BYKdb

Dataset for cluster tadcd of phylum nitrospirae

[Download (right click)] [Edit] [Sequences] [Repertoires]

29 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A7C1A2W1      --------------------------------------------------MIQAQLHLQD
A0A7C5S9N9      --------------------------------------------------MQEREIHLRD
A0A7C1NP38      ------------------------------------------------MDYTEKSTDLKE
A0A7C1NJJ1      --------------------------------------------------MQQQEIHLRD
A0A1G1E4S2      -------------------------------------------------------MELKK
A0A349BQG7      -------------------------------------------------------MELKK
A0A1G1HPN4      -------------------------------------------------------MELKK
A0A354F6L6      -------------------------------------------------------MELKK
A0A1G1HUY8      -------------------------------------------------------MELKK
A0A419FND3      --------------MSNIESTIEKATKLRQFISPVKGETLTPENVRLYIEDKDKSPHLRD
A0A1G1GFA6      ------------------------------------------------MLFKNDNLHLLD
A0A1G1HA47      ----------------MRNRKNDDIKDRLEIQRYDRRDLPLSTHLEYLDHKVTEEVHLRD
A0A1G3XRU6      -------------------MSNHEEKSSSQANIQKIEEFPVSTSLNLAPEEKEEEIHLRD
A0A7C1ANF2      -------------MSMNDDEKHGNNNQQFGIKPYEPREHSVSTEIRHLEQEADEEIHLRD
A0A7C5SCK5      -------------MRFKRDG-HNEDRKNYPVGPYERQEYAISPDLRYFDFQEEEEVHLRD
A0A3N5I7D6      ----------MDKRRNKDSNLLSVSRPGVETSVTPYLRPAEPTVPYYGFSESKDDSALVE
A0A0S8DH48      ---------------------------------MDVFRYDTQEI------QEEPQIDVRH
A0A0K2GIJ9      --------------MERRNGLPADR--------------TAPGA------ADEPEHPLRE
D8PGN0          -----------------------MN--------------AKAVM------SDESEHTLSE
A0A136JVD6      -----------------------MN--------------AKPMV------LDEAEQTLSE
A0A3A0BU62      -----------------MVKGDSVN--------------AKPMV------LDEAEQTLSE
A0A532DAI5      --------------MNAKLDKTNVEKTHTSLALYHPMAHGNAIH------EHRHSQVFDD
A0A525WL30      --------------MDRNAEFIPHQ----------------SAQ------GDAAETALTD
A0A532DDN0      --------------MDRNADFIPFQ----------------SAQ------GDGPETALVD
A0A0S4L511      --------------MTRDDDSISPQ----------------SAE------SNGRETVLAE
A0A532CR46      --------------MNRNEGFAPLQ----------------SVP------GDGPETVLAE
A0A3A4W5D3      -----------------------------------MNTIPQSYP------EDKKDIHLYD
A0A533Z444      MSESIDAQQKRGLMQRDQGSSGESLHAIERAASRPLQDLEILDV------SPEEVPHLLD
A0A7C1TP87      -----------------------------------MNQIEYSND------AEERETHLYD
                                                                         .  

A0A7C1A2W1      YMQTLLRRRWVVITFFVVIVVSVLIGSLKQTPIYESSATILI--ERRTPQVLSM-QEVVP
A0A7C5S9N9      YLKVIDKRRYSVYTFFIIVFTLVLIGTLSSQPVYMASTKILI--ERGAPADLER----TY
A0A7C1NP38      YLWTFYKHRWAIVTFFVVTVSVTAIYNIIAEPEFRASTRILI--EKENPNIVDF-KEIYA
A0A7C1NJJ1      YFRIIRKRRHVVLTFFFITLALVILFTFTASPLYKADTRLLIEKAEQYTITEYG------
A0A1G1E4S2      IFEIIWARKWVIIQAFIVITLTAFIGSYLIKPTYMAIAKASVSSSNASSSIASS------
A0A349BQG7      IFEIIWARKWVIIQAFIVITLTAFIGSYLIKPTYMAIAKASVSSSNASSSIASS------
A0A1G1HPN4      IFEIIWARKWVIIQAFIVITLTAFIGSYLIKPTYMAIAKASVSSSNASSSIASS------
A0A354F6L6      IFEIIWARKWVIIQAFIVITLTAFIGSYLIKPTYMAIAKASVSSSNASSSIASS------
A0A1G1HUY8      IFEIIWARKWVIIQAFIVITLTAFIGSYLIKPTYMAIAKASVSSSNASSSIASS------
A0A419FND3      YFEVILRRKWIVLGFLLTVVMTVALLSFLTKPLYKATTTLQI--KSENTNILTF-KDVYQ
A0A1G1GFA6      YWRVLSKRRYAAIIVFAFIVGIVTVYSFVATPVYKGSAQILINLEKNPTMTFSEGDVAYL
A0A1G1HA47      YLNVILKRKRIVLVFSICIVIITVILTFMMTPLYKSTAVVRI--EGESPNVLSV-NGVTG
A0A1G3XRU6      YLHILLRRKWTFITFFIVIITTVLIGTFMTTPIYRSTATIKI--DRENPQVLKF-EDIYK
A0A7C1ANF2      YIHVVLRRKWIVLLFFISVVVTVSLATFMMKPLYKSTVTIKI--DKEDPRVLSF-EDAYR
A0A7C5SCK5      YLNVIRRRKWIVIIFLLSVFVTVTLFTFMAIPQYKATTVIKI--DKEAPRILSF-ADV-E
A0A3N5I7D6      YWTAIYRRKFLVLAVAALGALAGYIKNLPQQPVYQAVATLEVQDKNESFLNIGD-LDPNA
A0A0S8DH48      YLRVVHKRRWTIIATFVIVLLTVAINVFTEEPLYQANARMII--EKSNPNIVSI-QEVMA
A0A0K2GIJ9      YASACRQHARLIVLIGCGFAAAAGMWSVLQTPVYQSRATVVI--ESQAPGGLEK-DKSYY
D8PGN0          YATACWRHRWLIVLVVGCFGIGAAVWSFLQVPVFQAKATVVI--DNPTPGGLDK-DKSFY
A0A136JVD6      YATACWRHRWLIVLVAGCFGFGAAVWSFLQVPVYQAKATVVI--DNPTPGGLDK-DKSFY
A0A3A0BU62      YATACWRHRWLIVLVAGCFGFGAAVWSFLQVPVYQAKATVVI--DNPTPGGLDK-DKSFY
A0A532DAI5      FIFLCRRRWLLIGTMTAGCTLAAMAWSFTQTPVYQGKATVAI--DQQNSGILER-DKVHA
A0A525WL30      YVGACRRRIWLIVAFAGGVAVVAAVWSLLQTPLYQAKATVVV--NQEGPSALDK-DRGY-
A0A532DDN0      YARACRRRIKLIVACAVGFAVVAAVWSLMQTPLYQSKATVVV--NQEGPSALDK-DRGY-
A0A0S4L511      YAGACRRRVWLIVVIVVGCAAAAAVWSFMQIPRYQAKATVVV--EQVGRSGLEY-DRDYR
A0A532CR46      YAGACRRRVWLITAIAAGVAGVAAVWSFLQTPQYQAKATVVV--EQVGPNGLQN-DRDSR
A0A3A4W5D3      YLEVLIRRKWVVIIFFTVLVATVAVSTYRMTPIYESDTTLLI--EEKEPWEGTN-ILTEF
A0A533Z444      YWQVVLKRRWTVLVCLVVVFTTVAIGTLKKRPVYEGKVLLEINPEEPQVLNFRE-VSQEA
A0A7C1TP87      YIEVLIRKKWIVITCFAVVVLATGIATYLATPVYEATTSILI--EEAQSGGGEA-LFTEL
                       .                       * : . .   :                  

