V7D8F5      -----------MNDLEKYRSHVIEQRPANFEP-------------PPESAGH--------
A0A432MFP3      TSETTRPQYELARLSDLPPALRAPLPPASRPA------------SDGGGLPI--------
A0A518HFL0      TADSPRPGHELARLTELPPALRVPPPPASRTS------------SPGGGLPI--------
A0A3L7UX05      MNQSLSPQLPVHQQGYGQGAALWNAHQHDSHE------------PENQSKGM--------
A0A2E0SHG0      --------------------MPTAPLPETLSS------------QSPLHGIL--------
A0A2S8F9B8      ----------------MTNGNLVIPSDRDRHASKADVPGAVIGMRPPEENGM--------
A0A368KP63      ----------------MSNGNLVIPSDNNRQAASVNVPGRVVDVRSSDEDSN--------
A0A518CQB8      --------------------MPTTPPPEQQTS------------QSPLQGVL--------
A0A7C4QPD3      VPEGTASRGAAKV---RAKAAPSLSARAFRAP------------EGDPQGYL--------
A0A7C2JZW2      MSTGMSAADAPQA---KANGRPSASSQAATRP------------REAHTGPH--------
A0A836RF42      LSADLARLEKDYAEFRRKNGHLLAKSEGGENM------------YQAR------------
A0A7D8YCU5      --------MPFVARFIQSATNKMQNPVQRASADSQGQPGTQTMSQPRQPAGG--------
A0A353BE27      ----------------------MSDVVLDQRNVNGQPSPVPGGAPEAQSEGS--------
A0A5C6BPW1      SNQEPNHYRNGNAGVPAYTNGGGGGGGALVPVGNGMDPSPAPMAGNEGAGQV--------
A0A1I3GSP0      ---------------------MTAPQKQPNAAAEFDFAPFGFHKATAGRSID--------
A0A517QJV1      ---------------------------------------MSGNSASSRASID--------
A0A3C1QS25      DISTGIHHGSTPGDGPLFPRFGWSTFVAQMPVEGRPAWAEMGPPMGTEPESQ--------
A0A5C6FX55      TPSCGGILYYFNEIRMSTNELSNRPYSNSPAMMQAPIAMMDRDGADGGKNE---------
A0A5C6DS51      -------------------------------------MPSNSSEQNVGHQSV--------
A0A5C6DSL6      -------------------------------------MRPQSSEQAVGNQSI--------
A0A3M1VG27      ---------------------------MNDDVPFRFADGVAGAPAVSTDRITTVQRPGDV
A0A518GC22      -----------------------MSDVAMDQPRTNGQLAIPGAPEAAPQEGS--------
A0A3L7Q373      ------------MWWRLPETSDVTQRSQLPVVAPSIDFAPLGFQKSNDGRSID-------
A0A3E0PW54      ---------MVGFRPPGESGTAFALTVSRPPVAPSARHSHERTDMPAPQHNVDFAPLGYR
A0A7C3TAH2      -------MSDLEQYIDKVIEPRPAQQALPRPGVPAAYAVPAVHAGTGDQQLE--------
A0A1Z8MHR4      -------------------------MLDMPPSTPVGFDTSGAYGSQNQSPAN--------
A0A5C6EHJ0      ---------------------MNQQAKPREVTSREMSDKRPPQQPMPQSALA--------
A0A5C6F1H9      ---------------------MNQMQSQDETRSPDLADRRGREMAASPVGGG--------
A0A255QXY0      -------------------------MLPLHSSTSSNDLRSIADGS---QDEH--------
A0A517SYI0      ----------------------------MPPSTPVGFDTSGAYGSQNQSPAN--------
A0A518HX54      -------------------------MLEPSPPHVHADTFHARQPD-DIGRLQ--------
A0A5B9MF59      -------------------------MLDQTTTQPGNYEASVSLGP-SQEHHH--------
A0A2A2WC24      ---------------------MYSSMLDQTSPQPVNYDSSVTLDP-AQEQHH--------
A0A518KYW8      -------------------------MLDQTSPQPVNYDSSVTLDP-AQEQHH--------
A0A5C5YZZ0      ----------------------------MQPAPPSSTNRSGSELMNNMQSAS--------
A0A518JLD2      ------------------------------------------------------------
A0A5M6DJ15      NGSGDGDDRGLLTEPRSLRTSRPRVNGSSPVMPPPVVQGTIDDDEPQF------------
A0A3L7P7S7      -----------------------------------------MSQEGGRLPED--------
A0A517N8M1      RLSDPSTAFGSSAQPE----------------------------QQ--------------
A0A5C6CW01      PAITGADRSMSDTS------------------------------AD--------------
A0A5C6BXS9      ------------------------AVGSYPTHAPAWEGGK----HE--------------
M5U569          YQTLGSPATGVGMPEGPSG-------------------------DS--------------
L7CND7          -------------------------------MNEGWRSGGSAEPAD--------------
A0A0J1B8S4      TAGKRGPNSFASYPSQNAGTMGLAATGSYPAMNEGWGSADQG---D--------------
F2ARR3          GASTRGKEAFASYPSPNPGAMGLAAQGSYPAMNTGWQPTHQAA-NE--------------
K5D8H6          GASTRGKEAFASYPSPNPGAMGLAAQGSYPAMNTGWQPTHQAT-NE--------------
M2AKU0          GASTRGKEAFASYPSPNPGAMGLAAQGSYPAMNTGWQPTHQAT-NE--------------
A0A5B1CRW9      ---------------------------------------MTKPSKTISMVTG--------
A0A5C6EI46      ---------------------------------------MADANKSMGLSPN--------
A0A5B1CKI2      -------------------------MQATAPPSPQLAQKLDPFSTAPGTNAQ--------
A0A5C6EG84      -------------------------MKVQQLTEPRFSDPSGAFAAPSEAEDK--------
A0A5C6F2X4      -------------------------MKAQQLTEPRFSDPNQGLTASAQTENQ--------
A0A7W5DXF4      ---------------MAIRMAVGDISSAYPSRESGLSDFGQDNHDQGGDASE--------
A0A5C5XTV6      -----------MQVIPESESDRPTPVGAYPAPAPSW-----QGGKP-----E--------
A0A5C6AAB1      -----------MQANPDSDFERPVVMGAYPAQNPGW-----QGDSAAAAGGD--------
M5T8W8          ------------------------------------------MSTPDGPSVD--------
M5SF00          --------------------MGQAAMGSYPAMNEGW------GSSGSSQTAE--------
A0A2G1WDS1      TAGKRGPNSFVSYPSQNAGTMGQAAMGSYPAMNEGW------GSSGSAQTAE--------
Q7UVS9          SAGKRGPNSFASYPSQNAGTMGQAAMGSYPAMNEGW------GSSGSAQTAE--------
A0A5C6B601      ------------------------------MLEQDIHQINDAAAGEDLPGLS--------
A0A517PFU1      ------------------MPSFAASGSSFPGEDPQAEGYGRGGDGPNAPRSHAVTGYDAN
A0A5B9M8J9      ---------------------------MLDHSTPHLHSHAGRLMDQDVELPQ--------
A0A2A2WFP6      ---------------------------MLEQLPPHVHSDTGHAMERDGGRLQ--------
A0A518L8N2      -------------------------------------------MERDGGRLQ--------
A0A518HQN9      ---------------------------MLDQASPHSAIQDANGSADLLPEHH--------
A0A5M6D8H8      ---------------------------MLDQTSPSQQTHEISGAIDSVQDVQ--------
A0A1G2ZG92      -------------------------------------------------MEF--------
A0A2E7D3V4      ---------------------------MDNSENRPVERPFEFAVLSENSDKP--------
A0A5B9PER9      -------------------MEPNNNQIGQYQNPNQMGSPMGMPPVMMAQDDD--------
A0A517QSM4      -----------METQLTSDSSSSLTSVNPVHEVAQPRATSVGPHPNQGNEAI--------
A0A355GJI7      ------------------------------------------------------------
A0A1Z8MCI4      ---------------------------------------MDDLDKIETSQAI--------
A0A517SYL7      ---------------------------------------MDDLDKIETSQAI--------
A0A3L7P0L2      --------------------------MNKRSSLPVAEPDVDFAPLGYHKSQE--------
A0A6M5YVJ1      ------------------------------------------------------------
A0A832M9Q8      ----------------MNNAALVSRQDPSQLPQWSPASPGYLALENGQPRNA--------
A0A7W0MCI8      -------------------------------MLSAPHSATPAHAARTPNGGL--------
A0A517SCC8      ---------------------MNEVEPVNMPQNARSSESVEFAPLGVVSGNK--------
A0A358MY60      ---------------MDKVKSIIDQQAV--PALPRSGAGQPMPQPAADSVNF--------
A0A517MNB1      ---------------MDNRITPSNEYRVDRSAAPRGPVERRVEPPAAKGQEF--------
A0A3A0DR44      ---------MSSPHVSESALIAQTAGPPALLRPPPIQFGGPPKPAPQTGAGI--------
A0A142YJ13      NALHAEELPTVLPRREEAVAHGEMMIPVDRIAQRSVAVPSNLEPAPGTTDAP--------
A0A517Z7D3      ----------------------------MSTQTPTHESDIEFAPLGHASSSP--------
A0A7X7KCE7      ------------------------------------------------------------
A0A1N6KY57      -----------MMLNSNPGSRPDSVNLPATIPPHRKDSFADSSAVMGSSTSL--------
L0DK20          -----------MMSNSNFGPQPNSANLPAVVPPHRAEVFSVSSPPAGPVAGL--------
A0A517XRC2      MARSNNGENPPTGPLQPYNNPPGGM--LAPGGGP--YGPSVTIPGGTGKTPP--------
A0A6M5YH47      MARPIAGDPPAGSPPAPFPTGSGGLPPVQAGASPFNYTNQPSLPGSAVQTTP--------
A0A660UUK3      ------------------------MADLERYENRMVQQEVVQFDGPPDGHEG--------
A0A517ZHG5      NQEPNHYRNGNAGVPAYTNGGGGGGGGALVPVGNGMEPSPASMGGNEGAGQV--------
A0A1Z8MPL5      ------------------------------------------------------------
A0A7C1EH96      ------------------------------------------------------------
A0A5C1AGE3      GDQQGNAALAQYSAPTYSIP--GG-AYSAAPSPV------SLPSPVGNRNVP--------
A0A2Z3HEL7      GD-------PPASPPPAPFPTPGGVPAPVAPSPFSYTNQPSLPGPT-VSSAP--------
A0A142XAP8      GD-------PPMMQPPYQVPQSGG-PVPVALSPFNYTNQPNIPGPA-VAATP--------
A0A6P2DEK1      GD-------SPMIQPPYQAPQSGV-PVPVVTSPFNYTNQPNIPGPV-VVGTP--------
A0A5C6C1R5      NHHLNGTGVPAVLEPSRGQRSSSS-GQSISYADNSSGWSESPRAEVESQENF--------
A0A1G2YRE4      -----------------------M-NNLEKYADRLLEQKLVNTGTPPEFNGQ--------
A6BZU4          -----------------------M-NTDFQPLDQQSDFAIDGMEENAEVNSS--------
A0A2D5GZ77      -----------------------M-NTDFQPLDQQSDFGIDGMEENAEVNSS--------
A0A3D3R1Z6      -----------------------M-NTDFQPLDQQSDFGIDGMEENAEVNSS--------
A0A517XG00      -----------------------M-NTDFQPLDQQSDFGIDGMEENAEVNSS--------
A0A353Z859      -------------MSTDQMNGQGA-MVPVRRNEVGMPGPAVGGAPANSGIVV--------
A0A2D6ST10      MDHTTRTSDTSAPAAGNETNGAND-NGTLSVPAPLVLPLSVVNAADGEEATV--------
A0A177QX42      --------------------MFHL-EIRVSTTTTDWQAP---NNPALEEQPN--------
A0A517SHR0      ----------------------------MSTTTTDWQAPTPITPSATEEQPT--------
A0A2E0AW64      -----------------------------MNLSTSQPPPLNSSTESESAAQL--------
A0A351FZ59      -----------------------------MNLSTSQPPPLNSSTESESAAQL--------
A0A660V239      -----------------------M-DELQRYQPQPLGQEVVQFEGPVEDQSD--------
A0A177Q3B7      ----------------------------------------MSGPDSGRATAP--------
A0A2E0X6Y6      --------------------------------MNSELDSNLAQEGPASSEIV--------
A0A518GFD7      ----------------MVTDRVNG-TNGQRTNAQQQIVVARPVKGGPEPSGP--------
A0A518GE37      -------------------------------------MQNPATAKNASPPAF--------
A0A5C6F3H8      --MTTSRKKNAKPTHSKPTHSKLS-GTVPSAAPRSSSKARAHAPVDSESSSF--------
A0A5C5X072      ----------------MTQHLNHQ-GSRTSIVGPPRAKAAANSPSNDAAKAF--------
A0A5C5WUQ3      --------------------------MNTNYISSERATETSYRPSARPENQF--------
A0A5C6E697      -------------MNDTQQLTKTS-PHAREETTKAVPSRTVSTPPKDAAAAF--------
A0A5C5Z1A3      --------------------------------------MTASN--SGASTQF--------
A0A5C6D2P7      ------------MNDHKATSGHAG-RIAPPPLPTAVPSKSIAA--TSSAGQF--------
A0A5B9ML17      -----------------------------MNQSVVVSAPIARNQPKTEAKAF--------
A0A5C5VZJ8      ----------MSESEVHDTTQPVR-ALAKAGPIGPAGALAAPLIIDADAGAA--------
A0A517LX75      ---------------------------------------MNESETHRIAEQD--------
A0A7X7YXL7      ----------------------MN-NLEKYLDQVIEQKPVVYEPPAEVQEAP--------
A0A7W1FH76      -------------------------------------------MSSHSPHTP--------
A0A7C5W7B3      ----------MSRQPPAPPFDMGN-ILRAQRKLLLGGGQHVSPQPHAEPPER--------
A0A7V2IPP1      ---------------MEHIEPYRE-REPHVVSRVPSEMDVEMMPAEPETPGT--------
A0A142XL75      ---------------------------------------------------M--------
A0A6P2D5D5      ---------------------------------MTQISGNGQAPPEKRATTL--------
A0A7C7T8W8      ----------------MHSQNGTH-VNDTSGTPHNGMPVNTLPAPQSVFRGL--------
A0A5C6B3S0      ---------------MSTDPLPNG-QSQMIVLPHDLDWGDDQDAGNRDSSGG--------
A0A354GX32      ----------MMPHDPNAMKTKTA-SPAGPITPAAASTEQAAPAPPGLSAPP--------
A0A518GIZ9      --------------------------------MRQTPQDSELASSFETEGEG--------
A0A1C3EBY9      --------------------------------MRQTPQDSELASSFETEGEG--------
D5SX64          --------------------------------MRQTPQDSELASSFETEGEG--------
A0A517Z0U7      DRNGDPQYVPEPGTPGNGHMVEPP-VPAHAPPQPVQVMGGNPAGEEQQEGGI--------
A0A2S8FCC0      ---MSTDQTSLPVERTNREIRFDS-PIDLTPGSSNEFPHINDVVEMDDTGGT--------
A0A1Z8MBT6      ----------MPSERFWTPLQIVL-MTTESTSNIASRQSSHSNASTGEGAPI--------
A0A517SXN9      ----------MPSERFWTPLQIVL-MTTESTSNIASRQSSHSNASTGEGASI--------
A0A7X7F3C7      -------------------------------MSHEPITLRDDADERPSSHLV--------
A0A255QXF5      ----MQQHTPRQHQGAP--------------------YHFNGPSSGPDSGGF--------
A0A518KYQ0      ----MDHQSNQLQPYHAG-------------------PVVRVPASSEPTNSF--------
A0A5B9QX47      ----MTTHAPPKGIP----------------------GYSAGSPGAAPPFQF--------
M5T666          ------------------------------------------------------------
M5U6N6          ------------------------------------------------------------
A0A517M0G2      ----MQKTPTSSPQAASQFRNHAR-P-----------PVRAAHGAPSGSTDL--------
A0A5C6AST1      ----MNPG-SGP---RSNGVRTYE-------------GLRRPDEKPNSGYEF--------
A0A5C6C951      ----MSPHPNGPDSRRQNSSGRAK-------------VKRSAHGNDKSNIEF--------
A0A5C6C5T3      ----MSHNHNNLGGHASVPGTQG--------------RTLPAPSGDAAAKAF--------
A0A2A2W6A9      ----MDHQSNQLQPYHTG-------------------PVGRMPVSNEPPNAF--------
A0A518HQS9      ----MDHQSNQLQPYHNG-------------------PVVRMSASSESPNAF--------
A0A5M6DFE6      ------MVAQNSTGTHSMTLHTNQ-PGHGHPGHGPGHHRPGHPGHGHSSNAF--------
A0A5C6F286      ----MATSRKKTTTPNRNPETGAD-RDQARPRRKGPVMTGPPSRAATDETSF--------
A0A517NGN1      ------------MHPSRS-------------------ASSASIGDAASGASF--------
M5RUI3          ----MQSNANRVNGNDRP-------------------IGRLSGPSAGANSQF--------
A0A5C1AAF0      ----------MALNEQLTPVAKSV-DVVVHRAELIGGTGAGSAPAVGAPGLA--------
A0A3B8ZJM2      ------------------------------------------------------------
A0A1U7CLW1      SSFINGIPTVLSQEQGASAPTPVE-LLPVDRIVPGYGASLKAVEPPPGLSEM--------
A0A5Q3LBQ3      --------------------------MATKAILPAIRQAPALPAETNPAQPI--------
A0A142WPR7      ------------------------------------MGIRGDFEDELSEKSD--------
A0A517T4K9      ---------------------------MLPALPAGQVPAITTAMMPAESRPI--------
A0A7C6B2Q1      ----MSQHERLPEPSSGVPVGLPP-SLSAGQSGPLYVDAEWHPLAGGQGTNE--------
A0A2Z3GZZ5      -----------------------------------MADTDKNTAAPPDDDEP--------
A0A4V0I6L6      -----------------------M-ATLNPLLDPASQSSASIILPPVAAEPP--------
A0A7C4QQT3      -----------------------------MTRELEFHPGRLPSHVHPDEEAD--------
A0A7V9G5K3      -------------------------------------------MSSSPAPRL--------
A0A7W1JAD6      -------------------------------------------MSASPAPKL--------
A0A518KBI5      ------MSDHTKTDETQLPIRRVD--NGIVKHDAYHRHPRPVNNSGPAPSHF--------
A0A5C5V6Q5      ------MSKHEHPTEPNFMLQRVD-QSGSPQPIATQSNSRHWSAPQNAPQQF--------
A0A517P477      ------------------------------MAAARTPRPPVSQPVADEHFQI--------
A0A518HFS8      ------------------------------------------------------------
A0A7Y5LUV4      -----------------------------------MSATHDPQSSETADPAS--------
A0A3M1TFJ0      ------------------------------MDSRESQLGRLE----DEDELH--------
A0A7Y5HGA4      ------------------------------------------------MAPR--------
A0A517MY49      ------------------------------MNIDQDPAHREDNDSTSTSELL--------
A0A2E6AG00      -------------------------------MTRQSTSSVSNLLPTTGSHVL--------
A0A1G3A880      --------------------------------------------------MV--------
A0A2E8ATT1      -------------------------------MSRDSHYNEQN----STSEAV--------
A0A524HC32      ------------------------------------------------------------
A0A660VT66      ------------------------------------------------------------
A0A7C2ZTD2      ------------------------------------------------------------
A0A0S8H0S8      ------------------------------------------------------------
A0A7C2VEF7      ------------------------------------------------------------
A0A7V7D6N0      ------------------------------------------------------------
M5S2L2          ------------------------------------------------------------
A0A7V1EK28      ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A7C2VXA0      ------------------------------------------------------------
A0A7C3AA48      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A7C5PFV3      ------------------------------------------------------------
A0A7C3QGD2      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A7Z9UC46      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A7C2ZUK5      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ------------------------------------------------------------
A0A7X8YY48      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
                                                                            

A0A523CME0      ------------------------------------------------------------
A0A7Y3UKB3      ------------------------------------------------------------
A0A7C2JY73      ------------------------------------------------------------
A0A836W298      ------------------------------------------------------------
A0A354PCV3      ------------------------------------------------------------
A0A354PHB4      ------------------------------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A538RV31      ------------------------------------------------------------
A0A1G2XSU7      ------------------------------------------------------------
A0A350KD81      ------------------------------------------------------------
A0A356AE44      ------------------------------------------------------------
A0A7Z9UBD9      ------------------------------------------------------------
A0A257WQ92      ------------------------------------------------------------
A0A2E3Z6T8      ------------------------------------------------------------
A0A7Y2AF64      ------------------------------------------------------------
A0A7C1U6X6      ------------------------------------------------------------
A0A7C7UXI5      ------------------------------------------------------------
A0A7C3SFJ0      ------------------------------------------------------------
A0A7X7YIF4      ------------------------------------------------------------
A0A7C7WWF7      ------------------------------------------------------------
A0A7V3JIB0      ------------------------------------------------------------
A0A356ETW1      ------------------------------------------------------------
A0A3L7NJY1      ------------------------------------------------------------
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      -------------------------------------------------------MDYKD
A0A177PV03      ------------------------------------MVLGDAASA--LATKGLSSLEGLS
A0A1G2YIM0      ----------------ASMNLWPAICRHWRALLVTFMIAAGMGTP--LIWFAVKP-MYES
A0A1G3A0W0      ----------------ANDILGSFLRFKWT-VLFVFLLVSAPAIA--IIWMQIVP-KYRA
A0A7V7D8F5      ----------------STSNLIMGVLRRWYIVLLIFFVMCAIGIP--AIWFSIEP-LYSV
A0A432MFP3      ----------------NPRLVLRGLARHWWQALALWVVGSAALAA--LVYLKFQP-TYRS
A0A518HFL0      ----------------NPRLVLRGLARHWWQALALWVVGTAALAT--LVYLRYEP-TYRS
A0A3L7UX05      ----------------NLATVWRSIRRYWWQAGLLWVISSGVLMF--LAFTSVKP-TFLS
A0A2E0SHG0      ----------------DVLSILR----RRIGIILFFVVVGVALGT--LGILQLKE-KWKS
A0A2S8F9B8      ----------------QFGQVLHSLRRQWLAAVVLGLLCAAPIAV--GAWLLQSP-TYTS
A0A368KP63      ----------------RMGQVVHSLRRQWLASVVLGVLLAVPIGV--GVWLLQAP-KYSS
A0A518CQB8      ----------------DVLSIIR----RRKGIILFGIIVGAALGT--LAILKLPE-KWES
A0A7C4QPD3      ----------------SLLSVLHALRLRWPWVIVLGLPLAAALAV--AAYVTVPA-PYTG
A0A7C2JZW2      ----------------PWVCALHAMRLQWPWIVFLGIPLSAVLAY--TAWTTVPT-PFTA
A0A836RF42      --------------------VVRIEQARGELLIQRSQLLAQLKAF--REAMQSGT-DPRA
A0A7D8YCU5      ----------------DSKFLGILWRWKK--LFVFCILCGLGGGY--FHFTRQPE-SFSS
A0A353BE27      ----------------NFDFVQILWRWKW--LPILGSIVGACLGF--LYFSRLPE-TFEA
A0A5C6BPW1      ----------------DPKALLNAFRRRWFLAVTVGLFCGGSAAA--AVYLLVPP-NYVA
A0A1I3GSP0      ----------------IVSFVLSLWK-----PMAIGLFLGLLVGV--GLYLMMGP-VYSA
A0A517QJV1      ----------------IGRFLLSIWK-----PLILGGCLGGMAGI--GMYLFLGP-IYSA
A0A3C1QS25      ----------------RFDFLAMAWRRKW--LIAFGLMVGLGLGF--LAYKQQTP-IYTS
A0A5C6FX55      ----------------MPNIGAAMWRYRW--AVALPTMLGMVAGF--LLFLRTNE-TFRA
A0A5C6DS51      ----------------ELDIIGLIRRRWY--HLVLGTVFGVGVGL--LYFYATTP-MYES
A0A5C6DSL6      ----------------ELDFIGLFRRRWH--HLLIGICVGIAIGL--LYFYSTTP-MYES
A0A3M1VG27      ATPGAPSPPIELMRRQQFDPLEIGLRYRV--WIGLAILAGLLLGG--LAYWKFGP-TYDA
A0A518GC22      ----------------SFDIVQILWRWKW--LPILGSIVGACLGF--LYFSRQPA-TYEA
A0A3L7Q373      ----------------IVRFAMSIWK-----SLAIGLMAGCGLGV--LAYLYSGP-TYVA
A0A3E0PW54      QPDEGK----------SIDILKFTMSIRN--MLIAGLAVGLLVGV--GVYMCLGP-AYQA
A0A7C3TAH2      ----------------QPNVLKGILRRWYIALGVFILLAGLGIPA--IWLLVEPK-YTVS
A0A1Z8MHR4      ----------------GESVLTILWRYKW--LIGMLLLAGLIIGY--WNYKRTPT-TFLS
A0A5C6EHJ0      ----------------SIDFAKIAWNSKY--LLILGMLLGLGCGY--FYFSRTPA-TYRS
A0A5C6F1H9      ----------------HLDYAKVAWNARY--LLALGTLIGLAVGY--FHFTRQPA-MYRS
A0A255QXY0      ----------------GQAVLSILWRFRY--LVAICVVIGVGVGH--WYHRQKPA-QYQA
A0A517SYI0      ----------------GESVLTILWRYKW--LIGMLLLAGLIIGY--WNYKRTPT-TFLS
A0A518HX54      ----------------GEPIGTVLWRYKW--LIGVLLPIGTLLGY--WVNRQKPM-TYRA
A0A5B9MF59      ----------------GETILTVLWRFKW--LLTAFVAVGTSVGY--WMYKQKPT-TYRA
A0A2A2WC24      ----------------GETILTVLWRFKW--LLAAFVAIGTSIGY--WMYKQKPT-TYRA
A0A518KYW8      ----------------GETILTVLWRFKW--LLAAFVAIGTSIGY--WMYKQKPT-TYRA
A0A5C5YZZ0      ----------------DVSVGGVLWRRKG--LILFLILCGLGGGY--WFFTQQEE-TFRA
A0A518JLD2      ---------------MQIDWVKLIWGGRW--LLLLGLLVGLGAGY--FHFKTLPP-EFLS
A0A5M6DJ15      ----------------DPAVIRHSVRRRWPLALIFGLMLAPLLAG--AAWIALKP-KDMA
A0A3L7P7S7      ----------------AMNIFRMLQQRMG--LIAVLAVLGLVAGG--LFTLRMLP-AYAA
A0A517N8M1      ----------------AINVAAAVWRYRW--AVAIPVLIGAVCGL--MIYLQLPE-TYRS
A0A5C6CW01      ----------------STNLLASLWRYRW--AVILPAIVGATAGF--LLYLKTPE-TFRA
A0A5C6BXS9      ----------------TTDMLAAVWRYRW--AVLIPAVLGLVGGL--LMYLKTPE-TFQS
M5U569          ----------------GPDMLAAIWRYRW--AVIIPAILGAAGGF--IAFLKTPE-TFKS
L7CND7          ----------------AGDLMGAIWRYRW--AAFVPAILGAVIGF--LVFVKTPE-TFQS
A0A0J1B8S4      ----------------ASDLLGAIWRYRW--AAMGPTILGAMIGF--LVFIKTPE-TFQS
F2ARR3          ----------------TADIAAAIWRYRW--AVLIPTILGLVAGF--LAFVKTPE-TYQS
K5D8H6          ----------------TADIAAAIWRYRW--AVLIPTILGLVAGF--LVFVKTPE-TYQS
M2AKU0          ----------------TADIAAAIWRYRW--AVLIPTILGLVAGF--LVFVKTPE-TYQS
A0A5B1CRW9      ----------------EIDPIGMIRRRWR--LLTFGAVMGVLLSG--LYFQTAKK-SYQS
A0A5C6EI46      ----------------ELDISGMIRRRWR--LLVFGMVVGVGLSI--LYFKTAPR-VYES
A0A5B1CKI2      ----------------PVNVAEVLWRYRW--AVALPVVVGAVVGL--LIYLQLPE-TYRS
A0A5C6EG84      ----------------AVNIADAVWRYRW--AVAIPVVVGAVCGL--LIYLQLPE-TYRS
A0A5C6F2X4      ----------------AVNIADAVWRYRW--AVALPVIVGAVCGL--LIYLQLPE-TYRS
A0A7W5DXF4      ----------------GTDLFGALWRYRW--AVVLPTLLGMLGGF--LLFLKTPE-SFRS
A0A5C5XTV6      ----------------TTDMLSAIWRYRW--AVLIPTVIGFVCGL--LLYLKTPE-TYQS
A0A5C6AAB1      ----------------SADLVAAIWRYRW--AVIVPGILGLLFGF--LFYIKTPE-TFQA
M5T8W8          ----------------SADMVASIWRYRW--AVIIPAILGAAGGF--IAFLKTPE-TFKS
M5SF00          ----------------SADLMGAIWRYRW--AALVPTILGAVIGF--LVFVKTPE-TFQS
A0A2G1WDS1      ----------------SADLMGAIWRYRW--AALVPTILGAVIGF--LVFVKTPE-TFQS
Q7UVS9          ----------------SADLMGAIWRYRW--AALVPTILGAVIGF--LVFVKTPE-SFQS
A0A5C6B601      ----------------GESMLTVLWRFKW--LLVIFTAVGLGVGY--WVYQRKPT-TYMA
A0A517PFU1      GGWGAQSAGGDAATEEGFQLGRLLRRRWW--VLLLGLASGLGGGY--LYDLYQPP-VYQS
A0A5B9M8J9      ----------------GETIATVLWRYKW--LIGILLPLGTLLGY--WVNCQKPT-TYRA
A0A2A2WFP6      ----------------GEAIGTVLWRYKW--LIGILLPIGTLLGY--WVNRHKPV-TYRA
A0A518L8N2      ----------------GEAIGTVLWRYKW--LIAILLPIGTLLGY--WVNRQKTV-TYRA
A0A518HQN9      ----------------GESILAVFWRFKP--LILVLVIIGTGVGY--WRYHEKPT-TYRA
A0A5M6D8H8      ----------------GESILTVLWRFKW--LLGVFLAAGTGVGY--WIYKQKPT-TYRA
A0A1G2ZG92      ----------------LKIWEILSRRKWIFISAFLGFFGIVVIGT-----ILITP-TYKA
A0A2E7D3V4      ----------------KVEFDVVQIALRHKKIISIGVICGLVIGH--LAYKQAGP-EYEA
A0A5B9PER9      ----------------EAAFDFWGVLNRRKWLVFLGLVTGLALGA--LVYAKSET-IYES
A0A517QSM4      ----------------DTRALLNSVRRNWFVATLLGLIFGTGAAV--ATWVYVPA-PYQA
A0A355GJI7      ------------------------------------------------------------
A0A1Z8MCI4      ----------------GLGLILQTARRHLLWVLPTGFVLCALVFL--LLHDWKVD-RYQA
A0A517SYL7      ----------------GLGLILQTARRHLLWVLPTGFVLCTLVFL--LLHDWKVD-RYQA
A0A3L7P0L2      ----------------GRSIDIVRFAISMWKYLIAGLVLGCGMGG--LAYLYMGP-VYVA
A0A6M5YVJ1      -----------------------------------MFLLALAAGA--AAWCLLALPKTSV
A0A832M9Q8      ----------------QAAKFAAAAKKYWWLVLLCWALVGVPISL--WVYNAIKP-QFTA
A0A7W0MCI8      ----------------DVTTVLRSLRRRWAPCVFLGVPLAVVCGL--AAFFFLPA-PYVA
A0A517SCC8      ----------------GRSIDIARFALSLWKPMVLGLVAGCLMGL--GAYSYLGP-TFEA
A0A358MY60      ----------------DPRVLVSTWRHCWFWATPLGVALGCAAAF--TVYASFVP-MFKA
A0A517MNB1      ----------------DPRLIWVTFRRCWLWAVPLGLALASVAAY--AVFATFVP-MYQA
A0A3A0DR44      ----------------TIGFVYRSFQHWWRVAIPAGLVCALLAGA--AVWLTWTP-KYRA
A0A142YJ13      ----------------DLIGLLRALRRRWRLAFLGGLSCASLAAA--AAFYYLPSPKYTT
A0A517Z7D3      ----------------GKSIDIINFTLSIWKPLALGIVAGGILGV--LMYLRMGP-VYEA
A0A7X7KCE7      ---------------------------------------------------MFEP-VYEA
A0A1N6KY57      ----------------DPFMLLKALRRRWAMALGIGLVGAGVIGF--TTYLLVPAAKYTA
L0DK20          ----------------DPVAMLKALRRRWPLALGAGLLGGAVLAF--ATYFLVPPAKYTA
A0A517XRC2      ----------------TPLGLLNALRRRWVLATFLGLLVGSALGT--GVWFILPGGKHTA
A0A6M5YH47      ----------------TAMGLFNAFRRRWVLSTFIGGLVAAAVAV--GAWVALPGGKHEA
A0A660UUK3      ----------------SVTELIVPILRRWYVIMATFIVVCGIGVP--AIWFGMEQ-KYET
A0A517ZHG5      ----------------DPKALLNAFRRRWFLAVTVGLFCGGSAAA--AVYLLVPP-NYVA
A0A1Z8MPL5      ----------------------------MLFAIPAGL----------GTWFLVPV-NYTA
A0A7C1EH96      ----------------------------------------------------FMPDKYET
A0A5C1AGE3      ----------------TFMGLLNALKRRWVLASFLGLLVAAAAAV--ALWIAAPQGKHQV
A0A2Z3HEL7      ----------------TPSGLWNAFRRRWVLSTFVGALVAAAVAV--GAWLAMPAGKHQV
A0A142XAP8      ----------------TPLGLLNAFRRRWVLGTFIGGLVAVAVAV--GIWLALPTGKHQV
A0A6P2DEK1      ----------------TPLGLLNAFRRRWVLSTFIGGLVAVAVAV--GIWLALPAGKHQA
A0A5C6C1R5      ----------------DPLSVFHSLRRHWPVALLTGLLLAPPMAV--VGWFLLAP-KDTA
A0A1G2YRE4      ----------------GSPDLIKGILHRWYILLLGFSIMCAIGLP--AIWLSIKP-QYTV
A6BZU4          ----------------GPGVDIVRLLLRNKYLLVLGLATGLLLGQ--AAYMKLGP-IFSA
A0A2D5GZ77      ----------------GPGVDIVRLLLRNKYLLVLGLATGLLLGQ--AAYMKLGP-IFSA
A0A3D3R1Z6      ----------------GPGVDIVRLLLRNKYLLVLGLATGLLLGQ--AAYMKLGP-IFSA
A0A517XG00      ----------------GPGVDIVRLLLRNKYLLVLGLATGLLLGQ--AAYMKLGP-IFSA
A0A353Z859      ----------------DQNTVLAAMRRRWLIATALGLTGALVGAA--TTWLLIPV-TYTT
A0A2D6ST10      ----------------NFHVLWGAFRRRWLLASVLGLIFGVAAAA--AAWELLPA-PFTA
A0A177QX42      ----------------EKGLDFFTAIMGRKFLVVAFIGIGLGLGH--LHFTRQPP-VFAS
A0A517SHR0      ----------------DKGLDVFNAIMGRKFLVVAFIGIGIALGH--LYYTRQPP-VYAS
A0A2E0AW64      ----------------SPMLVLEAARRWWAIATPVGLLAGLIVAA--ILYLQFEP-LYEA
A0A351FZ59      ----------------SPMLVLEAARRWWAIATPVGLLAGLIVAA--ILYLQFEP-LYEA
A0A660V239      ----------------STMNLAAAILRRWPVLVATFVVVCAVGVP--AIWFLVEK-KYDT
A0A177Q3B7      ----------------SPWELLRAFRRCWFPATSLGLLVALLAAG--AVWYLLPN-RFTA
A0A2E0X6Y6      ----------------SAAMRFLRLIRRRQNVLLVALALCSAVGA--AVYIAAPR-YYAS
A0A518GFD7      ----------------NLSAALGSLRRWWWIGLPLGVLLGVAGAV--AGWLAMVP-KYAA
A0A518GE37      ----------------DPWLLWIAFRKHWGWVLPMGFLFASAAGL--AVWSQFVP-EFEA
A0A5C6F3H8      ----------------DPWILWVTFRRCWPWAVPAGMVLAGVAAM--FVLQGFVP-RYEA
A0A5C5X072      ----------------DPWIIWVTFRRCWPWAVPVGAALAGIAAF--VVMQGFVP-EYRA
A0A5C5WUQ3      ----------------DPWILWVTFRQCWPWAVPCGAILSAITAF--VVLQNFTP-TYRA
A0A5C6E697      ----------------DPWILWVTFRRCWFWALPLGILLGGFSVY--YVNRTFVP-TYRA
A0A5C5Z1A3      ----------------DPWILWVTFRRCWFWVLPIGAVLAALASF--GVLSTFVP-TYRA
A0A5C6D2P7      ----------------DPWLIWHTFRRCWPWALPIGIILAGAAAL--AVQRTFVP-EYRA
A0A5B9ML17      ----------------DPWLLWVTLRRCWYWAVPVGLVLACLAAF--SVLATFEP-RFRA
A0A5C5VZJ8      ----------------PSTPVSLAMLWRFKWTIAGTFMLCAAAGL-GLIWTAIRP-AYSA
A0A517LX75      ----------------SFEIDILRLLRRRWPLLLFGLLVGVGVAV--AYQMNARV-SYES
A0A7X7YXL7      ----------------PTSNLMESVRRRWPTVMIVTLLISAAGLP--AVWFLVEP-IHVV
A0A7W1FH76      ----------------SFGDLWHVCKRHAVIVILVGMAIAAVVMW---GASKIVP-IYRA
A0A7C5W7B3      ----------------SLWEHMKTILMFRWPWGLASLVIVFAMTL--AFDSMTPL-QYRA
A0A7V2IPP1      ----------------SFGDVVVGILRYWYWALIVMVLVAGAGLP--CIWLFLKP-EYSV
A0A142XL75      ----------------TGRAILNAVKRRPFTLLGVALLAAGTGAA--VWLFLPLP-KATA
A0A6P2D5D5      ----------------SGRAILNAVKRRPFTLLGVAILAAGVGAT--VWLFLPLP-KATA
A0A7C7T8W8      ----------------SPAIVVHTVKRSLWWTLPVGVLLSIAAGA--AVWYGVPY-RYEA
A0A5C6B3S0      ----------------GLTSVLHAFRRRWLLATALGICGGLMASF--TAWRLTAP-TYST
A0A354GX32      ----------------GATAVWYAIRRRWLTILVLGLGLGSLGAA--AAWYIMPA-KYTA
A0A518GIZ9      ----------------GLSIDWMNLVFRYRWWLCAGVVLGLGLGI--AAYMKLGP-EYMA
A0A1C3EBY9      ----------------GLSIDWMNLVFRYRWWLCAGVVLGLGLGI--AAYIKLGP-EYMA
D5SX64          ----------------GLSIDWMNLVFRYRWWLCAGVVLGLGLGI--AAYIKLGP-EYMA
A0A517Z0U7      ----------------QISAVLAAFRRRWFTAISLGLVLGAAAAA--TVWYVTPV-TYTS
A0A2S8FCC0      ----------------GISHVFHAVRRRWLPAFSIGVLLAAVAAT--SVWLLDVP-EYTA
A0A1Z8MBT6      ----------------DPWIIWVTFRRCWVWAVPIGLVIGTIGAV--MVLKSFQP-EYTA
A0A517SXN9      ----------------DPWIIWVTFRRCWVWAVPIGLVIGTIGAV--MVLKSFQP-EYTA
A0A7X7F3C7      ----------------HNATRFVAAARYRWKVLAASIVACGLLGG--LYCSTATP-LFKA
A0A255QXF5      ----------------DPWLIWVTFRRCWHWAVPAGLVLGSIAAF--GVLSTFEP-QFEA
A0A518KYQ0      ----------------DPWLLWITLRRCWFWAIPIGIVLATVAAF--LVLQTFVP-MYRA
A0A5B9QX47      ----------------DPWLIWVTFRRCWMWALPCGLVLAGIAAY--VVQRDFVP-RYRA
M5T666          ------------------------------------------------------------
M5U6N6          -------------------------------------------------MLGFVP-RYQA
A0A517M0G2      ----------------DPKLLWVTIRHCWIWATPIGLALAAAAAF--AVFSGFVP-VYKA
A0A5C6AST1      ----------------DPRLIWVTIRRCWLWATPIGLALAALAAY--GVYATFVP-IYQA
A0A5C6C951      ----------------DPKLLWVTVRRCWLWATPIGLSLAAAAAF--IVYSRFVP-IYQA
A0A5C6C5T3      ----------------DPWILWVTFRRCWPWAIPLGAALAGIAAF--VVIRGFVP-RYQA
A0A2A2W6A9      ----------------DPWLLWITLRRCWYWAFPVGIVLGVIAAF--VVLQSFVP-RFRA
A0A518HQS9      ----------------DPWLLWITLRRCWYWAIPVGVVLAVIAAF--AVLQSFVP-QFQA
A0A5M6DFE6      ----------------DPWLIWVTLRRTWYWAVPVGLVLASVAAF--AVLKQFVP-RYES
A0A5C6F286      ----------------DPWIIWVTFRRCWAWAIPAGAVLAGLTAM--AVLRGFVP-RYEA
A0A517NGN1      ----------------DPWMLWVTVRRCWFWAVPIGLVLASLAGF--VVLKTFVP-RYKA
M5RUI3          ----------------DPWILWVTFRRNWLWAVPVGMVLASLAAF--GVFKSFVP-VYRA
A0A5C1AAF0      ----------------LTPGALLRALRRRLILALAVGVVLAAVAATAVWVYLPPP-KPRV
A0A3B8ZJM2      ------------------------------------------------------------
A0A1U7CLW1      ----------------PDLDGLLRALRRRWLFALLGGLLCSSLSAAAVYLYLPPP-KYTA
A0A5Q3LBQ3      ----------------TATFVANSLRQWWWAFVPAALGLALASAT--AIMMFFEP-VYEA
A0A142WPR7      ----------------ERTVNFLALTWRYLWLLILFGGVGTGAAY--LHFLKQPP-IYQS
A0A517T4K9      ----------------DHRGLWSAFRRRWLWATLGGGIVGLCAAA--VVYFMMET-PYHA
A0A7C6B2Q1      ----------------GLTAYLHAFRRRWFPAVFLGIVLAAAAAV--AVWFLYIP-QYTA
A0A2Z3GZZ5      ----------------ASGLNPLHLVMRRWQFLAVGLIIGGVLGA--LIYSTSAP-QYQS
A0A4V0I6L6      ----------------AEQPNVLFAVLRRWPWLVLGLAVGCVLGL--LFHMQRTP-VYQS
A0A7C4QQT3      ----------------RKPINYAELAFRYRFWLAAGAVAGLLLGE--LAYLKLGP-EYEA
A0A7V9G5K3      ----------------LTLGDVVDLVRRRPLSAAIAGLGTLVLVL--FLTSRTVP-LYEA
A0A7W1JAD6      ----------------LTLGDVVDLVSRRPLTSAIAGFGVMLLVL--FMTSRTVP-LFEA
A0A518KBI5      ----------------TPKFLLWVFSRSWKVVVPVGVLLAAATAA--VLLYTYVP-QFAA
A0A5C5V6Q5      ----------------TPKFLVWVFLRHWKLVVPSGLVLAAAAVS--ALLWTYQP-DYLA
A0A517P477      ----------------DWRPAVAGLKRFWYVAVLVGLPLGAGGAY--AAWIYIPA-PYVA
A0A518HFS8      ------------------MPALLRALRLRWKLAVSGAILLGAAAGAVAFVAMPPA-EYSS
A0A7Y5LUV4      ----------------SALPRLVLVLRRRWKIASLAFVATLGSVA--AWTFTQPR-LYRA
A0A3M1TFJ0      ----------------EDLWVYLQTLRRQLPLVLVVAGACTLLAT--LRTLRLPA-VYAA
A0A7Y5HGA4      ----------------LPVASYLFILRKHLLLMLGTMAVVLAAGW--TYAATCRA-VYRA
A0A517MY49      ----------------KTFMRFARILRLRQKTVLATLVLSCLLGG--CYYTFATR-YFQS
A0A2E6AG00      ----------------HNAMWLVRSVRYRKHYLIGALVASGLVGA--VYFFTADR-IYEA
A0A1G3A880      ----------------YAVLYFLRVVRYRRSVMVTALLITGLLGG--LYFTTATR-YYEA
A0A2E8ATT1      ----------------RAVLRFLRVIRYRKSYLIVALTTAVLLGS--VYYFTAAR-IYEA
A0A524HC32      ------------------------------------------------------------
A0A660VT66      ------------------------------------------------------------
A0A7C2ZTD2      ------------------------------------------------------------
A0A0S8H0S8      ------------------------------------------------------------
A0A7C2VEF7      ------------------------------------------------------------
A0A7V7D6N0      ------------------------------------------------------------
M5S2L2          ------------------------------------------------------------
A0A7V1EK28      ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A7C2VXA0      ------------------------------------------------------------
A0A7C3AA48      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A7C5PFV3      ------------------------------------------------------------
A0A7C3QGD2      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A7Z9UC46      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A7C2ZUK5      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ------------------------------------------------------------
A0A7X8YY48      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
                                                                            

A0A523CME0      ------------------------------------------------------------
A0A7Y3UKB3      ------------------------------------------------------------
A0A7C2JY73      ------------------------------------------------------------
A0A836W298      ------------------------------------------------------------
A0A354PCV3      ------------------------------------------------------------
A0A354PHB4      ------------------------------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A538RV31      ------------------------------------------------------------
A0A1G2XSU7      ------------------------------------------------------------
A0A350KD81      ---------------------------------------------------------MAQ
A0A356AE44      -----------------------------------------NIHHQRVDAIATERV-KVE
A0A7Z9UBD9      ------------------------------------------------------------
A0A257WQ92      ------------------------------------------------------------
A0A2E3Z6T8      ------------------------------------------------------------
A0A7Y2AF64      ------------------------------------------------------------
A0A7C1U6X6      ---------------------------------------------------------MDV
A0A7C7UXI5      ------------------------------------------------------------
A0A7C3SFJ0      ------------------------------------------------------------
A0A7X7YIF4      ------------------------------------------------------------
A0A7C7WWF7      ------------------------------------------------------------
A0A7V3JIB0      ------------------------------------------------------------
A0A356ETW1      ------------------------------------------------------------
A0A3L7NJY1      ------------------------------------------------------------
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      SPEFNPVKKANIFSIKELTRGNSSPTVRKPEPGKESQEPETPVKYD-----------VDD
A0A177PV03      QSEILAVLKGGF---------------------------------------------GAN
A0A1G2YIM0      AGAIRISPIVPSILFSDRDSEQAMPNYMNFMNTQ------------------AELI-ASF
A0A1G3A0W0      RAEVRVR--------PIVPHLVFRTDENGAIPFY-------DSFVNTQVSY----M-RSS
A0A7V7D8F5      TGAIRVAPILANILTGEADRGEIS---NYDNFMN-------TQAQM---------I-TSS
A0A432MFP3      FSLLQIERNQANPYGSLEDP-------RSIEYLQ-------TQIQL---------I-TSP
A0A518HFL0      SSMLRIETDPANPYVTNGGP-------PVRSDLQ-------TQIQL---------I-TSA
A0A3L7UX05      FALLRVEPPRASILGPSMNTL------GIDQIKR-------THMQL---------I-KAP
A0A2E0SHG0      EAQIHIIRRDPNLATEAAESTSPGDFRRMEDELA-------NQMKI---------M-SSY
A0A2S8F9B8      SAYLRISASEQPLAFRTVEQAGRD---DYRTFKS-------TQRQL---------M-ITP
A0A368KP63      SAYLRISANDQPLAFKTVEQAARN---DFRTFKN-------TQVQL---------M-ITP
A0A518CQB8      QAQIHIIRHDPNLATEGSENSSPNDFRRMEDELA-------NQMKI---------M-SSH
A0A7C4QPD3      YAELFCQPRRFFWKTNEDDP-------QFAVYKQ-------TTMRL---------L-KDP
A0A7C2JZW2      YVELLCQPRRFFWETKEDEA-------QFSVYKQ-------TMMRR---------I-KDP
A0A836RF42      LLVLVEQARAATPSLKPMED-------ELRQAEV-------NLIQI---------E-QQI
A0A7D8YCU5      SSTISVVQ-----PRTGPGNGSPMEGIVDSAPSV-------GQIQA--E------M-ASE
A0A353BE27      AARVQVI---------SSIPAPVKNPYFSGGQEV-------NRIDESMI------I-RSQ
A0A5C6BPW1      SSIIYID------ATPGSVLQDNSSF----SSDF-------DTFKRTQMFRALSRV-VLD
A0A1I3GSP0      TTSVLVS--------KKASVPANNGEANRYGERG-------DHVQL---------I-QTD
A0A517QJV1      NTQVLVS--------KKASVPINDGEANRFGDRG-------DHVEL---------I-KSD
A0A3C1QS25      VAKVMIT------PKNPATVIIPGFEGMPSGPGV-------KQDHEHDAVLTSTTF-IRD
A0A5C6FX55      TTQIMIE------SNRPAVMDTMTGEMVGGVPSI-------EIVQA--Q------L-FSD
A0A5C6DS51      HIEILVG--------QRSSEMASNGTMSNAQASG-------DSIHEDLLATHMRLF-LSR
A0A5C6DSL6      RIEILVG--------QRSSEMANSGTMSNAQASG-------DTIHEDLLATHMRLF-LSR
A0A3M1VG27      KAQILVS------RKASIHLKSDDLRTYGERSEH-------VAL-----------I-MSP
A0A518GC22      AALVQVV------SSTPTQTRMDFYDPRGSAIT---------------RVDESMVI-RSQ
A0A3L7Q373      ETQIMV-------SKKASISDQEARRYGDRGEHV-------RVIAT---------D-IIA
A0A3E0PW54      DTRIEVS------QKSAIPMDERSINFSGERTEH-------VHL-----------I-KSD
A0A7C3TAH2      GYIRVAPAMQDLLTGQPDRGDIGTYESFVNTQAM-------AITQP---------Q-VLE
A0A1Z8MHR4      STQLMFK------SETPLSLDTATGLVQGGVPSG-------NLMES--L------V-ISD
A0A5C6EHJ0      AAQVQIV------ESTARNLPVDS--LDAGLKSR-------NLSDEALV------M-RSE
A0A5C6F1H9      AAQVQIV------ESLARNLPVDG--LDTGLKGR-------NLGDEAIV------M-RSE
A0A255QXY0      TSKLMFR------SDAPMALDTSTGLIRGGLPSG-------QLLKS--L------I-NSR
A0A517SYI0      STQLMFK------SETPLSLDTATGLVQGGVPSG-------NLMES--L------V-ISD
A0A518HX54      TTRLMFK------SDTPLTLDTSTGMVRGGIPSG-------NLMQS--L------I-SSD
A0A5B9MF59      TTQLMFK------SDTPISLDSNTGIVRGGIPSG-------NLMQS--L------V-TSD
A0A2A2WC24      TTQLMFK------SDTPISLDSNTGIVRGGIPSG-------KLMQS--L------I-TSD
A0A518KYW8      TTQLMFK------SDTPISLDSNTGIVRGGIPSG-------KLMQS--L------I-TSD
A0A5C5YZZ0      GATIEVYS-----QNVQTNTGSVVENLTESAPSL-------AFIQA--E------M-TSD
A0A518JLD2      S------------SDVQIIESTTNKNMAVDGVEV-------AASRS--LADEALVM-RSE
A0A5M6DJ15      VAVLKID------SVAAPLIFQTADQSGGGRGSY-------ELYKN--TQSQL--I-KTS
A0A3L7P7S7      SVDVMVV------KKKGAMASDFRTAMLDDYVAI-------QVTI----------I-KSD
A0A517N8M1      TTRLMIE------SDKSTMLDSMTGEIVGGVPGL-------DIVES--Q------L-FSD
A0A5C6CW01      STRLIVE------SDRPAILDSMTGDVIGGVPSV-------DILSS--H------L-YSD
A0A5C6BXS9      STRLMFE------ANRPAVINTMTGDIVGGVPSV-------EILRS--Q------L-FSD
M5U569          ATRLMFE------SDRPAVLDTMTGDVLGGVPSI-------DILRS--Q------L-FSD
L7CND7          GTLLMFE------SDRAAVIDTMTGDLIGGVPSI-------EILRS--Q------L-FSD
A0A0J1B8S4      ATLLMFE------SDRPAVIDTMTGDRIGGVPSI-------EIIRA--Q------L-FSD
F2ARR3          ATRLMFE------SDRPAVMDTMTGDVLGGVPSI-------DILRS--Q------L-FSD
K5D8H6          ATRLMFE------SDRPAVMDTMTGDVVGGVPSI-------DILRS--Q------L-FSD
M2AKU0          ATRLMFE------SDRPAVMDTMTGDVVGGVPSI-------DILRS--Q------L-FSD
A0A5B1CRW9      SVEVLVGQRSSEMTNRGTISDGSAGSDSLGEDQL-------ATHMR--L------F-VAR
A0A5C6EI46      SIEVLVGQRSSEMTNRGTISSTSGGTEGMGEDEL-------ATHMR--L------F-VAR
A0A5B1CKI2      TTRLMIE------SDQAAVLDPINGDMVGGVPSL-------DIVQS--Q------L-FSD
A0A5C6EG84      TTRLMIE------SDNQAVLESKSGDVVGGVPGL-------DIVES--Q------L-FSD
A0A5C6F2X4      TTRLMIE------SDNKAMLESMSGEVIGGVPGL-------DIVES--Q------L-FSD
A0A7W5DXF4      STKLLFE------TERPAALNSLTGDMIGGVPPI-------QILTS--Q------L-YSD
A0A5C5XTV6      STRLMFE------SHRPAVIDTMTGDIVGGVPSV-------DILRS--Q------L-FSD
A0A5C6AAB1      STRLMFE------SDRPVVLDSMTGDVMGGVPSI-------DILRS--Q------L-FSD
M5T8W8          ATRLMFE------SDRPAVLDTMTGDVLGGVPSI-------DILRS--Q------L-FSD
M5SF00          GTLLMFE------SDRPAVIDTMTGDLIGGVPSI-------DILRS--Q------L-LSD
A0A2G1WDS1      GTLLMFE------SDRPAVIDTMTGDLIGGVPSI-------DILRS--Q------L-LSD
Q7UVS9          GTLLMFE------SDRPAVIDTMTGDLIGGVPSI-------DILRS--Q------L-LSD
A0A5C6B601      SSKLMFR------SDKPLILNSQTGVMEGGIPSG-------NIMQS--V------I-TSD
A0A517PFU1      VAELTVS------ARRTALPGSEGG---GGEPEE-------LAGEA--LGNYLYRA-QTG
A0A5B9M8J9      TTKLMLK------SDTPLTLDTATGVVRGGIPSG-------NLMQS--L------I-SSD
A0A2A2WFP6      TTRLMFK------TDTPLTLDTSTGLVRGGIPSG-------NLMQS--L------I-SSD
A0A518L8N2      TTRLMFK------TDTPLTLDTSTGLVRGGIPSG-------NLMQS--L------I-SSD
A0A518HQN9      TSQLMFK------SDTPISLDSNTGIVRGGIPSG-------KLMQS--L------I-TSD
A0A5M6D8H8      TTQLMFK------SDTPLTLDAASGSIRGGIPSG-------NLMQS--L------I-TSD
A0A1G2ZG92      KAKLIIETSDTISSLLSSLGTKGTKIG-GVIPPKTGKTGSTDYETDIALAKIRPLIEKLI
A0A2E7D3V4      TVKILVSKKA------------------DVMDKD----NLADTKGAGGRGEHIALI-MSP
A0A5B9PER9      VASVKIEPRNK-----------------PSIRNH----RQVEYGPEVAQVAHDKLI-VQR
A0A517QSM4      FFEFHINSVES-----------------KILFET----SEAQSNFNTYKQTQMRKV-TGE
A0A355GJI7      -----------------------------------------------------MLI----
A0A1Z8MCI4      SHWVEIAP--------------------NHVAFS-----DVRARGGSDAKGEEALL-KSP
A0A517SYL7      SHWVEIAP--------------------NHVAFS-----DVRARGGSDAKGEEALL-KSP
A0A3L7P0L2      GTKITVSKKATV--------------------------GETEARLYGGRSEHISAI-KSD
A0A6M5YVJ1      AVAFHISTQAP-----------------ALLDAT----SESRIDFGSYRQAQIALV-KRR
A0A832M9Q8      VGTINVAPTTP-----------------NVVTGQ----EAATAFYSEFVRTQAELI-KSP
A0A7W0MCI8      IAEVYFKSYDD-----------------NLVFDT----NEPQADFRVRKETHQRLV-TSR
A0A517SCC8      NTQVKVSQ-------------------------KASLPSSDQARRYGDRGEHVYLI-KSD
A0A358MY60      SHMLEANQ--------------------DYIVFE-----NVLAESSNLEATEKQII-LSD
A0A517MNB1      THLLEKNQ--------------------DYVVFE-----GVMPTSANLAGSERQLI-YTD
A0A3A0DR44      YAIIEIPD--------------------RGGVLL----PTSPDTSPRFAQTQLRSI-ASS
A0A142YJ13      SSLVHVAEKRPREIFET---------------------RESDVGYRTYQETQLILV-KSR
A0A517Z7D3      NTRILVSQ--------------------RAAVAD----SPRETNLTGERSEHVDLI-MSD
A0A7X7KCE7      SAWLQFEERT------------------PYLAFE----NKDDGRSKLFFQTQIEII-RSP
A0A1N6KY57      RSMLHVNSVQP-----------------RILLTT----GEVHTEYGAYQRTQLALL-HSR
L0DK20          RSMLHVSSTQP-----------------RILLKV----GENETDFVAYQRTQLALL-KSR
A0A517XRC2      RATVQLRP--------------------STVESG----KGQVEDFDSFRRSQMYLV-KSR
A0A6M5YH47      RALVQLRP--------------------KAIEFV----NRNTENFAEYRGRQVFLL-KSR
A0A660UUK3      TGSIRISPIV------------------SRILFNDSDSDRPMPNYANFMTTEAERI-AGP
A0A517ZHG5      SSIVYIDATPG-----------------TVLQDS----SSFSSDFDTFKRTQMFRA-LQR
A0A1Z8MPL5      HSLMQSRR--------------------NTLIFD------VQNAEESGWEAQEQLI-RGY
A0A7C1EH96      QGSVLVSSVVVPIMYETTAQGGVGAY-------------------QTFKNTQAGVM-TSD
A0A5C1AGE3      KALLEITP--------------------ENVGLMPGANQQNDSNTSNFKENQMVLI-KTR
A0A2Z3HEL7      RALVQLQP--------------------QHAYIT----NKGQEDFEWYRRRQIYLLTKDR
A0A142XAP8      RALVQLQP--------------------KQVEFV----NKTQEDFEAYRRHQMFLL-KSR
A0A6P2DEK1      RALVQLQP--------------------KQVEFV----NKTQEDFEAYRRHQMFLL-KTR
A0A5C6C1R5      MAYLRIDSVDSLLVF-------------QTADRL----NAGRDSFSMYKNTQAQLI-KTP
A0A1G2YRE4      TGALRFSP--------------------VLMNIL----TGEQNSAQISMLTEAELI-TSE
A6BZU4          NTKIQVSQ--------------------KNPVPI----KDGEIQTFGELTAHIDVI-KSP
A0A2D5GZ77      NTKIQVSQ--------------------KNPVPI----KDGEIQTFGELTAHIDVI-KSP
A0A3D3R1Z6      NTKIQVSQ--------------------KNPVPI----KDGEIQTFGELTAHIDVI-KSP
A0A517XG00      NTKIQVSQ--------------------KNPVPI----KDGEIQTFGELTAHIDVI-KSP
A0A353Z859      RAELRVKAVNYT----------------PGGGLK----QGEELRGEVYRQTLGRMV-QGP
A0A2D6ST10      TAQVRINSFDP-----------------FFFFKV----DNQTPRFETYKQTQMILV-RSP
A0A177QX42      FAKVMVLRPQSVLPN-------------EDPERG----TKKSANAVNLLENHQYLL-TQP
A0A517SHR0      FAKVMVLRPQTSMST-------------GRDDR-----TTNSINSVDLLENHQYLL-TQP
A0A2E0AW64      KALLRIT---------------------TPISFD----GSKNKADRSFLANQFAVL-YSV
A0A351FZ59      KALLRIT---------------------TPISFD----GSKNKADRSFLANQFAVL-YSV
A0A660V239      EGAIQISPVES-----------------PILFET----EERLPNYQNFMNTQAQLF-RRN
A0A177Q3B7      TTLLHVSAQE------------------PTILAT----SEAHTDFGLYQKAQAALI-SSR
A0A2E0X6Y6      TAKLLIIEQKSDQLASVNDADGS----------------------DNTMATQREIV-VSP
A0A518GFD7      SAYLRIDSDNRPLLF-------------ETVDQA----GGGVSGFKLYKSTQQQIM-LTP
A0A518GE37      THIMEANR--------------------DYVLAQ----SLHNTS-RDLARSERQLI-TNA
A0A5C6F3H8      THLLVAND--------------------EYVVFD----NVMKYS-KDLARTETALI-LNP
A0A5C5X072      SYLLESNE--------------------DYVVFK----GVMPQV-ENLARTEKSLF-QNS
A0A5C5WUQ3      SHLLEAND--------------------DFVVFK----GVMPTV-DDLANTEKSLF-FNP
A0A5C6E697      SHLLEANE--------------------DFVVFK----GVMPTI-NDLARTEKPLF-FNP
A0A5C5Z1A3      NALLQANQ--------------------DWIVFK----GVMPTL-TDLARTEKSLF-FNP
A0A5C6D2P7      QHLLEANE--------------------DYVVFQ----GVMPMV-KDLARTETSLF-FNP
A0A5B9ML17      QHLIEANQ--------------------DYILYR----DVFNTV-RDLAGTEKTIF-FDE
A0A5C5VZJ8      SGVIHIKPVRD-----------------DLLSGR----QDVMPMYESFRQTQASFV-TNA
A0A517LX75      NMEILIALRSSELTNSGTSSDGGIDS---------------TVLHSDMLATHIELL-TSP
A0A7X7YXL7      QGTAQIIPVVRSVLTGQPKPDEASSYAEFVNTQA----TLLMSSSDSIQKITDDLV-RRN
A0A7W1FH76      STTLALDRGS------------------KPVFQG----ERDPVTDQSLLNAQRDLL-LST
A0A7C5W7B3      RGQMLLVQ--------------------NVTGAS----GMDQVFAWRLYFSNVALA-RLG
A0A7V2IPP1      AGLVHITPVQA-----------------NLLSGG----EDRMSNYESFVNTQVSMI-TGE
A0A142XL75      ATVFHVSAQA------------------PSVLGQ----ADGQANFVSYRASQIATI-KRQ
A0A6P2D5D5      ATVFHISSQT------------------PSVLGQ----TDGQTNFASYRASQIALI-KRR
A0A7C7T8W8      KAWIRIKS-TRPKVAFELEES------------------------KLWTRTQVELI-RSP
A0A5C6B3S0      ASLLRVASQDAPL---------------VFKTVD----QASVSSFDIYKRTQRELL-KSD
A0A354GX32      TATLRLNP--------------------QSPRGV----NETSEDYTNLRSYLAGWV-KSD
A0A518GIZ9      IGQVMVSR-------------------RNAVPLK----EQSAMGDWGERSEHIALI-MSP
A0A1C3EBY9      IGQVMVSR-------------------RNAVPLK----EQSAIGDWGERSEHIALI-MSP
D5SX64          IGQVMVSR-------------------RNAVPLK----EQSAIGDWGERSEHIALI-MSP
A0A517Z0U7      YAELQFDL---TPFYFGDRETGEANG--DLRSFK----GTM-----------MRLA-TYP
A0A2S8FCC0      RALLRISS-----------------RHGTLLKQN----GEANGDFEVYKLTQRQLI-RGS
A0A1Z8MBT6      RYIVAANQ--------------------DWVIYK----GINEAPRDLAASEKTWVI-DHP
A0A517SXN9      RYIVAANQ--------------------NWVLYK----GINEAPRDLAASEKTWVI-DHP
A0A7X7F3C7      KAALLVIDTGVDQSAMGVTGERSRQQ-------------------LNAMPTYVNLL-AYP
A0A255QXF5      GYRLEANK--------------------DWLLDR----GVMPTP-DDLAKSEGPII-ASP
A0A518KYQ0      SHHLAANK--------------------DWLIDR----GVLPAP-EDLAKSERLLL-TSP
A0A5B9QX47      SHLLEASQ--------------------DYVLFK----NLLPTAGSNLSGTERTIL-LNS
M5T666          --MLEANE--------------------DFVVFK----GVMPVV-KDLARTENSLF-FNP
M5U6N6          THLLEANE--------------------DFVVFK----GVMPVV-KDLARNEKSLF-FNP
A0A517M0G2      SHLLEVNQ--------------------DFVVFK----GIMPTP-RNLVASERPLV-LNA
A0A5C6AST1      THLMEANQ--------------------DFVVFR----GVMPTS-SNLAATEKQLI-TTD
A0A5C6C951      THLLEANQ--------------------DYVVFQ----GVMPTS-RNLAATERQLI-TTD
A0A5C6C5T3      SYLLEANE--------------------DFVVFK----GVMPVM-ENMARTEKNLF-TNP
A0A2A2W6A9      THQLAANK--------------------DWLIDR----GVMPTP-DNLSSSERMLI-TSP
A0A518HQS9      THHLAANK--------------------DWLIDS----GVMPTP-DDLARSEKTLI-TSP
A0A5M6DFE6      SALLEASR--------------------DYVAFK----GVMPAL-DDIARTEKPLI-VNP
A0A5C6F286      SHLLVAND--------------------EYVVFN----NVMKVS-KDLARTETALI-LNP
A0A517NGN1      IHLLEANQ--------------------DYVVFK----GVMPMV-DDLVRTERALF-LNP
M5RUI3          SHLLEANS--------------------QWVVFK----DVIPVI-EDIAATEKPLF-FNS
A0A5C1AAF0      SAKLYVDY-SQRGTLFEHPDSPLNQQ------TQ------------------INVL-KSE
A0A3B8ZJM2      ---------MDPKKGVDVSPAEKSER----------------------------------
A0A1U7CLW1      RALVHVAE-KRPRELFETRESEVGFR--TYQETQ------------------VILV-KSR
A0A5Q3LBQ3      SAWIQIAE-REPYIAFDTPLESH-----RFVETQ------------------VGLM-RSP
A0A142WPR7      SSTVLVTGDRQQQANPLGTESGFAQGITQTMPHQ-------------------MLI-GSP
A0A517T4K9      FAEIRMKS-VQERLLFNTAEAQTSFQ--TFKQTQ------------------MKLV-KSP
A0A7C6B2Q1      TALIRVAASSQSVLFPANDRGGASFD--IYKATQ------------------LEYL-RSR
A0A2Z3GZZ5      TAQVLVVK---KGVEVTKEGDGRIVE--DHVATQ------------------VTLI-KSE
A0A4V0I6L6      TAELMVVK-SRPDMVAGGAGDARVQYLEDYIGPQ------------------VILL-GSE
A0A7C4QQT3      TGQILVYR--RNVVPLKEDQRALHDW--GERSEH------------------IALI-MSP
A0A7V9G5K3      SARLSIDRGNKPVQWQVDPDTGKVEY--SLLNTQ------------------KELL-LSY
A0A7W1JAD6      SARLSVERGNKPVQWQVDPDTGKVEY--SLLNTQ------------------KELL-MSQ
A0A518KBI5      SGLIKIED-IQPYVAFQQAAVGSNNG--SFIRTQ------------------IELM-RSP
A0A5C5V6Q5      TGLVRIED-TQPYIAFEKASVGSANS--AFVRTQ------------------IELM-RSP
A0A517P477      SAELYMRS-YVDRVAFSTSEQQASFR--TRKQTN------------------QKLL-RSR
A0A518HFS8      RSLVHVAE-KRPRDLFETRESGVSYA--IYQHTQ------------------TTLI-RSN
A0A7Y5LUV4      QAVLEIRP-ERSTVATLGDPTQFADT--ALWESY----YRTQ----------ENIL-VSP
A0A3M1TFJ0      TASLRLVR-EPPDPIQAKYAYR--WD--GIPQEY----LNSEIRDMTSLSLARAVI-ESN
A0A7Y5HGA4      VATVKIEA-GSRGAGSGKASAREEGN--FLSDQF----WVIRTDDSLAERVLRHIR-GED
A0A517MY49      SAELLIIE-QYRDQLS-SAGNHRSSE--NTMATH------------------SKIV-RSP
A0A2E6AG00      SSQLLVQQ-MSPVVASGPIGQVGXXX--GMLPTY------------------EKLF-ASA
A0A1G3A880      DASLLILQ-TGGDVLTPSLSVDGAKQ--EIIPTY------------------CQLI-ESA
A0A2E8ATT1      KASLLITQ-SSPDVWNGAASSEVGRH--GLIPTY------------------EQLF-SSA
A0A524HC32      ------------------------------------------------------------
A0A660VT66      ------------------------------------------------------------
A0A7C2ZTD2      ------------------------------------------------------------
A0A0S8H0S8      ------------------------------------------------------------
A0A7C2VEF7      ------------------------------------------------------------
A0A7V7D6N0      ------------------------------------------------------------
M5S2L2          ------------------------------------------------------------
A0A7V1EK28      ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A7C2VXA0      ------------------------------------------------------------
A0A7C3AA48      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A7C5PFV3      ------------------------------------------------------------
A0A7C3QGD2      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A7Z9UC46      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A7C2ZUK5      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ------------------------------------------------------------
A0A7X8YY48      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
                                                                            

