BYKdb

Dataset for cluster tadcd of phylum nitrospirae

[Download (right click)] [Edit] [Sequences] [Repertoires]

22 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1G1E4S2      --------------------------------------------------------MELK
A0A349BQG7      --------------------------------------------------------MELK
A0A1G1HPN4      --------------------------------------------------------MELK
A0A354F6L6      --------------------------------------------------------MELK
A0A1G1HUY8      --------------------------------------------------------MELK
A0A3A4W5D3      ------------------------------------------MNTIPQSYPEDKKDIHLY
A0A1G1GFA6      -------------------------------------------------MLFKNDNLHLL
A0A419FND3      ---------------MSNIESTIEKATKLRQFISPVKGETLTPENVRLYIEDKDKSPHLR
A0A1G3XRU6      --------------MSNHEEKSSSQANIQKIEEFPVSTSLNLAPEE------KEEEIHLR
A0A1G1HA47      --------------MRNRKNDDIKDR---LEIQRYDRRDLPLSTHLEYLDHKVTEEVHLR
A0A3N5I7D6      -----------MDKRRNKDSNLLSVSRPGVETSVTPYLRPAEPTVPYYGFSESKDDSALV
A0A0S8DH48      ----------------------------------MDVFRYDTQEIQ------EEPQIDVR
A0A533Z444      MSESIDAQQKRGLMQRDQGSSGESLHAIERAASRPLQDLEILDVSP------EEVPHLL-
A0A0K2GIJ9      ---------------MERRNGLPADR--------------TAPGAA------DEPEHPLR
D8PGN0          ------------------------MN--------------AKAVMS------DESEHTLS
A0A136JVD6      ------------------------MN--------------AKPMVL------DEAEQTLS
A0A3A0BU62      ------------------MVKGDSVN--------------AKPMVL------DEAEQTLS
A0A532DAI5      ---------------MNAKLDKTNVEKTHTSLALYHPMAHGNAIHE------HRHSQVFD
A0A525WL30      ---------------MDRNAEFIPHQ----------------SAQG------DAAETALT
A0A532DDN0      ---------------MDRNADFIPFQ----------------SAQG------DGPETALV
A0A0S4L511      ---------------MTRDDDSISPQ----------------SAES------NGRETVLA
A0A532CR46      ---------------MNRNEGFAPLQ----------------SVPG------DGPETVLA
                                                                          . 

A0A1G1E4S2      KIFEIIWARKWVIIQAFIVITLTAFIGSYLIKPTYMAIAKASVSSSNASSSIASSLGMED
A0A349BQG7      KIFEIIWARKWVIIQAFIVITLTAFIGSYLIKPTYMAIAKASVSSSNASSSIASSLGMED
A0A1G1HPN4      KIFEIIWARKWVIIQAFIVITLTAFIGSYLIKPTYMAIAKASVSSSNASSSIASSLGMED
A0A354F6L6      KIFEIIWARKWVIIQAFIVITLTAFIGSYLIKPTYMAIAKASVSSSNASSSIASSLGMED
A0A1G1HUY8      KIFEIIWARKWVIIQAFIVITLTAFIGSYLIKPTYMAIAKASVSSSNASSSIASSLGMED
A0A3A4W5D3      DYLEVLIRRKWVVIIFFTVLVATVAVSTYRMTPIYESDTTLLIEEKE-P----WEGTNIL
A0A1G1GFA6      DYWRVLSKRRYAAIIVFAFIVGIVTVYSFVATPVYKGSAQILINLEK-NPTMTFSEGDVA
A0A419FND3      DYFEVILRRKWIVLGFLLTVVMTVALLSFLTKPLYKATTTLQIKSEN-TNILTFKD---V
A0A1G3XRU6      DYLHILLRRKWTFITFFIVIITTVLIGTFMTTPIYRSTATIKIDREN-PQVLKFED---I
A0A1G1HA47      DYLNVILKRKRIVLVFSICIVIITVILTFMMTPLYKSTAVVRIEGES-PNVLSVNG---V
A0A3N5I7D6      EYWTAIYRRKFLVLAVAALGALAGYIKNLPQQPVYQAVATLEVQDKN-ESFLNIGD---L
A0A0S8DH48      HYLRVVHKRRWTIIATFVIVLLTVAINVFTEEPLYQANARMIIEKSN-PNIVSIQE---V
A0A533Z444      DYWQVVLKRRWTVLVCLVVVFTTVAIGTLKKRPVYEGKVLLEINPEE-PQVLNFRE---V
A0A0K2GIJ9      EYASACRQHARLIVLIGCGFAAAAGMWSVLQTPVYQSRATVVIESQA-PGGLEKDK---S
D8PGN0          EYATACWRHRWLIVLVVGCFGIGAAVWSFLQVPVFQAKATVVIDNPT-PGGLDKDK---S
A0A136JVD6      EYATACWRHRWLIVLVAGCFGFGAAVWSFLQVPVYQAKATVVIDNPT-PGGLDKDK---S
A0A3A0BU62      EYATACWRHRWLIVLVAGCFGFGAAVWSFLQVPVYQAKATVVIDNPT-PGGLDKDK---S
A0A532DAI5      DFIFLCRRRWLLIGTMTAGCTLAAMAWSFTQTPVYQGKATVAIDQQN-SGILERDK---V
A0A525WL30      DYVGACRRRIWLIVAFAGGVAVVAAVWSLLQTPLYQAKATVVVNQEG-PSALDKDR---G
A0A532DDN0      DYARACRRRIKLIVACAVGFAVVAAVWSLMQTPLYQSKATVVVNQEG-PSALDKDR---G
A0A0S4L511      EYAGACRRRVWLIVVIVVGCAAAAAVWSFMQIPRYQAKATVVVEQVG-RSGLEYDR---D
A0A532CR46      EYAGACRRRVWLITAIAAGVAGVAAVWSFLQTPQYQAKATVVVEQVG-PNGLQNDR---D
                        .                       * : . .   :.                