A0A7C1A2W1      MGLNDYHSYKEYYETQYQLIKSRTLLKKV-----------------ADSLGLA-------
A0A7C5S9N9      YLPYD----PEFYETQYQLIKSVSVAERV-----------------VKMLGY--------
A0A7C1NP38      IDSTS----LEFYQTQYNILESRFIAREV-----------------IEKLGLWAYGELTD
A0A7C1NJJ1      FTVYD----PEFYATQYLIIKSRPVARKVYDSLKDNGLFIKHFEESPGEGGLKAMIKGLL
A0A1G1E4S2      LGMED----IAPSLSRFSVDSMENVIAQV--------TLLPYMENMIGKLQLR-------
A0A349BQG7      LGMED----IDPSLSRFSVDSMENVIAQV--------TLLPYMENMIGKLQLR-------
A0A1G1HPN4      LGMED----IAPSLSNFSVDSMENVIAQV--------TLLPYMENMIVKLQLR-------
A0A354F6L6      LGMED----IAPSLSNFSVDSMENVIAQV--------TLLPYMENMIVKLQLR-------
A0A1G1HUY8      LGMED----IAPSLSNFSVDSMENVIAQV--------TLLPYMENMIGKLQLR-------
A0A419FND3      GEMPA----EEYYETQYNILKSRNLAKRA-----------------VTKLPP--------
A0A1G1GFA6      QMKDS----DDYFRTQIEILNSRGFADKV-----------------VKKLLL--------
A0A1G1HA47      VPLG-----ADYYQTQYEILKSQSLAEKV-----------------IRNLSL--------
A0A1G3XRU6      IEMGE----DDYYQTQYKILKSRNLAKRV-----------------IRTLKL--------
A0A7C1ANF2      IERVE----TDYYQTQYKILKSRNIAKRV-----------------IKKLGL--------
A0A7C5SCK5      IDRPD----ADYYETQYKILKSRAIAKRV-----------------IWKYNL--------
A0A3N5I7D6      QRYSA----DSKLLTEMKMLEGRQLRQRV-----------------HDKLAL--------
A0A0S8DH48      IDTWD----PDYKETQYKIIESRSVARRV-----------------IKKLNL--------
A0A0K2GIJ9      HLDNS----PEYFQTHFELLKSHQVIRRA-----------------VDQLKL--------
D8PGN0          P-DNS----PEYFQTHFELMKSHFVLQRT-----------------ARLLDL--------
A0A136JVD6      P-DNS----PEYFQTHFELMKSHFVLQRT-----------------ARLLDL--------
A0A3A0BU62      P-DNS----PEYFQTHFELMKSHFVLQRT-----------------ARLLDL--------
A0A532DAI5      SPDVT----PEYFATHFELMRSRTVLQRT-----------------AQRLNL--------
A0A525WL30      NPDLT----PEYFQTQFELMKSHHVFLRT-----------------AQLLHL--------
A0A532DDN0      NPDLT----PEYFQTQFELMKSHHVFQRT-----------------AQLLHL--------
A0A0S4L511      QGDLS----PEYFQTQFELMKSHYIFQRT-----------------AQLLHL--------
A0A532CR46      QSDLS----PEYFQTQFELIKSHHVFQRT-----------------AQLLHL--------
A0A3A4W5D3      AGM-K----PSKVQTEIEMIKSRTIAEKV-----------------VKKLY---------
A0A533Z444      PTVDV----DSYRETQYKVLRSRTLAEKV-----------------VNDLHL--------
A0A7C1TP87      AGLPR----NSEIPSQIEIIKSRTIAEEV-----------------VRDLK---------
                              :   :     .   .                               

A0A7C1A2W1      ---RDNHDVETGP-----------------------------------------------
A0A7C5S9N9      ---DKNPDLFFSL--------DKRGDSFISDVLAWAGNLFSLFVRNNEDVPEKANDKNPS
A0A7C1NP38      GRGAPDTEGLSQE-----------------------------------------------
A0A7C1NJJ1      SGGAPEDEGADPE---------AAKRTLIVETILENIL----------------------
A0A1G1E4S2      ---NEENELMLPQ---------NLISTGILYQIRSSIF----------------------
A0A349BQG7      ---NEENELMLPQ---------NLISTGILYQIRSSIF----------------------
A0A1G1HPN4      ---NEENELMLPQ---------NLISTGILYQIRSSIF----------------------
A0A354F6L6      ---NEENELMLPQ---------NLISTGILYQIRSSIF----------------------
A0A1G1HUY8      ---NEENELMLPQ---------NLISTGILYQIRSSIF----------------------
A0A419FND3      ---EKASEAAPVE----------------GPSMMQAVFGSIFNFGEKPENG---REDERE
A0A1G1GFA6      ---DKNPYYLEKK---------SKPDNGMINKIKDTVFMLFPGRTKPDNPFPESLAQREI
A0A1G1HA47      ---DKNKDFLPVQ--SIPDKAKELIFNNTLGLLSRLYSSFIVSDHPVREGPVQKVSPSEN
A0A1G3XRU6      ---GEEPEFGG-----------------NAGLSHKVAS--VASVDVSKQNMSE-------
A0A7C1ANF2      ---DSSKEFTAGD--RGVS---------LKGIIFSLVS--FVGRDKSREKHVVED-----
A0A7C5SCK5      ---DKDPNYLPVK--SEIDKAVSRVKRFFTGALDSIYN--LVNRTQRRSTRQDNNTAAKD
A0A3N5I7D6      ---QSDDAPLLPD---------DQLSKWLNSIGFDAIGESPTRA----------------
A0A0S8DH48      ---AESEEFNPAPKTGVIVSLKSSIRGMLSSLKKAVKGLIKTEPKVAQKPG---LMSDEE
A0A0K2GIJ9      ---SNRPEYQPQP---------S----LLDKVLPKWVQ-AWWQPKKKEGPL---AEEAEQ
D8PGN0          ---AERPEYQPKP---------SAIKQFLKSLLPDSVL-AFVKPVKKEAVD---SVDDAE
A0A136JVD6      ---AERDEYQPKP---------SVIRQFVKSLMPESVL-AFVRPPKKEEVD---PADDAE
A0A3A0BU62      ---AERDEYQPKP---------SVIRQFVKSLMPESVL-AFVRPPKKEEVD---PADDAE
A0A532DAI5      ---KAQPEYNPAL---------AKKKSWSFTLWPSSAH-EREAAKSDEPAL---SPEAAE
A0A525WL30      ---SERPEYKPNP---------SALQSLLSSIFPAPPSLDAVGPKNGASEP---SSEEVD
A0A532DDN0      ---SERPEYKPNP---------SALRSLVGGLMPAPPTMDVRAPNNGATEP---PSEEVD
A0A0S4L511      ---SEQPEYKPRP---------SILSSTMGDILPAAVA-GVVGFKGDVDAQ---VLGDED
A0A532CR46      ---SEQPEYQPKP---------SILSSMVGGIIPTADA-DIVAQKEGA-----------D
A0A3A4W5D3      ---YDINIFDVSG---------NLNPQITDVTIPDNRIGKIFAVTFQDNERFIVTDDSLD
A0A533Z444      ---YQSPEFYRYR---------GLF----------GLYESDPEKIPSSDPG---PPDTST
A0A7C1TP87      ---YDTKVFDLSR---------DLSVDVEGLEVPEDLMDEEIEVEFDDDKG---GFTVSV
                                                                            

A0A7C1A2W1      ----------------------------------------------VERLMRSVDVIPVK
A0A7C5S9N9      E-------------------------------------------VIVKTISSGISVRPIK
A0A7C1NP38      ---------------------------------ESRKLDLAAREIVITSFLERFDVKPVR
A0A7C1NJJ1      -------------------------------------------------------VRPEV
A0A1G1E4S2      -------------------------------------------------PVRHIEVLPYK
A0A349BQG7      -------------------------------------------------PVRHIEVLPYK
A0A1G1HPN4      -------------------------------------------------PVRHIEVLPYK
A0A354F6L6      -------------------------------------------------PVRHIEVLPYK
A0A1G1HUY8      -------------------------------------------------PVRHIEVLPYK
A0A419FND3      A-------------------------------------------AQINSFIKRIEIQPIK
A0A1G1GFA6      DP------------------------------------------ELVDIILSEMRVETGK
A0A1G1HA47      --------------AIPT--------------------------YLINSLIDRLEVTPIK
A0A1G3XRU6      --------------GINK--------------------------RFVDGFLGRVTVTPEQ
A0A7C1ANF2      --------------GVDT--------------------------GIVDSFLERLDVKPLI
A0A7C5SCK5      SYEINDINNKFNELNIKS--------------------------YYVNSLLSRLEVVPIK
A0A3N5I7D6      --------------------------------------------GALEMAAATLTVSNPR
A0A0S8DH48      E--------------------------------------RLPDSGLVSAFIGRISVSPVR
A0A0K2GIJ9      E-------------------------------------------RLLKAFLNNVEIMPIR
D8PGN0          E-------------------------------------------ALIKQFAQDIEIMPIR
A0A136JVD6      E-------------------------------------------ALIKQFAQDIEIMPIR
A0A3A0BU62      E-------------------------------------------ALIKQFAQDIEIMPIR
A0A532DAI5      D-------------------------------------------RLLKQFGEHLEIMPVR
A0A525WL30      D-------------------------------------------RLLKHFSETVEIVPIR
A0A532DDN0      D-------------------------------------------RLLKRFSESIDIVPIR
A0A0S4L511      E-------------------------------------------RLLKQFAEAIEIVPIR
A0A532CR46      E-------------------------------------------RLLKRFTEAVEIVPMR
A0A3A4W5D3      KDKVIGSGRTGHPFSGGKDISFTLNNAGA-GRDASFKIKKESFYSSVNKLMAATSVAPVK
A0A533Z444      D----------------------------------------AYRNSVTHFLASVDVNPVR
A0A7C1TP87      DGEPIGTGVAGTPFRSDTGVSFELKGVSSPAKGASFKLMKVSFYKAVKDLQDRVTVSPVR
                                                                       :    

