BYKdb

Dataset for cluster orphancd of phylum lentisphaerae

[Download (right click)] [Edit] [Sequences] [Repertoires]

11 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1V5GU03      ------------------------------------------------------------
A0A1V5V8D4      MNQMVESQEKSNSLE------------DFFCLTNILDTTLRYWKIWVFAAFFGLAFSFIV
A0A524MSC4      ------------------------------------------------------------
A0A1V6FKM9      ---------------------------MRLLLGYYNTYVRQYFWLYPTAILLFAAAAFIY
A0A1G1AKK0      ----MSTESEQ----------------RGIDFRVYIGIIFFRWQIIAVCFLYCLLGGVLY
A0A7C5AIN4      -----MAETEQ----------------GKVDFRLYLGIILFRWQIIALCFLYALLGGVLF
A6DFD0          ----MNQQINENEFS------------QDIEFLQYLKVLLHYWWIISPISLIGAGAMMAY
A0A7C1AX00      ----------AHLTE------------KEVEPLGDYIA----------------------
A6DSE4          -----MKQNHSDEIE------------KEIDLLSYFLVVLRYWWIIAPITALGGVAAYFL
A0A1G1C9Z9      ----MTNNPNTDTVAVQGDWSAGAAGGDGEGLLTYIRPLLMYWWIIAPLAIVGGAGALAY
A0A348XG41      ----MEQKRNGVSLV---------------DLQSYLAMGLRHFRLMVLLMCLALAAGLAY
                                                                            

A0A1V5GU03      ------------------------------------------------------------
A0A1V5V8D4      TKYFTPPVFMAKTTIYAGITNKASIQDGSEKEISISQYSQSIMMNSLLVNDYKMLLVSDR
A0A524MSC4      ------------------------------------------------------------
A0A1V6FKM9      LR-TQVPLYRSTCQLHVSNADLRVTELRGIVDPYNA-------AGASFINTQIRLMQSPE
A0A1G1AKK0      LS-LAPKEYLASSKVMVYRDPLLEMSGNIAG------------AERTSLTMHTFLLQDDK
A0A7C5AIN4      IN-LAPKSFLTHCKIMIYRDPNLEVAS--GS------------SPWRSFSAHAYLIESER
A6DFD0          SM-TLPKKYRAECRFEIFENQAIQVAERIKDD------Y----WEEDPMEKHMLMLRSSK
A0A7C1AX00      --------------------------------------T----QQQIIYSKDLIQRARQR
A6DSE4          AQ-ALPPKFEADCRFEIIQNKVSQLSEDVDDKALNAVKS----RKYSLLDRHIVLLKSEK
A0A1G1C9Z9      SY-TLQPLYRASCRFEIFENEMMRIGEQPGLRDAAFYYM-----NANPIDRHVVLLTSGN
A0A348XG41      YI-FKRPVFHARSLVQV-EYEHRPFTDDDLWSDAEMEYVLRQLNSPHILERALAEFGIEA
                                                                            

A0A1V5GU03      ------------------------------------------------------------
A0A1V5V8D4      VQDKVREKMAEKFPS---------------------------------------------
A0A524MSC4      ------------------------------------------------------------
A0A1V6FKM9      I-------LNRAYELTGGLEGDSSKCSEPEIAQVPNT--TLVNLSITSPYPEAAAKLANT
A0A1G1AKK0      FRERAARQLAEKWGD--KMGNFQKMILPVTVARERGFG-SMLNISVKSADPGYGVEFLKV
A0A7C5AIN4      LRRQAVRRLLPAWAD--TMRGEKRMMLPVEVEQDRRIP-ATMHINVKSDRPAYAEEYLRT
A6DFD0          LNTPIRNSVLEKFPKLKQINLTS---FQLNLNPVKGAQYDLIDISVDSHNKEASLEYLKQ
A0A7C1AX00      IGRTAEE--------------FSRLLVNLNVAQVWKT--SLLRITVDALDPVFAKEFANA
A6DSE4          LNKSVEKVILNNFPDLRELKLLKKKIFEVEITPVKGAAQSMLDISIVSPDVSASKEYLLK
A0A1G1C9Z9      LDARVRTRLAKTWPGEVKMSRP----VLLSVVPVKKAPQVMVDISADSYDARYSEAYVTA
A0A348XG41      SYSTIRSKYIKQMRSETNSEGN----IVVRVWAT--SPELANNAVSTAIDVFYR------
                                                                            