A0A1G1E4S2      IAPSLSRFSVDSMENVIAQVTLLPYMENMIGKL---------------------------
A0A349BQG7      IDPSLSRFSVDSMENVIAQVTLLPYMENMIGKL---------------------------
A0A1G1HPN4      IAPSLSNFSVDSMENVIAQVTLLPYMENMIVKL---------------------------
A0A354F6L6      IAPSLSNFSVDSMENVIAQVTLLPYMENMIVKL---------------------------
A0A1G1HUY8      IAPSLSNFSVDSMENVIAQVTLLPYMENMIGKL---------------------------
A0A3A4W5D3      TEFAGM--KPSKVQTEIEMIKSRTIAEKVVKKLYYDINIFDVSGNLNPQITDVTIPDNRI
A0A1G1GFA6      YLQMKD--SDDYFRTQIEILNSRGFADKVVKKL---------------------------
A0A419FND3      YQGEMP--AEEYYETQYNILKSRNLAKRAVTKL---------------------------
A0A1G3XRU6      YKIEMG--EDDYYQTQYKILKSRNLAKRVIRTL---------------------------
A0A1G1HA47      TGVPL---GADYYQTQYEILKSQSLAEKVIRNL---------------------------
A0A3N5I7D6      DPNAQRYSADSKLLTEMKMLEGRQLRQRVHDKL---------------------------
A0A0S8DH48      MAIDTW--DPDYKETQYKIIESRSVARRVIKKL---------------------------
A0A533Z444      SQEAPTVDVDSYRETQYKVLRSRTLAEKVVNDL---------------------------
A0A0K2GIJ9      YYHLDN--SPEYFQTHFELLKSHQVIRRAVDQL---------------------------
D8PGN0          FYP-DN--SPEYFQTHFELMKSHFVLQRTARLL---------------------------
A0A136JVD6      FYP-DN--SPEYFQTHFELMKSHFVLQRTARLL---------------------------
A0A3A0BU62      FYP-DN--SPEYFQTHFELMKSHFVLQRTARLL---------------------------
A0A532DAI5      HASPDV--TPEYFATHFELMRSRTVLQRTAQRL---------------------------
A0A525WL30      Y-NPDL--TPEYFQTQFELMKSHHVFLRTAQLL---------------------------
A0A532DDN0      Y-NPDL--TPEYFQTQFELMKSHHVFQRTAQLL---------------------------
A0A0S4L511      YRQGDL--SPEYFQTQFELMKSHYIFQRTAQLL---------------------------
A0A532CR46      SRQSDL--SPEYFQTQFELIKSHHVFQRTAQLL---------------------------
                          .   .    :       .    *                           

A0A1G1E4S2      ------QLRNEENELMLPQNLIST---GILYQIRSSIFP---------------------
A0A349BQG7      ------QLRNEENELMLPQNLIST---GILYQIRSSIFP---------------------
A0A1G1HPN4      ------QLRNEENELMLPQNLIST---GILYQIRSSIFP---------------------
A0A354F6L6      ------QLRNEENELMLPQNLIST---GILYQIRSSIFP---------------------
A0A1G1HUY8      ------QLRNEENELMLPQNLIST---GILYQIRSSIFP---------------------
A0A3A4W5D3      GKIFAVTFQDNERFIVTDDSLDKDK--VIGSGRTGHPFSGGKDISFTLNNAGAGRDASFK
A0A1G1GFA6      ------LLDKNPYYLEKKSKPDN----GMINKIKDTVF------MLFPGRTKPDNPFPES
A0A419FND3      ------PPEKASEAAPVEGP-------SMMQAVFGSIFNFGEKPENGREDEREAA-----
A0A1G3XRU6      ------KLGEEPEFGGNA---------GLSHKV-----------ASVASVDVSKQNMSEG
A0A1G1HA47      ------SLDKNKDFLPVQSIPDKAKE-LIFNNTLGLLSRLYSSFIVSDHPVREGPVQKVS
A0A3N5I7D6      ------ALQSDDAPLLPD---------DQLSKWLNSI-------------------GFDA
A0A0S8DH48      ------NLAESEEFNPAPKTGVIVSLKSSIRGMLSSLKKAVKGLIKTEPKVAQKPGLMSD
A0A533Z444      ------HLYQSPEFYRYR---------GLFGLYESDP-------EKIPSSDPGPPDTSTD
A0A0K2GIJ9      ------KLSNRPEYQPQP---------S----LLDKVLPKWVQ-AWWQPKKKEGPLAEEA
D8PGN0          ------DLAERPEYQPKP---------SAIKQFLKSLLPDSVL-AFVKPVKKEAVDSVDD
A0A136JVD6      ------DLAERDEYQPKP---------SVIRQFVKSLMPESVL-AFVRPPKKEEVDPADD
A0A3A0BU62      ------DLAERDEYQPKP---------SVIRQFVKSLMPESVL-AFVRPPKKEEVDPADD
A0A532DAI5      ------NLKAQPEYNPAL---------AKKKSWSFTLWPSSAH-EREAAKSDEPALSPEA
A0A525WL30      ------HLSERPEYKPNP---------SALQSLLSSIFPAPPSLDAVGPKNGASEPSSEE
A0A532DDN0      ------HLSERPEYKPNP---------SALRSLVGGLMPAPPTMDVRAPNNGATEPPSEE
A0A0S4L511      ------HLSEQPEYKPRP---------SILSSTMGDILPAAVA-GVVGFKGDVDAQVLGD
A0A532CR46      ------HLSEQPEYQPKP---------SILSSMVGGIIPTADA-DIVAQKEGA-------
                                                                            