A0A523CME0      ------------------------------------------------------------
A0A7Y3UKB3      ------------------------------------------------------------
A0A7C2JY73      ------------------------------------------------------------
A0A836W298      ------------------------------------------------------------
A0A354PCV3      ------------------------------------------------------------
A0A354PHB4      ------------------------------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A538RV31      ------------------------------------------------------------
A0A1G2XSU7      ------------------------------------------------------------
A0A350KD81      QFLM--------------------------------------------------------
A0A356AE44      LLYE--------------------------------------E-----------------
A0A7Z9UBD9      ------------------------------------------------------------
A0A257WQ92      ------------------------------------------------------------
A0A2E3Z6T8      ------------------------------------------------------------
A0A7Y2AF64      ------------------------------------------------------------
A0A7C1U6X6      SFTC---------------ASAS-------------------------------------
A0A7C7UXI5      ------------------------------------------------------------
A0A7C3SFJ0      ------------------------------------------------------------
A0A7X7YIF4      -MTS---------------RVPA-------------------------------------
A0A7C7WWF7      ------------------------------------------------------------
A0A7V3JIB0      ------------------------------------------------------------
A0A356ETW1      ------------------------------------------------------------
A0A3L7NJY1      ------------------------------------------------------------
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      ALIN--------------------------------------N-----------------
A0A177PV03      RVFK---------------DGVT-------------------N----N------------
A0A1G2YIM0      QVLN---------------RAAD-------------------D---------------LK
A0A1G3A0W0      TVLQ---------------RVLD-------------------Q-P--A----------IR
A0A7V7D8F5      QVVQ---------------RVAT-------------------D---------------LA
A0A432MFP3      RVLS---------------VAKL-------------------D-P--K----------VA
A0A518HFL0      NVLT---------------SAVS-------------------D-P--D----------VS
A0A3L7UX05      DVLS---------------DAVS-------------------EYP--E----------IV
A0A2E0SHG0      KIVS---------------AGLE-------------------S-G-------------LE
A0A2S8F9B8      FVLN---------------KALS-------------------R-E--D----------IM
A0A368KP63      FVLS---------------KALG-------------------K-D--G----------II
A0A518CQB8      KIVK---------------AALE-------------------A-G--L----------KN
A0A7C4QPD3      FVLE---------------AALR-------------------E-T--I----------SQ
A0A7C2JZW2      QVIA---------------AAMR-------------------K-E--D----------VA
A0A836RF42      RYVK---------------KKLA-------------------T-L--D----------LL
A0A7D8YCU5      PVLH---------------KAIE-------------------D-G--G----------LL
A0A353BE27      AVLR---------------LAVS-------------------L-G--R----------LG
A0A5C6BPW1      TALN---------------EPVR-------------------N-Q--T----------LK
A0A1I3GSP0      LIVE---------------RAFK-------------------D-H--G----------LN
A0A517QJV1      LIIE---------------PAFK-------------------K-H--G----------LN
A0A3C1QS25      SVVS---------------NPEL-------------------D-Q--Q----------VP
A0A5C6FX55      EVIR---------------GAFE-------------------N-P--E----------MI
A0A5C6DS51      KNVA---------------NAIE-------------------T-G--N----------LK
A0A5C6DSL6      KNIA---------------NAIE-------------------T-A--N----------LK
A0A3M1VG27      MIVR---------------KAVA-------------------L-R--R----------LD
A0A518GC22      TVLR---------------RAVQ-------------------L-G--R----------LT
A0A3L7Q373      RIAY---------------EKYG-------------------L-N--Q----------IS
A0A3E0PW54      AIVS---------------RAVR-------------------D-H--G----------LG
A0A7C3TAH2      RVLD---------------ELLP---------RNLTFFSGQNR-G--R----------LA
A0A1Z8MHR4      AIVK---------------RVAM-------------------S-P--Q----------LR
A0A5C6EHJ0      QILR---------------RAAE-------------------I-G--E----------LS
A0A5C6F1H9      QILR---------------RAAE-------------------L-G--E----------LS
A0A255QXY0      AIVG---------------RVKN-------------------D-R--Q----------LR
A0A517SYI0      AIVK---------------RVAM-------------------S-P--Q----------LR
A0A518HX54      AIAG---------------RVHL-------------------N-E--Q----------LR
A0A5B9MF59      AIVN---------------RVAS-------------------N-P--E----------LK
A0A2A2WC24      AIVR---------------RVAA-------------------N-P--E----------LK
A0A518KYW8      AIVR---------------RVAA-------------------N-P--E----------LK
A0A5C5YZZ0      EVLK---------------SAIE-------------------I-G--Q----------LT
A0A518JLD2      FILR---------------RAAE-------------------L-P--E----------IV
A0A5M6DJ15      EVLA---------------TALK-------------------N-E--E----------VR
A0A3L7P7S7      RVLR---------------EAAQLLQQGEIAGGVAQATDTAGA-P--K----------TD
A0A517N8M1      RVME---------------AAFE-------------------N-P--K----------LH
A0A5C6CW01      RVVK---------------MAFD-------------------N-P--E----------MV
A0A5C6BXS9      TVME---------------NAFR-------------------N-P--S----------FE
M5U569          TVTK---------------NAFE-------------------D-D--S----------FD
L7CND7          KVTE---------------YAFE-------------------N-E--N----------MV
A0A0J1B8S4      EVNR---------------SALS-------------------D-G--N----------MN
F2ARR3          IVLA---------------KTFA-------------------D-E--N----------MR
K5D8H6          TVLN---------------KTFN-------------------D-E--N----------MR
M2AKU0          TVLN---------------KTFN-------------------D-E--N----------MR
A0A5B1CRW9      KVVA---------------KAIE-------------------M-G--E----------LN
A0A5C6EI46      KVLT---------------EAIK-------------------L-G--S----------LD
A0A5B1CKI2      RVMQ---------------MTFN-------------------A-P--R----------LR
A0A5C6EG84      RVMA---------------TAFG-------------------N-E--R----------MR
A0A5C6F2X4      RVLA---------------ATFA-------------------N-P--R----------MR
A0A7W5DXF4      RVVS---------------SSLQ-------------------S-P--H----------MN
A0A5C5XTV6      SVVK---------------RAFE-------------------D-P--H----------FE
A0A5C6AAB1      SVTR---------------NAFQ-------------------H-A--A----------FE
M5T8W8          TVTK---------------NAFE-------------------D-E--S----------FE
M5SF00          KVTR---------------NAFE-------------------N-E--S----------ME
A0A2G1WDS1      KVTR---------------NAFE-------------------N-E--S----------ME
Q7UVS9          KVTR---------------NAFE-------------------N-E--S----------ME
A0A5C6B601      SIMA---------------SVAQ-------------------D-P--A----------LT
A0A517PFU1      PLVA---------------RAVR-------------------E-R--R----------LD
A0A5B9M8J9      AISG---------------RVEL-------------------D-D--Q----------LR
A0A2A2WFP6      AIAG---------------RVHL-------------------S-E--Q----------LR
A0A518L8N2      AIAG---------------RVHL-------------------N-E--Q----------LR
A0A518HQN9      AIVG---------------RVAS-------------------N-P--E----------VK
A0A5M6D8H8      GIVS---------------RVAS-------------------H-H--E----------LK
A0A1G2ZG92      SLLN---------IKDRHGKTIR-------------------P-D--K----------LT
A0A2E7D3V4      LIVG---------------AAIE-------------------E-A--G----------LD
A0A5B9PER9      LMVE---------------QCLN-------------------D-DGGK----------LR
A0A517QSM4      YVLN---------------AALR-------------------D-P--E----------IS
A0A355GJI7      ------------------------------------------------------------
A0A1Z8MCI4      MVLE---------------SVLA-------------------Q-P--F----------IK
A0A517SYL7      MVLE---------------SVLA-------------------Q-P--F----------IK
A0A3L7P0L2      EVVR---------------IAYE-------------------K-Y--G----------LK
A0A6M5YVJ1      QTLA---------------AVLS-------------------S-P--A----------VQ
A0A832M9Q8      FVLQ---------------QAAR-------------------D-V--R----------LA
A0A7W0MCI8      DVLT---------------AALR-------------------K-L--D----------VS
A0A517SCC8      AICQ---------------RALD-------------------E-F--G----------LN
A0A358MY60      IVLD---------------DVVS-------------------K-A--D----------IQ
A0A517MNB1      MVLD---------------EVLA-------------------K-P--E----------IQ
A0A3A0DR44      VVLT---------------PALA-------------------D-P--E----------IA
A0A142YJ13      KVLE---------------AAIA-------------------P-P--A----------IA
A0A517Z7D3      DIVQ---------------RAMD-------------------K-F--G----------LR
A0A7X7KCE7      LVLG---------------PVVK-------------------R-P--E----------IA
A0A1N6KY57      LVLS---------------SALK-------------------Q-P--E----------VA
L0DK20          LVLG---------------TALK-------------------D-P--E----------VA
A0A517XRC2      DLIN---------------RTIA-------------------E-P--K----------VA
A0A6M5YH47      DLIT---------------KTLA-------------------E-P--A----------VS
A0A660UUK3      TVLN---------------RVAD-------------------E-L-------------SG
A0A517ZHG5      VVLD---------------TALS-------------------E-PVRNSELKRYGFKTIG
A0A1Z8MPL5      RVLN---------------TALN-------------------D-GLME----------LE
A0A7C1EH96      VILN---------------RVAD-------------------A-V--K----------DR
A0A5C1AGE3      TILT---------------RVVQ-------------------N-E--K----------LK
A0A2Z3HEL7      DLFN---------------RVLA-------------------D-P--A----------VS
A0A142XAP8      DVFT---------------RALA-------------------D-P--A----------VS
A0A6P2DEK1      DVLT---------------RVLA-------------------D-P--A----------VS
A0A5C6C1R5      FVLN---------------EALA-------------------V-P--E----------VR
A0A1G2YRE4      RVIQRVA------------DNLA-------------------N-R--N----------LS
A6BZU4          RIVG---------------EAVK-------------------E-A--K----------LN
A0A2D5GZ77      RIVG---------------EAVK-------------------E-A--K----------LN
A0A3D3R1Z6      RIVG---------------EAVK-------------------E-A--K----------LN
A0A517XG00      RIVG---------------EAVK-------------------E-A--K----------LN
A0A353Z859      IVLK---------------QVVR-------------------R-E--E----------VA
A0A2D6ST10      LVLM---------------AALR-------------------S-P--E----------LA
A0A177QX42      KILKGAVDPPIKDDASEEEKKHA-------------------K-E--A----------SL
A0A517SHR0      TIIKGAVDPTLPEGATDEEKLAS-------------------K-E--S----------GL
A0A2E0AW64      VTLE---------------PLLA-------------------D-K--E----------IA
A0A351FZ59      VTLE---------------PLLA-------------------D-K--E----------IA
A0A660V239      NVLN---------------QVAD-------------------E-L--A----------DM
A0A177Q3B7      LVLN---------------AVLK-------------------R-D--A----------IA
A0A2E0X6Y6      VVLR---------------RAIE-------------------R-L--A----------PE
A0A518GFD7      FVLN---------------AALR-------------------D-G--E----------LS
A0A518GE37      LVLD---------------PVLA-------------------D-P--A----------LK
A0A5C6F3H8      IVLV---------------PALA-------------------D-P--S----------LH
A0A5C5X072      IVLD---------------PVLA-------------------D-P--T----------LR
A0A5C5WUQ3      IVID---------------PVLA-------------------D-P--E----------IR
A0A5C6E697      IILD---------------PVLS-------------------D-P--E----------FR
A0A5C5Z1A3      IVID---------------PVLA-------------------D-P--D----------LR
A0A5C6D2P7      IVLD---------------PVLA-------------------D-P--E----------NR
A0A5B9ML17      IVLR---------------PVLS-------------------D-P--E----------LR
A0A5C5VZJ8      EVRN---------------GVLE-------------------D-S--A----------VK
A0A517LX75      LILN---------------DAIK-------------------V-G--R----------FD
A0A7X7YXL7      LEFF---------------SGKP-------------------S-T--P----------IE
A0A7W1FH76      PTLS---------------LAVQ-------------------N-D--I----------FH
A0A7C5W7B3      TLPA--------------TGQKA-------------------H-T--H----------LN
A0A7V2IPP1      RVVQRVADGLSDSARQFLIEAVT-------------------A-S--P----------VE
A0A142XL75      RTLN---------------NVIK-------------------V-P--A----------VE
A0A6P2D5D5      LTLN---------------NVIK-------------------E-P--A----------VD
A0A7C7T8W8      LILR---------------EVLL-------------------R-P--T----------VA
A0A5C6B3S0      FVLA---------------AALR-------------------K-K--D----------VM
A0A354GX32      PVLD---------------ATLK-------------------K-Q--E----------VG
A0A518GIZ9      MIAS---------------EAVR-------------------L-G--Q----------LD
A0A1C3EBY9      MIAS---------------EAVR-------------------L-G--K----------LD
D5SX64          MIAS---------------EAVR-------------------L-G--Q----------LD
A0A517Z0U7      FVLV---------------AALR-------------------E-P--G----------VH
A0A2S8FCC0      FVIN---------------AALR-------------------D-T--E----------VL
A0A1Z8MBT6      GVIQ---------------AVMG-------------------D-Q--T----------VC
A0A517SXN9      GVIQ---------------AVMG-------------------D-Q--T----------VC
A0A7X7F3C7      KVLE---------------GAVN-------------------H-L--E------------
A0A255QXF5      IVLS---------------SILA-------------------N-D--T----------LH
A0A518KYQ0      IVLS---------------QVIN-------------------N-P--E----------LQ
A0A5B9QX47      IVLD---------------PVLE-------------------D-A--S----------LR
M5T666          IVLD---------------PVLA-------------------D-P--S----------LR
M5U6N6          IVLD---------------PVLA-------------------D-P--Q----------LR
A0A517M0G2      LVLE---------------EVKN-------------------D-P--E----------VQ
A0A5C6AST1      LVLD---------------NVLT-------------------D-P--E----------IQ
A0A5C6C951      LVLD---------------SVLA-------------------D-A--E----------VQ
A0A5C6C5T3      IVLD---------------PVLA-------------------D-P--S----------LR
A0A2A2W6A9      IVLS---------------QVLD-------------------N-P--E----------FQ
A0A518HQS9      IVLS---------------QVID-------------------K-P--E----------LQ
A0A5M6DFE6      VVLD---------------PILQ-------------------D-P--E----------LR
A0A5C6F286      IVLD---------------PVLA-------------------D-S--S----------LH
A0A517NGN1      IVLD---------------PVLS-------------------D-P--D----------LR
M5RUI3          IILD---------------PVLA-------------------D-P--A----------LR
A0A5C1AAF0      AVIT---------------AALR-------------------N-P--E----------VN
A0A3B8ZJM2      ------------------------------------------------------------
A0A1U7CLW1      KVLE---------------AALN-------------------P-P--A----------IA
A0A5Q3LBQ3      LILG---------------PVVS-------------------K-P--E----------VA
A0A142WPR7      LVVR---------------KAVE-------------------T-H--D----------LR
A0A517T4K9      FVLN---------------AALR-------------------R-P--E----------VA
A0A7C6B2Q1      FVLV---------------AALR-------------------Q-P--E----------VA
A0A2Z3GZZ5      KIRL---------------AAAA-------------------K-A--R----------AA
A0A4V0I6L6      AILK---------------VAAE-------------------R-R--L----------DE
A0A7C4QQT3      MILN---------------KAVE-------------------I-G--K----------LM
A0A7V9G5K3      AVLG---------------EAVK-------------------T-D--A----------FG
A0A7W1JAD6      VVLG---------------EAVK-------------------T-E--A----------FN
A0A518KBI5      VVLR---------------EVLS-------------------D-Q--R----------VG
A0A5C5V6Q5      LVIR---------------EVLS-------------------E-A--S----------VG
A0A517P477      EVLT---------------AALR-------------------N-A--E----------VA
A0A518HFS8      KVLE---------------AALK-------------------K-S--G----------IG
A0A7Y5LUV4      GIAE---------------AS-----------------------V--A----------AL
A0A3M1TFJ0      SVI---------------------------------------------------------
A0A7Y5HGA4      RVPG---------------GAGG-------------------A-A--V----------GG
A0A517MY49      KVIQ---------------GA-----------------------I--E----------RL
A0A2E6AG00      VVLN---------------GAIX-------------------R-I--V----------EM
A0A1G3A880      VVLQ---------------GA-----------------------I--A----------RL
A0A2E8ATT1      VILN---------------GATQ-------------------R-L--A----------RL
A0A524HC32      ------------------------------------------------------------
A0A660VT66      ------------------------------------------------------------
A0A7C2ZTD2      -----------------------------------------------------------M
A0A0S8H0S8      ------------------------------------------------------------
A0A7C2VEF7      ------------------------------------------------------------
A0A7V7D6N0      ------------------------------------------MDN-------------LF
M5S2L2          ------------------------------------------------------------
A0A7V1EK28      ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A7C2VXA0      ------------------------------------------------------------
A0A7C3AA48      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A7C5PFV3      ------------------------------------------------------------
A0A7C3QGD2      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A7Z9UC46      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A7C2ZUK5      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ------------------------------------------------------------
A0A7X8YY48      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
                                                                            

A0A523CME0      ------------------------------------------------------------
A0A7Y3UKB3      ------------------------------------------------------------
A0A7C2JY73      ------------------------------------------------------------
A0A836W298      ------------------------------------------------------------
A0A354PCV3      ------------------------------------------------------------
A0A354PHB4      ------------------------------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A538RV31      ------------------------------------------------------------
A0A1G2XSU7      ------------------------------------------------------------
A0A350KD81      -------------------------------GQTRGQAANGNTSE---------------
A0A356AE44      -------------------------------ISSRLSTLKAAIERGESHEALMLLVKTFL
A0A7Z9UBD9      ------------------------------------------------------------
A0A257WQ92      ------------------------------------------------------------
A0A2E3Z6T8      ------------------------------------------------------------
A0A7Y2AF64      ------------------------------------------------------------
A0A7C1U6X6      ------------------------------------------------------------
A0A7C7UXI5      ------------------------------------------------------------
A0A7C3SFJ0      ------------------------------------------------------------
A0A7X7YIF4      ------------------------------------------------------------
A0A7C7WWF7      ------------------------------------------------------------
A0A7V3JIB0      ------------------------------------------------------------
A0A356ETW1      ------------------------------------------------------------
A0A3L7NJY1      ------------------------------------------------------------
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      -------------------------------YLSKLTVQMTGNSD--------IISISFT
A0A177PV03      -----------------------------------------------------VLYLSFR
A0A1G2YIM0      TKNVAMVGRDPFTFLRDAA------------SNGRLIIEPAKKSE--------LIRIVMS
A0A1G3A0W0      QTQW--YKNPRSSLMQRFYGNKA-----PPLERLRDTLSVRPRQRT------EIIDVDFV
A0A7V7D8F5      DKNLAYFENEPTGLVTKLKQTLKNTKAKPESASILKQAISNGVISAASDRRTEFIKITMQ
A0A432MFP3      SQSGVREAPDA-------------EQYLREMIKVAARPNT------------SLIEVAAE
A0A518HFL0      KLPSVIQSEDA-------------VGYIREAIKVSPLPGG------------SLIEVSAE
A0A3L7UX05      QLPELKNSASPEYVMDKKINVIDRVNS-------------------------ELIEVQMV
A0A2E0SHG0      EDGKPVNLLTCPSLLEEVKEGETVVDYVIQHLFLSTQGEEGNVAVSGG----HWIYATFE
A0A2S8F9B8      NLPVVRENENP-------------LEWLQEALVVSFPGDA------------EILQVSLT
A0A368KP63      NLPVIAENENP-------------LEWLQKELQVRFPGDA------------EILQVSMS
A0A518CQB8      EDGTPINMMNLPSIMEELADDQNPIDYVIDNLYLSLQGEEGNIAVNGG----HWIYVTFE
A0A7C4QPD3      EPPLTVADLPF-------------FAKGDDQLRVALLSDALRVTSPAE----EFIRVELT
A0A7C2JZW2      KTKYARESIDI-------------LEQ---------INQDLVVSSPAQ----EFIRIELR
A0A836RF42      EKKIESGEFAT-------------QDS---------AAADAELLPLLQ----EEQRLLER
A0A7D8YCU5      EYPG---APGNLASMASWIRSRL----------GVSSPRDHSTRNQ------TIVQVHVE
A0A353BE27      EQPE--FVGLASEDIVSALQDVG---------SPLVIEPADKDDQT------TLIRIAYV
A0A5C6BPW1      KYGF--KTIGDLPLLKGQTFEID--------WLEARLSASGRDEEF------FAIKMEYS
A0A1I3GSP0      EIPALANAYDPLREVTEGLSVSR--------------SAGQESSFD------NVLSITYL
A0A517QJV1      SVPALATAYDPYKNIREGMAVSR--------------SAGQENSFD------NVFDISFD
A0A3C1QS25      SIAG-----LSPEMKLFQIQEGL--------------EVDLEKDSE------NLYLVSFS
A0A5C6FX55      QYHE--SLDEGDGPWARFVEMVK----KDEVLELEPEVSDVKTAQS------VVALLHFD
A0A5C6DS51      ATETIRQVLSEDGNPIDYIIEQM----------EVGRGGEGAAENA------MVLSASFR
A0A5C6DSL6      KIASIGTVLADGGSPIDYIVEQM----------EVGRGGEGSAENA------MVLSATYR
A0A3M1VG27      RLPSLATKKDPVAAIITELKAKR--------------VAGTDQSFL------NIIELTYS
A0A518GC22      EQSE--FLGMQTDEVVATLMDEE---------SPLIIEPADKDDST------TLIEISYI
A0A3L7Q373      NFAG--AYDPLKAVWEDLQVKRV---------------AGQESSFD------NILSIAYQ
A0A3E0PW54      ELPA---FQKSKDPVMDIIDSLT-----------VKRSAGSDQSFV------NLIDISYL
A0A7C3TAH2      WLKNWIASLQGPMTPMDRLKDAI----------SSGDISAQARRGS------ELIVVTMV
A0A1Z8MHR4      QSPS--MRGRSEAQVVSAIRGSV---------RFHTITAVKDSRDR------MIVGLNYQ
A0A5C6EHJ0      TTPE--FAGYSSEQIAAVVGGLD-----------LVVGSADENIDS------SVFQIRYD
A0A5C6F1H9      TAPE--FAGMAPEQIAAAIGDAS-----------LSIGSAGSSIGS------SVFQIQFN
A0A255QXY0      EVAA--VRGLTDREVMRLVRQRI---------RFDSVTDLKDSHDR------LIAVLSFE
A0A517SYI0      QSPS--MRGRSEAQVVSAIRGSV---------RFHTITAVKDSRDR------MIVGLNYQ
A0A518HX54      SIPA--LRELTNDQFIALVRRGI---------RFQTITDLKDSRDR------LIAAVHFD
A0A5B9MF59      SIPS--LQSNTDQQIVSMVRGGI---------RFQTLTDQSDSRDR------MIAALNFD
A0A2A2WC24      SIPS--LESSSETQIVSMVRSGI---------RFQTLTDQGDSRDR------MIAALNFD
A0A518KYW8      SIPS--LESSTETQIVSLVRSGI---------RFQTLTDQSDSRDR------MIAALNFD
A0A5C5YZZ0      AFEE---TPADVGALIALIRKNL---------RLQAPFDGAESRDR------TMVEVTFE
A0A518JLD2      ESAE--FAGLGPEQIAGLMGGRA------------LTIGPATEESN------SVFRVQFV
A0A5M6DJ15      RLSLIRSKPDPEQWLAE---------------ELQVDFPGRSELMA------VSLSADDA
A0A3L7P7S7      APTG--TVSATVNRFQGKEIQDLIDYLRAGVGIIKAKEAGSTTASN------NVLKVSFQ
A0A517N8M1      PFHK--QFENESKAFTSQALRSM---------ELEPEVDDVRTAQS------VVALLHFE
A0A5C6CW01      PLQE--RFGGDPTRYNGTARGGL---------SLTVEGTGGRVAQS------FVAVLSFE
A0A5C6BXS9      IFRD--RFQNRSGSFAGMSASAL---------KFHTDLQDARSASS------LVATLSFE
M5U569          AFRA--KFNDDPRAFAGMSSKAL---------QFSPDVQGTRSASS------LVATLAFE
L7CND7          VFQE--SLGGRPSGLAGLAFESL---------KFETDIEDARSASS------LVATLTFD
A0A0J1B8S4      VFRE--QFHGSPVELAALASKML---------EFETDLKDERSASS------LVAQMTFE
F2ARR3          PFRD--RFENNPNLFAGLANGAL---------EFETDLQGVRGASS------IVANMTFE
K5D8H6          PFRD--RFENNANLFAGLANGAL---------EFETDLQGVRGASS------IVANMTFE
M2AKU0          PFRD--RFENNANLFAGLANGAL---------EFETDLQGVRGASS------IVANMTFE
A0A5B1CRW9      QFKSFAQIARNGGSAVDHIIQNI---------EVERG-GEGSAQDA------MVLRVFYR
A0A5C6EI46      ELDTFRKARENDQSLVDHILENI---------EVERG-GEGAAADA------MVLRVFYH
A0A5B1CKI2      PFQE--EFEGRVGAFVEESLESL---------ELEPEVEDVKTAQS------VVTLMHFE
A0A5C6EG84      PFQV--EFESNLREFNEVAIKSL---------ELEPEVDDLRTAQS------VVALLHFE
A0A5C6F2X4      PFQS--EFESHQAMFNDIALNSL---------ELEPEVDDLRTAQS------VVALLHFE
A0A7W5DXF4      PFRD--RIESNPRGFASSITSGL---------QFSVDSQGGRSASS------MVAVLTFQ
A0A5C5XTV6      IFQD--QFSG-PGAFGGMSAGAL---------RFQTDLQDGRMASS------LVATLSFH
A0A5C6AAB1      VFRG--QFENQPGVFGGTASKSL---------KFNTDLQDVRSGSS------LVASMSFE
M5T8W8          VFRS--KFGDNPAGFAGASGEAL---------QFNADVQDTRSASS------LVATLAFE
M5SF00          VFRE--SLGGHPSALLGLANKAL---------KFETDIQDARSASS------LVASLSFE
A0A2G1WDS1      VFRE--SLGGHPSALLGLANKAL---------KFETDIQDARSASS------LVASLTFE
Q7UVS9          VFRE--SLGGHPSALLGLANNAL---------KFETNIQDARSASS------LVASLSFE
A0A5C6B601      LLPS--MTGKSVAQIAATIRSGV---------RFQTITNAADSRDR------MIASLSFE
A0A517PFU1      ELPA--FKGAGSP--VGRILKGL---------EGGQVPGTR------------VLQLTYS
A0A5B9M8J9      SIPK--LRDLSDDQFVALVRGGI---------RFQTMTDLKDSRDR------MIAALHFD
A0A2A2WFP6      SIPA--LRELTDDQFVALVRRGI---------QFQTITDLKDSRDR------LIAAVHFD
A0A518L8N2      SIPA--LRELTNDQFIAMVRGGI---------QFQTITDLKDSRDR------LIAAVHFD
A0A518HQN9      SIPS--LESSTEKQIAAMVRSGI---------HFQTLTDQSDSRDR------MIAALNFD
A0A5M6D8H8      SIPS--MQGKDAKSVASMIRKGI---------KFQTLTDVSDSRDR------MIAALHFD
A0A1G2ZG92      E-LSLISKLKNKVL-----------------PRPYIEVNQYKDAD--------MLEIAAY
A0A2E7D3V4      G-LPSMLTSGDPEED----------------IVDGLKVERSAGHDRSLLN---VLDITYK
A0A5B9PER9      LLNSFDEIPKDDIAEY---------------VINNLVVTPDPEAPY-------IYEIRYT
A0A517QSM4      N-LPTLKEQQHPTDW----------------LEKNLKVTSPASE---------FFRLELE
A0A355GJI7      ------------------------------------------------------------
A0A1Z8MCI4      ELKPTTDGGPRNLAY----------------LVENVALTSKGAQG--------RYAISFI
A0A517SYL7      ELKPTTDGGPRNLAY----------------LVENVALTSKGAQG--------RYAISFI
A0A3L7P0L2      E---IFGNDKDPLKS----------------IWENLVVVRESGQETSFDN---ILNISFT
A0A6M5YVJ1      Q-LGVIQKQPNPQDW----------------LSDALKVDTKGGE---------LMVVSIE
A0A832M9Q8      R-HEHFRNEADQEGY----------------LAKSIDASPVASAQ--------TINVIMT
A0A7W0MCI8      A-MKTFVGIQNPVEW----------------LAENVSVRRAGDE---------FFTISLS
A0A517SCC8      K-LPAFEGADDAAKE----------------ISERLTVKRTSGQDSSFDN---LIDITYL
A0A358MY60      A-V-GFSDPVQSVNT----------------IRDGLGIETAGTQT--------LLRITYA
A0A517MNB1      S-LPAFADTQLAKDT----------------MRKYMRVSGAGSAS---------LTISYQ
A0A3A0DR44      K-IPEIKRQVAPLEF----------------LEETLKVSGEGGSE--------LYRIEYV
A0A142YJ13      A-LPIVRNSVDPIEW----------------LSQQVQVEFPRGSE--------ILSISIT
A0A517Z7D3      E-LPAFKTAYDPLMD----------------VLDSLSAQRSAGRDSSFVN---LIDLKYA
A0A7X7KCE7      Q-SPKIAAQTDKVSW----------------LAKQIRVTSVGNSE--------LFRILYA
A0A1N6KY57      K-LPILTKVSDPIEW----------------LENELKVDFAPGSE--------ILRISIS
L0DK20          K-LEVITKAVDPIEW----------------LEKELQVDFASGSE--------ILRISIN
A0A517XRC2      S-LQTIREADDPVAL----------------LETGVRVDGSIAPD--------LMQVSFN
A0A6M5YH47      S-LDSVKQTPDPVSI----------------VEDQIKVT-VVADD--------ILQVTLT
A0A660UUK3      KKLTLLEGSVDPVLTLRQAA-----------NNGGIEIATQRHSE--------LITIKMI
A0A517ZHG5      D-LPLIKAQAFPIDW----------------LEARLSASGRQEE---------FFAIKME
A0A1Z8MPL5      YIKEAQEDGIDPIDY----------------LANVLIIEVPDSEKEMKGYGGQILRISMR
A0A7C1EH96      R-LAFFEPGQNLLQA----------------LRSMVSKGDIEVIPDRQ---TEFLHVRMK
A0A5C1AGE3      D-TQLVKTSDDPAKV----------------IEDMLRLRWEAPD---------LMAVTMN
A0A2Z3HEL7      S-LALVKTADDPVAM----------------LEDAVRVSVAAPE---------MLEVTLT
A0A142XAP8      S-LDTVKQSEDPVAM----------------LEDTIRVAVAAPE---------ILEVTLT
A0A6P2DEK1      S-LDTIKQSEDPVSM----------------LEDTIRVTVAAPE---------ILEVTLT
A0A5C6C1R5      D-LPEIKEKPSPLQW----------------LSESLRVEFPGKGE--------VMTIALE
A0A1G2YRE4      FFEAESTDLAGKMKQKLTGDNTKLDAVTK--LKRAISSGVISAKAVRN---TELLKLTMV
A6BZU4          Q-LSTLAGEKDPTQD----------------IIDSLKVKRISGNDRAF---LNILTLTYE
A0A2D5GZ77      Q-LSTLAGEKDPTQD----------------IIDSLKVKRISGNDRAF---LNILTLTYE
A0A3D3R1Z6      Q-LSTLAGEKDPTQD----------------IIDSLKVKRISGNDRAF---LNILTLTYE
A0A517XG00      Q-LSTLAGEKDPTQD----------------IIDSLKVKRISGNDRAF---LNILTLTYE
A0A353Z859      K-LPTITDQEDPLIF----------------FEKNMRVTNPATE---------FLQMSLT
A0A2D6ST10      GLSEWTDPGQNTQEW----------------LEENLEVSSRASE---------FISISLS
A0A177QX42      SRLASLAASSNPA--AT--------------IATGLRVIRSEVSE-------DVLEISYV
A0A517SHR0      LKLPTLAGQSKPSVIST--------------IAGGMRVQRSEVSE-------DVLEISYS
A0A2E0AW64      T-IPDLVEADDPIAE----------------LKRNLSIKSAYRDS-------NQWYLTYR
A0A351FZ59      T-IPDLVEADDPIAE----------------LKRNLSIKSAYRDS-------NQWYLTYR
A0A660V239      D-IVFFRDTGDLVLALREAI-----------LDGVIIIEPERNTE--------LIKIKMT
A0A177Q3B7      SLAILPRDPEKQIAW----------------LQAELKVDYKTGPE--------FMRLSLT
A0A2E0X6Y6      DRIDLVDEAPHEWIDR---------------LAALSSSSVTRRTN--------LIDVKFR
A0A518GFD7      S-LPIIAQHDDPVSW----------------LQEKLEVTFPGDGE--------VMQVTLE
A0A518GE37      K-APSLSNPLTAERQ----------------IRKRLSIGNAGTDN--------LLTISYR
A0A5C6F3H8      D-VPSLSNPATAEAH----------------LRSNLTIKSGGDPK--------SLEIRYE
A0A5C5X072      S-APSLSDPNSAEGK----------------LRKNLSISSGGTDS--------RLVVSYT
A0A5C5WUQ3      R-APSLADPDTAEVN----------------LRKNLTVGNGGTRA--------RLVVSYE
A0A5C6E697      I-APSLSDPGKAEAA----------------MRKNLTVASAGTAA--------RLIVSYE
A0A5C5Z1A3      R-APSLSDPDTAEVN----------------LRKNLKISSDGTPT--------QLLVSYE
A0A5C6D2P7      M-APSLSDPESAEQS----------------LQRNLSVASGGTST--------RLVVSYK
A0A5B9ML17      A-APSLSDPEEAERN----------------IRKNLNISHGGSRA--------RMIVSYE
A0A5C5VZJ8      GLSWFAARPLTFWDRLISADPVEQR------FDDDVNVIVPPGKQ--------LIEVSIS
A0A517LX75      ELESYIEARREGTSALSL-------------LQKNLLVERGGEGDARG---ASVLNASYR
A0A7X7YXL7      RLLARILPQDANDAPDVI-------------LRKAIVAGKIQAAHVRD---TQMMAVVMR
A0A7W1FH76      R-SPPYAGHPDPVGV----------------LRQRLDLNVSRESA--------AITVTLR
A0A7C5W7B3      AWLEGAENRPEHLPEVDEAAAEKLQALTPSHILSLVSVTPDTENV--------AVEINGW
A0A7V2IPP1      RLKDELRGQSATVEPAALLRAAI--------RNDMITVQAMRRTE--------LIKVAMK
A0A142XL75      N-LAIVRKSPNPVAW----------------LDHAIKIDAPANSE--------YMRVSLE
A0A6P2D5D5      N-LATVRKQPDPIAW----------------LEHAIKIDAPVNSE--------YMRVSLE
A0A7C7T8W8      K-LPEIQKTISPLEL----------------IEKSLTVKSVGGSE--------LYTIAYN
A0A5C6B3S0      E-SRVIQSQIDPAEW----------------LKANLGVGFPGEAE--------IMQVSLA
A0A354GX32      DLSEIKAQGEGRVAW----------------MKSAALVDDKTGLQ--------VLRLSLS
A0A518GIZ9      K-LQTFAGESDPTQM----------------VLDDLKVKRVAGQDRSY---LNVLDVTFQ
A0A1C3EBY9      K-LKTFAGESDPTQM----------------VLDDLKVKRVAGQDRSY---LNVLDVTFQ
D5SX64          K-LKTFAGESDPTQM----------------VLDDLKVKRVAGQDRSY---LNVLDVTFQ
A0A517Z0U7      Q-CPTIREQRDPEAW----------------LEDAIEVSAVG-EQ--------FMRISLT
A0A2S8FCC0      R-LPMVEQEPDPVAW----------------LQSALSVNFPDNAE--------IMEVRLS
A0A1Z8MBT6      K-APSLADPTTRETN----------------LRKNLSVAGAGTKD--------KMMIKYT
A0A517SXN9      K-APSLADPTTRETN----------------LRKNLSVAGAGTKD--------KMMIKYT
A0A7X7F3C7      --PEDRVDFEGIENDKWVGA-----------MQQNLVVRPVRGAN--------FIELSYF
A0A255QXF5      Q--FSLADPESREQH----------------LKQRLKIHGGGTKS--------TMVVTYT
A0A518KYQ0      AFSLNDPDPDVREQA----------------LLSNLTIGNSGTRS--------TLSISYR
A0A5B9QX47      K-APSLSDPLIAEQN----------------LRRNISISSGGAAT--------RMVVSYT
M5T666          N-VPTLVDPATAEAN----------------LRKNLSVSSGGTES--------RLVVSYT
M5U6N6          S-APSLSDAETAEAQ----------------LRENLSVSSGGTEA--------RLVVGYT
A0A517M0G2      AFYGSETPLNVGQ------------------LRSSVGLSNAGSST--------LLSIQFE
A0A5C6AST1      A-TGHFVNMDDAKHS----------------LRKNLGIGNAGTNS--------LLSISFK
A0A5C6C951      A-TGLFQNSEAAKNA----------------LRAGLSIGNAGVDS--------LLTISFK
A0A5C6C5T3      T-APSLSNPETAEAN----------------LRKNLSIGSGGTDS--------RLVVSYT
A0A2A2W6A9      AFSLQDPDPDVRDQK----------------LRSSLSIGSAGSRS--------TLTVSYT
A0A518HQS9      AYGLQDPDPDVREQT----------------LISNLSIRGGGTRS--------AMSISYI
A0A5M6DFE6      N-APSLSDPEQAEQN----------------LRDNLSIRSAGSKS--------RMEVSYT
A0A5C6F286      D-VPSLSDPATAEAN----------------LRANLKIKGGGDPK--------SLEVRYQ
A0A517NGN1      S-APSLSDPETAEAQ----------------LRKNLSVQSAGAKT--------QMLVSYE
M5RUI3          K-APSLADPEYAEVS----------------LRENLKVTSGGNRR--------HLVVSYE
A0A5C1AAF0      K-TELISQQADPVDW----------------LAKELMVDYPSGDE--------IVRISLV
A0A3B8ZJM2      -----------------------------------------TITD--------QLKISYI
A0A1U7CLW1      S-LPTVRKLLDPIDW----------------LSGVLMVDFPRGSE--------ILSISMT
A0A5Q3LBQ3      Q-MPEILQEEAPIEW----------------LSERIHVKSVGDSE--------LFEVRFE
A0A142WPR7      K-HPAFAGESDPASRI---------------VRGLNVLADSKTPD--------VIRMSFR
A0A517T4K9      R-LTTVRGENHPVD-----------------WLEQEVEVSSPATE--------FIRISLR
A0A7C6B2Q1      R-LPSIQEQLDPVQW----------------VAQNLNVRFPGNSE--------FMNVSFS
A0A2Z3GZZ5      G-GAGLPADDRAVADMIGTGLTV--------VRDKDSAGPTIGSG--------VLNLTLR
A0A4V0I6L6      Q-KPFQNPPPDGVAERVAYMKARFA------VARVKEAGSNTPSN--------VLQLSFK
A0A7C4QQT3      E-LPAFRESEDIVEDLLDGL-----------QVKRSSGQDRSHTN--------VLNISYS
A0A7V9G5K3      G-DEVYTASRDRVAT----------------LSHRIKVTTSRDTW--------IIAVALT
A0A7W1JAD6      G-DEVYTKSRDRVAT----------------LSHRVTATTSRDTW--------IISVALK
A0A518KBI5      A-ASHLNKTPDRLSH----------------LRKNLQIKQVGGSE--------LYEVSYS
A0A5C5V6Q5      K-AEHLVAKPDKLKH----------------IKENLSIRQIGGSE--------LYDVSYT
A0A517P477      N-TPTLQEVPDPVV-----------------HLQKHLSVGSPGAE--------FISVGLS
A0A518HFS8      S-LEMVRSRTDPVA-----------------WLRERLRTEFGNSE--------ILTISMS
A0A7Y5LUV4      P-PALKDRFAGPGGTGE--------------FARTVDLEQVRASF--------ILKVGFP
A0A3M1TFJ0      A-RQLAEDIGSEDPNALAMA-----------FLAGVDVHPEETTY--------VVDVTYT
A0A7Y5HGA4      A-EGASAGPSGAPREPPLPSPDLLRSLTPGEVRRMISIAPIPPTS--------YCTVTAQ
A0A517MY49      P-QKYRGDLKNKASKDWVSA-----------ISANLSTSITRKTN--------FIDVRYR
A0A2E6AG00      P-TDLQCDLKNYPREDWVRX-----------LREQXTVRSFRSTH--------IIEIRYR
A0A1G3A880      G-PQHQVDFRGQPRDQWIEI-----------LEDNLTAVAIRRTN--------IIRVSYQ
A0A2E8ATT1      P-AALRVDFLSVPRDKWIDV-----------LRANVSARSVRNTN--------IIELSCR
A0A524HC32      ------MPGDKDKTDAVVSRELLKQQKLFDYMAENLQASPSRKSM--------LIEVSFT
A0A660VT66      ------VCRSLRERGKLSPD-----LATPDDLLDAVEVQPRPRSR--------IVELSVY
A0A7C2ZTD2      SFFENKAINPAAKLKRAISD-------------DIITAAPANRTE--------LIKVVVK
A0A0S8H0S8      -----VLQAALERCGGAGLKILQGRPNPVAYLKEALKIEAGKKDD--------IICVSLD
A0A7C2VEF7      ---------------------------------------VGKKDD--------IISVAFD
A0A7V7D6N0      DYIKDKLSIPVDKKDDVIID------NLLIYLKKELDVAIGKKDD--------IISVSFD
M5S2L2          ------------------------------------------------------------
A0A7V1EK28      ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A7C2VXA0      ------------------------------------------------------------
A0A7C3AA48      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A7C5PFV3      ------------------------------------------------------------
A0A7C3QGD2      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A7Z9UC46      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A7C2ZUK5      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ------------------------------------------------------------
A0A7X8YY48      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
                                                                            

A0A523CME0      --------------------------------------MSKIEG-------ALRKSKTEL
A0A7Y3UKB3      --------------------------------------MSKIEG-------ALRKSKTEL
A0A7C2JY73      ------EVKLVRESIATAMDFYRRQGIRLPEERVAAGELTFAPQ-------DFVALYLSS
A0A836W298      ---------QMAKQKL--------------------------------------------
A0A354PCV3      ---------RINQTLS--------------------------------------------
A0A354PHB4      ---------RINQTLS--------------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A538RV31      ------REKQGKDGER--------------------------------------------
A0A1G2XSU7      ---------------------------------------------------MVQTTTSNV
A0A350KD81      ------------------------GQIASPGTSQVDRARTALETHLMPLLIQKNRLERDF
A0A356AE44      QKDQTSNSQTVVSGATERQQ-------------------------------LDTQLIPLL
A0A7Z9UBD9      ------------------------------------------------------------
A0A257WQ92      -----------------------------------------SLQWKAPVGSAAADGQTTT
A0A2E3Z6T8      ------------------------------------------------------------
A0A7Y2AF64      ------------------------------------------------------------
A0A7C1U6X6      ------DAVVIANAVLDQYM----KYVDETASGQKKDEDRKRDELFLKLQTEISDLEFII
A0A7C7UXI5      --------------------------------------------------LVIRDAQDGL
A0A7C3SFJ0      -------------------------------------KRKTTQYEQLANELGAPDSEAMR
A0A7X7YIF4      ------DAEKIINAFLDSYI----EVYNMEEAKGGGQTMTILEDQRQTLLVKMDQQRDAV
A0A7C7WWF7      -------------------------YNIIQKENLYSKKRQLRVLKEQVGDLGISDDDDLV
A0A7V3JIB0      ----------------------------------------------MTISLTTADPRESA
A0A356ETW1      -------------------------------------------------MLPSGDGKEIL
A0A3L7NJY1      ------------------------------------------------DLVDTGDKTNSL
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      GTHPE-TLAKMCNMHAKKFL----ETHLELRFAASQDAVKWLQD-------QLVDKKLKV
A0A177PV03      GTNRD-DCQVILDAIMQKYD----TYLKSKYERLNDKTVREVLN-------IIKELKKGM
A0A1G2YIM0      SKNPR-EGEQVVNAIIRAYM----AVEVSNSVRGGDEKLSVLED-------EYRTLTDKL
A0A1G3A0W0      DPSAN-EAKLIVDTVLEQYI----RYIAEMSNENEEELYRQLSE-------RHTSLRSEI
A0A7V7D8F5      SMNAS-EAKQIVDAFISAYM----AVEGDSSIEYEGQKLTALVE-------EQRVQARNL
A0A432MFP3      AERAH-EAADVVNAVVRSYL----DANKEWSEARTNNAIRMLVE-------YEKELGDKV
A0A518HFL0      SRLRH-EAATIVNAVVDAFL----KEDATWADARNRGSIVRLES-------YREELEAEI
A0A3L7UX05      GTSPQ-NATDIVNAVVRSYL----KQAGRWANETTTAQIGKLTR-------ELERRNKEV
A0A2E0SHG0      HTNKE-DTPRVLQAILNAYQ----DHVEETYRNPVNDAAENIRA-------DFKKAEEEW
A0A2S8F9B8      NADRQ-AAMKLVNAVVGAYK----DEVIESERLARVQRLENLER-------VYNETETKA
A0A368KP63      SADPT-TAMKIVNAVVGAYQ----EEVIESERMARVRRLDNLER-------VYNETEAKA
A0A518CQB8      HTNEA-DTPRVLKAILAAYQ----EHITETYQNPVNEAAQVIGG-------VANKAREEW
A0A7C4QPD3      SPHKE-EVDDIVNAVINAFV----REVVAKEVQERKLALAELQR-------LHDAEAEQL
A0A7C2JZW2      GPDPK-ELNVLLKAIVDSFQ----VEVIDREQAARKDRLDGLRK-------LLTEEEDRL
A0A836RF42      YGENH-PDVISVRKRIELTR----AVLSQTRKETQLSKLTQERA-------SLNEELTKL
A0A7D8YCU5      SPNPD-LSGAVINAVVASYA----SHLGGRHRKTISDLVDFFQE-------ARDTVLPQL
A0A353BE27      SEDAE-TAAKVVHAVVEGYE----KYLADEYKTVGEEIAQLMEG-------AHADLTKRM
A0A5C6BPW1      EKPEE-LAEIVNAITQVYYR----DIANETKLNDKKRITKLVEL-------SVDYEQQTK
A0A1I3GSP0      HPDKR-IARAVVQAMVEAYR----DYLEDTRDENAQQLYKSLLE-------RQQQLENDV
A0A517QJV1      HPDKE-IAKTVVQAIVESYR----DYLHETRDENSRQMYDTLLN-------RQKKLSDEI
A0A3C1QS25      SPNQE-DCDRVLWGVLNGYQ----EYLNRKYKATGQELKGILDD-------LKRNYDAKA
A0A5C6FX55      SPNPD-LSTAAVTAFSQSLQ----QYYNKKYSNSRDELKRFITE-------ATDKVQPQL
A0A5C6DS51      APHPD-DAAMILAAVYSSYQ----TYVESHSQNTSREAAELIEA-------ARVQNEMEL
A0A5C6DSL6      DPNPD-DAATILAAVFASYE----DYVESHSKNTSREAANLIEK-------AQNDNKKEL
A0A3M1VG27      NRYAQ-DAVAVLDAIVAAYS----QYLQESQKEHTNELLTLIHT-------ATVDLRKQL
A0A518GC22      SQDAE-VAAKVVSAIVDGYE----GYLAEEYKTVGIEIEQLISG-------ARDQLSNRL
A0A3L7Q373      SKDPK-LAKQVVESIVAAYG----DWLEAQKDNNARDLYETKLT-------QKNALDEER
A0A3E0PW54      HPDKN-AAGAVVRGLVAAYE----DYLEAKQDSNSQELRESLAR-------RQTELAEEI
A0A7C3TAH2      STKPD-EARQIVDSLIRNYM----AVSAYRDTLKEEADLRLLEN-------HRKELTERL
A0A1Z8MHR4      SQDPY-ACVAAINGFYSAIR----QHFDAERQATIKEIENLVNN-------ARNKLLPDQ
A0A5C6EHJ0      STSAT-TTQRVVQSIVDAYA----SHLQDQYRNIGQETIDLIQT-------ARNDVLTKL
A0A5C6F1H9      STSPS-TSQRVVQAVTDAYA----SHLKEQFRNVGQETIDLIQT-------ARNDVLAKL
A0A255QXY0      HDDPQ-VCEAAVDAVSRAIG----AHFQEERESTINEFTRLINK-------AQDKLLPQQ
A0A517SYI0      SQDPY-ACVAAINGFYSAIR----QHFDAERQATIKEIENLVNN-------ARNKLLPDQ
A0A518HX54      GHDPE-VCVAAVNAVSDAIR----SHFQEERELRVNEFEQLVSQ-------AQEKLLPQQ
A0A5B9MF59      GRDPQ-VCVAAVKAVSQAIS----EHFERERQSTINEVGELVRN-------AMDKLIREQ
A0A2A2WC24      GRDPQ-VCVATVNAVSQAIS----QHFERERQSTINEVGELVRN-------AMDKLIREQ
A0A518KYW8      GRDPQ-VCVATVNAVSQAIS----QHFERERQSTINEVGELVRN-------AMDKLIREQ
A0A5C5YZZ0      SGDAT-VATAIVNAVVEAYN----EYVNGRHRRNIENVVEFFRE-------GRDSILPKL
A0A518JLD2      SDSPV-ISKLVVQALVDAYG----LHLQDQYRNVSQETLDLIES-------AQKDVSKKL
A0A5M6DJ15      KAAAV-VLDAVVQAYMSEVA----NGERKQRDSRLKELREIYDE-------RSEAIRRER
A0A3L7P7S7      SGSST-ECVQALKAVIKGYK----NYLDKEYNLADDQFMTRLER-------SSTVARREA
A0A517N8M1      SENRE-LCQPVVQAFSESLQ----AFYNENYKSSRGDLIKLIST-------GMEQLHPKM
A0A5C6CW01      HSDAE-LCEASVKAFSDAMQ----TFFNERQKSSRSELLQLISV-------AIEQLHPKM
A0A5C6BXS9      GTDPD-LCEAAVKSFSSSLQ----KMFAEKHKTSRSELMRLITV-------ATDQLQPKM
M5U569          SSDRE-LCLGAVKAYSSALQ----RLFAEKHKSSRTELLRLITL-------ATDQLQPKM
L7CND7          HSDPE-LCEAAVKAYSAAVQ----QLFSEKHKSSRGELLRLIED-------ATKVLQPKL
A0A0J1B8S4      NTDPE-LCEAAIKAYSAALQ----KLFADKHKSSRSELLKLISI-------ATNQMQPKM
F2ARR3          HTDPE-LCEAAIRAFSSSFQ----QFFADRHKSSRSELMSLISV-------ATDQLQPKL
K5D8H6          HTDPE-LCEAAIRAFSASFQ----QFFADRHKSSRSELMSLISV-------ATDQLQPKL
M2AKU0          HTDPE-LCEAAIRAFSASFQ----QFFADRHKSSRSELMSLISV-------ATDQLQPKL
A0A5B1CRW9      AEEPE-EAALVLSAVYNSYK----AYIDSQDQDSSKLAVELIEA-------ARETHEREL
A0A5C6EI46      ASNPE-ESATVLAAVFQSYK----RYIDSQDQDNSKLAVELIEA-------ARETHEQEL
A0A5B1CKI2      SENEE-LCKAAVESFSESLQ----SFYNENYKSNRGDLIRLIST-------GMEQLHPKM
A0A5C6EG84      SDVEE-LCQPVVQSFSESLQ----AYYNENYKSNRGDLINLIAK-------GMEQLHPKM
A0A5C6F2X4      SDVEE-LCQPVVQSFSESLQ----DYYNENYKSNRGDLINLIAK-------GMEQLHPKM
A0A7W5DXF4      NHDPV-LCEQSVKAFSESLR----ELFAERHKSSRSELIRLINV-------GIDQLHPKM
A0A5C5XTV6      GADPD-LCEGAVEAYSAALQ----EMFAEKHRSSRGELIRLITV-------ATDQLQPKM
A0A5C6AAB1      HTDPE-LCEAAVKAYSAAIQ----QLFAEKHKSSRSELMRLISV-------ATDQLQPKM
M5T8W8          STDSE-LCVGAVKAYSAALQ----KLFAEKHKSSRTELLRLITM-------ATDQLQPKM
M5SF00          HSDPE-LCEAAVKAYSAALQ----QLFAEKHKSSRGELLRLIRD-------ATDNLQPKL
A0A2G1WDS1      HSDPE-LCEASVKAYSAALQ----QLFAEKHKSSRGELLRLIRD-------ATDNLQPKL
Q7UVS9          HSDPE-LCEAAVKAYSAALQ----QLFAEKHKSSRGELLRLIRD-------ATDNLQPKL
A0A5C6B601      GGDPA-LCVAAVNVMSAAIS----DHFDAERESQLDNLGKLVNQ-------AYNDLLPKY
A0A517PFU1      GGSPE-ETGAVLDAVVATFV----EEVREEGQSGIREAIRLISE-------ARDQVLRDL
A0A5B9M8J9      GNDPQ-VCVAAVNAVCDAIG----DHFQEEREQRVNEFEQLVSS-------AQEKLLPQQ
A0A2A2WFP6      GHDPE-VCVAAVNAVSDSIR----SHFQEERELRVNEFEQLVSQ-------AQEKLLPQQ
A0A518L8N2      GHDPE-VCVAAVNAVSDSIR----SHFQEERELRVNEFEQLVSQ-------AQEKLLPQQ
A0A518HQN9      GRDPQ-LCVATVNAVSQAIS----QHFERERQSTINEVGELVRN-------AMDKLIREQ
A0A5M6D8H8      GPDPQ-VCVAVVNAASEAIG----EHFEAERESTINEFSRLIDD-------AQQKLLPQQ
A0A1G2ZG92      SPNPF-EAANMSNKLATLYI----EDRLERKREEYKAAKIFIKC-------QMKEVKEEY
A0A2E7D3V4      NRNKD-DARQILEAVVDAYE----AYLKNSQQEHNSETRELIDE-------ANVKLEAQL
A0A5B9PER9      SPDKS-DAPTVVNNLLQTYE----ETLIRQYETDKNLFVSELRK-------YQDNFNNRF
A0A517QSM4      GDRPK-DLAMIVNAVADAFL----TEVVNKERTSRQDRLRQLQG-------FYRDINEEL
A0A355GJI7      ---------------------------------------------------QKNRLERDF
A0A1Z8MCI4      DNDPV-AAKQLSDAIAESFM----AVRTLLDSTQISNVRESLRP-------AISEWESTV
A0A517SYL7      DNDPV-AAKQLSDAIAESFM----AVRTLLDSTQLSNVRESLRP-------AISEWESTV
A0A3L7P0L2      SADKV-EAKKVVSAVIDAYA----DWLEAKRGSGSQLLYKTLLD-------QKKMMDEER
A0A6M5YVJ1      GDNPE-ELFTILEALCRAYL----AEVDERDNGTRRRRIDKLEA-------TNRSYRADL
A0A832M9Q8      HEQPA-FAKDVVDSVIDAYL----GQRKALDDFSSLESLRILRG-------LRDTTIKSL
A0A7W0MCI8      GEEAK-EIADIVNAVAGSYM----SEVVEADVVKRRERLAELQK-------VIDGVEEDL
A0A517SCC8      YPDPN-VAKAVVEAIVKAYD----AYLKANLETNSAELFTNLTR-------QLKDAEQTI
A0A358MY60      DPDPN-IAALVCNEVAASFL----EQRERLDNRRVIDLESWLTP-------SIDLWKAEV
A0A517MNB1      DPDPQ-HAALICNEIVEAYL----ARREQFDNERVANLESWLSP-------SIDLWKEEV
A0A3A0DR44      GENAK-DAATIVNGVIRVYL----GKLVADEKTRREEMLVQLEN-------VKLKREAEI
A0A142YJ13      ANGPPSDLSMLVNSVTEAYL----SQIVEQDRLERVARFERLKG-------LFSDYQKDL
A0A517Z7D3      HPDKD-VAKKVIAAMVAAYD----DYLEETRKTNSSELYEALTR-------REKDLQARI
A0A7X7KCE7      DPDPK-IAAGVVGAVTESYF----KLRDQTDAERNQRIIDLLGQ-------EKDRRLREV
A0A1N6KY57      AEKPD-LPMLLVNAVTQAYL----DEIVDVEMKQSRQRYDLLKS-------TWNRYQENL
L0DK20          GEKPH-EPMLLVNAVTQAYI----DEIVDVETKQRRQRYDLLKE-------TWNRYQENL
A0A517XRC2      GNNRD-DLVKIVDALVGKYV----DDANNAVRKNLMDKADRLEK-------LIGDLRAKV
A0A6M5YH47      GNNLD-DMKVVLDHLVKRYV----DDATAFDRGQRTSEVTKLEQ-------YAETLRTEI
A0A660UUK3      SRFPR-EAEQIVDAFIRSYM----NIVRAEEGRSDDNKLNILEE-------QKRTLDTKI
A0A517ZHG5      YSEKPEELAEIVNAITQVYY----RDIANESKLLDKKRIAMLIE-------LSDDYEQET
A0A1Z8MPL5      GDDPD-QLKQILEAVTDAYL----EEVVTEERAEWLKQKDVLQA-------QYLEKVDEL
A0A7C1EH96      TEHAA-DAEVLIDAFLRSYE----AVVRTDEIRAIDDRLARLEA-------QRRTLEEQM
A0A5C1AGE3      GDRPD-ELKEVLDVLVQTFK----AESSAKETERRRAQKDILVK-------LREKYQKDI
A0A2Z3HEL7      GNHLD-DMKVLLDRLIKRYL----DDTNAFDNRSRTEEREHLRN-------RRSEVQNEI
A0A142XAP8      GNNIE-DMKVILDHVVRRYV----DDATVLDRKQRDDQSAALQA-------TLTSIEKKL
A0A6P2DEK1      GNNIE-DMKVILDHVVRRYV----DDATAIDRKQRDDQIAALET-------TLTSIEREL
A0A5C6C1R5      TEDPK-ASTIIVDAVVKAYM----NEAVLDERNERMQRVNSLEE-------VYAEAEGKV
A0A1G2YRE4      SKKSE-EAQQIINAFINAYM----AVEVSSSSEEQDRKLNLLDA-------ERKLLEDKL
A6BZU4          NPNAK-DARLVTQAVVDAYK----RYLHEVREENTEDIIQQLKQ-------AEKQIATEL
A0A2D5GZ77      NPNAK-DARVVTQAIVDAYK----RYLHEVREENTEDIIQQLKQ-------AEKQIATEL
A0A3D3R1Z6      NPNAK-DARVVTQAIVDAYK----RYLHEVREENTEDIIQQLKQ-------AEKQIATEL
A0A517XG00      NPNAK-DARLVTQAVVDAYK----RYLHEVREENTEDIIQQLKQ-------AEKQIATEL
A0A353Z859      GNNPA-DLAPILNAVVEVFL----REVAQREAQERTKIVNSIDA-------AKADTRAKL
A0A2D6ST10      GERPT-ELKDTVNAVMGAYL----QEEVAGAAAARRERLTKLEN-------LFAKRRAEL
A0A177QX42      GPNAG-DCKKILDSVLASYK----RWLESTQAGNRKVLEEILVS-------AKGDLDRRL
A0A517SHR0      GPNAG-DCKRILIAVLDSYK----TWLQSTQAGSRAELESLLKS-------GKTELEDRL
A0A2E0AW64      STDPQ-VAAMLANRIYESFI----RTKGDFDVSLRSALLSRLEE-------LRKDKEDDV
A0A351FZ59      STDPQ-VAAMLANRIYESFI----RTKGDFDVSLRSALLSRLEE-------LRKDKEDDV
A0A660V239      TQYPD-QAEKVIDALIRAYK----ARAVTDEVKGEDQTLAILDE-------ERRSLEDQK
A0A177Q3B7      AERAA-DVKTLVGEITDVYL----KEVVYKERTRKLERLKHLQE-------IQSKYEESL
A0A2E0X6Y6      SKRPD-TAAAVVRAIIDSYL----EWVRDTHQGAAGAEKRRLTE-------KLARREQEL
A0A518GFD7      TQSPA-DCVKIVNGVVDAYM----KEVVGNERSQRRQRLESLEI-------VHAEAESKV
A0A518GE37      DTDKV-MAAAVCNAVAESYL----QVRRRFDDERMGNVEAWLVQ-------PIEQWKRNV
A0A5C6F3H8      DTDPE-VAKNVCNAVAKSYL----RQRDSFDAARVTNIEEWLEP-------EIQQWEQRV
A0A5C5X072      DTDRE-AAAMVCNAIVDSYL----RQRDSFDDTRVNNLERWLEP-------EIQRWEQEV
A0A5C5WUQ3      DSDRE-AAAMVCNAVVDSYL----RQRDAFDNARMTNLEMWLEP-------EIQRWEQQV
A0A5C6E697      DTDPE-AAALICNAIVESYL----RQRDSFDNSRVNNLERWLEP-------EIQRWKQEV
A0A5C5Z1A3      DTDRE-AAANVCNAVVESYL----RQRDDFDNIRVSNLGRWLEP-------EIQRWEQEV
A0A5C6D2P7      DTDPE-AAALVCNAVVESYL----RQRDSFDSTRVSNLERWLEP-------EIQRWEREV
A0A5B9ML17      DANRE-YAAKVCNAIVEAYM----MQRKALDGRRVAILEELLDP-------EIDHWKGQV
A0A5C5VZJ8      TPWPG-EAAVLVNKILENYK----RNYEDRQSAEDNTDVRALER-------AAADLKRRI
A0A517LX75      NPNPA-DAEHVLTVVYERYC----HYVESQTRNVGEEAASLIQQ-------AQQTNETEL
A0A7X7YXL7      SPNVE-EAKIIVDSFLRNFI----SLYSQRFTTGEAQNITTLED-------RQREYQNKI
A0A7W1FH76      DEQPE-QATALLQAVVATFL----ERLRDHREERISQSLSLLER-------QVAEARAKL
A0A7C5W7B3      HEDEA-FIHYVVQAVLEGLI----DTLVDHELAMV----------------NTEGVEQII
A0A7V2IPP1      GKQAG-PMKEIVDAFLRNYM----AVEVSSQSETESRNLGELER-------ERDILAGKL
A0A142XL75      GDDAT-ESKIILEHLKTAYL----ADVDLRDNGAKWSRLQKLEE-------TKRGYRSEL
A0A6P2D5D5      GNDPT-ESKIILEHLRTAYL----ADVDLRDNGAKRTRLKTLED-------TTQKYRKDV
A0A7C7T8W8      TKFKA-SAPIVANAILQAYL----EKQPEYVDRQLDDTVELLER-------ERTRKAEDL
A0A5C6B3S0      SQEPK-GLNTVVNAVVNAYL----EEIVQKERDLKRERLNKLES-------IYEDANEQV
A0A354GX32      GDQPD-EMAKVVNEWAATCD----SLYTASEEAKIKERIKQVLK-------NYQDGTTHL
A0A518GIZ9      SASAD-DARHVVKAVIDAYA----SYLNESRSEKTTEVFKTAQE-------AHDTLQKSL
A0A1C3EBY9      SASAD-DARHVVKAVIDAYA----SYLNESRSEKTTEVFKTAQD-------AHDTLQKSL
D5SX64          SASAD-DARHVVKAVIDAYA----SYLNESRSEKTTEVFKTAQE-------AHDTLQKSL
A0A517Z0U7      GERPA-DLKTIVEAVTNAFV----TQVVDQQLQDRRLKLTELKE-------LLGREQTEL
A0A2S8FCC0      GENSK-AISKIVNAVVQAYM----DEVVDAEAISRTTRLSSLER-------AYSETENDL
A0A1Z8MBT6      DTDRD-AAAAVCNAVVAEYL----QRRAEFDGTQSRRLISVIEK-------QIDELDVEI
A0A517SXN9      DTDRD-AAAAVCNAVVAEYL----QRRAEFDGTQSRRLISVIEK-------QIDELDVEI
A0A7X7F3C7      SRDRR-AAARVVNAVIASYR----EFLNQTHRGAAGEISEMLTT-------KMGQIEQSI
A0A255QXF5      DADKN-FSAEVCNAIVGAYL----QKRDEYDNLRISRLVQYLGR-------QIDELKRRV
A0A518KYQ0      DIDKR-FAADVCNAIVEAYL----QKRDEYDNRRIGRLENWLTP-------QVEQLKRKV
A0A5B9QX47      DTDQQ-AAAMVCNAIVDSYL----RQRNAFDSSRMRNLERWLEP-------ETTRWEQEV
M5T666          DTDRE-AAAVVCNAVVDSYL----RQRDSFDDTRVNNLERWLEP-------EIQRWEQEV
M5U6N6          DTDRE-AAAMVCNAVVESYL----RQRDSFDDTRINNLERWLEP-------EIQRWEQEV
A0A517M0G2      HEDPV-AAATICNKITHSFL----SIRDRLDNDRVSNLESWLTP-------SIDQWKNEV
A0A5C6AST1      HPDPQ-TAALVCNKVTEAYL----TQRDRLDSERVSNLESWLAP-------SIDLWKSEV
A0A5C6C951      HADPE-VAALVCNKVTEAYL----VQRDRLDGERVSNLESWLAP-------SIELWKSEV
A0A5C6C5T3      DTDRE-AAAQVCNAIVESYL----RQRDSFDNTRVNNLERWLDP-------EIQRWEQEV
A0A2A2W6A9      DTDKQ-FAADVCNAIVESYL----QKRDEFDNRRIGRLESWLTP-------QVEQLRRKV
A0A518HQS9      DSDKK-FAADVCNAVVEAYL----QKRDEYDNRRIGRLEQWLTP-------QVEQLKRKV
A0A5M6DFE6      DTDRE-YAQKICTAIVVSYL----SQRDSMDTNRVNSLINYLTP-------AIRDREKKV
A0A5C6F286      DTDRD-AAARVCNAVVESYL----RQRDSFDDARVNDVERWLEP-------EILRWEQEV
A0A517NGN1      DSDRD-MAAKVCNAVVNAYL----RQRDAFDSKRTNNLERWLEP-------EIQRWEAEV
M5RUI3          DSDGV-AAATVCNAVVDSYL----RQRDAFDQARMVKVERGLEP-------EIQRWQQEV
A0A5C1AAF0      TMQTD-DGVKIVDAVKTAYL----DEFVNKSAKARRQRLDRLQA-------LQTTAHESL
A0A3B8ZJM2      AGDPD-TAMAVVNAIVLGYQ----KFLDEEYKFVDDEVIKLFNE-------VKKKLDQDL
A0A1U7CLW1      ASCPPLDLSTLVNAIADSYL----TEIVDKERLARVERLERLKE-------LFADYQKDL
A0A5Q3LBQ3      GPNAA-HAQLITNEVVNTYL----KMRNEDDNAQTQRVIELLEG-------QKEQRSQNV
A0A142WPR7      DSDPE-VCQVALEAVLDGYR----SYLGETHQTTSKDVAELIKE-------AKDVLLKQL
A0A517T4K9      GEHPA-DLAAIVNAVTTCYM----EEIVNSEENRRGERLRRLER-------IQSNLEEEL
A0A7C6B2Q1      SPRAE-ETAVLVNAIVDAYM----REVVDTEQRERRERLSELDQ--------------LY
A0A2Z3GZZ5      EPDPE-LCKRLLEAVIAAYQ----AELYSIYEKASQDRIATLDR-------LLEAVKGQR
A0A4V0I6L6      SLHPA-DAPKYLRAIIAAYK----DELTGVYEDASVRQLKLLDE-------QIARLKRGL
A0A7C4QQT3      HRDAA-VARAVVQAVISAYA----AYLEDTRNEKSNEVLRLAQN-------AHDEVLQKL
A0A7V9G5K3      NEDPV-RAQSQLQSVIEAYQ----RSQNQREAGHSVGALSFLNK-------SVVDAGKRL
A0A7W1JAD6      NEDPV-RAQSQLQAVIEAYL----RGQDERESGHSRGALNFLSH-------QVTEANKRL
A0A518KBI5      APSPQ-EASDVVGAVIQQYF----ARQSDEGYRRVQRVVDLLEK-------ERTRRQLEV
A0A5C5V6Q5      SPSAQ-ESQDIVAAVIKKYF----VLQSDEQYKQVQRVVDLLEK-------ERVRRKLEV
A0A517P477      GEHAE-DLPVIINGVVDAYM-----------KEVVVGSMDDREG-------KLANLRQVL
A0A518HFS8      GGNPE-AVATVVNAVTEAYL-------EQIVRQEEQERVERLER-----------LEQLF
A0A7Y5LUV4      DVDPE-ASAQIVNTLVNVYI----DGANRRMRELKSTAAETLSR------ETLPDIRQKI
A0A3M1TFJ0      SSHEE-RCALYANALAEAYTRQRKSLWGQKTRQTEASVAVVVSRLGATLAASRKKLEEFL
A0A7Y5HGA4      GPDPG-IVYAVANGYARVFA----EVFREKAEEEFRQSLGDRLR-------SRDRLAAKL
A0A517MY49      SKQAE-SAAAVVQAVVNSYL----EFVRQNHRSAASDQLVHLEK-------QRATLEAEL
A0A2E6AG00      SQRAD-AAEAVVGAIVDACL----EFMDEYHRNVASEVVAILHK-------ERKEVEQQL
A0A1G3A880      SRSAS-AAVAVIRAVMQSYF----DFIEKTHRGTAGQIMDVLGQ-------EKVRVEAKL
A0A2E8ATT1      SRDPA-AGEAVVGAVVDSYL----EFIERNHKDVSVEVVTILEK-------ERQVTEAKL
A0A524HC32      SPDPK-LSQVVVNTLVDEFI----GWKMEQKFEASRMARDFLMM-------QIDQAKIHL
A0A660VT66      STDPE-AAAEYANTIARTFI----EFYSRENRES----LSFYTT-------QLKALEAQI
A0A7C2ZTD2      STNGE-EAKQIVDAFISAYM----AIEVSSSAQGQDRRLTVLED-------ERRVLAEKL
A0A0S8H0S8      SPYPS-EADLLVNNIVEAFV----SSSPGGNRSTAREILKTLRS-------EKARQAEEL
A0A7C2VEF7      SPYPQ-EAAGVVNTVVDSYI----KYHSLRKQTTVSKVLDILQK-------EKVKRDREL
A0A7V7D6N0      SPYPA-EAAQIVNAVVDSYV----EYHTTSTRSTASEVLKILQK-------EKIQRDKEL
M5S2L2          ------------------------------------------------------------
A0A7V1EK28      ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A7C2VXA0      ------------------------------------------------------------
A0A7C3AA48      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A7C5PFV3      ------------------------------------------------------------
A0A7C3QGD2      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A7Z9UC46      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A7C2ZUK5      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ------------------------------------------------------------
A0A7X8YY48      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
                                                                            

A0A523CME0      KKRKDR------------------------------------------------------
A0A7Y3UKB3      KKRKDR------------------------------------------------------
A0A7C2JY73      LRQEMA------------------------------------------------------
A0A836W298      ----QH------------------------------------------------------
A0A354PCV3      ----RN------------------------------------------------------
A0A354PHB4      ----RN------------------------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A538RV31      ----LR------------------------------------------------------
A0A1G2XSU7      ANLEQV------------------------------------------------------
A0A350KD81      QKNH--------------------------------------------------------
A0A356AE44      LEEQTA----------------------------------LKRYGSGH------------
A0A7Z9UBD9      ------------------------------------------------------------
A0A257WQ92      NVHQE-------------------------------------------------------
A0A2E3Z6T8      ------------------------------------------------------------
A0A7Y2AF64      ------------------------------------------------------------
A0A7C1U6X6      NGLSQK------------------------------------------------------
A0A7C7UXI5      SVVVK-------------------------------------------------------
A0A7C3SFJ0      L-----------------------------------------------------------
A0A7X7YIF4      AKLIEE------------------------------------------------------
A0A7C7WWF7      HPILQ-------------------------------------------------------
A0A7V3JIB0      ALVNA-------------------------------------------------------
A0A356ETW1      DPATK-------------------------------------------------------
A0A3L7NJY1      SVVSE-------------------------------------------------------
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      EEAEEA----------------------------------LILYKEKQNIVGLG------
A0A177PV03      DETKQK----------------------------------EDAWLAKNP-----------
A0A1G2YIM0      QRQRKI----------------------------------VRQMAEEFGTSALT------
A0A1G3A0W0      QGHEEF----------------------------------VANLSKTLGT---ATPGELV
A0A7V7D8F5      EKKRID----------------------------------INALAQKFGS----------
A0A432MFP3      EAQQKK----------------------------------LIELFKEAEDPRRMLGNLAA
A0A518HFL0      EGLQQG----------------------------------LFRLVQQSENPEMMQRNLDK
A0A3L7UX05      EDLRNN----------------------------------IKLLGSELGA----------
A0A2E0SHG0      ESIQAK----------------------------------YKNFVESSQFYTSDSDSVNV
A0A2S8F9B8      RQKRSD----------------------------------LRQLAETLGT----------
A0A368KP63      RSKRSD----------------------------------LRTLAETLGT----------
A0A518CQB8      EGIREK----------------------------------YKTFMESSQIYTTTGDTVNV
A0A7C4QPD3      KIRQNQ----------------------------------LRSLDKELLV----------
A0A7C2JZW2      KSQREA----------------------------------LKLVDQNLEA----------
A0A836RF42      LDQRAL----------------------------------AG------DE----------
A0A7D8YCU5      NELEAT----------------------------------YSEFRASAPL-EWSSSGEAV
A0A353BE27      RELSES----------------------------------ASQFKEANPDIVFIGDDVN-
A0A5C6BPW1      KKLDE-----------------------------------IAKLGRRLGITNEEELSLDI
A0A1I3GSP0      KSLEAE----------------------------------YQKFRHDAPVFLKASPIVSI
A0A517QJV1      AKLEKD----------------------------------YREFRVSAPVFLKASPIVGA
A0A3C1QS25      EELQAKIQ--------------------------------EQVEAHGEKLAFWNAEGII-
A0A5C6FX55      DKYESI----------------------------------YAQFRKESDL-FFDEQGNAI
A0A5C6DS51      VTADNE----------------------------------YRDFISKVPV-LLEGDQVR-
A0A5C6DSL6      ELADIE----------------------------------YREFIKNVPV-LLEGDQVR-
A0A3M1VG27      EAKQQE----------------------------------YLRFRAEAPF-LWRRPTVAD
A0A518GC22      KQLTQQ----------------------------------THDFMLRAPEVIWTGDEAT-
A0A3L7Q373      KALEKE----------------------------------YSQWRADVPFYINTTPAVTA
A0A3E0PW54      ERLQSE----------------------------------YHAFRADSPYYLPTPPTVAV
A0A7C3TAH2      QQH-------------------------------------YEQIRQLGQL----------
A0A1Z8MHR4      EKLEQE----------------------------------YRRFRETAPL-QWDLDGQAI
A0A5C6EHJ0      DKLEAE----------------------------------FSEFKKSSGL-IFR-GNETT
A0A5C6F1H9      DTLEGE----------------------------------FSDFKKSSGL-IYR-GNDTT
A0A255QXY0      LALERD----------------------------------YKEFRREAPL-EWDTQGNVI
A0A517SYI0      EKLEQE----------------------------------YRRFRETAPL-QWDLDGQAI
A0A518HX54      AELEEA----------------------------------YKTFREGAPL-EWDPNGQVV
A0A5B9MF59      KDLESE----------------------------------YLTFRNNADL-EWDVEGQAI
A0A2A2WC24      KDLESE----------------------------------YLTFRDNADL-EWNVEGQAI
A0A518KYW8      KDLESE----------------------------------YLTFRDNADL-EWNVEGQAI
A0A5C5YZZ0      DELENE----------------------------------FTEFRSTAPL-EWNGKGEAI
A0A518JLD2      TALEED----------------------------------YAKFKTSSNL-IYHDDKIAS
A0A5M6DJ15      QDLQLRAESLGTSDSESLSIAQQMSVQRYGQIQSELGKVNFNLLRAEGELEAYQQLLAGM
A0A3L7P7S7      QQLRED----------------------------------LRLIEEQ--L-QKNTTSGVV
A0A517N8M1      LELESR----------------------------------YREFRRDAPL-AWDSEGKAI
A0A5C6CW01      TDLEKQ----------------------------------YRDFRRDAPL-AWNSQGEAI
A0A5C6BXS9      AKLEQQ----------------------------------YRDFRTQAPL-VWNEQGVAV
M5U569          TELEQR----------------------------------YRDFRTSAPL-VWNEEGKAV
L7CND7          SELEEN----------------------------------YREFRTNASL-VWDENGKAI
A0A0J1B8S4      AELESR----------------------------------YREFRQDAPL-VWDENGQAI
F2ARR3          TELEER----------------------------------YREFRTNAPL-VWDQNGAAI
K5D8H6          TELEER----------------------------------YREFRTNAPL-VWDQNGAAI
M2AKU0          TELEER----------------------------------YREFRTNAPL-VWDQNGAAI
A0A5B1CRW9      IEADET----------------------------------YRGYVASVPV-LLEGD-KVR
A0A5C6EI46      SDADAA----------------------------------YRDFVASVPV-LLEGD-KVR
A0A5B1CKI2      LELENR----------------------------------YRTFRRDAPL-AWNAEGLAI
A0A5C6EG84      LDLEAR----------------------------------YREFRRDAPL-AWDSEGIAI
A0A5C6F2X4      LDLESR----------------------------------YREFRRDAPL-AWDSQGIAI
A0A7W5DXF4      TELEDR----------------------------------YRQFRIDAPL-VWNEAGKAI
A0A5C5XTV6      DLIEER----------------------------------YRKFRIEAPL-VWNERGDAT
A0A5C6AAB1      TELEQR----------------------------------YRDFRTTAPL-VWNEKGEAV
M5T8W8          VELEKR----------------------------------YRDFRTDAPL-VWNEEGKAV
M5SF00          SELEED----------------------------------YRAFRTKASL-VWNENGEAI
A0A2G1WDS1      SELEKD----------------------------------YRAFRTKASL-VWNENGEAI
Q7UVS9          SELEKD----------------------------------YRAFRTKASL-VWNENGEAI
A0A5C6B601      EELVEE----------------------------------YHEFQENSPL-KWDKDRQVI
A0A517PFU1      EAAEAA----------------------------------HREFERTSPL-VRGPDGQPL
A0A5B9M8J9      AELEES----------------------------------YKVFREGAPL-EWDPDGQVV
A0A2A2WFP6      AELEEA----------------------------------YKSFRESAPL-EWDPNGQVV
A0A518L8N2      AELEEA----------------------------------YKTFREGAPL-EWDPNGQVV
A0A518HQN9      KDLESE----------------------------------YLTFRDNADL-EWNVEGQAI
A0A5M6D8H8      RMLEEE----------------------------------YKSFRENARL-EWNLEGQAI
A0A1G2ZG92      YKSLSA----------------------------------LSDFKISKK-----------
A0A2E7D3V4      QAKMAA----------------------------------YVDFRQSAPLQWKRPP--GT
A0A5B9PER9      AVAIAE----------------------------------RKKWDDQYD-----------
A0A517QSM4      GLKRTQ----------------------------------LEGIAQSLK--------TTD
A0A355GJI7      QKNH--------------------------------------------------------
A0A1Z8MCI4      LNQQER----------------------------------LQLAARSAG-----------
A0A517SYL7      LNQQER----------------------------------LQLAARSAG-----------
A0A3L7P0L2      TRLEDE----------------------------------YEKWRGESPFYISSSPVVSA
A0A6M5YVJ1      KTNYDR----------------------------------IDAIAVSLG-AKDGETQALN
A0A832M9Q8      DGLQNN----------------------------------LNTLTADGSNVWSEEA----
A0A7W0MCI8      KMKQEE----------------------------------LRRLTEMTSSASSEQS----
A0A517SCC8      RDLDKE----------------------------------YHDWRNNAPFFLSTPVIVTA
A0A358MY60      QGHERR----------------------------------ISELSKSTL-GFDPNN----
A0A517MNB1      AGHGRR----------------------------------VRELSKAAY-GFDPTM----
A0A3A0DR44      RSIREK----------------------------------IVEIEKTVVGKVPAKG----
A0A142YJ13      SGKRAK----------------------------------FKELAGSVG--------TSD
A0A517Z7D3      DELEQA----------------------------------YLQFRDESPWHASTPPIVTA
A0A7X7KCE7      LRLRDN----------------------------------VRALAQEAA-------VKDP
A0A1N6KY57      REKRQQ----------------------------------LKGLTELAG--------SDN
L0DK20          KEKRKE----------------------------------LKRLTELAG--------SDD
A0A517XRC2      EQDERE----------------------------------IKRKAEFNG-TIGIEDTNKQ
A0A6M5YH47      EATEKH----------------------------------IELLGRANN-TTGSEDNSLQ
A0A660UUK3      DTQAKE----------------------------------INTLLDEFG-----------
A0A517ZHG5      KKKLDE----------------------------------IAKLGRRLG-----------
A0A1Z8MPL5      RLKRED----------------------------------LQELAKTVG-TSDPDT----
A0A7C1EH96      RRQRAR----------------------------------IRERVEEYG-----------
A0A5C1AGE3      DD-----------------------------------------IMRAGH-LRGDMNAPQT
A0A2Z3HEL7      AQGERV----------------------------------IEFTARNLG-VNGTGDANGS
A0A142XAP8      SDQKSK----------------------------------LELAGRTNG-TTGAEATSNA
A0A6P2DEK1      KEQKSK----------------------------------LELAGRTNG-TTGAEATSNA
A0A5C6C1R5      RARRAE----------------------------------IRKLADTLGTGDSESL----
A0A1G2YRE4      RSTNDS----------------------------------IRQLGTEYG-----------
A6BZU4          KLKKSE----------------------------------YQKFRENAPLYWESTP--GS
A0A2D5GZ77      KLKKSE----------------------------------YQKFRENAPLYWESTP--GS
A0A3D3R1Z6      KLKKSE----------------------------------YQKFRENAPLYWESTP--GS
A0A517XG00      KLKKSE----------------------------------YQKFRENAPLYWESTP--GS
A0A353Z859      GDFIKT----------------------------------KERLVKKLG---------GD
A0A2D6ST10      ETKRRR----------------------------------TETLSEQTG-AITEGQRDWK
A0A177QX42      GENRQK----------------------------------YDDFRNTATLIFQDNK----
A0A517SHR0      ANNRTE----------------------------------YDRFRNKAQLLFQDNK----
A0A2E0AW64      DRLRQD----------------------------------FRNEAIRNL-NWDPYA----
A0A351FZ59      DRLRQD----------------------------------FRNEAIRNL-NWDPYA----
A0A660V239      QRQRDE----------------------------------LRQLAQEFG-----------
A0A177Q3B7      RSHRET----------------------------------VRKLILALG-SGDAQVLAVK
A0A2E0X6Y6      EEFEAG----------------------------------LRALRRQVG-HLAVSS----
A0A518GFD7      RIKRAE----------------------------------LKSLATLLGTGDAESL----
A0A518GE37      ESLRAN----------------------------------LAELTKSAN-GYDPFK----
A0A5C6F3H8      EERQAR----------------------------------VQTLSEQTL-GFAPGK----
A0A5C5X072      DERQKR----------------------------------VAALSQKTL-GYAPGQ----
A0A5C5WUQ3      EERQLK----------------------------------VTRLSEQTL-GFAPGQ----
A0A5C6E697      TERQRL----------------------------------VQSLSKQTL-GYAPGE----
A0A5C5Z1A3      EERRQS----------------------------------VNRLSQQTL-GYAPGR----
A0A5C6D2P7      SDRQRV----------------------------------VQSLSEQTL-GYSPGE----
A0A5B9ML17      EQHKAR----------------------------------VRELTIGMK-GYDPGS----
A0A5C5VZJ8      EARADE----------------------------------IKVVRKDLNLGAGSPA----
A0A517LX75      RQATQE----------------------------------YTRFVATSA-GLLDGE----
A0A7X7YXL7      ATTRAK----------------------------------INELAMAHG-----------
A0A7W1FH76      EESREN----------------------------------ERQFRAKNA-IISTDP----
A0A7C5W7B3      LSTQNG----------------------------------INDVEREISSIYSEGM---E
A0A7V2IPP1      QTQREA----------------------------------INQLAAEYG-----------
A0A142XL75      EKFHKQ----------------------------------IDTIAAALG-----------
A0A6P2D5D5      EDAHKR----------------------------------MDIIAVALG-----------
A0A7C7T8W8      AELRER----------------------------------LTTIASQMT---SLPAFQIG
A0A5C6B3S0      RQKRNE----------------------------------LKRLVEIHGSGSSDAL----
A0A354GX32      RNKKNE----------------------------------LQARRDLLG-LKDPLTLGKE
A0A518GIZ9      REKEEA----------------------------------YLKFRESAPLQWRAPIGAIA
A0A1C3EBY9      REKEEA----------------------------------YLKFRESAPLQWRAPIGAIA
D5SX64          REKEEA----------------------------------YLKFRESAPLQWRAPIGAIA
A0A517Z0U7      DRQQSA----------------------------------LRRLDKELA-PNETQV----
A0A2S8FCC0      RSKRSE----------------------------------FRRLADTLG-TGDTAS----
A0A1Z8MBT6      SAKEAE----------------------------------VRQYEVEAQ-GFSSNN----
A0A517SXN9      SAKEAE----------------------------------VRQYEVEAQ-GFSSNN----
A0A7X7F3C7      AQTQHE----------------------------------VLELRGRVG-DVRLRE----
A0A255QXF5      EEQKEA----------------------------------VAKFAREAS-GAAPGE----
A0A518KYQ0      EEQEKL----------------------------------VAQLAKESH-GVAPGE----
A0A5B9QX47      ESRQLR----------------------------------VQELSARLM-GYAPTE----
M5T666          EERQQR----------------------------------VHMLSEKAL-GFAPGR----
M5U6N6          ESRQQR----------------------------------VHMLSEKAL-GFAPGQ----
A0A517M0G2      HVHGER----------------------------------VRDLSKVVI-GYDPTH----
A0A5C6AST1      QSHEKR----------------------------------VRELSKTAL-GFDPTQ----
A0A5C6C951      QAHEKR----------------------------------VRELSKAAL-GFDPTQ----
A0A5C6C5T3      DERRKR----------------------------------VQLLKQKSF-GYAPGQ----
A0A2A2W6A9      EEREHL----------------------------------VSQLAKEAH-GVAPGE----
A0A518HQS9      EEQEKL----------------------------------VSQLAKEAH-GVAPGE----
A0A5M6DFE6      QEKQDI----------------------------------VQKLSEKTL-GYNPSA----
A0A5C6F286      EKRQSL----------------------------------VQALSEEAL-GFSPGH----
A0A517NGN1      SNRQSR----------------------------------VQSLSERTL-GFNPAA----
M5RUI3          EQRHHR----------------------------------VQKLSETLV-GFAPGQ----
A0A5C1AAF0      KRKQAT----------------------------------VRKLAEAVG-STRPEN----
A0A3B8ZJM2      VAHKNG----------------------------------YDKFLVDIK-QQGVLF----
A0A1U7CLW1      TEKRLK----------------------------------FKEMAGSIG-TSDKQA----
A0A5Q3LBQ3      MRLREN----------------------------------VRELSKQTT-GQDPFGPNPV
A0A142WPR7      ETKEDE----------------------------------YHKFRQDAP-LLFAKE----
A0A517T4K9      RTKYMS----------------------------------QRRLAETLH-TSDSET----
A0A7C6B2Q1      AEKESE----------------------------------LRKLENDLK-ALSQQLETGD
A0A2Z3GZZ5      KAAGEH----------------------------------RITHLTELR-GITT------
A0A4V0I6L6      NDTRVQ----------------------------------LDEAERKLR-GVIDPA----
A0A7C4QQT3      REKERE----------------------------------YQAFREQAP-LQWKTPVAGL
A0A7V9G5K3      EEARSA----------------------------------EQRFRAERG-ILSADP----
A0A7W1JAD6      EEARLT----------------------------------ESRFRAEHG-ILSTDP----
A0A518KBI5      ERLQTY----------------------------------VIDLSREVT-G---KDPFGQ
A0A5C5V6Q5      DRLQQY----------------------------------VVELSKEVT-G---KDPFGH
A0A517P477      ATAEDA----------------------------------LDLKRKQYQ-QFVEAS----
A0A518HFS8      EKYQEE----------------------------------LRAKREDYR-EQAQSA----
A0A7Y5LUV4      TEAEAG----------------------------------LQEFQQQSG-FVDFEE----
A0A3M1TFJ0      SSNQTP----------------------------------LFERQEEL------------
A0A7Y5HGA4      EEANAA----------------------------------VTAFRKDNS-RVDFSPVRGA
A0A517MY49      DEKQNQ----------------------------------LQVHRERVG-HLAISS----
A0A2E6AG00      VTRDRQ----------------------------------LLNTKRSLG-DLGMRD----
A0A1G3A880      DEKKAA----------------------------------LLAARRNFG-DLGIKP----
A0A2E8ATT1      EQKKRS----------------------------------LLELKRQIK-DFGLRE----
A0A524HC32      EKAEED----------------------------------LNRFAKKAGIVSLD------
A0A660VT66      ADCNER----------------------------------INDFIHRNGLITPEM-----
A0A7C2ZTD2      QRQRKT----------------------------------IRQLAQEYGTTALG------
A0A0S8H0S8      TANFQA----------------------------------MEEFKRANGIISLAD-----
A0A7C2VEF7      SDKYEE----------------------------------MVQFTRENGVVSFDN-----
A0A7V7D6N0      SDSFTR----------------------------------LLEFTRENGVVSLEK-----
M5S2L2          ------------------------------------------------------------
A0A7V1EK28      ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A7C2VXA0      ------------------------------------------------------------
A0A7C3AA48      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A7C5PFV3      ------------------------------------------------------------
A0A7C3QGD2      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A7Z9UC46      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A7C2ZUK5      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ------------------------------------------------------------
A0A7X8YY48      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
                                                                            