A0A7C1A2W1      KSQLVRISVEDPDPVLAAGIANTVATEYIRQNLERNISVSGNAAEWLTRKIEEQRQKLKE
A0A7C5S9N9      NSKIVEISYESTSPRLAATIANAAARAYMEQILEMKMNASRYTLQWMTKKAEEEKAKLER
A0A7C1NP38      NTQIALVSFNSKSPEMAARVANAAVQAYVDYTLTTKIKANVGASGVLRKNIQEQRKKIEE
A0A7C1NJJ1      DTRLVTVSYFSRNPELASLVVNTLANAYIEALFELRMDSSQRALQWMSRKVEEERIKLDD
A0A1G1E4S2      ETNMFQINATSRDPEEAMMMANTLAGVFISELQKLTRQEANSARIFIEDQITKIRGEWLS
A0A349BQG7      ETNMFQINATSKDPEEAMMMANTLAGVFISELQKLTRQEANSARIFIEDQITKIRGEWLS
A0A1G1HPN4      ETNMFQINATSKDPEEAMMMANTLAGVFISELQKLTRQEANSARIFIEDQITKIRGEWLS
A0A354F6L6      ETNMFQINATSKDPEEAMMMANTLAGVFISELQKLTRQEANSARIFIEDQITKIRGEWLS
A0A1G1HUY8      ETNMFQINATSKDPEEAMMMANTLAGVFISELQKLTRQEANSARIFIEDQITKIRGEWLS
A0A419FND3      KSQLINISFVSRDPAFASLAANTLADEYINFSLESKVGPTLVARKRLEEQVEATRSRLEA
A0A1G1GFA6      EGNIIKIHYLSENPNVAVAMANGIAAAYIEHNMYIRIKPFRDAVEWLSARMVELRAKVES
A0A1G1HA47      NSQLVKVSFLSDDPEISMNVTNAVAESFIQLDLESTVGASKDARDFLKEQIEIMKDKVEE
A0A1G3XRU6      RSRLVKVSFDSPNQELSAKVANEIAKLYIQFSIESRFEATQQARDWLQEQLEDMKAKVER
A0A7C1ANF2      KSQLVKVSFEAYDPELAKKVANSVAETYIDFNLDSKIEASRQARKWLEKQIEIMKAKVEE
A0A7C5SCK5      KSRLVEVSFISHDPRLSQKVANAVAEAYIDFNLESKLNASVEAQKFLQKQIDNMKAKVEE
A0A3N5I7D6      MTRIVHLQSDSTDPIVASDFVNTLAQTYIDYTIENRLDSYQKVGLWLNQQLSDIQSTLQK
A0A0S8DH48      DSRLVDIGFTARDPEVAVRTVNALAQAYIDHNMELRLGTIQDAMAWMNERIEEERRKVEA
A0A0K2GIJ9      GARLAHVTVSSVDPAFAALAANTLVSVYVERNQELSSIAREQAARWFTTHLEGLREKVQA
D8PGN0          GARLAHVTANAIDPELAAQIANTLVSVYIERNQELSTNSKEQAAQWFTGHLEELRQKVQN
A0A136JVD6      GARLAHVTANAIEPELAAQIANTLVSVYIERNQELSANSKEQAAQWFTTHLEELRQKVQN
A0A3A0BU62      GARLAHVTANAIEPELAAQIANTLVSVYIERNQELSANSKEQAAQWFTTHLEELRQKVQN
A0A532DAI5      GARLAHILAQSEDPALAALAANTLVNVYIERTQELSAKSTENSAAWFMTHVDELRKKVEA
A0A525WL30      GARLAHVVATSEDPKFAAQVANTLASVYIERTQELNALSKEKAVQWFTNNLEGLRKKAEA
A0A532DDN0      GARLAHVIATSEDPKFAAQTANTLASVYIERTQELNALSKEKSVQWVTGNLDGLRKKAEA
A0A0S4L511      GARLAHVMATSNDPEFAARIANTLASTYIERTQELNALSKEKAAAWYIAHLDELRKKAED
A0A532CR46      GARLAHVIATSEDPQFAALIANTLASTYIERTQELNAVSKDKAAQWFTTHLDELRKKAEA
A0A3A4W5D3      STNVVKISTRDSNKQMAADMANSIVEFYRQHDIRARSQQALQVIHFVDKQLDTVQGKVDD
A0A533Z444      RSNLVEVTFDSYSSKVAALAANKLADDYVEQNLEVKWDAAEKASQWLQGKNVEIKAKLEK
A0A7C1TP87      NTNVVYIKVQESDPARAADIANSIVRHYIKQDISRRSKEATYMIKFVKKQIEPTQKKLEN
                  .:  :     .   :   .*  .  :                     .    .     

A0A7C1A2W1      AELALAKYRMQHNINILPQSGA--------------------------------------
A0A7C5S9N9      SEKALQEYMKKNDIVTLENR----------VTVIPQKLAELSTELVKAETKRKELEVLYR
A0A7C1NP38      SEKLLFEYKEKFKIISLEEE----------ENITIQKLAAHSKNLVNAENVRIEAQSKYQ
A0A7C1NJJ1      SESGLQAYMKANDIVTLEGR----------VAIVPQKLLELSTQLTRSETRRKELETLRN
A0A1G1E4S2      SLEGLKEFQKTNKTVNLDQE----------ISIAIAKMSEL---MKQKEDNIIDLAEEEA
A0A349BQG7      SLEGLKEFQKTNKTVNLDQE----------ISIAIAKMSEL---MKQKEDNIIDLAEEEA
A0A1G1HPN4      SLEGLKEFQKTNKTVNLDEE----------ISIAIAKMAEL---MKQKEDNIIDLAEEDA
A0A354F6L6      SLEGLKEFQKTNKTVNLDEE----------ISIAIAKMAEL---MKQKEDNIIDLAEEDA
A0A1G1HUY8      SLEGLKEFQKTNKTVNLDEE----------ISIAIAKMAEL---MKQKEDNIIDLAEEDA
A0A419FND3      SERQLNDYIARGQIVFLGKKGDD-------ESLLNQKLAELSRELDTATANRISREAVYQ
A0A1G1GFA6      SERTLQKYKEERGIASFETR----------ENIIAQKLQELVSEVVRIEGRRQEAEIRYN
A0A1G1HA47      SEKRLNDYASKKEIVFDKAD----------QNLITQKLSDLSAALNSITAERMQKEGLYR
A0A1G3XRU6      SEEALNKYAADNGIIFLTEGETTETKTVQGQNIITRKLAELSTELVQATSDRISKEALYR
A0A7C1ANF2      TEERLNEYSSSNRMIFLDAKNDK-------QSILKEKLAEFSTALSLATTVRVQKEALYN
A0A7C5SCK5      SEEALNAYASKNQIIFLDKENSR-------NSVLIQKLSQLSSALNKATADRIQKEALYR
A0A3N5I7D6      SEDQLIKYSKESGLLL--------------TEGVDLKMNHIQTQLLDADTDVLNKKFKYE
A0A0S8DH48      SERKLQEYREQEGIVTEFSGEV--------ETVTAQKLAQLNSQVVQAESSRVEAETRYK
A0A0K2GIJ9      AQEALYLYRAKHGLLT--GEER--------KSLAGQTMAELNSQLVKTEMAKAAAYSRLQ
D8PGN0          SQQALYLFRAKHGLLT--GEER--------KTVAAHTLAELNSQLVKTEMAKAEAHSRFL
A0A136JVD6      SQQALYLFRAKHGLLT--GEER--------KSVAAHTLAELNSQLVKTEMAKAEAHSRFL
A0A3A0BU62      SQQALYLFRAKHGLLT--GEER--------KSVAAHTLAELNSQLVKTEMAKAEAHSRFL
A0A532DAI5      SQQALYVFRTKHGL-----RDA--------RSGAGQQMGELESELVKAEMKKVEAQSRFQ
A0A525WL30      SQQALYLFRVKHGLLG--GRDR--------QSVTAQTNSDLDSELVKAEMKRAEAQSRME
A0A532DDN0      AQQALYLFRVKHGLLG--GRDR--------QSVTVQTNSELDTELVRAEMKRAEAQSRME
A0A0S4L511      SQQALYQFRLKHGLMG--GREQ--------QTARAHTNTELDSELVRAEMKQAEAKSRLE
A0A532CR46      SQQTLYLFRVKHGLMG--GREQ--------QTVRTHTNTELDSELVRAEMKLAEAQSRVE
A0A3A4W5D3      SLSALAEYKSSAGVTD--LGEG--------TRAIIKNVTDLEKARAQLQVEKYQVGSLYE
A0A533Z444      AEDELQAYAQANSIVY--ITEK--------QNMATARLEEL----LEAYTKAQSERFEKE
A0A7C1TP87      ALEALAAHKRRSKVVD--LKEG--------TKNLIGTIGDLEKKKVDLEIKEEQVRYLRD
                :   *  .                                                    