A0A1G1E4S2      --------------VRHIEVLPYKETNMFQINATSRDPEEAMMMANTLAGVFISELQKLT
A0A349BQG7      --------------VRHIEVLPYKETNMFQINATSKDPEEAMMMANTLAGVFISELQKLT
A0A1G1HPN4      --------------VRHIEVLPYKETNMFQINATSKDPEEAMMMANTLAGVFISELQKLT
A0A354F6L6      --------------VRHIEVLPYKETNMFQINATSKDPEEAMMMANTLAGVFISELQKLT
A0A1G1HUY8      --------------VRHIEVLPYKETNMFQINATSKDPEEAMMMANTLAGVFISELQKLT
A0A3A4W5D3      IKKESFYS-SVNKLMAATSVAPVKSTNVVKISTRDSNKQMAADMANSIVEFYRQHDIRAR
A0A1G1GFA6      LAQREIDPELVDIILSEMRVETGKEGNIIKIHYLSENPNVAVAMANGIAAAYIEHNMYIR
A0A419FND3      ---------QINSFIKRIEIQPIKKSQLINISFVSRDPAFASLAANTLADEYINFSLESK
A0A1G3XRU6      INKR-----FVDGFLGRVTVTPEQRSRLVKVSFDSPNQELSAKVANEIAKLYIQFSIESR
A0A1G1HA47      PSENAIPTYLINSLIDRLEVTPIKNSQLVKVSFLSDDPEISMNVTNAVAESFIQLDLEST
A0A3N5I7D6      IGESPTRAGALEMAAATLTVSNPRMTRIVHLQSDSTDPIVASDFVNTLAQTYIDYTIENR
A0A0S8DH48      EEERLPDSGLVSAFIGRISVSPVRDSRLVDIGFTARDPEVAVRTVNALAQAYIDHNMELR
A0A533Z444      AYRN-----SVTHFLASVDVNPVRRSNLVEVTFDSYSSKVAALAANKLADDYVEQNLEVK
A0A0K2GIJ9      EQER-----LLKAFLNNVEIMPIRGARLAHVTVSSVDPAFAALAANTLVSVYVERNQELS
D8PGN0          AEEA-----LIKQFAQDIEIMPIRGARLAHVTANAIDPELAAQIANTLVSVYIERNQELS
A0A136JVD6      AEEA-----LIKQFAQDIEIMPIRGARLAHVTANAIEPELAAQIANTLVSVYIERNQELS
A0A3A0BU62      AEEA-----LIKQFAQDIEIMPIRGARLAHVTANAIEPELAAQIANTLVSVYIERNQELS
A0A532DAI5      AEDR-----LLKQFGEHLEIMPVRGARLAHILAQSEDPALAALAANTLVNVYIERTQELS
A0A525WL30      VDDR-----LLKHFSETVEIVPIRGARLAHVVATSEDPKFAAQVANTLASVYIERTQELN
A0A532DDN0      VDDR-----LLKRFSESIDIVPIRGARLAHVIATSEDPKFAAQTANTLASVYIERTQELN
A0A0S4L511      EDER-----LLKQFAEAIEIVPIRGARLAHVMATSNDPEFAARIANTLASTYIERTQELN
A0A532CR46      -DER-----LLKRFTEAVEIVPMRGARLAHVIATSEDPQFAALIANTLASTYIERTQELN
                                   :   .  .:  :     .   :   .* :.  : .      

A0A1G1E4S2      RQEANSARIFIEDQITKIRGEWLSSLEGLKEFQKTNKTVN--LDQE--------ISIAIA
A0A349BQG7      RQEANSARIFIEDQITKIRGEWLSSLEGLKEFQKTNKTVN--LDQE--------ISIAIA
A0A1G1HPN4      RQEANSARIFIEDQITKIRGEWLSSLEGLKEFQKTNKTVN--LDEE--------ISIAIA
A0A354F6L6      RQEANSARIFIEDQITKIRGEWLSSLEGLKEFQKTNKTVN--LDEE--------ISIAIA
A0A1G1HUY8      RQEANSARIFIEDQITKIRGEWLSSLEGLKEFQKTNKTVN--LDEE--------ISIAIA
A0A3A4W5D3      SQQALQVIHFVDKQLDTVQGKVDDSLSALAEYKSSAGVTDLGEGTR----------AIIK
A0A1G1GFA6      IKPFRDAVEWLSARMVELRAKVESSERTLQKYKEERGIAS--FETR--------ENIIAQ
A0A419FND3      VGPTLVARKRLEEQVEATRSRLEASERQLNDYIARGQIVFLGKKGD-------DESLLNQ
A0A1G3XRU6      FEATQQARDWLQEQLEDMKAKVERSEEALNKYAADNGIIFLTEGETTETKTVQGQNIITR
A0A1G1HA47      VGASKDARDFLKEQIEIMKDKVEESEKRLNDYASKKEIVF--DKAD--------QNLITQ
A0A3N5I7D6      LDSYQKVGLWLNQQLSDIQSTLQKSEDQLIKYSKESGLLLTEGVDL--------K-----
A0A0S8DH48      LGTIQDAMAWMNERIEEERRKVEASERKLQEYREQEGIVTEFSGEV--------ETVTAQ
A0A533Z444      WDAAEKASQWLQGKNVEIKAKLEKAEDELQAYAQANSIVY--ITEK--------QNMATA
A0A0K2GIJ9      SIAREQAARWFTTHLEGLREKVQAAQEALYLYRAKHGLLT--GEER--------KSLAGQ
D8PGN0          TNSKEQAAQWFTGHLEELRQKVQNSQQALYLFRAKHGLLT--GEER--------KTVAAH
A0A136JVD6      ANSKEQAAQWFTTHLEELRQKVQNSQQALYLFRAKHGLLT--GEER--------KSVAAH
A0A3A0BU62      ANSKEQAAQWFTTHLEELRQKVQNSQQALYLFRAKHGLLT--GEER--------KSVAAH
A0A532DAI5      AKSTENSAAWFMTHVDELRKKVEASQQALYVFRTKHGL-----RDA--------RSGAGQ
A0A525WL30      ALSKEKAVQWFTNNLEGLRKKAEASQQALYLFRVKHGLLG--GRDR--------QSVTAQ
A0A532DDN0      ALSKEKSVQWVTGNLDGLRKKAEAAQQALYLFRVKHGLLG--GRDR--------QSVTVQ
A0A0S4L511      ALSKEKAAAWYIAHLDELRKKAEDSQQALYQFRLKHGLMG--GREQ--------QTARAH
A0A532CR46      AVSKDKAAQWFTTHLDELRKKAEASQQTLYLFRVKHGLMG--GREQ--------QTVRTH
                             .    .     :   *  :                            