A0A523CME0      ------------------------------------------------------------
A0A7Y3UKB3      ------------------------------------------------------------
A0A7C2JY73      ------------------------------------------------------------
A0A836W298      ------------------------------------------------------------
A0A354PCV3      ------------------------------------------------------------
A0A354PHB4      ------------------------------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A538RV31      ------------------------------------------------------------
A0A1G2XSU7      ----------------------------------------------------LITAKQHL
A0A350KD81      ------------------------------------------------------------
A0A356AE44      ---------------------------PDVINVRKRIDLVKSYYRQMGIDLPTMTTKVNP
A0A7Z9UBD9      ---------------------------------EQQLREINSQLLLARAELDGSRAKLAR
A0A257WQ92      -----------------------------------RVLAAEEQRRLNLLRKATLQSRLKS
A0A2E3Z6T8      ------------------------------------------------------------
A0A7Y2AF64      ---------------------------------------MNQALTEVQKERLNLEATATA
A0A7C1U6X6      ---------------------------LGTSTPQERISAMRLNLDETEARIDELKLSIAK
A0A7C7UXI5      -----------------------------------RALELNSALTEAIEDRLEAEAQYRA
A0A7C3SFJ0      -----------------------------------KSLYALETTNTLRDRITRLQQALSG
A0A7X7YIF4      ---------------------------YGTQELTPRQTSMFEMVSGLQRELINTNIRRIS
A0A7C7WWF7      -----------------------------------RVVLINNRLAEVQQERIELHAAQIA
A0A7V3JIB0      -----------------------------------VVEAYRAEVVDVELN--QRRQRLND
A0A356ETW1      -----------------------------------RALYFADELSKIERKRIDLQPTLAR
A0A3L7NJY1      -----------------------------------TIKLLAAEYSEARRATEESRTRAAS
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      ---------------------------ETAGIIEQKLEGLKSNLTEIKIEKIKLKALSDQ
A0A177PV03      ---------------------------PPTEVSETLLTNLRTRRSNETILRDSLQRQVKD
A0A1G2YIM0      ---------------------------GRQDMMLQQVTMLQSEMTRIQTQKLSLEAQIMM
A0A1G3A0W0      ---------------------------SSKR---VRLDQTKARLNELKQSIALLEWKKKA
A0A7V7D8F5      -----------------------KSLDKRQEIKLERVGMLLSEVTKWEANRISLEAQVEV
A0A432MFP3      MDGGVAPAAS----------GEE-GQRAAFQVDVDEYERLSQALLELEYEEIEARADLEA
A0A518HFL0      L---LSPGAS----------GDGISGNPDLEVELSEYQRLHQSLLELEYEEIEAKAELEA
A0A3L7UX05      --------------------ADPELIKDRSRLTLEDYTRMSRDLSQLEFERITAESRVER
A0A2E0SHG0      YLNTLNDYETQLRLLQFQRYASESRLEIIKESLKPENREKYNDFQRLALISAESVERMGL
A0A2S8F9B8      --------------------SDSETLSLAQQGSVQHYGLVRNELAQVRFDLMRSEGELDF
A0A368KP63      --------------------SDSDTLSLAQQGSVQHYGLVRNELAQVRFDLMRAQGELDF
A0A518CQB8      YLNSLNDYETQLRLLQFERYAAESRLEIIKESLEPENMERFTDYQRLALVDSKHVERLGL
A0A7C4QPD3      --------------------PNAAQSDAKRQAQLDLQLELRKQLSLL------QPQIIEL
A0A7C2JZW2      --------------------ATDSQMDLRRQAKIDEQLEIRREMAKL------HPQIIEL
A0A836RF42      --------------------LARLRSDFARMQREQQKLTGRGEPRKL------RQR----
A0A7D8YCU5      ---------------------------NPFR---QDALAIEESLRRVRSETRQIDSKLRL
A0A353BE27      ---------------------------DPYH---ATWETLHKKLIDIRSRKSEIDALTTQ
A0A5C6BPW1      ---------------------------AADN---AFTRQLQDQWFNHTILRNKLRLETQI
A0A1I3GSP0      N-------------------GMPAPAQNQYE---TELASIETAQNENLRKRSSIQARLAT
A0A517QJV1      N-------------------GVPVPPQSRYE---AELSSIEEEQNEGQIKQSGIEAKLSE
A0A3C1QS25      ---------------------------NLEQ---QRMQELDAHIRQLELQKTEYQSQLDR
A0A5C6FX55      ---------------------------NPHR---VRVQELMADRGKLVQEYVDAELTYRS
A0A5C6DS51      ---------------------------DVHK---NRLDQLEQELTDVRSSLAEAKSRLIV
A0A5C6DSL6      ---------------------------DLHK---NRLDQLEKELAEVRSSLAEAKSRLIV
A0A3M1VG27      ---------------------------ESSQ---DVISVHIDEVQKIQQALSGVTVEQTV
A0A518GC22      ---------------------------DPYS---VNFLKLNSKITELRVERGRLESVYSQ
A0A3L7Q373      Q-------------------GTPLAQQSIYQ---AKLSDVITRQSANEALLRSTRSKIGI
A0A3E0PW54      N-------------------GSVIPGKNPYQ---ARVEKIGTDLSRNRVLQSEIASRIAT
A0A7C3TAH2      ----------------------------------YGTTFLDSRQDMVTQRLASLMAELSR
A0A1Z8MHR4      ---------------------------NPHR---ERQVMLQKNRLDLEQQLRLLSSDLRL
A0A5C6EHJ0      ---------------------------SLHR---DNADRYMAQRQNLLIQKAKISGLLAA
A0A5C6F1H9      ---------------------------SIHR---DNADRFMAQRQDLLIQKAKLSSLLSS
A0A255QXY0      ---------------------------NPHR---QHYDHLQTMRQGLERRRRQLGTELTF
A0A517SYI0      ---------------------------NPHR---ERQVMLQKNRLDLEQQLRLLSSDLRL
A0A518HX54      ---------------------------NPHR---QRQFQLQSFRDQLEQKQRQLDCELRF
A0A5B9MF59      ---------------------------NPYR---ERQFQLQTYRTELEQKKRELNSDLRL
A0A2A2WC24      ---------------------------NPYR---ERQFQLQSYRTDLEQKKRELNSDLRL
A0A518KYW8      ---------------------------NPYR---ERQFQLQSYRTELEQKKRELNSDLRL
A0A5C5YZZ0      ---------------------------NPYR---DDAIRLEESLHALETQSRQLNSKLRL
A0A518JLD2      ---------------------------VHRE---NSGVYLSQIQSLTLERAKLNSVMDSA
A0A5M6DJ15      ---------------------------EATRAKLEKELDAMRKSNAAGEQAESKGSNIAK
A0A3L7P7S7      ---------------------------NRQKLLQEKSNGLMNRLDRVRARQEELTDQMRL
A0A517N8M1      ---------------------------NPHR---ERQLFLVGSRSEVVEKLRQKSVEVAA
A0A5C6CW01      ---------------------------NPHR---ESQLFLTGKRSELNEQMRQKATQLAA
A0A5C6BXS9      ---------------------------NPHR---ERQLYLTGRRSELFEELRQRSVELTA
M5U569          ---------------------------NPHR---ERQLYLTERRSELFEQARQKSIELAS
L7CND7          ---------------------------NPHR---ERQLYLTARRSELFETLRSESVELSA
A0A0J1B8S4      ---------------------------NPHR---ERQLYLTARRSELFEELRKKAIELTA
F2ARR3          ---------------------------NPHR---ERQLYLTERRSELFEHLRQKSIELTA
K5D8H6          ---------------------------NPHR---ERQLYLTERRSELFEHLRQKSIELTA
M2AKU0          ---------------------------NPHR---ERQLYLTERRSELFEHLRQKSIELTA
A0A5B1CRW9      ---------------------------DVHK---ERLSDMETELNEVRSLLAESSSRLQV
A0A5C6EI46      ---------------------------DIHK---ERLSDMETELNKVRSSLAENESRLQV
A0A5B1CKI2      ---------------------------NPHR---ERQLFLVGRRSEIDEIARQKKTEVAA
A0A5C6EG84      ---------------------------NPHR---ERQLFLVGRRSEVVEKLREKAVEVAA
A0A5C6F2X4      ---------------------------NPHR---ERQLFLVGRRSEVTEKLREKAVEVAA
A0A7W5DXF4      ---------------------------NPHR---EQQLLLAKRRGQLSEELRQKSIELSS
A0A5C5XTV6      ---------------------------NPHR---ERQLYLTGRRSQLDEELRQKSVELTA
A0A5C6AAB1      ---------------------------NPHR---ERQLFLTERRSELYELMRQKATELAA
M5T8W8          ---------------------------NPHR---ERQLYLTERRSELFEQARQKSIELAA
M5SF00          ---------------------------NPHR---ERQLYLTERRSELFETLRSQSVELSA
A0A2G1WDS1      ---------------------------NPHR---ERQLYLTGRRSELFETLRSQSVELSA
Q7UVS9          ---------------------------NPHR---ERQLYLTERRSELFETLRSQSVELSA
A0A5C6B601      ---------------------------NPHR---ERQLRLQAEREDLESEAMKYERELKT
A0A517PFU1      ---------------------------NPHA---ADLLALDRARDELSLELSNLTAEV--
A0A5B9M8J9      ---------------------------NPHR---QRQFQLQAFRDELEQKQRELDCELRF
A0A2A2WFP6      ---------------------------NPHR---HRQFQLQSFRDQLEQKQRQLDGELRF
A0A518L8N2      ---------------------------NPHR---HRQFQLQSFRDQLEQKQRQLDGELRF
A0A518HQN9      ---------------------------NPYR---ERQFQLQSYRTELEHKKRELNSDLRL
A0A5M6D8H8      ---------------------------NPHR---EQQFRLQAHRTELQQRMRQINSELRF
A0A1G2ZG92      ------------------------------------TVNLDTETQNLINKIATLQGEYED
A0A2E7D3V4      ESSPA----------------------DVVNVHQDRLEAIDAERRKNLLEREDLQSKIAV
A0A5B9PER9      ALRIN----------------------GNSNIHAVMVVQLAKSMQAMREELGKLQNERAK
A0A517QSM4      PEILS----------------------SKRQLEYEYYGQLREEFTRLRFELMQANIQLAA
A0A355GJI7      ------------------------------------------------------------
A0A1Z8MCI4      --IPL----------------------DEMTQQREFLASLKRAHMDATMQLKAVQQELSS
A0A517SYL7      --IPL----------------------DELTQQREFLASLKRAHMDATMQLKAVQQELSS
A0A3L7P0L2      QGVPT----------------------SMPSPYQANLQDLVTRRNLNRDQLRKTKIKIDQ
A0A6M5YVJ1      DSLLR----------------------DDLRNATRELSVVRDQLQRAELDLRAAETPNAA
A0A832M9Q8      -----------------------------RKIIADTGGALRVTLAKLEVDRAQLAATLDN
A0A7W0MCI8      ----S----------------------QKQNFVLEMQIEIRKQITQVEMALLQMRIRERV
A0A517SCC8      QGTAM----------------------PGQSPYMVELDRINTAVRDNMLKRTAVEAKLKT
A0A358MY60      ---PV----------------------ESLEYDLSTLSNLRKEVQDMRVQESWLETAVTR
A0A517MNB1      ---RV----------------------EGLENDLSVLGSLRRDLADLIVEESILEAKIAM
A0A3A0DR44      ---DT----------------------GAAGSVLSPVFALQQRLVEIEADREVLNAQIAA
A0A142YJ13      KTASA----------------------VRQQMMVEHLGLARQELMRLQSDVRRSQARLNV
A0A517Z7D3      NGMVA----------------------AGQSPYQARVERIRQDRNENDIRKAEIQSRISV
A0A7X7KCE7      FAAKM----------------------EPAAAQKHPLADLESRLIEVQVEGTVLKARIKA
A0A1N6KY57      KSTIA----------------------TIHQHELDRLGRAEDELSRIQSELRSLRIESEV
L0DK20          KKTIA----------------------NIHQHELDRLGRAEDELARVQSELRGLRVEHEV
A0A517XRC2      LSTLK----------------------L----METQLSQEVAALKTINQDNELLLEKVKE
A0A6M5YH47      IGLLH----------------------RQHAEAEADYNKTTREISRLESELSVLEKQLAE
A0A660UUK3      TEELD----------------------GRQEIMLQTVARLQDDLDGVTIRRIELEAQVNM
A0A517ZHG5      -ITSE----------------------EELSLDIAADNAFSRELQQQYFDLTIMRYNLKL
A0A1Z8MPL5      ---AN----------------------ATQQLLLDQILYLRRQISEVREQSVQKQRDLRA
A0A7C1EH96      TEQLT----------------------PRQEIALQQVATLKQEQISIGVQRMQMEARVQA
A0A5C1AGE3      PEMFN----------------------EKVKDVGDELRKARSAKREAEVKLAALDDQVKA
A0A2Z3HEL7      TQLLH----------------------IKFGELDRMFTAANHELGDLQSQLSVYQDQLEE
A0A142XAP8      LALLQ----------------------KQHVEADALFVGAGREIEKAEAELKVVQKQLED
A0A6P2DEK1      LALLQ----------------------KRHIEADALFVAAGREIEKAEAELKVLQKQLED
A0A5C6C1R5      ----S----------------------IAQQLSVERYGHVQTELGKVNFDLMRTQGEVEA
A0A1G2YRE4      SXXXI----------------------DRQDMKLRRVTALQSTLTAVEARRISLEAQVQF
A6BZU4          EAAVA----------------------GSTNVHQERVKAIDNERRLNLLKLTELKSKIDS
A0A2D5GZ77      EAAVA----------------------GSTNVHQERVKAIDNERRLNLLKLTELKSKIDS
A0A3D3R1Z6      EAAVA----------------------GSTNVHQERVKAIDNERRLNLLKLTELKSKIDS
A0A517XG00      EAAVA----------------------GSTNVHQERVKAIDNERRLNLLKLTELKSKIDS
A0A353Z859      NETAA----------------------EAAKARESFYADIRKQSVMAKIEKTKINAELSL
A0A2D6ST10      YQNDL----------------------AIQRSLIAEFRQVKVQLINLRFDQTHLENDKAS
A0A177QX42      ----------------------------GINYYEERLRKIEDERHQKMIALQELQATRNA
A0A517SHR0      ----------------------------GINYYEERLRKIEDERHLKMLELQQLSVQRNA
A0A2E0AW64      ---VA----------------------QTESDPGASALSYEKQLAKLAIDQAIVQYQIER
A0A351FZ59      ---VA----------------------QTESDPGASALSYEKQLAKLAIDQAIVQYQIER
A0A660V239      STELT----------------------SRQEMMLQQVTSLRNELINVNIRRISLETQIQV
A0A177Q3B7      QRYAA----------------------EALGQAERELLQTQSELRRARLAGEVKRRRIKA
A0A2E0X6Y6      ---KD----------------------GLTDPIIQQALRVNEMLMDAQQQRLQLQATLAA
A0A518GFD7      ----T----------------------VAQQNALQQYGLMQEKLSTIQFALMQAEGEMKL
A0A518GE37      ---ES----------------------SPRERDASQMVQVRSELSNIEAEKTVTRGRINA
A0A5C6F3H8      -AIEK----------------------AENESNLALLTQLRSEIGDLKIELSLFDAGL-Y
A0A5C5X072      -SVDR----------------------NDSEAHMSRVAALRSQIGDLKIELALFDAIVEA
A0A5C5WUQ3      -RLDV----------------------IEDQSSLSLMTHLRSQIADLSVQLAIDDAQIAM
A0A5C6E697      -NAAS----------------------LESDSNLSLMARLRDEIADLNVQLAVMDAQLAM
A0A5C5Z1A3      -ATSV----------------------AENNDNMSLLAKLRADIADLTVELSIADAQLAM
A0A5C6D2P7      -RVST----------------------LEDSSSFSLMTRLRQQIAELNVEISVLDAQQAM
A0A5B9ML17      -PLGF----------------------SRNESRLALLNGYESQINDLRVDIFELEGKLQL
A0A5C5VZJ8      ----------------------------------EVVVKRQVALDERRAELWTLRKEIAL
A0A517LX75      ---------------------------ELRSVPHERLKGIEQELAEIRSQLAYAKSRYEM
A0A7X7YXL7      GTALT----------------------ALQEVELQTQNALRARLSQLEADRIRIDADISV
A0A7W1FH76      ---DG----------------------NYVAVRLRQLNAVRAEITTQIASDDALDHQLMA
A0A7C5W7B3      KGLMP----------------------KDISRTLDRIEELNRTIEETRLAIIEVEQRVNT
A0A7V2IPP1      SKNLT----------------------ERHDMRLQRVAALLSELTRLQAARVNLEIKAKV
A0A142XL75      ----T----------------------KDEATLMTFDSFLRDELRLAQRDLQNARENLEL
A0A6P2D5D5      ----T----------------------KDEATLMTLDAILRDELRLAQRDLQTATENVAL
A0A7C7T8W8      DPTSP----------------------LLMSAPHRPMLELNKRLGALEARRSELLAKQAA
A0A5C6B3S0      ----S----------------------LKQQNTLQQYAIVRNELTKLHFESMRARGELET
A0A354GX32      LDSTQ----------------------DLLKTPQSQRLLLELDLAKSESELSILNERIKA
A0A518GIZ9      ADGTS----------------------GATNVHQERVIAVEEQRRLNLLRRTEINSRMQA
A0A1C3EBY9      ADGTS----------------------GATNVHQERVIAVEEQRRLNLLRRTEINSRIQA
D5SX64          ADGTS----------------------GATNVHQERVIAVEEQRRLNLLRRTEINSRMQA
A0A517Z0U7      ----D----------------------AMQQAKLDLRVELRKQLGAVRLQIIEQEIILQT
A0A2S8FCC0      ---LS----------------------LVQQNALQQFAALRSELTKVQLELLRARANVLG
A0A1Z8MBT6      -QVSV----------------------IEDQSQTSRLRELIDQRFELEQQISLIEQDLES
A0A517SXN9      -QVSV----------------------IEDQSQTSRLRELIDQRFELEQQISLIEQDLES
A0A7X7F3C7      ---DG----------------------RVLHPLVQRATSFNEELIAVQKQRSRLETSLAS
A0A255QXF5      -RVAE----------------------IESAESFLLIEKLRSQISNLEIQLAMIDAGVS-
A0A518KYQ0      -RVAA----------------------LENSDSFSVIRNLRSQISDLEIEIALLDAGVG-
A0A5B9QX47      -RVDA----------------------MEDKNSFSMMQSLHSQVANLTYELAVLDAHHAM
M5T666          -NVDR----------------------AESESSMSRLADLRSQVGELEIELALFDATKDL
M5U6N6          -NLDR----------------------AESESNLSRLSDLRAQIGELKIELALFDATEDF
A0A517M0G2      -RVEG----------------------LEND--LSVLAGLRTDLSNMIVEESILEAKVAM
A0A5C6AST1      -RVEG----------------------LEND--LSILGSLRRDLANFIVEESVLEAKVAM
A0A5C6C951      -RVEG----------------------LEND--LSILTGLRRDLANYIVEESILEAKVAM
A0A5C6C5T3      -SIGR----------------------SDSEAHATRMSELRSQVGDLKIKLALFDVMAAE
A0A2A2W6A9      -KVAA----------------------LENSDSLSVAQKLRNQISDLEIELAMLDAGVG-
A0A518HQS9      -RVAA----------------------IENSDSIALVEKLRGEISDLEIELALMDAGIG-
A0A5M6DFE6      -PLSS----------------------MENQHSISLFGQLQSQISSLEAEIEMLDAIEKG
A0A5C6F286      -ALDR----------------------AENDTNVALLTQLRSEIGDLKIELAMFDAGLAD
A0A517NGN1      -RLSV----------------------AEDESSLALFAELRSKITDIEVKLSVLDASEAM
M5RUI3          -KIAA----------------------LENESNMTLMAELRSRISDLRVKIAIADASRVS
A0A5C1AAF0      ---VA----------------------MQQQLAHEQYGTAQREYVKLQSDLRRLRLEESS
A0A3B8ZJM2      --NVT----------------------EPVNHFFEAAMRNQQQLTAKRLEANQIKSILDT
A0A1U7CLW1      ---AA----------------------VRQQMMVEHLGLARQELLKLNSDVRKSQARLNV
A0A5Q3LBQ3      SEVIS----------------------LE-----HPLGNLQKRLTEAEVHREVMEARLKV
A0A142WPR7      ----E----------------------GAKNIHQERLAGIEQARSALLIALHEKTAELDS
A0A517T4K9      ---VT----------------------VKHQLDLEYFSELRKKLAETRFELTRAKIQLAV
A0A7C6B2Q1      SQALS----------------------LKQQITLQQFSTYRSELINVQLRMMRAQGEL-S
A0A2Z3GZZ5      ----------------------------------EDVSSVRTRVSALRDQARALRTDISN
A0A4V0I6L6      -TGAV----------------------LVPGISQETPERVQQRISDNRSAQNARELEKIV
A0A7C4QQT3      SADAQ----------------------ATTNVHQERVVAIEDQRKLNLLRRAELQSRLQA
A0A7V9G5K3      -----------------------------------DHNFLSEEVANLGANRTAFLADLAA
A0A7W1JAD6      -----------------------------------DHNFLAEEVGNLGSKRSDFLAQLAA
A0A518KBI5      N-VVD----------------------VEKAI--SPLASLHQQLTEIEVRIEILKAELQS
A0A5C5V6Q5      NTLMD----------------------VDKAI--SPLASLHSQLTDVEVRIEILHAEIQS
A0A517P477      ----------------------------QGGV--ASTIMAEQRHAGLQELRTMLRGEVTR
A0A518HFS8      -GASD----------------------QKGSA--LRQQMVAEHLGQSRRELVQLQSEIRK
A0A7Y5LUV4      ----R----------------------YSSYL--AGWKKVSDRLTDVRLARIRLSAELAA
A0A3M1TFJ0      ------------------------------LI--QQIDANNRALEAVRRDRIALDASLET
A0A7Y5HGA4      IARET----------------------LDSLK--KDLAQTRQRLYTVRREARTIEETLSA
A0A517MY49      -EDNV----------------------VEPMI--QAAMSLNEAALEAKQKRLELQAKLDS
A0A2E6AG00      -ASNS----------------------LHPLV--QRVVQINDSLIEAQQKRIRLQATYDA
A0A1G3A880      -GGQV----------------------VHPLV--QRAVRLNEALVEAQEKRVELQSALAA
A0A2E8ATT1      -GS------------------------IHPEV--QRVLQLNKAIMEVQEERLQLQASLTS
A0A524HC32      ---------------------------SKLNSIYRQLEELNSVITVAEADMITKMAAYQ-
A0A660VT66      ---------------------------WKA--FREELTRLRSEVAQQRNDLRIRTRRCKE
A0A7C2ZTD2      ---------------------------GRQDMMLQRVASLLAELTKIEARRINLEAQVQL
A0A0S8H0S8      ---------------------------GKGSIMAQRLGELSAALTVAEVEAILAKAEYDA
A0A7C2VEF7      ---------------------------QGGNVVFQKLIKLSEALTEAQLMTIEAQADYEA
A0A7V7D6N0      ---------------------------SDAHIVFKRLTRLSSALTDAQLETINAKADYEA
M5S2L2          ------------------------------------------------------------
A0A7V1EK28      ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A7C2VXA0      ------------------------------------------------------------
A0A7C3AA48      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A7C5PFV3      ------------------------------------------------------------
A0A7C3QGD2      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A7Z9UC46      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A7C2ZUK5      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ------------------------------------------------------------
A0A7X8YY48      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
                                                                            

A0A523CME0      ------------------------------------------------------------
A0A7Y3UKB3      ------------------------------------------------------------
A0A7C2JY73      ------------------------------------------------------------
A0A836W298      ------------------------------------------------------------
A0A354PCV3      ------------------------------------------------------------
A0A354PHB4      ------------------------------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A538RV31      ------------------------------------------------------------
A0A1G2XSU7      APTN--------------------------------------------------------
A0A350KD81      ------------------------------------------------------------
A0A356AE44      VTGE--------------------------------------------------------
A0A7Z9UBD9      VREL------------------------------------VSRGSGFDSIAEVLASDVIR
A0A257WQ92      VETA------------------------------------VANNEPRDALEVLIRRFLAQ
A0A2E3Z6T8      ------------------------------------------------------------
A0A7Y2AF64      ISTA------------------------------------LKDGRDLRQHIENLGEFPGR
A0A7C1U6X6      LEAQ------------------------------------VNQAGVADGN----------
A0A7C7UXI5      VDQA------------------------------------VRNGEDLQQYVFSIMDSVGR
A0A7C3SFJ0      IEQR------------------------------------IAIGEA--------------
A0A7X7YIF4      LETR------------------------------------LAAQEATSEDTI--------
A0A7C7WWF7      IRQA------------------------------------VASDTDLRQHLLTLEPFLGR
A0A7V3JIB0      LERI------------------------------------YTEKENELRAKRSDLKRLAE
A0A356ETW1      VQTA------------------------------------VRNGEDLRRHWITVADVVGQ
A0A3L7NJY1      LNRA------------------------------------IANGEDILQFAMEALDSAGR
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      IKQY-------------------------------------------------------S
A0A177PV03      LDHA--------------------------------------------------------
A0A1G2YIM0      LEKA--------------------------------------------------EEETLP
A0A1G3A0W0      LIDD-------------------------------------------------SNNVAFA
A0A7V7D8F5      LKNRLELPDAN------TQDQTTEQE------KLATAVQQPVDQNDP-------------
A0A432MFP3      V----------------RRQAAATDP------RVWVDR----------------------
A0A518HFL0      V----------------RREAGGTDP------RIWVER----------------------
A0A3L7UX05      L----------------RGELAQPPV------IAQRQNLQD-------------------
A0A2E0SHG0      ILSVENLGVQI------ATNTATTEV------SQANQILRAKTADTEFDTLVSARLSLAE
A0A2S8F9B8      LTSSNKAKMEAQAVAGNATAEPGKQE------NSGTGQTPAEDKGNSANSSGEEDADGSS
A0A368KP63      -LTSSNSSSQA------ADKAQAEPS------KEVEKTVSGENAALPVGSDQALVADAAT
A0A518CQB8      LLSVENLEISV------ATNAATSEA------FQAQQYTRAETANTEFDKLLSARLDLKA
A0A7C4QPD3      ELALGDADAAA------AADAEESAA------KALSVS--------------------AE
A0A7C2JZW2      ELLLGALATSD------SAEPAGDEP------RAVEGS-APESAAGPL------SAASQE
A0A836RF42      -------RAAA------ADEPGGNGA------AVAAATLAAEKPGATL------RPGGDK
A0A7D8YCU5      IDDA-------------LRDQKSASLALRTLQFLLEDSGSIAPGEVGGMKVV--------
A0A353BE27      VRKS-------------LNKGHSPES--LMRLLAMVSGGGTASANGAWDLEVFRQEQAQT
A0A5C6BPW1      TEKI-------------GDSLEENPD------IQADLIDTL-------------------
A0A1I3GSP0      LDRK-------------LKDNASREE------LEFWVMHSLS-----------TGT-AGA
A0A517QJV1      LKRR-------------RERGDSRES------LEFWVTYSLS-----------TGTGAGK
A0A3C1QS25      IAQL-------------EEEGKTQAV-------IVFILEQHEKIKEDKEKNS--------
A0A5C6FX55      IKQT-------------VEGAE-DPR------LAFTIVSQLLDR---------PLSLPKE
A0A5C6DS51      ISSY-------------AKRDDTNDV------NDLDKLALLSQKEVTRLKLFLDMTRGET
A0A5C6DSL6      ISSY-------------ADQSKESGV------DDLDKLALLSQKEVTRLKLFLDMTRGET
A0A3M1VG27      VRSK-------------IRALE-EAIASGRSPRELTALVKLFLYSEGHKNAAEAFAAPAD
A0A518GC22      ALKA-------------IESGR-SPE------TIMMLLTQLNNASLTALDSTYSQLLQID
A0A3L7Q373      LKEM-------------MANPEERES------IQTYIMSSLAASSSPGGEGGSGAGLVST
A0A3E0PW54      LEEL-------------QASGESREA------LEFFVIHWMSQ----------GKSSSGD
A0A7C3TAH2      IEAT-------------RIGMEAELQVPEPVDVNAPVIMP-----EDVNAIIAGSTILSR
A0A1Z8MHR4      AQKT-------------IQRHQ-DPA------IVAQVIGLLGSLNHEGMTGIKRALNGEN
A0A5C6EHJ0      ARKA-------------MIENQ-PNE------AILLALNSSLKIA-DGDVDLSKAMSPES
A0A5C6F1H9      TRKA-------------MEEEQ-PYE------AILMALNSSFQATDDAAADFTRSMSPEQ
A0A255QXY0      VTNM-------------RTQQR-HPE------LVARVISELSDEAHD-LGDVPFGMRKLM
A0A517SYI0      AQKT-------------IQRHQ-DPA------IVAQVIGLLGSLNHEGMTGIKRALNGEN
A0A518HX54      AESM-------------RSRHK-NPL------MVAMIIGQLSDVFED-SRLMLNGRSSGS
A0A5B9MF59      AVNT-------------RKLHS-DPV------LVAQIIGHLGSVVDD-FEPLKQIVGPGS
A0A2A2WC24      AINT-------------RKLHS-DPV------LVAQIIGHLGSVVNE-FEPLRQIVGPGN
A0A518KYW8      AINT-------------RKLHS-DPV------LVAQIIGHLGSVVNE-FEPLRQIVGPGN
A0A5C5YZZ0      IREA-------------VKDGTNNYA------ILQEVQYLLEDVKDIDTIQQ--------
A0A518JLD2      KLAI-------------SEEKPLESV---------------LMSLRNLAVDDSKQDLAND
A0A5M6DJ15      QDGE-------------SSAADSEKL-------------------VADSVPP-MDQIPEE
A0A3L7P7S7      AGTL-------------SQTDLLPGV----------------------------------
A0A517N8M1      IESI-------------IRESGDDPL------LGLSIIGELLD--KKFSLPN-SQGRLSD
A0A5C6CW01      VESI-------------YSQ-ANDHL------IAMAVISKLLN--VNLELSNVENEITRN
A0A5C6BXS9      IETI-------------SKE-AKDPL------VRLSIIGQLVG--RTFAIPQ-ATHFNQD
M5U569          IKSI-------------AKE-GKDPT------VSLSIIGQLVG--TTFDIPE-VMQTRQD
L7CND7          IESI-------------ARE-ADDPL------VRLSIIGQLLG--KTFKIPD-SAQISQN
A0A0J1B8S4      IDSI-------------SNE-AKDPL------VRLSIIGQLIG--KNFEIPD-SKRISQD
F2ARR3          IQSI-------------ADE-AEDPI------VGLSIIGQLIG--KTFEVPG-KAVFNQN
K5D8H6          IQSI-------------ADE-AEDPI------VGLSIIGQLIG--KTFEVPG-KAVFNQN
M2AKU0          IQSI-------------ADE-AEDPI------VGLSIIGQLIG--KTFEVPG-KAVFNQN
A0A5B1CRW9      IQAA-------------QLSND-DAVNADMGQLALLSQNEVERLQFFVNMAR-GGARSEA
A0A5C6EI46      ILTE-------------AEERG-DELAGEMDQLALLSEKEVDRLKFFLDMTR-GSSQSEK
A0A5B1CKI2      LKSI-------------VSQSGQDPI------LGLNIIGELLG--KQFSLPN-SGSRLGE
A0A5C6EG84      LESI-------------IRESKSDPL------LALNIIGELLG--KSFSMPS-TQGRLED
A0A5C6F2X4      IESI-------------IRESKSDPL------LGLNIIGELLG--KSFTMPN-SQGRLED
A0A7W5DXF4      IEAI-------------TKETE-DAS------LALSILAQLLG--RKSAFSA-VSAATAS
A0A5C5XTV6      IESI-------------AREAS-DPL------VGMSVIGQLVG--KTFTLPQ-ATQFNRD
A0A5C6AAB1      MTTI-------------SKEAK-DPE------IGLSIIGQLTG--KQFDISS-SAPLTQN
M5T8W8          IQSI-------------AEEGK-DPL------VSLSIIGQLVG--KTFKIPE-TLQTRQD
M5SF00          VESI-------------AREAD-DPL------VRLSIIGQLMG--KTFEMPE-SNQISQN
A0A2G1WDS1      VESI-------------AKEAE-DPL------VRLSIIGQLMG--KTFEMPE-SNQISQN
Q7UVS9          VESI-------------AKEAD-DPL------VRLSIIGQLMG--KTFEMPE-SNEISQN
A0A5C6B601      ADLI-------------RQQNP-DPI------MVAQMIGGSAGLGDPNRFSE-IQSPMAA
A0A517PFU1      -----------------------ESI------RSSMEVGGRRAALAQMASLK-RESAGEN
A0A5B9M8J9      AESM-------------KRRHK-NPL------MVALIIGQLSDVFEDSRLML-KGESTAD
A0A2A2WFP6      AESM-------------RSRHK-NPL------MVAMIIGQLSDVFEDSRLML-NGKSTDS
A0A518L8N2      AESM-------------RSRHK-NPL------MVAMIIGQLSDVFEDSRLML-NGKSTDR
A0A518HQN9      AINT-------------RKLHR-DPV------LVAQIIGHLGSVVDEFEPLR-QIVGPGN
A0A5M6D8H8      ATST-------------FKRHD-DPV------LVAQIIGQMGSDNDGFDFVS-RVDQSPN
A0A1G2ZG92      NEKT----------------------------------------------ILESRRKIVD
A0A2E7D3V4      FEEA----------------------------------IASGQSMESLTMLVKFYISTSE
A0A5B9PER9      NERA------------------------------------------AALGPAGISARIWE
A0A517QSM4      RQPS---------------------------------------LAADGDVNSVSLPAAEP
A0A355GJI7      ------------------------------------------------------------
A0A1Z8MCI4      LPDA---------------------------------------------------DLSDS
A0A517SYL7      LPDA---------------------------------------------------DLSDS
A0A3L7P0L2      LKEM------------------------------MANPEERETLQAWIMNSISSSSSGGP
A0A6M5YVJ1      PEAG-------------------------------------------GKGGAGTAPPGRE
A0A832M9Q8      LKNR--------------------------------------------------------
A0A7W0MCI8      LGDA-------------------------------------------------PKDDAKD
A0A517SCC8      LKDM--------------------LA------RNEPREAIQMRVLWSLSTGTVAAGGAEG
A0A358MY60      QLDT----------------------------------------NATPFNLNE---ELLV
A0A517MNB1      RKAG----------------------------------------GKDIREVVKTLPEITI
A0A3A0DR44      YGQP---------------------------------------------------VASKP
A0A142YJ13      LKSQ------------------------------------------------PTVATTSN
A0A517Z7D3      LQDM-----------------------------------IDKGESRETLEFFVLQWFSSG
A0A7X7KCE7      AEEE---------------------------------LKAKEEQWAAASGEADQLLTKQE
A0A1N6KY57      LHEK---------------------------------------------------AALNQ
L0DK20          LQED---------------------------------------------------VARNS
A0A517XRC2      KVEQ-------------------------------------------------AKTDKTK
A0A6M5YH47      KEPK-------------------------------------------------APPSPVL
A0A660UUK3      YEKD--------------------------------------------------VSEPLP
A0A517ZHG5      ETRI---------------------------------------------TEKIGDTVEEN
A0A1Z8MPL5      YEQQ-------------------------------------------------VGSLALA
A0A7C1EH96      KEEQ--------------------------------------------------LNEPLT
A0A5C1AGE3      ANDE-----------------------------------------------------AAS
A0A2Z3HEL7      RKRD-----------------------------------------------------PKK
A0A142XAP8      --KD-----------------------------------------------------PKT
A0A6P2DEK1      --KD-----------------------------------------------------PKT
A0A5C6C1R5      YQQL---------------------S------ERMRRQAELIATELESRAKANAADSEEG
A0A1G2YRE4      LEQI--------------------------------------------------KEQSIT
A6BZU4          LKAA------------------------------IASGESKETLELLAQQFLMGQTRGQA
A0A2D5GZ77      LKAA------------------------------IASGESKETLELLAQQFLMGQTRGQA
A0A3D3R1Z6      LKAA------------------------------IASGESKETLELLAQQFLMGQTRGQA
A0A517XG00      LKAA------------------------------IASGESKETLELLAQQFLMGQTRGQA
A0A353Z859      RERQ---------------------------------------------------EKIEG
A0A2D6ST10      GQPA--------------------------------------------------------
A0A177QX42      MKDA-----------------------------------LSRGASKEALLLMANMLKPNG
A0A517SHR0      MKDA-----------------------------------LARGASKEALLLMANMLK-ND
A0A2E0AW64      AQGI-----------------------------------HQKVEENLNAQSESIEISDTD
A0A351FZ59      AQGI-----------------------------------HQKVEENLNAQSESIEISDTD
A0A660V239      QEGG--------------------------------------------------LQEVAT
A0A177Q3B7      ITEK-------------------------------------------------------G
A0A2E0X6Y6      VEEA---------------------------------------VATGADVFQHLAGLEES
A0A518GFD7      ASEF--------------------------------DQRLRTQAAELAADSQSEEGGLVA
A0A518GE37      LQSQ-----------------------------------------------ADNPSEEKL
A0A5C6F3H8      DGGN-----------------------------------LAASPVLAAAPMVVPEAVVKR
A0A5C5X072      PLPL-----------------------------------DSDESLAAATPAIAP-TEIQK
A0A5C5WUQ3      QDDS-----------------------------------EPLPSLVASTPFVPPAISIQK
A0A5C6E697      HDKE-------------------------------------GSDFEPEAEILAETALSAA
A0A5C5Z1A3      KGEA-----------------------------------QSAMVLDVNSTFVPPIIKVQR
A0A5C6D2P7      KDSG-----------------------------------VLVSGDPMSDSLVIP------
A0A5B9ML17      EEME------------------------------QANHVKEDAGEFVPEAFIPPPSEVTR
A0A5C5VZJ8      DEKR---------------------------------------LERAKAQHAASTDAGDA
A0A517LX75      IDDL-------------------------------EGAKQEGEPTDIERLALLSAKEIDR
A0A7X7YXL7      YEKT--------------------------------------------------EKLELS
A0A7W1FH76      ARLQ----------------------------------------------------TDPE
A0A7C5W7B3      YQAI----------------------------------------------LTSPDRLTGK
A0A7V2IPP1      LETA-------------------------------------------------KPAPAMD
A0A142XL75      AKPT-------------------PKI------GINSLDEEGAALTLPWDLGVVEIVPPLS
A0A6P2D5D5      TVSS-------------------PP-------GAKSLEEWGPVLTLPWNLGTIEPVPPIP
A0A7C7T8W8      AQTL--------------------------------------------------LTEIQN
A0A5C6B3S0      LKKQ-------------------------------------------------VIGPALP
A0A354GX32      PEKL---------------------------------------TVSETAVEEALNKEMKD
A0A518GIZ9      LQKA--------------------------------------------------QDQGES
A0A1C3EBY9      LQKA--------------------------------------------------QDQGES
D5SX64          LQKA--------------------------------------------------QDQGES
A0A517Z0U7      IEGT--------------------------------------------------QEEGVE
A0A2S8FCC0      MEPR-----------------EAPVE------KDAVVAKKPVVDGDKEAPEASVANSDEE
A0A1Z8MBT6      IEAG---------------------E------NPLAVISGDLLEEMDEQDFTPPRSMVKK
A0A517SXN9      IEAG---------------------E------NPLAVISGDLLEEMDEQDFTPPRSMVKK
A0A7X7F3C7      IETS------------------------------------IENGDDLQQHIMQVADVVGQ
A0A255QXF5      ---------------------------------IRNPSADDNIDDLPMTHFVPPYIPVVK
A0A518KYQ0      ---------------------------------IRNPLSSSELGESSIEEFVPAVEKVKR
A0A5B9QX47      RE-------------------------------ELRGEQGLESPED----------SVKR
M5T666          PV-------------------------------ALPPSETAQLPDA-PVVPTLAETEVQK
M5U6N6          P--------------------------------ALPLENTSSSPQAIPSVPAVADIKVQK
A0A517M0G2      NA-------------------------------AMGEESANTDLDRSKVR----------
A0A5C6AST1      ---------------------------------HNAGIPDKTDIDVKLPELIIP------
A0A5C6C951      ---------------------------------HEAGVSGESDRNIELPKLEIP------
A0A5C6C5T3      LPAL---------------EVGGSKV------PDPAPAAA---------------VEIQK
A0A2A2W6A9      ---------------------------------IRNPSESDDIIVPSVAEFVPPEIRVQR
A0A518HQS9      ---------------------------------IRNPSASDNIIVPSVAEFVPPVIQVER
A0A5M6DFE6      QR-------------------------------QDRENLASNGENLDYPKFVPPIIDVRR
A0A5C6F286      SG-------------------------------FSAGGAAKTGLTPGSVEAIVVKRAEPR
A0A517NGN1      ANEV---------------EIENVSD------LAAADSVSVMDLDAAGVAFVPVRREVRR
M5RUI3          ---------------------------------AAGEAEFVPPVEAAVIPSAVVERHVPS
A0A5C1AAF0      LKAG---------------------------------------------------AVVPR
A0A3B8ZJM2      VETA-------------------------------------MKSGDFRAQELLLLINDSS
A0A1U7CLW1      LASK------------------------------------------------PELEPTSN
A0A5Q3LBQ3      YQEA-----------------------------------IHARPVELSQMEVEES-----
A0A142WPR7      LKNA-----------------------------------MARGGNREALALIINANKESR
A0A517T4K9      LENA-------------RKEAEERNR------ASEETESVADDKKSVTDTDGNSSDSEST
A0A7C6B2Q1      LKKA-----------------------------------LRDKAAQLQVTERELDAAART
A0A2Z3GZZ5      LDAQ-----------------------------------VE---------LVSRTGPAPE
A0A4V0I6L6      IENR-----------------------------------LK----QIRDAGKTRAERLAT
A0A7C4QQT3      IDAA-----------------------------------VR-EGAHREALELMIRQFLNH
A0A7V9G5K3      TQAL-----------------------------------MG-------MVAVADQQKDPA
A0A7W1JAD6      SQAL-----------------------------------MG-------MVAKADEQKEPA
A0A518KBI5      IEET-----------------------------------PI--------------VTQTH
A0A5C5V6Q5      LEES-----------------------------------EV--------------TIAPH
A0A517P477      TELE-----------------------------------LIRERAKQSYRDSVDDEFELG
A0A518HFS8      ARAE-----------------------------------VTVLAEDAATPAAAAHRDLGF
A0A7Y5LUV4      L------------------------------------------------------SAYGS
A0A3M1TFJ0      IRRV-----------------------------------LE-QGRPLD------------
A0A7Y5HGA4      AGLS-----------------------------------VRADGEGRKALHPPPAEPIGE
A0A517MY49      VKES-----------------------------------VE-QGETIN---LGADSTAGQ
A0A2E6AG00      VQLA-----------------------------------MR-EGRDLRQYVTAVEPVVGR
A0A1G3A880      IQNA-----------------------------------VR-SGADLQHHLLSVEEAVGR
A0A2E8ATT1      VRSA-----------------------------------VR-SGKDLRQHLINLEPVVGD
A0A524HC32      -QAL----------------------------------------------------GDET
A0A660VT66      IEKV----------------------------------------------------RSEG
A0A7C2ZTD2      LEQT----------------------------------------------------KE--
A0A0S8H0S8      ARAM----------------------------------------------------MNDP
A0A7C2VEF7      VKAI----------------------------------------------------ADDP
A0A7V7D6N0      ILSM----------------------------------------------------ADES
M5S2L2          ------------------------------------------------------------
A0A7V1EK28      ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A7C2VXA0      ------------------------------------------------------------
A0A7C3AA48      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A7C5PFV3      ------------------------------------------------------------
A0A7C3QGD2      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A7Z9UC46      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A7C2ZUK5      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ------------------------------------------------------------
A0A7X8YY48      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
                                                                            

A0A523CME0      ------------------------------------------------------------
A0A7Y3UKB3      ------------------------------------------------------------
A0A7C2JY73      ------------------------------------------------------------
A0A836W298      ------------------------------------------------------------
A0A354PCV3      ------------------------------------------------------------
A0A354PHB4      ------------------------------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A538RV31      ------------------------------------------------------------
A0A1G2XSU7      ------------------------------------------------------------
A0A350KD81      ------------------------------------------------------------
A0A356AE44      ------------------------------------------------------------
A0A7Z9UBD9      DL-----------------------------RREQSELI-----------RKEAQLRARY
A0A257WQ92      DG------------AAGSEFQQQQQQDIAIFESRLLPLI-----------LEEKQLLRDF
A0A2E3Z6T8      ---------------------------------------------------------MHY
A0A7Y2AF64      EL---------IENALGVS--NGHVASVSALEKKLFDDQ-----------NQLKSYAQFY
A0A7C1U6X6      ---------------------EVAIAGTDQPPLSYYRQD-----------PQWQTLDERF
A0A7C7UXI5      QV---------LLQRLGLD--PGDTYTVSRMNEQLLQNT-----------ARLKTLLQRY
A0A7C3SFJ0      -----------MLKKMGEEGVPDETKQRETLKRKMMEAA-----------LAQDPWLSYA
A0A7X7YIF4      -----------LPLELQEK--KNAIINTDPIMQGLLAEQ-----------RRYESMVAEA
A0A7C7WWF7      EL---------LLSAMGLN--PNELKAAEDLKQKLLLSR-----------ARHRKLAEHF
A0A7V3JIB0      QLGAGEKENLSLRQQIALQ--QFAAFRSELINTQFKVMR-----------LRWELKAKEA
A0A356ETW1      EM---------MMRSFGLS--PADIQTQASLEQTLLADQ-----------ALLESMRGRV
A0A3L7NJY1      QL---------IEQSMGLG--SSDALHVQRINEELLDLR-----------SRLRDANLKY
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      KDPTLTKLIPEIVKDGSINTLKA--------KYADLQAN-------------KTMLSEKY
A0A177PV03      --IKIGQGAEMFNDMRRVSAHPQTGNTKLDEKLWELYMQ-----------MALLQADYGE
A0A1G2YIM0      LEKVLTMKNEILRNDAQEQSLSS--------QISQLEQA-----------LIVANQTLTA
A0A1G3A0W0      SSPAIQSEYSDDEEWRKLD---------YDVRAMKLQIA-----NSG---LTS-------
A0A7V7D8F5      ----------------TRRSYIN-----ADPTLIAFIAN-----LTLLEQELIVAELRFA
A0A432MFP3      ----------------RIEQVFL-----SDERVNALRGA-----IRDVEARIAEARTRIR
A0A518HFL0      ----------------RIEQVFL-----SDPDVRSLREG-----LKDIQVQIDEAQGRIR
A0A3L7UX05      ----------------AVYQAFY-----ADRDVADLADA-----LDDAKARLDKLNKVSR
A0A2E0SHG0      ----------------RQSEFGA-----NHPKVREAEEN-----LRDLEMLLDRSKEEIP
A0A2S8F9B8      DASEEIDLESIEYSETEMNEAIA-----SDPISVKLQAE-----LERFEE--AKYTLTPA
A0A368KP63      VEGEQSEEIEPQLSEVEMNEAIS-----SDPISVKLQAE-----LDRFEE--PQYTLTPA
A0A518CQB8      ----------------KKTEYAD-----NHPKVIEAEEN-----LQDLEKFLVEKKDDVP
A0A7C4QPD3      ----------------DLRNALL-----SDPEYASLMRQ-----LRSAETLLAEWQKRVR
A0A7C2JZW2      ----------------ELSALLM-----KDPEFVRLART-----HEGHKRLLDEWRRRVN
A0A836RF42      ----------------STKEAPQ-----VDPAEVAENSP-----KDIFSVYLESLQQRIA
A0A7D8YCU5      --------QESDRELE------------IQEKLAPMVIR-----LEL---LKRQYAD---
A0A353BE27      --------RIRTDEMSRRL---------EQEQLNPLRIQ-----LEV---FSNQLGE---
A0A5C6BPW1      --------IERDPKMVDLS---------IKADAIEATIR-----RYE---ETLKDTE---
A0A1I3GSP0      GGGNGGGGASIAGPPEKGA---------LDSQLLTARLL-----EQR---LLHSLGD---
A0A517QJV1      SASSGGGAGALSGPPEKAA---------LDQQFLTARLL-----EQG---LLHSLGA---
A0A3C1QS25      ----------------------------EETDILELRLN-----LER---LLFKFGE---
A0A5C6FX55      LDATRLAMGADDGELASME---------VQEELAPLKAD-----RDA---LAAELGK---
A0A5C6DS51      QSVAFQMDQPLRAEAARAQ----------YNRLLDLLQK-----ERT---MVDVYGA---
A0A5C6DSL6      QSVAFQADQPLRAEAARAQ----------YNRLLDLLQK-----ERT---MVDVYGA---
A0A3M1VG27      APDV------------------------VRTQLVPLYLE-----EQR---LLSEFGE---
A0A518GC22      DNDLKNRLNSKSAQI-------------EQQILFPLQVE-----ERV---LLDSVGA---
A0A3L7Q373      -------------PTGKAE---------LDQQLLVNRML-----ERR---LLLVLGE---
A0A3E0PW54      GESGGGGGSLLTEPPVRAE---------LDKRFLDLQLM-----RDR---LTVQLGK---
A0A7C3TAH2      NQYINADPLVQDLTRRIID---------LEQELIVARQS-----LTP-------------
A0A1Z8MHR4      Q-------RQDDLTLQRLE---------VQRKLIPLQIK-----RDQ---MELQFGP---
A0A5C6EHJ0      RWELEKIRKKPLLSAAERF---------RQERLLPLELE-----RET---LVESVGR---
A0A5C6F1H9      KWELEKIRSKPLLNAGERM---------RQESLLPLQLE-----RES---LVDTVGR---
A0A255QXY0      D-------VKEDIGIQQIE---------IEKSLVPLKIK-----LEQ---MQMAFGA---
A0A517SYI0      Q-------RQDDLTLQRLE---------VQRKLIPLQIK-----RDQ---MELQFGP---
A0A518HX54      L-------ATDDLEMQKIE---------VEKKLVPLVIR-----REQ---LEMAYGR---
A0A5B9MF59      A-------TTDDLTLKKLE---------VERTLIPLQIK-----RDQ---LELAYGS---
A0A2A2WC24      A-------APDDLTLKKLE---------VERALIPLQIK-----RDQ---LELAYGA---
A0A518KYW8      A-------APDDLTLKKLE---------VERTLIPLQIK-----RDQ---LELAYGA---
A0A5C5YZZ0      ---V----IEADVPNSEWE---------LQTKLMGLRVR-----ADT---LASQFAP---
A0A518JLD2      AVAL----KMSSIERKRIVDQLRTSARIREEKLLPLEIE-----RKK---LSRSFGS---
A0A5M6DJ15      ---M----RLTEVEVSTIL---------ASDNIYQRLYNESRQVKDEIELYRLEYGEGMV
A0A3L7P7S7      ----------GDSPASEVN---------LTRNQEIRILE-----RKVKQLARTGLGK---
A0A517N8M1      ---L----QQGDSQLASNN---------LAQELVPLMIE-----RDK---FEAEFGP---
A0A5C6CW01      ---L----VDADVELAQLK---------LDQQLVPLIIE-----RNK---MANEFGA---
A0A5C6BXS9      ---M----RESDTELKQLE---------LDQKLVPLMIE-----RNK---YAAEFGE---
M5U569          ---L----REGDAELKQLE---------LDQQLVPLIIE-----RNK---YAAEFGD---
L7CND7          ---M----REGDAQLAQIE---------LDQQLVPLMIE-----RNK---FAAEFGE---
A0A0J1B8S4      ---M----RDGDVELAQIE---------LDQQLVPLMIE-----RNK---FAAEFGE---
F2ARR3          ---V----REGDEELAQIK---------LDQQLVPLMIE-----RHK---FAAEFGE---
K5D8H6          ---V----REGDEELAQIK---------LDQQLVPLMIE-----RHK---FAAEFGE---
M2AKU0          ---V----REGDEELAQIK---------LDQQLVPLMIE-----RHK---FAAEFGE---
A0A5B1CRW9      FQAE----QPMRQEVAKAH---------YNR-LLDLIQK-----ERA---LSDTFGS---
A0A5C6EI46      FQAE----APVRQEVAKAQ---------YNR-LLDLIQR-----EKA---LSDTFGK---
A0A5B1CKI2      ---L----QQGDRILATIG---------LDKELVPMIIE-----RDK---YAAEFGP---
A0A5C6EG84      ---L----QQGDAELAKNN---------LAQELVPLMIE-----RNK---FEAEYGP---
A0A5C6F2X4      ---L----QQGDAELAKNN---------LAQELVPLMIE-----RNK---FESEYGP---
A0A7W5DXF4      RGVA----RDTDLQLAEID---------LDQRLIPLVIE-----RIK---YAEQFGE---
A0A5C5XTV6      ---L----RESDTELQQLQ---------LDQKLVPLMIE-----RNR---YAAEFGD---
A0A5C6AAB1      ---M----REGDMRLAQIE---------LDQQLVPLMIE-----RNK---YAAEFGD---
M5T8W8          ---L----REGDAQLKQLE---------LDQQLVPLIIE-----RNK---FAAEFGE---
M5SF00          ---M----RDGDAELAQIE---------LDQQLVPLMIE-----RNK---FAAEFGE---
A0A2G1WDS1      ---M----RDGDAELAQIE---------LDQQLVPLMIE-----RNK---FAAEFGE---
Q7UVS9          ---M----RDGDAQLAQIE---------LDQQLVPLMIE-----RNK---FAAEFGE---
A0A5C6B601      NVLG----LGDDLELERLG---------VEQQLVPLETE-----RAE---LISQFGD---
A0A517PFU1      PAI-------AELGFEEQH---------LD-----LILQ-----LEE---ARETKGE---
A0A5B9M8J9      LTT-------DDLELQKIE---------VEKKLIPLEIQ-----REQ---LELAYGR---
A0A2A2WFP6      LAT-------DDLEMQKIE---------VEKKLVPLVIR-----REQ---LEMAYGR---
A0A518L8N2      LAT-------DDLEMQKIE---------VEKKLVPLVIR-----REQ---LEMAYGR---
A0A518HQN9      TAP-------DDLTLKKLE---------VERALIPLQIK-----RDQ---LELAYGA---
A0A5M6D8H8      PVP-------GDLELQKIE---------IERSLIPLEIK-----REQ---LELAYGE---
A0A1G2ZG92      SNKKLKEMEKFRKESKELTRSDA-----LKSLQTKLDGY-----------LVDIAQKSVE
A0A2E7D3V4      KAVAPQTIVTGLPGQENTAQLLP--------LLIQEQRL-----------LRDLGADH--
A0A5B9PER9      MREQQQLSGERYQPQRGSQTATL--------RMRLLEAE-----------ANAELIRQKV
A0A517QSM4      PPVPQELLNERINSSPEYQRISN--------SIRELEWS-----------ITDKSQNLGE
A0A355GJI7      ------------------------------------------------------------
A0A1Z8MCI4      EGVRVAELEDGEATDLTRLRAGL--------VAEKHRII-----------VEDSENVFK-
A0A517SYL7      EGVRVAELEDGEATDLTRLRAGL--------VAEKHRII-----------VEDSENVFK-
A0A3L7P0L2      GAEGGSSGGGLLSSPAGKMELDQ----------QLLMAR-----------LLERRLLLVL
A0A6M5YVJ1      AVVSPAQIDEELRQDADLRELEA--------RVVQAQLT-----------LNATKALFNP
A0A832M9Q8      PGAEEGMFRATVNPDADGQIEKW--------SAERIRLQ-----------MQDNVLESKR
A0A7W0MCI8      ELVPEDVLQNLLAREPAYADAKS--------RVDQMKRF-----------VTATENRVAA
A0A517SCC8      GGGGGGGGGSILASPPGKAELDS----------QLLAAR-----------LLEHRLLYVL
A0A358MY60      PEPTNADIKRFVENSQEVTRQRG--------IVAEQETI-----------LRSLEKNGLK
A0A517MNB1      PEPTSAEIARYVSSDGEVAKHRG--------LLADREKK-----------IRGMEDAGFA
A0A3A0DR44      PKIPDDVLDVEVKMHPEVREQSR--------VISAMRLQ-----------LEDIEKKSRQ
A0A142YJ13      QDFASVEVREATSPDPKMMLIQD--------RISELRGR-----------QARLSRNARK
A0A517Z7D3      SAATQGSGGAGLTEPPGKAQLDN--------RLLEAQLL-----------LSRLMQHLAD
A0A7X7KCE7      LALRDVLADRIVEESPEVRQQKD--------IIAAKMAN-----------LKETERLVAK
A0A1N6KY57      MMVTPAMIADAISRDRSIELLKD--------KEALVQRA-----------IDRVSHLVRN
L0DK20          SMITPAMIVDAINRDHSIEVLKE--------REAAAQKA-----------IDRIYHIARN
A0A517XRC2      LDADTLMLRDWVAKHPRVDTLVK--------QKLAREID-----------LGQAKTAAGT
A0A6M5YH47      VD-EQVRTDAGVIKAKAAWEYTK--------SVLEREIL-----------KAADPDANAY
A0A660UUK3      EINRLQEQSAYINTDPTMQTLVA--------NIRQYEAQ-----------IITDKQTMTD
A0A517ZHG5      PDIQAEMIETLIDRDPKMADLLV--------KADAIEAN-----------IRRYEETLKD
A0A1Z8MPL5      GSILPEDIEAELSENEDLAEYQV--------SIAELQAE-----------LDAYKQIYRD
A0A7C1EH96      AEDIADQIQMRVENDPTIVALRQ--------DIRRYEQI-----------IRDGQATMLD
A0A5C1AGE3      -------LQTKKFTDEQIEAAL---------------------------------LRDKE
A0A2Z3HEL7      FAADTQLLKLAVARDKRVVAANE--------LWQAANDL-----------YTKE-LKNSN
A0A142XAP8      -PPDPAIVTQLVAADVRVKAAKS--------AYTARKEY-----------ADKEATKATN
A0A6P2DEK1      -PPDQAIVAQLVAADVRVKTAKS--------AYTARKEY-----------ADKEAAKATN
A0A5C6C1R5      EEDQESSVLTAYETDRILSSDRDYQSLLAMARSLEEEIE-----------LYKTRYGKGM
A0A1G2YRE4      PEDMLRIRNENINSDPMVQELTR--------NIVSLERD-----------LITAKQMFAA
A6BZU4          ANGNTSEGQIASPGTSQVDRARTALETHLMPLLIQKNRL-----------ERDFQKNH--
A0A2D5GZ77      ANGNTSEGQIASPGTSQVDRARTALETHLMPLLIQKNRL-----------ERDFQKNH--
A0A3D3R1Z6      ANGNTSEGQIASPGTSQVDRARTALETHLMPLLIQKNRL-----------ERDFQKNH--
A0A517XG00      ANGNTSEGQIASPGTSQVDRARTALETHLMPLLIQKNRL-----------ERDFQKNH--
A0A353Z859      KDLDEQLIDLHLDRRNEVLSAAY--------TVEKEREA-----------LSRREGKGPA
A0A2D6ST10      -EVPDDVLEAALSRDPQYAAASK--------KVAELERR-----------VQQNDVE--L
A0A177QX42      DEKSDPAASLQPKVDPFMEKMMP--------LLLERDTL-----------LERVGESH--
A0A517SHR0      PEKSNQTESLQARMDPFMKEVTP--------LLVERETL-----------LETVGEGH--
A0A2E0AW64      LATMVDQSADMLQHNEDLARAQA--------AIKLLRKE-----------LAEIEQIAAG
A0A351FZ59      LATMVDQSADMLQHNEDLARAQA--------AIKLLRKE-----------LAEIEQIAAG
A0A660V239      PGSLIERQNAIVNSDPIIQALTN--------SIMQYEEL-----------IVVGQQTMT-
A0A177Q3B7      LSGSATPIDLEVDADPSIQTLLA--------HKARVEKD-----------IERIEQVSVR
A0A2E0X6Y6      VAAQMLQMTLGISEQDMTMLAEQ--------ESRLLKTQ-----------EELQDAVNYY
A0A518GFD7      AREPQSDVSESLLRTPDVLRLED--------DIARIQSQ-----------LTVMRAS--V
A0A518GE37      PPLNPRDIDYLVAEDSQVQKAKL--------ALEDVKTK-----------IRNIEREERQ
A0A5C6F3H8      GKPSESEIASHLEADPRVAELVQ--------KVNRYRAS-----------VLDMEVNDMV
A0A5C5X072      QVIRERDIENGIDADAKVRAAKA--------VVNRYTSI-----------ILDIEVKDMV
A0A5C5WUQ3      QVPTESQIAQFVANDAEVREAEM--------VYRKYQGM-----------VLEMEISDLV
A0A5C6E697      RKPSEANIMALVNADPEVLEAKS--------RIARYKKI-----------SLDMEQNDLV
A0A5C5Z1A3      REPTEDDIAKIVQRKPEVVNARE--------RIRRYEGM-----------ILNMEDTDLV
A0A5C6D2P7      -EPSEGEIASWVNADTDVVEAKS--------MIQRYKSI-----------AMNMEDSDLV
A0A5B9ML17      NVIGPGDIANYVNSDESVVEALQ--------QIGRYEAQ-----------IVRMEDLGTW
A0A5C5VZJ8      APDPAAAEKAAFERNAEWRGLRR--------ELQTARDN-----------LAAGLRRWD-
A0A517LX75      LKLFIEVTKGEVDSQQFQIDQPMRSAALDAEYEKVLSLI-----------LREQALTADF
A0A7X7YXL7      PEQIVAARTEHINSDPMVDELSK--------NIVQMQRE-----------LIAAQQTHL-
A0A7W1FH76      ARLQSLLHIEAVSQDATVITTNR--------AMGEIRDH-----------ERQLSQRYL-
A0A7C5W7B3      MPVPLTLVDELLRKELLLDDYRR-----------------------------------KY
A0A7V2IPP1      ATERLMRRQQYIREDPTLQLLAA--------RVAQLEQT-----------LVEARQQYT-
A0A142XL75      PAELRAQIDAEIRQDAQLKQLAE--------AAASAKER-----------LNKVKERYQE
A0A6P2D5D5      PAESRSRVEAETRQDAHLKLLDE--------AVVASKER-----------LNKVKERYQE
A0A7C7T8W8      EELSQFQQIRAVESDPQVTRLSN--------QQLNATTA-----------IAKYEELG-Y
A0A5C6B3S0      DAVPNAEIDAYIAADASVMVLEN--------KVANLNAM-----------IAKINEEIKS
A0A354GX32      DNLTKAQLEGLVKDQADLAELQR-------------------------------RLIPAD
A0A518GIZ9      TSTMEMLIRRFIANDGSGAELQQQQQEISAFENRLLPLI-----------LEEEKLLRDF
A0A1C3EBY9      TSTMEMLIRRFIANDGSGAELQQQQQEISAFENRLLPLI-----------LEEEKLLRDF
D5SX64          TSTMEMLIRRFIANDGSGAELQQQQQEISAFENRLLPLI-----------LEEEKLLRDF
A0A517Z0U7      LAIPEAVVDSQLLEDPGFQKLYR--------STRQKEVQ-----------LSTLRDR--L
A0A2S8FCC0      SEEIDFELERIMAADEVMVAFKS--------QIMQLENE-----------ILAIEQTAAP
A0A1Z8MBT6      RLVTRPVLDQAISQXRKVVTQKG--------VVDRHQAA-----------LIAIKADRRF
A0A517SXN9      RLVTRPVLDQAIGQHRKVVTQKG--------VVDRHQAA-----------LIAIKADRRF
A0A7X7F3C7      EMLMRSLGFNPRDTATQAALERD--------LLEDHAEL-----------KAMREHLA--
A0A255QXF5      GKIDDSDVQDFIEKDESVKLANE--------RYERHRRE-----------VVNLEVAEGW
A0A518KYQ0      GTIDPKRLSDFISRDKEVNRTKE--------MYEIYRKQ-----------VIELEVSERW
A0A5B9QX47      IEPTPEAIAQTVANNPSVKEAQA--------HIARYKKI-----------MLEMEDNGRI
M5T666          AAIREADIQEAIEGDVKVREASR--------VVGRYQAI-----------LLDLEVKDMV
M5U6N6          RIVNESDIKSAVEDDVKVREAKR--------VVDRYSAI-----------VLDLEVKDMV
A0A517M0G2      -TPYPEEIDQYVEADPSVVTNRK--------LLAERESR-----------VRNLEDRGLA
A0A5C6AST1      -EPTSAEIERFVSNDSTVKRHAA--------RIAQQEAI-----------VRSIEDRDMV
A0A5C6C951      -EPTTAEIDRYVESSAEVSRYEN--------RVAQLQGM-----------IRSMEDGDLV
A0A5C6C5T3      ATVSEREIENAIDGDAKVKAARA--------VVDRYNAV-----------VLDLEIQDMV
A0A2A2W6A9      GEIDPKRLAAMVENSRDVFLAKE--------RYEIYRKQ-----------VLELEISERW
A0A518HQS9      GEIDPDRLESLILNDKVVARAQE--------MYEIYRKQ-----------VLELEISERW
A0A5M6DFE6      DILDPDEVNAMAENDPAVVEARQ--------RYNYFKDR-----------VFDMENNDVA
A0A5C6F286      ESQILAAIEN----DSKVRETVR--------KVDRYRAM-----------ILDLEVKDMV
A0A517NGN1      QSISSNDVDRMAQTDADVLQARK--------KAAYYEGL-----------RLNMEASDLV
M5RUI3          EQEILNAINQ----DAKVSEALS--------RVAHYKAI-----------LLELEDSDIV
A0A5C1AAF0      TPAESAIKQY-VDSDPVVKDLEK--------RQAQIEAR-----------VRETERVATK
A0A3B8ZJM2      DLVKSTIFDQLFEDQDLAGKAMLESEKLEQSELLLLQGE-----------LDHLLEKY-G
A0A1U7CLW1      QTVSTLDTLSTAEVDPQVMELRS--------RLAELRRK-----------HASVKRISRQ
A0A5Q3LBQ3      -----------VERNVEVQELKT--------KLATMRVM-----------MLDTERRAAD
A0A142WPR7      ENGLPQEKSPVTELFPLLLDEQM--------LLETL-----------------------G
A0A517T4K9      HNIPEELILARLAQEPQLESQAT--------EVLQLERQ-----------LETLKDRV-K
A0A7C6B2Q1      DSLMLQLLMREAELKGLVAQTRD--------------VV-----------RPEMAGRYGN
A0A2Z3GZZ5      DRQLAFVQLTAQYRAPVVPNAANGGELTGTAALRALEFE-----------RRELTQATGL
A0A4V0I6L6      MAKLGIANDR-PFLFGDVKDPES--------MLAHLKYK-----------KGELGTRL-G
A0A7C4QQT3      DGTAAAE----QRRQQEITVFEN--------RLLPLLLE-----------EQKLLRDY-G
A0A7V9G5K3      ERIAGLMRIEPIRTNAVVMEQQR--------RVYDLIGK-----------ESSLAQKY-L
A0A7W1JAD6      DRVINLLRIEPVRTNPVVIEQQR--------QLYDLIGK-----------ETALAQKY-Q
A0A518KBI5      EDRTGSIDLE-VSMHAEVRQREQ--------AILALESQ-----------MRQIQQLTKQ
A0A5C5V6Q5      ADRAGAIDLE-VNMAPEVVQRER--------ALTGIADQ-----------MRHYQRVSKR
A0A517P477      DEQLAALVAD-LPEYKQAEEVAR--------AAETYVGK-----------LERSKGA--D
A0A518HFS8      EGLIG--------RDPVVAKLRA--------DLAEYSGR-----------LEQVRRIVRN
A0A7Y5LUV4      DGATGMFHPS-FHKTRALEQLGE--------ERARIAEV-----------IAVEAHRL-K
A0A3M1TFJ0      ------MAPP-VAQSPVVSMLRR--------NLAEAELE-----------LAGLEQRY-G
A0A7Y5HGA4      DPRLSERVLA-LDVVAAHPRAQK--------SVEIIEEQ-----------EAEVRALL-T
A0A517MY49      EMLLASLGLS-SRDTRVLAEQDK--------RLLTAEEE-----------LRNIEPFY-G
A0A2E6AG00      EVMLAALGLN-QHDVDAVAELDQ--------QLVADRTK-----------LANIRVHY-G
A0A1G3A880      EILLTGLGFN-TRDAAVQANMER--------SLLEYQSE-----------MKSMQQFL-G
A0A2E8ATT1      RLISSALGLS-PLSSQLVNDMER--------KLIEDRSK-----------LAMYRGHY-G
A0A524HC32      SNLPQVLKSNL--------------VANLKDKYAQLRSE-----------YEDLKTTFHD
A0A660VT66      GDLSNL-----------LFLQEDPLLAEMRKEILSLEKE-----------LSIARLSYGP
A0A7C2ZTD2      ----QVIAPEDLLKMRQEYINADPAVETLTVNIVQLDQE-----------LIVANQTLAS
A0A0S8H0S8      GRMRYFAEQ----GSRSHLAQAGPDDAELAAAINQMQLQ-----------LVALKRQRTE
A0A7C2VEF7      AQVKQFAAALPTVGVRIFINDT---ETQLQSELRNAEIE-----------LKNTRYHVTE
A0A7V7D6N0      ENIKQFAMAQPTVGVRVFVTDI---ETQLRTELREIEVE-----------LNNVRYHCTE
M5S2L2          ------------------------------------------------------------
A0A7V1EK28      ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A7C2VXA0      ------------------------------------------------------------
A0A7C3AA48      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A7C5PFV3      ------------------------------------------------------------
A0A7C3QGD2      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A7Z9UC46      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A7C2ZUK5      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ------------------------------------------------------------
A0A7X8YY48      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
                                                                            