A0A7C1A2W1      -------------------------------QSAVEDIKAEYAR----------------
A0A7C5S9N9      RVRKYRKHP-----------EKAETMPAIASDPTVQSLREQILK----------------
A0A7C1NP38      VAVGMLVDG-----------DLAGSIPEVMSNGFITKLKMTEAV----------------
A0A7C1NJJ1      KIRSLKAAGK----------DLDSLPAIASDKTVASLRGQVLKGEQRITEFSKKYGQKHP
A0A1G1E4S2      RLKALKGQGNIKG-------DLGITPEALVDNPQIKILMDRLAG----------------
A0A349BQG7      RLKALKGQGNIKG-------DLGITPEALVDNPQIKILMDRLAG----------------
A0A1G1HPN4      RLKALKGQVNIKG-------DLGITPEALIDNPQIKILMDRLAG----------------
A0A354F6L6      RLKALKGQVNIKG-------DLGITPEALIDNPQIKILMDRLAG----------------
A0A1G1HUY8      RLKALKGQVNIKG-------DLGITPEALIDNPQIKILMDRLAG----------------
A0A419FND3      EAK-----------------RSGTNYNFVLENPLIQALTKDYIG----------------
A0A1G1GFA6      QIKSVIDSP-----------ELLATVPDVMNNLVIQGLRIEELR----------------
A0A1G1HA47      EVRE----------------S-GASNPVILGNQLILGLKKDFSS----------------
A0A1G3XRU6      EAQQ----------------GEGSLLSAVQGNPLIQTLKKDHAS----------------
A0A7C1ANF2      EIKE----------------S-GDNNPVILNNSLIQELKKRYVS----------------
A0A7C5SCK5      EIKE----------------S-GTENPIILNNALILGLKKQLSN----------------
A0A3N5I7D6      MARSL----------------DPNSVTPILEDSLVGAYRMELMR----------------
A0A0S8DH48      QALQLKDNP-----------LILDSIPEVLSNSLIQSIKKSEVE----------------
A0A0K2GIJ9      QVESALN--TQGQPGSGGGWPELDSLTQVLNSQLIQMLRAQEIA----------------
D8PGN0          QIRAVLN--PQGAGTAGVDWSKLDSQIQVLNSPLIQTLRAQEIT----------------
A0A136JVD6      QIRSVLN--PQGAGTAGLDWSKLDSQIQVLNSPLIQTLRAQEIT----------------
A0A3A0BU62      QIRSVLN--PQGAGTAGLDWSKLDSQIQVLNSPLIQTLRAQEIT----------------
A0A532DAI5      QIQSVLQGPNQNG---KIDWANLDASTEVLTSPLIQNLRAQEIK----------------
A0A525WL30      QLQSVLRNRTDRNGVIEIDWSSLDALTEVLSSPLIQTLRAQEIR----------------
A0A532DDN0      QIQSVLRNRTGQDGVIEIDWSSLDSLSEVLTSPLIQTLRAQDIR----------------
A0A0S4L511      QIESILRSRTGHNGAIETDWSSLDASTEVLSSTLMQTLRAQDIR----------------
A0A532CR46      QIKSVLRNRTDQSGVIEIDWSSLDASTEVLSSPLIQTLRGQDIR----------------
A0A3A4W5D3      EIRKNISS------------VSPSAL-SVFNDPVVENMIIRLSS----------------
A0A533Z444      SLYSLVEA------------GKIQDLPGVLSNRLVQDLEIRLAD----------------
A0A7C1TP87      AVQREITD------------TSTLNL-AVLDDPVVQSMISSLAM----------------
                                               .                            

A0A7C1A2W1      LQALLAGYSQRYTDEHPKVIEIKAQIRSLRNKID--------------------------
A0A7C5S9N9      AEQNIMELSKKYGYKHPVMKRAVSELEVLKERKT------QEIQRVIDSIKNDYELALSK
A0A7C1NP38      LLEQFSEVSRKYGSKHPQVIDLNEKIRTVRGKID------DEIFMVVDSMKSQYDVALRN
A0A7C1NJJ1      LMIESVGDLRVLREKKEQEIG--RVVKSVENEYDLALSNERNIRRLLSETK-----LEAH
A0A1G1E4S2      LKIELAGALATATEEHPKVIGLRMQIDRTQKELKKEMATHRELSPQIEESSRKIAALKAH
A0A349BQG7      LKIELAGALATATEEHPKVIGLRMQIDRTQKELKKEMATHRELSPQIEESSRKIAALKAH
A0A1G1HPN4      LKIELAGALATATEEHPKVIGLRMQIDRTQKELKKEMATHRELSPQIEESSRKIAALKAH
A0A354F6L6      LKIELAGALATATEEHPKVIGLRMQIDRTQKELKKEMATHRELSPQIEESSRKIAALKAH
A0A1G1HUY8      LKIELAGALATATEEHPKVIGLRMQIDRTQKELKKEMATHRELSPQIEESSRKIAALKAH
A0A419FND3      LESQYSSLLNVHKPEYPKMQRLEKQMEDLKKRIA------FEEQKIISSLDSDYRIALKR
A0A1G1GFA6      IKKDISELSEKYGPRHPHMMKIVSELNTVQKNLV------EEARKMLSAAKTEYEIAKSR
A0A1G1HA47      LEAEYYNLSKVYTPDYPKMKSLKSQMDAIQRRIE------EETSRIADSVNSDYKASVKK
A0A1G3XRU6      REAEYYQLSKKFKPEYPKMGRLKEEMDKIEARIN------TETRKIVSSIEKDFKAAQRR
A0A7C1ANF2      LESEYSNLLKIYKPEYPKMKRLKSQMNSLQKRIN------LETSNIVKSIKSDYQTAVKR
A0A7C5SCK5      LEADYYNLLNIFKPDYPKMKRLMSQMDAIRAKIK------EEKAKLIKSIESDYRAALKR
A0A3N5I7D6      KESALSELKTALKPEHYRLKRLTDELKERQKQLK------LEESKVIQRLHDEYKSAEGH
A0A0S8DH48      LYNRISELSGKYGKEHPKMKAANSELGSLQKRKT------SEINRIIDSLRNEFEVAQAR
A0A0K2GIJ9      LSSQVADLSEKYGPLHPDRAQKHAELQNLRQRIK------QEVQKIYDSLKHEYNMTVAQ
D8PGN0          VSAQVAELSEKYGALHPKLAHMKAELQDLRQRIQ------QEVQKIYDSVKHQYDMALAQ
A0A136JVD6      VSAQVAELSEKYGPLHPKLAHMKAELQDLRQRTQ------QEVQKIYDSVKHQYDMALAQ
A0A3A0BU62      VSAQVAELSEKYGPLHPKLAHMKAELQDLRQRTQ------QEVQKIYDSVKHQYDMALAQ
A0A532DAI5      ASGEVAELSDKYGPLHPKLARAKAELEDLRGRIQ------HEVEKVYDSVKHEYNAALVR
A0A525WL30      ASGQVAELSEKYGPLHPKLARADAELQDLRERIR------QEVQKIFDSVKHEYNAAVSR
A0A532DDN0      VSGQVAELAEKYGPLHPKLARAKAEMQDLRERIR------QEVQKIFDSVKLEYNAAISR
A0A0S4L511      VSGQVAELEDTYGPLHPKLIHAKAEMQDLHERIE------QEVQKIFDSVKQEYDSARGR
A0A532CR46      VSGQVAELAEKYGPLHPKLIHAQAEIRDLRERIR------QEVQKIFDSVKQDYDAARGR
A0A3A4W5D3      LEVNRQSLLSDYTEKHPQVVALSAEINALRGRAH------SSIMNILKSLENKTENLSAE
A0A533Z444      TEREYAQVTTWVKPDYPKAQQVKKQIDALQAQLD------KHKKAVVDNIVDEYRSATAK
A0A7C1TP87      LENDRKSLLAEYTERHPQVVALSAEINEIKRRIN------SSIFNILDSLRNEKESLSRE
                                         :                                  