A0A1G1E4S2      KMSELMKQKEDNIIDLAEEEARLKALKGQGN----------IKGDLGITPEALVDNPQIK
A0A349BQG7      KMSELMKQKEDNIIDLAEEEARLKALKGQGN----------IKGDLGITPEALVDNPQIK
A0A1G1HPN4      KMAELMKQKEDNIIDLAEEDARLKALKGQVN----------IKGDLGITPEALIDNPQIK
A0A354F6L6      KMAELMKQKEDNIIDLAEEDARLKALKGQVN----------IKGDLGITPEALIDNPQIK
A0A1G1HUY8      KMAELMKQKEDNIIDLAEEDARLKALKGQVN----------IKGDLGITPEALIDNPQIK
A0A3A4W5D3      NVTDLEKARAQLQVEKYQVGSLYEEIRKNIS-------------SVSPSALSVFNDPVVE
A0A1G1GFA6      KLQELVSEVVRIEGRRQEAEIRYNQIKSVIDSP-----------ELLATVPDVMNNLVIQ
A0A419FND3      KLAELSRELDTATANRISREAVYQEAKRSGT-----------------NYNFVLENPLIQ
A0A1G3XRU6      KLAELSTELVQATSDRISKEALYREAQQGEG----------------SLLSAVQGNPLIQ
A0A1G1HA47      KLSDLSAALNSITAERMQKEGLYREVRESGA-----------------SNPVILGNQLIL
A0A3N5I7D6      -MNHIQTQLLDADTDVLNKKFKYEMARSLDP----------------NSVTPILEDSLVG
A0A0S8DH48      KLAQLNSQVVQAESSRVEAETRYKQALQLKDNP-----------LILDSIPEVLSNSLIQ
A0A533Z444      RLEELLEAYTKAQSERFEKESLYSLVEA----------------GKIQDLPGVLSNRLVQ
A0A0K2GIJ9      TMAELNSQLVKTEMAKAAAYSRLQQVESALN--TQGQPGSGGGWPELDSLTQVLNSQLIQ
D8PGN0          TLAELNSQLVKTEMAKAEAHSRFLQIRAVLN--PQGAGTAGVDWSKLDSQIQVLNSPLIQ
A0A136JVD6      TLAELNSQLVKTEMAKAEAHSRFLQIRSVLN--PQGAGTAGLDWSKLDSQIQVLNSPLIQ
A0A3A0BU62      TLAELNSQLVKTEMAKAEAHSRFLQIRSVLN--PQGAGTAGLDWSKLDSQIQVLNSPLIQ
A0A532DAI5      QMGELESELVKAEMKKVEAQSRFQQIQSVLQGPNQNG---KIDWANLDASTEVLTSPLIQ
A0A525WL30      TNSDLDSELVKAEMKRAEAQSRMEQLQSVLRNRTDRNGVIEIDWSSLDALTEVLSSPLIQ
A0A532DDN0      TNSELDTELVRAEMKRAEAQSRMEQIQSVLRNRTGQDGVIEIDWSSLDSLSEVLTSPLIQ
A0A0S4L511      TNTELDSELVRAEMKQAEAKSRLEQIESILRSRTGHNGAIETDWSSLDASTEVLSSTLMQ
A0A532CR46      TNTELDSELVRAEMKLAEAQSRVEQIKSVLRNRTDQSGVIEIDWSSLDASTEVLSSPLIQ
                    :                                               :  .  : 

A0A1G1E4S2      ILMDRLAGLKIELAGALATATEEHPKVIGLRMQIDRTQKELKKEMATHRELSPQIEESSR
A0A349BQG7      ILMDRLAGLKIELAGALATATEEHPKVIGLRMQIDRTQKELKKEMATHRELSPQIEESSR
A0A1G1HPN4      ILMDRLAGLKIELAGALATATEEHPKVIGLRMQIDRTQKELKKEMATHRELSPQIEESSR
A0A354F6L6      ILMDRLAGLKIELAGALATATEEHPKVIGLRMQIDRTQKELKKEMATHRELSPQIEESSR
A0A1G1HUY8      ILMDRLAGLKIELAGALATATEEHPKVIGLRMQIDRTQKELKKEMATHRELSPQIEESSR
A0A3A4W5D3      NMIIRLSSLEVNRQSLLSDYTEKHPQVVALSAEINALRGRAHSSI------MNILKSLEN
A0A1G1GFA6      GLRIEELRIKKDISELSEKYGPRHPHMMKIVSELNTVQKNLVEEA------RKMLSAAKT
A0A419FND3      ALTKDYIGLESQYSSLLNVHKPEYPKMQRLEKQMEDLKKRIAFEE------QKIISSLDS
A0A1G3XRU6      TLKKDHASREAEYYQLSKKFKPEYPKMGRLKEEMDKIEARINTET------RKIVSSIEK
A0A1G1HA47      GLKKDFSSLEAEYYNLSKVYTPDYPKMKSLKSQMDAIQRRIEEET------SRIADSVNS
A0A3N5I7D6      AYRMELMRKESALSELKTALKPEHYRLKRLTDELKERQKQLKLEE------SKVIQRLHD
A0A0S8DH48      SIKKSEVELYNRISELSGKYGKEHPKMKAANSELGSLQKRKTSEI------NRIIDSLRN
A0A533Z444      DLEIRLADTEREYAQVTTWVKPDYPKAQQVKKQIDALQAQLDKHK------KAVVDNIVD
A0A0K2GIJ9      MLRAQEIALSSQVADLSEKYGPLHPDRAQKHAELQNLRQRIKQEV------QKIYDSLKH
D8PGN0          TLRAQEITVSAQVAELSEKYGALHPKLAHMKAELQDLRQRIQQEV------QKIYDSVKH
A0A136JVD6      TLRAQEITVSAQVAELSEKYGPLHPKLAHMKAELQDLRQRTQQEV------QKIYDSVKH
A0A3A0BU62      TLRAQEITVSAQVAELSEKYGPLHPKLAHMKAELQDLRQRTQQEV------QKIYDSVKH
A0A532DAI5      NLRAQEIKASGEVAELSDKYGPLHPKLARAKAELEDLRGRIQHEV------EKVYDSVKH
A0A525WL30      TLRAQEIRASGQVAELSEKYGPLHPKLARADAELQDLRERIRQEV------QKIFDSVKH
A0A532DDN0      TLRAQDIRVSGQVAELAEKYGPLHPKLARAKAEMQDLRERIRQEV------QKIFDSVKL
A0A0S4L511      TLRAQDIRVSGQVAELEDTYGPLHPKLIHAKAEMQDLHERIEQEV------QKIFDSVKQ
A0A532CR46      TLRGQDIRVSGQVAELAEKYGPLHPKLIHAQAEIRDLRERIRQEV------QKIFDSVKQ
                                       :        ::                     .    