A0A1V5GU03      ------------------------------------------------------------
A0A1V5V8D4      ------------------------------------------------------------
A0A524MSC4      -------------------ASRMLDEELGRLEERVGEAEEDIADYARLNQMDITSARGDI
A0A1V6FKM9      IAEVYMTSVLQRRVSISITGVDLLRDQLDDLQKSRDKAMAELLKFKEQHGIFDLEQTYTT
A0A1G1AKK0      LLTVHSNEWRAIQMEASESATRKLTEELSRLEEKIKQSEDDVVEYKRLNDVARVEGRAST
A0A7C5AIN4      LLEEHEAEWTSIQRMAADSAARTLEDELAKLEDKIRKAEDDLIEYQRLHDIARVETKGSM
A6DFD0          LIPAYENLRVNTNSGEVEASREQLEQKIQSLDKQIDDVEKEIIEFKTRHNFVFVSTKTEF
A0A7C1AX00      LAEEYLDYKAEERMDTSQATVLSLTQQANRLREELQRAENRMLAFEKENKVIAIRERGNI
A6DSE4          LLGEYAKMRVEENRLTTETTRLALENEEKSIDTKIKKQSDFILDYKIDNNYVFMSTKNEF
A0A1G1C9Z9      LVEEYRDSQREEMGLIHEETVKNLRIELAKLAADLKMERAEVAKFEAEHNVQFEAEKSES
A0A348XG41      YRSEKRKLQRKQQILVYTEEMGRMLRDMTEFNDRMR-----------AFVMSSRLPEVEA
                                                                            

A0A1V5GU03      ------------------------------------------------------------
A0A1V5V8D4      ------------------------------------------------------------
A0A524MSC4      ERRYLAGLLSHQNKLSTEMMLLESLFPMLRGEDAVVVGHVDDLTRQAGSVSPVDEIGDSA
A0A1V6FKM9      LLSQLTELNKHCIEAEIQDVELTATLQTIEEHRADAV-----------------------
A0A1G1AKK0      ELRYLQALMERRSQISTELMLLEAEFPALKGMNPGIISDVVNLTRETGAIEPIRETSEES
A0A7C5AIN4      ESAYLAALMERRNQLTTELMLLEAQFPALKDANAVVIGNVHRLTRETGAIEPLRPETGSG
A6DFD0          DQKYISNLLEKANKNQFILDILKPE----------LIRLDKETSLASEVF----------
A0A7C1AX00      AADVLASLSAKAANYRTQRMLLEAEQPLLSKASDEIVLEALAAPMPSPLLGYSMPAIAMM
A6DSE4          DKEYISELFSKSNQKKLQLGVLEAN-------IDELELSNMEDSKFSSVI----------
A0A1G1C9Z9      ELAHMRDVLRKARSIQTQRMIIESQLKLLTNANAATMRDVLDLTMYT-------------
A0A348XG41      SMERLKQVPEQLQQVRTRLAMLERAQSELRKENKTVAERLSIIATLD-------------
                                                                            

A0A1V5GU03      ------------------------------------------------------------
A0A1V5V8D4      -----------------------------------------PEGKAPWFSVDAQYHRNTR
A0A524MSC4      NGETRMSTLSGPGTERIAAETPE---------------------MRDWSRMKAERATLEM
A0A1V6FKM9      ----------------------------------ILMPFLLPEGATNLGSLKSLYLSHEM
A0A1G1AKK0      RRDGREVGNKDNEVQKSELPAALRNGKADNTK---------ADDAHGWRDLRVKLFRLQQ
A0A7C5AIN4      AAQGKEEGT-AAEYPKPSLPEPLKAEAAGEEL---------KDTLSGWRELRVKLARAEQ
A6DFD0          -----DQIIEIVGHGNNRLSIGQTGLEQDIQQ---------------WKDHKLSRFRIEA
A0A7C1AX00      RAGGTGTVVVTQSTGPESL------LERGVVK------------EPGWEKLRREKARLEL
A6DSE4          -----DALMSIQGDQKSEF------VFKDVSE---------------WKSRQVILGSYIA
A0A1G1C9Z9      -----TAAAAADDKGGPEWTD-----------------------VSDWQKNEAELIRLNA
A0A348XG41      -----VGRTLKPGEGISSLGDGEEDGVLEVDNDVIVTPWMSQSRITGWEEDHKALEELAV
                                                                            

A0A1V5GU03      ------------------------------------------------------------
A0A1V5V8D4      IITILAYA-HTAFQAQCAA-----------------------------------------
A0A524MSC4      RKKLLLGK-FTPEHPEVQEISRQLSELDEKLRVAAEVSLGRLKDRLAALKITWNALESAI
A0A1V6FKM9      RLPELLTQ-YNEAHQAVQTHRKVGDMIIAAEEKEIDISIQGLELRRKRSQQRVIRLNAQI
A0A1G1AKK0      KEKELAAN-LKPEHPELKRVRDEIADIKNQLDAAAEIELGRLKDRYDALKIHLNTVEAAE
A0A7C5AIN4      REKEMAEN-LRPEHPEMRAIRQQIENLRKQLDLAAEIELGMLQDRHKALQIQLDAIEAAE
A6DFD0          QLKIMLKK-YKLSHPKVIAVTDELEIIEVEQEVFRKNILSGLRGKVKTLEAQNRNYLLRA
A0A7C1AX00      ELKQLRRT-FKDSHPKVQEVLRKLDDINRRLELEVQFALKSYYNRLQALQIKEQAAKRVE
A6DSE4          EYDILLEK-FKPGHPNMEELQKKIDIITKEIQAYRKNIVRLIKSRVETLKVEYKSYIARA
A0A1G1C9Z9      DYGQMRTV-LKPGHPRLAELQEKIAKAQREQQISAELTLKRLEARRDALRMQGEALDSAA
A0A348XG41      KREELLTQNYLALHPKIAALDNEIKELREGLEGMLNGASDQLEWEISKLEAHRTDLEKKI
                                                                            