A0A7C1A2W1      -----------GLEGVDRGSTTMEFRVLEREVQANKHMYESLLERLKEIDLSSTLNVNNI
A0A7C5S9N9      ERDLKALLARTKSEALDLNEKFIQYGILKREVETNRQLYDALMKKIKEQSVTEKIQPVNV
A0A7C1NP38      EIALKGELVRLKEESQSLGKHAVTYSVLARDVYTNKEMYEVLLKRLKETSITGGMQTTNV
A0A7C1NJJ1      ----------------GINEKFVKYNSLKREVDTNRKLFESLLQKMHKERIEEEGQTVNV
A0A1G1E4S2      LSLVNGNIEKYSSFFMSIPDKSTEMTRFKQSMGASEKIYNALLDYNYKIGIIEATTLSNI
A0A349BQG7      LSLVNGNIEKYSSFFMSIPDKSTEMTRFKQSMGASEKIYNALLDYNYKIGIIEATTLSNI
A0A1G1HPN4      LSLVNGNIEKYSSFFMSIPDKSTEMTRFKQSMGASEKIYNALLDYNYKIGIIEATTLSNI
A0A354F6L6      LSLVNGNIEKYSSFFMSIPDKSTEMTRFKQSMGASEKIYNALLDYNYKIGIIEATTLSNI
A0A1G1HUY8      LSLVNGNIEKYSSFFMSIPDKSTEMTRFKQSMGASEKIYNALLDYNYKIGIIEATTLSNI
A0A419FND3      EDVLSRAIEGLRREVLGFQQQMVQYQILKREVDTNGELYSSLLTRLKEVDVSTTLSESNI
A0A1G1GFA6      ETSLKRALDEQKQEFLDLSRKSIEFNVIAGESESNKLFYEMLLKKLQEASLSSGINISNA
A0A1G1HA47      EENLLRALNVQKQMALSFRDTISDYEVLKREVDANKDLYNTLLKRFNEVGVSAMSSATNI
A0A1G3XRU6      EDSLRSTLEKYKKEALDLNDRMVQYLILKRESDTNRELYNGLLQRLKETGVSASLTSSNI
A0A7C1ANF2      ESYLNAIFNVQKNRVMEFQKKMVQYHILKREVDTNKELYNNMLQRLKEVAVSATMRATNI
A0A7C5SCK5      ENYLKESFEAYKKKLLEFQNKTVQYQILKREVDANKELYNSLLQRLKEIRVSATKTATNI
A0A3N5I7D6      RDVLLGAYREQADAVAGQGEKLIYYNMLKREVEASRELYSSMSKQVKQASIASALAASNV
A0A0S8DH48      EASLKAALERQKQESLELNKKAIEYSVLKREAEGARELYDLLIRRFKETSVTEEIDAGNI
A0A0K2GIJ9      ERAVQAAIARYGNDKIRLEKNEIEHGMLEREAESSLHVYNLFLKATKESDLSAGMQTNNV
D8PGN0          DKAVKEAITRYSSDKIRLEQNEIEHSMLERDAETSQHLYDVFLKATKETDLSSGLRANNV
A0A136JVD6      DKAVKEAITRYNTDKIRLEQNEIEHSMLERDAETSQHLYDVFLKATKETDLSSGMRANNV
A0A3A0BU62      DKAVKEAITRYNTDKIRLEQNEIEHSMLERDAETSQHLYDVFLKATKETDLSSGMRANNV
A0A532DAI5      ERTIKEAVGRHRHEKIGLEQYEIERGILEREAESNQHLFDIFLKLTKEADVLAGMRSAAV
A0A525WL30      VRVIKDAAGRHRQEKILLERHEIEYGTLERDAESTQHIYNVFLKQTKETDLSVGLGSANV
A0A532DDN0      ARVIKEAAGRHRQEKILLERHEIEYGTLEREAESTQQIYNIFLKQTKETDLSAGLVTANV
A0A0S4L511      VRVIKEAASRHRQEKIKLEQYEVDYGILEREAESTQHLYDIFLKQTKEADLSAGLRSANV
A0A532CR46      VRVIKEAASRHRQEKIKLEQYEVDYGILEREAESTQHIYDIFLKQTKEANLSAGLPTANV
A0A3A4W5D3      IERFKTQLRELPDREKKLADL-----TRNVEVSSSLHKF--LMEKVNEANIMSASTLSQT
A0A533Z444      EQYFAQAVEDQKREVNEIAARSIQYNILKREVDSNRQLYEGLLQRMKEAQASAGLRASNI
A0A7C1TP87      IARLRAELKVLPEEEKRLAGL-----VLNKEVLSNINAF--LFQKLNEATITQASTISSI
                                              .       :  :     :            

A0A7C1A2W1      SIIDSAQVPNRPVKPNIPLNMALSVMAGLVMGAGLGFFVDYLDTTIKSPQDVKDIL-ESY
A0A7C5S9N9      WIVEKAEIPESPVKPRKALNLLLGIIVGLFGGIGIAFFIEYLDNTIKSPDDAEARL-GKP
A0A7C1NP38      RVLDEAIPPTIPFRPRRMLNILLAIVLGLFMGPVVAISFEYMDSSVKTPEDIERYL-RIP
A0A7C1NJJ1      MLVEAAETPSYPERPKKAFNLIIGFMIGILGGAMLAFFFEYFDNTVKAAEDAEEKL-GIP
A0A1G1E4S2      RLLEPAGVPLFPFKPNIFLNTILGAFLGLMSGVGLAFFSEYMDDTIKSPGDIEAYD-NTP
A0A349BQG7      RLLEPAGVPLFPFKPNIFLNTILGAFLGLMSGVGLAFFSEYMDDTIKSPGDIEAYD-NTP
A0A1G1HPN4      RLLEPAGVPLFPFKPNIFLNTILGAFLGLMSGVGLAFFSEYMDDTIKSPGDIEAYD-NTP
A0A354F6L6      RLLEPAGVPLFPFKPNIFLNTILGAFLGLMSGVGLAFFSEYMDDTIKSPGDIEAYD-NTP
A0A1G1HUY8      RLLEPAGVPLFPFKPNIFLNTILGAFLGLMSGVGLAFFSEYMDDTIKSPGDIEAYD-NTP
A0A419FND3      QILDRAEVPGSPFKPLKAQNMALSLIVGLLGGVFFAFFAEYFDNTVKNADDIEKKS-RLP
A0A1G1GFA6      QIIDNAVTPKSPVSPRRGLYIFLAAIAGVFGGVFAAFFVDYLDDTIKGQADVDSIL-GLP
A0A1G1HA47      QLLDRAVYPKAPYKPNVPFNFLLSLFFGLTGGVGLAFLAEYFDNTVKDTDIIERKI-NLP
A0A1G3XRU6      QVLDWAEVPQSPHKPRKTLNLLLATIIGLFGGIGLSFFVEYIDNTIKTPEDLEKTI-SLP
A0A7C1ANF2      QILDRAEYPKSPYKPNKPLNILLSIVLGLFGGVGLAFFMEYFDNTVKDPQDIEKRM-NLP
A0A7C5SCK5      QILDRAELPKRPFKPNKVRNLLLAIVMGLMGGIGLAFFVEYFDNTIKDVDEIERKA-NLP
A0A3N5I7D6      TFVDRSDPPVKPYKPQALREVVLGGSVGLFLGVVLVFVRRTTDQKFRSPGEVSLCL-NTN
A0A0S8DH48      RIIDRA-EYAYQVSPNTRRDMRLAAVIGLMLGLGLAFFIEYLDNTIKSPEEVEPYF-KVP
A0A0K2GIJ9      YLADPATPSAVPAKPKTKLNIVLALMTGLMSGVGLAIVLEARNKKLQDPGDVERYLPEVS
D8PGN0          YLADPAAPSSVPSKPRTKLNIMLGLLAGLMSGVGLAIFVEGRSKKLMAPADVERYLPNVS
A0A136JVD6      YLADPAAPSSVPSKPRTKLNIMLGLLAGLMSGVGLAIFVEGRSKKLMAPADVERYLPNVS
A0A3A0BU62      YLADPAAPSSVPSKPRTKLNIMLGLLAGLMSGVGLAIFVEGRSKKLMAPADVERYLPNVS
A0A532DAI5      YLADPAAPSSIPVKPRKVLNTALGLLLGLMSGFGTAMFLDFRKRILRVPDDVERFMPSVS
A0A525WL30      YLADPAVPSSIPVKPKKQLNTILGLLLGLMTGVGLALVLEARDRTLKGPTDLERYLPKIS
A0A532DDN0      YLADPAVPSSIPVKPKKQLNTLLGLVLGLMAGVGIALVLESRDRTLKGPDDLEQYLPRVS
A0A0S4L511      YLADPAVPNAIPVKPKKQLNIMLGLLVGLMTGVGLALFLEARDRTLRGPDDLGRYLPKVS
A0A532CR46      YLADPAVPSSIPVRPKKQLNIIVGLLVGLMTGIGLALFLEVRDRTLKCPDDLGRYLPKVS
A0A3A4W5D3      QIVDEAVASLRPVMPNVMLNIILSMIVGLIGGMALAFFIDYLDNSIKFTYDVEKRL-GLP
A0A533Z444      RVVDAAETPKYPAKPKVLLDLILGVMLGLGLGVGMAFFQEYLDKTLKTSDEVERLL-RLP
A0A7C1TP87      QVVDPAIVPDVPIKPNKKRNILLAVVAGLMSGIGLAFFFDYLDSSIKTPRDVENRL-GLP
                 . : :        *       :.   *:  *    :     .  .              