A0A523CME0      ----------------------------ESASFTEKEKKGENNS----------------
A0A7Y3UKB3      ----------------------------ESASFTEKEKKGENNS----------------
A0A7C2JY73      ------------------------------------------------------------
A0A836W298      ------------------------------------------------------------
A0A354PCV3      ------------------------------------------------------------
A0A354PHB4      ------------------------------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A538RV31      ------------------------------------------------------------
A0A1G2XSU7      ---------PELARKESLLN--------ALKQRLEELRQQADKN----------------
A0A350KD81      ---------PDLDAVNRSIE--------TIINLYRRQGLDISAD----------------
A0A356AE44      ---------PELVTGNDPIA----------------------------------------
A0A7Z9UBD9      GER----H-PSIIEIKDERRD---------------------------------------
A0A257WQ92      GPD----H-PDVKLKRQTIQ--------TALDFYRRQGVRLPEE----------------
A0A2E3Z6T8      GPN----H-PRIIELQQDVR--------SLDQYINNYHSGAGDR----------------
A0A7Y2AF64      GPE----H-PKVVQLADSID--------STRVYLEDLRQQAIQA----------------
A0A7C1U6X6      REVRHQID-VSLLKPTHQNMKRMEKELAYAEDALRRRAAELDEE-------WRNRSSVVA
A0A7C7UXI5      GPA----H-HEVQEAQERIR--------IAEEYLRNRHRNQLAQ----------------
A0A7C3SFJ0      QQQIALLD-IRIFEEKQRVVDENAPSIARMRERQQKYREGMEKR--------------IA
A0A7X7YIF4      EQTMSDKN-PELLRRKGMLENLTGRVETRRSQVAKEFDETYKNQ----------------
A0A7C7WWF7      GPS----H-PERLELQQAIE--------DSEKYLEQMRSGSTSR----------------
A0A7V3JIB0      EAQ----R-PATVEVTDVELEQFLRSDPVAIQLLQRDSELRQRRQEAQSVLTWRGSAEHL
A0A356ETW1      GMS----H-PSMIAQQEKVR--------LAREYLQRNQERAAES----------------
A0A3L7NJY1      GVN----H-PRIVAINDEIL--------VKESYLQQLPMLQQQR----------------
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      GEK----H-PNIANIDLQLK--------EVENRIKLETLSLITK----------------
A0A177PV03      GH-------PQIQSVKRQIE--------AVRALYYGAKAKEVEM----------------
A0A1G2YIM0      EN-------PEIKRRSELLE--------NMKKKLRAREEELTKN----------------
A0A1G3A0W0      --K----H-PDMIRMEKNLE--------FVEESLRLRQMQLNER----------------
A0A7V7D8F5      PT-----N-PELRDKAVVIE--------TLKERIEQRKTEVGEM----------------
A0A432MFP3      NPG----D-PALSRLMSQRQ--------ILMEQYEQLWSDLEPT----------------
A0A518HFL0      NPA----D-PAVSRLKVQQQ--------RLLERYNQLWADLEPA----------------
A0A3L7UX05      GQ-----D-VSHREMNDRIT--------DLKSKIKVLWERRRSA----------------
A0A2E0SHG0      DP-----S-ATNPEPIEPIQ--------LVSAYVTQLEKDLEDI----------------
A0A2S8F9B8      AY-----E-RYRQTNEAAIS--------TLESRLEKRREHLVLL----------------
A0A368KP63      AY-----Q-RYRETNSAAIK--------SLESRLKERREHLELL----------------
A0A518CQB8      PP-----S-TEALTPIDTSD--------LIRAYVSLLEKDLEDL----------------
A0A7C4QPD3      DD-----H-PAIAKYSAAVK--------DAVAKLAARHRAIEPA----------------
A0A7C2JZW2      GP-----H-REIERLELAVD--------QAAEQLAKRRDEIEPA----------------
A0A836RF42      A--------------------------------IDRQTEELDRM----------------
A0A7D8YCU5      --K----H-PVVSELEEEIA--------ATERVLAGLEASRNER----------------
A0A353BE27      --E----H-PSVATLRAQVQ--------GLEKQLEKIREGERLY----------------
A0A5C6BPW1      --N----N-SVLKSARREQK--------TTQEAIAKYREELRPV----------------
A0A1I3GSP0      --D----H-TQVRNVRRQIN--------TILDFYT-------------------------
A0A517QJV1      --D----H-TDVRNVRRQID--------TILNSYA-------------------------
A0A3C1QS25      --D----H-PEVKIVRNEI------------RAWEELMISRGIS----------------
A0A5C6FX55      --G----H-PHVKVLDNKIA--------SLEKALDRLGQSRSSR----------------
A0A5C6DS51      --N----H-PLVESTQQEIQ--------VIRQFIAQNAPAEEPV----------------
A0A5C6DSL6      --N----H-PLVESTRQEIQ--------VIKQFIEQNAPAETQA----------------
A0A3M1VG27      --D----H-PDVIAVRQRME--------ALRRLARRTAADDSLD----------------
A0A518GC22      --G----H-PSVGIVQKKVE--------SVKRQIAELRESE-------------------
A0A3L7Q373      --N----H-ADVRNVRRQTE--------TILDFYYRQGLTPPNL----------------
A0A3E0PW54      --D----H-PNVIKLHQQLA--------TLTD----------------------------
A0A7C3TAH2      --D----N-PTIQRQERLLE--------DFRQKLEQRKKEVAAD----------------
A0A1Z8MHR4      --S----H-PEVKSIALQIE--------SSQRKLNELNQLMSNR----------------
A0A5C6EHJ0      --D----H-PAIDTINKRIA--------VIEKMIETVGENETKL----------------
A0A5C6F1H9      --D----H-PAIDTINKRIA--------LIEKTIEKVEENEKRL----------------
A0A255QXY0      --S----H-PEVVSLSTQIE--------ASQRRLHELNLMGQQR----------------
A0A517SYI0      --S----H-PEVKSIALQIE--------SSQRKLNELNQLMSNR----------------
A0A518HX54      --S----H-PEVKSIVMQIE--------SSQSKLNELIAQVDRR----------------
A0A5B9MF59      --S----H-PEVKSIAMQIE--------SSQNKLNEINQQMTSR----------------
A0A2A2WC24      --S----H-PEVKSIAMQIE--------SSQNKLNELNQQMSER----------------
A0A518KYW8      --S----H-PEVKSIAMQIE--------SSQNKLNELNQQMSER----------------
A0A5C5YZZ0      --N----H-PQRIAIEQELK--------MTEKAFREIQKTRDSV----------------
A0A518JLD2      --G----H-VAIKSLDEEIQ--------VVKRLILDAVQTEERS----------------
A0A5M6DJ15      RHQ----V-GRLERLEKELE--------RRREDLVRIAQTRKYK----------------
A0A3L7P7S7      --D----H-PDVKNLNDEIK--------DIREYIDQMAKGIVPK----------------
A0A517N8M1      --S----H-PSVKVLDAQLS--------TMRRELQKLVQEKTSR----------------
A0A5C6CW01      --S----H-PTVKQLDTELS--------LMKSELRRIVVDQTKR----------------
A0A5C6BXS9      --Q----H-PTVKALDTELT--------MMKSELTRLVTEQTQR----------------
M5U569          --S----H-PTVKQLDVELK--------MMKSELKRLITEQAER----------------
L7CND7          --Q----H-PTVKALDAELT--------MMKSELKRLVKEQSDR----------------
A0A0J1B8S4      --Q----H-PTVKALDAELT--------MMKRELKRLITEQSER----------------
F2ARR3          --Q----H-PTVKALDAELT--------MMKSELKRLVKEQSER----------------
K5D8H6          --Q----H-PTVKALDAELT--------MMKSELKRLVKEQSER----------------
M2AKU0          --Q----H-PTVKALDAELT--------MMKSELKRLVKEQSER----------------
A0A5B1CRW9      --G----H-PLVEAARQETA--------LTRQFITANTPETNGV----------------
A0A5C6EI46      --G----H-PLVEATRQETE--------ITRQFIAANAPETKAR----------------
A0A5B1CKI2      --E----H-PTVRNLDAQLE--------SMKTEMKKLVEDQTDR----------------
A0A5C6EG84      --S----H-PSVKVLDSQLE--------TMRSELKKLVEAKTSR----------------
A0A5C6F2X4      --S----H-PSVKVLDSQLE--------TMRSELQRLVEEKTTR----------------
A0A7W5DXF4      --S----H-PTVKNLDTELT--------MMRSEFTRLIKERTDR----------------
A0A5C5XTV6      --Q----H-PTVKALDTELT--------VMKSELKRLITEQTQR----------------
A0A5C6AAB1      --S----H-PTVKQLDAELT--------MMKSELKRLVTEQTER----------------
M5T8W8          --Q----H-PTVKQLDVELK--------MMKSELKRLVTEQAER----------------
M5SF00          --Q----H-PTVKALDAELS--------MMKRELKRLVKEQSER----------------
A0A2G1WDS1      --Q----H-PTVKALDAELS--------MMKRELKRLVKEQSER----------------
Q7UVS9          --Q----H-PTVKALDAELT--------MMKSELKRLVKEQSER----------------
A0A5C6B601      --N----H-PQVVSITSKIE--------NIRRRLNELESQKAAR----------------
A0A517PFU1      --N----H-PDIKRLENRVA--------A--------LRRIEAD----------------
A0A5B9M8J9      --S----H-PEVKSIVMQIE--------SSQSKLNELIGQVDRR----------------
A0A2A2WFP6      --S----H-PEVKSVAMQIE--------SSQSKLNGLIAQVDRR----------------
A0A518L8N2      --S----H-PEVKSIVTQIE--------SSQSKLNELIAQVDRR----------------
A0A518HQN9      --S----H-PEVKSIAMQIE--------SSQNKLNELNQQMSER----------------
A0A5M6D8H8      --S----H-PEVKSITMQID--------SSQKKLNELSERISQR----------------
A0A1G2ZG92      YTK----EHPDYKILEKEIE--------TAKELIKNEKKVALNS----------------
A0A2E7D3V4      ---------PDVQSVQSEIA--------LVKAYYRQQGIPIPGA----------------
A0A5B9PER9      GTG----H-PDHEAAVVSIN--------IVKKQLAEMEEENSKN----------------
A0A517QSM4      KH-------PDRVRLNTHIE--------RQRLLAEELKKQIEKR----------------
A0A355GJI7      ---------PDLDAVNRSIE--------TIINLYRRQGLDISAD----------------
A0A1Z8MCI4      ---------EGLVRIEAKIR--------DIDEQLSLRKAQASSE----------------
A0A517SYL7      ---------EGLVRIEAKIR--------DIDEQLSLRKAQASLE----------------
A0A3L7P0L2      GPN----H-GDVRNVRRQID--------TILDFYHRQGLTPPNL----------------
A0A6M5YVJ1      GER----P-LAVAKAEEELA--------AAQQKRDKYRDELRPR----------------
A0A832M9Q8      ATP----NHPDRIEIRAQLK--------TLDSKIAARKKELQDN----------------
A0A7W0MCI8      GH-------RSIADARKRLE--------LAEAELQQTALELKPV----------------
A0A517SCC8      GPN----H-NDVVDVRRQID--------AIVKMYAQNGFAPPVM----------------
A0A358MY60      NLR----Q-EYYNEVSRKVT--------EAEKKLASAREAAEAQ----------------
A0A517MNB1      SLR----Q-DHYEDLKKQAD--------ELRKQVQAAEKVARDR----------------
A0A3A0DR44      GKQ----S-SSYKDYAALIV--------RAEKELATLQDEVRAQ----------------
A0A142YJ13      GNA----D-PAAQALEREIK--------QLARTLESHRNTAQRA----------------
A0A517Z7D3      DH-------PSVLRLKEQIG--------SILSFYKRKGLAPPHV----------------
A0A7X7KCE7      GRQ----S-PVYARLLGDIR--------NDERTLDRLRNEIKQR----------------
A0A1N6KY57      RND------PAVKKHRDDLE--------AIHVALAAQRRKLYPI----------------
L0DK20          KSD------PSLKKHRDELE--------AARTAMVAQRRKLYPI----------------
A0A517XRC2      VPD----A-PVVLALDAEVK--------QLQKAIDKARTEVLPD----------------
A0A6M5YH47      IKE-----------IKGEVA--------KRLKEYEDARKFATAE----------------
A0A660UUK3      NN-------PELQNRIAILE--------SFKKRMEERREELVKD----------------
A0A517ZHG5      TEN----N-SVLKSARREQE--------TTQEAIAKYREELRPI----------------
A0A1Z8MPL5      SSA------EAIKSREAEIT--------RLQEEQAGFAQQLRNE----------------
A0A7C1EH96      TN-------PEMQRRRQILA--------DLQEELEKQRQEATER----------------
A0A5C1AGE3      PAL----V-GFQAELEVAQA--------KLKARQGAYKDADNPR----------------
A0A2Z3HEL7      PE-----N-AYIQELKAAAD--------KYKKALDDVQNQVTTE----------------
A0A142XAP8      PDL----D-DGIATLRAEVK--------KLEAEVKGAEKLAATE----------------
A0A6P2DEK1      PDI----D-DGITKLRAEVK--------KLETEVKEAEKLAATE----------------
A0A5C6C1R5      IQY----KIDRFDRLTSDAK--------EREATLLKLAAEEKGR----------------
A0A1G2YRE4      SN-------PIIKQKQDLLE--------AFRSRIEEQRQKASED----------------
A6BZU4          ---------PDLDAVNRSIE--------TIINLYRRQGLDISAD----------------
A0A2D5GZ77      ---------PDLDAVNRSIE--------TIINLYRRQGLDISAD----------------
A0A3D3R1Z6      ---------PDLDAVNRSIE--------TIINLYRRQGLDISAD----------------
A0A517XG00      ---------PDLDAVNRSIE--------TIINLYRRQGLDISAD----------------
A0A353Z859      ---------SSVEEYARRLR--------EAEAKLKEVREELRPK----------------
A0A2D6ST10      SET----H-PTLVKFKKQLA--------DAQKHQQELQEELKPQ----------------
A0A177QX42      ---------PQVKMLDRKIE--------SLRGLLREEAGAKGSK----------------
A0A517SHR0      ---------PQIRKLDKRIE--------ALRGLLRQETGDSGPK----------------
A0A2E0AW64      DPA----NLPRYQSAQRQIA--------LQQEQIEKLDAARQPL----------------
A0A351FZ59      DPA----NLPRYQSAQRQIA--------LQQEQIEKLDAARQPL----------------
A0A660V239      -PG----N-PELKQRREILK--------TLKERLGQRRKEVAQE----------------
A0A177Q3B7      GRR----E-PAMKPLLDQSA--------ALDAQLEKRRKLLRPE----------------
A0A2E0X6Y6      GPN----H-PRISELKRQEQ--------TLIAYLRDYRSNLGNR----------------
A0A518GFD7      GPG----H-PSARALTVELE--------ARQELLDKRREYAREA----------------
A0A518GE37      ELF----A-DRYARLKEDVP--------RLEEDIRNAEVAARPQ----------------
A0A5C6F3H8      RVN----R-DYYKELNKNLA--------SAESELQSERREARDR----------------
A0A5C5X072      RIS----R-DYYNDMKKNLE--------DARDKLQDERDLARTR----------------
A0A5C5WUQ3      RVR----R-DYYLEIKAKRD--------SLEYSLEAKKSKAEKL----------------
A0A5C6E697      RIR----R-EYYNENLARIS--------EWEEVLKKAQEVAREA----------------
A0A5C5Z1A3      RIN----R-SYYDELKAKKN--------ESEKKLQAAMDAARQQ----------------
A0A5C6D2P7      RIQ----G-EYYRETLDKVK--------KWEQTLEESRQAARVV----------------
A0A5B9ML17      RLN----Q-THFAELKKKRD--------EWEATLKTAKAAAETK----------------
A0A5C5VZJ8      -EG----H-YKIQSLKNEVT--------RVEQQVAALETDLRDR----------------
A0A517LX75      GDD----H-PLVQRVRDEVA--------SVKRFIREKAPGDLEA----------------
A0A7X7YXL7      -PA----N-PLYTQKEAVLK--------AFEAKLEQRRATLTEE----------------
A0A7W1FH76      -EK----Y-PRLKETRAQLA--------AKREELQRA-----------------------
A0A7C5W7B3      TEE----N-PKLKKLVREIE--------GLRQTIEQVKQDPDRF----------------
A0A7V2IPP1      -DA----H-PELAHRMDLLE--------QMKKRMEERREEVGKA----------------
A0A142XL75      GER----P-PTVIKAEDDLK--------AAELRRDKHRDELGTT----------------
A0A6P2D5D5      GEQ----A-PAITKAENDLK--------AAEQKRDKYRDELQAA----------------
A0A7C7T8W8      GRD----H-PRIQSLLADIE--------RLDTLLADRREAAKVD----------------
A0A5C6B3S0      GSK----E-YHIERLQAQLN--------TAEESLKSHRAELRSE----------------
A0A354GX32      REN----G-PGVGQLRDRIS--------LIQNLVTQKKEVQRPG----------------
A0A518GIZ9      GPD----H-PEVKAVRKSID--------TTLDFYRKHGLRMPDD----------------
A0A1C3EBY9      GPD----H-PEVKAVRKSID--------TTLDFYRKHGLRMPDD----------------
D5SX64          GPD----H-PEVKAVRKSID--------TTLDFYRKHGLRMPDD----------------
A0A517Z0U7      KEG----H-ALITKAEDDLA--------ALEAQLEAYRETQLPQ----------------
A0A2S8FCC0      KIQ----N-QYVSRLRDKIS--------ELEEQVSLRKDQLTKD----------------
A0A1Z8MBT6      GPG----Y-VGIQETEDLLV--------TAQTELDRLMDSVKDE----------------
A0A517SXN9      GPG----Y-VGIQETEDLLV--------TAQSELDRLMDSVKDE----------------
A0A7X7F3C7      -AN----H-PDVIAAEERIR--------VKQDYLLNYPQRVNEW----------------
A0A255QXF5      RRA----Q-AYYADQQKLRD--------EWKTKLDEARAEASAR----------------
A0A518KYQ0      RFD----K-DRYARLQTERD--------QWEEKHALARKAASER----------------
A0A5B9QX47      RVA----R-DHYEDMQSRRD--------EWTAKLEQATKDAQEQ----------------
M5T666          RVS----R-DYYNQMKENLA--------DAQSKLDQERQVARDR----------------
M5U6N6          RVS----R-DYYNQMRKNME--------EAERKLAQERTLARDR----------------
A0A517M0G2      PLR----Q-EYHKELKEKAA--------EQQRELDNAVAAARQR----------------
A0A5C6AST1      RIS----R-DYYNDLKSKIA--------DTQKELDKAKEVARAK----------------
A0A5C6C951      RIQ----R-DHYEGLKTQLA--------DTEDDLRQARIDVRST----------------
A0A5C6C5T3      RIS----K-DYYLDMKQNLE--------DAKDTLKQERDSARTR----------------
A0A2A2W6A9      RFD----K-ERYARLQKDRD--------EWEAKLASAKQAASEA----------------
A0A518HQS9      RFD----K-ERYARLQKDRD--------EWEAKLASARETASKT----------------
A0A5M6DFE6      RMR----K-EYYREMMDQRD--------EWEEKLLAFRKEARTR----------------
A0A5C6F286      RVS----R-TYYNELIRSLA--------EAESKLEGIRQEARPR----------------
A0A517NGN1      RIN----R-EHYRGIVADQA--------LWEGKVEEALTAARER----------------
M5RUI3          RIR----R-EYYEEMQGKRD--------EWTANLETLKAGARER----------------
A0A5C1AAF0      AVA----E-VAAKKAQDDLT--------ALSKDLKEARAKARVD----------------
A0A3B8ZJM2      -EK----H-PNIRRIRSTIA--------SVEKKIAHAKEAESRL----------------
A0A1U7CLW1      GNV----D-PSILAIQREIK--------LVTGELEGRRQELRAA----------------
A0A5Q3LBQ3      PEK----S-STYRKLAGDYK--------ETQASLEEIREELRAR----------------
A0A142WPR7      -PD----H-PKVTAVQKRIE--------ITRKYLTESLAEERKN----------------
A0A517T4K9      -ED----H-PELARVAAKLE--------AGQKEYEKLEQQLRPA----------------
A0A7C6B2Q1      -RY----S-QELADVQGRIQ--------ARREELRQEL----------------------
A0A2Z3GZZ5      GKD----H-PRVLAVDARIA--------VLKEELARPPAA--------------------
A0A4V0I6L6      -PG----H-PEMAALNSQIK--------VLEEEVAAR-----------------------
A0A7C4QQT3      -RD----H-PDVQSVQQSIR--------AVLRYYRERGIHLLDD----------------
A0A7V9G5K3      -DK----H-PRLVEVRGEIV--------QS------------------------------
A0A7W1JAD6      -DR----H-PRLLEIRSQIT--------QG------------------------------
A0A518KBI5      WRE----N-GSYKSLSDARK--------HARTELTEFKAALREQ----------------
A0A5C5V6Q5      YEQ----N-ANYKALAEQYQ--------RFKDELAGYKANLRRK----------------
A0A517P477      -ST----S-PTLATARAEAT--------RRQAELKELQVSLRPH----------------
A0A518HFS8      -PG----E-PSRKRLEQAVA--------SLAESLRMRYEELRGF----------------
A0A7Y5LUV4      -DA----H-PRMVGL---------------------------------------------
A0A3M1TFJ0      -EN----W-PQVRAA---------------------------------------------
A0A7Y5HGA4      -GE----A-PKQPD-SDVVR--------HAERRRDDERRRLARI----------------
A0A517MY49      -PN----H-PRVRELQTQII--------NINQFLANYGSNAGKI----------------
A0A2E6AG00      -DR----H-PKVQDXLKSIR--------DTQNYLENYQQSVADR----------------
A0A1G3A880      -PA----H-PRLTEVAERVR--------ATEQYLTAYQTRVSER----------------
A0A2E8ATT1      -PN----H-PQVRQLQHSLQ--------LAQAHREEYHAKVQKH----------------
A0A524HC32      DY-------PSVKNLKARMN--------SIAARIEKEETII-------------------
A0A660VT66      KH-------SKILSLEASLA--------KQKQILNDTAEQLAES----------------
A0A7C2ZTD2      AN-------PELKRKAQLLE--------ALNARLEEQKKQAGKS----------------
A0A0S8H0S8      GH-------PAVQALQAQLA--------RARQRQAKADKKFAEN----------------
A0A7C2VEF7      EH-------PAVKALHTKID--------YIKSDLKAEMKKFADT----------------
A0A7V7D6N0      DH-------PSTQALLGKIT--------EIKRQLNDESKSFADA----------------
M5S2L2          ------------------------------------------------------------
A0A7V1EK28      ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A7C2VXA0      ------------------------------------------------------------
A0A7C3AA48      ---------GLFLGCGLAVL----------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A7C5PFV3      ------------------------------------------------------------
A0A7C3QGD2      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A7Z9UC46      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A1V6CUG1      -------------MANVWDA----------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A7C2ZUK5      ---------MRISGTRERSF----------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ------------------------------------------------------------
A0A7X8YY48      ---------MGNVSNAMKKQ----------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
                                                                            

A0A523CME0      ------------------------------------------------------------
A0A7Y3UKB3      ------------------------------------------------------------
A0A7C2JY73      ------------------------------------------------------------
A0A836W298      ------------------------------------------------------------
A0A354PCV3      ------------------------------------------------------------
A0A354PHB4      ------------------------------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A538RV31      ------------------------------------------------------------
A0A1G2XSU7      -----FDEMAEKEFKESDMLEIQE------------------------------------
A0A350KD81      -----NLESGEFQVAKTKDVDFVN------------------------------------
A0A356AE44      ------------------------------------------------------------
A0A7Z9UBD9      -----LDRQIRSEVSRIVVGL---------------------------------------
A0A257WQ92      -----RRQQQADGSAPGEVDF---------------------------------------
A0A2E3Z6T8      -----LEAMGKSIPKEVVVNL---------------------------------------
A0A7Y2AF64      -----LTPERRREIGDSLLSV---------------------------------------
A0A7C1U6X6      PVAPGVSALAEALLSP--------------------------------------------
A0A7C7UXI5      -----LRQISDRELRPVLIQM---------------------------------------
A0A7C3SFJ0      EISPTLEKQIEERIREHLAEGWNT------------------------------------
A0A7X7YIF4      -----AERNRQKQLAE--------------------------------------------
A0A7C7WWF7      ----SRERLTNESLGRLLLSM---------------------------------------
A0A7V3JIB0      ERSRGAEESTQRALAARRVELREE------------------------------------
A0A356ETW1      -----ISRLQNEQLGPLLVEM---------------------------------------
A0A3L7NJY1      -----MQDMARNELGPRLLQY---------------------------------------
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      -----VETDYN-------------------------------------------------
A0A177PV03      -----PKPGPD-------------------------------------------------
A0A1G2YIM0      -----FNDMLTKEIARNRVYKLKE------------------------------------
A0A1G3A0W0      -----WHHRPQDVPGT---PSTIA------------------------------------
A0A7V7D8F5      -----Y-------------DGFMA------------------------------------
A0A432MFP3      -----L-------------RAQLA------------------------------------
A0A518HFL0      -----L-------------RAQLA------------------------------------
A0A3L7UX05      -----L-------------EKQLA------------------------------------
A0A2E0SHG0      -----K-------------QREEM------------------------------------
A0A2S8F9B8      -----I-------------KERLA------------------------------------
A0A368KP63      -----V-------------KERIA------------------------------------
A0A518CQB8      -----L-------------RQETT------------------------------------
A0A7C4QPD3      -----I-------------LQDL-------------------------------------
A0A7C2JZW2      -----L-------------LHEL-------------------------------------
A0A836RF42      -----L-------------KQEQ-------------------------------------
A0A7D8YCU5      -----ITDPSL-------------------------------------------------
A0A353BE27      -----KEELEK-------------------------------------------------
A0A5C6BPW1      -----IEQKIR-------------------------------------------------
A0A1I3GSP0      -------------------RQGLT------------------------------------
A0A517QJV1      -------------------QQGLT------------------------------------
A0A3C1QS25      -----LPGTGD-------------------------------------------------
A0A5C6FX55      -----IGQLMD-------------------------------------------------
A0A5C6DS51      -----RDNKLD-------------------------------------------------
A0A5C6DSL6      -----NENKLD-------------------------------------------------
A0A3M1VG27      -----RLDTGD-------------------------------------------------
A0A518GC22      -------------------QQVDS------------------------------------
A0A3L7Q373      -------------------GTPGQ------------------------------------
A0A3E0PW54      -------------------FYRQK------------------------------------
A0A7C3TAH2      -----YQQVLE--------EQRRL------------------------------------
A0A1Z8MHR4      -----IAELQA--------KNQND------------------------------------
A0A5C6EHJ0      -----NAELDE--------AMKAA------------------------------------
A0A5C6F1H9      -----NAELDE--------AMKAA------------------------------------
A0A255QXY0      -----RKEIAP--------ED--L------------------------------------
A0A517SYI0      -----IAELQA--------KNKND------------------------------------
A0A518HX54      -----RKELSE--------QSQQI------------------------------------
A0A5B9MF59      -----IAELRA--------QSQTV------------------------------------
A0A2A2WC24      -----IAELRA--------QSQRV------------------------------------
A0A518KYW8      -----IAELRA--------QSQRT------------------------------------
A0A5C5YZZ0      -----QAETID-------------------------------------------------
A0A518JLD2      -----IAELESAWAELDELASNQP------------------------------------
A0A5M6DJ15      -----EMNPEG--------EQIAG------------------------------------
A0A3L7P7S7      -----GPDGKA--------SSLLG------------------------------------
A0A517N8M1      -----VMELMS--------ETLA-------------------------------------
A0A5C6CW01      -----LMEIKK--------ENEIK------------------------------------
A0A5C6BXS9      -----IIQLMD--------ENRVE------------------------------------
M5U569          -----IVELME--------ANKVE------------------------------------
L7CND7          -----IVELME--------QNKVE------------------------------------
A0A0J1B8S4      -----IVELME--------QNKVE------------------------------------
F2ARR3          -----LVELME--------QNKVE------------------------------------
K5D8H6          -----LVELME--------QNKVE------------------------------------
M2AKU0          -----LVELME--------QNKVE------------------------------------
A0A5B1CRW9      -----KKDDL--------------------------------------------------
A0A5C6EI46      -----ETKTM--------------------------------------------------
A0A5B1CKI2      -----VMELIG--------ETL--------------------------------------
A0A5C6EG84      -----VMELMS--------ETL--------------------------------------
A0A5C6F2X4      -----VMTLMS--------ESL--------------------------------------
A0A7W5DXF4      -----ILELMK--------ESSQP------------------------------------
A0A5C5XTV6      -----ILQLME--------ESRGQ------------------------------------
A0A5C6AAB1      -----IVELME--------ENKVD------------------------------------
M5T8W8          -----IVELME--------QNRVE------------------------------------
M5SF00          -----IVELME--------QNKVE------------------------------------
A0A2G1WDS1      -----IVELME--------QNKVE------------------------------------
Q7UVS9          -----IVELME--------QNKVE------------------------------------
A0A5C6B601      -----QAQLRA--------EIKTT------------------------------------
A0A517PFU1      -----RAGLQA--------GPDGT------------------------------------
A0A5B9M8J9      -----RKELSD--------QGQRI------------------------------------
A0A2A2WFP6      -----RKELSE--------QSQQG------------------------------------
A0A518L8N2      -----RKELSE--------QSQQI------------------------------------
A0A518HQN9      -----IAELRA--------QSQRV------------------------------------
A0A5M6D8H8      -----RAELNA--------QSSRT------------------------------------
A0A1G2ZG92      -----VSISIDPIYDELSKNLIDA------------------------------------
A0A2E7D3V4      -----DVVPGADKKTPKSADANLV------------------------------------
A0A5B9PER9      -----SADLDILPDEIIFERKTAE------------------------------------
A0A517QSM4      -----ILAEIAAN-----------------------------------------------
A0A355GJI7      -----NLESGEFQVAETKDVDFVN------------------------------------
A0A1Z8MCI4      -----AEAVLRDKAGKAAKQQIAD------------------------------------
A0A517SYL7      -----AETVLRDKAGKAAKQQIAD------------------------------------
A0A3L7P0L2      -----GTSDASTRNAQGAAGADLA------------------------------------
A0A6M5YVJ1      -----LESAVRKQAEQRERARMAG------------------------------------
A0A832M9Q8      -----AWAFYQANTDLDKSRRIHE------------------------------------
A0A7W0MCI8      -----VLKQIEIEQKSSNVVSEQD------------------------------------
A0A517SCC8      -----ETLNDEQKPAAVASADLAS------------------------------------
A0A358MY60      -----AVKAISDDLRQAAERARTI------------------------------------
A0A517MNB1      -----APEVLQKHAMELAQRERES------------------------------------
A0A3A0DR44      -----LELRNSVVSTADRGQEAVQ------------------------------------
A0A142YJ13      -----LSAEPERFESSPVQDTRSR------------------------------------
A0A517Z7D3      -----DDSLKAAPPAGQTEEGVDL------------------------------------
A0A7X7KCE7      -----AVREAELSLLAKRTEQGTS------------------------------------
A0A1N6KY57      -----VTKQLQDMGRDSDESKEIL------------------------------------
L0DK20          -----VEQQLQEIGRDDDDSNKAL------------------------------------
A0A517XRC2      -----VRAALQEYGEEMLKAKHAE------------------------------------
A0A6M5YH47      -----ATVRARETERAQKQAQVTA------------------------------------
A0A660UUK3      -----FDDRYKQEVEARRNYAKVQ------------------------------------
A0A517ZHG5      -----IEQKIRESGNAQNPDDLPA------------------------------------
A0A1Z8MPL5      -----ILAAVRRGERKSDAQYNHE------------------------------------
A0A7C1EH96      -----YEKIALADVRRSRQAELEA------------------------------------
A0A5C1AGE3      -----IVEVQDEIKDIIARRAALT------------------------------------
A0A2Z3HEL7      -----AETALRFSDLAERQKKVSD------------------------------------
A0A142XAP8      -----ALEVARAIDTANKKKRAEE------------------------------------
A0A6P2DEK1      -----AIEVARAIDTAKKKKRVEE------------------------------------
A0A5C6C1R5      -----KIAQGEMGQIDLSLSPEDQ------------------------------------
A0A1G2YRE4      -----FNNVASEEIAKVNKEKTLN------------------------------------
A6BZU4          -----NLESGEFQVAKTKDVDFVN------------------------------------
A0A2D5GZ77      -----NLESGEFQVAKTKDVDFVN------------------------------------
A0A3D3R1Z6      -----NLESGEFQVAKTKDVDFVN------------------------------------
A0A517XG00      -----NLESGEFQVAKTKDVDFVN------------------------------------
A0A353Z859      -----VIEELKERSQLEEVLSTQA------------------------------------
A0A2D6ST10      -----IAQQILGGMAASGEMSNLE------------------------------------
A0A177QX42      -----LDL----------------------------------------------------
A0A517SHR0      -----RDL----------------------------------------------------
A0A2E0AW64      -----RESLMEVARKDRQGAWKTY------------------------------------
A0A351FZ59      -----RESLMEVARKDRQGAWKTY------------------------------------
A0A660V239      -----FDKNFEAELAKNRDRRLAE------------------------------------
A0A177Q3B7      -----VVKRFADRAVRDLQAEFAS------------------------------------
A0A2E0X6Y6      -----FAGGDSGEA----------------------------------------------
A0A518GFD7      -----ALESLAKTNAESMLPLGQQ------------------------------------
A0A518GE37      -----VISTLQGLVAEREALKRAE------------------------------------
A0A5C6F3H8      -----TIEKLERFAEDEYERQKVA---------------------------------AKR
A0A5C5X072      -----VEEELQRVVDEDYRQRKAV---------------------------------AER
A0A5C5WUQ3      -----AIAVLTKRAEEDYQRQMAE---------------------------------AEA
A0A5C6E697      -----ATAKLEQLAADELKFAQSE---------------------------------QIR
A0A5C5Z1A3      -----ALVEVQKLADEDFKLQEEE---------------------------------AKT
A0A5C6D2P7      -----ALEKLNELAKDQLERSRIE---------------------------------AKL
A0A5B9ML17      -----AATELEALADADYEHQQKQ---------------------------------WEE
A0A5C5VZJ8      -----LTNGRGDPDTGDFALTDPR------------------------------------
A0A517LX75      -----LESKEMKPAQI--------------------------------------------
A0A7X7YXL7      -----FNAELEKKLKEAAQQRVLQ------------------------------------
A0A7W1FH76      ------------------------------------------------------------
A0A7C5W7B3      -----GLVGRQFDRGWQTENVELA------------------------------------
A0A7V2IPP1      -----FDELMTSREADMEGRELAQ------------------------------------
A0A142XL75      -----LAREVQKKHAQQEILRRAE------------------------------------
A0A6P2D5D5      -----AAIIAQKKYAQQELQRRAE------------------------------------
A0A7C7T8W8      -----AIQNYKLEIMRNHRDELRQ------------------------------------
A0A5C6B3S0      -----LLEHWNARPESVSNDGSDE------------------------------------
A0A354GX32      -----MERQLRAKALDDLVNEAAK------------------------------------
A0A518GIZ9      -----MTPGPDGKPLIKERANL--------------------------------------
A0A1C3EBY9      -----MTPGPDGKPLIKERANL--------------------------------------
D5SX64          -----MTPGPDGKPLIKERANL--------------------------------------
A0A517Z0U7      -----IRQQLQSRIAD--------------------------------------------
A0A2S8FCC0      -----KEQWSVATHRAELNKARSE------------------------------------
A0A1Z8MBT6      -----VRQELEQQFEAQYQQDLED---------------------------------EGK
A0A517SXN9      -----VRQELEQQFEAQYQQDLED---------------------------------EGK
A0A7X7F3C7      -----LAKVQDTQLRPRLVQMVGQ------------------------------------
A0A255QXF5      -----AISVLNADLEADYQQRLRE--------------------------RD-------D
A0A518KYQ0      -----AIDIMEAELD--------------------------------------------E
A0A5B9QX47      -----ALAYLNQKADEDFEARKAA--------------------------AI--------
M5T666          -----ALKELQRLVEEDFRQRKEV--------------------------AERAFAWQQE
M5U6N6          -----ATKELQRIVEEEYERQKEV--------------------------VARTFAWQKE
A0A517M0G2      -----APEAITERLRRTAERTYKE--------------------------SL-------A
A0A5C6AST1      -----AADEIKSLATEVAQRERAA--------------------------QI-------A
A0A5C6C951      -----AVAEIKSDALELAERNRKA--------------------------QL-------A
A0A5C6C5T3      -----VTKELERIVDEDYRQRKAV--------------------------AE-------R
A0A2A2W6A9      -----AVQILEDEIEEDYQQQLAL--------------------------AE-------K
A0A518HQS9      -----AVRILEDEIEEDYQRQLEL--------------------------AE-------L
A0A5M6DFE6      -----AEKAMKERIEFDYQRRLKD--------------------------AE-------G
A0A5C6F286      -----AIAKLDQIAEEQYQRDLAN--------------------------AE-------R
A0A517NGN1      -----VQAELEDRAETIYKQELAA--------------------------VD-------A
M5RUI3          -----VVAMLNERADAEYERQKIA--------------------------AK-------A
A0A5C1AAF0      -----YTTGV-------AQLSELE------------------------------------
A0A3B8ZJM2      -----EQAAAELNQKRNRSKNKMLNSEVASNDQPIDPPSDTTPGDASATAVTDSPNEVEK
A0A1U7CLW1      -----AAEFN-------RAEPAAI------------------------------------
A0A5Q3LBQ3      -----VVSEM-------ESHERSV------------------------------------
A0A142WPR7      -----AGENPMLK----GGKRPDL------------------------------------
A0A517T4K9      -----IIEDLILQRE-------RQ------------------------------------
A0A7C6B2Q1      -----------------EQKRVAN------------------------------------
A0A2Z3GZZ5      -----------------GGPVLDE------------------------------------
A0A4V0I6L6      -----------------GGPAEDE------------------------------------
A0A7C4QQT3      -----AASDSPGTPA--RPPADDF------------------------------------
A0A7V9G5K3      -----------------RKLLADA------------------------------------
A0A7W1JAD6      -----------------RKLLADA------------------------------------
A0A518KBI5      -----LLAARESDRQVGGQSVADH------------------------------------
A0A5C5V6Q5      -----LLLSTRSERPFGGSTVVDE------------------------------------
A0A517P477      -----VK-----EQL--KNSWEAQ------------------------------------
A0A518HFS8      -----HGAQQSGDRP--AARDPGL------------------------------------
A0A7Y5LUV4      --------RAELTAT--ESKIHEA------------------------------------
A0A3M1TFJ0      --------RARRDQL--KLLLRQE------------------------------------
A0A7Y5HGA4      -----VEAAVLKHAL--DLEQVEL------------------------------------
A0A517MY49      -----LN-AERRDEL--GSIVINK------------------------------------
A0A2E6AG00      -----AE-RTQAEQL--QSFLXGM------------------------------------
A0A1G3A880      -----LT-QLKDTRL--GPMLIQM------------------------------------
A0A2E8ATT1      -----ME-KVQEREL--GPLLISM------------------------------------
A0A524HC32      ------FRAIQNEYLTAQRI----------------------------------------
A0A660VT66      -----YISETEDRKVL--------------------------------------------
A0A7C2ZTD2      -----FDDLMSRELVNAGSRSLID------------------------------------
A0A0S8H0S8      -----HLALCAQRLSAAQQK----------------------------------------
A0A7C2VEF7      -----YIEVMRQRWRTAKQK----------------------------------------
A0A7V7D6N0      -----YMEVMRLKWTTAKQR----------------------------------------
M5S2L2          ------------------------------------------------------------
A0A7V1EK28      ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A7C2VXA0      ------------------------------------------------------------
A0A7C3AA48      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A7C5PFV3      ------------------------------------------------------------
A0A7C3QGD2      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A7Z9UC46      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A7C2ZUK5      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ------------------------------------------------------------
A0A7X8YY48      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
                                                                            

A0A523CME0      ---------------------------------------------------EIERFTKKG
A0A7Y3UKB3      ---------------------------------------------------EIERFTKKG
A0A7C2JY73      -----------------------------------------------ERQVRDKELEGIV
A0A836W298      -----------------------------------------------TLEKQHQIL-AQL
A0A354PCV3      -----------------------------------------------QLETKLTVLRKQY
A0A354PHB4      -----------------------------------------------QLETKLTVLRKQY
A0A356ESF4      ------------------------------------------------------------
A0A538RV31      -----------------------------------------------MLEEMEKKLREEL
A0A1G2XSU7      ----------------------------------YKYKLE-------QISLHQQQLRDML
A0A350KD81      -----------------------------VYLKSMEQQLK-------ELENRELELTKIF
A0A356AE44      -----------------------------TYVVALEQQQA-------ELKNRIGELQKLF
A0A7Z9UBD9      -----------------------------------ENEVA-------VAATRVRSLEKSL
A0A257WQ92      ---------------------------VALYAESVRQELA-------ELDVRDQHLAQLV
A0A2E3Z6T8      ----------------------------------LRQSTQ-------QAIEKEKQIRQAY
A0A7Y2AF64      ----------------------------------AAEKVA-------QAMAHENGLLTKF
A0A7C1U6X6      -----------------------------------EQQLE-------QAKQELPLLEEQY
A0A7C7UXI5      ----------------------------------ARQRLE-------QARQHEQAVRRQY
A0A7C3SFJ0      -------------------APKTPREQQIASLDAWKTEKA-------VLEKELQIAQEAF
A0A7X7YIF4      ----------------------------------IKAELD-------QTIAYEKRIQDQM
A0A7C7WWF7      ----------------------------------VNERLT-------KAVAHERELDRQY
A0A7V3JIB0      -------------------LKRRKRAALQASIDQLKAEIA-------AGAEQEKQLLADA
A0A356ETW1      ----------------------------------VRQQLR-------EAVEQEQSLRVQF
A0A3L7NJY1      ----------------------------------INQQLQ-------KNEENELAIFARL
A0A2D6SRY7      ------------------------------------------------------------
A0A1G3C300      -----------------------------------------------VLLASEESYEKAY
A0A177PV03      -------------------------DPARWHLQSLKRELV-------AAQANLDEIEKQC
A0A1G2YIM0      ----------------------------------SRAELE-------RINAYEEKLMAML
A0A1G3A0W0      ----QWRNQTINVLGAPVTIANSGMPDLDEDSAGVERQLA-------QTKHEEQLLAAEI
A0A7V7D8F5      ----KKIVEAEKEKLLNAE----------NELANAQAELE-------LTRAYEQRFKDML
A0A432MFP3      ----AEETHPV------------------QIVLRAEQRLL-------RLERERQLLQQKL
A0A518HFL0      ----AEETNPT------------------QLVRKAEAQLL-------ALQQKRELMKQRL
A0A3L7UX05      ----QEGAGQSTSTLDRELRDAENQYQ-DLIVREQAIRKN-------MQESKLTLENDES
A0A2E0SHG0      ----LKQYRDAAESQAKLVANFKLNQE--LLSDERELKKE-------LRSVSIQRLNDI-
A0A2S8F9B8      ----QQLLEGRSRQGSIANNGLVVPAEVDNSLPELRVHLG-------VLRQQEKTLAKEV
A0A368KP63      ----QDLAAQAKGEIARKGSSILAVPEVDNTLPDLRVRVG-------VLKQQEETLAAEV
A0A518CQB8      ----LVTFRDMAEAKAKEVATFKLNEE--LLRDEKELKKE-------LFTNSNRRLEDI-
A0A7C4QPD3      -------------AQRK--VTVGGQPQ--GSLDQMATRLK-------MLRSLRDRYVAEL
A0A7C2JZW2      -------------YKSRSAAVLGTQGV--STRAQLDERLK-------MLKLLLARYDEQL
A0A836RF42      -------------QKAKDLIQLEVSDS--TLRQTIDRKRQ-------LFDIVLKRLEEL-
A0A7D8YCU5      ---------------FSEYREEEARRIIDSFTEGLGRKRL-------LLLEDSTELETRL
A0A353BE27      --------NGDALARKTGAEIRSIEERLEERLLALEEQSE-------VFRLEEEELANQA
A0A5C6BPW1      ----------------------ESGNAPNPGDLPAEEQIA-------RLDVILEQLKEEL
A0A1I3GSP0      ----PPDLKQTGKGPISSRSAALGLDLVSVYRDTLQGQLK-------ELELDNQNLALLH
A0A517QJV1      ----PPAYQRSSNNPADARNHE-GMDLISVYEETLKSQLE-------ELKSIAKNLDIMR
A0A3C1QS25      ----------------------NRADFVALYKISLTEQVR-------SIDYELVAFRAQF
A0A5C6FX55      ---------------DEERKTKQALQAISAVQATAKTKVD-------MLKQRLDLLTKEI
A0A5C6DS51      -----------------------PKGMLSTYTRLLTNDVS-------EYEIREKVLVETC
A0A5C6DSL6      -----------------------PKGMLSTYTRLLTNDVA-------EYEIREKVLVETS
A0A3M1VG27      ------------------------SSLVDVYLAGLREQDA-------ELTHRRQQLEKLY
A0A518GC22      ----EMDRMKLEMQTRTGARIRSMEERLTAGTDMLAEQIA-------ALQLEEEHLQRDA
A0A3L7Q373      ----TAAPGTVA----------INEGLSQQYLKVLESRVE-------ELQADQIALKSAY
A0A3E0PW54      ----GHTPPRSHGPGADTTDDAGPIDLVAAYIRIQQQELM-------HRQDLEQRLTADL
A0A7C3TAH2      ----ALDQLQRA----RREAERARQERVAQRRMEMEAAIQ-------RLKAQEDRLRQVL
A0A1Z8MHR4      ----PESQRPRD------ASKNAASVMVDAYVNGITERIN-------ILDEDMQSIDVQI
A0A5C6EHJ0      ----AAAESSLL-PSGEYDPRDRILEKVRFAVGALRQEMD-------AMDSELQVVTDAY
A0A5C6F1H9      ----AAEASSFQNPDEDLEPRNRAMEQVRFAVGALRQEMD-------ALDSELTVVSDAY
A0A255QXY0      ----PTEDGSSP------TNKSNASELVDAFICGLQERLK-------VTQKEIDDLDLQI
A0A517SYI0      ----PESQRPRD------ASKNAASVMVDAYVNGITERIN-------ILDEDMQSIDVQI
A0A518HX54      ----DEADGSTQ------AQVARAGEAVDAYIRGLSERLR-------VANEDLSEVDRKI
A0A5B9MF59      ----DYDKEARK------ARDERARTAVDAYIRGIEAQLT-------VLAQDMADIDLQI
A0A2A2WC24      ----DYDKEARE------ARDERARMAVDAYIRGLEAQLT-------VLAQDMSDIDLQI
A0A518KYW8      ----DYDKEARE------ARDERARMAVDAYIRGLEAQLT-------VLAQDMSDIDLQI
A0A5C5YZZ0      ---------VAA------QRNEAAKTLLIMYVSSIRKKIQ-------LIDEDIADTNSRL
A0A518JLD2      ----TTNPED------------ELRRQVRLVFDSMTQKLQ-------SVEQEIGEIQTAY
A0A5M6DJ15      ----YANLTGEQ------RAKALQIQELDQQIKTQKRAIESRKIAAGVLKQQSERINDDL
A0A3L7P7S7      ----LGEDEI-------------FSNKAQGLLKHYSERIE-------EHETELAKVKDES
A0A517N8M1      ------DPRE------------RAVEAVNAVVLASKAQID-------LLKAQIKELDGQI
A0A5C6CW01      ----TIDPKE------------KAKEAISAVLIAAKAELD-------LLKNQILELDKQI
A0A5C6BXS9      ----GIDPGV------------RAQESVDVILIAAKAEVD-------LLKEQIAEIDAQV
M5U569          ----GVDPAA------------RAREAVDVILYASEAEVE-------LLRQQIKELDSQI
L7CND7          ----GVDPAK------------RAEEAVNVILTASRAEVQ-------LLQQQISEIDSQI
A0A0J1B8S4      ----GIDPAK------------RAEEAVNVVLIASRAEVN-------LLEQQIGEIDLQI
F2ARR3          ----GVDPAK------------RAMEAVSVILTASNAEVQ-------LLRQQISEIDAQV
K5D8H6          ----GVDPAK------------RAMEAVSVILTASNAEVQ-------LLRQQISEIDAQV
M2AKU0          ----GVDPAK------------RAMEAVSVILTASNAEVQ-------LLRQQISEIDAQV
A0A5B1CRW9      ----------------------DPTEMVNTYVMLLKNDIA-------EYEKRKSLLLAES
A0A5C6EI46      ----------------------DAEEMLKTYVMLLRNDIS-------ELQKRKTILMEEA
A0A5B1CKI2      -----VDPVQ------------RAKEALAAIVMASEAQVD-------LLTEQRKELDDQI
A0A5C6EG84      -----ADPRE------------RAVEAVSAVVLASKAQVE-------LLNSQVRELDEQI
A0A5C6F2X4      -----ADPRE------------RAIEAVNAVVLASKAQVA-------LLTSQVKELDSQI
A0A7W5DXF4      ----NSEPDE------------RAKQSISVMKIAYEAEIQ-------FLSQQIADLDKQI
A0A5C5XTV6      ----GVDPSV------------RAKESVDVILIASRAEVA-------LLNEQISEIEAQI
A0A5C6AAB1      ----GVDPAK------------RAAEAVSVILTASNAEVN-------LLKQQITDLEEQI
M5T8W8          ----GVDPAA------------RAQEAVDVILFASNAEVE-------LLQQQIAELDQQI
M5SF00          ----GVDPRK------------RAEEAVNVILTASRAEVQ-------LLKQQISEIDSQI
A0A2G1WDS1      ----GVDPRK------------RAEEAVNVILTASRAEVQ-------LLKQQISEIDSQI
Q7UVS9          ----GVDPRK------------RAEEAVNVILTASRAEVQ-------LLKQQISEIDSQI
A0A5C6B601      ----DINTLRLK------ERQERASSFVAAYMGGLAQRLT-------VLQEDMRELDQKI
A0A517PFU1      ----EGPSSF-----------------LDLYVAARVERAR-------VLQSQIDKLDERY
A0A5B9M8J9      ----AGGEGFQK------AQLARAGEAVDAYIRGLSERLR-------VANEDLGVIDQKI
A0A2A2WFP6      ----ADADGSTQ------AQVVRAGEAVDAYIRGLSERLR-------VANEDLAEVDRKI
A0A518L8N2      ----AEANGSTQ------AQVVRAGEAVDAYIRGLSERLR-------VANEDLAEVDRKI
A0A518HQN9      ----DYDKAARE------ARDERARMAVDAYIRGLEAQLT-------VLAQDMSDIDLQI
A0A5M6D8H8      ----DLGAEAQK------ARTEHAREIVEAHIRGLQERLL-------VMQDDLSQLDDQI
A0A1G2ZG92      -----------------------------------HIDKN-------IAIAKKGLLQKYI
A0A2E7D3V4      ----------------------------TTYMASLRQQWK-------ALANKNVRLDSLY
A0A5B9PER9      ----------------------------------IDQSIK-------DVSRMLAEQDEQW
A0A517QSM4      ---------------------------EDKSIVELQSRVK-------ILEAEKNHLEQEL
A0A355GJI7      -----------------------------VYLKSMEQQLK-------ELENRELELTKLF
A0A1Z8MCI4      ------------------------------------------------LELRIKTLNDGI
A0A517SYL7      ------------------------------------------------LELRIKTLNDGI
A0A3L7P0L2      ----------------------------QTYLTILKSRLE-------ELEDEQVRLVEDY
A0A6M5YVJ1      ----------------------------------LRDAVA-------GLKKQEALVKTKV
A0A832M9Q8      ----------------------------------ASADLK-------ALEQQIAAMRARL
A0A7W0MCI8      ----------------------------------LPNEIE-------SLEKARAELDREL
A0A517SCC8      -----------------------------TYVDVLQDQLE-------ELDSNSRLLEQEQ
A0A358MY60      -------------------ASKKAVIKTKQDAVNAKEELA-------KLKARRALLEVEY
A0A517MNB1      -------------------QLANLEVSTKASLASQEVQLA-------ELKSKRSILQQEY
A0A3A0DR44      ----------------------------------WRQRLT-------ALDAEHALLKRRY
A0A142YJ13      ---------------------------------EVEEYLD-------ILREQEKSLVQEI
A0A517Z7D3      ---------------------------VTSFMQLQKQKLV-------ELDHRDKLLAKSL
A0A7X7KCE7      -----------------------LLQKKMDELAKMRSDLA-------ACAVMETMLLERY
A0A1N6KY57      ----------------------------------VQHRCV-------ILEKIEAALQDDV
L0DK20          ----------------------------------IPHRIS-------ILSKLEAVLASDV
A0A517XRC2      ----------------------------------LQEQLT-------LDRARLERKERTL
A0A6M5YH47      ----------------------------------LTTALD-------VKKLDRDKLKDLR
A0A660UUK3      ----------------------------------VKAQLA-------QTIEHEKKIREEL
A0A517ZHG5      -----------------------------------EERIA-------RMDVILEQLKEEL
A0A1Z8MPL5      ---------------------------------RLEAESI-------EANNYLASLQAEY
A0A7C1EH96      ----------------------------------LKSELN-------RLITYEEKIIAQL
A0A5C1AGE3      ----------------------------------SQRRSD-------VETKLRAERRDEI
A0A2Z3HEL7      ----------------------------------LADQIA-------IKEKVRNGLRTER
A0A142XAP8      ----------------------------------LAYTIE-------VKKGVREKHRLER
A0A6P2DEK1      ----------------------------------LAYSIE-------VKKGEREGHRLER
A0A5C6C1R5      ------------KLAQRHARLLADAEEHDKRIVARGIQVG-------ILQQQKERIEHDL
A0A1G2YRE4      ----------------------------------LKTELE-------QTKVHEKHLREVL
A6BZU4          -----------------------------VYLKSMEQQLK-------ELENRELELTKIF
A0A2D5GZ77      -----------------------------VYLKSMEQQLK-------ELENRELELTKIF
A0A3D3R1Z6      -----------------------------VYLKSMEQQLK-------ELENRELELTKIF
A0A517XG00      -----------------------------VYLKSMEQQLK-------ELENRELELTKIF
A0A353Z859      ----------------------------------LQRRLQ-------LLEITIDGLDKQL
A0A2D6ST10      ----------------------------------RKKLIG-------DLLAWQAELEKKI
A0A177QX42      ---------------------------LSIHLESLDERIN-------AYENEVAQLNSAF
A0A517SHR0      ---------------------------LSIHLESLDERIT-------SLQNEVAELNTGF
A0A2E0AW64      --------------------QQEVISRQKEEVARLQEQTE-------QMAIEERVVTEKY
A0A351FZ59      --------------------QQEVISRQKEEVARLQEQTE-------QMAIEERVVTEKY
A0A660V239      ----------------------------------LKIQLA-------QTIEYEERIRAKL
A0A177Q3B7      ----------------------------------LEERAS-------LLQDLETSLVETV
A0A2E0X6Y6      ---------------------------GEATLKMLRQALA-------EAQRREQRLTETF
A0A518GFD7      ---------------QSATNRTPLGALTQQDLISRASHIE-------VLKQQEALLQEKV
A0A518GE37      ------------------------------QIEEFQLQLD-------ELDIRQAALQKEY
A0A5C6F3H8      TSEWQQEQFAAQAKELAQQSSKIQSEVSAAEKASRERQRF-------AIVSRLEILQAQY
A0A5C5X072      TLAWQEEQQKKQQDLSKQERKRAQERSQKAFAKEREKSRK-------AMVAKLDVLQTQY
A0A5C5WUQ3      KLTAMKQLHEVELDAARSHDSLKRNHQDNMNTALKKRDRA-------ALVAKLGILQKQY
A0A5C6E697      Q----KEIGVRL------------------KKVSEKKNRQ-------QLQSRLSVLQNQY
A0A5C5Z1A3      K----IELARREFEQGLKLASLDHQSEGRIAMEAEKQQRD-------GLETRLQMIEKQY
A0A5C6D2P7      Q----QQLGAQD------------------RVASKQQTRQ-------QLQMKLDVLNKQY
A0A5B9ML17      KVAALRAAHEEKQRLDRQNRALVDAQLRTETTRQYRRMIT-------EKKEKIKIIQRQL
A0A5C5VZJ8      ---------------------------------VIELRLS-------RLRDEEAVLAGLL
A0A517LX75      ---------------------------LEAYSSLLANDIN-------ELTKRQQHLVEEA
A0A7X7YXL7      ----------------------------------AKAQKT-------QIEAHIEEITRIL
A0A7W1FH76      ---------------------------VEDAGQAIDKKHE-------KLRIQARTWDEQI
A0A7C5W7B3      ------------------------VATESARKAAYLARLE-------TLESQRKALEEKI
A0A7V2IPP1      ----------------------------------VKEELE-------QVKAHEARLNELL
A0A142XL75      ----------------------------------TRKQIR-------ILEKRFALAKEKH
A0A6P2D5D5      ----------------------------------FREKVE-------TLEKREKIAKGKI
A0A7C7T8W8      ----------------------------------FQNELA-------ELAISEEMINESI
A0A5C6B3S0      ----------------------------------LRAKIA-------ILAAQEKQLQQEV
A0A354GX32      ---------------------------TKGHIEGDKNQLL-------TLGKKISELESQV
A0A518GIZ9      ---------------------------VQNYMETLRQQLK-------ELDIREQQLNVLF
A0A1C3EBY9      ---------------------------VQNYMETLRQQLK-------ELDIREQQLNVLF
D5SX64          ---------------------------VQNYMETLRQQLK-------ELDIREQQLNVLF
A0A517Z0U7      ---------------------------VPDSAGQIRQRID-------LLRKMEDGYTEEI
A0A2S8FCC0      --------------------------------------VA-------ILEQMEKQLDESV
A0A1Z8MBT6      ELERLEDAWAKNRDLQIKNASKSSAGQRELVVKRLQFDLG-------RRKRQLEMVKNEY
A0A517SXN9      ELERLEDAWAKNRDLQIKNASKSSAGQRELVVKRLQFDLG-------RRKRQLEMVNNEY
A0A7X7F3C7      -------------------------------------KLE-------ETRRLEASVEAQY
A0A255QXF5      EIERQRKEFADLADIKQAELARRADYMSEHEAENLKQGRE-------RLERQLAVLQKQY
A0A518KYQ0      ELERARAEYVASSIAKQKQHARRAELMSDQEKAEIAERRE-------QLVKRLDVLESQY
A0A5B9QX47      ---------------------VERERKRAAQIAADEQERK-------SLVAKLEIAQSLY
M5T666          QLKKQQQEMKRLQDKSAEERKVAQKAYAAAQAKERDNQRK-------VLVAKLDILKAQH
M5U6N6          QLAKQQEELKKQQANSAEEQKAAQQAYIAAQERERERQRK-------ALLAKLNILQAQH
A0A517M0G2      ER----------------------KAASFAQRESINQQLV-------DLKARRAIIQQEY
A0A5C6AST1      QMQFST------------------KANMESNRKSEQEQLA-------ALKAKRAIIQQEY
A0A5C6C951      QLEFKR------------------KAELKLGQQSDQQRLA-------ELKAKRAITQQEY
A0A5C6C5T3      TLEWQQEQQKRQLALTEQERKLEETKNREAQLKERERSRK-------EMVAELNVVQSEY
A0A2A2W6A9      EKERLRAEFPAKVKAKQEELERRAEIMSDQEKQQIADRRE-------QMVKRLAVLQEQY
A0A518HQS9      EKERLRAEFAANADAKKAELERRSELMSEQEKLLIGDRRD-------QLVKRLQVLQDQY
A0A5M6DFE6      DIERQKIAFQNEYRRSLADRDRQNQAELERQKWQDQEKRR-------QLVARLASVREQY
A0A5C6F286      EMEFQREQLLARLKQEGRESEQMKEARAAAVRMEHDAQRK-------VIASRLDILQSQY
A0A517NGN1      EVQLQRDQFLADQQLAKRKAVAMRQAAMKIDQETAQLARK-------ELEARLAVLNTHY
M5RUI3          RIESLKEGFEAQRKSKIEAARVEWQRELQKRYADEKKEYE-------ALATQLDVLQKQY
A0A5C1AAF0      ---------------------------SKTRVTQLSEQIA-------FQEELGKVLVTEI
A0A3B8ZJM2      AIASTDSDSSVSPEDEAPDVEEQVNLYLQISLNSLTQRYK-------SLKLEEEEIQRWI
A0A1U7CLW1      ---------------------------PDARLEEVKEYLE-------ILHEQEKSLIDEI
A0A5Q3LBQ3      ---------------------------RDDQLLSLQSELD-------STRLMEELLSRRY
A0A142WPR7      ---------------------------VSLYLESLQHEVD-------VIQTKQKEMNLLF
A0A517T4K9      ---------------------------SEATLTGVQSQIE-------LLQAEYDYLTKEL
A0A7C6B2Q1      ---------------------------IDQEIENLNFELA-------ILDAQQQQLQQEV
A0A2Z3GZZ5      ---------------------------LGAHILWVEQKRR-------TAGRQLVQLEAQL
A0A4V0I6L6      ---------------------------LERYRRKLETELG-------AISAQLDILARRI
A0A7C4QQT3      ---------------------------VQLYVAALHQELA-------ELKIRDEQLAKLF
A0A7V9G5K3      ---------------------------VEMARAGIANDHQ-------KLTIQLDDVTKRI
A0A7W1JAD6      ---------------------------VEMARAGIANDHQ-------KLTIQLDDVTSRI
A0A518KBI5      ---------------------------KREE-------LA-------SLEIQERTLRRRF
A0A5C5V6Q5      ---------------------------KRKE-------LA-------ALQIQQRSLKTRF
A0A517P477      ---------------------------GEAGDQKLSETIA-------QLESFRNNLRQQL
A0A518HFS8      ---------------------------EQAG-----RYLE-------ILEEQERILREEI
A0A7Y5LUV4      ---------------------------IQGSLTALQTDLN-------SAQAEELSLTDEE
A0A3M1TFJ0      ---------------------------IDTILGQLESQRQ-------QRLSEEEGLSQRA
A0A7Y5HGA4      ---------------------------LEKDGAGQVKELE-------NQLAAENAARAEL
A0A517MY49      ---------------------------LQQD-------VS-------QAMQQERQLTSSF
A0A2E6AG00      ---------------------------VKQE-------VD-------QASAHESQLKIEY
A0A1G3A880      ---------------------------LSQA-------LA-------NASQREMALRDSF
A0A2E8ATT1      ---------------------------LEEK-------LF-------EAWTFEKGLLKEY
A0A524HC32      ----------------------------------------------------VAAMKERI
A0A660VT66      ----------------------------------------------------LDEMEQEL
A0A7C2ZTD2      ----------------------------------ARNELK-------QTAAYENRLREIL
A0A0S8H0S8      ----------------------------------------------------QGEIRAAL
A0A7C2VEF7      ----------------------------------------------------EQTLLVSF
A0A7V7D6N0      ----------------------------------------------------EAELQTSF
M5S2L2          ------------------------------------------------------------
A0A7V1EK28      ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A7C2VXA0      ------------------------------------------------------------
A0A7C3AA48      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A7C5PFV3      ------------------------------------------------------------
A0A7C3QGD2      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A7Z9UC46      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A7C2ZUK5      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ------------------------------------------------------------
A0A7X8YY48      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
                                                                            

A0A523CME0      QNLKRDSKMAGSK-------------------------SYIKSAIEKKGEEVPSRYDPLP
A0A7Y3UKB3      QNLKRDSKMAGSK-------------------------SYIKSAIEKKGEEVPSRYDPLP
A0A7C2JY73      QRESAEARNVAKY-------------------------QAKDETLNAELARLRQLWGQLD
A0A836W298      QHEKRVAMPIAKL-------------------------QARIEFVKDTLDRLRKDYDLLL
A0A354PCV3      EEEVARLEQFGGM-------------------------TAELQFAQAELEVANDVLKKLR
A0A354PHB4      EEEVARLEQFGGM-------------------------TAELQFAQEELEVANDVLKKLR
A0A356ESF4      --------------------------------------MTELENKERDLKRLQTWNEQLL
A0A538RV31      DKMASDVKSDARR-------------------------GVELESLKEQIESTDKISQRLH
A0A1G2XSU7      VHEDSKTIELGRK-------------------------QLAMQDVKEQLDNSKDMYSTIQ
A0A350KD81      DQETELAKKVGDF-------------------------QVVDQSYNEEIAQLKSQRDNIF
A0A356AE44      DRSADQAKDFAQY-------------------------EEREQTLSDELKRIKSLHDIVA
A0A7Z9UBD9      EATTAAAGEREQD-------------------------RVRLRELQRDATSNRTLYENFL
A0A257WQ92      EDESVKARGVAKF-------------------------QAKDEAMHAELARLRDLWGQLV
A0A2E3Z6T8      QQARAEAAAYSGS-------------------------LVQFRALERAVARDEAKSDILT
A0A7Y2AF64      AEAESEAVQLNDQ-------------------------QVQLAFVNHELDRLRSLHDTLL
A0A7C1U6X6      AKDKKDFDQLFAI-------------------------AQDFETQSIALRHKRELFDQVR
A0A7C7UXI5      EVEMQRAIALDRD-------------------------NTELTNLELDLDRLRRYYDAVL
A0A7C3SFJ0      NKHVEETQKFSSQ-------------------------SIDLELRKNELDRLKRLTERMG
A0A7X7YIF4      EGLDVKTINLGRK-------------------------QFAINDQQEQLNRTKEMYNEVC
A0A7C7WWF7      NLATGEAKVVTRE-------------------------LTLLSETQSDVERLMHLHDTLL
A0A7V3JIB0      EQAKKLAESFGGS-------------------------SIDVEMMRSEIALLEGLLKSVA
A0A356ETW1      QAAQADASRRTGQ-------------------------IARLTMLQREVKRLYDLSDALV
A0A3L7NJY1      ESEQVKAQNLTQI-------------------------LTRLADVDREIERLYTQQSDYQ
A0A2D6SRY7      ---------------------------------------FELVGLLRKSEVNQDLYTRLL
A0A1G3C300      NEQSLVVFDLNRK-------------------------ITVYRRLQREADSERAFYDILL
A0A177PV03      NAAEYKARAREEW-------------------------IKQEARFKESALSARQSYEEVG
A0A1G2YIM0      SKHNVQTIELGRK-------------------------QLAMQDQKDQFALTEEMYNTIR
A0A1G3A0W0      DKQQVEFDTLFAT-------------------------AQSLEKANNDLNHKRDLFEAVR
A0A7V7D8F5      AKEDTETIDVGRR-------------------------QLDIQELQDEMSLTKETYDRIG
A0A432MFP3      DLIELADRSESVE-------------------------QLEISFAMTKLKQYQAMEQQVQ
A0A518HFL0      DRIEPSTRSEGIE-------------------------QLKVSFAATDLRQRRIMLDQVN
A0A3L7UX05      KELQLA-------------------------------------FRRTDLARAESTLDSVQ
A0A2E0SHG0      -------------------------------------------ALLEDYDLLQVHSMGNL
A0A2S8F9B8      AELENEVRTFGRS-------------------------SVEVEMMRSEIESLDEIVQQLN
A0A368KP63      AVLEKEVRTYGRS-------------------------SVEVEMMRSEIEGLDSIVQQLS
A0A518CQB8      -------------------------------------------SLLEDYELLKVQSMGNI
A0A7C4QPD3      DSLQLAETKLARD-------------------------WVDREAIAEEIAALKGTVDAYA
A0A7C2JZW2      SASKTEEASLANL-------------------------MIEREQLTEQITSLKSTVDIYA
A0A836RF42      -------------------------------------------NLSEDMGGYKAT-----
A0A7D8YCU5      TEMRSRAHDLMRF-------------------------ENENISFNRRIKRLQDMLDSFE
A0A353BE27      ERERRSSRELQGM-------------------------LDGYRILQTDRDAVSELLTAYT
A0A5C6BPW1      DNRKIQKTQIVTD-------------------------SFELQQLQKEAAKLEARTDEID
A0A1I3GSP0      TDAQKKAKQAEMF-------------------------EVEDQRRKDEIAQKKQQLERMF
A0A517QJV1      EDAEKKAKDAELY-------------------------QVEDQRLKDDLSIKKAQLSQVF
A0A3C1QS25      EEHRARAMELNQV-------------------------DLSLKNLLDQKKYQESVITSVV
A0A5C6FX55      ESEAAKGRLLADK-------------------------EVDYIALQNKIEGTRELVTQVS
A0A5C6DS51      EEELRLAKEVENA-------------------------FLEGSAKKAKLVRAQARYDEVI
A0A5C6DSL6      DQELIEAKKVENA-------------------------FLEGSAKKAILVRAQARYDEVI
A0A3M1VG27      EEKLRVAKQFAHI-------------------------LEQDQAYRDQIQSIKSTLDVVI
A0A518GC22      AEEKKKSRELQIM-------------------------LGEDRVIKAELEAVNTLLAGYT
A0A3L7Q373      DDAEKTARMASTY-------------------------EVTDQQYKDDIARMKKDLDLAL
A0A3E0PW54      ASAESEAKAAGLF-------------------------EVEDQKRKDEIARHKKQWQDVI
A0A7C3TAH2      TEQDELAKKMGRT-------------------------AVDIQTLQWELDLVKKDHDLAY
A0A1Z8MHR4      ERERQLADELKKA-------------------------EENDASFNRRLETIHALRFQLE
A0A5C6EHJ0      EDEMTQARTESDS-------------------------EIRSAQFVREIERQQQLYDRIV
A0A5C6F1H9      EAEMTQARAESDS-------------------------EIRSAQFVREIDRQQQLYDRIV
A0A255QXY0      EAEKRAADELKHF-------------------------EEDESSYKRRIASVQGMLIQLE
A0A517SYI0      ERERQLADELKKA-------------------------EENDASFNRRLETIHALRFQLE
A0A518HX54      DTEKLAADELKKY-------------------------EDTDASFRRRIASLQGMLIQLE
A0A5B9MF59      EQQKDEADKLKIV-------------------------EERDASFNRRIETMRGLETQLE
A0A2A2WC24      EQQKDEADKLKIV-------------------------EERDASFNRRIETMRGLETQLE
A0A518KYW8      EQQKDEADKLKIV-------------------------EERDASFNRRIETMRGLETQLE
A0A5C5YZZ0      TEVRDRALKLIAF-------------------------ENKNSSFLRSIARYQETLQSFD
A0A518JLD2      HTAVEAAKAESIA-------------------------ESRSEQYVREIERQQQLYDRIV
A0A5M6DJ15      VKMDEEVKELGKS-------------------------SMEIEMKRSEIASLSDVLTRLA
A0A3L7P7S7      QSLQEELDKHKAL-------------------------ENRKLEMSRRLEQLTRDSETIE
A0A517N8M1      TVERQDAAKLAQF-------------------------EQENQAQLREIERTRDLLNQLE
A0A5C6CW01      VDERAAAIELAKY-------------------------EQDNVAMLRELERNRDLMDQLE
A0A5C6BXS9      TTEKSEAIKLAKY-------------------------EQENMALLREIERNRELSNQLE
M5U569          ATEKSEAVKLARY-------------------------EQENNAILREIERNRELINQLE
L7CND7          ASERIEATKLAQD-------------------------EQENASMLRQIDRNRELINQLD
A0A0J1B8S4      ASERKEAIKLAQF-------------------------EQENTALLREIDRNRELINHLE
F2ARR3          NAEKSEAVKLAKF-------------------------EQDNTALLREIDRNRELINQLE
K5D8H6          NAEKSEAVKLAKF-------------------------EQDNTALLREIDRNRELINQLE
M2AKU0          NAEKSEAVKLAKF-------------------------EQDNTALLREIDRNRELINQLE
A0A5B1CRW9      QKEMLLAKQIEAD-------------------------FMKATSLRAKMQRAQQRYDEVV
A0A5C6EI46      EREMLAAKEVEAS-------------------------FMESNSLKAKLARAQSRYDQVI
A0A5B1CKI2      SEERLGASKLAQY-------------------------EQENQAQLREIERTRELLEQLE
A0A5C6EG84      AVERQSAAKLAQF-------------------------EQENHAQLREIERTRELLDQLE
A0A5C6F2X4      EDERTEAAKLAQF-------------------------EQENQAQLREIERTRELLNQLE
A0A7W5DXF4      EDEKKKALALAKF-------------------------EQEDASLLREIERTRQLINQFE
A0A5C5XTV6      ETEKKKAIEIAKF-------------------------EQENMAILREMERNQALINQLD
A0A5C6AAB1      AVEKGEAIKLAKF-------------------------EQENSAILREIERNRELINQLE
M5T8W8          ANEKSEAVQLAKY-------------------------EQENNAILREIDRNRELIDQLE
M5SF00          ASERIEAMKLAQD-------------------------EQENASMLRQIDRNRELINQLD
A0A2G1WDS1      ADERIEAMKLAQD-------------------------EQENASMLRQIDRNRELINQLD
Q7UVS9          AGERIEAMKLAQD-------------------------EQENASMLRQIDRNRELINQLD
A0A5C6B601      ATEEALADQLHKA-------------------------ENTDKAFNRKMDFLKGMLDELD
A0A517PFU1      AETREAAEDVRDA-------------------------ESRERELRDRRNRHADLYAALV
A0A5B9M8J9      SVEKQAADELKKF-------------------------EDTDASFRRRIASIQGMLIQLE
A0A2A2WFP6      EAEKLAADELKKF-------------------------EDTDASFRRRIASLQGMLIQLE
A0A518L8N2      DAEKLAADELKKF-------------------------EDTDASFRRRIASLQGMLIQLE
A0A518HQN9      EKQKDEADKLKIV-------------------------EERDASFNRQIETMRGLETQLE
A0A5M6D8H8      AVEKRAADELKEQ-------------------------EQNDASYRRRIESIRGMTIQLE
A0A1G2ZG92      NAYQEELLNIPLK-------------------------DSENSKLELTLTINKDMYQNLL
A0A2E7D3V4      DDEAKKAKEFSKF-------------------------EAEDQKFVEEIARIKSLQAVIV
A0A5B9PER9      QMHNNEAIKLSKI-------------------------EQEITRLDEQLKEIGASQRLGA
A0A517QSM4      SALKIKEAGEGTA-------------------------AFNLEELKREITHMETTESRFR
A0A355GJI7      TQESELAKKVGNF-------------------------QVIDQSYNEEIAQLKSQRDNIF
A0A1Z8MCI4      NAEKARLAGEQSK-------------------------WNAIQFELDNVEVSKDVLISLR
A0A517SYL7      NAEKARLAGEQSK-------------------------WNAIQFELDNVEVSKDVLISLR
A0A3L7P0L2      KEAEKTAKEASSY-------------------------EVIDQRYKDDIARKKKELDAIL
A0A6M5YVJ1      LDLREEVVKSNDY-------------------------RVEIAKIRSEIAQTEKVMTRIA
A0A832M9Q8      EESDKQARDLGNK-------------------------TQPILNLREQIADAKEALKRYN
A0A7W0MCI8      EQWKVTEQETGLY-------------------------SLQIADATKELGRLEALNETLT
A0A517SCC8      KSSMERAKSGMLL-------------------------EKDDRDWKERIADQKKFRDDLQ
A0A358MY60      DNERARLQQKGGN-------------------------AVELLFAKEDREIASQLLGMMQ
A0A517MNB1      DLEKGRLEQKGGD-------------------------AADLRFAQEDREIAVGILAKLN
A0A3A0DR44      DEYMKSLSESGGD-------------------------AVRLQFKYADLERESSVFNLIA
A0A142YJ13      AGLESQMSSLNVK-------------------------TMDVHWLDEEIEVASSTAKTVG
A0A517Z7D3      EEAEIEAKRASLF-------------------------ELEDQKRKDEIERVKDQLKTAL
A0A7X7KCE7      EKQRKDVEASSGD-------------------------TLELGFKYDELVRAEKVFEMIA
A0A1N6KY57      KRLTERSRSIGQN-------------------------SVDLFSIQEEIANADEIARLIG
L0DK20          KRLSERSLSITQN-------------------------SVDLFSVQEEIANADEIARTIG
A0A517XRC2      TELTKNAGNIAKT-------------------------GFDIQSLTRGLEPMKKRLDTLE
A0A6M5YH47      EAYKKSISAGVGG-------------------------GLNMKALQDGLKPQRENLERVN
A0A660UUK3      DRYDTATIGLGRK-------------------------QLNIDDKKAELARTREIFNTVC
A0A517ZHG5      DNRKIQKTQIVTD-------------------------SFELQQLQKEAAKLEARTDEIN
A0A1Z8MPL5      SKLALQVQEIGEY-------------------------SADLERRQDELVHLTQVTNELG
A0A7C1EH96      EEQDESTIRIGRT-------------------------QLDIDDLREQFENSRQIYNEIT
A0A5C1AGE3      EKGQRLIQIERTTAQSNLTKYSQAVTELESRLEVMNRMGIEVIKQDREIKPKMEQKQKIE
A0A2Z3HEL7      DTAKKTIESTAGG-------------------------GASIDALRKNLEPQRALLSRLD
A0A142XAP8      DGLQRVIATTAAG-------------------------GLSIDEDRKNLQPQREMHDKIQ
A0A6P2DEK1      EGLQRVIATTAAG-------------------------GLSIEEERKNLQPQREMHDKIQ
A0A5C6C1R5      VELDSEAKKLGRS-------------------------SIDIEMMRAEIASLDDVLNRLG
A0A1G2YRE4      AQEDTQVIEIGRR-------------------------QLNIEDLQFQQNLDQETYDTVR
A6BZU4          DQETELAKKVGDF-------------------------QVVDQSYNEEIAQLKSQRDNIF
A0A2D5GZ77      DQETELAKKVGDF-------------------------QVVDQSYNEEIAQLKSQRDNIF
A0A3D3R1Z6      DQETELAKKVGDF-------------------------QVVDQSYNEEIAQLKSQRDNIF
A0A517XG00      DQETELAKKVGDF-------------------------QVVDQSYNEEIAQLKSQRDNIF
A0A353Z859      VYEDESRNNKLAW-------------------------QMELDELNKSIEQFRTIYNRLQ
A0A2D6ST10      DEHKTTLTKNNIF-------------------------NAELNRLDQDIAQDGALIDAIA
A0A177QX42      DNIKGDALKMQGE-------------------------QRTNERLNEEHANLKQTYEALV
A0A517SHR0      EDVKAKALSMQED-------------------------QRIDQRLTEEHNHLKQLYDALV
A0A2E0AW64      QAEIEEIQNAKGR-------------------------TFDMVQLQTSLERAEEQALAFQ
A0A351FZ59      QAEIEEIQNAKGR-------------------------TFDMVQLQTSLERAEEQALAFQ
A0A660V239      AQQDKDTIGMGRK-------------------------QFVIDDKKDQLARTTARLEDTK
A0A177Q3B7      ERLRKQTQAATVG-------------------------QSDIESFRTEIAQSEKIADRIG
A0A2E0X6Y6      ASARQAAAEHSGH-------------------------IVEIERLEGQVEWTKTQREAIL
A0A518GFD7      DVLSDETRKLGQS-------------------------SIDVELMRAEIAGLEDVLQHVG
A0A518GE37      EVEKSRLEKQGGE-------------------------TAEIFFAREDYEQAAEILSQLN
A0A5C6F3H8      NEESERLEKFGGT-------------------------TAQLQFAQDELAVASGVLKKLR
A0A5C5X072      NEERERLEQYGGM-------------------------TAELRFANDELVVASGVLTKLR
A0A5C5WUQ3      DEERDRMEQFGGA-------------------------TAALQFAQEELSVATDVLRKLR
A0A5C6E697      EAERMRLEQFGGA-------------------------TAELQFAQEELSVANDVLRKLR
A0A5C5Z1A3      DAERTRLEQFGGT-------------------------TAELQFAQEQLDVANEVLIQLR
A0A5C6D2P7      EEERIRMEQFGGA-------------------------TAELQFAQEELAVANDVLKKLR
A0A5B9ML17      DQESEKFTTLLDD-------------------------SAKLQFAQDDLRRASLLLNKLE
A0A5C5VZJ8      DEEEARYENASRL-------------------------ASRLVEVEREVEADTHELDNLE
A0A517LX75      KTERVLAKEVESE-------------------------YLEGKALKARMVRAQQRYDEVM
A0A7X7YXL7      RDQTAKTFDMGTA-------------------------EFNIKDYQHQLAVDEGVLEQVN
A0A7W1FH76      VKEEENLRLYRNK-------------------------LFALQVLGQETASQEKFFLQLQ
A0A7C5W7B3      A-----ASDTDDN-------------------------TIRLRILEKRREALRTLLEDLN
A0A7V2IPP1      GQEDTQTIGIGQR-------------------------QLEIQNLEEQYALTKQLYDTIL
A0A142XL75      DNILRKISQTNDY-------------------------KIELSTIQFSIGQTEKLNQSLG
A0A6P2D5D5      EEIIKRVSKTNDY-------------------------KIELDGLKLSIGQTEKLNQSLG
A0A7C7T8W8      TEEKNKLLKTGDR-------------------------SLEFAFALQEVNRAEGVHSLIS
A0A5C6B3S0      NELENEAKQFGKS-------------------------SIDVEMMRSEMSALEQVLSSIG
A0A354GX32      ANLRAGGQTAGKS-------------------------NGDVDGLQAEVNALDAEVKKSG
A0A518GIZ9      ELESNKAKEYARF-------------------------QAEDQAMTAELNRLRSLWGQLV
A0A1C3EBY9      ELESNKAKEYARF-------------------------QAEDQAMTAELNRLRGLWGQLV
D5SX64          ELESNKAKEYARF-------------------------QAEDQAMTAELNRLRSLWGQLV
A0A517Z0U7      NALKVEERHLAVS-------------------------WVDRQILADTVDSLKEKVNRFS
A0A2S8FCC0      QLFEKEAKQFGRS-------------------------SIDVEMMRTEIDSLEGILSRLG
A0A1Z8MBT6      QIEGDKRSKRVND-------------------------SWDVDKHVNHLAMLRERYAAAE
A0A517SXN9      QIEGDKRSKRVND-------------------------SWDVDKHVNHLAMLRERYAAAE
A0A7X7F3C7      REAHAEATQLNTL-------------------------LTELENKERDLKRLQTWNEQLL
A0A255QXF5      DAEADRLRKRDNN-------------------------NVALEFAKTDLQQSRAMLQKVT
A0A518KYQ0      KAESDILRQRDGV-------------------------SVALLFAQDDLERTRSMLHRIT
A0A5B9QX47      DEERERMSQYGGA-------------------------TAELSFARQELEVANDVLSKLR
M5T666          DEERERMEQFGGT-------------------------TAELQFANDELVVASDVLTKLR
M5U6N6          DEERERLEQYGGT-------------------------TAELQFANDELTVASDVLTKLR
A0A517M0G2      DIEKSRLEQRGGK-------------------------AADLRFATEDREIAAGILGQLN
A0A5C6AST1      DEEKARLEQHGGD-------------------------AADLHFAQEDREIAVGILGQLN
A0A5C6C951      DNEKARLEKQGGN-------------------------SADLKFAQEDREVAVGILAQLN
A0A5C6C5T3      DEERERLEQYGGM-------------------------TAELEFAEDEQAVASDVLTKLR
A0A2A2W6A9      EAEADLLRQRDGN-------------------------SVALQFAQDDLARSRTMLHRIM
A0A518HQS9      KTESDRLRQRDGN-------------------------SVALQFANDDLERSRSMLHRIV
A0A5M6DFE6      EQERERMKKYSGA-------------------------SAELEFAQQELAIERETLQTLR
A0A5C6F286      SEERQRLEKFGGT-------------------------TAQLQFAQDELDVASGLLKKLR
A0A517NGN1      DRERVRLEQLGGD-------------------------AAELQFAEEDLAVGNGVLDKLR
M5RUI3          DDERSRLEQFGGA-------------------------SADLQLAIDEKQIAMDVLGKLK
A0A5C1AAF0      DRLGKSIKSINTA-------------------------NLDLEAEKIEIQTAEDLYAKVA
A0A3B8ZJM2      DEDTAKSQIVQGF-------------------------LLTHESIKNQAEKLDKIQEVLS
A0A1U7CLW1      ASLESQMSSLNVK-------------------------SMDFHWLEDEIAVASDTAKMVG
A0A5Q3LBQ3      EEELGKVKKSSGQ-------------------------SLELVFALAELEREEKVFELIA
A0A142WPR7      DQEKEAAKSLVAY-------------------------EVRDESLRNEIARTSKLFEGVV
A0A517T4K9      ENQKADEKRTGTL-------------------------SYELETVNKAIEQTEKIVQNVK
A0A7C6B2Q1      ENVRRTAETFGKG-------------------------SIEIEFLRAEVELARRTLQTIA
A0A2Z3GZZ5      SKDEETMKRAGGL-------------------------LDLAEAMAVQSQHADAEIMRLE
A0A4V0I6L6      DADEETARNMAPV-------------------------QQAIRNNEEKLKQTAAELQAAE
A0A7C4QQT3      HIESEQAKEVARF-------------------------QAQEQALSAELTRLRELWGQLV
A0A7V9G5K3      ATREKDLATYRAN-------------------------LAELMALTGDTTSRANLYERLL
A0A7W1JAD6      AQREKDLGKYREN-------------------------LAELQALSGDTQSRANLYERLL
A0A518KBI5      EKELANVQEGGGK-------------------------GAELEFAKAELAREEKVFELIA
A0A5C5V6Q5      QAELKSVQDSGGK-------------------------GAELEFAKAELAREEKVFEMIA
A0A517P477      EENQIEERQAGKE-------------------------SVGLRRLEAELLRKEELVNLLA
A0A518HFS8      ASLEQEMGTLGIQ-------------------------SLDLHWVEDEIDLSTEVARAVG
A0A7Y5LUV4      TRLGSKMAETASA-------------------------LNRSRRLTSELTAAKDLYSAYL
A0A3M1TFJ0      QQLREQSRQLARR-------------------------ARLYESLKKEVEANERFYEEFI
A0A7Y5HGA4      DRLQEAALALRAE-------------------------FEAVDGLVLEAERQRKAGEAEA
A0A517MY49      EEARDVASKHSAD-------------------------LATLENLEREKGRLESSYDAVK
A0A2E6AG00      VEARDSAVQXHXQ-------------------------IEELAIAEREVERLRSLHHTLQ
A0A1G3A880      ETARAEAVRLNGD-------------------------LAQLEILEHDVEQLRSFHDVLV
A0A2E8ATT1      QALEESALTLNDD-------------------------MAELTITERDVERLSRLHDTLL
A0A524HC32      EQQKKLVLGLNER-------------------------ATQYSIIAREVDTNKAIYQSLL
A0A660VT66      RDSEARAQRMLTL-------------------------LQSYTKLERDLKSSQSLYDIVL
A0A7C2ZTD2      DKEDAETIGLGRK-------------------------QLTIQDLQFQLELDGELYDKIR
A0A0S8H0S8      VDQQKQAEQMDAR-------------------------LARCALLEAAFKRSLRMNELLD
A0A7C2VEF7      QIQRRQAQDSGVK-------------------------AAEYSMLQSELGRTERICKILD
A0A7V7D6N0      DAQQQAALDLSVK-------------------------AAEYYMIESNLKRTEKLCDILN
M5S2L2          ------------------------------------------------------------
A0A7V1EK28      ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A7C2VXA0      ------------------------------------------QTDASHAIQTAAAKGAVS
A0A7C3AA48      --------------------------------------RSFLDQRLRSAEEISAVLGVPT
A0A3L7SU85      ------------------------------------------------------------
A0A2D6A9B6      --------------------------------------------------MSEPETNPAL
A0A2G6JGH3      ----------------------------------------------------MSEEPQEE
A0A7C5PFV3      --------------------------------------------------MSNKKKGKPE
A0A7C3QGD2      ------------------------------------------------------------
A0A3M1RAJ8      --------------------------------------------------STHQLTYDLG
A0A7Z9UC46      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A1V6CUG1      --------------------------------------IKKHQAEQEQQRAAADQVSAET
A0A3M1SE88      ------------------------------------------------------------
A0A7C2ZUK5      --------------------------------------YRRVTVGKVSRALDKAGAPIKP
A0A660WB30      ----------------------------------------GRNGEGADVKRFAASLPLVH
A0A660W9Z7      ------------------------------------------------------------
A0A7X8YY48      --------------------------------------EPESQHSLHVRVPLPSQTPAPA
A0A3M1R9K7      -----------------------------------------------VEIVQEAQQPRVA
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
                                                                            