A0A1G1E4S2      KIAALKAHLSLVNGNIEKYSSFFMSIPDKSTEMTRFKQSMGASEKIYNALLDYNYKIGII
A0A349BQG7      KIAALKAHLSLVNGNIEKYSSFFMSIPDKSTEMTRFKQSMGASEKIYNALLDYNYKIGII
A0A1G1HPN4      KIAALKAHLSLVNGNIEKYSSFFMSIPDKSTEMTRFKQSMGASEKIYNALLDYNYKIGII
A0A354F6L6      KIAALKAHLSLVNGNIEKYSSFFMSIPDKSTEMTRFKQSMGASEKIYNALLDYNYKIGII
A0A1G1HUY8      KIAALKAHLSLVNGNIEKYSSFFMSIPDKSTEMTRFKQSMGASEKIYNALLDYNYKIGII
A0A3A4W5D3      -------KTENLSAEIERFKTQLRELPDREKKLADLTRNVEVSSSLHKFLMEKVNEANIM
A0A1G1GFA6      EYEIAKSRETSLKRALDEQKQEFLDLSRKSIEFNVIAGESESNKLFYEMLLKKLQEASLS
A0A419FND3      DYRIALKREDVLSRAIEGLRREVLGFQQQMVQYQILKREVDTNGELYSSLLTRLKEVDVS
A0A1G3XRU6      DFKAAQRREDSLRSTLEKYKKEALDLNDRMVQYLILKRESDTNRELYNGLLQRLKETGVS
A0A1G1HA47      DYKASVKKEENLLRALNVQKQMALSFRDTISDYEVLKREVDANKDLYNTLLKRFNEVGVS
A0A3N5I7D6      EYKSAEGHRDVLLGAYREQADAVAGQGEKLIYYNMLKREVEASRELYSSMSKQVKQASIA
A0A0S8DH48      EFEVAQAREASLKAALERQKQESLELNKKAIEYSVLKREAEGARELYDLLIRRFKETSVT
A0A533Z444      EYRSATAKEQYFAQAVEDQKREVNEIAARSIQYNILKREVDSNRQLYEGLLQRMKEAQAS
A0A0K2GIJ9      EYNMTVAQERAVQAAIARYGNDKIRLEKNEIEHGMLEREAESSLHVYNLFLKATKESDLS
D8PGN0          QYDMALAQDKAVKEAITRYSSDKIRLEQNEIEHSMLERDAETSQHLYDVFLKATKETDLS
A0A136JVD6      QYDMALAQDKAVKEAITRYNTDKIRLEQNEIEHSMLERDAETSQHLYDVFLKATKETDLS
A0A3A0BU62      QYDMALAQDKAVKEAITRYNTDKIRLEQNEIEHSMLERDAETSQHLYDVFLKATKETDLS
A0A532DAI5      EYNAALVRERTIKEAVGRHRHEKIGLEQYEIERGILEREAESNQHLFDIFLKLTKEADVL
A0A525WL30      EYNAAVSRVRVIKDAAGRHRQEKILLERHEIEYGTLERDAESTQHIYNVFLKQTKETDLS
A0A532DDN0      EYNAAISRARVIKEAAGRHRQEKILLERHEIEYGTLEREAESTQQIYNIFLKQTKETDLS
A0A0S4L511      EYDSARGRVRVIKEAASRHRQEKIKLEQYEVDYGILEREAESTQHLYDIFLKQTKEADLS
A0A532CR46      DYDAARGRVRVIKEAASRHRQEKIKLEQYEVDYGILEREAESTQHIYDIFLKQTKEANLS
                       .   .                       :  .      ... :     :    

A0A1G1E4S2      EATTLSNIRLLEPAGVPLFPFKPNIFLNTILGAFLGLMSGVGLAFFSEYMDDTIKSPGDI
A0A349BQG7      EATTLSNIRLLEPAGVPLFPFKPNIFLNTILGAFLGLMSGVGLAFFSEYMDDTIKSPGDI
A0A1G1HPN4      EATTLSNIRLLEPAGVPLFPFKPNIFLNTILGAFLGLMSGVGLAFFSEYMDDTIKSPGDI
A0A354F6L6      EATTLSNIRLLEPAGVPLFPFKPNIFLNTILGAFLGLMSGVGLAFFSEYMDDTIKSPGDI
A0A1G1HUY8      EATTLSNIRLLEPAGVPLFPFKPNIFLNTILGAFLGLMSGVGLAFFSEYMDDTIKSPGDI
A0A3A4W5D3      SASTLSQTQIVDEAVASLRPVMPNVMLNIILSMIVGLIGGMALAFFIDYLDNSIKFTYDV
A0A1G1GFA6      SGINISNAQIIDNAVTPKSPVSPRRGLYIFLAAIAGVFGGVFAAFFVDYLDDTIKGQADV
A0A419FND3      TTLSESNIQILDRAEVPGSPFKPLKAQNMALSLIVGLLGGVFFAFFAEYFDNTVKNADDI
A0A1G3XRU6      ASLTSSNIQVLDWAEVPQSPHKPRKTLNLLLATIIGLFGGIGLSFFVEYIDNTIKTPEDL
A0A1G1HA47      AMSSATNIQLLDRAVYPKAPYKPNVPFNFLLSLFFGLTGGVGLAFLAEYFDNTVKDTDII
A0A3N5I7D6      SALAASNVTFVDRSDPPVKPYKPQALREVVLGGSVGLFLGVVLVFVRRTTDQKFRSPGEV
A0A0S8DH48      EEIDAGNIRIIDRA-EYAYQVSPNTRRDMRLAAVIGLMLGLGLAFFIEYLDNTIKSPEEV
A0A533Z444      AGLRASNIRVVDAAETPKYPAKPKVLLDLILGVMLGLGLGVGMAFFQEYLDKTLKTSDEV
A0A0K2GIJ9      AGMQTNNVYLADPATPSAVPAKPKTKLNIVLALMTGLMSGVGLAIVLEARNKKLQDPGDV
D8PGN0          SGLRANNVYLADPAAPSSVPSKPRTKLNIMLGLLAGLMSGVGLAIFVEGRSKKLMAPADV
A0A136JVD6      SGMRANNVYLADPAAPSSVPSKPRTKLNIMLGLLAGLMSGVGLAIFVEGRSKKLMAPADV
A0A3A0BU62      SGMRANNVYLADPAAPSSVPSKPRTKLNIMLGLLAGLMSGVGLAIFVEGRSKKLMAPADV
A0A532DAI5      AGMRSAAVYLADPAAPSSIPVKPRKVLNTALGLLLGLMSGFGTAMFLDFRKRILRVPDDV
A0A525WL30      VGLGSANVYLADPAVPSSIPVKPKKQLNTILGLLLGLMTGVGLALVLEARDRTLKGPTDL
A0A532DDN0      AGLVTANVYLADPAVPSSIPVKPKKQLNTLLGLVLGLMAGVGIALVLESRDRTLKGPDDL
A0A0S4L511      AGLRSANVYLADPAVPNAIPVKPKKQLNIMLGLLVGLMTGVGLALFLEARDRTLRGPDDL
A0A532CR46      AGLPTANVYLADPAVPSSIPVRPKKQLNIIVGLLVGLMTGIGLALFLEVRDRTLKCPDDL
                         . : :        *       :.   *:  *.   :.    .  .     :