A0A7C1A2W1      FLGSIPKITGGDKAKRDR------------------LVHLQP--------------NSPI
A0A7C5S9N9      VLGVIPLLKEKGKTIED-------------------IVLKEP--------------RSSF
A0A7C1NP38      YLGPLPDFHGQESERAGG-------------RSTMLVTSLDP--------------KSVP
A0A7C1NJJ1      VLGMVSHLRREKKGKERH------------------IERIVI--------------EEPK
A0A1G1E4S2      LLGTIYNY---GKALPQL------------------ISGMEI--------------RSPA
A0A349BQG7      LLGTIYNY---GKALPQL------------------ISGMEI--------------RSPA
A0A1G1HPN4      LLGTIYNY---GKALPQL------------------ISGMEI--------------RSPA
A0A354F6L6      LLGTIYNY---GKALPQL------------------ISGMEI--------------RSPA
A0A1G1HUY8      LLGTIYNY---GKALPQL------------------ISGMEI--------------RSPA
A0A419FND3      VLGLVPISKTDPKALTG-------------------SAGPGD--------------GMPF
A0A1G1GFA6      FLGLVPAAKGTG----------------------PLYITADP--------------RSVM
A0A1G1HA47      TLGIIPDFEIATQKARFQVIDKISPRKGTAPSRLPMPLHPQK--------------GGPV
A0A1G3XRU6      SLGVVPNLGKQSDRSSI-----------------SMITFEDK--------------KSPL
A0A7C1ANF2      ALGLIPLYAS-SDPSER-----------------LLITHSDN--------------KGHI
A0A7C5SCK5      MLGIIPYNKKYGSPASRDVKDDV-----------PMIPFKDN--------------PNPV
A0A3N5I7D6      ELGAVPSVEGLRENGTLQIRMRFSGGKPGS----TLPLFPSTLRKNSKEIEVWSARKSLF
A0A0S8DH48      LLGVVLGHQVKGRREEDM--------NKKD----ELVTLKDP--------------KSAV
A0A0K2GIJ9      LLGVVPLLPKASTPEKA-------------------LVHPDA--------------MSPA
D8PGN0          LLGVVPLLSKSAAQEKA-------------------LAPPNA--------------LTPV
A0A136JVD6      LLGVVPRLSKAAAQKKA-------------------LAPPNA--------------LTPV
A0A3A0BU62      LLGVVPRLSKAAAQKKA-------------------LAPPNA--------------LTPV
A0A532DAI5      LLGVVPIFNK-QSGNGRL------------------LQSADS--------------SSPV
A0A525WL30      LLGVLPLLPKTGTGDSAH------------------LLTDQS--------------SGAT
A0A532DDN0      LLGMVPLLPKAETGERAQ------------------LTSDQS--------------SGAT
A0A0S4L511      LLGVMPLLPKTKIGEGVS------------------LLTQQS--------------SGVA
A0A532CR46      FLGTIPLMPKAKAGARAY------------------LLTDQS--------------SGVT
A0A3A4W5D3      VFGRIPVVQANKAEFITG---EEAVHANHS----SLITLESA--------------KSIT
A0A533Z444      SLGVLPRFSSNGAGELGEQGIEGAEPGPGT----AIAPAIQT--------------HAEV
A0A7C1TP87      IFGHIPLAPEEKSSRRSN--------GSVS----ALVTVEST--------------KSIT
                 :* :                                                       

A0A7C1A2W1      S---EAYRAIRTEILHLMPKDRSLAILVTSAEPKAGKTITTTNLALALCQM-GNKVLMVD
A0A7C5S9N9      A---EDYKVLRTSLLLSSAEAPPKTVLITSTGPEEGKTVTAINLATAIAQS-EYSVLLMD
A0A7C1NP38      A---EAYRSIRTSIIFSSPDDK-RTLLVTSSNPTEGKSVTSSNLAVTMAQN-GTRTLLLD
A0A7C1NJJ1      SSFAENYKALRTAIMLSSAESTPKTLLITSMGPAEGKTATAVNLALVVAQS-VGKVLLVD
A0A1G1E4S2      Y---EAFRTTRNSIRFASIDKPVKSLLITSAIAGEGKTNIVANLGISLARE-DKKVLLID
A0A349BQG7      Y---EAFRTTRNSIRFASIDKPVKSLLITSAIAGEGKTNIVANLGISLARE-DKKVLLID
A0A1G1HPN4      Y---EAFRTTRNSIRFASIDKPVKSLLITSAIAGEGKTNIVANLGISLARE-DKKVLLID
A0A354F6L6      Y---EAFRTTRNSIRFASIDKPVKSLLITSAIAGEGKTNIVANLGISLARE-DKKVLLID
A0A1G1HUY8      Y---EAFRTTRNSIRFASIDKPVKSLLITSAIAGEGKTNIVANLGISLARE-DKKVLLID
A0A419FND3      V---EAFRTIGTYIQFSNTVKPPKQILVTSPLAKDGKTMFAVNVARSLVKSSRGKGIVVD
A0A1G1GFA6      A---ESFRTIRTSVMLSSVEKPPKVIVITSTFPKEGKTTIASNLAVAMAQM-GERVLLID
A0A1G1HA47      A---EAFRSIGAFIVLSSASTPPKTILVTGPGEKVGKTTICVNIARALLES-LGKGIIID
A0A1G3XRU6      S---EAFRSIGTYIQFSSPIRPPKTMLVTSARKAEGKTSMAVNLAVTLASS-WGKGIVID
A0A7C1ANF2      A---EAFRSIGTFISLSSAARPPKTILITSPGEKEGKTTVTINTATALTNT-LGKGIVID
A0A7C5SCK5      A---EAFRSISTFILLSSADKPPKSILITSAGEQEGKTTVSTNTAMALRET-LGDGILID
A0A3N5I7D6      S---ESFQGVVTSIL--SIAEEDKCFLITSPEAGAGKTSVVSNIGMTLAEI-GYRAVMVD
A0A0S8DH48      S---ESYRGIRTRILFSSTVSQPKSILIVSAMEGEGKTISAANLAVIMART-GSRVLLLD
A0A0K2GIJ9      A---ESIRIIRTGLLLSRPDTLPSRVLITSPGDNEGKTTLAVNLALALARLERRRVVLVD
D8PGN0          A---ESFRIIRTSLLLSNPDMLPSRILITSPGENEGKTTLAVNLAMAMAQLEDTLVVLID
A0A136JVD6      A---ESFRIIRTSLLLSNPDMLPSRILITSPGENEGKTTLAVNLAMAMAQLEDTQVVLID
A0A3A0BU62      A---ESFRIIRTSLLLSNPDMLPSRILITSPGENEGKTTLAVNLAMAMAQLEDTQVVLID
A0A532DAI5      A---ESVRIIRTSLLMSNPNLLPACVLVTSPGESEGKTTLAVNLATALSQLEDTRVLLMD
A0A525WL30      A---ESIRIIRTSVLLSSPNKLPSCVLITSPGESEGKTTLSVSLAIALAQLKNARVLLID
A0A532DDN0      A---ESIRIIRTSVLFSNPNKLPACVLITSPGESEGKTTLSVNLAIAMAQLKNTRVLLID
A0A0S4L511      A---EHVRIIRTSVLLSRPDELPSCVLITSPGEGEGKTTLSVNLAVALAQLENTKVLLID
A0A532CR46      A---EHIRIIRTSVLLSSPNELPSCVLITSAGEGEGKTTLSMNLAIALAQLESARVILID
A0A3A4W5D3      A---ESFRSLRTNLQFAVMEKKGKIFHLTSSEASEGKTTITANLGITLALM-GSRTLIID
A0A533Z444      L---KAFRSLRTSILLSA-SPVPRVVLITSALPGEGKTTTAVNLGAALASL-GSKVVIVD
A0A7C1TP87      A---ESFRSLRTNLQFAVLERRGKVFHFTSAIQGEGKSTITANLGITLALM-GSRTLIID
                    :  .     :           . ...     **:    . .  :        :::*