A0A523CME0      DDSR----QYALSQDAVSIIQQTEASELMMGTRSFSPKFK-IDSNH----------VDER
A0A7Y3UKB3      DDSR----QYALSQDAVSIIQQTEASELMMGTRSFSPKFK-IDSNH----------VDER
A0A7C2JY73      SQVN----QVGI-EKDGSGYSLRQIA----PVKDMLSIKR-LLKFVGAGGLFGLA-LAGA
A0A836W298      DRIN----RLDL-GKD-QGLLTEIVSPPSVSTSQVWPKLI-VVALI--SVTLGLG-SGLA
A0A354PCV3      DRVA----AIRT-ERR-QDGAVRLLASATPPRTPVAEFPL-KKMAM--AGGAAMA-VPFF
A0A354PHB4      DRVA----AIRT-ERR-QDGAVRLLTSATPPKTPVAELPL-KKMGL--VGGAAMA-VPFF
A0A356ESF4      NKLT----DLNI-RRDGQEVRIEVVQEPQVASAPAIPDRR-RVALL--ALAAGLA-LGLL
A0A538RV31      QMID----EEQI-NLTAQDRIARLGSDPTPDTRRTLDEKK-QAIIAGGAGAAAMA-LVFL
A0A1G2XSU7      KRIG----ELEMERKRLARISVAYLANT----APYQDRRM-QYSLA--ITMGSLV-FGLG
A0A350KD81      KQLL-------VEKVSQGNSGYTLTQLAPVKDELVIKRQL-KFLMA--GAGAGLG-LILA
A0A356AE44      NRVE---------VLSLASDEGYQLTQISPSRAEPDIKHVIKIVGG--CLVMTLM-STYA
A0A7Z9UBD9      ARFK----ETRQ-QEDLQEADARIISRATLPVAKSSPRTS-LNLAL--AVVASTL-LGVG
A0A257WQ92      TQVN----QVSI-ERDGNGYVMKQIAP--VKEELSMKRIL-KFVGG--GGVAGMF-LIAG
A0A2E3Z6T8      DKIA----NIDF-RQNQAPIRATVVREPIANNNPVTPQIR-LIAAV--CLLGGTC-VGVV
A0A7Y2AF64      ERMS----TIEI-KQDHADVTVSVTEDPEASPNPVSPNLK-KTVVS--SLFLGCA-FGFL
A0A7C1U6X6      QVRE----TKRM-ESGVA-GSIKVLTKASAPSKPSEDRRV-VFTAM--ALFMGLG-MGGG
A0A7C7UXI5      QRIK----DVDL-GEQNGMVRTAVLTQPEVPTAPVSPRLV-VVAFL--AVTLGLA-VGLA
A0A7C3SFJ0      QELE----QWEV-ELAAA-PRVTVLEPASVPKTSDIKRKY-RMMWF--LSAAAFG-VAVL
A0A7X7YIF4      KRIE----EIKV-ESQRP-ARISIAFR--ASSVPVTGRKY-KMIGA--MAFGGMV-AGVF
A0A7C7WWF7      DRIV----SFDL-SKNGPDVRVSTVGKTEARMDPVAPKLS-LVVVL--AALGGLS-FGLG
A0A7V3JIB0      DERE----KLNI-EIRNR-PRITLMHRADPPAAPDRDRKP-QLTVL--AGLGGFF-LPFL
A0A356ETW1      SQIA----SLDL-RQDGHDVRAKVTAPPVANHRPVSPRLA-FVALV--AIVSGLG-IGFA
A0A3L7NJY1      NHAD----GISL-NKDTF-IRTKIASKPTVPTRPVSPRLA-IVGIL--SLMVGTA-GGLL
A0A2D6SRY7      QKYE----EARI-AEAAEVGTAQLVDPALPPGGPFRPNTS-VNVFL--GALLGLV-LGIA
A0A1G3C300      KRMK----ESNI-AGDLQTSNVSILDPAMEPRTPIGASRN-SQIMK--GVMIGLA-LGIG
A0A177PV03      KRLN----ELQ--LSKNFGGVTADVIEPATPALKVAPVPA-KIFIV--AMMLGLL-LGAG
A0A1G2YIM0      RRIQ----ELE--MERKRPARISIAFNADSMLAKDKRP---KYVVA--NIFGSGF-LAIL
A0A1G3A0W0      QRMD----QKTM--ERDIPPSIEVLSKAFVPSQPHSDRRM-VFMAM--ALILGVG-AGGG
A0A7V7D8F5      RRIQ----ELEMERKRPARISVAYNADVASIRDKRV-----KYSAA--LVFGAFA-CGML
A0A432MFP3      RRLE----VLRFESRPADTITVIDPATP-GLMLSNKRD---KFLAL--TPLAMLG-LVLG
A0A518HFL0      RRIE----MLEYESRGSEPIIVISEAKPGGPPVTNKRD---KYLAV--TPLAMLG-LVLG
A0A3L7UX05      RALE----QLQFESQGQTQISLIQTARPIGLPSNDKRW---RFMAM--APLGMFL-AVAS
A0A2E0SHG0      NEVR----SAKTSLL--------------------------LGILP--GAFFGFI-FGGL
A0A2S8F9B8      AEIE----RTKIELRQAPRITLLSEAKLGVVSDKKRPL---MITAA--AAFAGFM-LPAG
A0A368KP63      AEIE----RTKIELRGTPRITLLSKAEPGTVTDKKRPI---MITAA--AALAGLV-LPGG
A0A518CQB8      DDVK----SAKVSIL--------------------------YGIIP--GGFVGMM-FGLL
A0A7C4QPD3      MEIR----RRQVELDNAPPAIRIHQKAREPQVADERKRL--LATVG--GAGAGLT-LVLL
A0A7C2JZW2      QEVR----KLEVELAKAPPPIVVSPAGVRVPVQPDQKKRY-LATIA--GAGGGVG-LVAA
A0A836RF42      ---------------------VVSAPGQGYQVEPDLARSLAVALVL--GLMSGFG-LA--
A0A7D8YCU5      AQVE----RASL-PLMNPGLEVEVLNRSGRGVQ-TGPNLS-RSLMM--GLMVSVA-LGFA
A0A353BE27      EKLQ----EIDL-MPKMGQRTLKRLDMPNTGLF-YGPKVI-KYLVG--GAAVGFI-LLSG
A0A5C6BPW1      NKID----ELKIELDAPDRINVAQWAEVPRIKD--WESLY-KKSAM--AGLGVFG-LFVA
A0A1I3GSP0      DQIA----EYDI-TRGQEGYRLQQISQVRIERS--MKRVI-KLVGT--CGVMGIA-IIFC
A0A517QJV1      NQIA----TYDV-SKEQEGYRMKQIAQVRIERS--LKRVI-KIVGM--FGFLGIG-LVFI
A0A3C1QS25      DRLQ----QVDV-TGDKEGFNYEILEPPTFAEQ-TEPSLL-KVFAV--AGFLGLL-GGVG
A0A5C6FX55      ESMA----RVDMSTSTESETRVVELIAAKGAYL-VAPILW-KLVGI--GGFLGLA-LGAG
A0A5C6DS51      RRLQ----ELNL-AGSYAGFSTDLLASPESARNPSWPKLP-IVVVL--GAMLGMF-LGSS
A0A5C6DSL6      RRLQ----ELNL-AGSYAGFSTDLLASPEAATVPSWPSLP-IAIVV--GAMLGLF-LGSA
A0A3M1VG27      SRMQ----EIEL-IKDNRGYALRTVAEPKAEVSIKRP--L-KFLGA--GLFGSLV-AVTA
A0A518GC22      EKLQ----EISL-MPKVGQRTLKRLNMPSIGWF-YGPTLP-KYLLG--GAAVGFV-LLSG
A0A3L7Q373      KQLS----DLDQ-NKAQEGYKMSRTNDVRVDRS--LKQTI-KIVGA--FGVMGLL-AVFG
A0A3E0PW54      VELE----SFGV-RKEQEGYRVNQIAQVRVEKS--IKRII-KIVGA--MGCLGVA-VVFG
A0A7C3TAH2      NRLA----EKQL-EQRRE--RRITVQASAEVER-IDDKRP-KYAAA--MAFAALG-AGCF
A0A1Z8MHR4      QQLA----ALNL-AHVNDGIMVKQIQETSPAIR-VGPELT-RYLLI--YGLFGLG-ISGL
A0A5C6EHJ0      ARLD----EVNL-MSGGDGLKVFPLNTAKLGYQ-VAPSLA-KSLIL--GGFLGSM-LAFG
A0A5C6F1H9      ARLD----EVNL-MSGGDGLKVFPLNTAKLGYQ-FAPSMP-KSLIL--GGLLGGM-LAFG
A0A255QXY0      EQLA----GLKL-IDMDGGIIVDQLWGSGGAAR-IGPDQK-KDLLA--GGMIGFI-LGGI
A0A517SYI0      QQLA----ALNL-AHVNDGIMVKQIQETSPAIR-VGPELT-RYLLI--YGLFGLG-ISGL
A0A518HX54      QQLA----ALEL-IDINGGILVEPLLATGKAHP-TGPDLR-KDVAV--FTMLGLG-LSGL
A0A5B9MF59      QQLA----ALNL-ADVKGGILVEPLLDTGQAYV-TGPDLR-KDLIL--YGMLGLA-LSGL
A0A2A2WC24      QQLA----ALNL-ADVKGGILVEPLLDTGQAYE-TGPDLK-KDLVL--FGMLGLG-LSGL
A0A518KYW8      QQLA----ALNL-ADVKGGILVEPLLDTGQAYE-TGPDLK-KDLVL--FGMLGLG-LSGL
A0A5C5YZZ0      SQLE----KANL-PSLNSGLHVNVLRPAGLGYL-VGPILS-RALVL--GGFLGLV-LGAA
A0A518JLD2      ARLD----EVNL-ISEGEGLKVIPLNTANYGYQ-IAPVML-KSLVM--GGFLGTV-LAFG
A0A5M6DJ15      AEIE----RTSI--ELNAQPRVTVVDDARARTNSGSKKRV-LASGV--MGFAGLC-LPLL
A0A3L7P7S7      FNKQ----QYAM-TKDHGGYDAQELGRIPELGGEVPSRKS-LIVVA--GGIFGVA-IGGG
A0A517N8M1      EQMA----RVTI-SEDERGTRVIELTAPSLAYK-VGPSLL-KTVGG--GSILGIL-LGCG
A0A5C6CW01      EQMA----RVSL-TEEEGGTRVQELTAPSRAGR-VGPNLT-RTLAM--GTFIGLV-IGAG
A0A5C6BXS9      EQMA----RIEL-TEEEGGLRVSELRAPSGAYR-IGPNMA-KMLSV--GALLGVA-VGMG
M5U569          EQMA----RVEL-TEEEGGVQVTELSAPSNAYR-VGPNMA-KMLSF--GTFIGLA-AGCG
L7CND7          EQMA----RVEL-TEEEGGLQVSELRAPSRAYR-TGPNLV-KMLGI--GTFLGLA-LGCG
A0A0J1B8S4      EQMA----RVEL-VEEEGGIRVTELVAPSTAYV-IGPSII-KTLGI--GTIAGLI-IGCG
F2ARR3          EQMA----RVEL-TEEEGGLRLTELRAPTRAYR-VGPNML-LMLGI--GLGVGLL-LGCG
K5D8H6          EQMA----RVEL-TEEEGGLRLTELRAPTRAYR-VGPNML-LMLGI--GLGAGLL-LGCG
M2AKU0          EQMA----RVEL-TEEEGGLRLTELRAPTRAYR-VGPNML-LMLGI--GLGAGLL-LGCG
A0A5B1CRW9      ERLQ----ELKL-SRSYAGFSTDLLASAEVPMNPVWPRLP-IVLAL--GLMGGLA-MGSL
A0A5C6EI46      VRLQ----ELNL-SRSYAGFSTDLLASAEVPRNAVWPKLP-IVLAV--GVGAGLA-LGLL
A0A5B1CKI2      EQMA----KVSI-GKDERGTRVIELTAPSLAYK-VGPSIL-KTVGL--GSLLGIM-LGSG
A0A5C6EG84      EQMA----RVNL-VEDERGTRVIELTAPSLAYK-VGPSLI-KTVGA--GSILGIL-LGCG
A0A5C6F2X4      EQMA----RVNL-VEDERGTRVVELTAPSLAYK-VGPSLI-KTVGA--GSILGIL-LGCG
A0A7W5DXF4      EQMA----RVSL-TEEDSGVIVTELSAPSMAVR-IGPNLS-KSLSL--WSVVGLA-LGCV
A0A5C5XTV6      EQMA----RIEL-SEEDGGLQVTSLRAPGNAYR-IGPNMA-KMLTI--GTLLGIA-AGLG
A0A5C6AAB1      EQMA----RVEL-TDEEGGVRVSELTAPSSAYR-VGPNMV-KMLGI--GTFLGLA-LGCG
M5T8W8          EQMA----RVEL-TEEEGGVRVSELSAPSSAYR-VGPSMA-KMLGI--GTFLGIA-LGCG
M5SF00          EQMA----RVEL-TEEEGGIQVSELRAPSRAYR-TGPNLV-KMLGI--GTFLGLA-LGCG
A0A2G1WDS1      EQMA----RVEL-TEEEGGIQVSELRAPSRAYR-TGPNLV-KMLGI--GTFLGLA-LGCG
Q7UVS9          EQMA----RVEL-TEEEGGVQVSELRAPSRAYR-IGPNLM-KMLGI--GTFLGLA-LGCG
A0A5C6B601      QRIE----ELDL-ANTNGGIVVEPLLNTGNAYV-TGPDLK-KDLIL--FGMLGLG-LSGL
A0A517PFU1      ADVD----QLDL-LKDADTVRVTPIVPPGPGRP-ARAPLI-RALAA--GGALGLA-VAFG
A0A5B9M8J9      QQLA----ALEL-IDINGGILVQPLLATGKAHP-TGPDLK-KDLAV--FAMLGLG-LSGL
A0A2A2WFP6      QQLA----ALEL-IDINGGILVEPLLATGKAHR-TGPDLK-KDLAV--FTMLGLG-LSGL
A0A518L8N2      QQLA----ALEL-IDINGGILVEPLLATGKAHR-TGPDLK-KDLAV--FAMLGLG-LSGL
A0A518HQN9      QQLA----ALNL-ADVKGGILVEPLLDTGQAYE-TGPDLK-KDLVL--FGMLGLG-LSGL
A0A5M6D8H8      QQMS----ALKL-VDVNGGIIVEPLLSTGQAYV-TGPDLK-RDLIL--YGMLGLG-ASGL
A0A1G2ZG92      EYLM----TVSI-AESMTLSNIRLIEAAIEPYKPHFPRRY-LNFAI--ALFLSVF-WGLV
A0A2E7D3V4      KRLA----EM---GLVAKNYGYKLKQISPVRDQLVFKRKL-KFWFM--GLAMAMS-AVGA
A0A5B9PER9      ELLLQISPDGDISNSNGNDGYRFERLANALEGQAVWPNLP-MLLGL--GGLLGSL-FGFG
A0A517QSM4      TEIE----ALL--IEIQAKQRITENRRASTPHTPQMSKKY-KMAGM--AGLAALG-LIAG
A0A355GJI7      KQLL-----VE--RVSQGNSGYMLTQLAPVKDELVIKRQL-KFLMA--GAAGGLG-LILA
A0A1Z8MCI4      RREA----ALK--TEGGYKDVVSSLASASLPETPLENSNT-KRQLL--AYPLVFA-ALFG
A0A517SYL7      RREA----ALK--TEGGYKDVVSSLASASLPETPLENSNT-KRQLL--AYPLVFA-ALFG
A0A3L7P0L2      TQIT----HF---DLNKDQEGYTLSRTNDVRVDRSMKRVM-KIVGA--CGILGLL-SVFC
A0A6M5YVJ1      DEAN----SIKI-ELGGAPPRVSLAEEPHVVPGLGGSRRK-KFAVA--AVLGVLF-VGFA
A0A832M9Q8      DRIE----VIE--NQNQAQGRVTALGPTVEPKTPSVDKRP-RYALA--ANAAGIM-VGMV
A0A7W0MCI8      TELERREFELK-----NARLPARIIEDAIAPTTRSFKKKL-AGVGG--AAGIALA-LVIG
A0A517SCC8      MKLA----SF---NQTRDQEGYRMEQIAQVRVGKSMKRFL-KIVGA--CTLAGIA-AVFG
A0A358MY60      QRLA----AIK--IERRRGSGLHTVDAAKPPTRPVVPLPF-KNMIL--AGLLGLA-APFS
A0A517MNB1      ERLA----AIR--TERRRGMTIQTLAAAKPPNKPLVPVPV-KKMVV--AGGAAFM-IPFL
A0A3A0DR44      QRKL----QVE--TETHNPAKVIVRSDAQIPPAPIEAWPY-KPLIL--FCGAAFV-LPFF
A0A142YJ13      AEVQ----SMT--VEMQAPPRIRLIEKASIPTLSDPMKRY-KLSGA--AGAGALV-AFLG
A0A517Z7D3      TQLS----TF---AQYKDQEGYRLKQIAPIRVDRSRTRPI-KIVGM--FSMMGVM-AVFV
A0A7X7KCE7      QRAV----ELQ--TERGAPGRVRLMQGATPPSAPVEAFPL-KLMAI--VCMGGLC-LPFA
A0A1N6KY57      KEVE----ALT--VELQAPPRIRLLEKAELPRTKDETRKF-KLAGV--AGCGAFA-LALL
L0DK20          KEVE----ALT--VELQAPARIRLLEKAELPRTKDEARQL-KMAGV--AGCGAFA-LALI
A0A517XRC2      DQKI----QIV--IERGMESRVSVREAAVLILNENLKQKV-MLSGA--VGVAGFL-GVLA
A0A6M5YH47      AHLL----QLR--LAVKMEGRVSPHGVTEKIPNNNQNRKL-LMSSV--GGLGAFF-GVVF
A0A660UUK3      NRIS----EIV--MEQKRPARISIAEMA--SSVPAQSKRK-KLALA--TPFGGIA-LGVF
A0A517ZHG5      NKID----VLK--IELGAPDRIKVAQWAEVPRIKDWESLY-KKSAM--AGLGVFG-LFVA
A0A1Z8MPL5      YELE----KLDLELRANQSRVRRVDGGVRKPKTGDTSKRD-QLTLV--ASFGALL-LGIG
A0A7C1EH96      RRIE----ELN--IERDRQPRISI--GSWARSVSAEGKKK-KLVAA--APFGGLA-AGMA
A0A5C1AGE3      EQIE----QLN--LWLSSGGRIEIREKAVIMYNHNQRQKM-LYSGM--IGVAMFL-VVLT
A0A2Z3HEL7      EQLL----QLS--TGEGRT-RASARGEAEKIPNNNQNKKL-AMSSV--GGLGAFL-TVVL
A0A142XAP8      SQLI----QLQ--VAALQSGRVSARGGAEKIPNNNQNKKI-VLSSA--GGAVSFF-GVIL
A0A6P2DEK1      TQLI----QLR--IAAQQSGRVSARGGAEKIPNNNQNKKI-VMSSA--GGFVSFF-GVIL
A0A5C6C1R5      SEIE----RTR--IELNSGSRVAVISEATPVADSSSKKRY-VGTAG--LGFIGFC-LPFL
A0A1G2YRE4      RRIR----DLE--LERKRPARVSVAYNADISG--IQDKRA-KYSAA--LLFGALF-CGMG
A6BZU4          KQLL-----VE--KVSQGNSGYTLTQLAPVKDELVIKRQL-KFLMA--GAGAGLG-LILA
A0A2D5GZ77      KQLL-----VE--KVSQGNSGYTLTQLAPVKDELVIKRQL-KFLMA--GAGAGLG-LILA
A0A3D3R1Z6      KQLL-----VE--KVSQGNSGYTLTQLAPVKDELVIKRQL-KFLMA--GAGAGLG-LILA
A0A517XG00      KQLL-----VE--KVSQGNSGYTLTQLAPVKDELVIKRQL-KFLMA--GAGAGLG-LILA
A0A353Z859      EEGE----RAR--MTMSNLMRVEKFRDAVTPTQPDMAKKI-MATTA--VGGGLFG-LIFL
A0A2D6ST10      TQIE----QIEV-EIENSPKRIMEFRKADAPQRRDQKKKI-TGAAA--AGFGVFG-LFVA
A0A177QX42      SKLV----SLD--LAKDAMAMQAEITSEPSPGVQIGPSMV-QSLGF--GGIGGLL-AAIA
A0A517SHR0      AKIT----TLD--LSKSAAPMQADILSEPTPGIQIGPSMP-QALGF--GGFGGLL-AAIA
A0A2E0AW64      DRED----RLR--LESKNLDSITLLKSASPPVKPAVIAPW-KNMLM--GGGIALL-IPFG
A0A351FZ59      DRED----RLR--LESKNLDSITLLKSASPPVKPAVIAPW-KNMLM--GGGIALL-IPFG
A0A660V239      KRID----QIR--LESKRPSRISVAYGA--SSVPARGKRR-KLAAA--LGFGGLA-LGAL
A0A177Q3B7      SEVE----RLK--LEVDAPQRVHLIEEPVVMESASTRFRA-KALLG--AAFGALL-LAIG
A0A2E0X6Y6      AQLQ----QVES-LAGQAPIKASVVREPLPDPRPVSPRLK-MVVVG--ALAGGLF-LGSL
A0A518GFD7      GEIE----RTS--IELKTASRIKLLSSADRAIAPDLKKRF-AVAGA--GGGLGLL-LPLV
A0A518GE37      NRLA----TLR--TERGRGSSVSTMAAAKVPSWPIEEIPF-KKVIM--AGGAAFL-LPFA
A0A5C6F3H8      DRVA----AIK--TERRQDGAVRTLAEATAPKSPIETVPY-KKLAM--ASSVAFM-VPFL
A0A5C5X072      GRVA----AIR--TERRQDGAVRTLAAATPPKAPVESKPY-KKLVM--ASAGAFV-IPFL
A0A5C5WUQ3      DRTA----AIQ--TERRQDGAVRTLASATPPKNPTETIPV-KQLGL--ASTVAFV-APFL
A0A5C6E697      DRVA----AIR--TERRQDGAVRSIAKATPPRTPVEPIPL-KKMAV--FGLGAMM-IPFL
A0A5C5Z1A3      SRDA----AIK--TERRQDGAVRTLAAATPPKTPVEEIPV-KKMAV--AGLAAMM-IPFL
A0A5C6D2P7      DRVA----AIR--TERRQDGAVRTLAAATPPRTPIESLPV-KQMAV--FGGGALM-IPFL
A0A5B9ML17      DRKA----AIK--TERTQADAVRSVSPATPPGHPVEDIPV-KKLLV--ASGGAFA-IPLL
A0A5C5VZJ8      KQLN---------IREMRRATEVTVAMSTAVAKPPVDKRV-KLSAA--ALFGALI-AGLG
A0A517LX75      ERLQ----EIQ--LTTNYAGFSTDLLSAPVVGTQVWPNPL-VVLSL--GSFAGLL-LGSC
A0A7X7YXL7      SRLRW--------LEMEQTNRPRVQLAASAEEVAEEDKRV-KYAVA--VVFGALA-CGVG
A0A7W1FH76      GRLN----EERV-TSQLQASTMNVIEPPRAEPQAINVRPT-ATKAV--AAGLALL-GGIL
A0A7C5W7B3      RRVEQGRWVRE--GLLKKDPAFTKVEKVNAATGRAAPNSS-LVYVL--ALLVGLF-AGAA
A0A7V2IPP1      RRIQ----EAE--LERRRPGRISVGEWGKVEQTF--DKRV-KLSAA--TLFGAVG-LGLF
A0A142XL75      ETIE----RLK--VELGAPSRVTCSEEPFIVTGIEGNRRL-KYTVL--AALAVFG-IGFA
A0A6P2D5D5      ETIA----RLR--VELGAPPRVSCSEDPFIVTGLEGNRRL-KFTVL--AALAVFG-LGLA
A0A7C7T8W8      ERIQ----VLQ--TEMGGPERIERLREADADSVSIASSPI-KTMTA--ASSCAFV-VPFL
A0A5C6B3S0      EEIERSKVELRDQIDSTGGSRVTLFSSAYAPRRGKSMTRY-SMAGL--AGVVGMA-FPLF
A0A354GX32      EELA----SLD--SSLPVTPRLTVTEAAAPPMSPASDKRI-KAAGG--AFLGLFG-LVFL
A0A518GIZ9      DRMS----QL---TIDKESSGYTLRQTGPIKDEWVLKRLL-KIVGA--GMVAGMG-LIIS
A0A1C3EBY9      DRMS----QL---TIDKESSGYTLRQTGPIKDEWVLKRLL-KIVGA--GMVAGMG-LIIS
D5SX64          DRMS----QL---TIDKESSGYTLRQTGPIKDEWVLKRLL-KIVGA--GMVAGMG-LIIS
A0A517Z0U7      DTIY----KREI-ELEKAGVPIVVRRPAEVPKKPDGGKRE-KMAGV--AGFGVFG-LLVA
A0A2S8FCC0      HEIE----NTK--IELKSDSRVSVLQEAQPPKSK-NPRSY-AMVGV--AGVFGFM-LPVA
A0A1Z8MBT6      QRLD----AIK--TESENMSRVQPIAAATPPTKPNEEVPT-KKLAM--VALAGFC-VPFG
A0A517SXN9      QRLD----AIK--TESENMSRVQPIAAATPPTKPNEEVPT-KKLAM--VALAGFC-VPFG
A0A7X7F3C7      NKLT----DLNI-RRDGQEVRIEVVQEPQVAAAPAIPDRR-RVALL--ALAAGLA-LGLL
A0A255QXF5      ERLD----SIQ--LESQRGSSVISVAKATPPTRPVEDMPF-KKMLA--AGGAGFF-VPFL
A0A518KYQ0      DRLA----SIQ--MESKRGSSVMSISQATPPSRPVEAVPF-KKMIM--AGGAGFA-IPFL
A0A5B9QX47      GRVA----AIQ--TERRQDGAVRSLAAAKPPSRPIEKIPY-KKMFM--ASAGAMA-LPFL
M5T666          GRVA----AIR--TERRQDGAVRTLASATPPKSPVEAMPY-KKLGM--ASAVAFM-VPFL
M5U6N6          GRVA----AIR--TERRQDGAVRTLASATPPKSPVEKMPY-KKLLM--ASAIAFA-VPFF
A0A517M0G2      QRLA----AIR--TERRRGSGLHTLAEATPPLAPVEPMPT-KKMIV--AAGGAFA-IPFF
A0A5C6AST1      QRLA----AIR--TERRRGSGVHTLAAATVPTRPIEPMPT-KNMAV--AGAGAFA-IPFL
A0A5C6C951      QRVA----AIR--TERRRGSGVHTMAAANTPTRPIEPMPT-KNMVV--VAAGAFA-IPFL
A0A5C6C5T3      GRVA----AIR--TERRQDGAVRTLAAATPPRAPVEAVPY-KKLAL--ASAGAFV-IPFL
A0A2A2W6A9      DRLE----SIQ--MESKRGSSVLSISEAVPPSRPVEAVPV-KKMLM--AGGGAFA-IPFL
A0A518HQS9      DRLE----SIQ--MESKRGSSVISIAAATPPSRPVEAVPF-KKMVM--AGGGAFA-IPFL
A0A5M6DFE6      NRID----AIR--TESEHEGVVRLLADATEPRSPVENVPV-KKMAM--AGGACFL-IPFV
A0A5C6F286      DRVA----AIH--TERRQDGAVRTLAVARPPKSPIETAPY-KKLAM--VSSVAFL-IPFL
A0A517NGN1      QRVA----EIR--TERRQDGAVRSLAEATPPRAPVESIPT-KKILM--ASGACFA-IPFL
M5RUI3          IRAA----AIR--TEKQQGGSVQTLAAATPPRIPLESVPT-KKLIA--VSGGAFC-IPFL
A0A5C1AAF0      AAIS----THL--AENDAPSRVAHLENARVERVNTEARKM-QFAGF--AGAAALG-FVCL
A0A3B8ZJM2      DKLK----GVEL-FQNSSNRKILQELIPSMPGAYYGPFSS-TYTAA--GALAGIL-LMSF
A0A1U7CLW1      AEVQ----SMT--VEMQAPPRIRLIEKASVPTMNDPLRRC-KLSTI--VGAGVFL-AFVG
A0A5Q3LBQ3      ARTL----ALR--TEMRAPARVNLLKEAEIPPKPIEALPV-KKLGI--AMLGSLG-LPLL
A0A142WPR7      KRLD----EISL-VKGYGGYEMSVLSPP-TEGFLTGPVMA-RYLAL--GAVAGIA-VGYL
A0A517T4K9      DEIQ----RLQ--IELQSPSRIALHRKAEPPRTRETGRKL-KLASV--AGFGMFG-LIFI
A0A7C6B2Q1      EERN----RMS--IELRAKPRITVVQRAEAPRVADQDKRI-QLATL--AGFAGFV-LPGV
A0A2Z3GZZ5      AERL----ARQA-TLGAGGYSAEQITRP-GSGHKVAPVLL-RSLLL--GLGIGAL-LGCG
A0A4V0I6L6      KEKD----RVSG-SRSAGAYEVRDVTKPADGGQ-VAPVLL-QSLML--GAVLGLL-LGGG
A0A7C4QQT3      TQVN----QVSI-ERQGAGYSLKQIAPVKDALSL--KRLL-KFWGA--GGMLGAL-LVAG
A0A7V9G5K3      TRKG----EEEV-SSHLNVNQIAVVDPAHSTSKPVNISRL-KFLAI--ALVAAAA-VTVA
A0A7W1JAD6      TRKG----EEEV-SSHLNVQQIGVVDPSHSTSKPVNISRL-KFLAI--ALVAGFA-AALA
A0A518KBI5      ARKL----ALQ--TESKAPARVEVVDEVTASPVPLEAAPW-KKLVL--ACGLAMA-APFG
A0A5C5V6Q5      ARKL----ALQ--TETNAPARVRVMGPIVASPTPVESAPW-KKIFL--ACGVGML-APFG
A0A517P477      TEAE----RREF-EISNATPPIAVQEDAVVPRTRNDGKRI-KTAVL--VGGGGVG-FGMA
A0A518HFS8      SEVR----AVTVELEAPPRIRLLEPAKPQGPADPMERYKF-CAMAA--VASMGAF-VGLV
A0A7Y5LUV4      KRQG----EQSA-TVGTGLQSVRVLDWAKSPPTPWKPNTR-QNLLI--GALLGLA-MAAG
A0A3M1TFJ0      QQQK----DISA-YS-RVNVAEVRIVDPALAAVRVGPNHV-RNVLV--GALLGLF-AGVL
A0A7Y5HGA4      GSVT----VHAF-AR-------------RGEAQLVSPDRP-VIFGT--TAALALL-LAAA
A0A517MY49      DQIR----SVGG-LQVQAPIRAIAVSEPRPEYRPVSPRLK-NVVLG--SIFAGFA-LGCL
A0A2E6AG00      DRIA----NIDX-NQNQADVRVEVVSDPKGRQTPVSPRLA-NVFVX--SLLGGTL-IGIG
A0A1G3A880      NQIA----NTDL-RQEHGDIRATVVKEPMASQQPVSPRLM-TVALL--VLVIGLL-GGGI
A0A2E8ATT1      ERIS----NIDM-TQHRANVRVSVVSEPAASRMPVSPRLA-FVGVL--CLTFGLG-GGTG
A0A524HC32      ERAK----EIES-MSGVSASNIQKVDRALLPIFSVKPNVK-LTLLF--AIVVGLL-GGLG
A0A660VT66      QKMK----ESDL-TAQGGVKPIEVIDEAVVPHRPYYPKVK-LNLAA--GLLLGLV-LAVL
A0A7C2ZTD2      RRIQ----EMEM-EQKRPAR----ISVAYNADVISIRDKR-IKYTM--ALIFGAMALGML
A0A0S8H0S8      SRIS----EVAL-ASDVGPMFIRVLEEASSGDEPTRPNRP-HAAAM--ALGLGLI-LGVM
A0A7C2VEF7      DRIK----ELNV-TEDTGALNISILEVARPATGPSRPQKT-RIMAI--ALILGLM-FGGA
A0A7V7D6N0      DRIK----ELNV-TEEAGGLNISILEVARPEDKPSEPQKA-KLMAL--ALALGLM-FGSG
M5S2L2          ------------------------------------------------------------
A0A7V1EK28      ------------------------------------------------------------
A0A2Z3GYP4      ----------------------------------------------MADAAGN-------
A0A7C2VXA0      QSLS-------------------------------------SAARRNWPRSAD-------
A0A7C3AA48      LGVV-------------------------------------PTMSRKL------------
A0A3L7SU85      ------------------------------------------------------------
A0A2D6A9B6      TDG---------------------------------------------VLVIV-------
A0A2G6JGH3      RAND-------------------------------------EERGDATPFVLV-------
A0A7C5PFV3      RGGE-------------------------------------FELDGEETFVLL-------
A0A7C3QGD2      ------------------------------------------------------------
A0A3M1RAJ8      IHVV-------------------------------------GSLPLVHKRRLL-------
A0A7Z9UC46      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A1V6CUG1      EAAP-------------------------------------REAWRVTPAADAAP-APAP
A0A3M1SE88      ------------------------------------------------------------
A0A7C2ZUK5      DENS-------------------------------------FIP----------------
A0A660WB30      SSPK-------------------------------------FALIMVLAGVGGVV-LGGA
A0A660W9Z7      --MS-------------------------------------NESLGKLNNLISTA-LDLQ
A0A7X8YY48      PDSE-------------------------------------EPPKTRLAVLLPKN-RPSQ
A0A3M1R9K7      DQDR-------------------------------------QIQLTVLAGLGGFA-CPVA
A0A3L7PH51      -----------------------------------------------------MA-LGLG
A0A3N5UQY5      -----------------------------------------------MALLCGLV-LGGG
                                                                            

A0A523CME0      IVSYYDFLGKQTWEG----------------PVMVHFRRLQISLN---------------
A0A7Y3UKB3      IVSYYDFLGKQTWEG----------------PVMVHFRRLQISLN---------------
A0A7C2JY73      LCVFRELRDTRLNTLAELRPVL------TQ-PLLGTIVKFAT------------------
A0A836W298      AVYVLDLLDDRFRSPEDLRLHL------GV-PVLAMVRQMEP------------------
A0A354PCV3      FALLWEL---RVRRVTDSSMSG------GL-SLVGEVARMPA------------------
A0A354PHB4      LGLLWEL---RVRRVTDSSMCG------GL-SLVGEVARMPA------------------
A0A356ESF4      AVHVLDTLDDRFRGIDDLQNQL------RT-TVLAVLPKL--------------------
A0A538RV31      VIAYWEFLARRIITGDDVVYGL------GW-RLVGAIPDLPS------------------
A0A1G2XSU7      LALITNKLDLRLKTPDDITKRI------GV-RIIGTTTS---------------------
A0A350KD81      FSYFREMRDTTMKSVDEIRNQL------HL-PILGEVPSFA-------------------
A0A356AE44      FLFLREMRDTSLKSLADLRAIV------DT-PILGTLPSIA-------------------
A0A7Z9UBD9      CAFVREYLDDRFRTPREVEEHL------GL-PVLASLPRLKD------------------
A0A257WQ92      ICLLRELRDLRIMSVGELRRAT------NY-SLLGTISRFTS------------------
A0A2E3Z6T8      MAYAQDVLADRFNSPEELTLQL------GV-PVLAMVKKLDA------------------
A0A7Y2AF64      IVYVLDRLEDRFRTPEELRDQL------GA-PLLAVVRDIPD------------------
A0A7C1U6X6      VAFLRASRNQTIYAPKDMPPTL------QA-PFLGYIPLTRI------------------
A0A7C7UXI5      VVYVQDLLDDRFRSPEELQLQL------GV-SLLALLQEFEP------------------
A0A7C3SFJ0      GVAGVDFLSRRVNSSAEVAYGL------GL-RVVGDLPVISG------------------
A0A7X7YIF4      LAFLLAKADKRLHHPNQIVRRI------GV-RIIGTT---TS------------------
A0A7C7WWF7      VIYVLDLMDDRFRSPEDLKDQL------GV-PVLAIVRKLET------------------
A0A7V3JIB0      GIIWLDARSRRINSSGEVYVHT------GL-DVIGALPLVPA------------------
A0A356ETW1      AVYVLDVLDDRFRDIDDMQQQL------GV-PVLSLIRRLDV------------------
A0A3L7NJY1      IIWVLDILDDRFRTPEELKLQL------ST-QILSMIPRLEQ------------------
A0A2D6SRY7      QAFLLEHIDNSVHSVRELEKAM------GL-PTFGLIPQIPE------------------
A0A1G3C300      LAFFLDYLDNTVKSTEDVENYL------GV-TLLGLVERAKQ------------------
A0A177PV03      LAFVAEAMDQNFHTLEEIRERL------GL-AVVGHIPIVEP------------------
A0A1G2YIM0      IALVFDKLDRRVHTTEDITRRL------GL-RIIGTTVSSEN------------------
A0A1G3A0W0      MGLLRANRRQTVYVPDDMPYAM------QV-PFLGYVPVLPV------------------
A0A7V7D8F5      LAFLRDRADQRLRTPDDVVKRI------GI-RIIGTTT--SS------------------
A0A432MFP3      LVTLVELRSGRVGGTEELSGRL------AA-EVFAVPPLPTT------------------
A0A518HFL0      LVTLVELRSGRVSGAEDLTGRL------SA-EIFAVPPLPSA------------------
A0A3L7UX05      LCVLVEVRSGRVSNPDDLTNRS------RL-EVLGVVPP-LP------------------
A0A2E0SHG0      MAAVIDLADSTFRSPEQIRETL------RS-PVLAHIPRLNV------------------
A0A2S8F9B8      LLLLRDFSKKHLSDLPTTRDEL------GL-EILGTIPK-LP------------------
A0A368KP63      LLVLRDFQKKRLSDLPTTRDEL------GL-EILGTIPR-LP------------------
A0A518CQB8      LAFVIDLADSTFRSPEQIRNTL------NT-AVLAHVPRLNV------------------
A0A7C4QPD3      VVVALEMHACRISDLAAVRGRI------NV-PVLGSVPV-IP------------------
A0A7C2JZW2      LLLLLELSIQRIFESSQIRTRT------NL-PLLGTVPL-IP------------------
A0A836RF42      --YLVDMADKRFRSPEDVQRHL------NL-PLLGHIPLALQ------------------
A0A7D8YCU5      LVWLADWSEQTYRNPEEVVTAL------GL-PILAHLPVIAE------------------
A0A353BE27      LAVLMDLADRSYKNPSEISTDL------GV-SVLGHIPVMN-------------------
A0A5C6BPW1      AIVWFEFQAKRIDTLGDVTGGL------NL-RIMGALPQMPR------------------
A0A1I3GSP0      LAYFREWYDTSLKTLDDVTTFT------HE-PLMGSVPTFSS------------------
A0A517QJV1      LSYFREWMDTRIKNVDELCKLS------ET-TLLGSIPKFAT------------------
A0A3C1QS25      IAYLVDLADKTFRSPDDIAQSL------AL-PILGHIPFI--------------------
A0A5C6FX55      MAFLLEKNANTFRDPDEIAASL------GT-SVLTHVPFF--------------------
A0A5C6DS51      SALAAELLDTTFRDVEDLEKTL------AA-PAIAHVPRF--------------------
A0A5C6DSL6      SALTSEILDTTFRDVEDLERAL------NA-PAIAHVPKF--------------------
A0A3M1VG27      MIYLREVRSRSLRSLEELRNAL------AV-PVLGGIPEF--------------------
A0A518GC22      LAVLMDLADRSYRNPSEIATDL------GV-TVLGHIPVM--------------------
A0A3L7Q373      MAYFREWYDTTLKSIEEVRSIV------KA-PLMGAIPRFRL------------------
A0A3E0PW54      LSYLKEWTDMTLRTADELKALV------PV-SVLGEVPEY--------------------
A0A7C3TAH2      LAFLRDKADKRFRSPAEITKVL------RI-PVIGTVT----------------------
A0A1Z8MHR4      LAMTFEASAKMFRSAEEVHSDL------RL-PVLSHIPLD--------------------
A0A5C6EHJ0      LAVLRELSDRSYHSARDIAEHT------RL-PIIGHVPV---------------------
A0A5C6F1H9      LALLREMSDRSYHSARDIAEHT------RL-PIIGHVPV---------------------
A0A255QXY0      LSILIEFWSMTFRSADEVQRAL------RA-PVLTHIPVD--------------------
A0A517SYI0      LAMTFEASAKMFRSAEEVHSDL------RL-PVLSHIPLD--------------------
A0A518HX54      LALLLEAGAKTFRSAEAIQHEL------QA-PVLTHIPFD--------------------
A0A5B9MF59      LAMVFESTAKMFRSAEEVQREL------RL-PVLTHIPLD--------------------
A0A2A2WC24      LAMIFESTAKMFRSAEEVQREL------RL-PVLTHIPLD--------------------
A0A518KYW8      LAMIFESTAKMFRSAEEIQREL------RL-PVLTHIPLD--------------------
A0A5C5YZZ0      LAFLWDWSERTFRSPDEISTSL------GL-PILAHLPVMLT------------------
A0A518JLD2      LAFLREISDRSYRSPQEVSEHT------GL-PVIGHIPVL--------------------
A0A5M6DJ15      GFIGLDVRSKLVNDSESVSREA------GL-PILGSVPRE--------------------
A0A3L7P7S7      LAWLMERADRTFRSPDDIRKRL------GI-PVLGHLPLF--------------------
A0A517N8M1      LALLLEKNANTFRDPDEIADIL------GV-PVLTHIPFF--------------------
A0A5C6CW01      LALLLEMNANTFRDPEEISALL------AV-PVLTHVPFF--------------------
A0A5C6BXS9      LALLLEKNANTFRDPDEVIAAV------GA-PVLTHVPFF--------------------
M5U569          LALLLEKNANTFRDPDEIAEAV------GA-PILTHVPFF--------------------
L7CND7          LALLLEKNANTFRDPEEIIAAV------GA-PILTHVPFF--------------------
A0A0J1B8S4      LALLLEKNANTFRDPEEIVAAV------GA-PILTHVPFF--------------------
F2ARR3          LALLLEKNANTFRDPEEIVTAV------GA-PILTHVPFF--------------------
K5D8H6          LALLLEKNANTFRDPEEIVTAV------GA-PILTHVPFF--------------------
M2AKU0          LALLLEKNANTFRDPEEIVTAV------GA-PILTHVPFF--------------------
A0A5B1CRW9      LVLAAETFDSTFSSVEELERAT------GA-AVIAHVPRM--------------------
A0A5C6EI46      LTLAAETFDSTFGSVTDLESTT------KA-AVIAHVPRL--------------------
A0A5B1CKI2      LALLLEKNANTFRDPDEISEEL------GV-PVLTHIPFF--------------------
A0A5C6EG84      LAILLEKNANTFRDPDEIADIL------GV-PVLTHIPFF--------------------
A0A5C6F2X4      LAILLEKNANTFRDPDEIADIL------GV-PVLTHIPFF--------------------
A0A7W5DXF4      LAFLLEKNANTFRTPDEIVAAI------GV-PILTHLPFF--------------------
A0A5C5XTV6      LALLLEKNANTFREPDEVVAAV------GA-PILTHVPFF--------------------
A0A5C6AAB1      LALLLEKNANTFRDPEEIATAV------GA-PILTHVPFF--------------------
M5T8W8          LALLLEKNANTFRDPDEIAEAI------GV-PILTHIPFF--------------------
M5SF00          LALLLEKNANTFRDPEEIIAAV------GA-PILTHVPFF--------------------
A0A2G1WDS1      LAVLLEKNANTFRDPEEIIAAV------GA-PILTHVPFF--------------------
Q7UVS9          LAVLLEKNANTFRDPEEIIAAV------GA-PILTHVPFF--------------------
A0A5C6B601      MAMLFEAGAKMFRSAEEIQKEL------RL-PVLSHIPLD--------------------
A0A517PFU1      LSYLLEQSDRRFTGPAELRAEF------GL-PLLGHVPEI--------------------
A0A5B9M8J9      LALLFETTAKTFRSADAIEREL------QS-PVLTHIPVD--------------------
A0A2A2WFP6      LALLFEAGAKTFRSAEAIQQEL------QA-PVLTHIPFD--------------------
A0A518L8N2      LALLFEAGAKTFRSAEAIQHEL------QA-PVLTHIPVD--------------------
A0A518HQN9      LAMIFESTAKMFRSAEEIQREL------RL-PVLTHIPLD--------------------
A0A5M6D8H8      LALLFEASAKMFRSAEEIQREL------RL-PVLTHIPLD--------------------
A0A1G2ZG92      LSLFVEYIDNTIKTPEDIKHIK------SL-NFLGIIPNTKL------------------
A0A2E7D3V4      VIYWREWRDTTLKTFDDVRQSM------QF-PVLGGVPEFAA------------------
A0A5B9PER9      LGCLVELADKTFHNPSEIIRQL------NV-PLIGHVPVIGQ------------------
A0A517QSM4      GIIFLDYRRRRVSTAEEITENL------RI-RILGVIPILPR------------------
A0A355GJI7      FSYFREMRDTTMKSVDEIRNQL------HL-PILGEVPCFAD------------------
A0A1Z8MCI4      LGLTVEVFSQRFXRARNVTEIT------QL-SLLGELAKFPR------------------
A0A517SYL7      LGLTVEVFSQRFSRARNVTEIT------QL-SLLGELAKFPR------------------
A0A3L7P0L2      LAYFREWYDTTLKTVEETRTVI------GA-AVMGAIPHFRG------------------
A0A6M5YVJ1      GVVLWEQRTARVTHPDDVTVAL------GV-RLIGAVPPAGP------------------
A0A832M9Q8      ALFLLATLNNRIATSEDLPEPM------QP-LVVGTVSHSGG------------------
A0A7W0MCI8      GFTALDMRGGRISTRQEISDTL------SL-PIIATIPALPN------------------
A0A517SCC8      LAYFREWYDTSLRSLDEVSETA------GT-QLLGAVPTFKT------------------
A0A358MY60      LGLLLELRAKRVSDAETLTAGN------LA-P-FGEVAKLPS------------------
A0A517MNB1      LGLLLEFRSQRICDASGFDGQS------LA-PVIGEVARLPS------------------
A0A3A0DR44      VVVGWEKLSRRIADADQLSSES------TL-SIIGEIAQLPT------------------
A0A142YJ13      CLSLLEFRSRKVDMPDEVSDRL------GL-RIIGDLPRLDH------------------
A0A517Z7D3      LLYYREWSDISIRTLADVRSLV------QS-PIFGAVPSFRP------------------
A0A7X7KCE7      LAVLWERLVGRVGDSAALESQS------RL-AVLGEIARLPM------------------
A0A1N6KY57      GISFWESSARRVDSASDVVQCL------GM-DLFGTLPILPR------------------
L0DK20          GVSFWEFQSRRIDSAADVIKSL------GM-NLFGTLPAIPK------------------
A0A517XRC2      LIALLEWRNRRVDGVDQVVTEL------GM-RVIGTVPAFPN------------------
A0A6M5YH47      LVSFLEWRTRRVDGVDQVVNEL------GM-RVIGTVPAFPN------------------
A0A660UUK3      LAFLLAKADKRLRGAQDVVKRV------GV-RIIGTTTSSRH------------------
A0A517ZHG5      AIVWFEFQAKRIDTLGDVTGGL------NL-RIMGALPQMPR------------------
A0A1Z8MPL5      APTLLDVIRRKVSSVNQMSEGL------GI-RVLGNLPLLDK------------------
A0A7C1EH96      LAFLLAKLDRRVHTPDDVARRV------GV-RIIGTTTGPEH------------------
A0A5C1AGE3      LVAFLEWRTRRVDGVDQVVNEI------GM-RVIGTIPAFPS------------------
A0A2Z3HEL7      LISFLEWRTRRVDGVDQVVTEL------GM-RVIGTVPVFPN------------------
A0A142XAP8      LVSFLEWRSRRVDGVDQVVNEL------GM-RVIGTVPAFPN------------------
A0A6P2DEK1      LVSFLEWRSRRVDGVDQVVNEL------GM-RVIGTVPAFPN------------------
A0A5C6C1R5      GFIGLDLTKKRVNSVSGVGREL------SV-PILGSVPRHR-------------------
A0A1G2YRE4      LAFLKDKTDQRLRTPDDITKRI------HI-PVIGTTTSLHN------------------
A6BZU4          FSYFREMRDTTMKSVDEIRNQL------HL-PILGEVPSFAE------------------
A0A2D5GZ77      FSYFREMRDTTMKSVDEIRNQL------HL-PILGEVPSFAE------------------
A0A3D3R1Z6      FSYFREMRDTTMKSVDEIRNQL------HL-PILGEVPSFAE------------------
A0A517XG00      FSYFREMRDTTMKSVDEIRNQL------HL-PILGEVPSFAE------------------
A0A353Z859      GILFLDLRTRRINSLDDIVTGL------RL-PVIGSVPLIP-------------------
A0A2D6ST10      AIVFLEYRSHRISRLEEVVDGL------GM-RIVGNIPTMPR------------------
A0A177QX42      IALLLETADKSFRNPDEISRQL------RL-PVIGHIPELA-------------------
A0A517SHR0      IALLLETADKSFRNPDEISRQL------RL-PVIGHIPELA-------------------
A0A2E0AW64      LAVLWELRVGRITDSKQIEKQS------QL-PVLAEIARFPS------------------
A0A351FZ59      LAVLWELRVGRITDSKQIEKQS------QL-PVLAEIARFPS------------------
A0A660V239      LALLLDKADKSLHDPKDVVRRV------GV-RIIGTTTSPK-------------------
A0A177Q3B7      LMTWREYSFRRVELAEEITQHL---------PVVACLPRLEA------------------
A0A2E0X6Y6      IIYVQDVLDDRFGSPEEMAAQL------GV-GVLTVVGNLK-------------------
A0A518GFD7      LLVGWDLTRRKVDNLEGVSHSL------SL-STFGTVPMVD-------------------
A0A518GE37      LALLLEFRMKRLTHVGGIEAQN------LA-PVLGEIARIP-------------------
A0A5C6F3H8      IGLIFEYRVQRVTDASSFTRSG------DMVPIMGEVARLP-------------------
A0A5C5X072      LGLLWEFKVQRLTDAESHDKTG------LLAPVVGEVSRLP-------------------
A0A5C5WUQ3      LGLLLELRIQRVTDGNAVQKHF------GMAPVVGEIARLP-------------------
A0A5C6E697      FGLLWEVRVHRVTHSTAVGH----------LDVMGEVAKLP-------------------
A0A5C5Z1A3      IGLLWELRVQRVTDSSMCDG----------LIVVGEVAKLP-------------------
A0A5C6D2P7      LGLLWELRVRRVTDSSMCTS----------LAVVGEVSRLP-------------------
A0A5B9ML17      LGLLWEFKTNRVTDTHVLDSSQ------AIAPVIGELARSP-------------------
A0A5C5VZJ8      AGFVRLRFSATVTSMRDVSRPL------QQ-TLIGSVPLRRG------------------
A0A517LX75      GALWADYSDQTFRDPGDLERSL------GA-SVLAHVPRFQI------------------
A0A7X7YXL7      LAFLRDKTDKTIQSPADVTRQI------DL-PILGTTTSSR-------------------
A0A7W1FH76      AAIAVHALARRVHGIAEAVAIT------GL-PVIGRIPYVK-------------------
A0A7C5W7B3      VMYFMENMDTTIHSVENAETIA------AA-RVLGEIPFFS-------------------
A0A7V2IPP1      LAFLRDRMDERLRTPRDVTRRV------GA-RIVGTTTSYH-------------------
A0A142XL75      GTIGLETRARRVTDTDDVTKAL------GV-RLLGTVPAAG-------------------
A0A6P2D5D5      GAIGWETRARRVIDTDDVTKAL------GV-RLLGTVPVAG-------------------
A0A7C7T8W8      LALVFELRARHLSFADQVATET------QL-PVLAEVSRVP-------------------
A0A5C6B3S0      GIIFWDTRKKCINSPEEISGQM------SL-EVIGSLPLIS-------------------
A0A354GX32      GVVATEFRTRRVYKSEDVSQGL------GL-PLMGTVPALS-------------------
A0A518GIZ9      LIVLKEFLSNQVRTVREVRQLL------PE-AYLGAVTSFD-------------------
A0A1C3EBY9      LIVLKEFLSNQVRTVREVRQLL------PE-AYLGAVTSFD-------------------
D5SX64          LIALKEFLSNQVRTVREVRQLL------PE-AYLGAVTSFD-------------------
A0A517Z0U7      AIVWLEMAAKRINSVDELEAAS------NL-QVMATIPLMP-------------------
A0A2S8FCC0      GFVFWDLRSQRINVPSDVSDNL------RM-NVLGAIPLVP-------------------
A0A1Z8MBT6      LGLLWELHTKRITDSHHIE-AL------AVPPVIGELARAP-------------------
A0A517SXN9      LGLLWELHTKRITDSHHIE-AL------AVAPVIGELARAP-------------------
A0A7X7F3C7      AVHVLDTLDDRFRGIDDLQNQL------RT-TVLAVLPKLR-------------------
A0A255QXF5      LGLLWEFRVKRITDSHELERSQ------MLAPVIGELARAP-------------------
A0A518KYQ0      IGLAWEFRTKRITDSLDLEKSH------LIAPVIGELARAP-------------------
A0A5B9QX47      LGLLWEFRVRRISDGSTLSKMT------GLAPVVGEVSRLP-------------------
M5T666          FGLLWELKVQRLTDAETHDKTG------QLAPVLGEVARLP-------------------
M5U6N6          LGLLWEYKIQRLTDAETHDKNH------DLAPVLGEIARLP-------------------
A0A517M0G2      LGLLWELRSQKICDSAKLE-SK------LMAPIMGEVAKLP-------------------
A0A5C6AST1      LGLLWEFRSQRICDAAALG-SK------DLAPVIGEVARIP-------------------
A0A5C6C951      LGLLWEFRTQRISDATTLE-SK------DVAPVIGEVARLP-------------------
A0A5C6C5T3      IGLLWEFKVQRLTDAETHDKTG------LLAPVLGEVSRLP-------------------
A0A2A2W6A9      IGLFWEFMTKRITDSKDLERSL------ALAPVIGELARAP-------------------
A0A518HQS9      IGLLWEFRTKRITDSLDLEKSH------TLAPVVGELARAP-------------------
A0A5M6DFE6      FGLLWEMRTNRVTDIQVLEKTG------GLAPIVGELARSP-------------------
A0A5C6F286      IGLAFEYRVQRVTDASSFSKAG------DMVPIMGEVARLP-------------------
A0A517NGN1      VGLLWEMRTQRITDANAVDRCA------VLAPVVGELTRAP-------------------
M5RUI3          LGLLWELRVQRVTDSAAVDRSQ------SLAPVVGEIAQLP-------------------
A0A5C1AAF0      VVSLFEFRNQRVDSIASVGLAT------GL-PTLGTIPWFP-------------------
A0A3B8ZJM2      VALLMDMADRSYRSPDEIVSDL------GK-PVLGHIPAMD-------------------
A0A1U7CLW1      CVSLWEFQSRKIDVPDEVAFRL------GL-RIIGDLPKLN-------------------
A0A5Q3LBQ3      ICVFWERTVRRVSEAKQLGQDL------KV-ESVWEIASLP-------------------
A0A142WPR7      LAYLLELNDRSFRDPEEVQTSL------GL-PVVGHIPVIE-------------------
A0A517T4K9      GVIWIESLTRRVCSLNTVVDEL------RM-RVIGGVPLVP-------------------
A0A7C6B2Q1      VLLWWDVRRKPVNTPQDVLRVA------GT-DVWGTIPLLP-------------------
A0A2Z3GZZ5      LMVLAETRDKSFRSPAEIRRRL------GL-AVVGHIPRIR-------------------
A0A4V0I6L6      LALRAELVDRGFRSPEDVRRRL------GL-PILAHVPVIR-------------------
A0A7C4QQT3      LCVVRELRDSRLKDVKALRLCL------RQ-PVLGTVVRFT-------------------
A0A7V9G5K3      VPLAFESLDTRVRGAIAAQVLT------RL-PLLGKTPRVA-------------------
A0A7W1JAD6      VPLVFEGLDSRVRGAVAAQVLT------RL-PLLGKTPRIA-------------------
A0A518KBI5      LAVLREASLRRVSDAEQLFEDT------RL-RILGEISTFP-------------------
A0A5C5V6Q5      LVLLREVTLRRVADAEQLYEDT------RL-RVLGEISVFP-------------------
A0A517P477      LAAGLGFLFTSVQRTQDLKGNL------AI-DLFGTLPHLP-------------------
A0A518HFS8      SLW--EFRAQRIDATAEVAGRL------GI-GVVGALPTSP-------------------
A0A7Y5LUV4      ATAAAEQLDNRILSVEEVKAFV------GL-DVLAAVPRLT-------------------
A0A3M1TFJ0      AALGLDRFSDRVRSLAE-AQRL------GP-PVLGAVPELS-------------------
A0A7Y5HGA4      LAYVLEYLDDTVKTREDFDRLV------RL-PFLGYVPHIR-------------------
A0A517MY49      VVYVQDVLDDRFSSPEELTAQL------GT-PVLAMVRKLD-------------------
A0A2E6AG00      LVYVIDALDDHVRSPDELKDQL------GL-PILAMIRXLP-------------------
A0A1G3A880      SVYVLDILDDRFRSADELRLRL------GV-PVLAMVRQLP-------------------
A0A2E8ATT1      LIYVLDLLDDRFRSPEELQEQL------EL-PVLAMIGNLE-------------------
A0A524HC32      CAFLAEYIADTITDPEEINDRY------RI-PILGMIPQIKT------------------
A0A660VT66      ASLLMEYFDDSIRSSDEALDCLREVTGDQA-CILGYVQRLPG------------------
A0A7C2ZTD2      SAFLRDKADLSLHTPDDVVKHI------GI-RILGTTTSPHA------------------
A0A0S8H0S8      LALLAARLDHRIHSAADVPAVL------GL-PLLGAVPTIRR------------------
A0A7C2VEF7      LALVRDWMDIRLRSADEVSAIL------GV-PVLGVIPTMTDVRTITAHGRQAWLNFKPV
A0A7V7D6N0      FAFLREWLDYRLRSADEISAIL------GV-PVLGTVPRMPK------------------
M5S2L2          ------------------------------------------------------------
A0A7V1EK28      ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A7C2VXA0      ------------------------------------------------------------
A0A7C3AA48      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A7C5PFV3      ------------------------------------------------------------
A0A7C3QGD2      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A7Z9UC46      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A1V6CUG1      APASQDAKAPALQAPPIIQSVG------AA-KVIGH------------------------
A0A3M1SE88      ----------RFRSIEEMQLQL------RT-PVMAVIRRMKPREFLG-------------
A0A7C2ZUK5      ----ADVTPRSRDAVVERKKVP------GG-TKTSPSPAPTVNT----------------
A0A660WB30      LTLLAEMTDHTVKRPTDLRRIV------DR-PVLAAIPSLDIGRFHT-------------
A0A660W9Z7      KEHRPSGSGAAAGTVVEPHSLP------ST-ETDMEEFRRTIRR----------------
A0A7X8YY48      ASPPRPEVAKPAERASTVAQAV------GK-SPAQPKQRPVVSR----------------
A0A3M1R9K7      LILWWDTRGKRINTPAEVVRTT------GL-DLLGTVPLVPAKA----------------
A0A3L7PH51      LIYVLDALDDRFRSPDELQWQL------GL-PMLAMIRKMEPME----------------
A0A3N5UQY5      IAAARDWIDQTIRSTEEISTIF------RL-PVLGGGPAMSRRK----------------
                                                                            