A0A1G1E4S2      EAYD-NTPLLGTIYNYGKAL-----------------PQLISGMEIR-------------
A0A349BQG7      EAYD-NTPLLGTIYNYGKAL-----------------PQLISGMEIR-------------
A0A1G1HPN4      EAYD-NTPLLGTIYNYGKAL-----------------PQLISGMEIR-------------
A0A354F6L6      EAYD-NTPLLGTIYNYGKAL-----------------PQLISGMEIR-------------
A0A1G1HUY8      EAYD-NTPLLGTIYNYGKAL-----------------PQLISGMEIR-------------
A0A3A4W5D3      EKRL-GLPVFGRIPVVQANK-----------------AEFITGEEAVHANHSSLITLESA
A0A1G1GFA6      DSIL-GLPFLGLVPAAKGT------------------GPLYITADPR-------------
A0A419FND3      EKKS-RLPVLGLVPISKTDPKAL--------------TGSAGPGDGM-------------
A0A1G3XRU6      EKTI-SLPSLGVVPNLGKQSDRS-------------SISMITFEDKK-------------
A0A1G1HA47      ERKI-NLPTLGIIPDFEIATQKARFQV----------IDKISPRKGTAPSRLPMPLHPQK
A0A3N5I7D6      SLCL-NTNELGAVPSVEGLRENGTLQIRMRFSGGKPGSTLPLFPSTLRKNSKEIEVWSAR
A0A0S8DH48      EPYF-KVPLLGVVLGHQVKGRRE--------EDMNKKDELVTLKDPK-------------
A0A533Z444      ERLL-RLPSLGVLPRFSSNGAGELGEQGIEGAEPGPGTAIAPAIQTH-------------
A0A0K2GIJ9      ERYLPEVSLLGVVPLLPKASTPE--------------KA-LVHPDAM-------------
D8PGN0          ERYLPNVSLLGVVPLLSKSAAQE--------------KA-LAPPNAL-------------
A0A136JVD6      ERYLPNVSLLGVVPRLSKAAAQK--------------KA-LAPPNAL-------------
A0A3A0BU62      ERYLPNVSLLGVVPRLSKAAAQK--------------KA-LAPPNAL-------------
A0A532DAI5      ERFMPSVSLLGVVPIFNK-QSGN--------------GRLLQSADSS-------------
A0A525WL30      ERYLPKISLLGVLPLLPKTGTGD--------------SAHLLTDQSS-------------
A0A532DDN0      EQYLPRVSLLGMVPLLPKAETGE--------------RAQLTSDQSS-------------
A0A0S4L511      GRYLPKVSLLGVMPLLPKTKIGE--------------GVSLLTQQSS-------------
A0A532CR46      GRYLPKVSFLGTIPLMPKAKAGA--------------RAYLLTDQSS-------------
                         :* :                               .               

A0A1G1E4S2      -SPAYEAFRTTRNSIRFASIDKPVKSLLITSAIAGEGKTNIVANLGISLARE-DKKVLLI
A0A349BQG7      -SPAYEAFRTTRNSIRFASIDKPVKSLLITSAIAGEGKTNIVANLGISLARE-DKKVLLI
A0A1G1HPN4      -SPAYEAFRTTRNSIRFASIDKPVKSLLITSAIAGEGKTNIVANLGISLARE-DKKVLLI
A0A354F6L6      -SPAYEAFRTTRNSIRFASIDKPVKSLLITSAIAGEGKTNIVANLGISLARE-DKKVLLI
A0A1G1HUY8      -SPAYEAFRTTRNSIRFASIDKPVKSLLITSAIAGEGKTNIVANLGISLARE-DKKVLLI
A0A3A4W5D3      KSITAESFRSLRTNLQFAVMEKKGKIFHLTSSEASEGKTTITANLGITLALM-GSRTLII
A0A1G1GFA6      -SVMAESFRTIRTSVMLSSVEKPPKVIVITSTFPKEGKTTIASNLAVAMAQM-GERVLLI
A0A419FND3      --PFVEAFRTIGTYIQFSNTVKPPKQILVTSPLAKDGKTMFAVNVARSLVKSSRGKGIVV
A0A1G3XRU6      -SPLSEAFRSIGTYIQFSSPIRPPKTMLVTSARKAEGKTSMAVNLAVTLASSWG-KGIVI
A0A1G1HA47      GGPVAEAFRSIGAFIVLSSASTPPKTILVTGPGEKVGKTTICVNIARALLESLG-KGIII
A0A3N5I7D6      KSLFSESFQGVVTSILSIAEE--DKCFLITSPEAGAGKTSVVSNIGMTLAEI-GYRAVMV
A0A0S8DH48      -SAVSESYRGIRTRILFSSTVSQPKSILIVSAMEGEGKTISAANLAVIMART-GSRVLLL
A0A533Z444      -AEVLKAFRSLRTSILLS-ASPVPRVVLITSALPGEGKTTTAVNLGAALASL-GSKVVIV
A0A0K2GIJ9      -SPAAESIRIIRTGLLLSRPDTLPSRVLITSPGDNEGKTTLAVNLALALARLERRRVVLV
D8PGN0          -TPVAESFRIIRTSLLLSNPDMLPSRILITSPGENEGKTTLAVNLAMAMAQLEDTLVVLI
A0A136JVD6      -TPVAESFRIIRTSLLLSNPDMLPSRILITSPGENEGKTTLAVNLAMAMAQLEDTQVVLI
A0A3A0BU62      -TPVAESFRIIRTSLLLSNPDMLPSRILITSPGENEGKTTLAVNLAMAMAQLEDTQVVLI
A0A532DAI5      -SPVAESVRIIRTSLLMSNPNLLPACVLVTSPGESEGKTTLAVNLATALSQLEDTRVLLM
A0A525WL30      -GATAESIRIIRTSVLLSSPNKLPSCVLITSPGESEGKTTLSVSLAIALAQLKNARVLLI
A0A532DDN0      -GATAESIRIIRTSVLFSNPNKLPACVLITSPGESEGKTTLSVNLAIAMAQLKNTRVLLI
A0A0S4L511      -GVAAEHVRIIRTSVLLSRPDELPSCVLITSPGEGEGKTTLSVNLAVALAQLENTKVLLI
A0A532CR46      -GVTAEHIRIIRTSVLLSSPNELPSCVLITSAGEGEGKTTLSMNLAIALAQLESARVILI
                     :  .     :           . :...    ***    .:.  :        :::