A0A7C1A2W1      GDLRKPQIHKIFNVDRM----QGFSDYLKGKISLP----L----TIKDTDVDNFKIVTSG
A0A7C5S9N9      ADLRKPRIHKIYSLRND----KGLSTYLAGGSDIN---------IIREGPLPNLSVIPSG
A0A7C1NP38      MDFRRPVLHKIFNVPQE----KGFSNMLVGDAGVD----D----VITHTNVPNLDVIPSG
A0A7C1NJJ1      TDLRKPRIHNIFGFSNK----SGLSTYLVG--SNA----K----IIKEGPSPNINIVTSG
A0A1G1E4S2      TDLRRPRLETLMGIKNQ----SGLTNVLVGDITIE----D----AICHTSIDKVDLLPSG
A0A349BQG7      TDLRRPRLETLMGIKNQ----SGLTNVLVGDITIE----D----AICHTSIDMVDLLPSG
A0A1G1HPN4      TDLRRPRLETLMGIKNQ----SGLTNVLVGDITIE----D----AICHTSIDMVDLLPSG
A0A354F6L6      TDLRRPRLETLMGIKNQ----SGLTNVLVGDITIE----D----AICHTSIDRVDLLPSG
A0A1G1HUY8      TDLRRPRLETLMGIKNQ----SGLTNVLVGDITIE----D----AICHTSIDMVDLLPSG
A0A419FND3      ADLRRATIHSSFDLDNS----TGLSSYLSGAIGYD----D----LIKKLPHLGIDCITSG
A0A1G1GFA6      ADMRKPYIDKVFGMDNS----IGISNVIARHSDFP----DA---VRTMPDFPNLSILPGG
A0A1G1HA47      ADLRRPALHYHFNMDNS----TGLSTFLSGNMEFD----STEGVLIKPASEKGLSVITSG
A0A1G3XRU6      ADMRNPQLHKILGLDNS----KGLSSFLTGLLEFD----NG---LIQKTDIPNLDVITAG
A0A7C1ANF2      ADLRKPKIHNGFGVENS----TGLSTFLSGNMEFD----EG---LIKPTT-GVLDVITSG
A0A7C5SCK5      ADMRRPKLHRTFGVDNR----VGLSTFLSGNTHLG----NG---LIKNTDIKGLHVIPSG
A0A3N5I7D6      ADLRRPRLHKIFGLDNT----WGLSDLIDSAKPIDSYPIEA---LAKPTSVDGVFVLPSG
A0A0S8DH48      CDMRKPRMNSIFGLERE----KGVSNILVGDCSIS----D----AVHKTDIENLNLIPCG
A0A0K2GIJ9      VDFRKPNPHRIYEVGLHKTSAPGLAQLLAGQADIA----D----VVHDSFVPNLSIVPSG
D8PGN0          VDFRNQHIHPLYDVGSPEQPPKGLGHLLRGEAGLD----E----VVHQTFVKNLSVIPHG
A0A136JVD6      VDFRNQQIHPLYEVGSPEQPPKGLGHLLRGEASLA----D----VVHQTFVSNLSVIPHG
A0A3A0BU62      VDFRNQQIHPLYEVGSPEQPPKGLGHLLRGEASLA----D----VVHQTFVSNLSVIPHG
A0A532DAI5      VDFRKPTHHHIFGLHRESRNTKGLVDYLKGNAHLD----E----IIHRTDNPRLWVVPRG
A0A525WL30      ADFRKPAHRYIHGIQRDGSQTKGLAGFLSGSIKLE----E----IIHRTDIPNLSVIPRG
A0A532DDN0      ADLRKPAHRFIHGIQRDGGQTKGLAGFLAGRFELD----D----IIHHTNIPNLSVIPRG
A0A0S4L511      ADLRNPSHKYIHGVQREGIDTNGLANFLAGRASLR----E----IIYRTDLANLSVIPRG
A0A532CR46      ADLRKPTHSGIHGIQGLGLETKGLVSFLAGRANLE----E----IMYRTDVANLLVIPRG
A0A3A4W5D3      LDLRKPRIHQIFGINKE----PGITHLLTQKATAN----E----ITETASIEHLYIIPAG
A0A533Z444      CDMRRPSCHRSVGVKNS----PGFVQCLTGHVELA----EA---VLPAPVVPNLSVIPCG
A0A7C1TP87      LDLRKPRVHRIFNISKE----PGITHLLAGRSDFN----E----ILRASEIEHLYMIPAG
                 *:*.        .        *.   :                         .  :. *

A0A7C1A2W1      KVPSNPAEIISSARAEEFIREAKQRFDYILFDSSPVASVSDAVILAAKVDASIQVVRSGN
A0A7C5S9N9      PIPPNPSELLGSKRMKELLETLRGSFDVIIIDSPPVLTVSDSLVMGKMTDGVLLVTRGGK
A0A7C1NP38      HIPPNPAELLSSDGIGTFMDIFKSRYDRIVIDSPPILSATDPVIISTFVDEVLMVIKMGE
A0A7C1NJJ1      PLPPNPSELLGSEKFARFLASMQERYDVVIFDSPPVLTVTDSLVLSKYVDGTIVVARAAK
A0A1G1E4S2      TTSLDPGRVIESQKLMSLIASLSQVYDYVLLDSPPILSFDDAVIMAGYVDGTILVVESKK
A0A349BQG7      TTSLDPGRVIESQKLMSLIASLSQEYDYVLLDSPPILSFDDAVIMAGYVDGTILVVESKK
A0A1G1HPN4      TTSLDPGRVIESQKLMSLIASLSQEYDYVLLDSPPILSFDDAVIMAGYVDGTILVVESKK
A0A354F6L6      TTSLDPGRVIESQKLMSLIASLSQEYDYVLLDSPPILSFDDAVIMAGYVDGTILVVESKK
A0A1G1HUY8      TTSLDPGRVIESQKLMSLIASLSQEYDYVLLDSPPILSFDDAVIMAGYVDGTILVVESKK
A0A419FND3      PVPANPSELFNSLRMKELIDTLSGEYDYVIVDSPPVLGMSDSLVLSAFIEAVIVVVRASN
A0A1G1GFA6      RIAPDPSELLSSSLMKDLLNGLRDRFDRIIIDSPPLNAVSDPLILSSLADSVIMVIWGGV
A0A1G1HA47      PVPPNPSELLGSARMQDLLYALQATFEFILVDAPPVMGLPDAIYLSKIVDGTVLVAKAGE
A0A1G3XRU6      IIPPNPSELLGSQRLKDLLYELVPLYSFIIFDSPPLLGLSDSLILSTVSDGVIMVVRSDS
A0A7C1ANF2      PIPPNPSELLGSARMKDLLDALYSIYDFVIIDSAPVLGMTDSLYLSSFADGVVIVIRSGQ
A0A7C5SCK5      PIPPNPSELLVSKRMRELIESLSEQYNFIIIDSPPIMGMPDSVYLSSIVDGTVLVVKSGH
A0A3N5I7D6      PPHPHISRLLYSSRAREIIVRLREEFDMVLIDTPPLLKVADARVLARYVDDTILVLRAGK
A0A0S8DH48      QIPPNPSELLGSKAMREMLATLGRSYERIVIDSPPITAVTDAVVLSKAVDGVVVVLQANK
A0A0K2GIJ9      DRPGNPTELLHSKYLTQLLEWALRQDCHMILDCPPTLPFADTAVLASKVDGVLMVVCAGK
D8PGN0          GRPANPTELLHSKSMAQLLKWGATNRYHIILDCPPVLPIADAAVLASKVDGVLLVVSAGE
A0A136JVD6      GRPANPTELLHSKSMAQLLNWGATNRYHIILDCPPVLPIADAAVLASKVDGVLLVVSAGE
A0A3A0BU62      GRPANPTELLHSKSMAQLLNWGATNRYHIILDCPPVLPIADAAVLASKVDGVLLVVSAGE
A0A532DAI5      SAPERPSELLHSKHMTELLTWCRKEGYLVVLDAPPVLPVADPLVLASKVDGVLLVVSSGT
A0A525WL30      KRPSNPSELFHSKQMSVLLNRCREEGYHVILDAPPVLPVTDPAILASQVDGVLMVASVGQ
A0A532DDN0      KRPSNPSELLYSDQMGLLLNRCREEGYHVILDAPPVLPVTDPVILASQVDGVLLVASVGQ
A0A0S4L511      DRPPNPSELLHSKQLRELLNRCREERYHVILDAPPVLPVTDPVILASQVDGVLLVASAGQ
A0A532CR46      ERPSNPSELLHSKQMRTLLNRCRQDGYHIILDAPPVLPVTDSVILASQVDGVLLVASAGQ
A0A3A4W5D3      LIPPNPSELLSQQNLKDFLDEAREEFDYILLDSPPTLPVTDAQLLGRLADATFIVLELGV
A0A533Z444      PIPPNPAEVLSSSLAAELLRKLRAEFDYVLVDSPPLLSVADSRILATMTDAAVLVTRAFE
A0A7C1TP87      IIPPNPSELLSKQELGNFLEKARQEFDYVLIDSPPVLPVTDAQLLGRLADASFIIIKLGE
                        :: .     ::         ::.* .*     *.  :.   :  . :     