A0A523CME0      ------------------------------------------------------------
A0A7Y3UKB3      ------------------------------------------------------------
A0A7C2JY73      ------------------------------AAPRRPEFGRLHPALRYLHSPNSLEAECY-
A0A836W298      ------------------------------------IGGSGIDSVHTLAKPNAVETEAF-
A0A354PCV3      ---------------------------------------GTRGTKDRRIFQESVDTLRS-
A0A354PHB4      ---------------------------------------GTRSTKERRIFQESVDALRS-
A0A356ESF4      ----------------------------------RVANGAGIDSLQVHVAPDTRESEGF-
A0A538RV31      ------------------------------RQRRNLTLDGEANKHWNSLLTESVDAARA-
A0A1G2XSU7      -------------------RDKIKKA-----------------------MWPRQLADDY-
A0A350KD81      ------------------------------ESDAVVDDSEFAPALWYYYRPASREAESF-
A0A356AE44      -------------------NPAKNLQ--------AARETGLAPMLYYYHDPGSPEAEAC-
A0A7Z9UBD9      ------------------------------KDMEAL-QTGMSPHRFIKARPLSAYSEGF-
A0A257WQ92      ------------------------------VIDPHVIRGGMHSALRYLLAPRSMEAESY-
A0A2E3Z6T8      ------------------------------LNGENL------ETIHTHACPNAPETEAF-
A0A7Y2AF64      ------------------------------FEGDGL------DALQVHVSPNAVESEAF-
A0A7C1U6X6      ------------------------------KKSLGK-------PLHEEIRRIRDDKVESV
A0A7C7UXI5      ------------------------------LAERGI------GALHAHVRPDAVETEAF-
A0A7C3SFJ0      ------------------------------RHRRQL-------ALDGRGSPLYGLLADSI
A0A7X7YIF4      ------------------------------PKDVDR------KVLGQHLSDDYQNIRAN-
A0A7C7WWF7      ------------------------------MVDAGA------ESLHVHIAPQSVEAEAF-
A0A7V3JIB0      ------------------------------RSFRSL------VGASGRLQRARQELNESI
A0A356ETW1      ------------------------------PETSGL------EAIQLHVAPASTESEAF-
A0A3L7NJY1      ------------------------------LPGAGF------EAVLSHLKPHSKDVEAF-
A0A2D6SRY7      -------------------KPGSGPS----LAERGRRKRVRPDRLISSMELGSIAMEAY-
A0A1G3C300      ----------------------------------SKENKDANLELLTSEAPKSVFSETI-
A0A177PV03      -------------------VGHVPGT----------PATAMESILCTYYQPKSVQAEAF-
A0A1G2YIM0      -------------------IDKALLP--------------------------AKLADDY-
A0A1G3A0W0      -------------------RRFPQKP--------------FGKSLCEQKYAQDRMAESI-
A0A7V7D8F5      -------------------DTIKRAA---------LPR---------------QMAGDY-
A0A432MFP3      -------------------RDAERAR---------LEGPGYDPKFE-------QFVQQL-
A0A518HFL0      -------------------RSADRNR---------LEGPGHDPKFE-------QFVQQL-
A0A3L7UX05      -------------------NPRSA------------RKLMGGIDETRLRRQLVEYIQSI-
A0A2E0SHG0      -------------------RRITKLA---------DRGSRLSPVLVTHHIPQSPEAEIF-
A0A2S8F9B8      -------------------RGIVR------------KPKSLSVDLGSFED---QVRDSS-
A0A368KP63      -------------------RGITR------------KPKALAVNLGPFED---RVRDSS-
A0A518CQB8      -------------------RRLTKLA---------DKKSKLSPVLVTYHIPQSPEAEIF-
A0A7C4QPD3      -------------------YNVRGAT---------PRRQRMAAAY--WRS---VLSEAF-
A0A7C2JZW2      -------------------PGFRNPR---------TAKQRLTATY--WRD---VLQEAF-
A0A836RF42      -------------------KDLIAKK---------GSRVDVAVCV--HHKPSSSLAETF-
A0A7D8YCU5      -------------------AKAKRKKQKKVDAGGSEELGKISEKVSVVWNSSSPISEAF-
A0A353BE27      ------------------------------LSKVKKSVEAVDPAVCAIHHSKGRVAEAY-
A0A5C6BPW1      -------------------WASQKSS----KAKKTAKSAFWHSVL----------TESI-
A0A1I3GSP0      -------------------STDLDRI---------AQQRGLSPALCYYHRPGSREAEAY-
A0A517QJV1      -------------------TPDSERL---------AKETGLTSALVFLHRPGSREAEAF-
A0A3C1QS25      ------------------------PK----SKQKQTEGITFDGTAISVHQPKSKISEAY-
A0A5C6FX55      -------------------KKRVTKRGSGQNADKDSPYKELDPCLAVLHSPSSVAAESV-
A0A5C6DS51      ----------------------DLRK----MNIPSPSETSLAPSLITSHCPRSAEAEVY-
A0A5C6DSL6      ----------------------DFRK----LPMPAPGETPLAPSLVTEHCPRSAEAEVY-
A0A3M1VG27      -------------------------T----ATEHGPPTARKCAQWYRLY-PRSGEAEAF-
A0A518GC22      -------------------------N----ISKVKKSVEAVDPSICAIHHSKGRVAEAY-
A0A3L7Q373      -------------------SGALKRG----TTSNG-----LSPSLVYYHRPGSREAEAF-
A0A3E0PW54      ------------------------SP----SAAAARSASALDPRLCYYHRPGSREAEAY-
A0A7C3TAH2      -----------------------------------------DTTIPSPQQAAAHVAEDL-
A0A1Z8MHR4      -------------------DSMVQSA----K-VGDPHVDQLDPKLAVVHRPYSAAAEAV-
A0A5C6EHJ0      ----------------------LKPH----KFEKGEPGENLDSRLVTFFNGKGQKAEAF-
A0A5C6F1H9      ----------------------LKPH----KVEPGEVGEHLDSRLVTFFSGKGQKAEAF-
A0A255QXY0      -------------------SSRVKAH----DSMDGENGSSLCDKISVVHRPHSPAAEAV-
A0A517SYI0      -------------------DSMVQSA----K-VGDPHVDQLDPKLAVVHRPYSAAAEAV-
A0A518HX54      -------------------AGRSHKR----KQMPTDSIARLDPKLAVIHRPHSPAAEAV-
A0A5B9MF59      -------------------EGRIQQG----KGMVDSAISNLDPKLSVVHRPYSPAAEAV-
A0A2A2WC24      -------------------EGRIQQG----KGLVDSEIAKLDPKLSVVHRPYSPAAEAV-
A0A518KYW8      -------------------EGRIQQG----KGLVDSEIAKLDPKLSVVHRPYSPAAEAV-
A0A5C5YZZ0      -------------------PRKLRKK----TSQKASAFPKTASIVTVLHEPHAPCSEAF-
A0A518JLD2      -------------------K----RW----KVDADHVGAALDSRLCTFFQRKGMNSEAF-
A0A5M6DJ15      -------------------RQISAQF----NDDN------------FVHGAFGNSVNSI-
A0A3L7P7S7      -------------------P-----P----MDEEEKALCKVDPTLICFHNPKSQEAEFF-
A0A517N8M1      -------------------KGKLKKV----AKGETNPYEKFDPSLAVVHMPASIPAEAI-
A0A5C6CW01      -------------------KGRIRKP----TKDEINPYKDLDPGMAVLHQPASVAAEAI-
A0A5C6BXS9      -------------------KGKVRKG----KPDNPNPFEELDPHLAVVHTPSSVPAEAI-
M5U569          -------------------KGRVRKA----KPDNPNPFEKLDPYLAVVHQPASVPAESI-
L7CND7          -------------------KGRVKRK----KGEASNPFELLDPHLAVVHAPSSVASESI-
A0A0J1B8S4      -------------------KGRVRRA----KGETSNPFEQLDAHLAVVHAPSSVASEAI-
F2ARR3          -------------------KGRVRHK----KGDKSNPFEHLDPHLAVVHAPSSVASESI-
K5D8H6          -------------------KGRVRHK----KGDKSNPFEHLDPHLAVVHAPSSVASESI-
M2AKU0          -------------------KGRVRHK----KGDKSNPFEHLDPHLAVVHAPSSVASESI-
A0A5B1CRW9      -------------------PVRELRK----AAKAGS---ALDPSLMAYHSPRSQESEIF-
A0A5C6EI46      -------------------NLRTLRK----AAIAGS---QLDPSLLTYHTPRSAEAEIF-
A0A5B1CKI2      -------------------KGKLKKL----GKDEVNPYEKLDPALAVIHMPASVPAEAI-
A0A5C6EG84      -------------------KGKVKKS----IKGDMNPYEKFDGSLAVVHMPASIPAEAI-
A0A5C6F2X4      -------------------KGKVKKS----VKGDINPYEKFDQSLAVVHMPASIPAEAI-
A0A7W5DXF4      -------------------KGKIRKS----KKDALNPFEKLDPYLAVVHQPASVPAEAI-
A0A5C5XTV6      -------------------KGKVRKS----KIDNPNPFEELDPHLAVVHTPSSVPAEAI-
A0A5C6AAB1      -------------------KGKVRKG----KPESPNPFEQLDPHLAVVHAPSSVPAESV-
M5T8W8          -------------------KGRVRKS----KPDHPNPFEKLDPYLAVVHQPASVPAEAI-
M5SF00          -------------------KGRVKRK----KGEASNPFELLDPHLAVVHAPSSVASESI-
A0A2G1WDS1      -------------------KGRVKRK----KGEASNPFELLDPHLAVVHAPSSVASESI-
Q7UVS9          -------------------KGRVKRK----KGEASNPFELLDPHLAVVHAPSSVASESI-
A0A5C6B601      -------------------ESRVQQG----KTVMDKELSRLDPKLSVVHRPYSSSAEAI-
A0A517PFU1      -------------------PPRTLKE----GKRIREGVP--DAGLSTVLRPKSQLAESY-
A0A5B9M8J9      -------------------AARAPKR----GPGPTGSIEQLDSKLAVIHRPHSPAAEAV-
A0A2A2WFP6      -------------------GGRRQNR----KQMPTNSIARLDPKLAVIHRPHSPAAEAV-
A0A518L8N2      -------------------GGRSPKR----KQMPTNSIARLDPKLAVIHRPHSPAAEAV-
A0A518HQN9      -------------------EGRIQQG----KGLVDSEIAKLDPKLSVVHRPYSPAAEAV-
A0A5M6D8H8      -------------------EGPVRPA----AGTVAPEIAELDPQLSVVHRPYSPASEAV-
A0A1G2ZG92      -------------------LKDMSII--------S------------KLNPTLPVVEAY-
A0A2E7D3V4      -------------------ISLMDQM--------LYEQSPLQPSLCYFHRPGSSEAEAY-
A0A5B9PER9      -------------------SKRYLVE--------G---SAIEPIVCSYHRPKSQVSEAF-
A0A517QSM4      -------------------TIIKAVD--------D----GKRKLSSQQVALRSVLKEAI-
A0A355GJI7      -------------------SDAAVDE--------S----EFAPALWYYYRPASREAEAF-
A0A1Z8MCI4      -------------------WGSKSGR--------Q------------------FYERSV-
A0A517SYL7      -------------------WGSRSGR--------Q------------------FYERSV-
A0A3L7P0L2      -------------------GAVSDRL--------A-VQNGLSPALVYFHRPGSREAEAY-
A0A6M5YVJ1      -------------------AQDGTHA--------V-------------------LVEAI-
A0A832M9Q8      -------------------TSASSTH--------N--------------IRRKILGEEM-
A0A7W0MCI8      -------------------SAMSPAS--------G-----SRRSRQKTIFWTSALKESI-
A0A517SCC8      -------------------TPEAERA--------A-RNSRLHPRLCYSHHPGSREAESF-
A0A358MY60      -------------------KVGQGKR--------Q-----------------RVFEESI-
A0A517MNB1      -------------------RAGSSKR--------Q-----------------RVFEESI-
A0A3A0DR44      -------------------RPVLSGG--------A-------ASRRKIRRDLGLFQESV-
A0A142YJ13      -------------------ARLDDPS--------G--------------RDRDRLVQSI-
A0A517Z7D3      -------------------QLFRVPD--------T---SRLGAELFYYHHPGSREAEAF-
A0A7X7KCE7      -------------------RSPIGHR--------S--------SSERVKHDLRLFEESI-
A0A1N6KY57      -------------------RRLMLGS--------G---------AAQHRRWGSMLIESV-
L0DK20          -------------------RSRGMKL--------R---------EAESVRWRSMLVESV-
A0A517XRC2      -------------------RASLKAA--------E---------AAGNANWRFILNESI-
A0A6M5YH47      -------------------RANLKAA--------V---------EAGGANWRFVLNESI-
A0A660UUK3      -------------------IDRSMIT--------Q------------------QLSDDY-
A0A517ZHG5      -------------------WASQKSS--------K------AKKTAKSAFWHSVLTESI-
A0A1Z8MPL5      -------------------PKRRLGF--------R------APTPEAIEDLQVTMEESI-
A0A7C1EH96      -------------------VSRKLLG--------R------------------QLVDDY-
A0A5C1AGE3      -------------------RQSIKTG--------E---------ADANQNWRFILNESV-
A0A2Z3HEL7      -------------------RASLQAA--------V---------EAGGANWRFVLNESI-
A0A142XAP8      -------------------RASLQAA--------T---------EAGGANWRFVLNESI-
A0A6P2DEK1      -------------------RASLQAA--------T---------EAGGANWRFVLNESI-
A0A5C6C1R5      ---------------------------------------KIHEVLTNENFSDCEFGNSV-
A0A1G2YRE4      -------------------IKPALIP--------D------------------QIAGEY-
A6BZU4          -------------------SDAVVDD--------S----EFAPALWYYYRPASREAESF-
A0A2D5GZ77      -------------------SDAVVDD--------S----EFAPALWYYYRPASREAESF-
A0A3D3R1Z6      -------------------SDAVVDD--------S----EFAPALWYYYRPASREAESF-
A0A517XG00      -------------------SDAVVDD--------S----EFAPALWYYYRPASREAESF-
A0A353Z859      -------------------SSRGGKN--------S--------EGGGGQRWQGALIESI-
A0A2D6ST10      -------------------ASSRRPT--------G-------DNRGKTAFWNSVLSESI-
A0A177QX42      -------------------ADRDWKM--------V-KDAQVDSSISVHHRPKSRLAESY-
A0A517SHR0      -------------------ADRDWKI--------V-KDAKVDSSISVHHRPKSRLAESY-
A0A2E0AW64      -------------------HADGQRH--------S----------RRVTRQLRLFEESV-
A0A351FZ59      -------------------HADGQRH--------S----------RRVTRQLRLFEESV-
A0A660V239      --------------------------------------------NVDKLLLGRQLADDY-
A0A177Q3B7      -------------------SATLAAG--------A----------NGTHARDLVFVEHV-
A0A2E0X6Y6      ----------------------------------T-LVGEGFDLVHAYVSPNKPETEAF-
A0A518GFD7      ------------------------RD--------P-LVSPGQAKKGRDYQRAVELAEAI-
A0A518GE37      -------------------GGARSTQ--------G----------------HRLFEESI-
A0A5C6F3H8      -------------------SGSRSQK--------G----------------RRVFEESI-
A0A5C5X072      -------------------AGSGSRK--------A----------------RRVFEESI-
A0A5C5WUQ3      -------------------AGTHGGR--------A----------------RRVFEESV-
A0A5C6E697      -------------------TGNKNSK--------A----------------RRVFEESV-
A0A5C5Z1A3      -------------------AGPRSSR--------G----------------RRVFEESI-
A0A5C6D2P7      -------------------SGPQSSR--------S----------------RRVFEESI-
A0A5B9ML17      -------------------STTASRG--------S--------------KGRRIFQESV-
A0A5C5VZJ8      -------------------VSAEVLT--------N----------------CPIQTESV-
A0A517LX75      -------------------TRKEKKA--------A-KQSKLSPLCRTVFAPHSTEAEVL-
A0A7X7YXL7      -------------------TVKPALF--------A-----------------EQIAGDY-
A0A7W1FH76      -------------------GLNPVTR--------A-----------GHHEQHPALAEGF-
A0A7C5W7B3      -------------------ADPFIFP--------E--------------NPTTRTANVF-
A0A7V2IPP1      -------------------GTRPTQF--------R-----------------EQIWEDY-
A0A142XL75      -------------------QESGKPG--------A---------------PPPSLVEAI-
A0A6P2D5D5      -------------------QESSKSG--------R---------------PAPSLVEAI-
A0A7C7T8W8      -------------------TRLVSGR--------E----------RKLGLRRAMFEESI-
A0A5C6B3S0      -------------------QRKMRRV--------N--------HQNQRTHWMGRLTEAV-
A0A354GX32      -------------------AKVRATA--------P----------VAGDQSMGPMIESM-
A0A518GIZ9      -------------------PEQSRLD--------P--VQNVHPSLRYLRSPASIEAENY-
A0A1C3EBY9      -------------------PEQSRLD--------P--VQNVHPSLRYLRSPASIEAENY-
D5SX64          -------------------PEQSRLD--------P--VQNVHPSLRYLRSPASIEAENY-
A0A517Z0U7      -------------------RWVSRGD--------D-------RTHHKAAYWHSVLTESI-
A0A2S8FCC0      -------------------QRVLAQS--------R-------KNSKKQQYWKSLIAESI-
A0A1Z8MBT6      -------------------RASGARQ--------S--------------RGRRVFXESV-
A0A517SXN9      -------------------RASGARQ--------S--------------RGRRVFEESV-
A0A7X7F3C7      -------------------VADGAGI--------D--------SLQVHVAPDTRESEGF-
A0A255QXF5      -------------------SATGSRN--------S--------------KGRRVFEESV-
A0A518KYQ0      -------------------RAAVGRN--------S--------------KSRRVFEESV-
A0A5B9QX47      -------------------AGS--GS--------R--------------RSRRLFEESI-
M5T666          -------------------AGA--GA--------V--------------KGRRVFEESI-
M5U6N6          -------------------AGH--GA--------A--------------KGRRVFEESI-
A0A517M0G2      -------------------PKF--GS--------R--------------KGRRVFEESI-
A0A5C6AST1      -------------------TKV--GV--------G--------------KRQRVFEESI-
A0A5C6C951      -------------------SKI--GV--------G--------------KRQRVFEESI-
A0A5C6C5T3      -------------------AGS--GS--------Q--------------KARRVFEESI-
A0A2A2W6A9      -------------------RGSTGRN--------S--------------KSRRIFEESV-
A0A518HQS9      -------------------RAASGRN--------S--------------KSRRVFEESV-
A0A5M6DFE6      -------------------AGQNGRG--------S--------------RGRRVFQESV-
A0A5C6F286      -------------------TGS--RS--------Q--------------KRRRVFEESI-
A0A517NGN1      -------------------IDP--RN--------S--------------KGRRIFEESV-
M5RUI3          -------------------SGA--RN--------G--------------RGRRIFEESV-
A0A5C1AAF0      -------------------SNVHRQS--------G----------VKKEYWHSVLTESM-
A0A3B8ZJM2      -------------------LPNIKKV--------V---DTVDPSLITIHHSRGRIAEAF-
A0A1U7CLW1      -------------------GPRRGDQ--------K-------------QIERDRLVQSI-
A0A5Q3LBQ3      -------------------VRSRNAR--------R------------AGRARGLFEESV-
A0A142WPR7      -------------------LARADRR--------S--NDAVHPSLVTFHRPKSRLAEAY-
A0A517T4K9      -------------------RNVTGSP--------K-PDDDARRVFWKSRLTESIDAART-
A0A7C6B2Q1      -------------------PRAMRAI--------V----DERVRSKKHRRWRQMFVESV-
A0A2Z3GZZ5      -------------------TV-PALS--------L-EPATYDPLLVAALRPKSSEAEAY-
A0A4V0I6L6      -------------------ANQPNEV--------T-PAAAVDPTLVVWLRPKTAEAEAV-
A0A7C4QQT3      -------------------QGVEPGA--------P-LAARAHPMLRYLRAPHSLEAENF-
A0A7V9G5K3      -------------------HLAPLGR--------E----GN-------PERPHSMAEAY-
A0A7W1JAD6      -------------------HLAPLGR--------E----GD-------PERPHALAEAF-
A0A518KBI5      -------------------TRRVAAN--------P----RQ--------IPRKLRKEMF-
A0A5C5V6Q5      -------------------SRRVAAN--------P----RR--------LPRRIQKEMY-
A0A517P477      -------------------RGGAGAG--------A----GQRGSDWNEALKESVDAARV-
A0A518HFS8      -------------------RG-DRGG--------A----TA---VRRRALIESVDAVRT-
A0A7Y5LUV4      -------------------GLDPANG------------------ILLGEGATIPELEAF-
A0A3M1TFJ0      -------------------DV-SGRE--------L----DR----YALSNPSSAYAEAF-
A0A7Y5HGA4      -------------------DAGKEGG--------P----PSRDLVVALGRTGSPEVEAF-
A0A517MY49      -------------------PL-PGEG--------V----AT---IHTATMPNAVETESF-
A0A2E6AG00      -------------------STLATTG--------V----NA---LHVATTPDSVESEAF-
A0A1G3A880      -------------------NA-GVPG--------W----AG---VQANAAPDAVESEAF-
A0A2E8ATT1      -------------------VG-NELG--------L----GA---LQVHASPDAVESEAF-
A0A524HC32      --------------------------------------DNSGIESTFVRHPRTMFSEAI-
A0A660VT66      -----------------------------------RSEDPRENDRICERMPRSVFAEVY-
A0A7C2ZTD2      ------------------------------------IKEAYLQDQVV---------GDY-
A0A0S8H0S8      ------------------------------------RRSLQSGAQTVLMDPASPAAEAY-
A0A7C2VEF7      AFGLCQRIHTIISTGIAGSRAKTTGVISPTSDGDIGKQDIAVRGQKVHIKPKSVIAEAY-
A0A7V7D6N0      ------------------------------------RQSVVERGQKVRIESKSIAAEAY-
M5S2L2          ------------------------------------------------------------
A0A7V1EK28      -------------------------------------------------------MADL-
A0A2Z3GYP4      -------------------------------------AVELDSGLATVHSAMSPEAEAY-
A0A7C2VXA0      -------------------------------------KDVVNRGQKAHLKPKSVVAEAY-
A0A7C3AA48      --------------------------------------TVATRGRTVHMDSTSPVAEAY-
A0A3L7SU85      ------------------------------------------------------------
A0A2D6A9B6      -------------------------------------ERTVNPYLVCFHEPNGFRSEQI-
A0A2G6JGH3      -------------------------------------DRVVDPYLVCFHEPRGFRAEQF-
A0A7C5PFV3      -------------------------------------DRVVDPYLVLFHNPSGFRAEQY-
A0A7C3QGD2      -----------------------------------------ERSLVRAAARSPIVEVFN-
A0A3M1RAJ8      -------------------------------------PNPVYNGSVPDDIRAVLHESVD-
A0A7Z9UC46      --------------------------------------MSIVDRLILLTEPNSNVAESY-
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A1V6CUG1      -------------------------------------NGSFSEVLVTHHDRGGRITEEY-
A0A3M1SE88      -------------------PKSL----------------------QVVAEPDSPESEGF-
A0A7C2ZUK5      -------------------------------------FEGWDERLVAASRNFSGVVESF-
A0A660WB30      -------------------PENLFFRTKRVVEADLESGMLYDRNYVREIRHRSIATEQI-
A0A660W9Z7      -------------------------------------VERFQFSPECSFSHSSEIGEKF-
A0A7X8YY48      -------------------------------------NAKYAEVIIAHHSQNHEITEQY-
A0A3M1R9K7      -------------------------------------AKQLHSEGKRYHHWRAIFTESV-
A0A3L7PH51      -------------------------------------GTGMELI-VTHMQPNSVESESF-
A0A3N5UQY5      -------------------------------------SVPVRGR-KVLLEPSSREAEAF-
                                                                            

A0A523CME0      -KMLRNVG-----------------------RSKVLIVASATQKEGKSTIALNTAITLCN
A0A7Y3UKB3      -KMLRNVG-----------------------RSKVLIVASATQKEGKSTIALNTAITLCN
A0A7C2JY73      -RTLRSAL------NVVCEAS----------DLKVVQISSPEPGDGKTTTVANLALAAAQ
A0A836W298      -RTLRTAL------SF--SEA----------QAHRIVVTSTEPSDGKTTILVNLAVAFAQ
A0A354PCV3      -NLFLST-----------RWK----------GTRSIAVVSSISSEGKSSIASQLSVSIAK
A0A354PHB4      -NLFLSS-----------SWK----------DTRSIAVVSSISSEGKSSVASQLALSIAK
A0A356ESF4      -RTLRTAL------AL--RDR----------EARRLVVCSAEPGDGKTTVLANLGVSFAQ
A0A538RV31      -LLLRTA-----------RTE----------AVRTVMVTSAVAGEGKTSLSCHLASSLAR
A0A1G2XSU7      -HSICINL------GLMNNCT----------IPNKLVISSASPREGKSTLAVNLATNLAK
A0A350KD81      -RSLRTSL------LLKTDRS----------GAKVLQMTSAEPGDGKTTSISNLALAIAQ
A0A356AE44      -RSVRATF------FVRAADV----------DAHIIQFTSSEPGDGKTTTISNLGISIAQ
A0A7Z9UBD9      -RELQAAL------ALSDVDN----------PPKSILITSSLPNEGKTTTAMSFATSLAR
A0A257WQ92      -RSLRTAL------NVTSDNA----------HANVILVTSPETGDGKTTTISNLAIAMAQ
A0A2E3Z6T8      -RTLRTVL------SLSEQNC----------E-RIL-ISSSEPGDGKTTISANLSVALAQ
A0A7Y2AF64      -RTLRTSL------TFSHKDR----------K-ILS-VTSPEPSDGKTTVIANLAASFAQ
A0A7C1U6X6      RLVRTALL------SRLNGQG----------R-TTVLIASAAEGTGKSTFTMMLGKSLAQ
A0A7C7UXI5      -RTLRTAL------SLARGQV----------R-SLV-ISSSEPGDGKTTVSANLAAVYAQ
A0A7C3SFJ0      DNIRTALL------YQASREG----------I-KVTLITSALAREGKTTVATQLAASLGR
A0A7X7YIF4      ------LG------LLNGDGK----------S-RILVITSPGTGDGKTTFSVNLAVSFAQ
A0A7C7WWF7      -RTLRTTL------SFSGPEM----------Q-RVT-ISSAEPGDGKTTVLANLGASFGQ
A0A7V3JIB0      DGIAARLL------HLAQRDQ----------T-RVVLVSSAVAGEGKTTLATQLALSLAR
A0A356ETW1      -RTLRTAL------ALADREL----------N-RIV-VTSAEPGDGKTTIIANLATCYAQ
A0A3L7NJY1      -RALRTSI------EFSPEET----------R-RLV-CTSTEPGDGKTTVSSNLAVAFAQ
A0A2D6SRY7      -RCLRTNI------QFAAPDT----------KTPCYLVTSAGPGEGKSLTTSNLAIAIAQ
A0A1G3C300      -RNIRTGI------MLSTTDT----------PHKSLLITSTKQGEGKSFIAANLAIAFAQ
A0A177PV03      -RGIRTAL------YFSLRSG----------DYKVIQITSPEARDGKTTLSANLAVSIAQ
A0A1G2YIM0      -QAIRANL------GLFNEEK----------IPHILAITSARPQEGKTTFAINLASSMAK
A0A1G3A0W0      -RLVRTAL------LSRLGGP----------RNTALLITSAVAGTGKSYFTMTLGESLAR
A0A7V7D8F5      -QTIRANL------RLL-NGD---------RMPKKLVITSPALREGKTTFAINLAISMSR
A0A432MFP3      -DHLRVAL------CGEGGQD---------GRGRCVLITSAVGGEGKTTLAAQLAVRCAE
A0A518HFL0      -DHLRVAL------CGEGGHD---------GRGRCVLITSAVGGEGKTTLAAQLAVRCAE
A0A3L7UX05      -DHLRVAI------SASLGST---------HEHQSILITSAFGGEGKTTLSAQLAGRCAN
A0A2E0SHG0      -RALRTNL------YYG-THG---------STPKVVQFTSPNPKDGKSVTTANLAISLAQ
A0A2S8F9B8      -DSVAATI------LRR-AAD---------QQCQVLLISSAMPREGKSSLACHLAISLAH
A0A368KP63      -DSVAATI------LRR-AAT---------QKCQVLLISSAMPQEGKSSLTCHLAISLAN
A0A518CQB8      -RSLRTNL------YFG-THG---------QSPKVVQITSPNPKDGKSVTTANLAISLAQ
A0A7C4QPD3      -DQIRTVL------LHS-PRL---------NGVKTIMVAGSGIAEGKTSTTTQLALSLAR
A0A7C2JZW2      -DGVQSIV------RHN-ERC---------AAARTIMVASSCEGEGKSTSAAQLALSFAR
A0A836RF42      -RTVRTGL------FFS-AAG---------KNAKIIQITSPAPRDGKTTVASNLAVAIAQ
A0A7D8YCU5      -RGIRTTL------LCTRTER---------PDFQVIQITSSVPGEGKSTVAANLAASIAK
A0A353BE27      -RSVRTGL------YFSNKGK----------ALKVIQVTSPVPGDGKSTLSSNISVTMAQ
A0A5C6BPW1      -DAARTVL------IRDANVE----------STRLVMVGSAISGEGKTTLSCHLAASLAR
A0A1I3GSP0      -RSVRTTL------FVSMRE-----------DHKVVQVSSAAPGEGKSTTAANLAIAIAQ
A0A517QJV1      -RTIRTTL------FHGLRN-----------NEKVLQITSAEPGDGKSTIAVNTALAMAQ
A0A3C1QS25      -RAVRTAL------FFSNRQR----------DIKVIQVTSPSPGDGKSTLALNLAVSIAQ
A0A5C6FX55      -RSLRTAT------YFELAGV---------QGGKILQVTSPLPGDGKSTIAGNLACAIAQ
A0A5C6DS51      -RVARTSL------MIKASGQ----------EAQVLMMSSPHPGDGKSTTIANLAISFAQ
A0A5C6DSL6      -RVARTSL------MIKSRGQ----------GTQVLMMSSPHPGDGKSTTIANLAISFAQ
A0A3M1VG27      -RVVRTRL------LVSLHDE----------HHRVLQITSPEPNDGKTTVACNLALAVAQ
A0A518GC22      -RSVRTGL------FFSNNGK----------ALKVLQVTSPVPGDGKSTLACNIAVTMAQ
A0A3L7Q373      -RSIRTTL------FHSTKES----------QDKLIQITSAEPGDGKSTTAANLAIAIAQ
A0A3E0PW54      -RSVRMAV------LRNQPES----------GGQAVQMTSAEPGDGKSVSAANLSLAIAK
A0A7C3TAH2      -QTIRTNI------GLQVDGV----------VPRRLVVTSPGVQEGKTSLAINLATSLAR
A0A1Z8MHR4      -RGVRTAM------LFEQRQF----------NSKVFQVTSPLPGDGKSTLVGNIGCLVAQ
A0A5C6EHJ0      -RAIRTAI------YFSNQSG----------NNQVLQMTSSTPSDGKSTIAANVAVAIAQ
A0A5C6F1H9      -RAIRTAI------YFSNQSG----------NNQVLQMTSSTPSDGKSTIAANVAVAIAQ
A0A255QXY0      -RAVRTAI------MLERKKN----------GSQVFQITSPLPGDGKSTLAANVGCSIAQ
A0A517SYI0      -RGVRTAM------LFEQRQF----------NSKVFQVTSPLPGDGKSTLVGNIGCLVAQ
A0A518HX54      -RAVRTAM------LLDRRQT----------DSKVFQITSPLPGDGKSTLAANVGCSIAQ
A0A5B9MF59      -RGVRTAM------LFDRRQF----------DSKVFQITSPLPGDGKSTLAANVGCSVAQ
A0A2A2WC24      -RGVRTAM------LFDRRQY----------NSKVFQITSPLPGDGKSTLAANVGCSVAQ
A0A518KYW8      -RGVRTAM------LFDRRQY----------NSKVFQITSPLPGDGKSTLAANVGCSVAQ
A0A5C5YZZ0      -RSIRTNL------FSTAGGA---------PEYQVIQVTSALPGDGKSTIVANLAASVAR
A0A518JLD2      -RALRTAV------FFSNQSG----------DNQILQITSATPSDGKTTTAGNLAITMAQ
A0A5M6DJ15      -----VAM------LVNKAKF---------EDANIIMVSSAVSGEGKSTLARSLWRGLAE
A0A3L7P7S7      -RGLRTAL------YFSTQGH----------GHQVLQATSPVAGDGKSTTAANLAISIAQ
A0A517N8M1      -RSCRTSV------FFELTG----------QRGKVIQVTSPLPGDGKSTIAGNLACSIAQ
A0A5C6CW01      -RSCRTAI------FFELAGI---------DGGKVVQVTSPLPGDGKTTVAGNLACSIAQ
A0A5C6BXS9      -RSCRTSI------FFELAGV---------PTGKILQVSSPLPGDGKSTISGNLACSIAQ
M5U569          -RSCRTSI------FFELSGI---------PGGKILQVTSPLPGDGKSTIAGNLACSIAQ
L7CND7          -RSCRTSV------LFEMAGI---------PGGKIIQVTSPLPGDGKSTIAGNLACSIAQ
A0A0J1B8S4      -RSCRTSV------LFEMAGI---------HGGKIIQVTSPLPGDGKSTIAGNLACSIAQ
F2ARR3          -RSCRTSV------LFEMAGI---------SGGKIIQVTSPLPGDGKSTIAGNLACSIAQ
K5D8H6          -RSCRTSV------LFEMAGI---------PGGKIIQVTSPLPGDGKSTIAGNLACSIAQ
M2AKU0          -RSCRTSV------LFEMAGI---------PGGKIIQVTSPLPGDGKSTIAGNLACSIAQ
A0A5B1CRW9      -RVGRTSM------MIANRKD----------SVQTMMVTSPQPGDGKSTTIANMAISFAQ
A0A5C6EI46      -RVGRTSL------MIANRKD----------SVQTIMVTSPQPGDGKSTTISNLAISFAQ
A0A5B1CKI2      -RSFRTSV------FFETSGP----------GCKVIQVTSPLPGDGKSTIAGNLACSMAQ
A0A5C6EG84      -RSCRTSV------FFELAGS----------GGKVIQVTSPLPGDGKSTIAGNLACSIAQ
A0A5C6F2X4      -RSCRTSV------FFELTGSGSWGSAEKSPGGRVIQVTSPLPGDGKSTIAGNLACSIAQ
A0A7W5DXF4      -RSCRTSI------FFDLSNI---------NGGKIIQVTSPLPGDGKSTVAGNLACSIAQ
A0A5C5XTV6      -RSCRTSI------FFELAGI---------QGGKILQVSSPLPGDGKSTISGNLACSIAQ
A0A5C6AAB1      -RSCRTSL------FFELARV---------PGGKIIQVTSPLPGDGKSTIAGNLACSIAQ
M5T8W8          -RSCRTSI------FFDLSNV---------PGGKIIQVTSPLPGDGKSTIAGNLACSIAQ
M5SF00          -RSCRTSV------LFELAGV---------EGGKVLQVTSPLPGDGKSTIAGNLACSIAQ
A0A2G1WDS1      -RSCRTSV------LFELAGV---------EGGKVLQVTSPLPGDGKSTIAGNLACSIAQ
Q7UVS9          -RSCRTSV------LFELAGV---------EGGKVLQVTSPLPGDGKSTIAGNLACSIAQ
A0A5C6B601      -RGIRTAL------FFDRRAY----------DSKVFQITSPLPGDGKSTIAANIGCSIAQ
A0A517PFU1      -RAVRTGL------LSAARN-----------GVKVVQVTSPDRGDGKSTLTANVAVTLGR
A0A5B9M8J9      -RAVRTAM------LLDRRQN----------DSKVFQITSPLPGDGKSTLAANVGCSIAQ
A0A2A2WFP6      -RAVRTAM------LLDRRQT----------DSKVFQITSPLPGDGKSTLAANVGCSIAQ
A0A518L8N2      -RAVRTAM------LLDRRQT----------DSKVFQITSPLPGDGKSTLAANVGCSIAQ
A0A518HQN9      -RGVRTAM------LFDRRQY----------NSKVFQITSPLPGDGKSTLAANVGCSVAQ
A0A5M6D8H8      -RAVRTAM------LFDHRQY----------DSRVFQVTSPLPGDGKSTLAANVGCSIAQ
A0A1G2ZG92      -RTIRNSI------QYASLDK----------PMKTIVVTSSMESEGKSSMSSNISITYSM
A0A2E7D3V4      -RSVRTAL-------FVSGSG----------RSQAIQVSSPEPGDGKTTFISNLAIAIAQ
A0A5B9PER9      -RAVRTSL------FFNTQNH----------QHSVIQITSPTPGDGKSTLASNLAVSIAQ
A0A517QSM4      -DSTRAVL------LRDPRMK----------VMNTILITSASDGEGKTSNACHLAASLAR
A0A355GJI7      -RSLRTSL------LLKTDRS----------GAKVLQMTSAEPGDGKTTSISNLALAIAQ
A0A1Z8MCI4      -MALALRL------GCLKVLS----------AGKVVGVVSGVSGEGKSTVTFGLACMLGH
A0A517SYL7      -MALAVRL------GCLKVLS----------AGKVVGVVSGVSGEGKSTVTFGLACMLGH
A0A3L7P0L2      -RSSRTTL------YHSTKDS----------QDKIIQITSAEPGDGKSTTAANLAIAIAQ
A0A6M5YVJ1      -DATRTML------LSGGPDS----------DLRVVVVASAIAGEGKTSLSGHLAISLAR
A0A832M9Q8      -RLVHANL-------LPPGSH----------VRRIMMVTSPTPGNGKTSIADQLATSLAK
A0A7W0MCI8      -DAARTML------LSLAERD----------GMKTIMISSAMPSEGKTTLSLHLATSLAR
A0A517SCC8      -RTIRTAL------LFACQEH----------NVRLLQFSSAEPGDGKTTTISNLAIAIAQ
A0A358MY60      -DTLRANL------MLSKQTK----------DARTVTVASSMSGEGKSSVSSQLAISLAK
A0A517MNB1      -DTLRANL------MLSKDTR----------DVRTISVASSLSGEGKSSVSSQLAISLAK
A0A3A0DR44      -DGLRTCL------LLSEATS----------SHRVFAVTSAVSGEGKTSLVSQLAISLAR
A0A142YJ13      -DAVRTML------LSVERQH----------SFQVVMVTSATKGEGKTSLSCHLATSLAR
A0A517Z7D3      -RSIRTTL------YASLDGT----------DDRLLQISSPEPGDGKSTTAANLAIAMAQ
A0A7X7KCE7      -DSLRTSL------SLSESLG----------GMRVLAVTSAANREGKTSVASQLAVSFAR
A0A1N6KY57      -DAARTAL------LHVSRTE----------SVRVVMIASALGGEGKTSLASHLATSLAR
L0DK20          -DAARTTL------LHFSRTE----------SVRVVMVASALSGEGKTSLSSHLATSLAR
A0A517XRC2      -NSTRTML------LHTARSQ----------SMQVVMVTSATQGEGKTSLSSQLASSMAT
A0A6M5YH47      -NSTRTML------LHTARTQ----------SMQVVMVTSATQGEGKTSLTSQLATSMAT
A0A660UUK3      -QTIRANL------GLFNGHE----------STKVLVVTSPGVGDGKTTFAINIALSFAQ
A0A517ZHG5      -DAARTVL------IRDANVE----------STRLVMVGSAISGEGKTTLSCHLAASLAR
A0A1Z8MPL5      -DGLRAML------LHLPAAK----------DVRTLMVTSALANEGKTTVASALATSMGR
A0A7C1EH96      -QTIRANL------GLLDGDG----------ETKMLVITSPGMGDGKSTLAVNLATSFAR
A0A5C1AGE3      -NSTRTML------LHTAKTQ----------SMQVIMVTSAMQGEGKTSLSSQLATSMAT
A0A2Z3HEL7      -NSTRTML------LHTAKSQ----------SMQVVMVTSATQGEGKTSISSQLATSMAT
A0A142XAP8      -NSTRTML------LHTAKAQ----------AMQVVMVTSATQGEGKTSLASQLATSMAT
A0A6P2DEK1      -NSTRTML------LHTAKAQ----------AMQVVMVTSATQGEGKTSLASQLATSMAT
A0A5C6C1R5      -SSIVAML------VNMSRFD----------RASVLMVTSGVSGEGKTTLATSLWRGLTQ
A0A1G2YRE4      -QTIRANM------GLLSKNE----------MPKILVITSPWMREGKTTLSINLATSLAK
A6BZU4          -RSLRTSL------LLKTDRS----------GAKVLQMTSAEPGDGKTTSISNLALAIAQ
A0A2D5GZ77      -RSLRTSL------LLKTDRS----------GAKVLQMTSAEPGDGKTTSISNLALAIAQ
A0A3D3R1Z6      -RSLRTSL------LLKTDRS----------GAKVLQMTSAEPGDGKTTSISNLALAIAQ
A0A517XG00      -RSLRTSL------LLKTDRS----------GAKVLQMTSAEPGDGKTTSISNLALAIAQ
A0A353Z859      -DSARVML------LRRASLE----------NAKVVMVSSAVTSEGKTTMACHMGTSLAR
A0A2D6ST10      -DSARTVL------LRDAKVD----------SLKAVMICSAVGGEGKSTLSCHLATSLAR
A0A177QX42      -RAVRAAI------FFGTRGQ----------THRVLQITSANSGDGKTTLCSNLASAIAM
A0A517SHR0      -RAVRAAI------FFGMRGQ----------SHRVLQVTSANSGDGKTTLCCNLASAIAM
A0A2E0AW64      -HHLRTSL------VLSRPLE----------DIQVLAVTSSVSGEGKTTLAAQLAMSIAR
A0A351FZ59      -HHLRTSL------VLSRPLE----------DIQVLAVTSSVSGEGKTTLAAQLAMSIAR
A0A660V239      -QAIRANL------GLLDGGG----------ASKIIVVTSPGIGDGKTTFAVNLATSFAQ
A0A177Q3B7      -DAARTSL------LHLAKHG----------EVQAILVTSAVGGEGKTSLACQLAASLAR
A0A2E0X6Y6      -RTLRTAL--------TLSPQ----------AHSRLLVSSSEPSDGKTTVALNLAVTFAQ
A0A518GFD7      -DSVAAMV------LHRAAVE----------KRQVFMVSSALAGEGKSTISCQLSRSLAK
A0A518GE37      -DALRANL--------LFKLE----------GARTIAVTSAMSSEGKSSVASQLAISLAK
A0A5C6F3H8      -DTLRANL------FLSMDTS----------NVRSIAVVSGMSGEGKSSVSSQLALSIAK
A0A5C5X072      -DSLRANL------FLSVDTR----------HTRSIAVVSSMSGEGKSSVASQLALSMAK
A0A5C5WUQ3      -DTLRSNL------FHSLATK----------NIRSIAVASSMTSEGKSSVASQLAISIAK
A0A5C6E697      -DSLRANL------LLSTDWK----------HVRSIAVVSSVSGEGKSSVASQLALSIAN
A0A5C5Z1A3      -DSLRANL------FLSKQWE----------GTRSIAVASSVSGEGKSSVASQLAISIAK
A0A5C6D2P7      -DSLRSNL------FLSTEWK----------DTRTIAVVSSVSGEGKSSVASQLALSIAK
A0A5B9ML17      -DTMRANI------FLSKHTQ----------HSRSIAIVSSMSGEGKSTAASQLAISLAK
A0A5C5VZJ8      -RVLRTAF------LNRLKQA----------GCSVVQFTSVGPRTGKSTLVGMLGRSLAA
A0A517LX75      -RMARTGL------FVHTGRS----------LDKVMLVTSPMPGDGKSTMIVNLAAAIAK
A0A7X7YXL7      -QTIRTNL------GLLYNGG----------TPKRLVVSSPGAREGKTTFAVNLATSLAK
A0A7W1FH76      -RGLRTSI------SLLLNRP----------GCAVVAVCSSDSQEGKTSVCAHLAISLAA
A0A7C5W7B3      -SLLRNHL------RYSDTNH----------PEKAFAVTSPRPGDGKSFVAVNLAISFAQ
A0A7V2IPP1      -QTIRVNL------GLLAGDV----------LPHMLVVTSAAMAEGKTSFAINLATAAAR
A0A142XL75      -DATRTML------VHGTDEP----------DLRVLVVTSAVSGEGKTSLTGHLAISLAR
A0A6P2D5D5      -DATRTML------VHGTDEP----------DLRVFVVTSAVSGEGKTSLTGHLAISLAR
A0A7C7T8W8      -DQLRISL------LMAEKAQ----------GKKVFSMSSSVSGEGKTSIASQLALSIAR
A0A5C6B3S0      -DSVAAVF------IRKARLE----------QHSVIMITSALAGEGKTTLASQLAVSLAA
A0A354GX32      -DGIRTRL------LHAGRSE----------TLRVVMVASAVSGEGKTTLASHLAASLAR
A0A518GIZ9      -RTIRTSL------LVTAEAL----------NAQVIQVGSPEPGDGKTTLVSNLALALAS
A0A1C3EBY9      -RTIRTSL------LVTAEAL----------NTQVIQVGSPEPGDGKTTLVSNLALALAS
D5SX64          -RTIRTSL------LVTAEAL----------NAQVIQVGSPEPGDGKTTLVSNLALALAS
A0A517Z0U7      -DAARTLL------LRNSQLS----------GTRTVMIASATGGEGKSTLSCHLATSLAR
A0A2S8FCC0      -GGIVARL------FRQSGAN----------KNRVVMISSALAGEGKTTLAGQIAYALAE
A0A1Z8MBT6      -DSLRANL------ALSQDTR----------TARSFCIASSMSGEGKSTAASQLAISLAK
A0A517SXN9      -DSLRANL------ALSQDTR----------TARTFCIASSMSGEGKSTAASQLAISLAK
A0A7X7F3C7      -RTLRTAL--------ALRDR----------EARRLVVCSAEPGDGKTTVLANLGVSFAQ
A0A255QXF5      -DSLRANL------ALSKDTR----------DARTFAIVSSMSGEGKSTAVSQLAISLAK
A0A518KYQ0      -DALRANL------ALSKDTR----------HARSFAVVSSMSGEGKSTAVSQLAISLAK
A0A5B9QX47      -DTLRSNL------FLSVRTR----------DTRSIAVASSMSGEGKSSVASQLAISIAK
M5T666          -DTLRANL------FLSVDTR----------ETRSIAIVSSMSGEGKSSVASQLALSIAK
M5U6N6          -DTLRANL------FLSMDTR----------NTRSIAVVSSMSGEGKSSVASQLALSIAK
A0A517M0G2      -DTLRANL------LLSKETS----------GVRTLTIASSMSGEGKSSVASQLAISVAK
A0A5C6AST1      -DTLRANL------MLSKDTQ----------GVRTIAIASSMSGEGKSSVASQLAISLAK
A0A5C6C951      -DTLRANL------MLSRDTV----------GVRSITIASSMSGEGKSSVSSQLAISLAK
A0A5C6C5T3      -DSLRSNL------FLSVDTR----------HIRSIAVVSSMSGEGKSSVASQLALSMAK
A0A2A2W6A9      -DTLRANL------ALSKDTR----------HARSFAVVSSMSGEGKSTAVSQLAISLAK
A0A518HQS9      -DALRANL------ALSKDTR----------HARSFAVVSSMSGEGKSTAVSQLAISLAK
A0A5M6DFE6      -DTLRANL------FLSESTR----------DARSFAIVSSMSGEGKSTAASQLAISLAK
A0A5C6F286      -DTLRANL------FLSMDTN----------KTRSIAVVSGMSGEGKSSVSSQLALSIAK
A0A517NGN1      -DALRANL------FLSQQTR----------GARTIAICSSMSGEGKSTAAAQLAVSLAK
M5RUI3          -DALRANL------FLSLDTK----------HTRSIAVVSSMSGEGKSSVASQLALSIAK
A0A5C1AAF0      -ASTQMFL------RHAGNVG----------LPRILLIASAEKGEGKTLLSTHLAAGFAR
A0A3B8ZJM2      -RSVRTGL------FFSSRGS----------ELKVVQITSPVPGDGKSTLSSNLAVAMAQ
A0A1U7CLW1      -DAVRTML------LNAGRHQ----------PFRVVLVTSALKGEGKTSLSCHLATSLAR
A0A5Q3LBQ3      -DSLRTGL------VLSEPLR----------DARVLAVTSAISREGKTSLSSELAVSIAQ
A0A142WPR7      -RAVRTSL------YFRTRGE----------PLKVIQVTSPNPGDGKSTLSGNLAISIAQ
A0A517T4K9      -MILKESE-----------NS----------GLQVVLIASALGGEGKSTLACHLSSSLAR
A0A7C6B2Q1      -RKVAARL------IREADQD----------GLKLVMVSSAMAGEGKTTLAGQLALTLAQ
A0A2Z3GZZ5      -RGLRTQL------YFSTQGR----------GHQVIQVTSPTPGDGKSTLAANLALSVAQ
A0A4V0I6L6      -RGLRTQL------LFSVANR----------NHQVIQVTSPMSGDGKSTTAANLAIALAR
A0A7C4QQT3      -RSLRTALGVICE------TR----------QAKVIQVSSPEPGDGKTTTVVNLAVAVAQ
A0A7V9G5K3      -RNLRASVRLAKR-----QDA----------GCHCLMVTSSRPYEGKSTVATRLAISMAS
A0A7W1JAD6      -RNLRASIRLARR-----QDA----------GCHCLMVTSSRPFEGKSTVAARLAVSLAS
A0A518KBI5      -AFAESIDALRMSLTFSADSE----------QQRIVAITSANSGEGKSSVSVALGMSFAN
A0A5C5V6Q5      -SFAESIDSLRMSLTFCAPSE----------RNRVIALTSAVSGEGKTSVSVALAMSFAN
A0A517P477      -VLLRKLGDGRGQTPESRLDA----------GGRVVLISSAVASEGKTTLSCHLAASLAR
A0A518HFS8      -ALLRASQVEPLQ---------------------VIMVTSATKGEGKSSLSCHLATSLAR
A0A7Y5LUV4      -RALRAQVVTHLERLTSSTTG----------RACILAVLSPLPGEGKTTVAANLARALAL
A0A3M1TFJ0      -RRARVQLNATGA--FPSEGC----------G--VLVCVSGVPREGKTLCSVNLAVAEAQ
A0A7Y5HGA4      -RAIRTGI----Q--FSRGDR----------EVRTFLVTSAGPGEGKTTVSVNVATAFAG
A0A517MY49      -RTLRTSL----T--LSPTSC----------E--RLLISSSEPGDGKTTVSANLAVAFAK
A0A2E6AG00      -RTLRTTI----A--FAGDDL----------K--CVAVSSSEPGDGKTTVVANLGATFAQ
A0A1G3A880      -RTLRTAL----A--FSPHAT----------E--RIAVSSSEPGDGKTTVLVNLAVSFAQ
A0A2E8ATT1      -RTLRTTL----A--FSESDT----------E--CIAVTSSEPGDGKTTVLANLGLVWAQ
A0A524HC32      -RSSRVSI------QLSGADT----------RCKSFLITSGIPNEGKTTIAANLALSFAV
A0A660VT66      -RNLRTSL------IFSFKEE----------GPKSILVTSPGSLEGKSTIVSNLGIAFAQ
A0A7C2ZTD2      -QTIRANL------GLMDGGG----------IPNKLVITSAGPGEGKSTLAINLATSLAR
A0A0S8H0S8      -RDIRTAV------CFGVREG----------QVKTLLVTSAQAGDGKTTLVSNLGIAMAQ
A0A7C2VEF7      -RTIRTAV------FFGVPRG----------EARTILITSPDAGDGKSTLVSNLAIAMAQ
A0A7V7D6N0      -RTIRTTV------FFGVPKG----------KAKTILVTSPASGDGKTSLVSNLAITMAQ
M5S2L2          ----------------MADIQ----------GGKVIQVTSPLPGDGKTTLAGNLACSIAQ
A0A7V1EK28      -GGSFTCL------LQQMGNR----------KGNVIVVTSAERGVGKTTVSTMLARSLAK
A0A2Z3GYP4      -RGVRTAL------FFSTHGE----------RHKVIQVTSPHMGDGKTTLIINLAVSIAQ
A0A7C2VXA0      -RTIRTGV------FFGIPKE----------EAKTILVTSPAPGDGKSTLVSNLAITMAQ
A0A7C3AA48      -RTIRTAV------FFSVPKG----------QARTLLVTSPSAGDGKSTLVSNLCIAMAQ
A0A3L7SU85      ------------------------------------------AGDGKSTTSANLAISIAQ
A0A2D6A9B6      -RALRNRL------TVMNPDG----------SARSLVITSAIQGEGKTATALNLAMSMTE
A0A2G6JGH3      -RALRSKL------LVMNPER----------APRSVVITSAIQGEGKSSSAINLALAFAE
A0A7C5PFV3      -RALRNKL------IFLNPEG----------LSRSLVVTSAIKEEGKSTTLLNLGLAFAE
A0A7C3QGD2      -TAAALIE------SHARQAS----------A-RLYAVTSAVPGEGKSTVTCNLAVALAR
A0A3M1RAJ8      -NIRTTLI------HRAKKDG----------L-KVVMVTSGVAREGKSTVASQLAASLAR
A0A7Z9UC46      -RSLRAAL------SRSLAKG----------K-RKFLIVSSWGGEGKSMVSANLAVAFSQ
A0A3D4PLL5      -------------------EN----------H-QRISITSTQPSDGKTTVISNTAVAFAQ
M5RD30          ------------------------------------MMTSPHPGDGKSTTISNLAISLAQ
A0A1V6CUG1      -RSLRTHL------LAQYPDE----------R-FCLLITSAMAGEGKTVTAANLAMVMAE
A0A3M1SE88      -RTLRTAL------ALSESDA----------DTIVVSSTEPG--DGKSTVAANLAAAF-A
A0A7C2ZUK5      -RKLRTRI------LYPVEDD----------VPRSILIISADAQEGKSFVCANLGISLAH
A0A660WB30      -RKLRLRM------N-TTTGE----------RVRTILVTSALAGEGKSTVAANLAVAISQ
A0A660W9Z7      -REIRANL------QVLQVDR----------SVKTLVFSSAHHKEGKTHTVVNTARFLSQ
A0A7X8YY48      -RTLCARL------LAGGAGK----------LSLMITSADAG--EGKTVTCLNLAIVLAA
A0A3M1R9K7      -RGIAARL------IRQAKED----------ETRVVLVTSAFGGEGKTTVASQLAISL-A
A0A3L7PH51      -RSLRNFI------TFSNEAT----------QRLVVTSTEPG--DGKTTTLANLAVAF-A
A0A3N5UQY5      -RIVRTAV------FFGAPNG----------KAKTTLITSPGMEDGKSTLVSNLAIAM-A
                                                             **:            

A0A523CME0      N-NNKVVIIDCDLRKP-----------------SIN----RLL-GF-------IP-DKGV
A0A7Y3UKB3      N-NNKVVIIDCDLRKP-----------------SIN----RLL-GF-------IP-DKGV
A0A7C2JY73      S-GKRVLLVDADLRRP-----------------MLH----TLF-AL-------PN-DIGL
A0A836W298      S-GKKTLVIDADMRRP-----------------GLT----TLL-EL-------KG-TKGL
A0A354PCV3      ATGKTVLLVDADLRRP-----------------DQH----RLF-GV-------EM-GPGL
A0A354PHB4      ATGETVLLVDADLRRP-----------------DQH----RLF-GV-------QM-GPGL
A0A356ESF4      A-QRKTLLIDADLRRP-----------------GLT----SML-DL-------RG-AEGL
A0A538RV31      A-GRKTLLIDCDLRRP-----------------SVH----QLF-DM-------PV-EPGF
A0A1G2XSU7      I-GKKVLLIDGDLRKP-----------------DIA----KYL-KL-------DNKGKGM
A0A350KD81      T-GRKVLIIDADLRRP-----------------TIH----KLF-GL-------AN-SIGL
A0A356AE44      A-GKRVLLIDADLRKP-----------------MVH----QLF-GM-------RE-EIGL
A0A7Z9UBD9      S-GLNVVLVDADLRRP-----------------SVK----KSI-GA-------DNAEHDM
A0A257WQ92      S-GKRVLLVDADLRRP-----------------SVH----TLF-NL-------PT-DIGL
A0A2E3Z6T8      A-GHRTLVIDADLRRP-----------------GFT----TLM-QL-------KG-QPGV
A0A7Y2AF64      A-GRRTLLIDADLRKP-----------------GLS----RLF-GV-------RG-LGGL
A0A7C1U6X6      S-GKKVIMIDADLRRM-----------------TLS----KRF-GL-------AD-EPGF
A0A7C7UXI5      A-GKRTLLVDADMRRP-----------------GLT----PLL-DL-------KG-PKGL
A0A7C3SFJ0      T-GRSTLLVDGDLRRP-----------------SAH----RIF-DL-------PQ-SPGL
A0A7X7YIF4      S-GEKVLLIDGDLRKP-----------------DIA----ETL-RM-------PK-GFRG
A0A7C7WWF7      S-GKRTLLIDADLRKP-----------------GLS----TMF-CY-------RK-MPGL
A0A7V3JIB0      T-GHQTVLVDFDLRQP-----------------AID----QVF-AV-------PL-EPGV
A0A356ETW1      S-NKKTLLIDADLRRP-----------------GLT----NLM-QM-------RQ-QEGL
A0A3L7NJY1      S-GRRTLLIDADMRRP-----------------GLS----TLL-GL-------RD-DFGL
A0A2D6SRY7      L-GRRVVLVDADMRRP-----------------VLH----GLF-GV-------ER-GPGL
A0A1G3C300      T-GKKTLLVDTDFRKP-----------------RQH----KIF-GI-------DL-KPGL
A0A177PV03      S-GKKVVLLDADFRKP-----------------RMH----EIF-GV-------SA-DVGV
A0A1G2YIM0      A-GARVLLVDGDLRKP-----------------DIA----KIL-NI------ETG-HNAL
A0A1G3A0W0      A-GKKVLMIDADLRKM-----------------GLT----RRF-NL------AG--KAGF
A0A7V7D8F5      S-GNKVLLIDGDLRKP-----------------DIA----HLL-NI------SDG-SKGL
A0A432MFP3      A-GASTVLIDADLRRA-----------------TLG----RLF-EV------PD--CPGL
A0A518HFL0      A-GASTVLIDADLRRA-----------------TLG----RLF-EV------PD--CPGL
A0A3L7UX05      A-GLSTVVVDGDLRNP-----------------TLT----RTL-EA------TD--MPGL
A0A2E0SHG0      T-GKSVLLIDCDMRLP-----------------MVD----KLF-GL------DT--SVGL
A0A2S8F9B8      A-GRKVVVVDFDLRRP-----------------SMH----AIF-DC------PI--SPGV
A0A368KP63      A-GRRVVIVDFDLRRP-----------------SMH----RIL-GL------PI--GPGV
A0A518CQB8      T-GKSVLLIDCDMRLP-----------------MVD----KLF-GL------ST--TVGL
A0A7C4QPD3      S-GFRVLLIDGDLRRP-----------------TLE----REF-NL------PR--QRGF
A0A7C2JZW2      A-GYRVLLIDGDLRRP-----------------SLE----KEF-GI------GT--GPGL
A0A836RF42      S-GKRVVLLDADCRKP-----------------RVH----KLF-GI------DR--QPGL
A0A7D8YCU5      A-QKRVIVIDADLRRP-----------------TQH----ILF-GR--GSQSEG--GIGL
A0A353BE27      S-GRRVLLIDADLRRP-----------------RVA----KIF-GI------DS--EIGV
A0A5C6BPW1      V-GRNTLLVDCDFRKS-----------------NVH----RVF-GV------EE--HPGL
A0A1I3GSP0      S-GKKVLLVDCDLRRP-----------------TQH----TLF-QV------PQ--EVGL
A0A517QJV1      A-GKRVLLIDCDLRRP-----------------TLH----HLL-GL------PQ--EIGF
A0A3C1QS25      S-GQKVLLVDADLRRP-----------------RQH----KVI-GE------NA--EHGF
A0A5C6FX55      S-GKSVLVIDCDLRRP-----------------QLT----DNF-VM------QD--QLGL
A0A5C6DS51      T-GKRVLLIDSDLRRP-----------------VVA----GLF-GL------EG--RLGL
A0A5C6DSL6      T-GKRVLLIDSDLRRP-----------------VVA----GLF-GL------EG--QPGL
A0A3M1VG27      S-GKRVLLLDADLRRP-----------------SIH----KAL-GL------RQ--DIGV
A0A518GC22      S-GRRVLLIDADLRRP-----------------RVA----KIF-GI------DS--DVGV
A0A3L7Q373      S-GKRVLLIDADLRRP-----------------TMH----TLF-GL------SQ--DIGL
A0A3E0PW54      S-GKRVLLIDADMRRP-----------------TVH----ELF-RI------KQ--DIGL
A0A7C3TAH2      S-GRRVLLVDGDLRKP-----------------DVA----ILM-GI---PVPAP--GSGE
A0A1Z8MHR4      S-GKRTLLIDLDLRSP-----------------RLS----LRF-NL------ST--NVGL
A0A5C6EHJ0      S-GRKVLLLDGDLRRP-----------------RVG----KLL-GI------ES--EIGT
A0A5C6F1H9      S-GRRVLLMDGDLRRP-----------------RVG----KVM-GI------EN--DKGT
A0A255QXY0      T-GKTTLLIDLDLRSP-----------------RLS----LRF-NL------QS--DKGL
A0A517SYI0      S-GKRTLLIDLDLRSP-----------------RLS----LRF-NL------ST--NVGL
A0A518HX54      S-GKRTLLIDLDLRSP-----------------RLS----LRF-NL------ET--KIGL
A0A5B9MF59      S-GKRTLLIDLDLRSP-----------------RLS----LRF-NL------EA--QTGL
A0A2A2WC24      S-GKRTLLIDLDLRSP-----------------RLS----LRF-NL------EA--KTGL
A0A518KYW8      S-GKRTLLIDLDLRSP-----------------RLS----LRF-NL------EA--KTGL
A0A5C5YZZ0      A-NKRVLIIDADLRRP-----------------TQA----KVF-GV------QP--SAGL
A0A518JLD2      A-GKSVLILDADLRRP-----------------RIA----KLF-DL------RA--DKGL
A0A5M6DJ15      A-KYRTVIVDFDLRRP-----------------SLH----VDL-GC------EP--GIGV
A0A3L7P7S7      S-GKKIVLLDADFRKP-----------------RVH----KIF-KL-----DQP--EVGL
A0A517N8M1      S-GKRTLVIDCDLRRP-----------------QLT----DNF-DM------AD--LSGL
A0A5C6CW01      S-GKRVLVIDCDLRRP-----------------QIT----DNF-AM------KS--KLGL
A0A5C6BXS9      S-GKRTLLIDCDLRRP-----------------QIT----DNF-GS------AE--KQGL
M5U569          S-GKKTLLIDCDLRRP-----------------QIT----DNF-AS------AE--QLGL
L7CND7          S-GKRTLIIDCDLRRP-----------------QVT----DNF-AM------AD--QLGL
A0A0J1B8S4      S-GKRTLIIDCDLRRP-----------------QVT----DNF-AK------AD--QLGL
F2ARR3          S-GKRTLIIDCDLRRP-----------------QVT----DNF-AM------AD--QLGL
K5D8H6          S-GKRTLIIDCDLRRP-----------------QVT----DNF-AM------AD--QLGL
M2AKU0          S-GKRTLIIDCDLRRP-----------------QVT----DNF-AM------AD--QLGL
A0A5B1CRW9      T-GKRVLLIDADMRRP-----------------VVA----KLF-GL------QH--DPGL
A0A5C6EI46      A-GKRVLLIDADMRRP-----------------VIS----KLF-GI------DD--RKGL
A0A5B1CKI2      S-GKRVLVIDSDLRRP-----------------QLT----DFF-SL------AE--QKGL
A0A5C6EG84      S-GKRTLVIDCDLRRP-----------------QLT----DNF-DM------AD--QRGL
A0A5C6F2X4      S-GKRTLVIDCDLRRP-----------------QLT----DNF-DM------AD--QKGL
A0A7W5DXF4      S-GKKTLLIDCDLRRP-----------------QIT----DNF-DS------AD--KLGL
A0A5C5XTV6      S-GKRTLLIDCDLRRP-----------------QIT----NNF-DS------AE--KQGL
A0A5C6AAB1      S-GKRTLLIDCDLRRP-----------------QIT----DNF-NG------SE--KLGL
M5T8W8          S-GKKTLLIDCDLRRP-----------------QIT----DNF-DS------AE--QLGL
M5SF00          S-GKRTLIIDCDLRRP-----------------QVT----DNF-AM------AD--QLGL
A0A2G1WDS1      S-GKRTLIIDCDLRRP-----------------QVT----DNF-AM------AD--QLGL
Q7UVS9          S-GKRTLIIDCDLRRP-----------------QVT----DNF-AM------AD--QLGL
A0A5C6B601      S-GKKVLLIDLDLRSP-----------------RMS----LRF-NL------QS--DVGL
A0A517PFU1      V-GKRTVLVDVDLRRP-----------------RVR----RMF-GLPQVAADNP--GVGT
A0A5B9M8J9      S-GKRTLLIDLDLRSP-----------------RLS----LRF-NL------DT--NVGL
A0A2A2WFP6      S-GKRTLLIDLDLRSP-----------------RLS----LRF-NL------ET--KIGL
A0A518L8N2      S-GKRTLLIDLDLRSP-----------------RLS----LRF-NL------ET--KIGL
A0A518HQN9      S-GKRTLLIDLDLRSP-----------------RLS----LRF-NL------EA--KTGL
A0A5M6D8H8      S-GKKTLLLDLDLRSP-----------------RMS----LRF-NL------ES--GKGL
A0A1G2ZG92      E-KKKVILVDLDLRRP-----------------TAH----KFF-KI-------SN-NNGI
A0A2E7D3V4      S-GRKVLLIDADLRRP-----------------TVN----QLF-GL-------PQ-DIGT
A0A5B9PER9      S-GKRVLLVDADMRRP-----------------RQH----STF-GI-------TS-KEGF
A0A517QSM4      S-GRKVVLVDCDMRRP-----------------TVH----RVF-RL-------NS-AHGF
A0A355GJI7      T-GRKVLIVDADLRRP-----------------TIH----KLF-GL-------AN-SVGL
A0A1Z8MCI4      SKHLKVLVIDADVRKP-----------------SLH----SLF-DV-------SN-EVGL
A0A517SYL7      SKHLKVLVIDADVRKP-----------------SLH----SLF-DV-------SN-EVGL
A0A3L7P0L2      S-GKKVLLIDADLRRP-----------------TMH----TLF-AL-------PQ-DIGL
A0A6M5YVJ1      A-GSRTLLIDGDLRAP-----------------TAQ----RVF-GG-------PL-APGL
A0A832M9Q8      S-GMEVLLIDGDLRKR-----------------DLS----TRF-DV-------GF-RPGL
A0A7W0MCI8      S-GRRVILVDADLRRP-----------------SLS----QVY-G--------AE-GPGV
A0A517SCC8      S-GKKVLLIDADMRRP-----------------TVH----DMF-RL-------SQ-EAGL
A0A358MY60      ACGETVLLVDADLRSP-----------------DQH----DIF-GL-------EM-GPGL
A0A517MNB1      ACGETILLIDADLRKP-----------------DQH----AIF-GL-------EM-GPGL
A0A3A0DR44      ATGKRVLIVDADLRSP-----------------NLH----EIF-EI-------HL-EPGL
A0A142YJ13      A-GRRTLLIDCDLRKP-----------------SLH----EIF-EV-------PS-EPGL
A0A517Z7D3      S-GKRVLLVDGDLRRP-----------------TLH----KLF-KL-------RS-DIGL
A0A7X7KCE7      STGKQLLLIDGDMRCP-----------------DLH----NVF-NI-------EL-EPGL
A0A1N6KY57      A-GRRTLLVDGDLRRP-----------------SVH----ELF-DQ-------PC-VPGF
L0DK20          A-GRRTLLIDGDLRRP-----------------SAH----ELF-DQ-------PC-VPGF
A0A517XRC2      A-GMRTLIVDCDLRNP-----------------SIH----KLF-DL-------PL-TPGV
A0A6M5YH47      A-GMRTLIVDCDLRNP-----------------SVQ----KLF-EL-------PL-GPGV
A0A660UUK3      S-GEKVLLIDGDLRKP-----------------DIA----DML-NL------PKG-LRGL
A0A517ZHG5      V-GRNTLLVDCDFRKS-----------------NVH----RVF-GV-------EE-QPGL
A0A1Z8MPL5      S-GRRTLLIDGDLRCP-----------------SAH----RFL-EM-------PL-DEGL
A0A7C1EH96      S-GRKTLLIDGDLRKP-----------------DIA----GML-NL------SAG-HRGI
A0A5C1AGE3      A-GLRTLIVDCDLRNP-----------------SMH----RLF-DL-------PL-APGC
A0A2Z3HEL7      A-GMRTLIVDCDLRNP-----------------CVM----KLF-EV-------PL-TPGV
A0A142XAP8      A-GMRTLIVDCDLRNP-----------------SIM----KLF-EL-------PL-APGV
A0A6P2DEK1      A-GMRTLIVDCDLRNP-----------------SIM----KLF-EL-------PL-APGV
A0A5C6C1R5      A-SYRTILIDFDLRRP-----------------SLH----ENL-GY-------EL-GVGV
A0A1G2YRE4      S-GKKVLLIDGDLRKP-----------------DIA----YLL-NL------PKS-TKGL
A6BZU4          T-GRKVLIIDADLRRP-----------------TIH----KLF-GL-------AN-SIGL
A0A2D5GZ77      T-GRKVLIVDADLRRP-----------------TIH----KLF-GL-------AN-SIGL
A0A3D3R1Z6      T-GRKVLIVDADLRRP-----------------TIH----KLF-GL-------AN-SIGL
A0A517XG00      T-GRKVLIVDADLRRP-----------------TIH----KLF-GL-------AN-SIGL
A0A353Z859      A-GYRTVVVDVDLRRP-----------------TVH----RVF-DV-------AG-DPGV
A0A2D6ST10      A-GRKVLLIDCDLRRP-----------------SIC----RVF-DL-------PQ-IPGV
A0A177QX42      S-GKKVLLVDGDLRRP-----------------RIH----KLF-GL-------DL-ERGL
A0A517SHR0      S-GKRCLLVDCDLRRP-----------------RVH----KLF-GV-------SI-DVGV
A0A2E0AW64      ASGQPTLLIDGDMRAP-----------------DLY----DVF-EI-------PN-QPGF
A0A351FZ59      ASGQPTLLIDGDMRAP-----------------DLY----DVF-EI-------PN-QPGF
A0A660V239      S-GEKVLLIDGDLRKP-----------------DIA----EML-NL------PKG-SRGL
A0A177Q3B7      A-GFQTLLIDGDMRRP-----------------ACH----RVF-GA-------PA-SPGF
A0A2E0X6Y6      A-GRRTLIIDADLRKP-----------------GLT----TRL-SL-------KR-DAGV
A0A518GFD7      S-GKRVLLVDFDLRRP-----------------SLH----SYL-EL-------SE-GPGV
A0A518GE37      TSQTTVLLIDADLRSP-----------------DQH----DLF-GL-------PN-EPGL
A0A5C6F3H8      ATGETVLLVDGDLRCP-----------------DQH----EIF-GL-------EM-GDGF
A0A5C5X072      STGETVLLVDGDLRRP-----------------DQH----EIF-GL-------EM-GPGL
A0A5C5WUQ3      ATGETVLLVDADLRCP-----------------DQH----SLF-GL-------DI-GPGL
A0A5C6E697      ATAETVLLVDADLRCP-----------------DQH----RLF-GL-------EM-GPGL
A0A5C5Z1A3      ATGETVLLVDADVRCP-----------------DQH----RLF-GL-------DM-GAGL
A0A5C6D2P7      ATGNTVLLVDADLRCP-----------------DQH----RLF-GL-------EM-GPGL
A0A5B9ML17      SSGKTVLLVDADMRCP-----------------DQH----DHF-GI-------SL-EPGL
A0A5C5VZJ8      A-GKRVLLVDGDVRRG-----------------SLT----AAF-RA-------AG-TAGL
A0A517LX75      A-GKSVLLVDADLRRP-----------------TLH----KLL-GV-------EA-SMGL
A0A7X7YXL7      A-GKKVLLIDGDLRKP-----------------DIG----HML-NV------LNN-TSGL
A0A7W1FH76      T-GARVLLIDADLRNP-----------------HLH----LAL-GE-------TI-TTGF
A0A7C5W7B3      E-GNRTVLVDCDLRHP-----------------DKNVYQEALLVQA-------HQ-QHGL
A0A7V2IPP1      S-GKKVLLIDGDFRKP-----------------DVA----PLL-GF------SAN-SAGL
A0A142XL75      A-GFRTLLVDGDLRSP-----------------TAH----RVF-DA-------PL-APGL
A0A6P2D5D5      A-GFRTLLVDGDLRAP-----------------TVH----RVF-DA-------PL-APGL
A0A7C7T8W8      SQNLPVLLIDADMRAP-----------------SQH----NIF-NC-------NI-GPGL
A0A5C6B3S0      S-GQRTVLVDCDLRRS-----------------VLH----QLF-EA-------NL-QPGL
A0A354GX32      G-GRRTLLVDGDLRNP-----------------AAH----KLF-GM-------AA-GPGF
A0A518GIZ9      S-GKRVLLIDADLRRP-----------------MAT----RLF-GL-------RP-DPGL
A0A1C3EBY9      S-GKRVLLIDADLRRP-----------------MAT----RLF-GL-------RP-DPGL
D5SX64          S-GKRVLLIDADLRRP-----------------MAT----RLF-GL-------RP-DPGL
A0A517Z0U7      A-GRSVLLVDCDIRRP-----------------SIH----RVF-DF-------EN-SPGI
A0A2S8FCC0      S-GARTVLVDFDLRRP-----------------ALD----ISF-DI-------EL-TPGV
A0A1Z8MBT6      SSGKTVLIIDADLRCP-----------------DQH----DIF-GL-------AL-EPGL
A0A517SXN9      SSGKTVLIIDADLRCP-----------------DQH----DIF-GL-------AL-EPGL
A0A7X7F3C7      A-HRKTLLIDADLRRP-----------------GLT----GLL-DL-------RG-AEGL
A0A255QXF5      ASGKTVLIIDADMRCP-----------------DQH----DVF-GL-------PL-EPGL
A0A518KYQ0      SSGNTVLIVDCDMRCP-----------------DQH----DVF-GL-------AL-EPGL
A0A5B9QX47      ATGELVLLVDADLRCP-----------------DQH----DIF-GL-------EM-GPGL
M5T666          ATGETVLLVDADLRCP-----------------DQH----EIF-GL-------EM-GPGF
M5U6N6          ATGETVLLVDADLRCP-----------------DQH----EIF-GL-------DM-GRGL
A0A517M0G2      ASGKTVLLIDGDLRSP-----------------DQH----AIF-GL-------DL-GPGL
A0A5C6AST1      ACGKTVLLIDADLRSP-----------------DQH----DIF-GL-------EM-GPGL
A0A5C6C951      ACGKTVLLIDADLRSP-----------------DQH----AIF-GL-------EM-GAGL
A0A5C6C5T3      STGETVLLVDGDLRRP-----------------DQH----EIF-GI-------EM-GPGF
A0A2A2W6A9      SSGKTVLIIDCDMRCP-----------------DQH----DVF-GL-------AL-EPGL
A0A518HQS9      SSGKTVLIIDCDMRCP-----------------DQH----DVF-GL-------AL-EPGL
A0A5M6DFE6      ATGKTVLLIDADMRCP-----------------DQH----DVF-GL-------TL-EPGL
A0A5C6F286      ATGGTVLLVDGDLRCP-----------------DQH----EIF-GL-------EM-GVGF
A0A517NGN1      ASNKTVLLVDGDTRCP-----------------DLH----DVF-GI-------DL-SPGL
M5RUI3          ATDQTVLLVDADLRYP-----------------DQH----EIF-GL-------EM-GPGL
A0A5C1AAF0      N-GVKTLLIDGDLRKP-----------------SAH----GAF-GV-------PS-GPGL
A0A3B8ZJM2      S-GRRVLLIDADFRRP-----------------RLQ----KLF-GF-------DA-DVGV
A0A1U7CLW1      G-GRKTLLMDCDLRKP-----------------SLH----DVF-DF-------PS-GPGL
A0A5Q3LBQ3      ATGEPTLLIDGDMRSP-----------------DIH----TIF-EI-------PM-EPGL
A0A142WPR7      T-GKRVLLMDADFRRP-----------------RIH----KLI-GQ-------NT-SLGV
A0A517T4K9      A-GRKTLLIDGDMRRP-----------------SVH----EVF-DI-------PL-GPGL
A0A7C6B2Q1      M-GKKTIIVDFDLRRP-----------------AIH----DVF-NV-------PL-SPGV
A0A2Z3GZZ5      S-GKRTILVDCDLRKP-----------------RVH----KLFAGA------DAT-GTGL
A0A4V0I6L6      A-DKRVVLVDCDFRKP-----------------RVH----KLF-GL------EKP-ATGL
A0A7C4QQT3      S-GRRVLLIDADLRRP-----------------SCH----RLL-GV-------SL-DIGL
A0A7V9G5K3      T-GAKVLLVDADMRKP-----------------TLH----LQV-GE-------SC-ERGL
A0A7W1JAD6      T-GAKVLLVDADLRKP-----------------TLH----LQL-GE-------SG-ERGL
A0A518KBI5      ATRRRTLIIDGDMRDP-----------------SVT----DLL-DV-------PA-GPGL
A0A5C5V6Q5      ATGAKTLLVDGDMRDP-----------------SIN----DLV-DA-------EP-GPGL
A0A517P477      T-GRRVVLVDADLRRP-----------------STH----RVF-GC-------ES-GPGL
A0A518HFS8      A-GRRTLLLDCDLRSP-----------------AIH----LLM-DE-------PL-APGL
A0A7Y5LUV4      E-GRRVLLFDADLRRP-----------------RLH----ALH-KT-------AD-GPGL
A0A3M1TFJ0      A-GRRTLLVDGDMRNP-----------------RVH----KVF-AA-------DP-APGL
A0A7Y5HGA4      G-KERVLLVDADLRRA-----------------RIH----SAL-GV-------DN-GRGL
A0A517MY49      A-GKRTLVIDADLRKP-----------------GMT----ALL-GL-------KS-QHGV
A0A2E6AG00      A-NXTTLMIDADLRKP-----------------GMT----RLF-EL-------RG-QEGL
A0A1G3A880      A-GKRTLLIDADLRRP-----------------GLT----TLL-GM-------KG-AAGV
A0A2E8ATT1      V-GKKTLLIDADMRRP-----------------GLS----RLL-DM-------RG-TSGL
A0A524HC32      A-GERVMLIDVDLRKP-----------------SLH----NVF-----IPSTPVN-GNGL
A0A660VT66      N-GQKTVIIDGDLRKP-----------------RLH----RTF-------EA-DN-SVGL
A0A7C2ZTD2      A-DKRVLLIDGDLRKP-----------------DIA----NLL-------NLPKG-SRGL
A0A0S8H0S8      A-AQRTLILDADLRNP-----------------MQH----EVF-------DV-AC-EPGL
A0A7C2VEF7      A-GQKTLILDADFRKP-----------------MQH----NIF-------EF-EN-NRGL
A0A7V7D6N0      A-GQKTLILDADFRKP-----------------MQH----NIF-------EI-DN-EKGL
M5S2L2          S-GKRVLVIDCDLRRP-----------------QIT----DNF-AM-------QS-KMGL
A0A7V1EK28      S-GKRALLIDADLRNP-----------------SVA----AHM-DL-------HP-LIGF
A0A2Z3GYP4      A-GRKVLLLDADLRRP-----------------RVH----RAF-GL-------TS-RIGL
A0A7C2VXA0      A-GQKTIIVDADFRKP-----------------MQH----NIF-EI-------DSGKKGL
A0A7C3AA48      A-DQKVLLIDADFRKP-----------------MQH----GIF-EV--------TREPGV
A0A3L7SU85      S-GKKIVLLDADFRKP-----------------RVH----KIF-RL-------EQPEVGL
A0A2D6A9B6      LQDHRILVLDCDLRKP-----------------SVE----TFL-GL-------NR-GPGL
A0A2G6JGH3      LEDQRAVLLDFDFRKP-----------------SVE----TLL-GL-------NQ-EPGL
A0A7C5PFV3      LEGQSAIILDFDLRLP-----------------SVE----RLL-GL-------NP-EPGL
A0A7C3QGD2      A-GSRVLLVDADLRKA-----------------TQH----QLL-NV-------AN-DPGL
A0A3M1RAJ8      A-GRKTVLIDGDLRRP-----------------RMH----RVL-KQ-------DL-APGL
A0A7Z9UC46      L-LMDVVLIDGDLRRP-----------------TLS----RVF-ER-------EE-LPGL
A0A3D4PLL5      A-GKKTLVIDGDMRRP-----------------GLT----AVF-AL-------KG-QAGL
M5RD30          T-GKRVLLIDADMRRP-----------------VIA----GLF-GL-------EG-EPGL
A0A1V6CUG1      RIDRKTILVDCDLRKK-----------------KLT----AML-GC-------K-QQAGM
A0A3M1SE88      QAGKKTLLIDGDLRRP-----------------GLT----AML-GY-------R-GESGL
A0A7C2ZUK5      SVAQHALMIDCDLRRP-----------------SLA----GLF-GL-------DNNSRGL
A0A660WB30      MIGEHVLLVDGDLRRP-----------------DLH----NFF-GL-------P-PKPGL
A0A660W9Z7      HENRHTLLMDCDLRRP-----------------KIK----EHV-LV-------D-CEYSL
A0A7X8YY48      RQENRVVVVDCDFRKK-----------------QVA----QML-NC-------R-KGPGF
A0A3M1R9K7      EMGQKTILIDFDLRRP-----------------SLD----GVF-GI-------E-NDRGV
A0A3L7PH51      QAGKKTLLIDADLRRPGMTQLLDLKGPRGLAQVLND----KKL-DI-------DIAERCL
A0A3N5UQY5      RAGQKTLILDADLRKP-----------------IQH----RIF-DI-------NHQEQCL
                      ::.* * *                                              