A0A1G1E4S2      DTDLRRPRLETLMGIK----NQSGLTNVLVGDITIE----D-AICHTSIDKVDLLPSGTT
A0A349BQG7      DTDLRRPRLETLMGIK----NQSGLTNVLVGDITIE----D-AICHTSIDMVDLLPSGTT
A0A1G1HPN4      DTDLRRPRLETLMGIK----NQSGLTNVLVGDITIE----D-AICHTSIDMVDLLPSGTT
A0A354F6L6      DTDLRRPRLETLMGIK----NQSGLTNVLVGDITIE----D-AICHTSIDRVDLLPSGTT
A0A1G1HUY8      DTDLRRPRLETLMGIK----NQSGLTNVLVGDITIE----D-AICHTSIDMVDLLPSGTT
A0A3A4W5D3      DLDLRKPRIHQIFGIN----KEPGITHLLTQKATAN----E-ITETASIEHLYIIPAGLI
A0A1G1GFA6      DADMRKPYIDKVFGMD----NSIGISNVIARHSDFP----DAVRTMPDFPNLSILPGGRI
A0A419FND3      DADLRRATIHSSFDLD----NSTGLSSYLSGAIGYD----D-LIKKLPHLGIDCITSGPV
A0A1G3XRU6      DADMRNPQLHKILGLD----NSKGLSSFLTGLLEFD----NGLIQKTDIPNLDVITAGII
A0A1G1HA47      DADLRRPALHYHFNMD----NSTGLSTFLSGNMEFDSTEGV-LIKPASEKGLSVITSGPV
A0A3N5I7D6      DADLRRPRLHKIFGLD----NTWGLSDLIDSAKPIDSYPIEALAKPTSVDGVFVLPSGPP
A0A0S8DH48      DCDMRKPRMNSIFGLERE----KGVSNILVGDCSIS----D-AVHKTDIENLNLIPCGQI
A0A533Z444      DCDMRRPSCHRSVGVK----NSPGFVQCLTGHVELA----EAVLPAPVVPNLSVIPCGPI
A0A0K2GIJ9      DVDFRKPNPHRIYEVGLHKTSAPGLAQLLAGQADIA----D-VVHDSFVPNLSIVPSGDR
D8PGN0          DVDFRNQHIHPLYDVGSPEQPPKGLGHLLRGEAGLD----E-VVHQTFVKNLSVIPHGGR
A0A136JVD6      DVDFRNQQIHPLYEVGSPEQPPKGLGHLLRGEASLA----D-VVHQTFVSNLSVIPHGGR
A0A3A0BU62      DVDFRNQQIHPLYEVGSPEQPPKGLGHLLRGEASLA----D-VVHQTFVSNLSVIPHGGR
A0A532DAI5      DVDFRKPTHHHIFGLHRESRNTKGLVDYLKGNAHLD----E-IIHRTDNPRLWVVPRGSA
A0A525WL30      DADFRKPAHRYIHGIQRDGSQTKGLAGFLSGSIKLE----E-IIHRTDIPNLSVIPRGKR
A0A532DDN0      DADLRKPAHRFIHGIQRDGGQTKGLAGFLAGRFELD----D-IIHHTNIPNLSVIPRGKR
A0A0S4L511      DADLRNPSHKYIHGVQREGIDTNGLANFLAGRASLR----E-IIYRTDLANLSVIPRGDR
A0A532CR46      DADLRKPTHSGIHGIQGLGLETKGLVSFLAGRANLE----E-IMYRTDVANLLVIPRGER
                * *:*.        :        *.   :                      :  :. *  

A0A1G1E4S2      SLDPGRVIESQKLMSLIASLSQVYDYVLLDSPPILSFDDAVIMAGYVDGTILVVESKKIT
A0A349BQG7      SLDPGRVIESQKLMSLIASLSQEYDYVLLDSPPILSFDDAVIMAGYVDGTILVVESKKIT
A0A1G1HPN4      SLDPGRVIESQKLMSLIASLSQEYDYVLLDSPPILSFDDAVIMAGYVDGTILVVESKKIT
A0A354F6L6      SLDPGRVIESQKLMSLIASLSQEYDYVLLDSPPILSFDDAVIMAGYVDGTILVVESKKIT
A0A1G1HUY8      SLDPGRVIESQKLMSLIASLSQEYDYVLLDSPPILSFDDAVIMAGYVDGTILVVESKKIT
A0A3A4W5D3      PPNPSELLSQQNLKDFLDEAREEFDYILLDSPPTLPVTDAQLLGRLADATFIVLELGVTK
A0A1G1GFA6      APDPSELLSSSLMKDLLNGLRDRFDRIIIDSPPLNAVSDPLILSSLADSVIMVIWGGVTG
A0A419FND3      PANPSELFNSLRMKELIDTLSGEYDYVIVDSPPVLGMSDSLVLSAFIEAVIVVVRASNTP
A0A1G3XRU6      PPNPSELLGSQRLKDLLYELVPLYSFIIFDSPPLLGLSDSLILSTVSDGVIMVVRSDSTP
A0A1G1HA47      PPNPSELLGSARMQDLLYALQATFEFILVDAPPVMGLPDAIYLSKIVDGTVLVAKAGETM
A0A3N5I7D6      HPHISRLLYSSRAREIIVRLREEFDMVLIDTPPLLKVADARVLARYVDDTILVLRAGKTS
A0A0S8DH48      PPNPSELLGSKAMREMLATLGRSYERIVIDSPPITAVTDAVVLSKAVDGVVVVLQANKTE
A0A533Z444      PPNPAEVLSSSLAAELLRKLRAEFDYVLVDSPPLLSVADSRILATMTDAAVLVTRAFETP
A0A0K2GIJ9      PGNPTELLHSKYLTQLLEWALRQDCHMILDCPPTLPFADTAVLASKVDGVLMVVCAGKTT
D8PGN0          PANPTELLHSKSMAQLLKWGATNRYHIILDCPPVLPIADAAVLASKVDGVLLVVSAGETT
A0A136JVD6      PANPTELLHSKSMAQLLNWGATNRYHIILDCPPVLPIADAAVLASKVDGVLLVVSAGETT
A0A3A0BU62      PANPTELLHSKSMAQLLNWGATNRYHIILDCPPVLPIADAAVLASKVDGVLLVVSAGETT
A0A532DAI5      PERPSELLHSKHMTELLTWCRKEGYLVVLDAPPVLPVADPLVLASKVDGVLLVVSSGTTT
A0A525WL30      PSNPSELFHSKQMSVLLNRCREEGYHVILDAPPVLPVTDPAILASQVDGVLMVASVGQTT
A0A532DDN0      PSNPSELLYSDQMGLLLNRCREEGYHVILDAPPVLPVTDPVILASQVDGVLLVASVGQTT
A0A0S4L511      PPNPSELLHSKQLRELLNRCREERYHVILDAPPVLPVTDPVILASQVDGVLLVASAGQTT
A0A532CR46      PSNPSELLHSKQMRTLLNRCRQDGYHIILDAPPVLPVTDSVILASQVDGVLLVASAGQTT
                      :: .     ::         ::.* **   . *.  :.   : ..:*       