A0A7C1A2W1      APVPVVSRVKEKLANAGTKFLGVILNDLKT----YHGDYYSYKYYRYYGEGVRDRSLVR-
A0A7C5S9N9      TTYELSMRSIKSISDMKANLLGIVINAIDMKR----GEYYYYRYYNYYSDDPQEIKERPV
A0A7C1NP38      TSRELVQTAIGKLHHVKANLIGTVLNSV------DAGQGNYYQYQYYGDRQSKMEQGVFG
A0A7C1NJJ1      TSYEAVRKGLRQLNDVGSNVLGLLINAIDASKGGYYYNYYYYHNYNYYY-----------
A0A1G1E4S2      ITPQAIIRIKAIFERARLKPLGVILNKFVDRH--YSGSYYYGDYYNYYYQDRKSKWGLWS
A0A349BQG7      ITPQAIMRIKTIFERARLKPLGVILNKFVDRH--YSGSYYYGDYYNYYYQDRKSKWGLWS
A0A1G1HPN4      ITPQAIMRIKTIFERARLKPLGVILNKFVDRH--YSGSYYYGDYYNYYYQDRKSKWGLWS
A0A354F6L6      ITPQAIMRIKTIFERARLKPLGVILNKFVDRH--YSGSYYYGDYYNYYYQDRKSKWGLWS
A0A1G1HUY8      ITPQAIMRIKTIFERARLKPLGVILNKFVDRH--YSGSYYYGDYYNYYYQDRKSKWGLWS
A0A419FND3      TPADALAQTVKLLRGVNARILGVVLNG----L--DVGTRYGYPYYYQPNGRDKEGNGRTA
A0A1G1GFA6      TGRDVVKKSMQSLKGVNAKILGVVINNLAMSK--RDGYQYYYSYYSYSEGKGIEKTV---
A0A1G1HA47      TMKNELTEIKRVFRTIDAKILGVILNG-VKKC--DLKYGTYNYYYSSYYSSYFKDKVS--
A0A1G3XRU6      TPKEAALQARKSLQGVNAKILGVVLNA-IKQS--NLKYGSYSYYYSYYYGEEDDHKGKKK
A0A7C1ANF2      TPRDALTETKRMLNRINAKILGVVING-IKEK--DLRYGSYSYYYSSYYKEH--------
A0A7C5SCK5      TQKNVLKETKKILRNINAKVLGVVLNG-IRKD--DIKYGYYSNYYSSYFKEE--------
A0A3N5I7D6      TSRAMGAAAYSQLVQDGRSVLGTILNDWNPKM--DVPYGYSSRLYQEGYGATPKSGSASP
A0A0S8DH48      TERVLAKRAIEQMQAVNAHIFGIILNR-LDER--MTKYYHLYSYFYRDYSEEKNLEEKSH
A0A0K2GIJ9      TTREACRLAIQRMAFAGGKMLGVVMQK-ARVE--DSPY-----YTAYYQEQA--------
D8PGN0          TTRDACHLAVQRIKQAGGRLLGVVMQK-APVA--ESSY-----YYGAYQQQR--------
A0A136JVD6      TTRDACHLAIQRIKQAGGRLLGVVMQK-APVA--DSPY-----YYGAYQQQR--------
A0A3A0BU62      TTRDACHLAIQRIKQAGGRLLGVVMQK-APVA--DSPY-----YYGAYQQQR--------
A0A532DAI5      TTMEACRTAIQRLTLAGGKILGAVMQK-TAPR--DVPY-----YYSYGSTSDR-------
A0A525WL30      TTREACRLAIQRLTAAGGNILGIVLQN-VQVP--ESSY-----YCHVPEEGDQAEENGVF
A0A532DDN0      TTKEACRLAIQRLTAAGGKILGIVLQK-VQVP--DNSY-----YCHLPEETDEAVENGVA
A0A0S4L511      TTREACRAAIDQLTSAGGRILGIVLQK-VRVS--TNLY-----PSYV---GKKFEENGIP
A0A532CR46      TTRGACRSAIDQLTSAGGKILGIVLQK-VPVP--NNPY-----YAYL---DEKPAKKGIV
A0A3A4W5D3      TKLPAAEQTIRKFRSVGVNVAGAIINK-DR-P--SNGYGYYNYYSY-YYGDDAPTGNGKK
A0A533Z444      TPYDLVCRARSLLYSAGARILGVALND-VDLR--REGYGHNGSYGYGYTGYRAPGSEGS-
A0A7C1TP87      TSFHAVEHAIKQLRSVNVNVAGTIINK-IK-P--SAGYGYYHNYYYYYYGDDSPEEKKA-
                            :        *  ::                                  

A0A7C1A2W1      ------------------------------------------------------------
A0A7C5S9N9      EGMRRLRWLYVPLLVIILGLLAIIIKSYVMAGNPGTPVRSGNLERRGTAVIADERQRPEE
A0A7C1NP38      RLFLMHK-----------------------------------------------------
A0A7C1NJJ1      -----SAGEEEGEE----------------------------------------------
A0A1G1E4S2      GKLLGAIGNKKGHS----------------------------------------------
A0A349BQG7      GKLLGAIGNKKGHS----------------------------------------------
A0A1G1HPN4      GKLLGAIGNKKGHS----------------------------------------------
A0A354F6L6      GKLLGAIGNKKGHS----------------------------------------------
A0A1G1HUY8      GKLLGAIGNKKGHS----------------------------------------------
A0A419FND3      GR----------------------------------------------------------
A0A1G1GFA6      ------------------------------------------------------------
A0A1G1HA47      ------------------------------------------------------------
A0A1G3XRU6      RREKGDKA----------------------------------------------------
A0A7C1ANF2      ------------------------------------------------------------
A0A7C5SCK5      ------------------------------------------------------------
A0A3N5I7D6      PASGSA------------------------------------------------------
A0A0S8DH48      RKFWKMKEKKRKEKERRKTSMIT-------------------------------------
A0A0K2GIJ9      ------------------------------------------------------------
D8PGN0          ------------------------------------------------------------
A0A136JVD6      ------------------------------------------------------------
A0A3A0BU62      ------------------------------------------------------------
A0A532DAI5      ------------------------------------------------------------
A0A525WL30      SDADHWTSSSK-------------------------------------------------
A0A532DDN0      PEADEWTSSSKF------------------------------------------------
A0A0S4L511      L-----------------------------------------------------------
A0A532CR46      G-----------------------------------------------------------
A0A3A4W5D3      PLFKFWKKAGQA------------------------------------------------
A0A533Z444      ------SRHGNT------------------------------------------------
A0A7C1TP87      ------------------------------------------------------------
                                                                            

A0A7C1A2W1      ------------------------------------------------------------
A0A7C5S9N9      PGYKDLSETGETANDSPPLIKRYIVTTELLNIRKNPSVLSPVVGRLKKGEAVYAIAVKDN
A0A7C1NP38      ------------------------------------------------------------
A0A7C1NJJ1      ------------------------------------------------------------
A0A1G1E4S2      ------------------------------------------------------------
A0A349BQG7      ------------------------------------------------------------
A0A1G1HPN4      ------------------------------------------------------------
A0A354F6L6      ------------------------------------------------------------
A0A1G1HUY8      ------------------------------------------------------------
A0A419FND3      ------------------------------------------------------------
A0A1G1GFA6      ------------------------------------------------------------
A0A1G1HA47      ------------------------------------------------------------
A0A1G3XRU6      ------------------------------------------------------------
A0A7C1ANF2      ------------------------------------------------------------
A0A7C5SCK5      ------------------------------------------------------------
A0A3N5I7D6      ------------------------------------------------------------
A0A0S8DH48      ------------------------------------------------------------
A0A0K2GIJ9      ------------------------------------------------------------
D8PGN0          ------------------------------------------------------------
A0A136JVD6      ------------------------------------------------------------
A0A3A0BU62      ------------------------------------------------------------
A0A532DAI5      ------------------------------------------------------------
A0A525WL30      ------------------------------------------------------------
A0A532DDN0      ------------------------------------------------------------
A0A0S4L511      ------------------------------------------------------------
A0A532CR46      ------------------------------------------------------------
A0A3A4W5D3      ------------------------------------------------------------
A0A533Z444      ------------------------------------------------------------
A0A7C1TP87      ------------------------------------------------------------
                                                                            

A0A7C1A2W1      ----------------------------------
A0A7C5S9N9      WYELYPQGSGPKADKQKVIGYVSGDYLRAEANSP
A0A7C1NP38      ----------------------------------
A0A7C1NJJ1      ----------------------------------
A0A1G1E4S2      ----------------------------------
A0A349BQG7      ----------------------------------
A0A1G1HPN4      ----------------------------------
A0A354F6L6      ----------------------------------
A0A1G1HUY8      ----------------------------------
A0A419FND3      ----------------------------------
A0A1G1GFA6      ----------------------------------
A0A1G1HA47      ----------------------------------
A0A1G3XRU6      ----------------------------------
A0A7C1ANF2      ----------------------------------
A0A7C5SCK5      ----------------------------------
A0A3N5I7D6      ----------------------------------
A0A0S8DH48      ----------------------------------
A0A0K2GIJ9      ----------------------------------
D8PGN0          ----------------------------------
A0A136JVD6      ----------------------------------
A0A3A0BU62      ----------------------------------
A0A532DAI5      ----------------------------------
A0A525WL30      ----------------------------------
A0A532DDN0      ----------------------------------
A0A0S4L511      ----------------------------------
A0A532CR46      ----------------------------------
A0A3A4W5D3      ----------------------------------
A0A533Z444      ----------------------------------
A0A7C1TP87      ----------------------------------
                                                  

© 1998-2021Legal notice