A0A523CME0      S--------DYLS--------EDLDLEE----C-SATGL--MPGLT-VI-PAG-N-RQ-A
A0A7Y3UKB3      S--------DYLS--------EDLDLEE----C-SATGL--MPGLT-VI-PAG-N-RQ-A
A0A7C2JY73      T--------DVLS--------GEIEL----LNA-VRPGG--VDTLS-VL-PAG-R-PP-T
A0A836W298      S--------HVLR--------DPLPIHESVAKN-LIASI--TERLD-VI-PSG-P-RP-M
A0A354PCV3      S--------GVLA--------GTTPL----LDA-VNTSL--GHLIH-LL-PAG-E-LT-A
A0A354PHB4      V--------AVLA--------GKTPL----LDA-VNTSL--GHLIH-LL-PAG-E-LT-A
A0A356ESF4      S--------NLLG--------GNGKVGAAAAAV-IRPSG--IAGLD-ML-PSG-P-RF-A
A0A538RV31      S--------GVLR--------GDVDL----SEV-IRPTP--AKNLW-VV-PAG-Q-CD-V
A0A1G2XSU7      H--------QLL---------ADFKLRD----L-LLYSD--VPGLS-VL-TAE-P-CD-I
A0A350KD81      G--------DVLN--------GEIDAQT----A-IRETR--VTHLS-IL-TAG-M-LP-E
A0A356AE44      S--------ECLS--------GEIEMAN----A-IQDSR--IENLH-IL-SAG-A-IP-A
A0A7Z9UBD9      I--------DFLT--------HACTLDDA-----LQTDT--ENEFM-YL-ATT-R-QP-A
A0A257WQ92      A--------DVLA--------GEIQGLNA-----LRPTF--VENLQ-VL-PAG-Q-PP-A
A0A2E3Z6T8      A--------DLLT--------SPETPAQSAPPL-IHSTI--VKDLD-VL-PAG-L-RR-P
A0A7Y2AF64      T--------EVLR--------SDESIIHMAKQR-IRNTD--LDCLD-LL-PCG-P-KP-S
A0A7C1U6X6      M--------ESLR--------A----RSVDQRY-IFATE--TPGLS-IL-PGGIP-NGDG
A0A7C7UXI5      S--------GVLR--------HEAPVPDVVSEH-IRPDV--LPNLD-VL-PAG-P-RP-T
A0A7C3SFJ0      C--------EVLR--------NEARLEDV-----IRPTR--VPGVW-LL-PAG-R-WD-I
A0A7X7YIF4      I--------QEVL--------FGKSIENAVY------VT--TSGVH-VL-AAD-E-RNTV
A0A7C7WWF7      S--------DFLQ--------SEEPIDNACKSR-IQETA--VTGMH-VF-PCG-P-KP-A
A0A7V3JIB0      A--------EILR--------DGVKLHEA-----LQNTE--IDGLV-VL-PAG-R-GD-R
A0A356ETW1      S--------TVLR--------SNAHVADLCVAL-IQPTG--IERLD-VL-PSG-P-RP-A
A0A3L7NJY1      S--------RLLR--------STDNLETSISQN-LRVTV--VEGLD-VI-SCG-P-RP-V
A0A2D6SRY7      S--------EILV--------GNATWQE----N-LRSTS--VEGLH-VL-PAG-Q-SP-P
A0A1G3C300      S--------NHFI--------GEIDYES----I-IKHVN--IPHLN-II-TCG-L-IP-P
A0A177PV03      A--------SVIA--------GTAKLKD----A-VKPTA--VEGLS-IL-PCG-P-RP-A
A0A1G2YIM0      R--------KVLL--------GYNTLDE----S-VWPMP--SVGLD-VLISDG-N-DS-Y
A0A1G3A0W0      I--------ESLR--------SRSADKR----H-IFPTD--TFGLN-IM-PAG-K-HN-D
A0A7V7D8F5      H--------DVLF--------GR-DFDQ----AVCFVPS--VGLDV-LA-PNS-R-NG-A
A0A432MFP3      S--------DVLR--------GDAQLED----ALVPISQ--VGGCQ-LL-PAG-S-PE-A
A0A518HFL0      S--------DVLR--------GDAQLED----ALVPISQ--VGGCQ-LL-PAG-S-PE-P
A0A3L7UX05      T--------NLLK--------GQSNIDK----CLVRIGE--GGGFH-LL-PAG-T-IH-G
A0A2E0SHG0      S--------SVLR--------GEAEIPD----A-IQETE--VENLT-AL-PCG-P-VP-E
A0A2S8F9B8      G--------ELLV--------NHVKLDE----A-IQPTN--IPNVD-LI-PAG-S-SE-Q
A0A368KP63      S--------DLLA--------GQAELAD----V-VKATD--IPNVS-FL-PAG-V-EE-Q
A0A518CQB8      S--------DVLR--------GEAEIQD----A-VQETE--VKGLT-AL-VCG-P-VP-D
A0A7C4QPD3      C--------ELLA--------GSISLAD----A-IHPSP--LAELD-LL-PAG-S-LD-D
A0A7C2JZW2      C--------EVLD--------GRVTLDQ----A-ICHTE--LQELD-LL-LAG-Q-LT-D
A0A836RF42      K--------EIIR--------GNAPARD----V-WQTCE--VDNLM-LI-PAG-E-RS-R
A0A7D8YCU5      T--------SVMN--------YDVSLAE----A-IQSTS--VEGLD-VL-TTG-P-IP-N
A0A353BE27      A--------AVVG--------GKVEVDD----A-ICAGP--VANLS-IL-PGG-K-RP-A
A0A5C6BPW1      S--------EVLL--------GTASLEE----A-IKSPS--DDGPD-VL-PAG-Q-FN-S
A0A1I3GSP0      T--------DVLL--------REIDWQN----A-VRPTQ--IENLS-LM-TAG-L-CP-E
A0A517QJV1      T--------DVLL--------NEIQWQN----A-IRETP--SENLS-VI-TAG-L-CP-E
A0A3C1QS25      A--------AVLR--------GDLAVAE----A-AIETQ--VPGLY-FI-PCG-E-RP-S
A0A5C6FX55      T--------NVLN--------GECEWQE----A-CHSTP--LGHLD-VM-PSG-P-IP-A
A0A5C6DS51      A--------DVLK--------GDSTLAE----A-ASKTS--VENLD-VM-PHG-T-ET-S
A0A5C6DSL6      A--------DVLN--------GQCSLAQ----S-VTHSS--VENLD-IM-PHG-T-ET-S
A0A3M1VG27      T--------DILR--------GEIDWQT----A-VQHTV--ENNLD-VL-PAG-L-PV-D
A0A518GC22      A--------AVVG--------GKCEIED----G-IHVGP--VANLS-IM-PGG-K-RP-A
A0A3L7Q373      A--------DVLQ--------NEIQWVN----A-VRSTR--LENLS-VL-TAG-R-CP-S
A0A3E0PW54      S--------EVLL--------GEIEWMN----A-LRETP--VEGLS-VM-TAG-A-CP-E
A0A7C3TAH2      S--------IEVD-----------GFCY----V-LCKTG--IPELDSLV-PAG-A-PA-A
A0A1Z8MHR4      T--------NVLN--------GELAPEE----A-VCHSP--IDNLD-IL-PCG-P-LP-A
A0A5C6EHJ0      AWAIEQCGPGSTD--------SNVAIDA----A-IHPSL--VANLS-VM-TAG-E-RP-D
A0A5C6F1H9      AWAIEQCEADAAG--------LDDRIQA----A-ITRSV--VANLS-VM-TAG-E-RP-D
A0A255QXY0      A--------NVLN--------GEIGISE----A-IHETS--IDYLD-VL-PCG-P-LP-A
A0A517SYI0      T--------NVLN--------GELAPEE----A-VCHSP--IDNLD-IL-PCG-P-LP-A
A0A518HX54      A--------NVLN--------GELGVAQ----A-VHQTP--IENLD-IL-PCG-P-LP-A
A0A5B9MF59      T--------NVLN--------GELGPAE----A-VHQSP--IENLD-IL-PCG-P-LP-A
A0A2A2WC24      T--------NVLN--------GELGPAE----A-IHQSP--IENLD-IL-PCG-P-LP-A
A0A518KYW8      T--------NVLN--------GELGPAE----A-IHQSP--IENLD-IL-PCG-P-LP-A
A0A5C5YZZ0      T--------GLLN--------GEIEFKD----A-IVETD--AENLF-VL-PSG-P-KP-N
A0A518JLD2      A--------WAIEQITLSKEIDDLMINE----A-IQDTV--VPNLS-AM-VAG-N-PP-D
A0A5M6DJ15      S--------DIVA--------ASANWKE----C-VRRQS--QLRY--YM-SAG-S-VE-N
A0A3L7P7S7      A--------SVVS--------GDATLQE----A-IHTCA--VPGLH-LM-PCG-P-RP-A
A0A517N8M1      S--------EVLN--------GECEAMD----A-CRQTP--LRNLF-VM-PSG-A-IP-A
A0A5C6CW01      S--------NVLN--------GDCDPSE----A-CHETP--LSTLQ-VM-PSG-P-IP-A
A0A5C6BXS9      T--------DVLN--------GTCDHVD----A-IHDTP--LATLK-LM-PSG-P-IP-A
M5U569          I--------DVLN--------GHCEHIE----A-IHDTP--LATLK-LM-PSG-P-IP-A
L7CND7          V--------DVLN--------GKCEHVD----A-AHDTP--LSTLK-MM-PSG-P-IP-A
A0A0J1B8S4      V--------DVLS--------GKCEHVD----A-AHDTP--LSTLK-MM-PSG-P-IP-A
F2ARR3          V--------DVLN--------GKCEHID----A-AHDTP--LSTLK-MM-PSG-P-IP-A
K5D8H6          V--------DVLN--------GKCEHVD----A-AHDTP--LSTLK-MM-PSG-P-IP-A
M2AKU0          V--------DVLN--------GKCEHVD----A-AHDTP--LSTLK-MM-PSG-P-IP-A
A0A5B1CRW9      S--------DFLG--------GSMPFVD----V-ISASE--VPNLD-VM-PNG-S-PT-A
A0A5C6EI46      S--------DFLA--------GRVEFAD----G-VVETE--VQNLH-IM-PNG-S-NT-S
A0A5B1CKI2      T--------DVLN--------GDCEVSD----G-CHSTP--LNNLF-VM-PSG-P-VP-A
A0A5C6EG84      T--------HVLN--------CECEPLD----A-CHATP--LRNLF-VM-PSG-A-IP-A
A0A5C6F2X4      T--------DVLN--------CECDALD----A-CHVTP--LRNLF-VM-PSG-A-IP-A
A0A7W5DXF4      I--------DVLN--------GHCEHVE----A-MHETP--LATLK-MM-PSG-P-IP-A
A0A5C5XTV6      T--------DVLN--------GTCDHGD----A-IHDTP--LATLK-LM-PSG-P-IP-A
A0A5C6AAB1      I--------DVLS--------GKCDHIE----A-IHDTP--LAPLK-LM-PSG-P-IP-A
M5T8W8          I--------DVLN--------GHCEHIE----A-IHQTP--LATLK-IM-PSG-P-IP-A
M5SF00          V--------DVLN--------GKCEHVD----A-AHDTP--LSTLK-MM-PSG-P-IP-A
A0A2G1WDS1      V--------DVLN--------GKCEHVD----A-AHDTP--LSTLK-MM-PSG-P-IP-A
Q7UVS9          V--------DVLN--------GKCEHVD----A-AHDTP--LSTLK-MM-PSG-P-IP-A
A0A5C6B601      T--------NVLN--------GEMSPGA----A-VHETP--IENLD-IM-ACG-P-LP-A
A0A517PFU1      A--------EVIA--------DPDKLDE----A-LVESG--QPGLW-LL-PCA-A-RP-D
A0A5B9M8J9      A--------NVLN--------GELPAGR----A-VHQTP--IENLD-IL-PCG-P-LP-A
A0A2A2WFP6      A--------NVLN--------GELSAAQ----A-VHQTP--IENLD-IL-PCG-P-LP-A
A0A518L8N2      A--------NVLN--------GELSAAQ----A-VHQTP--IENLD-IL-PCG-P-LP-A
A0A518HQN9      T--------NVLN--------GELGPAE----A-VHQSP--IENLD-IL-PCG-P-LP-A
A0A5M6D8H8      T--------NVLN--------GEMDVTE----A-IHTTP--IENLD-IL-PCG-P-LP-A
A0A1G2ZG92      T--------NILS--------GGFSLDE----T-IVHTD--VSGLD-LL-TSG-P-IP-P
A0A2E7D3V4      C--------DVLL--------GDIELPN----A-VKESG--IEGLQ-IL-TAG-T-PV-G
A0A5B9PER9      A--------TVLG--------GQSHWKDC---V-FEVAE--IEGMS-IM-PCG-S-KP-S
A0A517QSM4      C--------EILR--------GDKPLEG----A-AQPTP--TPGLS-VI-PAG-R-VD-S
A0A355GJI7      G--------DVLT--------GEIDAQT----A-IRETR--VSHLS-IL-TAG-M-LP-E
A0A1Z8MCI4      V--------DVLM--------QRSELDD-------AIVA--VGKLD-FL-PAG-R-LS-A
A0A517SYL7      V--------DVLM--------QRSELDD-------AIVA--VGKLD-FL-PAG-R-LS-A
A0A3L7P0L2      T--------DVLL--------SEVDWFN----A-VRTTR--LENLS-VL-TAG-L-CP-P
A0A6M5YVJ1      C--------EVLR--------GEIGAVA----A-VRPTD--VPGLS-VL-TAG-E-WT-L
A0A832M9Q8      T--------ELLQ--------GKQPEL-----I-QPMEL--LPNLR-LMGAGG-R-FD-R
A0A7W0MCI8      C--------EVIR--------GESTIDE----V-IVSGN--IEGLS-IL-PAG-E-FD-E
A0A517SCC8      S--------DVLL--------SEIEWVN----V-IKTTP--FATLS-VM-TAG-L-SP-E
A0A358MY60      A--------GVMA--------GDANLAD----A-VDDTL--GELVH-VL-PAG-R-MT-L
A0A517MNB1      T--------RVLS--------EDVKLED----A-VDKSL--GDLVH-VL-PAG-L-MH-Q
A0A3A0DR44      A--------GVLR--------KECEITD----A-IVEEV--AEGVH-LL-PAG-R-VA-T
A0A142YJ13      C--------EVLS--------GEIGWEG----V-VRETE--VRDLS-LI-LAG-R-CN-P
A0A517Z7D3      V--------DVLS--------GDVDAET----A-MQETA--VEGLR-VL-VAG-A-PP-A
A0A7X7KCE7      V--------KVLD--------GGCELED----A-INTGW--SDLVH-VL-PAG-R-LE-V
A0A1N6KY57      S--------EVLR--------DEIELID----A-VQPTL--ISGLS-LL-TAG-F-SD-S
L0DK20          S--------EVLR--------NEVNIAD----A-IQPTA--ASGLS-LL-TAG-L-SD-N
A0A517XRC2      S--------EVLC--------QEVDPSD----A-VQPTA--VPNLW-VI-PAG-Q-CS-T
A0A6M5YH47      S--------EVLR--------QEVDVSD----A-VQATA--VPNLW-VI-TAG-Q-CS-N
A0A660UUK3      Q--------DMLF--------GKSLAE-----S-VYELS--PTGLH-ILAADR-R-NC-S
A0A517ZHG5      S--------EVLL--------GTASLEE----A-IKSPS--DDGPD-VL-PAG-Q-FN-S
A0A1Z8MPL5      A--------EVLR--------GDVAIEN----A-IRPSR--MPGLR-FL-SAG-H-CD-P
A0A7C1EH96      Q--------DYLF--------G-IDLQK----T-LYPVE--GMPLF-VLASDD-R-NI-Q
A0A5C1AGE3      S--------EILL--------SELDVSD----A-VQPTT--VPNLW-VI-PAG-Q-CS-N
A0A2Z3HEL7      S--------EVLR--------EEVDVSD----A-VQATA--VPNLW-VI-PAG-Q-CS-N
A0A142XAP8      S--------EVLR--------QEVDVSD----A-VQATA--VPNLW-VI-PAG-H-CS-N
A0A6P2DEK1      S--------EVLR--------QEVDVSD----A-VQATA--VPNLW-VI-PAG-H-CS-N
A0A5C6C1R5      S--------DAVG--------GNVDWKD----A-VHATS--PNAFF-M--TAG-S-SR-P
A0A1G2YRE4      K--------DVLL--------G-TEFEQ----A-VSSIR--STGLN-VLAMHS-C-HR-V
A6BZU4          G--------DVLN--------GEIDAQT----A-IRETR--VTHLS-IL-TAG-M-LP-E
A0A2D5GZ77      G--------DVLN--------GEIDAQT----A-IRETR--VTHLS-IL-TAG-M-LP-E
A0A3D3R1Z6      G--------DVLN--------GEIDAQT----A-IRETR--VTHLS-IL-TAG-M-LP-E
A0A517XG00      G--------DVLN--------GEIDAQT----A-IRETR--VTHLS-IL-TAG-M-LP-E
A0A353Z859      C--------EVLS--------GAAKPAD----V-IQEST--QPNLF-VI-PAG-I-LA-S
A0A2D6ST10      C--------ELLR--------GESSLDD----C-TREVA--PEGLS-VI-PAG-K-ID-H
A0A177QX42      S--------SVIR--------DGMDLPD----A-VQTTL--VPNLD-VM-TVG-P-RV-D
A0A517SHR0      A--------SVVR--------DGMDVPD----A-IQSTL--VPNLD-VM-TVG-P-RV-E
A0A2E0AW64      A--------DLLE--------DHNSLG-----G-YVTKW--DEHCH-VL-PAG-Q-LT-S
A0A351FZ59      A--------DLLE--------DHNSLG-----G-YVTKW--DEHCH-VL-PAG-Q-LT-S
A0A660V239      Q--------DLLF--------GKEFAK-----L-VYNTG--AVGMD-VLAADR-R-NV-S
A0A177Q3B7      S--------ELLR--------NENSLEE----V-LQATP--LDHLT-LM-AAG-R-WN-Y
A0A2E0X6Y6      A--------ELLL--------ADGEIADNAPRF-VQKTV--VERLD-VI-PTG-L-RR-Q
A0A518GFD7      S--------ELLH--------GSTKLTH----A-IQETT--TRNLH-VI-TAG-G-EL-C
A0A518GE37      C--------KLLG--------GQSKLSD----C-IDKSL--GDLVH-VI-PAG-R-LH-A
A0A5C6F3H8      A--------GVLS--------GKTTLIE----A-VDTSL--GALIH-VL-PAG-R-LT-A
A0A5C5X072      T--------GVLS--------DKSTLDD----A-VDKSL--GSLIH-VL-PAG-P-LS-A
A0A5C5WUQ3      A--------GVLS--------GEVEFEQ----A-IDSTL--GHLIH-VM-PAG-P-LK-A
A0A5C6E697      C--------SVLD--------GTTSLSD----A-VDTSL--GERFH-LL-PAG-L-LK-T
A0A5C5Z1A3      S--------GVLS--------GQTTLTE----A-IDTSL--GDLIH-VL-PAG-K-LT-T
A0A5C6D2P7      S--------AVLS--------GKAKLSD----A-TDKSL--GDLVH-LL-PAG-P-LS-S
A0A5B9ML17      S--------GVLT--------NQATLDE----A-IQTEL--GDLIH-IL-PAG-R-LK-A
A0A5C5VZJ8      L--------DDLS--------APSPTV-----T-VHSTD--TPNLS-LV-PVG-R-IA-K
A0A517LX75      A--------EYLR--------GDGDLES----A-TVQTE--VAGLD-FI-SHG-H-HP-S
A0A7X7YXL7      Q--------NVLL--------GEDPSG-----V-VCVLP--SSGLH-VLAANP-R-HT-G
A0A7W1FH76      E--------TLLA--------ADSGEVP----A-IVFTA--HKGLS-FM-GVG-K-RP-T
A0A7C5W7B3      I--------HMLE--------NPDILPEN---I-LSATE--ITELV-VV-GAG-G-VA-H
A0A7V2IPP1      E--------EVLR--------GGDPAS-----A-VHGVA--SNGLD-VLVPAD-H-NS-D
A0A142XL75      C--------EILR--------GSTSVLE----A-VRPTG--IPGLS-AL-TAG-Q-WT-L
A0A6P2D5D5      C--------EILR--------GSASIAE----A-VRPTG--IPGLS-AL-TAG-Q-WT-L
A0A7C7T8W8      T--------DVFD--------GTATLDE------TIVQW--DDFVS-VL-PAG-E-LT-R
A0A5C6B3S0      S--------EWLS--------GRADVIS----V-IQPTG--IENLS-LV-AAG-R-RN-E
A0A354GX32      S--------ELLR--------GEVEPGQ----V-VQNTP--LENLS-LL-AAG-A-CD-H
A0A518GIZ9      V--------DVLQ--------GEIALEN----A-IVETV--VEGLT-IL-PSG-R-PP-H
A0A1C3EBY9      V--------DVLQ--------GEIALEN----A-IVETV--VEGLT-IL-PSG-R-PP-H
D5SX64          V--------DVLQ--------GEIALEN----A-IVETV--VEGLT-IL-PSG-R-PP-H
A0A517Z0U7      C--------DVLR--------QEVPLEE----A-IKQGS--PDGLS-IL-PAG-K-VD-Q
A0A2S8FCC0      T--------ELLS--------GEVEFDD----A-IQQTG--IGTLD-IV-AAG-D-WG-H
A0A1Z8MBT6      S--------DVVE--------EKSTLDD----A-INREL--GDLIH-IL-PAG-R-LK-A
A0A517SXN9      S--------DVVG--------EKSTLDD----A-INREL--GDLIH-IL-PAG-R-LK-S
A0A7X7F3C7      S--------NLLG--------GNGKVGAAAAAV-IRPSG--IAGLD-VL-ASG-P-RF-A
A0A255QXF5      N--------EVLR--------EVVPFEQ----A-INKEL--GDLVH-VL-PAG-R-LK-A
A0A518KYQ0      N--------EVLR--------KAVPLKE----A-INREL--GDLVH-VL-PAG-H-LK-A
A0A5B9QX47      C--------GVLS--------EEATLKD----A-VDTSL--GDLIH-VL-PAG-H-LT-S
M5T666          T--------SVLS--------KESQLVD----A-VDSSL--GNLIH-LL-PAG-R-LN-A
M5U6N6          T--------SLLA--------KQTELKD----V-VDTSL--GNLIH-LL-PAG-R-LS-A
A0A517M0G2      S--------KVLS--------GDIELKD----A-VDTSL--GELVH-VL-PAG-K-MH-Q
A0A5C6AST1      A--------KVLS--------GEATFDE----A-VDRTL--GDLVH-VM-PAG-H-MN-M
A0A5C6C951      S--------KVLS--------GEVDFDN----A-IDRSL--GDLVH-VM-PAG-Q-LD-M
A0A5C6C5T3      T--------GVLA--------GKSTLDG----A-VNSSL--GRLIH-IL-PAG-Q-LS-A
A0A2A2W6A9      N--------EVLR--------KAAPLKE----A-INREL--GDLVH-VL-PAG-R-LK-A
A0A518HQS9      N--------EVLR--------KVVPMKE----A-INREL--GDLVH-VL-PAG-H-LK-A
A0A5M6DFE6      S--------GVLL--------NEVKFED----A-VRTEL--GDLIH-VL-PAG-R-LK-A
A0A5C6F286      A--------GVLA--------GKATLAE----A-VDTSL--GGLIH-VL-PAG-R-LT-A
A0A517NGN1      T--------GVLG--------GRVELKD----A-INRSL--GNLVH-VL-PAG-R-LD-A
M5RUI3          S--------GVLS--------QTATLEE----A-VDTSL--GSLLH-VL-PAG-R-LD-R
A0A5C1AAF0      A--------ELLR--------DEVLDRD------VIREV--RANLF-FI-PAG-A-CD-D
A0A3B8ZJM2      A--------QLVA--------GQCELDD----A-TYTTC--VANLS-IM-PGG-K-RP-N
A0A1U7CLW1      G--------DILR--------GEIGWTD----A-VRQTP--VPGLS-LI-FAG-R-CD-P
A0A5Q3LBQ3      S--------KVLD--------YQCDVQD----A-IVTDW--GEGVH-LL-PAG-R-LH-K
A0A142WPR7      S--------SVIA--------GTAELVD----A-IQDTP--VENLA-VL-GCG-P-RP-D
A0A517T4K9      S--------EVLL--------GDIDAED----A-ITSPN--ADAPF-IL-PAG-K-FD-R
A0A7C6B2Q1      S--------EVLR--------AEISLQD----A-IQATS--IENLY-VL-SAG-Y-WS-P
A0A2Z3GZZ5      A--------EVIA--------GVRPLAD----G-IVASG--APGLD-LL-PCG-P-RP-A
A0A4V0I6L6      A--------SVVA--------DRADLGD----A-IRACE--VENLS-LL-PCG-P-IP-A
A0A7C4QQT3      S--------DVLK--------GEIAPLN----A-IQQTA--IEHLA-LL-TAG-Q-VP-A
A0A7V9G5K3      S--------SALE--------GEKGV------R-MTPTS--YTNLD-FL-SAG-G-RP-R
A0A7W1JAD6      S--------TALE--------GEKGV------R-MVQTT--YQNLD-FL-GAG-A-RP-R
A0A518KBI5      C--------EVLG--------GKLSLNEA---I-QPVPA--TEHLF-VL-RAG-S-CA-G
A0A5C5V6Q5      Y--------EVLS--------SRCSISDA---I-RPAKG--TDNLY-VL-RAG-D-CD-D
A0A517P477      S--------DVLR--------GEKSAEE----V-EIPLH--GSELR-LI-PAG-D-VC-D
A0A518HFS8      C--------EVLR--------GEVALDD----A-VHATA--ASPLE-VL-PAG-C-CD-A
A0A7Y5LUV4      D--------EVLA--------GTADIRA----A-ARPSV--VPGVD-IV-GVR-S-GT-S
A0A3M1TFJ0      R--------NALE--------EGEGLE-----F-LQSTD--VENLY-LL-PAG-Q-GE-E
A0A7Y5HGA4      T--------NVLV--------GEASLEE----C-IQRST--VHGLD-VL-ASG-P-VP-P
A0A517MY49      A--------DLLL--------SDEPIAEQVGNY-LHHTE--VPGLD-VV-PAG-I-RR-T
A0A2E6AG00      S--------DLLR--------SDVDVRDRAASL-ICKTS--CECLH-VL-PSG-S-RP-L
A0A1G3A880      S--------DVLR--------GDGEVARLAAQC-VCRSA--VAGLD-VL-GSG-P-RR-P
A0A2E8ATT1      S--------DVLR--------GEGAVGEICERL-VQSAD--VPHLD-IL-PCG-P-RP-A
A0A524HC32      S--------SFLA-----------AMTD----Q-VYSYNKFHKNLK-VI-LSG-P-VS-P
A0A660VT66      S--------TVLA--------GKASLDE----A-IRPTA--VPLLD-II-PSG-F-VP-P
A0A7C2ZTD2      Q--------DMLF--------GK-EFDR----A-VCSIP--SIGLD-VL-AAD-SRNA-D
A0A0S8H0S8      T--------GLLA--------GTAGLQD----A-IRFSG--VERLD-VL-PCG-A-AP-D
A0A7C2VEF7      S--------GVLA--------GTIALQD----A-IQAGP--IEELD-IL-SCG-P-EV-P
A0A7V7D6N0      S--------SLLA--------GNITLDE----A-VQPGP--VQGLD-LM-LCG-P-EV-P
M5S2L2          S--------NVLN--------GDCDPS----EA-CQQTP--LSTLQ-VM-PSG-P-IP-A
A0A7V1EK28      A--------EAVS--------GQATDS----EA-IVSTD--DPRLD-VL-PGR-K-SS-D
A0A2Z3GYP4      A--------EVLT--------GTAELA----DA-IQMTA--IPNLS-VL-PCG-R-RP-S
A0A7C2VXA0      A--------DVLT--------QEISLK----EA-IEHGP--VPGLD-IL-HCG-M-EL-P
A0A7C3AA48      S--------NIMA--------GTHTID----QS-VRPSG--VPGLD-IL-PCG-P-DV-P
A0A3L7SU85      A--------SVVN--------GDATLQ----EA-IHTCE--VPGLH-LI-PCG-P-RP-A
A0A2D6A9B6      A--------DLLQ--------GSTSLD----EA-IRPSG--IPGLD-II-GAG-S-RP-K
A0A2G6JGH3      T--------ELLM--------GRLALH----QA-IRNSG--VESFD-LI-GPG-G-MP-T
A0A7C5PFV3      T--------DLML--------GRIPLR----SA-IRNAG--KPGLD-FI-GAG-L-QK-V
A0A7C3QGD2      S--------SYLI--------GATDEID---TV-IFPTE--VENLS-LL-PSG-P-LL-Q
A0A3M1RAJ8      S--------EYLR--------GEAALE----EI-VRETD--RDNLW-LI-PAG-R-CD-T
A0A7Z9UC46      M--------DLLE--------NGGDPA----KC-VYETP--VERLF-VM-PAG-H-SK-Q
A0A3D4PLL5      S--------TILR--------DTASIEESALKH-ITKTR--LENLD-VI-SAG-P-RP-S
M5RD30          T--------NVLF--------DSTQFD----KC-IQSTP--IETLS-VM-AHG-S-RT-S
A0A1V6CUG1      A--------ELLQ--------GKATLRDV-----VVPTV--YPNLF-FL-PPG-N-AA-G
A0A3M1SE88      S--------RALQ--------SNEDIEEAAVKT-IRSTG--IENLD-LL-PAG-P-RA-L
A0A7C2ZUK5      V--------DYLR--------GEEDFARL-----VHGTG--LPDLS-IM-PAG-L-PP-D
A0A660WB30      A--------EYLE--------YDLDLSQL-----LVKTD--FDKLT-ML-QAG-K-VP-A
A0A660W9Z7      E--------DVLT--------GKCELADA-----LVYSE--QDNLA-VL-PTR-H-GQ-H
A0A7X8YY48      A--------EVLD--------GTSRVSEA-----IQSSA--YPNLS-IL-TAG-Y-TR-G
A0A3M1R9K7      S--------EILR--------GEAKWQQV-----CRDSG--IENLD-II-PAG-Q-WS-Y
A0A3L7PH51      E--------NVFH------------------------LG--VEGLD-FM-PSG-P-RP-A
A0A3N5UQY5      C--------SVLE--------GKVKLSQA-----IQPTQ--VPGLS-LL-TCG-Y-GI-G
                                                                            

A0A523CME0      NVC-ELLA-SDKMGSFAS-RMRE--LFD--YVIIDTPPVLAFPDT-AILA--PLSDGIVF
A0A7Y3UKB3      NVC-ELLA-SDKMGSFAS-RMRE--LFD--YVIIDTPPVLAFPDT-AILA--PLSDGIVF
A0A7C2JY73      NPA-ELLT-SSGFAQTLA-EARR--EFD--LVFVDGPPLLAVSDP-CIIG--QQTDGLLL
A0A836W298      NPA-ELLA-SDRFSELLA-WAET--VYD--QILVDAPPVLAVSDP-TIVG--RLVDGVLL
A0A354PCV3      SPH-RLMS-PQRLQAFMK-DALN--SYT--YVVVDTAPVLSAGET-LAIA--ATVESTLL
A0A354PHB4      SPH-RLMS-PQRLQAFMK-NALN--TYT--YVVVDTAPVLAAGET-LAIA--ATAESTLL
A0A356ESF4      NPA-ELLA-QPRLAELLA-WADK--VYD--QVLIDSPPVLAASDA-AVIG--RLVDGVVL
A0A538RV31      HTL-EALA-QEALASVLA-RVKE--QFD--FILIDSSPVLPVADA-LIIG--QHVDGVLF
A0A1G2XSU7      SIINRLIH-HKNMVEFIN-EISR--IFD--HVIIDTPPVLAAVDA-LLWA--SMVDGVIL
A0A350KD81      NPS-EMLM-SRGFSELVK-QLRN--EYD--YILIDTPPLVVVSDP-SVIA--SIVDGVLL
A0A356AE44      KPA-ELLS-SSKLHYLLG-QAKR--EYD--FVLVDSPPVLAVSDP-CITA--QSVDTVML
A0A7Z9UBD9      NPA-DLLA-SDAMKGLLA-KLRE--RFD--MVIVDSPPVLPVSDS-KALS--PQLDKVIF
A0A257WQ92      NPA-ELIS-TPRLTQFLK-SVRD--EFD--MVLIDSPPLLAVSDP-CAIA--RHADGLLL
A0A2E3Z6T8      NPA-ELLS-SKAFIELLA-WAES--KYD--RVIVDCPPVLAVSDA-QIVG--RLVDGAIL
A0A7Y2AF64      DPT-VLLE-MPRLEDLFA-WAES--QYD--QVLVDCPPIMAASDA-SLIG--RLTSGILI
A0A7C1U6X6      SVF-EGTA-NGAFKACID-QLRR--HYD--IVLLDSSPILPVADA-AILS--SQVDGTIM
A0A7C7UXI5      NPA-ELLA-TDRFHELLA-WAET--VYD--QVIIDSPPAM-VADA-AIIG--RLVDGLVL
A0A7C3SFJ0      SAI-QALV-NDELHEQFA-KLRE--GFD--FILIDSGPVLTDSDA-LLLG--RYVDGVLL
A0A7X7YIF4      DAL-NLLN-QPQTAEMIR-QIAA--GYD--RVIIDTPPVLAFADA-LVWA--KMADATIL
A0A7C7WWF7      DPA-ELLS-RSRFDELVA-WAEQ--NYD--QVLIDCPPVMAASDA-AIVG--RRTDGLLL
A0A7V3JIB0      RLL-VSLA-NGAVQGLFD-QLRQ--EFD--FVIVDASPILPVPDT-RFLA--KHVDGVVL
A0A356ETW1      NPA-ELLA-GPRFLELID-WAST--VYD--QILIDSPPTLATSDS-AVIG--RLVDGTIL
A0A3L7NJY1      NPA-ELLA-GDRFANLLA-WAET--RYE--QIIVDAPPVLAVSDP-AIVG--RLVDAVVL
A0A2D6SRY7      NPA-ELLA-SERTRTLIR-ELSD--NFD--LVLVDSPPALPLTDA-SVLS--TEVNGVFL
A0A1G3C300      NPS-ELLG-SHSMEKFCD-NVRN--RFD--IIIFDTPPTMTVTDA-VVLS--RNVDGVVF
A0A177PV03      NPA-ELLT-SPAFEQLLA-DLRK--EYD--FVLVDTPPLLAVSDP-SAVA--PRVDGVLL
A0A1G2YIM0      DAF-ELLT-RSQTPSRLK-AIAA--HYE--HVIIDTPPVLAVPDA-IIWA--KMADAVVL
A0A1G3A0W0      GAVIEETA-NGAFKACMS-QLRQ--WYD--FILLDSTPILPVADA-MILS--SQVDGTIM
A0A7V7D8F5      DAY-ELLA-LPGAAQRIN-TISQ--KYD--HVIIDTPPMLAFPDA-LVWA--KMADGVIL
A0A432MFP3      YPN-RILR-GKAFAPMLE-RLRR--SFD--VVIIDTSPVLPVPDA-LILG--RLADGAVI
A0A518HFL0      NPN-RILR-GKNFAPMLE-RLRR--SFD--VVIIDTSPVLPVPDA-LILG--RLADGAVI
A0A3L7UX05      DPS-RILE-SAKLGKIMA-HLRE--NFQ--VVIVDSAPVLPVPDA-LLFG--RWVQGIVI
A0A2E0SHG0      NPA-ELLN-QESFSRLLA-VVRE--QYD--FVVIDSPPLLVVSDA-TAVA--PRADVVIL
A0A2S8F9B8      SIP-RSAT-SGRLAELYR-ELRS--LYD--FVIVDAGPVLGAPST-RLLAQPQYADGVIL
A0A368KP63      SIS-RGAT-SGVLDAILG-DLRK--RYD--FVIVDAGPVLGSPST-RLLAQPQYVDGVIL
A0A518CQB8      NPA-ELLN-QESFTSLLA-VVRE--QYD--YVIIDSPPLLVVSDA-TAIA--PRVDSVIL
A0A7C4QPD3      NVR-GLLA-RGAQAQLLQ-SVQE--RYN--FVVIDSSPVLVAPEA-LMIA--RHVDGVIL
A0A7C2JZW2      KVR-GMLA-RDEHAPLFR-ELSQ--QYS--FVFVDSAPVLASADT-MSLA--KHVDGVVM
A0A836RF42      NPA-ELLA-SPRFGELLQ-ELRNDPEVD--CVIVDTPPLLAVSDA-VSVA--SHVDGVLL
A0A7D8YCU5      NPA-EALM-LPEFGQIID-ELRM--EYD--LIVIDSPPMLACTDAGTISS--TIADGVLF
A0A353BE27      NPA-EILS-SERFRNMID-MLRD--KFD--VIVVDTPPLLAVSDP-GAVA--GIVDGVLM
A0A5C6BPW1      QLL-AALA-QDGLGKIFE-ELKK--KYE--FVVVDSSPVLPVTDS-LMVA--QHVDAVIL
A0A1I3GSP0      NPA-ELLS-TGTLQVMLR-RARE--EYD--VVLLDSPPILAVSDP-CIIS--PHADGLLL
A0A517QJV1      NPA-EILS-QVNLPALLN-EMRS--EYD--FIILDSPPVLAVSDP-AILS--PHVDGISL
A0A3C1QS25      NPA-ELLT-SPKLPEFIE-IARQ--QYD--YVIIDSPPLLAVTDP-SVIA--PRVDAVVL
A0A5C6FX55      NPA-EALT-LPEMAETLE-QLRE--HYD--YVLVDTPPLLVVTDP-SILA--SMVDGVLL
A0A5C6DS51      VPA-ELLQ-SNRMGLLLQ-SARN--QYD--IVLVDAPPVLAVADP-AIVA--PLVDGVIL
A0A5C6DSL6      VPA-ELLQ-SNKMSLLIQ-AARK--EYD--IVLIDAPPVLAVADP-AIVA--PLVDGVIL
A0A3M1VG27      NPA-ELLS-SHAFRHLLQ-TLRV--EYD--LVVVDSAPVLAVTDP-CVVA--SLTDVVLF
A0A518GC22      NPA-EILS-SQRFKNMVD-VLRD--KFD--MIVIDTPPLLAVSDP-GAVA--GIVDGVLM
A0A3L7Q373      NPA-ELLS-SLRLGETLR-AIRG--DYD--IVIIDTPPILAVSDP-AIIA--PLVDGLLL
A0A3E0PW54      NPA-ELLT-ASDLDGLLR-AARE--EYD--VVIVDTPPVLAVSDP-SIVA--PHADGVVL
A0A7C3TAH2      DPY-EVIS-STDLAHKVD-LFGK--QYD--HIIIDTPPVLAFPDA-LIWT--RMAGAVVI
A0A1Z8MHR4      NPA-EALA-LAEVAEVFR-WARE--NYD--YVIVDTPPLLMVSDP-AVVT--TYVDSTIL
A0A5C6EHJ0      NPS-ELLS-SPNFDRLLS-VLRT--KFD--MIIVDTPPLLAVSDP-ANLA--SRVDGVLL
A0A5C6F1H9      NPS-ELLS-SPNFDRLLN-LLRK--QYD--MIIVDTPPLLAVSDP-ANLA--SRVDGVIL
A0A255QXY0      NPA-EALT-MPDLVEIIA-WARD--RYD--CIIVDTPPLLMVSDP-SIVA--SYVDAAIM
A0A517SYI0      NPA-EALA-LAEVAEVFR-WARE--NYD--YVIVDTPPLLMVSDP-AVVT--TYVDSTIL
A0A518HX54      NPA-EALT-LAELADVFQ-WARA--NYD--FIIVDTPPLLMVSDP-TIVT--TYVDAAIL
A0A5B9MF59      NPA-EALT-LAELAEVFQ-WARE--HYD--FVIVDTPPLLMVSDP-AVVT--TYVDASML
A0A2A2WC24      NPA-EALT-LAELAEVFQ-WARE--NYD--FVIVDTPPLLMVSDP-AVVT--TYVDAAML
A0A518KYW8      NPA-EALT-LAELAEVFQ-WARE--NYD--FVIVDTPPLLMVSDP-AVVT--TYVDAAML
A0A5C5YZZ0      NPA-EALM-LPEFGQILD-EARM--QFD--LIIVDTPPLLSVTDA-SNVA--THMDGVMV
A0A518JLD2      NPS-ELVT-SEAFEQILS-ALRV--KFD--LIIIDTPPMLAVSDP-SNVV--RRADGVIL
A0A5M6DJ15      VNL-AAAA-QESIPRLFD-ELRI--HFD--FVIVDTPPILPVVDT-RVIG--EHVDGCVL
A0A3L7P7S7      NPS-ELLT-SPKFVEVID-ELRK--MYD--IVLIDTPPILAVSDP-SIVA--PRVDGVLL
A0A517N8M1      NPA-EALT-LPDMQNMIE-MLRE--KFD--YVMLDTPPLLVVTDP-SITA--SLVDGVIV
A0A5C6CW01      NPA-EALT-LPEMGELIE-LLRE--DYD--YVILDTPPLLVVTDP-SITA--GMADGVIM
A0A5C6BXS9      NPA-EALS-LPEMSELLD-LLRY--EFD--YIVLDTPPLLVVTDP-SILA--SMVDGVVL
M5U569          NPA-EALT-LSEMGELLE-LLRD--EFD--YIIVDTPPLLVVTDP-SILA--SMVDVVVM
L7CND7          NPA-EALT-LPEMSELLD-VLRE--EYD--YIILDTPPLLVVTDP-SITA--SMTDGVVM
A0A0J1B8S4      NPA-EALT-LPEMSELLD-VLRE--EYD--YIILDTPPLLVVTDP-SITA--SMTDGVVM
F2ARR3          NPA-EALT-LPEMSELLD-VLRE--EYD--YIILDTPPLLVVTDP-SITA--SMTDGVVM
K5D8H6          NPA-EALT-LPEMSELLD-VLRE--EYD--YIILDTPPLLVVTDP-SITA--SMTDGVVM
M2AKU0          NPA-EALT-LPEMSELLD-VLRE--EYD--YIILDTPPLLVVTDP-SITA--SMTDGVVM
A0A5B1CRW9      EPA-ELLE-SHQLMRLFQ-HACD--SYD--LVLVDAPPVLAVADP-AIIA--PFVDSVLL
A0A5C6EI46      EPA-ELLE-SHRLMRLFQ-NACE--SYD--LVMIDAPPVLAVADP-AIIA--PYVDSVLL
A0A5B1CKI2      NPA-EALT-LPEMGSMLE-VLKQ--KFD--YIIVDTPPLLVVTDP-SIIA--SLVDGVVM
A0A5C6EG84      NPA-EALT-LPEMGNMME-MLRE--KFD--YILLDTPPLLVVTDP-SITA--SLVDGVVV
A0A5C6F2X4      NPA-EALT-LPEMSNMME-MLRE--KYD--YILLDTPPLLVVTDP-SITA--SMVDGVVV
A0A7W5DXF4      NPA-EALT-LTEMSELLE-LLRD--EFD--YIIVDTPPLLVVTDP-SILA--SMVDAVVM
A0A5C5XTV6      NPA-EALS-LPEMSELLD-MLRE--EFD--YIVLDTPPLLVVTDP-SILA--SMVDGVVV
A0A5C6AAB1      NPA-EALS-LPEMSELLE-LLRE--EYD--YIVLDTPPLLVVTDP-SILA--SMVDGVVM
M5T8W8          NPA-EALT-LTEMGELLE-LLRD--EFD--YIIVDTPPLLVVTDP-SIMA--SLVDAVVM
M5SF00          NPA-EALT-LPEMSELLD-VLRE--EYD--YIILDTPPLLVVTDP-SITA--SMTDGVVM
A0A2G1WDS1      NPA-EALT-LPEMSELLD-VLRE--EYD--YIILDTPPLLVVTDP-SITA--SMTDGVVM
Q7UVS9          NPA-EALT-LPEMSELLD-VLRE--EYD--YIILDTPPLLVVTDP-SITA--SMTDGVVM
A0A5C6B601      NPA-EALT-IAELSDVFD-WARA--NYD--FVIVDTPPLLMVSDP-AVVT--TYVDAAML
A0A517PFU1      HPA-ELLS-SEAYETFLD-VLRQ--KFD--FILLDSPPVLAVSDP-AATA--RLADGVVV
A0A5B9M8J9      NPA-EALT-LAELADVFQ-WARE--NYD--FIIVDTPPLLMVSDP-AIVT--TYVDAALL
A0A2A2WFP6      NPA-EALT-LAELADVFQ-WARA--NYD--FIIVDTPPLLMVSDP-TVVT--TYVDAAIL
A0A518L8N2      NPA-EALT-LAELADVFQ-WARA--NYD--FIIVDTPPLLMVSDP-TIVT--TYVDAAIL
A0A518HQN9      NPA-EALT-LAELAEVFQ-WARD--NYD--FVIVDTPPLLMVSDP-AVVT--TYVDAAML
A0A5M6D8H8      NPA-EALT-LAELGEVLA-WARK--HYD--FVIVDTPPLLMVSDP-AVVT--SYVDAAML
A0A1G2ZG92      DPS-SLIE-SQKLRDIVN-KLKE--MYD--MVIIDTPPVMAVNDA-TVVG--RIADGILL
A0A2E7D3V4      SPA-ELLS-SARMASTIE-AAKA--EYD--FVLVDTPPLLAVSDP-CIVA--PYTDGLLM
A0A5B9PER9      NPA-ELCS-SPQVKDLID-EMRT--EYD--FVIIDTPPLLAVTDA-CPIA--ARVDGVVL
A0A517QSM4      AAL-QALA-EGGAGQIFK-HLTE--DYD--YVIVDSAPILPVADT-LLLA--QDVDGVIL
A0A355GJI7      NPS-EMLM-SRAFSELVN-QLRK--EYD--YVLIDTPPLVVVSDP-SVIA--SIVDGVLL
A0A1Z8MCI4      PPF-GIFS-EGNVSGFID-SLRE--HYD--LILVDTSPLNLTPET-MLVA--ESFDHAIV
A0A517SYL7      PPF-GIFS-EGNVSGFID-SLRE--HYD--LILVDTSPLNLTPET-MLVA--ESFDHAIV
A0A3L7P0L2      NPA-ELLS-SSRLPDMLN-AAKK--SYD--VIIIDTPPILAVSDP-AIVS--PHIDGLIM
A0A6M5YVJ1      VTR-QALV-GNGWRAVKE-QLRA--AFD--FVVVDTSPLLLVSDA-LLLA--READGVVV
A0A832M9Q8      NPV-ELFQ-RKHIRECLD-QLKD--RFD--CIVIDTPPTLVVADA-RLMA--GSCDEILC
A0A7W0MCI8      EVL-ERVA-LNGFGPALT-ELRE--QWD--FVIIDSSPVLPICDG-LLFA--THVDGVIF
A0A517SCC8      NPA-ELLS-GSGFGALMR-QVRD--EYD--IVLIDSPPVLAVTDP-CVIA--PQTDAMVL
A0A358MY60      SPH-RLLS-SEGMRTLLD-EALQ--NYK--YVIVDTAPVLSAGET-LAVA--AQTDATLV
A0A517MNB1      SPH-RLLN-SSAIRDLLD-QALA--KYR--YVVIDTAPVLAAGET-LAIA--AETDATLV
A0A3A0DR44      SPH-NYLG-NGAIPKLVA-QLRE--VYD--FVVIDTPPILCASES-LVIA--KAADGTLL
A0A142YJ13      EAI-ELLP-RQPLPDLII-ALRE--QYE--FIIVDSSPVLLVTDT-LIIS--QHIDAVLF
A0A517Z7D3      NPA-EALS-SARLGRTLH-ELRG--ECD--YIIVDTPPILAVSDP-CIIS--PHCDGMLL
A0A7X7KCE7      NPH-TLLG-NGTWTSLLS-RIPE--KYR--YVIIDTPPVLSASEA-LVLT--KEADATLV
A0A1N6KY57      DSI-QTLA-SRDLRAMFD-QLKE--QFD--FLVIDSSPVLPVADA-LLIG--QHVDAVIF
L0DK20          ETI-QALA-CRDLRVMFD-QLKE--HYD--FIVVDSSPVLPVADA-LLIG--QHVDAVLF
A0A517XRC2      RVI-AALAQGHPLETLFN-RLRG--QFD--FVVVDSCPVLPVADA-LLIG--QHVDGVVF
A0A6M5YH47      ATI-AALAQGHPMETLFN-RLRG--QFD--FIIVDSCPVLPVADA-LLIA--QHVDGVVF
A0A660UUK3      DAL-DLLR-QTHTVDCMK-NIRN--EYD--HVIIDTPPVLASADP-LVWA--KMADAVIM
A0A517ZHG5      QLL-AALA-QDGLGKIFE-ELKK--KYE--FVVVDSSPVLPVTDS-LMVA--QHVDAVIL
A0A1Z8MPL5      TSL-QALT-KKNLSEIFE-KLVD--EFE--YIVVDSAPVLSVVDS-LLIG--QQCDAAIL
A0A7C1EH96      DAF-ELLS-LPDTAARMR-KLRD--EFD--YIIIDTPPALAFADA-MVWA--KMADGVIM
A0A5C1AGE3      RVI-SALAQGHQLESLFN-RLRG--QFD--FIVVDSCPVLPVADT-LLIG--QHVDGVLI
A0A2Z3HEL7      ATI-AALAQGHPLETLFN-RLRG--QFD--FVIVDSCPVLPVADA-LLIA--QHVDGVVF
A0A142XAP8      ATI-AALAQGNPLKTLFN-RLRG--QFD--FVIVDSCPVLPVADA-LLIA--QHVDGVVF
A0A6P2DEK1      ATI-AALAQGNPLKTLFN-RLRG--QFD--FVIVDSCPVLPVADA-LLIA--QHVDGVVF
A0A5C6C1R5      VNL-SAVG-AKTLPQLFS-ELRA--EYD--FVIVDTPPVLPVVDT-RVIG--EHVDAAVL
A0A1G2YRE4      DAY-ELVA-SPETANIIN-KLSP--KYD--YIIIDSPPVLLFPDA-LMWA--KIAGSVML
A6BZU4          NPS-EMLM-SRGFSELVK-QLRN--EYD--YILIDTPPLVVVSDP-SVIA--SIVDGVLL
A0A2D5GZ77      NPS-EMLM-SRGFSELVK-QLRN--EYD--YILIDTPPLVVVSDP-SVIA--SIVDGVLL
A0A3D3R1Z6      NPS-EMLM-SRGFSELVK-QLRN--EYD--YILIDTPPLVVVSDP-SVIA--SIVDGVLL
A0A517XG00      NPS-EMLM-SRGFSELVK-QLRN--EYD--YILIDTPPLVVVSDP-SVIA--SIVDGVLL
A0A353Z859      ESL-RNLA-QDGLGALME-HLRA--EFD--FVIVDSSPLLQVTDP-LLAA--QSVDGVIV
A0A2D6ST10      TVL-RLLA-EDAVGELFE-NVKK--QYD--FVIIDSAPVLFVTDS-LLIA--QHVDGVLF
A0A177QX42      NPA-ELLL-SPQFTELVQ-QLRE--KYD--FVLIDTPPILIVTDP-AAVA--AHVDGVIL
A0A517SHR0      NPA-ELLL-SPEFTVLVQ-QLRE--KYD--FVLMDTPPILIVTDP-AAVA--AHVDGVIL
A0A2E0AW64      SPH-RLLA-NGAFSGMLK-EARA--TYK--HIVIDTPPILAAGES-MVMA--KAADATIL
A0A351FZ59      SPH-RLLA-NGAFSGMLK-EARA--TYK--HIVIDTPPILAAGES-MVMA--KAADATIL
A0A660V239      DAL-DLLG-KPRTGECIE-QVSA--DYD--HVIIDTPPVLAFSDA-LLWA--RMADGVIL
A0A177Q3B7      QTS-QFLA-RERMPDILA-ALRQ--QYE--YIVIDSAPVLPLVDS-LLLA--QHVDGVVL
A0A2E0X6Y6      NPA-ELLG-SVRFAELLA-WAEA--NYD--QVLVDCPPVLAVSDA-QVVG--RLVDGAVI
A0A518GFD7      SVT-ECES-DGSLAALLN-KLRS--HYD--LVIIDTPPVLPVIDA-RVIG--KYTDGVIF
A0A518GE37      NPH-NLLT-KSKMEKLFA-DLES--EYR--YIVVDTAPVLPASET-LAAT--SACDATLL
A0A5C6F3H8      SPH-RLMS-PSGMKDFVD-HALS--HYS--YVVMDTAPVLSAGET-LAVA--SAVDASLI
A0A5C5X072      SPH-RLIS-PKKFETFVK-EALE--VYQ--YVVIDTAPVLAAGES-LAIA--SAVDSTLI
A0A5C5WUQ3      NPH-RLIN-QASMKKFLD-QALE--SYS--FVVFDTAPVLAAGET-LAVV--SVVESTLV
A0A5C6E697      SPH-RTIG-PEAFNRFMN-EACK--RYR--YVVIDTAPVLSAAET-LTVG--AAADATLL
A0A5C5Z1A3      SPH-RMLN-PKAMKAFIS-DAME--KYT--YVVVDTSPVLSAGET-LAIA--SAVESTLM
A0A5C6D2P7      SPH-RLIN-PDTMRAFIS-QALK--QYK--FVVVDTAPVLSAGES-LAVA--ASVDSTLL
A0A5B9ML17      SPH-RLMS-PESMKSLVS-DILD--RYE--YVIFDTAPVLSAGET-LSVA--ASVDTTLV
A0A5C5VZJ8      PED-AELFANGAFGRLLE-AWKK--AYD--VVLVDSAPLLMASES-VMLA--QRVDGTIM
A0A517LX75      DPA-ELLE-SFGMERLIA-EARQ--EYD--YVFIDTPPLLAVADP-LIIA--AQVDSALL
A0A7X7YXL7      DAY-ELLT-SSMAAEQME-RLGR--EYD--HLIVDSPPTLAFPDA-LVWA--KLTDAVIL
A0A7W1FH76      NPA-ELLH-SRILPEVLA-AWRQ--VYH--YIVIDTPPLGPVLDA-LVVG--NLSDVALV
A0A7C5W7B3      NPP-RLLR-SEAFANLLK-MLQE--QFD--VVILDTPPVIAVVDA-GVIA--EQVRGVLV
A0A7V2IPP1      GLF-ELLA-SREARERIT-RLGE--QYD--HVVIDTPPLLAFSDA-LLWA--RITGTAVL
A0A142XL75      ATR-HALV-GDRWRETKD-QLKA--EFD--FVVVDTSPLLLVSDT-LLLA--READGVVV
A0A6P2D5D5      ATR-HAIV-GDRWRVTKD-ELKS--NFD--FVIVDTSPLLLVSDT-LLLA--READGVVV
A0A7C7T8W8      NPN-ALLT-YESLTALLE-KVRD--DYS--YILIDCPPLLAATEA-YVIA--RASDGVLL
A0A5C6B3S0      STL-GQLA-GDEIENVFQ-TLRA--GFD--FIVVDGSPVLPVVDA-RLIG--QHVDSVVL
A0A354GX32      QAL-QALAQEGILRNVFD-ELKE--QYD--FLIVDVSPILPVADA-LLIG--EHADAVLL
A0A518GIZ9      NPA-ELLE-GGPLRQLIA-KART--FAD--IVLIDAPPVLAVSDA-CIIG--QHVDGYLL
A0A1C3EBY9      NPA-ELLE-GGPLRQLMA-KART--LAD--IVLIDAPPVLAVSDA-CIIG--QHVDGYLL
D5SX64          NPA-ELLE-GGPLRQLIA-KART--LAD--IVLIDAPPVLAVSDA-CIIG--QHVDGYLL
A0A517Z0U7      TVL-RLLA-QDELGNLFK-ELAA--EYD--FIIIDSAPVLPVTDS-LLIA--QHVDAVMF
A0A2S8FCC0      NSL-RELT-SDRMDSFFK-SLRS--QYD--YVIVDGSPILPVVDA-RLIG--QYVDGVVM
A0A1Z8MBT6      SPH-RILT-TEAVQGLIA-RCME--EYE--YVIFDSAPILAAGET-LAIA--AVVDSTLM
A0A517SXN9      SPH-RILT-TEAVQDLIA-QCME--EYE--YVIFDSAPILAAGET-LAIA--AVVDSTLM
A0A7X7F3C7      NPA-ELLA-QPRLAELLA-WADA--VYD--QVLIDSPPVLAASDA-AVLG--RLVDGVVL
A0A255QXF5      SPH-RLLS-TSSMRDLLD-QALE--KYE--YVIVDTAPVLSAGES-LAVA--SAVDSTLV
A0A518KYQ0      SPH-RLIS-PDSMKELMD-EALE--SYQ--YVILDTAPVLSAGET-LAVA--SVVDSTLV
A0A5B9QX47      SPH-RLIN-PSAMRDFVD-RALA--DYR--FVVVDTAPVLAAGET-LAVA--SAVDSTLL
M5T666          SPH-RLIS-PANVTAFVD-AALE--SYE--YVVFDTAPVLAAGET-LAIA--SAVDSTLI
M5U6N6          SPH-RLIN-PANIDNFVS-SALE--QYQ--YVVFDTAPVLAAGET-LAIT--AVVDSTLI
A0A517M0G2      SPH-RLVS-ASSIRDLLD-QALE--KYS--FVIFDTAPVLAAGET-LAIA--SETDATLV
A0A5C6AST1      SPH-RLLN-ASALRELLD-DALA--QYS--YVVVDTAPVLAAGET-LAVA--AETDATLV
A0A5C6C951      SPH-RLLN-ASALRDLLD-RALE--HYS--YVVIDTAPVLAAGET-LAIA--AETDATLV
A0A5C6C5T3      SPH-RLVS-PTSIKSFVD-DALL--TYR--YVVIDTAPVLAAGES-LAIA--SAVDATLI
A0A2A2W6A9      SPH-RLIS-PDSMKELMD-EALE--SYQ--YVILDTAPVLSAGET-LAVA--STVDSTLV
A0A518HQS9      SPH-RLVS-PDSMKELMD-EALD--SYQ--YVILDTAPVLSAGET-LAIA--SVVDSTLV
A0A5M6DFE6      SPH-RLMS-PAKMRELID-QALK--RYD--FVIVDTAPVLSASET-LAVA--ASVDTTLV
A0A5C6F286      SPH-RLVS-PSGIRDFID-DALS--QYS--YVVMDTAPVLSAGET-LAVA--SAVDATLI
A0A517NGN1      SPH-RLIT-QSGIETLIE-QALQ--QYD--FIVFDTAPVLSAGET-LALA--AATDVTLL
M5RUI3          SPH-RLIS-ESSMRDFVD-RALE--KYS--FVVIDTAPVLSASES-LAVA--SSVDSTLL
A0A5C1AAF0      ASL-CALA-RGVLAADFR-RFLS--DYE--VVIIDSSPLMLVADA-LHFA--KRADGVIL
A0A3B8ZJM2      NPA-ELLS-SSRFAELIE-IVRE--KYD--IVIIDTPPLLAVSDP-SVVA--SVVDGVVI
A0A1U7CLW1      ATI-DLLP-REDFPNLLQ-ELRD--QFD--FIIVDSSPLLLVTDA-LIVS--QHVDAVLL
A0A5Q3LBQ3      SPH-KLLG-NASFATILK-NLSR--IYR--YIIIDCPPILPASEA-MVIA--KAADATLV
A0A142WPR7      NPA-ELLT-GKRFDELLG-VLRE--QYD--FVIIDTPPLLAVTDP-SAVA--PRVDAVIV
A0A517T4K9      TVL-RQLS-MGKAEQIVE-SLRG--QYD--LIILDSSPILPVTDT-LLLA--PAADGVVF
A0A7C6B2Q1      HRL-AVLT-NGVLGAMFR-QLRE--DFN--FVIVDGTPVLPVADT-RFIS--THCDGVVL
A0A2Z3GZZ5      NPA-ELLG-SPQFQRVLA-ELRE--RYE--FVIVDSPPLMAVADP-AIVA--PQADGVLV
A0A4V0I6L6      NPA-ELLT-SPRFQDVLS-DLRA--SYD--FVLLDTPPVLAVSDP-AAVA--PRADGVII
A0A7C4QQT3      NPA-ELLA-SPQLTELFR-DVRD--DYD--LIFVDTPPLLAVSDP-CIIA--RQTDGLLL
A0A7V9G5K3      NPG-DLLH-SPQLKEMVF-AWRQ--AYD--YVIFDTPPLGPVSDA-VIVG--ELVDGIVL
A0A7W1JAD6      NPG-DLLH-SPQLKELLF-GWRQ--SYD--YVIFDTPPLVPVSDA-VIVG--EVVDSIVL
A0A518KBI5      APH-HLAQ-PQRLQKLVE-ALRG--DFR--TIVIDTPPVLGASEA-LSLC--RSADMTVV
A0A5C5V6Q5      SPH-RVAQ-PARIAALVS-RLRN--EFS--TVVIDTPPVLGASEA-LSFC--RSADMTAM
A0A517P477      TAL-AGFG-TAAMAECLD-DLRA--RYD--IVIVDSPPALPVSDG-LMLA--EHVDGVMF
A0A518HFS8      AAV-DALA-REEFPRLIQ-DLRG--RYE--FIIVDSAPALIVTDT-LMLS--QHVDAALL
A0A7Y5LUV4      SAA-ELAS-SPRCAEALR-TARE--EWD--IVILDSAPVILASES-ALVA--RRADAAVL
A0A3M1TFJ0      NAA-NLLGSGEAFARLIG-GLRQ--RFD--RIVIDTPPVAAFSDG-VLMA--VAADAVVL
A0A7Y5HGA4      NPA-EILG-SERMQDLLR-SAAS--RYG--RVVVDSPPLVAVTDP-ALLA--KYVDAVFL
A0A517MY49      NPA-ELLS-TDQFVELLA-WADS--QYD--QVLVDCPPVLAVSDA-QIVG--RHVDAAIL
A0A2E6AG00      DPT-GLLA-SNQFGELLA-WAEA--RYD--QILIDCPPTLVASDA-AIAG--RIAGGLML
A0A1G3A880      NPS-ELLA-GPRFADLLA-WAES--QYE--QILVDSPPVLAASDA-QILG--RLVDGVLL
A0A2E8ATT1      DPV-ELLS-GTRIVDLLG-WAQS--RYD--QILIDCPPIMAASDA-AIVG--HLADGIML
A0A524HC32      NPV-ELLA-SKRFQILLQ-GLSS--RYD--RVILDGPPYLGFADV-LVLS--KQVDGIVL
A0A660VT66      LPS-ELLS-GEALPRMLD-ELKK--RYD--WIIIDTPP-GIVTDP-VILS--AHVDGTVL
A0A7C2ZTD2      DAY-DLLA-LPVVRQQIN-AAGK--KYD--HVIIDTPPVLAFPDA-LLLA--KIADAVVL
A0A0S8H0S8      RPA-EMLH-SPAFRQMLA-ELSG--RYD--RIVIDSPPVVSVTDS-RILG--AICEVTVL
A0A7C2VEF7      NPS-EILN-SDAFAEILKEQLTK--HYD--RIIIDSPPIGPVADS-QILA--AICDITLL
A0A7V7D6N0      NPC-EILN-SDAFIEILK-KLSE--RYD--RVIVDSPPVRPVADS-QILA--AICDITLL
M5S2L2          NPA-EALT-LPEMGELIE-LLRD--EFD--YLILDTPPLLVVTDP-SITA--SMVDGVLL
A0A7V1EK28      GFDPELIA-NGMFSSALA-RWRA--SYD--VILLDSPPVLAAADA-SILA--RHADGVIL
A0A2Z3GYP4      NPA-ELLT-TPAFEDVLD-DLRA--AYD--YVLVDSPPLLAVSDP-CVVA--PRVDGLVL
A0A7C2VXA0      NPS-EVLN-SVLFGGMLQ-ELAQ--TYD--RVIIDSPPVGLVADS-QILA--ATCDIVLL
A0A7C3AA48      NPS-EMLN-SETFTDMMA-KLST--RYD--RVVVDAPPVLPVTDA-CILG--ALCDVTLL
A0A3L7SU85      NPS-ELLT-SPRFSEVIE-ELRK--LYD--IVMVDTPPILAVSDP-SIVA--PRVDGVLM
A0A2D6A9B6      NPS-ELAA-SRRVDELLG-QLKE--QYN--YVLLDTPPIVPISDA-GILS--AKSDGTLV
A0A2G6JGH3      NPS-ELLS-SRRIDELIA-RLKE--EYS--LIILDTPPAIPLTDA-GVLS--AKCDGTIL
A0A7C5PFV3      HPA-EFLS-SGKVEELLS-TLKE--EYN--YVLIDSPPALPFTDA-GILS--AKADGTLL
A0A7C3QGD2      SPA-PYLR-SERFRALLP-ELRE--RFD--FLFVDLPPVRSAADG-LHVV--GLADAVLL
A0A3M1RAJ8      EAL-QALA-RSDPERLFE-VLRR--EFD--FVVVDTSPLLTAADS-LAVG--RFMDGVLL
A0A7Z9UC46      NPG-NLLG-KGKLPGVLD-AITG--EDC--CVVLDTSPLSACSDA-LLMG--AATDGAVM
A0A3D4PLL5      NPV-ELLT-SERFEELIG-WAEG--VYD--QILIDAPPSLAVTDP-AIIG--RLVDGIIL
M5RD30          EPA-ELLE-SFRLSGLLR-SCEQ--RFD--IVLVDAPPLLAVADP-AIIA--PQVDGVLM
A0A1V6CUG1      NVG-ELMG-RPELMEIVG-ELRR--KYD--YVLFDTPPINVVSDA-GILS--KAANEALL
A0A3M1SE88      HPA-ELLS-GSRLAELLA-WVEN--VYD--QVVIDSPPVLAAGDT-AILG--RLADGVLL
A0A7C2ZUK5      NPA-ELVS-SERMADLLN-EAVN--GYVDGFILLDCPPFQAVSES-AVLA--QLVDKVVL
A0A660WB30      NST-ELLN-SEKMRHLIM-EVKS--RYPDRYIVVDSPPVLSTPEP-DVLG--SQVDGIVL
A0A660W9Z7      NAT-ELLE-TPAMKKVIA-DVRE--MFD--FVLIDTSPTLSTTDP-MVLG--AMCDAVII
A0A7X8YY48      RNAGELLA-QMEVEDVIR-DLRC--QYE--YVLLDTPPINLVSDA-AAIG--RVADQALL
A0A3M1R9K7      RGM-AVLA-NGVVGGLFR-SLRE--QYD--FVIVDGSPVLPVADT-RFVS--MHVDGVVM
A0A3L7PH51      NPS-ELLS-SERFSDIIA-WAEQ--IYD--QILIDAPPVLAVTDP-SIIG--RIVDGAIV
A0A3N5UQY5      NPA-EVLN-SPQFAKLLA-YLGR--AYD--RIIVDAPPVTAVTDA-QILG--ALCDFTIL
                                               :..*  *     .                

A0A523CME0      VINNKTTKKSLAKRAIES-LHECRV---IGCVMNKCEVS---------------------
A0A7Y3UKB3      VINNKTTKKSLAKRAIES-LHECRV---IGCVMNKCEVS---------------------
A0A7C2JY73      VLRLGKTSLQAVRQARDL-AQTHALNV-VGAVANGLSGD-----DAS-------------
A0A836W298      VVRPDKNRRKMVIRAVDT-FSTLDIPL-LGLVVNRVKPD-----SGG-------------
A0A354PCV3      CLMRDVSRLDSIRQTTRR-LEAAGAKI-VGTVFSGVTSR-----QYA-------------
A0A354PHB4      CLMRDVSRLESIRQTTRR-LEAAGAKI-VGTVFSGVTSR-----QYS-------------
A0A356ESF4      VVRPEKNCRRNVLRAAET-FATLNVPL-LGIAVNQVKAE-----SRA-------------
A0A538RV31      SLLRDVSRFPNVYAAYER-LSSLGIRM-LGAVVNGVRQD-----R---------------
A0A1G2XSU7      TSLAGHTETPDLKDTIER-LKQINVNL-LGIVLSNVKYN---------------------
A0A350KD81      VVRIDKNRRGVIRKVQQI-IQTNGIKV-TGLLANGVQSG-----KFGD------------
A0A356AE44      IVRLHKNRRPSVKRALEI-FEAHEIPL-LGVIANGLQDG---------------------
A0A7Z9UBD9      VVKWQDTPRNAAETSVSK-LREFGADL-AGVVFEQIDMD---------------------
A0A257WQ92      VVRLGKTSLVTARRAQEL-VKTHGLSV-LGMVANDTPAH---------------------
A0A2E3Z6T8      VVRPEKNHRRSVMRAVES-FHATGCHV-FGVVANGLSSD---------------------
A0A7Y2AF64      VVQPDKTHRRLVLRSVEN-LKSLHVPI-VGLVANRIKQQ---------------------
A0A7C1U6X6      VERELVSRRTNVVDALAR-LDSAGGRL-MGTVF---VGS---------------------
A0A7C7UXI5      VMQPEKNPRRMVTRIVES-LSSLEIKI-LGVVVNRLSGK---------------------
A0A7C3SFJ0      SVLRDVSRVPYVYEACQR-IRAVNLPL-LGAVVNGVGAQ---------------------
A0A7X7YIF4      TSLVDHTSQTDLREAIER-LEQIGIHV-IGTVVNNVRAG---------------------
A0A7C7WWF7      VVQPAKNHRRLVIRAVEH-LQSMESPL-VGIVANRVTNE---------------------
A0A7V3JIB0      SVLRDVSSVPNILSACEV-LAGFGVRP-LGAVV---TGP---------------------
A0A356ETW1      VVQPEKNHRRAVIRAVEG-LLSLRIPL-LGLVVNHAKGE---------------------
A0A3L7NJY1      VVRPDKDRRRMVIRAAET-LQSLGCSL-LGIVVNHLTAT---------------------
A0A2D6SRY7      VVRAGMASLEAARRAKAS-LQNVGARL-LGVIFNGACVQEGLGLPGH-------------
A0A1G3C300      VIKSGQTPKELTRRALLQ-YKNSKSDL-LGIILNLVDVS-----KGGYYSYYYSHY----
A0A177PV03      VVRFSKNARPSARRAKEI-LESMRADV-VGVVVNGYGRN-----GSG-------------
A0A1G2YIM0      ASYAGHTQGPDVQRSLER-LRAAGVKI-IGTVLNSVRIN---------------------
A0A1G3A0W0      VERELVSQRGTQIDALMR-LTSGGGQL-LGTVFVGSSDS-----KDYR------------
A0A7V7D8F5      TSFAGHTTAPDLREANEK-LAQINVNV-LGTVLSNVDTA-----HSY-------------
A0A432MFP3      ATRHDQSRFPAVERANGL-LTGAGIPV-LGVVVNGARTS-----DRR-------------
A0A518HFL0      ATRHDQSRFPAVERANGL-LTGAGIPV-LGVVVNGARGS-----DRR-------------
A0A3L7UX05      AVRYDTSRFPMIERAYKR-LSTLKVPV-LGAVVNGVRNA-----SAT-------------
A0A2E0SHG0      NLRFKKNGRPEALRAIEI-LNGVAANI-LGVTMTGYDSQ-----SGG-------------
A0A2S8F9B8      SIFKDVSQVTLVEDAKRI-LTSFGAPI-IGTVLSG-------------------------
A0A368KP63      SVFKDVSQVTQVEDAKRV-LTSFGAPI-LGTVLSG-------------------------
A0A518CQB8      NLRFKKNGRPEATRAMEI-LQSVDADV-LGVTMTGYDSQ-----GGQ-------------
A0A7C4QPD3      IVRRDVTQLHKLESALRR-FEMIGVPV-LGLLALGLRDS-----SPF-------------
A0A7C2JZW2      VVRKDVTRLRRLEASLHR-FEMIGVPM-LGLLSLGIGDS-----ATV-------------
A0A836RF42      VIRVHSKWSRDMASRASEILQTVGAKP-LGVVVNAVGTH-----KQYG------------
A0A7D8YCU5      VMRIQRNIKPYSERSLAI-LKSFRVNL-IGVVINAVGDS-----RYSS-TYAASWST---
A0A353BE27      TMRLRRNVKPLALRAKSI-LEGVGANL-LGVVINGVSSE-----AGYGYNYDYNDYRYAY
A0A5C6BPW1      SIRRDVSRRPKVAATRDR-LAMLGVPV-LGAVVIGLDGE-----TS---GYRS-------
A0A1I3GSP0      VVRMKKTKRATVQRVHET-LQSHGVQV-YGVIANDFQPT-----TSGE------------
A0A517QJV1      VARLKKNKRAAIVRAMET-LRVHGANV-HGLIANGLDME-----SASE------------
A0A3C1QS25      TFRLRKNIKLTSDRARDI-LASVGAEI-LGVVVNGIGGQ-----AGYG-DYKYSKYGRNY
A0A5C6FX55      TLRVRRKSKLNAREAVNI-LSSVGGNL-IGTVINNSDEA-----SSSD-GYR--------
A0A5C6DS51      TVRVCKNGRRPVERASRI-LSDIGIRP-LAIVVNGVSNN-----AKATYGY---------
A0A5C6DSL6      TVRVCKNGRRAVERAGRI-LREINIQP-LAIVVNGVSNN-----AKATYGY---------
A0A3M1VG27      VVRLNKSRHSSTRRALEL-MHAHGARI-LGVVGNCLPDD-----GEDS------------
A0A518GC22      TMRLRRNVKPLAVRAKSI-LESVGANL-LGVVINGVSSE-----AGYGYNYDYNDYRYAY
A0A3L7Q373      VVRMGKNKRATAQRSREL-IDSHGIPL-YGVVANDIDYT-----ADGGQEFSM-------
A0A3E0PW54      IVRMEKNKRAAIRRTLET-LGGLDVEL-LGVVANGVSPA-----ADDY------------
A0A7C3TAH2      VSRIGKTATTDIEEARSR-LVQTKARV-IGTVVNKVRPE---------------------
A0A1Z8MHR4      VMRIRRRCRPNAREAVAM-LRSAGASI-LGVVINKMDEF-----TGKS-YYRSSAS----
A0A5C6EHJ0      VVRLRKNIKPAVAQASRM-LETLEANV-LGIIVNGVGSR-----AARG-YGKYSGSEGEY
A0A5C6F1H9      VVRLRKNIKPAVAQATRM-LETLDANV-LGIVVNGVGSR-----AARG-YGKSSEAEGNY
A0A255QXY0      VMRIAHRCKPNAKEALSM-LRWSGTRV-IGVVINKLS-------PRNQ-AYKASAS----
A0A517SYI0      VMRIRRRCRPNAREAVAM-LRSAGASI-LGVVINKMDEF-----TGKS-YYRSSAS----
A0A518HX54      VMRIRRRCKPNAKEAVAM-LRWTGSRV-MGVVINKFTAP-----HSTA-SYQSSAC----
A0A5B9MF59      VMRIRRRCKPNAKEAISM-LRAAGARV-MGVVVNEIDEV-----SGGA-SYKTSAS----
A0A2A2WC24      VMRIRRRCKPNAKEAISM-LRAAGARV-MGVVVNEIDDV-----SGGA-SYKSSAS----
A0A518KYW8      VMRIRRRCKPNAKEAISM-LRAAGARV-MGVVVNEIDDV-----SGGA-SYKSSAS----
A0A5C5YZZ0      VMRIGRNIKPMSKRATTL-LRMLHVNI-IGIIVNAVGDS-----GYSA-TYSQAWS----
A0A518JLD2      VARLRKNVKPVVAQASRM-LETLEANV-LGIVINGVGSR-----EAGAYGKSSGRE----
A0A5M6DJ15      AVMRDRSRTPQLIAAAET-LRAHGTPI-MGVVVNGCNDG-----SNDN-SYY--------
A0A3L7P7S7      VMRITRNGRPAAEQAAEV-LGTLGAKV-LGVIVNGYDPR-----ESDKYGYGY-------
A0A517N8M1      ALRIRRKSRHNAKESISI-LRSVGAKI-LGVVINNSDEA-----GASD-GYR--------
A0A5C6CW01      ALRIRRKSKPNAKESVNI-LRSVGANL-FGVVINNSDEA-----GTSD-GYK--------
A0A5C6BXS9      ALKIRRKSKPNVKEAANI-LRNVGASI-IGVVINNSDES-----SASD-GYK--------
M5U569          TLKIRRKSKPNLKEAANI-LRNVGARL-VGVVVNNSDES-----SSSD-GYK--------
L7CND7          ALKVRRKSKPNAKEAASI-LANVGAKL-LGVVINASDEG-----ANND-GYK--------
A0A0J1B8S4      ALKVRRKSKPNAKEAASI-LANVGAKL-LGVVINASDEA-----GNND-GYK--------
F2ARR3          ALKVRRKSRPNAKEAASI-LANVGAKL-LGVVINASDEG-----SNND-GYK--------
K5D8H6          ALKVRRKSRPNAKEAASI-LANVGAKL-LGVVINASDEG-----SNND-GYK--------
M2AKU0          ALKVRRKSRPNAKEAASI-LSNVGAKL-LGVVINASDEG-----SNND-GYK--------
A0A5B1CRW9      TVRVIKNGRGIVDDAIRI-LDDIQIQP-TAVIVNGIDKN-----VSRSYQYG--------
A0A5C6EI46      TVRVTKNGRGTVEDAVRI-LNDIQITP-AAVIVNGIDRN-----ALKTYAYG--------
A0A5B1CKI2      ALRVRRKSRHNSKESINI-LRSVGARV-LGVVINNSDEA-----GASD-GYR--------
A0A5C6EG84      ALRIRRKSRHNAKESLSI-LRSVHARI-LGIVINNSDEA-----GSSD-GYR--------
A0A5C6F2X4      ALRIRRKSRHNARESINI-LRSVSARI-LGIVINNSDEA-----GASD-GYR--------
A0A7W5DXF4      TLKIRRKSKPNLKEAAGI-LRTVGARL-IGVVINNSDES-----GSSD-GYK--------
A0A5C5XTV6      ALKIRRKSKPNVKEAATI-LRNVGARV-LGIVINNSDES-----SASD-GYR--------
A0A5C6AAB1      ALKIRRKSKPNTKEAAGI-LRTVGARL-IGVVVNNSDES-----GSSD-GYK--------
M5T8W8          TLKIRRKSKPNLKEAATI-LRTVGARL-IGVVVNNSDES-----GSSD-GYK--------
M5SF00          ALKVRRKSKPNAKEAASI-LANVGAKL-LGVVINASDEG-----ANND-GYK--------
A0A2G1WDS1      ALKVRRKSKPNAKEAASI-LANVGAKL-LGVVINASDEG-----ANND-GYK--------
Q7UVS9          ALKVRRKSKPNAKEAASI-LANVGAKL-LGVVINSSDEG-----SNND-GYK--------
A0A5C6B601      VMRIRRRCKPNAKESVAM-LRSAGVRI-VGVVVNKIDEV-----SGSA-SYKASAS----
A0A517PFU1      VTRLHPRTRRRLGECLDT-LDQAGARV-LGLVVN---AV-----PAGG-EYTREVQ----
A0A5B9M8J9      VIRIRRRCRPNAKEAAAM-LRWSGSRV-MGVVINKFTAT-----HSTA-SYQSSAS----
A0A2A2WFP6      VMRIQRRCKPNAKEAVAM-LRWTGSRV-MGVVINKFTAP-----RSMA-SYQSSAS----
A0A518L8N2      VMRIQRRCKPNAKEAVAM-LRWTGSRV-MGVVINKFTAP-----HSTA-SYQSSAS----
A0A518HQN9      VMRIRRRCKPNAKEAISM-LRAAGARV-MGVVVNEIDDV-----SGGA-SYKSSAS----
A0A5M6D8H8      VLRIRRRCKPNAKEAVAM-LRSAGARV-MGVVVNKMDEI-----SGGA-SYKSSAS----
A0A1G2ZG92      VIESGRATFSIVDHIKEL-FTKAGLNT-IGIVLNKFKAY-----EAG-------------
A0A2E7D3V4      VVCVGKNKRTTTRRAADL-LDTHNVEV-LGVIANSIEQT-----QGNS------------
A0A5B9PER9      CIRIKKNVRISAERSTEM-LRNLGANC-LGLVVNGVGQQSGYGSQYTYGAYR--------
A0A517QSM4      TIRRDVSRLGNVAAAQQR-LEMIGVPP-IGSILIGLDEF-----ADK-------------
A0A355GJI7      VVRIDKNRRGVIRKVQQI-IQTNGIKV-AGILANSVKSG-----KPGD------------
A0A1Z8MCI4      SFMRDKSRAAYAAKMLDK-LELLDSNV-VGAVFSGTPIR-----EYK-------------
A0A517SYL7      SFMRDKSRAAYAAKMLDK-LELLGSNV-VGAVFSGTPIR-----EYK-------------
A0A3L7P0L2      VVRMGKNKRAAAERAREM-IDAHGIRL-YGVIVNDIDYS-----VEDG------------
A0A6M5YVJ1      SVLMGVSQVALTEEAVSR-LQTVRAKL-TGVIANGVRSA-----AHE-------------
A0A832M9Q8      VVRANMTSQKDIQQTVDA-LARMTGKA-PKIIMNGVEHH-----QSY-------------
A0A7W0MCI8      AIRRDVSRRSLVAAALDR-FRSVGKPV-LGAVAIGLHDD-----PAG-YSEM--------
A0A517SCC8      VVRMEKNKRASVTHTREQ-LDSYGVRL-LGAIANDASHA-----AQRDG-----------
A0A358MY60      CVMRDVSRSDAVLRSSKR-LEAAGANV-VGTVFSGVPSR-----QYA-------------
A0A517MNB1      CMMRDLSRTDTAIRSQRR-LEAAGANV-VGSVFSGVPYQ-----QYS-------------
A0A3A0DR44      CALRDVSRSRQVRLASDR-LNMAGVNL-MGAVLSGTSAR-----RYA-------------
A0A142YJ13      SVLRDVSQLPQIRAAFDW-LTSMGVRI-LGAVVSGVPAG-----SK--------------
A0A517Z7D3      VIRADKNQRPAVRRTQEI-LAAHGVRL-HGVVVNALDAE-----KDEG------------
A0A7X7KCE7      CVMRDYSRVDQFRKILER-LETAGTRP-VGIVLNGVPVK-----DYS-------------
A0A1N6KY57      SIMRDVSRIPTVQAAYDR-LARLGIRM-LGAIVTGEQTD-----HYG-------------
L0DK20          SIMRDVSRIPKVHEAYER-LAKLGIRM-LGAIVTGEQSD-----HYG-------------
A0A517XRC2      SIMQDISQLPKVMVASEK-LHQLSINL-LGAVVNGVHMG-----SAY-------------
A0A6M5YH47      SIMQDVSQLPKVMTATEK-LNQLNIPL-VGAVVNGIK-------QDV-------------
A0A660UUK3      ACFAEHTSRPDLREAIER-LEQIGVRV-LGTVLNNVRVG-----SSY-------------
A0A517ZHG5      SIRRDVSRRPKVAATRDR-LAMLGVPV-LGAVVIGLDGE-----TSGYRSGY--------
A0A1Z8MPL5      SILRDKSRIVPVYETNER-LRTTQIPV-LGCVFNGQQNN-----IFS-------------
A0A7C1EH96      TSFVGHTSQTEMKQATKR-LQEIKANI-IGTVVNNVKTS-----HSYRR-----------
A0A5C1AGE3      SILQDISQLPKVLDASDR-LSQLNIPL-LGAVVNGIKTD-----IHA-------------
A0A2Z3HEL7      SIMQDISQLPKVMTASEK-LTQLNIPL-VGAVVNGIKQD-----VYS-------------
A0A142XAP8      SIMQDVSQLPKVVTASEK-LTQLNIQL-VGAVVNGIKQD-----VYS-------------
A0A6P2DEK1      SIMQDVSQLPKVVTASEK-LTQLNIQM-VGAVVNGIKQD-----VYS-------------
A0A5C6C1R5      SVMKDKSRIPQVVAAHET-LKAHGVPV-MGVVVSGCPSK-----NGE-------------
A0A1G2YRE4      TSFAGQTTTQDLREANQR-LTQINVKV-LGTVLGNVQAQ---------------------
A6BZU4          VVRIDKNRRGVIRKVQQI-IQTNGIKV-TGLLANGVQSG-----KFGD------------
A0A2D5GZ77      VVRIDKNRRGVIRKVQQI-IQTNGIKV-TGLLANGVQSG-----KFGD------------
A0A3D3R1Z6      VVRIDKNRRGVIRKVQQI-IQTNGIKV-TGLLANGVQSG-----KFGD------------
A0A517XG00      VVRIDKNRRGVIRKVQQI-IQTNGIKV-TGLLANGVQSG-----KFGD------------
A0A353Z859      SIRRDVSQMPKVSSAIEK-LQMMGIPV-WGAVAIGVDQS-----SYG-------------
A0A2D6ST10      AVRRDISRAMKVASAQQR-LSMLGVPM-LGAVVIGLDRD-----SYGYN-----------
A0A177QX42      VVRNTKRSRPQTRRVRET-LDLIGARV-LGVVVNGISER-----AAG-------------
A0A517SHR0      VVRNTKRCRPQTRRVRET-LDLIGARV-LGVVVNGISER-----AAG-------------
A0A2E0AW64      CAKRDVTRMEQLKKSRER-LKGAGAEI-VGCVFNDVPPN-----RYS-------------
A0A351FZ59      CAKRDVTRMEQLKKSRER-LKGAGAEI-VGCVFNDVPPN-----RYS-------------
A0A660V239      TSFVDRTSRLDLKEAIER-LEQADAKI-LGTVVNNVKVT-----HSY-------------
A0A177Q3B7      SVLRRVSQLPLFESAVER-LQSVGVNL-LGAVMNGMSPK-----VHASR-----------
A0A2E0X6Y6      VVRPDKNHRRMVIRAVEN-FAATGCHI-FGVVANGVTAD-----SNG-------------
A0A518GFD7      TLVRDRSRLPNAARACDL-LKSYGIAV-LGTVVIGGRST-----GYQGY-----------
A0A518GE37      CAMRDISRTDHVKRTQNR-LLASGTNV-IGVVFSGVPSS-----DYA-------------
A0A5C6F3H8      CVMRDVSRIDNVTRTTRR-LEAAGASI-AGTVFSGVSAR-----QYS-------------
A0A5C5X072      CVMRDVSLKENVVRTTRR-LEAAGACV-AGTVFSGVSAR-----QYG-------------
A0A5C5WUQ3      CVMRDVSRLDNVGRAMRR-IQASGASI-AGTVFSGVTPR-----QYS-------------
A0A5C6E697      CVMRDVSRQDATQLTARR-LQAAGATV-TGTVFSGVATQ-----EYS-------------
A0A5C5Z1A3      CMMRDVSRMDSVRLATRR-LEAAGANM-VGTVFSGVTAQ-----QYA-------------
A0A5C6D2P7      CVMRDLSRVETVQLTTRR-LQAAGATL-TGTVFSGVTAR-----QYA-------------
A0A5B9ML17      CAMRDVTRMDSVIRTTHR-LESAGANV-AGTIFSGVTPR-----QYA-------------
A0A5C5VZJ8      VIREQHCRRHGLTEVIEL-LDSAGGTL-LGTVFVGSTTP-----SGYAS-----------
A0A517LX75      VVRVQKNGRRPVERSREL-LVSSKVNV-AGIIVNGAERG-----DKN-------------
A0A7X7YXL7      VSFAGQTTAPDLKEAKER-FARIRARI-LGAVLSNVPAD-----QGL-------------
A0A7W1FH76      VVRDRMTSKAELARTMAT-LHQIHGKVTMGLVMNAERGE-----RSK-------------
A0A7C5W7B3      VARWGITRNHELKGAVER-VRHVRGRV-LGIALNQSPSA-----EPD-------------
A0A7V2IPP1      VGFAGHTKASELRSAQDR-LAEVGVQL-LGVVLNNVEPG-----RGY-------------
A0A142XL75      SVLMGVSQVALVDEAVTR-LQAVRAKV-TGVIANGVRHA-----AHA-------------
A0A6P2D5D5      SVLMGVSQIALVDEAVAR-LLAVRAKV-TGVIANGVRHA-----AHA-------------
A0A7C7T8W8      CCMRDVSRTLQVRKAYER-LIAVGCDV-MGLILSGVPTY-----DYA-------------
A0A5C6B3S0      SVLRDVSCAPRISAACEI-LRSFKIPL-MGAVVLGSRAE-----AY--------------
A0A354GX32      SVLRNVSRLPAVHAAQQR-LASLGIRV-LGAVVIGEGM----------------------
A0A518GIZ9      TVRLGKNRRPMLRRSRDL-LLAHHIPI-LGVVANGVEPS-----DREEMGYY--------
A0A1C3EBY9      TVRLGKNRRPMLKRSRDL-LLAHHIPI-LGVVANGVEPS-----DREEMGYY--------
D5SX64          TVRLGKNRRPMLRRSRDL-LLAHHIPI-LGVVANGVEPS-----DREEMGYY--------
A0A517Z0U7      SVRRDVSRAAKVAAAVQR-LSMLGVSI-LGAVAIGLEDG-----GSSNRYYG--------
A0A2S8FCC0      AVLRDVSRGAKVQAARDL-LSVFGVPF-LGVVVVGTTRE-----DV--------------
A0A1Z8MBT6      CVMRDVTRTDSVLRSTRR-LEAAGANI-VGTIFSGVTPS-----KYV-------------
A0A517SXN9      CVMRDVTRTDSVLRSTRR-LEAAGANI-VGTIFSGVTPS-----KYV-------------
A0A7X7F3C7      VVRPEKNCRRGVLRAAET-FASLRVPL-LGIAVNQVKAE-----SRAGY-----------
A0A255QXF5      CVMRDLTRMDSVVRTTHR-LEASGANV-VGTIFSGVSHR-----QYA-------------
A0A518KYQ0      CVMRDLTRMDSVVRTTHR-LEASGANV-VGTIFSGVTPR-----QYS-------------
A0A5B9QX47      CVMRDVSRTENLTRSMRR-LEASGANI-AGTVFSGVSPR-----EYA-------------
M5T666          CVMRDVSRKESVLRTTRR-LEASGASV-AGTVFSGVSAR-----QYG-------------
M5U6N6          CVMRDVSRKESVVRTTRR-LEASGASV-AGTVFSGVSAR-----QYA-------------
A0A517M0G2      CVMRDVSRTDSVVRSSRR-LEASGANV-AGTVFSGVPSS-----QYA-------------
A0A5C6AST1      CVMRDVSRTDTVVRSSRR-LEAAGANV-VGTVFSGVPYS-----NYA-------------
A0A5C6C951      CVMRDVSRSDTVVRSSRR-LEAAGANV-VGTVFSGVPYS-----NYA-------------
A0A5C6C5T3      CVMRDVSLKENVLRTTRR-LQAAGASV-AGTVFSGVSAR-----QYG-------------
A0A2A2W6A9      CVMRDLTRLDSVVRTTHR-LEASGANV-VGTIFSGVTPR-----QYS-------------
A0A518HQS9      CVMRDLTRMDSVVRTTHR-LEASGANV-VGTIFSGVTPR-----QYS-------------
A0A5M6DFE6      CAMRDVTRKDSVVRTTHR-LEAAGANV-AGTIFNGVTPR-----QYA-------------
A0A5C6F286      CVMRDVSRIDNVTRTTRR-LEAAGASI-AGTVFSGVSAR-----QYS-------------
A0A517NGN1      CVMRDRTRMDSLERTSRR-LESAGANV-TGTIFSGVTSR-----AYA-------------
M5RUI3          CVMRDVSRMDNVNRSMRR-LDASGATI-AGTVFSGVTAG-----QYA-------------
A0A5C1AAF0      TVRNDYSRVALVQETVRR-LRQIAAPL-LGVVVNGYTHG-----GSG-------------
A0A3B8ZJM2      CMRLRRNVKPLATRAFRV-LESVDAQV-LGVVVNGVSTE-----AAY-------------
A0A1U7CLW1      SVLRAVSQLPQIYAASER-LASMGVRI-LGAVVSGVPLK-----PNR-------------
A0A5Q3LBQ3      CAKRDLSRVEQVEAAFER-LHVAGARP-VGAVLNGVPAR-----SYL-------------
A0A142WPR7      TLRIAKRTRSEARRAMEV-LGSVGANV-LGVVVNGISSR-----KGYGYSGS--------
A0A517T4K9      SIRRDVSRVSKVSAASER-LAMLDIPI-LGAVVIGIDQS-----AYGVM-----------
A0A7C6B2Q1      SVIRDYSRAPLVRSAKQI-LESFRVRV-LGTVVTGSSED-----AY--------------
A0A2Z3GZZ5      VFRMTKTARPAAERAREV-LAGVGAHT-IGVVVNASGDE-----GRG-------------
A0A4V0I6L6      VFRMTPAAGPNTERAKEE-LVAVSAHL-LGVVVNASSEQ-----HAN-------------
A0A7C4QQT3      VVRLGKNTVQAASRAREL-IQTNDMDL-LGVVANCLDAT-----DELAYAPH--------
A0A7V9G5K3      VVRDRFTTKANIKSALAR-LAPLTSKI-SGVVLNGEHAT-----EAS-------------
A0A7W1JAD6      VVRDRFTTKTNIKAALAR-LAPLSQKI-SGVVLNGERAV-----EAS-------------
A0A518KBI5      CARRGVSRIRQIKIASEK-LENAGVSI-VGSVLSGVPPR-----GYG-------------
A0A5C5V6Q5      CTLRGKSRGRQIRLALDQ-LESAGASV-SGSILSGVP-------SYS-------------
A0A517P477      AVRRGVTRLRNVAAALER-FQAVGVPV-LGAVAIGMDDE-----VGR-------------
A0A518HFS8      SVLRLVSRAPDVGEAYER-LATLGVRI-LGAVVSGVRDD-----PNL-------------
A0A7Y5LUV4      VFREGQTGRHAARAAAEA-LIAMDVHL-LGAVLNCSNPK-----RGGYG-----------
A0A3M1TFJ0      VVSARTSRRSASQLAVVE-LSRVGREP-VGVILNQRPGS-----DYGYYYGD--------
A0A7Y5HGA4      VISIGKTSIRNLQRARET-LATVGVPV-HGAVLNNADSR-----TSG-------------
A0A517MY49      VVRPEKNPRHMVIRAVES-FQSTNCEV-LGIVANGLTTE-----MGG-------------
A0A2E6AG00      VVQPAKNHRRSVFRCVEE-TRSVGVXV-VGLIVNRLTXX-----EGRSY-----------
A0A1G3A880      VVQPDSNRRRVVERAVES-FAALGVEL-LGVVANRIRPE-----SNDRYDDG--------
A0A2E8ATT1      VVQPEKNHRRVVFRAVAS-LLGMRNKV-IGIIANRIQPQ-----DQRGY-----------
A0A524HC32      VSSMGETSRRTIEHFRKK-MSIVNGTI-LGCIANKVNQS---------------------
A0A660VT66      VVRNDSTSRKFLRHFATL-LRQGDSRI-TGLVVNDVNVT---------------------
A0A7C2ZTD2      TSFAGQTTAPDLRKARER-LAEINVKV-LGTVMSNVRAG---------------------
A0A0S8H0S8      VLRAEKSTHPVAQQAIED-LLDVGARL-LGAVINAVPRG---------------------
A0A7C2VEF7      VLRAEKSTRKHSVAARDV-LLSVGGRL-LGAIVNDVPRK---------------------
A0A7V7D6N0      VLRAEKSTRRLSQQARDD-LLSVGAHI-FGVIVNDVSRK---------------------
M5S2L2          ALRVRRKSKPNAKESVNI-LRSVGANI-FGIVINNSDES-----GAS-------------
A0A7V1EK28      IAWAGRTQRSEIMHAMES-LNSAGGSL-MGTIFIQQRHR-----S---------------
A0A2Z3GYP4      TIRVTKNGRPAAERARDL-LVRLKVNC-LGVVVNGVGKQ-----GAMAGYGYDYYRHAD-
A0A7C2VXA0      VLRAEKSTRRHSLYAKDS-LMGVGGNI-LGVVVNDVPRK-----HGR----YGYYSSYG-
A0A7C3AA48      VLRADKSTRKTAQQARDG-LLSVGARI-LGAVVNDVHRG-----KGR----YGYYYGYG-
A0A3L7SU85      VMRVTRNGRPAAEQAAEI-LGTLGAKV-LGVVINGYDPR-----EAG---KYGYGYGYGY
A0A2D6A9B6      VVALERAARRMVKEALEQ-LESVGAQL-LGTFVVGIRGA-----DPATDERYRYTWDGEA
A0A2G6JGH3      VVGLERAPRKLSKEARKQ-LVESGAHL-LGSFVVGVRGA-----DPSKDPRYGYSRGE--
A0A7C5PFV3      VVKLEVSSKKLTKMALQN-LQELGGNV-LGTFVLGIRGA-----DPSTDPRYGYPETQWP
A0A7C3QGD2      VLAAGETRKDDATAAKRL-VRGAQGKL-AGCILNKAEIQ-----TRG-------------
A0A3M1RAJ8      SVIRDNSRLPLLLEAYQR-LEEVELPL-LGVVVNGGPAG-----RYR-------------
A0A7Z9UC46      VVSPEKWQGEAEAHFTQD-LEDHGIDV-LGVVLNNADPR-----EKTPGAGYGYGYGYG-
A0A3D4PLL5      TVRPDRNKRRMIIRAAES-VTSLGGNL-LGVVVNGLSDS-----RGE----YGYGYGYG-
M5RD30          TVRVLKNNRRSVERAGNV-LEEIGVTP-TAIIVNGSDAE-----SKA----YGYSNHYRS
A0A1V6CUG1      VVRMHRTHRESVDKALRL-LHATNAKL-VGLVLTHRR-F-----IIP-------------
A0A3M1SE88      VVQPEKNRRRVILRAAEY-LTVLKIRL-VGLVVNRTAKE-----RVP-------------
A0A7C2ZUK5      VVRWGKAGRENVKKLVEQ-VGR--DKI-IGIVFNSFEMN-----ILD-------------
A0A660WB30      VVRAGMTPREMVEDVLLS-LNP--DKV-LGIVMNDVRSG-----VGR-------------
A0A660W9Z7      VVKAGSTQRESVEHAISL-MYQANAKV-LGVVLTQVK-N-----HIP-------------
A0A7X8YY48      VVRMHKTRRESVANAIKA-LEATNIKI-GGLVLTHQK-S-----LIP-------------
A0A3M1R9K7      SVLRDVSRMPKVHAAYRT-LAAFDAKI-LGAIVTG---N-----PGE-------------
A0A3L7PH51      IVRPDKNRRKMVTRAIDS-FRASGVKV-IGLVANHVEVS-----SNS-------------
A0A3N5UQY5      VLRADRSTREITQRAIEA-LRGVGGRL-LGIVVNQVH-R-----DGG-------------
                                                                            