A0A1G1E4S2      PQAIIRIKAIFERARLKPLGVILNKFVD-------RHYSGSYYYGDYYNYYYQDRKSKWG
A0A349BQG7      PQAIMRIKTIFERARLKPLGVILNKFVD-------RHYSGSYYYGDYYNYYYQDRKSKWG
A0A1G1HPN4      PQAIMRIKTIFERARLKPLGVILNKFVD-------RHYSGSYYYGDYYNYYYQDRKSKWG
A0A354F6L6      PQAIMRIKTIFERARLKPLGVILNKFVD-------RHYSGSYYYGDYYNYYYQDRKSKWG
A0A1G1HUY8      PQAIMRIKTIFERARLKPLGVILNKFVD-------RHYSGSYYYGDYYNYYYQDRKSKWG
A0A3A4W5D3      LPAAEQTIRKFRSVGVNVAGAIINK----------DRPSNGYGYYNYYSYYYGDDAPTGN
A0A1G1GFA6      RDVVKKSMQSLKGVNAKILGVVINN-LAMSKRDGYQY---------YYSYYSYSEGKGIE
A0A419FND3      ADALAQTVKLLRGVNARILGVVLNG-LDVGTRYGYPY---------YYQPNGRDKEGNGR
A0A1G3XRU6      KEAALQARKSLQGVNAKILGVVLNA-IKQSNL---KYGSYSYYYSYYYGEEDDHKGKKKR
A0A1G1HA47      KNELTEIKRVFRTIDAKILGVILNG-VKKCDL---KYGTYNYYYSSYYSSYFKDKVS---
A0A3N5I7D6      RAMGAAAYSQLVQDGRSVLGTILNDWNPKMDV---PYGYSSRLYQEGYGATPKSGSASPP
A0A0S8DH48      RVLAKRAIEQMQAVNAHIFGIILNR-LDERMT---KYYHL------YSYFYRDYSEEKNL
A0A533Z444      YDLVCRARSLLYSAGARILGVALND-VDLRRE---GYGHNGSYGYGYTGYRAPGSEGSSR
A0A0K2GIJ9      REACRLAIQRMAFAGGKMLGVVMQK-ARVEDS---PY---------YTAYYQEQA-----
D8PGN0          RDACHLAVQRIKQAGGRLLGVVMQK-APVAES---SY---------YYGAYQQQR-----
A0A136JVD6      RDACHLAIQRIKQAGGRLLGVVMQK-APVADS---PY---------YYGAYQQQR-----
A0A3A0BU62      RDACHLAIQRIKQAGGRLLGVVMQK-APVADS---PY---------YYGAYQQQR-----
A0A532DAI5      MEACRTAIQRLTLAGGKILGAVMQK-TAPRDV---PY---------YYSYGSTSDR----
A0A525WL30      REACRLAIQRLTAAGGNILGIVLQN-VQVPES---SY---------YCHVPEEGDQAEEN
A0A532DDN0      KEACRLAIQRLTAAGGKILGIVLQK-VQVPDN---SY---------YCHLPEETDEAVEN
A0A0S4L511      REACRAAIDQLTSAGGRILGIVLQK-VRVSTN---LY---------PSYV---GKKFEEN
A0A532CR46      RGACRSAIDQLTSAGGKILGIVLQK-VPVPNN---PY---------YAYL---DEKPAKK
                          :        *  ::                                    

A0A1G1E4S2      LWSGKLLGAIGNKKGHS-----------
A0A349BQG7      LWSGKLLGAIGNKKGHS-----------
A0A1G1HPN4      LWSGKLLGAIGNKKGHS-----------
A0A354F6L6      LWSGKLLGAIGNKKGHS-----------
A0A1G1HUY8      LWSGKLLGAIGNKKGHS-----------
A0A3A4W5D3      GKKPLFKFWKKAGQA-------------
A0A1G1GFA6      KTV-------------------------
A0A419FND3      TAGR------------------------
A0A1G3XRU6      REKGDKA---------------------
A0A1G1HA47      ----------------------------
A0A3N5I7D6      ASGSA-----------------------
A0A0S8DH48      EEKSHRKFWKMKEKKRKEKERRKTSMIT
A0A533Z444      HGNT------------------------
A0A0K2GIJ9      ----------------------------
D8PGN0          ----------------------------
A0A136JVD6      ----------------------------
A0A3A0BU62      ----------------------------
A0A532DAI5      ----------------------------
A0A525WL30      GVFSDADHWTSSSK--------------
A0A532DDN0      GVAPEADEWTSSSKF-------------
A0A0S4L511      GIPL------------------------
A0A532CR46      GIVG------------------------
                                            

© 1998-2020Legal notice