A0A523CME0      -----------VSEYYGYG-----YEYGNDS-----------------------------
A0A7Y3UKB3      -----------VSEYYGYG-----YEYGNDS-----------------------------
A0A7C2JY73      ------------------------SYAGRT------------------------------
A0A836W298      ------------------------DYYGYG------------------------------
A0A354PCV3      ------------------------YRYG--------------------------------
A0A354PHB4      ------------------------YRYG--------------------------------
A0A356ESF4      ------------------------GYYGYA------------------------------
A0A538RV31      --------------------------YGY-------------------------------
A0A1G2XSU7      ------------QIYYPYG-----YGYYGK------------------------------
A0A350KD81      ---------------YDYGSGPGYSDYYIV------------------------------
A0A356AE44      --------SGDYQYRGGYGGGYDKTPYQQN------------------------------
A0A7Z9UBD9      ---------------KQT---KYGYGDATY------------------------------
A0A257WQ92      ---------------DLNSYSADAYYRDVT------------------------------
A0A2E3Z6T8      ---------------S-SGY-GYGYGYGYS------------------------------
A0A7Y2AF64      ---------------SGDGYSGYGYGYGYG------------------------------
A0A7C1U6X6      ---------------RENGHYGYGYGYGYG------------------------------
A0A7C7UXI5      ---------------NSESYYGYGYGYGYS------------------------------
A0A7C3SFJ0      ---------------RYRAYYSYRSYYPRP------------------------------
A0A7X7YIF4      ---------------HSYHRYGYGYGYGYG------------------------------
A0A7C7WWF7      ---------------QEDGYYGYGYGHGYG------------------------------
A0A7V3JIB0      ---------------VGGPFYRSPYM----------------------------------
A0A356ETW1      ---------------ERGGYYGYGYGYGYE------------------------------
A0A3L7NJY1      ---------------DSGG-YGYGYGYGYG------------------------------
A0A2D6SRY7      ---------------YRYSYSHYSHYYHET------------------------------
A0A1G3C300      ---------------YKYG-----YGYGAE------------------------------
A0A177PV03      --YGYDAYRYGYDQAYGYGSNESGYYHEHE------------------------------
A0A1G2YIM0      ---------------KSYNE----YGYGYY------------------------------
A0A1G3A0W0      ----------------------YSSAY---------------------------------
A0A7V7D8F5      -----------------YR---YGHNYHAQ------------------------NTRSRK
A0A432MFP3      ----------------------FGTGYATY------------------------------
A0A518HFL0      ----------------------FGGGYAAY------------------------------
A0A3L7UX05      --------------YGGYG---YGYGYGYG------------------------------
A0A2E0SHG0      -----------------YY---SGGKYASY------------------------------
A0A2S8F9B8      -----------------YT---SGMYYSYT------------------------------
A0A368KP63      -----------------YS---TGMYYSYT------------------------------
A0A518CQB8      -----------------YY---SASKYTSF------------------------------
A0A7C4QPD3      -----------------YG---YGYGYGYG------------------------------
A0A7C2JZW2      ------------------------YTYNHY------------------------------
A0A836RF42      ------YAHRYSSRYGGYK---YNYRYNYYGYRYTPYGYGYGDPNYAEGEEEENAKSPSG
A0A7D8YCU5      -------------QYGVYGSQYYYGRYGRY---------------------------GGY
A0A353BE27      KYGSN--------YRSGYG---YRYGYGNY---------------------------RYG
A0A5C6BPW1      ----------------GYGGYGYGSRYGYG---------------------------YQY
A0A1I3GSP0      ---------------SGYDYDSYGTYYREN---------------------------QTP
A0A517QJV1      ---------------SGYGYESYGSYYNED---------------------------ESP
A0A3C1QS25      AYNYRYGSYGNYGQPYGYG---YGYGYGYD---------------------------YEE
A0A5C6FX55      ----------------GYG---Y-YRYSRY---------------------------AKK
A0A5C6DS51      --GNY--------RADEYS---YVGQYHRE---------------------------YA-
A0A5C6DSL6      --GDY--------RQEEYG---YIGQYHRQ---------------------------YA-
A0A3M1VG27      ------------------------ELYTAF---------------------------YAP
A0A518GC22      KYGSN--------YRSGYG---YRYGYGNY---------------------------RYG
A0A3L7Q373      ----------------------YDRYYNEQ---------------------------TPE
A0A3E0PW54      ----------------------RANQYNSY---------------------------YNP
A0A7C3TAH2      ------------------------HRYNRY---------------------------RPD
A0A1Z8MHR4      --GSY--------QSIGYG---YGDSYRRR---------------------------YQH
A0A5C6EHJ0      NYGSS--------YQYGYG---YSYGYTYG---------------------------YTD
A0A5C6F1H9      NYGSS--------YQYGYG---YSYGYSYG---------------------------YRE
A0A255QXY0      --GGY--------QSIGYG---YGDKYRRR---------------------------YQR
A0A517SYI0      --GSY--------QSIGYG---YGDSYRRR---------------------------YQH
A0A518HX54      --GSY--------QSIGYG---YGDRYRRR---------------------------YQR
A0A5B9MF59      --GSY--------QSIGYG---YGDKYRRR---------------------------YQQ
A0A2A2WC24      --GSY--------QSIGYG---YGDKYRRR---------------------------YQQ
A0A518KYW8      --GSY--------QSIGYG---YGDKYRRR---------------------------YQQ
A0A5C5YZZ0      --DSY--------G--GQPGSEYGYSSYRY---------------------------GSD
A0A518JLD2      --GYY--------NQGEYYKYGYGYSYGAI---------------------------AND
A0A5M6DJ15      ----------------------Y-------------------------------------
A0A3L7P7S7      ----------------GYG---YKYSYGYK---------------------------YSY
A0A517N8M1      ----------------GYG---Y-YRYGRH---------------------------TSR
A0A5C6CW01      ----------------GYG---Y-YRYGRY---------------------------TNR
A0A5C6BXS9      ----------------GYG---Y-YRYTRH---------------------------TNR
M5U569          ----------------GYG---Y-YRYGRH---------------------------TSR
L7CND7          ----------------GYG---Y-YRYGRH---------------------------TNR
A0A0J1B8S4      ----------------GYG---Y-YRYGRH---------------------------TSR
F2ARR3          ----------------GYG---Y-YRYGRH---------------------------TNR
K5D8H6          ----------------GYG---Y-YRYGRH---------------------------TNR
M2AKU0          ----------------GYG---Y-YRYGRH---------------------------TNR
A0A5B1CRW9      ----------------GYGRNKY--GYVGR---------------------------YHQ
A0A5C6EI46      ----------------GYGKGKYGGGYIGH---------------------------YHA
A0A5B1CKI2      ----------------GYG---Y-YRYARH---------------------------TSR
A0A5C6EG84      ----------------GYG---Y-YRYGRH---------------------------TSR
A0A5C6F2X4      ----------------GYG---Y-YRYGRH---------------------------TSR
A0A7W5DXF4      ----------------GYG---Y-YRYGRH---------------------------TNR
A0A5C5XTV6      ----------------GYG---Y-YRYARQ---------------------------TNR
A0A5C6AAB1      ----------------GYG---Y-YRYGRH---------------------------TSR
M5T8W8          ----------------GYG---Y-YRYGRH---------------------------TSR
M5SF00          ----------------GYG---Y-YRYGRH---------------------------TNR
A0A2G1WDS1      ----------------GYG---Y-YRYGRH---------------------------TNR
Q7UVS9          ----------------GYG---Y-YRYGRH---------------------------TNR
A0A5C6B601      --GSY--------QSIGYG---YGDKYRQR---------------------------YQK
A0A517PFU1      --GGY--------YG-GYG---YGAMAGR-------------------------------
A0A5B9M8J9      --GSY--------QSIGYG---YGDRYRRR---------------------------YQR
A0A2A2WFP6      --GSY--------QSIGYG---YGDRYRRR---------------------------YQR
A0A518L8N2      --GSY--------QSIGYG---YGDRYRRR---------------------------YQR
A0A518HQN9      --GSY--------QSIGYG---YGDKYRRR---------------------------YQQ
A0A5M6D8H8      --GSY--------QSIGYG---YGDKYRRR---------------------------YQQ
A0A1G2ZG92      ------------------------YYYYNR------------------------------
A0A2E7D3V4      ---------------YTYSGGYADYLAPSE------------------------------
A0A5B9PER9      -------------AGYSYNGYGYGYGYGYG------------------------------
A0A517QSM4      ------------------------YGYYSR------------------------------
A0A355GJI7      ---------------YDYGSGPGYSDYYIV------------------------------
A0A1Z8MCI4      ---------------YQYGS----YYYYGG------------------------------
A0A517SYL7      ---------------YQYGS----YYYYGG------------------------------
A0A3L7P0L2      ---------------QTYNEYEKYYDAAAP------------------------------
A0A6M5YVJ1      ------------------------YTRAYR------------------------------
A0A832M9Q8      ---------------YKYK-----FAYTTP------------------------------
A0A7W0MCI8      -------------RRYQNR-----YGYSRA------------------------------
A0A517SCC8      ---------------YHYNSYDVYYSAPAA------------------------------
A0A358MY60      ---------------YRYGD----YRYL-T------------------------------
A0A517MNB1      ---------------YRYGD----YNYLMA------------------------------
A0A3A0DR44      ---------------STYGN----YAYLED------------------------------
A0A142YJ13      ---------------HNYGS----YPGPK-------------------------------
A0A517Z7D3      ---------------YDVQSYAAYYAEETA------------------------------
A0A7X7KCE7      ---------------YRWGE----YSYVRD------------------------------
A0A1N6KY57      ------------------------SNYLPS------------------------------
L0DK20          ------------------------SKYGYS------------------------------
A0A517XRC2      ---------------YAYG-----YNYVKQ------------------------------
A0A6M5YH47      ---------------YSYG-----YNYVKQ------------------------------
A0A660UUK3      ---------------YRYG-----YGYGAD------------------------------
A0A517ZHG5      -------------GGYGYGSR---YGYGYQ------------------------------
A0A1Z8MPL5      ---------------PGYYT----YGYGSP------------------------------
A0A7C1EH96      ---------------YGYG-----YGYHYS------------------------------
A0A5C1AGE3      ------------------------YGYNYV------------------------------
A0A2Z3HEL7      ------------------------YGYNYV------------------------------
A0A142XAP8      ------------------------YGYNYV------------------------------
A0A6P2DEK1      ------------------------YGYNYV------------------------------
A0A5C6C1R5      ------------------------YLYQY-------------------------------
A0A1G2YRE4      ---------------YSFHRYDRYYQNPSS------------------------------
A6BZU4          ---------------YDYGSGPGYSDYYIV------------------------------
A0A2D5GZ77      ---------------YDYGSGPGYSDYYIV------------------------------
A0A3D3R1Z6      ---------------YDYGSGPGYSDYYIV------------------------------
A0A517XG00      ---------------YDYGSGPGYSDYYIV------------------------------
A0A353Z859      ---------------YGYG-----YGYGYG------------------------------
A0A2D6ST10      ---------------SRYGRNYQSYQQYRQ------------------------------
A0A177QX42      ---------------YGYGDS---YSYNYT------------------------------
A0A517SHR0      ---------------YGYGDS---YSYNYT------------------------------
A0A2E0AW64      ---------------YRYGY----YGYEDH------------------------------
A0A351FZ59      ---------------YRYGY----YGYEDH------------------------------
A0A660V239      ---------------HRYG-----YGYGYG------------------------------
A0A177Q3B7      ------------------------YHYEPA------------------------------
A0A2E0X6Y6      ---------------YGYG-----YGYGYG------------------------------
A0A518GFD7      ------------------------YAYQNR------------------------------
A0A518GE37      ---------------YRYGD----YHYTTA------------------------------
A0A5C6F3H8      ---------------YRYGD----YHYALG------------------------------
A0A5C5X072      ---------------YRYGN----YHYALP------------------------------
A0A5C5WUQ3      ---------------YRYGD----YHYSAA------------------------------
A0A5C6E697      ---------------SRYGD----YNYFMN------------------------------
A0A5C5Z1A3      ---------------YRYGD----YHYVMP------------------------------
A0A5C6D2P7      ---------------YRYGD----YHYAVS------------------------------
A0A5B9ML17      ---------------YRYGD----YNYSNF------------------------------
A0A5C5VZJ8      ---------------YNYYGSYAQYGRSAS------------------------------
A0A517LX75      ---------------FGYGEYVQPYEYGYA------------------------------
A0A7X7YXL7      ---------------YRQG-----YTYRSH------------------------------
A0A7W1FH76      ---------------YGYP-----YLYSTT------------------------------
A0A7C5W7B3      ------------------------YYYYMH------------------------------
A0A7V2IPP1      ---------------YHYG-----YDYYKS------------------------------
A0A142XL75      ---------------YTHG-----YGTVDP------------------------------
A0A6P2D5D5      ---------------YTHG-----YGTIDP------------------------------
A0A7C7T8W8      ---------------YRYGG----YSRYYK------------------------------
A0A5C6B3S0      ------------------------YSDTNP------------------------------
A0A354GX32      ---------------EAYGQ--VRYPTKAP------------------------------
A0A518GIZ9      -------------ADYNRNE--AYFPQDQA------------------------------
A0A1C3EBY9      -------------ADYNRNE--AFFPQDQS------------------------------
D5SX64          -------------ADYNRNE--AFFPQDQS------------------------------
A0A517Z0U7      -------------R-YGYGY--G-YNYGYR------------------------------
A0A2S8FCC0      ------------------------YDYTSR------------------------------
A0A1Z8MBT6      ---------------YRYGD----YKYSNL------------------------------
A0A517SXN9      ---------------YRYGD----YKYSNL------------------------------
A0A7X7F3C7      ---------------YGYAP--G-HAYDYA------------------------------
A0A255QXF5      ---------------YRYGD----YRYSDY------------------------------
A0A518KYQ0      ---------------YRYGD----YKYSDF------------------------------
A0A5B9QX47      ---------------YRYGN----YDYAIA------------------------------
M5T666          ---------------YRYGD----YQYALG------------------------------
M5U6N6          ---------------YRYGD----YHYAIG------------------------------
A0A517M0G2      ---------------YRYGD----YRYFTA------------------------------
A0A5C6AST1      ---------------YRYGD----YRYLSP------------------------------
A0A5C6C951      ---------------YRYGD----YRYLTP------------------------------
A0A5C6C5T3      ---------------YRYGN----YHYALP------------------------------
A0A2A2W6A9      ---------------YRYGD----YKYSDF------------------------------
A0A518HQS9      ---------------YRYGD----YKYSDF------------------------------
A0A5M6DFE6      ---------------YRYGD----YTYAGA------------------------------
A0A5C6F286      ---------------YRYGD----YDYAIG------------------------------
A0A517NGN1      ---------------YRYGD----YHYSAI------------------------------
M5RUI3          ---------------YRYGS----YHYAIA------------------------------
A0A5C1AAF0      ---------------YGYG-----YGYNRL------------------------------
A0A3B8ZJM2      ---------------GGYG-----YNYSYN------------------------------
A0A1U7CLW1      ---------------Y--------YGSYTS------------------------------
A0A5Q3LBQ3      ------------------------YSYGRY------------------------------
A0A142WPR7      -------------GNRGYA-----YGEGKA------------------------------
A0A517T4K9      ---------------YNER-----YRYAYG------------------------------
A0A7C6B2Q1      ---------------YAHS-----YHTLLE------------------------------
A0A2Z3GZZ5      ---------------YGYG-----YGYGYE------------------------------
A0A4V0I6L6      ---------------YGYG-----YTYKYD------------------------------
A0A7C4QQT3      -------------SQYYHV-----YQAADE------------------------------
A0A7V9G5K3      ------------------------YGY---------------------------------
A0A7W1JAD6      ------------------------YGY---------------------------------
A0A518KBI5      ---------------YAYA-----YGYGYR------------------------------
A0A5C5V6Q5      ---------------YSYA-----YGYGFR------------------------------
A0A517P477      ---------------YGYAP--GRYPYAKH------------------------------
A0A518HFS8      ---------------SDDR-----YHYLSG------------------------------
A0A7Y5LUV4      ---------------YGYG-----YGYGYG------------------------------
A0A3M1TFJ0      -------------LYYGYG-----YGYGPS------------------------------
A0A7Y5HGA4      ---------------YAAG-----YGYGYG------------------------------
A0A517MY49      ---------------YGYG-----YGYGYG------------------------------
A0A2E6AG00      ---------------YGDS-----YGYGYG------------------------------
A0A1G3A880      -------------CAYAYG-----YGAAYR------------------------------
A0A2E8ATT1      ---------------YGYG-----YAYDYS------------------------------
A0A524HC32      ---------------KT-YGYGSYYKYYQA------------------------------
A0A660VT66      ---------------EGYYDRYYRKGYYFA------------------------------
A0A7C2ZTD2      ---------------HSYYRY--GYSYYA-------------------------------
A0A0S8H0S8      ---------------NRRYGRYSQYGYRR-------------------------------
A0A7C2VEF7      ---------------HGRYGYYSGYGYYRG------------------------------
A0A7V7D6N0      ---------------HSRYGYYTGYGYYG-------------------------------
M5S2L2          DGYKGYGYYRYSRYTNRYY-----------------------------------------
A0A7V1EK28      ------RYGQPYSYDYGA------------------------------------------
A0A2Z3GYP4      ------------DYSAPYT-----TADHDE------------------------------
A0A7C2VXA0      ------SYGGYGYYGRHGY-----YGRAGN------------------------------
A0A7C3AA48      ------YYG----YGHKKD-----GGATKR------------------------------
A0A3L7SU85      KYSYGYKYGYKYNYGYNYT-----DYESYT------------------------------
A0A2D6A9B6      K-----E-----------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A7C5PFV3      E-----A-----------------------------------------------------
A0A7C3QGD2      ------------YYYYSAA-----PAVEAG------------------------------
A0A3M1RAJ8      ------------SYYRAYT-----IDVES-------------------------------
A0A7Z9UC46      -------YGYGYGYGQGYG-----QEHKEP------------------------------
A0A3D4PLL5      -------------YGEGYG-----EGHDDP------------------------------
M5RD30          E-----EYSYTPYYHDTYA-----ASDPQP------------------------------
A0A1V6CUG1      ------SYLYRYS-----------------------------------------------
A0A3M1SE88      ------GYDAYDTAYDYHG-----RDESDD------------------------------
A0A7C2ZUK5      ------RKMQDVGYHNYYS-----EKY---------------------------------
A0A660WB30      ------YYSPSYA-----------------------------------------------
A0A660W9Z7      ------KYLYRYHYFNDMY-----ADLYER------------------------------
A0A7X8YY48      ------SYIYKCS-----------------------------------------------
A0A3M1R9K7      ------AYYHDPRYTHYID-----AADEPE------------------------------
A0A3L7PH51      ------DYGYGYGYGYGYG-----YGHDTP------------------------------
A0A3N5UQY5      ------RYGY-YGGHYRLG-----RSNHKH------------------------------
                                                                            

A0A523CME0      ------------------------------------------------------------
A0A7Y3UKB3      ------------------------------------------------------------
A0A7C2JY73      ------------------------------------------------------------
A0A836W298      ------------------------------------------------------------
A0A354PCV3      ------------------------------------------------------------
A0A354PHB4      ------------------------------------------------------------
A0A356ESF4      ------------------------------------------------------------
A0A538RV31      ------------------------------------------------------------
A0A1G2XSU7      ------------------------------------------------------------
A0A350KD81      ------------------------------------------------------------
A0A356AE44      ------------------------------------------------------------
A0A7Z9UBD9      ------------------------------------------------------------
A0A257WQ92      ------------------------------------------------------------
A0A2E3Z6T8      ------------------------------------------------------------
A0A7Y2AF64      ------------------------------------------------------------
A0A7C1U6X6      ------------------------------------------------------------
A0A7C7UXI5      ------------------------------------------------------------
A0A7C3SFJ0      ------------------------------------------------------------
A0A7X7YIF4      ------------------------------------------------------------
A0A7C7WWF7      ------------------------------------------------------------
A0A7V3JIB0      ------------------------------------------------------------
A0A356ETW1      ------------------------------------------------------------
A0A3L7NJY1      ------------------------------------------------------------
A0A2D6SRY7      ---------------------------------------------------DDDGEESTE
A0A1G3C300      ------------------------------------------------------------
A0A177PV03      ------------------------------------------------------------
A0A1G2YIM0      ------------------------------------------------------------
A0A1G3A0W0      ------------------------------------------------------------
A0A7V7D8F5      NAKRAG------------------------------------------------ANLLSS
A0A432MFP3      TYRSDR------------------------------------------------ISDPGG
A0A518HFL0      TYRTDR------------------------------------------------MPDPAG
A0A3L7UX05      -----G------------------------------------------------SFGDGA
A0A2E0SHG0      SAKESR------------------------------------------------SYYTNY
A0A2S8F9B8      ----------------------------------------------------------NR
A0A368KP63      ----------------------------------------------------------AR
A0A518CQB8      GAKESR------------------------------------------------SYYTSY
A0A7C4QPD3      YGYDPH------------------------------------------------TAEHHL
A0A7C2JZW2      SGRTSR------------------------------------------------PSEREP
A0A836RF42      NGQMAR------------------------------------------------SDASEP
A0A7D8YCU5      RGYGYS------------------------------------------------GYLDDA
A0A353BE27      YSEYSD------------------------------------------------TQDLSV
A0A5C6BPW1      NR----------------------------------------------------------
A0A1I3GSP0      AAS-----------------------------------------------------KAKS
A0A517QJV1      KAPQNP------------------------------------------------SQRPRP
A0A3C1QS25      ADKYYD------------------------------------------------EPVAPG
A0A5C6FX55      YYRRGG---------------------------------------------NAGEVVPKG
A0A5C6DS51      ------------------------------------------------------AHEPMA
A0A5C6DSL6      ------------------------------------------------------AQELPV
A0A3M1VG27      YCAAGA------------------------------------------------DADTAG
A0A518GC22      YTEDAD------------------------------------------------TNDLST
A0A3L7Q373      LPSPLS------------------------------------------------------
A0A3E0PW54      NQRPDH-----------------------------------------------------A
A0A7C3TAH2      YYQAAQ-----------------------------------------------SGRQVER
A0A1Z8MHR4      DAIAHD------------------------------------------------AYVVRG
A0A5C6EHJ0      GNKNNS------------------------------------------------YYEEE-
A0A5C6F1H9      ---NNS------------------------------------------------YYEEDD
A0A255QXY0      EVNSKD------------------------------------------------TYMIKA
A0A517SYI0      DAIAHD------------------------------------------------AYVVRG
A0A518HX54      EVNAQD------------------------------------------------TYVVTG
A0A5B9MF59      EAKTQD------------------------------------------------TYVVKG
A0A2A2WC24      EAKTQD------------------------------------------------TYVVKG
A0A518KYW8      EAKTQD------------------------------------------------TYVVKG
A0A5C5YZZ0      RYLDAS------------------------------------------------------
A0A518JLD2      SSRE--------------------------------------------------YYEVEA
A0A5M6DJ15      ------------------------------------------------------------
A0A3L7P7S7      GYKYGY------------------------------------------------NYSDYS
A0A517N8M1      YYR--S------------------------------------------------GKGDKS
A0A5C6CW01      YRRRNG------------------------------------------------SDTSKG
A0A5C6BXS9      YYRKTA------------------------------------------------DNGARG
M5U569          YYRKTK------------------------------------------------DNGPKG
L7CND7          YYRKTA------------------------------------------------DNGAKA
A0A0J1B8S4      YYRKTA------------------------------------------------NNGSKA
F2ARR3          YYRKTA------------------------------------------------DNGAKA
K5D8H6          YYRKTA------------------------------------------------DNGAKA
M2AKU0          YYRKTA------------------------------------------------DNGAKA
A0A5B1CRW9      DYAAKDVASDQPRVVTVNAKTIGSAATAVPVRPTFAQQASQSVNGTESDGLPRQQSSNHQ
A0A5C6EI46      DYAAKE------------------------------------------------RSDVHR
A0A5B1CKI2      YYR--S------------------------------------------------AKGNKV
A0A5C6EG84      YYR--S------------------------------------------------GKAGKS
A0A5C6F2X4      YYR--A------------------------------------------------GKSGKS
A0A7W5DXF4      YYRKTA------------------------------------------------ENGVKA
A0A5C5XTV6      YYRNTP------------------------------------------------ENGPMG
A0A5C6AAB1      YYRKTA------------------------------------------------DNGAKS
M5T8W8          YYRKTK------------------------------------------------DNGTKG
M5SF00          YYRKTA------------------------------------------------DNGAKA
A0A2G1WDS1      YYRKTA------------------------------------------------DNGAKA
Q7UVS9          YYRKTA------------------------------------------------DNGAKA
A0A5C6B601      EANATD------------------------------------------------TYIVKG
A0A517PFU1      ----DA------------------------------------------------YYSDEG
A0A5B9M8J9      EVNAQD------------------------------------------------TYVVTG
A0A2A2WFP6      EVNAQD------------------------------------------------TYIVTG
A0A518L8N2      EVNAQD------------------------------------------------TYIVTG
A0A518HQN9      EAKTQD------------------------------------------------TYVVKG
A0A5M6D8H8      EAKVQD------------------------------------------------TYVVKG
A0A1G2ZG92      ------------------------------------------------------------
A0A2E7D3V4      ------------------------------------------------------------
A0A5B9PER9      ------------------------------------------------------------
A0A517QSM4      ------------------------------------------------------------
A0A355GJI7      ------------------------------------------------------------
A0A1Z8MCI4      ------------------------------------------------------------
A0A517SYL7      ------------------------------------------------------------
A0A3L7P0L2      ------------------------------------------------------------
A0A6M5YVJ1      ------------------------------------------------------------
A0A832M9Q8      ------------------------------------------------------------
A0A7W0MCI8      ------------------------------------------------------------
A0A517SCC8      ------------------------------------------------------------
A0A358MY60      ------------------------------------------------------------
A0A517MNB1      ------------------------------------------------------------
A0A3A0DR44      ------------------------------------------------------------
A0A142YJ13      ------------------------------------------------------------
A0A517Z7D3      ------------------------------------------------------------
A0A7X7KCE7      ------------------------------------------------------------
A0A1N6KY57      ------------------------------------------------------------
L0DK20          ------------------------------------------------------------
A0A517XRC2      ------------------------------------------------------------
A0A6M5YH47      ------------------------------------------------------------
A0A660UUK3      ------------------------------------------------------------
A0A517ZHG5      ------------------------------------------------------------
A0A1Z8MPL5      ------------------------------------------------------------
A0A7C1EH96      ------------------------------------------------------------
A0A5C1AGE3      ------------------------------------------------------------
A0A2Z3HEL7      ------------------------------------------------------------
A0A142XAP8      ------------------------------------------------------------
A0A6P2DEK1      ------------------------------------------------------------
A0A5C6C1R5      ------------------------------------------------------------
A0A1G2YRE4      ------------------------------------------------------------
A6BZU4          ------------------------------------------------------------
A0A2D5GZ77      ------------------------------------------------------------
A0A3D3R1Z6      ------------------------------------------------------------
A0A517XG00      ------------------------------------------------------------
A0A353Z859      ------------------------------------------------------------
A0A2D6ST10      ------------------------------------------------------------
A0A177QX42      ------------------------------------------------------------
A0A517SHR0      ------------------------------------------------------------
A0A2E0AW64      ------------------------------------------------------------
A0A351FZ59      ------------------------------------------------------------
A0A660V239      ------------------------------------------------------------
A0A177Q3B7      ------------------------------------------------------------
A0A2E0X6Y6      ------------------------------------------------------------
A0A518GFD7      ------------------------------------------------------------
A0A518GE37      ------------------------------------------------------------
A0A5C6F3H8      ------------------------------------------------------------
A0A5C5X072      ------------------------------------------------------------
A0A5C5WUQ3      ------------------------------------------------------------
A0A5C6E697      ------------------------------------------------------------
A0A5C5Z1A3      ------------------------------------------------------------
A0A5C6D2P7      ------------------------------------------------------------
A0A5B9ML17      ------------------------------------------------------------
A0A5C5VZJ8      ------------------------------------------------------------
A0A517LX75      ------------------------------------------------------------
A0A7X7YXL7      ------------------------------------------------------------
A0A7W1FH76      ------------------------------------------------------------
A0A7C5W7B3      ------------------------------------------------------------
A0A7V2IPP1      ------------------------------------------------------------
A0A142XL75      ------------------------------------------------------------
A0A6P2D5D5      ------------------------------------------------------------
A0A7C7T8W8      ------------------------------------------------------------
A0A5C6B3S0      ------------------------------------------------------------
A0A354GX32      ------------------------------------------------------------
A0A518GIZ9      ------------------------------------------------------------
A0A1C3EBY9      ------------------------------------------------------------
D5SX64          ------------------------------------------------------------
A0A517Z0U7      ------------------------------------------------------------
A0A2S8FCC0      ------------------------------------------------------------
A0A1Z8MBT6      ------------------------------------------------------------
A0A517SXN9      ------------------------------------------------------------
A0A7X7F3C7      ------------------------------------------------------------
A0A255QXF5      ------------------------------------------------------------
A0A518KYQ0      ------------------------------------------------------------
A0A5B9QX47      ------------------------------------------------------------
M5T666          ------------------------------------------------------------
M5U6N6          ------------------------------------------------------------
A0A517M0G2      ------------------------------------------------------------
A0A5C6AST1      ------------------------------------------------------------
A0A5C6C951      ------------------------------------------------------------
A0A5C6C5T3      ------------------------------------------------------------
A0A2A2W6A9      ------------------------------------------------------------
A0A518HQS9      ------------------------------------------------------------
A0A5M6DFE6      ------------------------------------------------------------
A0A5C6F286      ------------------------------------------------------------
A0A517NGN1      ------------------------------------------------------------
M5RUI3          ------------------------------------------------------------
A0A5C1AAF0      ------------------------------------------------------------
A0A3B8ZJM2      ------------------------------------------------------------
A0A1U7CLW1      ------------------------------------------------------------
A0A5Q3LBQ3      ------------------------------------------------------------
A0A142WPR7      ------------------------------------------------------------
A0A517T4K9      ------------------------------------------------------------
A0A7C6B2Q1      ------------------------------------------------------------
A0A2Z3GZZ5      ------------------------------------------------------------
A0A4V0I6L6      ------------------------------------------------------------
A0A7C4QQT3      ------------------------------------------------------------
A0A7V9G5K3      ------------------------------------------------------------
A0A7W1JAD6      ------------------------------------------------------------
A0A518KBI5      ------------------------------------------------------------
A0A5C5V6Q5      ------------------------------------------------------------
A0A517P477      ------------------------------------------------------------
A0A518HFS8      ------------------------------------------------------------
A0A7Y5LUV4      ------------------------------------------------------------
A0A3M1TFJ0      ------------------------------------------------------------
A0A7Y5HGA4      ------------------------------------------------------------
A0A517MY49      ------------------------------------------------------------
A0A2E6AG00      ------------------------------------------------------------
A0A1G3A880      ------------------------------------------------------------
A0A2E8ATT1      ------------------------------------------------------------
A0A524HC32      ------------------------------------------------------------
A0A660VT66      ------------------------------------------------------------
A0A7C2ZTD2      ------------------------------------------------------------
A0A0S8H0S8      ------------------------------------------------------------
A0A7C2VEF7      ------------------------------------------------------------
A0A7V7D6N0      ------------------------------------------------------------
M5S2L2          ------------------------------------------------------------
A0A7V1EK28      ------------------------------------------------------------
A0A2Z3GYP4      ------------------------------------------------------------
A0A7C2VXA0      ------------------------------------------------------------
A0A7C3AA48      ------------------------------------------------------------
A0A3L7SU85      ------------------------------------------------------------
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A7C5PFV3      ------------------------------------------------------------
A0A7C3QGD2      ------------------------------------------------------------
A0A3M1RAJ8      ------------------------------------------------------------
A0A7Z9UC46      ------------------------------------------------------------
A0A3D4PLL5      ------------------------------------------------------------
M5RD30          ------------------------------------------------------------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------------------------------------------
A0A7C2ZUK5      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ------------------------------------------------------------
A0A7X8YY48      ------------------------------------------------------------
A0A3M1R9K7      ------------------------------------------------------------
A0A3L7PH51      ------------------------------------------------------------
A0A3N5UQY5      ------------------------------------------------------------
                                                                            

A0A523CME0      ------------------------------------------------------------
A0A7Y3UKB3      ------------------------------------------------------------
A0A7C2JY73      ------------------------AYYRQPPHS------------------------AER
A0A836W298      ------------------------YGYGYGYGYGYGYGYGHDDSDASEESGEEGALTQDG
A0A354PCV3      ---------------------------DYHYTV------------------------NDE
A0A354PHB4      ---------------------------DYHYTV------------------------NDE
A0A356ESF4      ------------------------PGHAYDYAD------------------------SRG
A0A538RV31      ---------------------------SYQYYY------------------------NKD
A0A1G2XSU7      ------------------------TNVIKDVKQEPADNIVIPEVK---------------
A0A350KD81      ------------------------PPQVQTKQADAPAKTKLTH-----------------
A0A356AE44      ------------------------NDIPEFLAPTKTIIPS--------------------
A0A7Z9UBD9      ---------YYDRYSDYYLS----------------------------------------
A0A257WQ92      ---------PRQPVTREALVTQA-------------------------------------
A0A2E3Z6T8      ---------YDGGYSHEEEQDMVDTADTMMTPMPEIVQLPSIASEEHLPSASPQEHQSHE
A0A7Y2AF64      ---------YGNGYGADDASDTFEHANETVK-----------------------------
A0A7C1U6X6      ---------YGQKKQYC-------------------------------------------
A0A7C7UXI5      ---------YRYGHRYG-------------Y---------------------GQDEEATE
A0A7C3SFJ0      ---------EENTPSPT-------------------------------------------
A0A7X7YIF4      ---------DQAGRRPKRRHRERLLLEMPAS---------------------GKTE----
A0A7C7WWF7      ---------Y--GHSEDGDSSADG--------------------------------GSDN
A0A7V3JIB0      ------------------------------------------------------------
A0A356ETW1      ---------YNGGYGNDEDDYADDVESEVTT---------------------ATPRDAHF
A0A3L7NJY1      ---------Y--GYGHDDPADRDGVQTLPLH---------------------SSETDVRH
A0A2D6SRY7      FGWRRWLLKCRRALSSQRGETWAASAKGQTTDPQTTNAQIADPQAAALVTTTDPQTTDDE
A0A1G3C300      ------------------------PPKEKRKREKREKKEINV------------------
A0A177PV03      ------------------------GSSRKPANGNGHGGGIVARLFRWLR-----------
A0A1G2YIM0      ------------------------GAAKSGYAKRVHNRRAIIVPVQEEKTEVTNAAS---
A0A1G3A0W0      ------------------------------------------------------------
A0A7V7D8F5      TQSRKRKKPADGTPNGN-------------------------------------------
A0A432MFP3      GVSGS-------------------------------------------------------
A0A518HFL0      GPSAG-------------------------------------------------------
A0A3L7UX05      DEDVVTDAVDIDVEIVD-------------------------------------------
A0A2E0SHG0      TKTAARKSKA--------------------------------------------------
A0A2S8F9B8      PTSTVEVEQ---------------------------------------------------
A0A368KP63      TKSTVEVAK---------------------------------------------------
A0A518CQB8      TKTARKEKV---------------------------------------------------
A0A7C4QPD3      ELPSEATAG---------------------------------------------------
A0A7C2JZW2      GPPRNQGAAVSADLVPA-------------------------------------------
A0A836RF42      ARPDESHSS---------------------------------------------------
A0A7D8YCU5      TKRT----VTVQGMGRTNPQTSGRTPIAGAYANGVAAAERNGGAAVDRDAVEHPVATNGH
A0A353BE27      KQPGNPQ-----------------------------------------------------
A0A5C6BPW1      --------SPEPTPSQS-------------------------------------------
A0A1I3GSP0      AYVPQTAGK---------------------------------------------------
A0A517QJV1      AEPTEIIKT---------------------------------------------------
A0A3C1QS25      GKRRKRSAAIGNDGPKS-------------------------------------------
A0A5C6FX55      SKKR----SGMVVSGRSTQNRVRPSEAMPTRNEAVAAAA----------------PVTRP
A0A5C6DS51      AERLETQKRPTRPLVRA-------------------------------------------
A0A5C6DSL6      SEIIPKQKLTHRVNAPV-------------------------------------------
A0A3M1VG27      EAADPSALAEASEAGRPSEEEAADRSSTPIASGA--------------------------
A0A518GC22      ADKE------------G-------------------------------------------
A0A3L7Q373      --------RELLVGSQK-------------------------------------------
A0A3E0PW54      AESR----QPVAADA---------------------------------------------
A0A7C3TAH2      RPRTRPILLPVATAPAG--------------------------------------QKDQK
A0A1Z8MHR4      YRPAGSDAQYDARYDSY-------AQSGPGMGGPSSGGVVPPGHYPNGAEAPGLPPQPPQ
A0A5C6EHJ0      -PTGRKKAKAKKLAKSK-------LVVAPPKPGDKT------------------------
A0A5C6F1H9      KKKGKDRKKAQQIRKAA-------VVAPPTSPADDV------------------------
A0A255QXY0      KGSTHRVDGPELDLEAD-------AVVDPV----------------------DMAETGAV
A0A517SYI0      YRPAGSDAQYDARYDSY-------AQSGPGMGGPSSGGVVPPGHYPNGAEAPGLPPQPPQ
A0A518HX54      TKNLERVDL-VAPSKAS-------QPGKPHLHQVV------------------PQNSSPG
A0A5B9MF59      KQASER---PTSAGKVD-------DAVEPY---------------DHAMIPPQPTAAGPS
A0A2A2WC24      RHASDPVSVPAAPVESG-------DPPGTYEGEIADPEFTDPEFTDRKITAPDAAPFAPK
A0A518KYW8      KHASDPVSVPAAPAESG-------HQPGTYEQEIADPEFTDSEFADRKITSPDAAPFAPK
A0A5C5YZZ0      --------KEQTVTVRGRHRAEKAEPIGAGAGGESNGKG---------------------
A0A518JLD2      PKQA----APVQQTQHV--------------------------------------PSACG
A0A5M6DJ15      --RR--------------------------------------------------------
A0A3L7P7S7      SYTD----EEGDGEGDDGKGGYDDRPRAPSLGSRVLPNV----------------QPRVR
A0A517N8M1      SRRRS---EPRIISGRG----------AAI--AKVMEQP---------------------
A0A5C6CW01      RDSSRSNMAPVVVKGRG----------STSSRKAKKAVP-------------------LS
A0A5C6BXS9      GTLR----TPVMVSGRG----------SIEQSANVAKAPVAEAPLAEAPVANLASPSING
M5U569          GQPR----TPIVVSGRA----------VGLRASAAAAKP----------------TSVAA
L7CND7          GQRR----SPVVVSGRG----------SAARSARPIAVP----------------P--AV
A0A0J1B8S4      GTRR----TPVVVSGRG----------PAPRSARPIAVP----------------P--TA
F2ARR3          GQRR----SPVVVSGRG----------PAARSARPIAVP----------------P--AT
K5D8H6          GQRR----SPVVVSGRG----------SAARSARPIAVP----------------P---T
M2AKU0          GQRR----SPVVVSGRG----------SAARSARPIAVP----------------P---T
A0A5B1CRW9      NNME----KLESIIESG-------KTAKIDGPSKGRPTS----------------PRGGP
A0A5C6EI46      SDAT----RSEPTPKNG-------RPATFAAASADLGSS----------------VRRQP
A0A5B1CKI2      RRDK----EPLIISGKG-------SQ-----------------------------TSSKP
A0A5C6EG84      QKQS----QPLIISGRG-------SR--------TAPAA----------------AQATQ
A0A5C6F2X4      HKPS----QPLIISGRG-------SKPQAKATSAKATSA----------------QAATP
A0A7W5DXF4      GQPR----TPIVVSGRT-------TGL---RATAAAAKP----------------ISVAT
A0A5C5XTV6      GKVR----TPVIVSGRGEMGQPVNGSPNPGSPNPVANIT----------------PAASR
A0A5C6AAB1      GQLR----TPVIVSGRG-------MTPVPRKANLGATTA----------------VGSSP
M5T8W8          GQPR----TPIVVSGRA-------VGL---RASAAAAKP----------------TSVAT
M5SF00          GQRR----SPVVVSGRG-------SAA---RSARPIAVP----------------PT-TP
A0A2G1WDS1      GQRR----SPVVVSGRG-------GGA---RSARPIAVP----------------PTVTS
Q7UVS9          GQRR----SPVVVSGRG-------QAA---RSARPIAVP----------------PATAP
A0A5C6B601      KSDE----APTVVAPPD-------VSPTLITGSTNAEST----------------PDESY
A0A517PFU1      TSAP----AAPALIAAT-------PADGDAATARRSTRT----------------PDAAR
A0A5B9M8J9      TKHL----GRVDKVSSD-------AAATLAKPHLRTAQP----------------TDSNA
A0A2A2WFP6      TKNL----ERVDLVAPS-------NSSQPGKPHLRQVVP----------------QDSAS
A0A518L8N2      TKNL----ERVDLVTAS-------EATRPGKPHLQQTDS----------------KSQSH
A0A518HQN9      RHAS----DPGAM--PG-------APTGPVGEPGAYERE----------------ITDSE
A0A5M6D8H8      KVAS----EPAEVRRPA-------RNGKPVASTVAGD-P----------------VQASR
A0A1G2ZG92      ------------------------AYYK--------------------------------
A0A2E7D3V4      ------------------------QSLELQREAQQPTAQPVA------------------
A0A5B9PER9      ------------------------YGQGGKYYDEDQKGRKVDPNVAQRIESKTS------
A0A517QSM4      ------------------------HYNTLDVS----------------------------
A0A355GJI7      ------------------------PPQAQAKQADVPAKTKITH-----------------
A0A1Z8MCI4      ------------------------KKAIEMPVSKDACSGIGSVPX---------------
A0A517SYL7      ------------------------KKAIEMPVSKDACSGIGSVPS---------------
A0A3L7P0L2      ------------------------SLSAQPQTELVGGRK---------------------
A0A6M5YVJ1      ------------------------AHESPALPVGGAGGPHER------------------
A0A832M9Q8      ------------------------NERDGAAHVESGS-----------------------
A0A7W0MCI8      ------------------------LAEC--------------------------------
A0A517SCC8      ------------------------PRKAEEPVTV--------------------------
A0A358MY60      ------------------------PKIDT-------------------------------
A0A517MNB1      ------------------------PEANQPAIK---------------------------
A0A3A0DR44      ------------------------SLS---------------------------------
A0A142YJ13      ------------------------------------------------------------
A0A517Z7D3      ------------------------PTPAAPAKTQSEPANVTV------------------
A0A7X7KCE7      ------------------------------------------------------------
A0A1N6KY57      ------------------------GRA---------------------------------
L0DK20          ------------------------ARAQESV-----------------------------
A0A517XRC2      ------------------------LPA---------------------------------
A0A6M5YH47      ------------------------LPA---------------------------------
A0A660UUK3      ------------------------GGKAQRKAKAKRGRSLLLVAPKSEQEDSK-------
A0A517ZHG5      ------------------------YNRSPEPTPSQS------------------------
A0A1Z8MPL5      ------------------------QPLGSDTESPS-------------------------
A0A7C1EH96      ------------------------AKKHPKRPAHKTKKSKALLLSEVAESAEQ-------
A0A5C1AGE3      ------------------------KQLPA-------------------------------
A0A2Z3HEL7      ------------------------KQLPA-------------------------------
A0A142XAP8      ------------------------KQLPA-------------------------------
A0A6P2DEK1      ------------------------KQLPA-------------------------------
A0A5C6C1R5      ------------------------------------------------------------
A0A1G2YRE4      ------------------------RKTAEQAKIQLLLPDTAVNETDKN------------
A6BZU4          ------------------------PPQVQTKQADAPAKTKLTH-----------------
A0A2D5GZ77      ------------------------PPQVQTKQADAPAKTKLTH-----------------
A0A3D3R1Z6      ------------------------PPQVQTKQADAPAKTKLTH-----------------
A0A517XG00      ------------------------PPQVQTKQADAPAKTKLTH-----------------
A0A353Z859      ------------------------YGYGYGYGYGNSYGYGYGNRPRSSAPAVPSESPSDQ
A0A2D6ST10      ------------------------YPR---------------------------------
A0A177QX42      ------------------------TSYRSRSGKYYSDERVGHSYYDDSRKRR--------
A0A517SHR0      ------------------------TSYRSKSGKYYSDERVGNSYYDDSRKRR--------
A0A2E0AW64      ------------------------GGI---------------------------------
A0A351FZ59      ------------------------GGV---------------------------------
A0A660V239      ------------------------HATEDDRKRESDARKRAETLLLTTEPKHETGHGSGS
A0A177Q3B7      ------------------------SSTLAPESLLDIDLSGVPSESSES------------
A0A2E0X6Y6      ------------------------YGHDEDETDGFEEDSPVGHDDLTLAINGRRTADEDH
A0A518GFD7      ------------------------SVERKPKLIEN-------------------------
A0A518GE37      ------------------------NLPPPH------------------------------
A0A5C6F3H8      ------------------------DVPFGDSSSELSESSVS-------------------
A0A5C5X072      ------------------------DTMAT-------------------------------
A0A5C5WUQ3      ------------------------GLAVQE------------------------------
A0A5C6E697      ------------------------AGVRS-------------------------------
A0A5C5Z1A3      ------------------------DFNTPS------------------------------
A0A5C6D2P7      ------------------------SSEAH-------------------------------
A0A5B9ML17      ------------------------TNLPGSAT----------------------------
A0A5C5VZJ8      ------------------------TDATD-------------------------------
A0A517LX75      ------------------------TKYTKSYSSRDTEELATASR----------------
A0A7X7YXL7      ------------------------SATAGRKSSKPKKLLLTSPGQGNGDRPAGN------
A0A7W1FH76      ------------------------ASQAPLVAKS--------------------------
A0A7C5W7B3      ------------------------SEADVPVAVQA-------------------------
A0A7V2IPP1      ------------------------SQKRRGASRRRKRMLLPLGEPDKK------------
A0A142XL75      ------------------------VEHT-PAPAISASPVTTERE----------------
A0A6P2D5D5      ------------------------IDHNVPAPAIAAGPATTERE----------------
A0A7C7T8W8      ------------------------KYYRQEFAENTQ------------------------
A0A5C6B3S0      ------------------------LDTDDHFADETSATIPEST-----------------
A0A354GX32      ------------------------QAPAQ-------------------------------
A0A518GIZ9      ------------------------SVEKPSIHRDLTISASLVRQP---------------
A0A1C3EBY9      ------------------------LPEKSSTHRDLTISASPVRQP---------------
D5SX64          ------------------------SPEKSSTHRDLTISASPVRQP---------------
A0A517Z0U7      ------------------------GSYHRTPANIS-------------------------
A0A2S8FCC0      ------------------------RDRKKRLVHVG-------------------------
A0A1Z8MBT6      ------------------------VS----------------------------------
A0A517SXN9      ------------------------VS----------------------------------
A0A7X7F3C7      ------------------------DSRGLDDDRGEQNDGFKTTRRSAA------------
A0A255QXF5      ------------------------TDLLPAGSNAE-------------------------
A0A518KYQ0      ------------------------GQMLAETTHRN-------------------------
A0A5B9QX47      ------------------------GETNS-------------------------------
M5T666          ------------------------GEPQAT------------------------------
M5U6N6          ------------------------GEPVAT------------------------------
A0A517M0G2      ------------------------RPEPQTIENA--------------------------
A0A5C6AST1      ------------------------KPRA--------------------------------
A0A5C6C951      ------------------------KHDRVPDAVATPTPAGMPLHGGMNEQSVL-------
A0A5C6C5T3      ------------------------DTMAT-------------------------------
A0A2A2W6A9      ------------------------GQMLAETAHRS-------------------------
A0A518HQS9      ------------------------GQMLAETAHRN-------------------------
A0A5M6DFE6      ------------------------GEIPDYS-----------------------------
A0A5C6F286      ------------------------DGSFGDSYHDEEQASS--------------------
A0A517NGN1      ------------------------ES----------------------------------
M5RUI3          ------------------------GETDA-------------------------------
A0A5C1AAF0      ------------------------AAAKTVEVEVKAEAR---------------------
A0A3B8ZJM2      ------------------------DYRYSYRSSYGYGYGKYGKYGYGKYGKYTSYSTGYI
A0A1U7CLW1      ------------------------PQWNPVEEEPS-------------------------
A0A5Q3LBQ3      ------------------------ALPTA-------------------------------
A0A142WPR7      ------------------------GVYYSEEEHPASSLTSQS------------------
A0A517T4K9      ------------------------YPGTK-------------------------------
A0A7C6B2Q1      ------------------------NTSGAPDDVEDIQPESTES-----------------
A0A2Z3GZZ5      ------------------------YKYTSYKYSDSYNTDADEDGARLVPAPTR-------
A0A4V0I6L6      ------------------------YQYSDSYTDQKK------------------------
A0A7C4QQT3      ------------------------PVAVS-------------------------------
A0A7V9G5K3      -------------------------------------------------------YANAS
A0A7W1JAD6      -------------------------------------------------------YSQVS
A0A518KBI5      ------------------------DDTQEQIESDDAGRR---------------------
A0A5C5V6Q5      ------------------------NPTEHSGGIEVSR-----------------------
A0A517P477      ------------------------RQARLLERTPAQAAKI--------------------
A0A518HFS8      ------------------------VKR---------------------------------
A0A7Y5LUV4      ------------------------YGYGRAERSTE-------------------------
A0A3M1TFJ0      ------------------------QPPARAGGSGA-------------------------
A0A7Y5HGA4      ------------------------YGGGAGGAAPDH------------------------
A0A517MY49      ------------------------HEEEAEESAATRVPATTHERPHYEVPADVQTVQYAP
A0A2E6AG00      ------------------------DNEGD--------------------------XEPAA
A0A1G3A880      ------------------------DEADQDGLIGA------------DRDHEPQGADEAI
A0A2E8ATT1      ------------------------SPEDENEQIST------------SKPAAGTPQEQVS
A0A524HC32      ------------------------YNDSYDEEKKESREQIS-------------------
A0A660VT66      ------------------------GDESGEGVRGIPGKELVRS-----------------
A0A7C2ZTD2      ---------------------------ENVRSRKNAKRAGINLLLPMQSSEDNINGTDSP
A0A0S8H0S8      ----------------------------SHRRKASAPSE---------------------
A0A7C2VEF7      ------------------------YGYYGDREKKEAAVV---------------------
A0A7V7D6N0      ---------------------------YGHKEKKK-------------------------
M5S2L2          ------------------------------------------------------------
A0A7V1EK28      ------------------------------------------------------------
A0A2Z3GYP4      ------------------------PGMGEGQPLTPPARLSSEPAGHVEPVANGPAHAPE-
A0A7C2VXA0      ------------------------REDDEA------------------------------
A0A7C3AA48      ------------------------LAVASS------------------------------
A0A3L7SU85      ------------------------DDEDEENEAANAEGKVQRGPSMASRVLPNLVPRIQT
A0A2D6A9B6      ------------------------------------------------------------
A0A2G6JGH3      ------------------------------------------------------------
A0A7C5PFV3      ------------------------------------------------------------
A0A7C3QGD2      ------------------------AAE---------------------------------
A0A3M1RAJ8      ------------------------------------REPKTAPRQPVGK-----------
A0A7Z9UC46      ------------------------KKKKFSISNLLSSKKKN-------------------
A0A3D4PLL5      ------------------------THDDEEEAIPMTQSNSHRPRKRFSRDESSDRYAA--
M5RD30          ------------------------NSIRLQNAV---GSQPVQPTKLMSRS----------
A0A1V6CUG1      ------------------------------------------------------------
A0A3M1SE88      ------------------------PVSADGVP---------FDDDDEDIVPRRVA-----
A0A7C2ZUK5      ------------------------------------------------------------
A0A660WB30      ------------------------------------------------------------
A0A660W9Z7      ------------------------LGDSGEPA------------RKSRGKRRKRK-----
A0A7X8YY48      ------------------------------------------------------------
A0A3M1R9K7      ------------------------PVSADETG----------------------------
A0A3L7PH51      ------------------------PETGTDHE--------------DEQPYRRAA-----
A0A3N5UQY5      ------------------------GPDAKAHDTCIGMTLQPLEAGLSRSPVLRPS-----
                                                                            

A0A523CME0      --------------------
A0A7Y3UKB3      --------------------
A0A7C2JY73      ELEPAGV-------------
A0A836W298      PLAEIGRRRAHAA-------
A0A354PCV3      DFGDVGIRASQDL-------
A0A354PHB4      DFIDVGVRDSHDL-------
A0A356ESF4      SNDDPGEQKDHFEAARRSAA
A0A538RV31      HN------------------
A0A1G2XSU7      --------------------
A0A350KD81      --------------------
A0A356AE44      --------------------
A0A7Z9UBD9      --------------------
A0A257WQ92      --------------------
A0A2E3Z6T8      TPFQTKSANSTTPLKPRRVA
A0A7Y2AF64      --------------RDRKAA
A0A7C1U6X6      --------------------
A0A7C7UXI5      AAAGTERLKKPVRRSAREAA
A0A7C3SFJ0      --------------------
A0A7X7YIF4      --------------------
A0A7C7WWF7      GPEDDDRNDENGMVSPRRVA
A0A7V3JIB0      ----------------PPVM
A0A356ETW1      HDTDPDEGGRPGRIVPRRAA
A0A3L7NJY1      VSDDKT----------KNAA
A0A2D6SRY7      TDEETDDETTERSRIVRSSS
A0A1G3C300      --------------------
A0A177PV03      --------------------
A0A1G2YIM0      --------------------
A0A1G3A0W0      --------------------
A0A7V7D8F5      --------------------
A0A432MFP3      --------------------
A0A518HFL0      --------------------
A0A3L7UX05      --------------------
A0A2E0SHG0      --------------------
A0A2S8F9B8      --------------------
A0A368KP63      --------------------
A0A518CQB8      --------------------
A0A7C4QPD3      --------------------
A0A7C2JZW2      --------------------
A0A836RF42      --------------------
A0A7D8YCU5      APAHHSGPKGGSENGGHVDE
A0A353BE27      --------------------
A0A5C6BPW1      --------------------
A0A1I3GSP0      --------------------
A0A517QJV1      --------------------
A0A3C1QS25      --------------------
A0A5C6FX55      NVSSDQQADS----------
A0A5C6DS51      --------------------
A0A5C6DSL6      --------------------
A0A3M1VG27      --------------------
A0A518GC22      --------------------
A0A3L7Q373      --------------------
A0A3E0PW54      --------------------
A0A7C3TAH2      VLK-----------------
A0A1Z8MHR4      SSGGSYDSSIGS--------
A0A5C6EHJ0      --------------------
A0A5C6F1H9      --------------------
A0A255QXY0      KTPTFK--------------
A0A517SYI0      SSGGSYDSSIGS--------
A0A518HX54      PLPKN---------------
A0A5B9MF59      AVAKRHRANVRS--------
A0A2A2WC24      VAPDRRRTNVRS--------
A0A518KYW8      VVPERRRTNVRS--------
A0A5C5YZZ0      --------------------
A0A518JLD2      ADLTNHTS------------
A0A5M6DJ15      --------------------
A0A3L7P7S7      TKRLTGGSPPQNVPGDGEPE
A0A517N8M1      ----AQEELLDR--------
A0A5C6CW01      MTGVD----SDV--------
A0A5C6BXS9      HGPYETNNGSHN--------
M5U569          TTPINGKPEDDV--------
L7CND7          TSPTEQER-SDV--------
A0A0J1B8S4      MPPVEQERSSDV--------
F2ARR3          APSIEREG-SDV--------
K5D8H6          TPSVEQER-SDV--------
M2AKU0          TASVEQER-SDV--------
A0A5B1CRW9      APVAAPVSSMPMTPSETV--
A0A5C6EI46      APITIPSGDAPPMADQSSKS
A0A5B1CKI2      VAAVSASNSDELDG------
A0A5C6EG84      TAMGYEGHDDHLDS------
A0A5C6F2X4      STLGESTLKDLTD-------
A0A7W5DXF4      SNSTNGTPTDDV--------
A0A5C5XTV6      NGHASHDDTDES--------
A0A5C6AAB1      SKMNGRSASSE---------
M5T8W8          SSTKNGTATDDV--------
M5SF00          SVEQERS---DV--------
A0A2G1WDS1      STDQERS---DV--------
Q7UVS9          SIEQERS---DV--------
A0A5C6B601      SSR-----------------
A0A517PFU1      SR------------------
A0A5B9M8J9      --------------------
A0A2A2WFP6      GPRPL---------------
A0A518L8N2      --------------------
A0A518HQN9      ITDSFAPTVVPERRRTNVRS
A0A5M6D8H8      GPAPLAPPVLTERHSTPTHH
A0A1G2ZG92      --------------------
A0A2E7D3V4      --------------------
A0A5B9PER9      --------------------
A0A517QSM4      --------------------
A0A355GJI7      --------------------
A0A1Z8MCI4      --------------------
A0A517SYL7      --------------------
A0A3L7P0L2      --------------------
A0A6M5YVJ1      --------------------
A0A832M9Q8      --------------------
A0A7W0MCI8      --------------------
A0A517SCC8      --------------------
A0A358MY60      --------------------
A0A517MNB1      --------------------
A0A3A0DR44      --------------------
A0A142YJ13      --------------------
A0A517Z7D3      --------------------
A0A7X7KCE7      --------------------
A0A1N6KY57      --------------------
L0DK20          --------------------
A0A517XRC2      --------------------
A0A6M5YH47      --------------------
A0A660UUK3      --------------------
A0A517ZHG5      --------------------
A0A1Z8MPL5      --------------------
A0A7C1EH96      --------------------
A0A5C1AGE3      --------------------
A0A2Z3HEL7      --------------------
A0A142XAP8      --------------------
A0A6P2DEK1      --------------------
A0A5C6C1R5      --------------------
A0A1G2YRE4      --------------------
A6BZU4          --------------------
A0A2D5GZ77      --------------------
A0A3D3R1Z6      --------------------
A0A517XG00      --------------------
A0A353Z859      SSQPPLN-------------
A0A2D6ST10      --------------------
A0A177QX42      --------------------
A0A517SHR0      --------------------
A0A2E0AW64      --------------------
A0A351FZ59      --------------------
A0A660V239      --------------------
A0A177Q3B7      --------------------
A0A2E0X6Y6      DGHDAPIRPRRAA-------
A0A518GFD7      --------------------
A0A518GE37      --------------------
A0A5C6F3H8      --------------------
A0A5C5X072      --------------------
A0A5C5WUQ3      --------------------
A0A5C6E697      --------------------
A0A5C5Z1A3      --------------------
A0A5C6D2P7      --------------------
A0A5B9ML17      --------------------
A0A5C5VZJ8      --------------------
A0A517LX75      --------------------
A0A7X7YXL7      --------------------
A0A7W1FH76      --------------------
A0A7C5W7B3      --------------------
A0A7V2IPP1      --------------------
A0A142XL75      --------------------
A0A6P2D5D5      --------------------
A0A7C7T8W8      --------------------
A0A5C6B3S0      --------------------
A0A354GX32      --------------------
A0A518GIZ9      --------------------
A0A1C3EBY9      --------------------
D5SX64          --------------------
A0A517Z0U7      --------------------
A0A2S8FCC0      --------------------
A0A1Z8MBT6      --------------------
A0A517SXN9      --------------------
A0A7X7F3C7      --------------------
A0A255QXF5      --------------------
A0A518KYQ0      --------------------
A0A5B9QX47      --------------------
M5T666          --------------------
M5U6N6          --------------------
A0A517M0G2      --------------------
A0A5C6AST1      --------------------
A0A5C6C951      --------------------
A0A5C6C5T3      --------------------
A0A2A2W6A9      --------------------
A0A518HQS9      --------------------
A0A5M6DFE6      --------------------
A0A5C6F286      --------------------
A0A517NGN1      --------------------
M5RUI3          --------------------
A0A5C1AAF0      --------------------
A0A3B8ZJM2      EDRQAEAAEVSTKNDADTQS
A0A1U7CLW1      --------------------
A0A5Q3LBQ3      --------------------
A0A142WPR7      --------------------
A0A517T4K9      --------------------
A0A7C6B2Q1      --------------------
A0A2Z3GZZ5      --------------------
A0A4V0I6L6      --------------------
A0A7C4QQT3      --------------------
A0A7V9G5K3      GRIPVSSIRPEGAELEPKTA
A0A7W1JAD6      ARLPMAA--PREGQLEPKSA
A0A518KBI5      --------------------
A0A5C5V6Q5      --------------------
A0A517P477      --------------------
A0A518HFS8      --------------------
A0A7Y5LUV4      -----------------KQA
A0A3M1TFJ0      --------------------
A0A7Y5HGA4      --------------------
A0A517MY49      PVVPHSATEPAAPIRPRKAA
A0A2E6AG00      DSSSSFSVXATPSQQIRRAA
A0A1G3A880      ERPRPANEAADQIGPVKRVA
A0A2E8ATT1      PDPASKPSGAKKRVVPRRAA
A0A524HC32      --------------------
A0A660VT66      --------------------
A0A7C2ZTD2      NEKMN---------------
A0A0S8H0S8      --------------------
A0A7C2VEF7      --------------------
A0A7V7D6N0      --------------------
M5S2L2          --------------------
A0A7V1EK28      --------------------
A0A2Z3GYP4      --------------------
A0A7C2VXA0      --------------------
A0A7C3AA48      --------------------
A0A3L7SU85      KRLPSKPASETKPPETPEST
A0A2D6A9B6      --------------------
A0A2G6JGH3      --------------------
A0A7C5PFV3      --------------------
A0A7C3QGD2      --------------------
A0A3M1RAJ8      --------------------
A0A7Z9UC46      --------------------
A0A3D4PLL5      --------------------
M5RD30          --------------------
A0A1V6CUG1      --------------------
A0A3M1SE88      --------------------
A0A7C2ZUK5      --------------------
A0A660WB30      --------------------
A0A660W9Z7      --------------------
A0A7X8YY48      --------------------
A0A3M1R9K7      --------------------
A0A3L7PH51      --------------------
A0A3N5UQY5      --------------------
                                    

© 1998-2022Legal notice