A0A1V5GU03      ------------------------------------------------------------
A0A1V5V8D4      --------------------------------NITGEIFSQTV---QDVLRLDNVKIIDP
A0A524MSC4      RTWKNTHQLASQKQAGYRRLELARDRRESMYKNLYGRLHDLKV---SEELKSDHFVMMAP
A0A1V6FKM9      AEIRERLNSLDRIGGDYKIREAACAALDDTCRMLVNRINEIKIADATTKIENYAIFIVEP
A0A1G1AKK0      YKWKAQNLLASTRQSELKRIMDVVERFESNYKTLYTRLQDMKI---QEELKAEHFYVVEA
A0A7C5AIN4      YKWQARNLLASQRRAELNRLAAVVARFESNYNTLYSRLHDMRV---SEELKAEHFRVVEP
A6DFD0          DRIEDTFGQNANVISTLEGFVNKQQRLNDLRASLHETLVSISS---SGG-DKYFTRMLRE
A0A7C1AX00      AEWEAEALEVARKAHEYENLQRSVARLQSLYDLVFNRLKEVDV---SIGIEPERIRIVER
A6DSE4          IELEKTFANSGVLINEIESLEGRLDQLNELKSNIRSKLILLNE---NVD-DKYITRIIRE
A0A1G1C9Z9      AKIESGMNLTGADKAKYENLKSTADHLKSLHDKVFTRIIDSSS---TPT-ERYFSRIVEG
A0A348XG41      PMNRAAMNNYEAIMWEFEQLGVTEFPWKEKYLEMARKIAELEY---AAE-TPFATRLEYM
                                                                            

A0A1V5GU03      ------------------------------------------------------------
A0A1V5V8D4      AK--LPFQRHRPLLRLNLVLGFLSGLFLGWLAAF-FLAFLDQTIKNPDQVESYLH--QPQ
A0A524MSC4      VK--TDENPVWPNIPKVMLFALALALGSGFGLAT-IAHLFNNRMQTISDVEGVLG--ITF
A0A1V6FKM9      AI--SASQPFYPVPKKVFSTALVLALALAGGIAF-ILVSVNNKVTHIEMVSAQFGNTLAN
A0A1G1AKK0      PG--LRSDYVWPDPIKVLILALVLGLGSGFGLAL-VMQVMDNRIQSISDVEKDLG--VKF
A0A7C5AIN4      VQ--TDENPVWPDPFKVLMMALVLGLGSGFGLAV-VAQALDNKIQTINDVEKVLG--VPF
A6DFD0          PF--LYDGPVSPQQSKYIIKGFVVCFGISSALIL-FNFFLKIKRYNFSRISRENH--LPC
A0A7C1AX00      AE--VPTSPVTPRKLQSIFIAALIGLGIGIGLVFGLEYLDDTIRYP-EEVTEGLG--LPF
A6DSE4          PF--AEENPVFPSIPKFTLAGALL-FNLASSFLVIILFYGKSKRYNFAKVINDYQ--API
A0A1G1C9Z9      PV--SSSTPVYPVKSRLALIGMVIAGGIGMAIAF-LLYYRYVRLYDLTLLETQFG--LPS
A0A348XG41      GILDRSRHAVSPNRGKLLVMSLGMGLALCVAFVF-VIEYLDHTISRVDKAEQVLS--MRG
                                                                            

A0A1V5GU03      ------------------------MDRDKP-NAASEAYRSLRTSLERFIADK----KG--
A0A1V5V8D4      MGTIPWLVDQEKNNALYKC-----LEEHSN-YDFVEALRLIRANLPYIVPLREASANAHS
A0A524MSC4      LGGIPRWIRKGGASSVRPI-----VLDEHS-SGAVEAYRALRTGILNELKDK----GQ--
A0A1V6FKM9      FGSVPLFTEDEHQL----------LKSSGE-DPIDEAFRDIRTSLNLSALTR----SS--
A0A1G1AKK0      LGGVPYWVHSGLEKTIRPI-----VTEEHS-TGAIEAYRALRTTILSELVKR----NE--
A0A7C5AIN4      LGGVPYWVHSGLEKTIRPI-----VTEEHS-SGAVEAYRALRTTVLTALAKA----NE--
A6DFD0          LATIPHFPAKFAKQNPFFL-----NEISKS-SVLAESYRSLRLFM---DKNM----DG--
A0A7C1AX00      FGVVPTAQWDPEDLSTHVL-----SNIDSR-SGVAEAYRNVRSALIFSGAEE----YT--
A6DSE4          LSVIPKFASSLAKKNPQFL-----NELPKN-SVLAESYRSLRLNI---EQKS----SG--
A0A1G1C9Z9      MGCVPLITDETQKSDPRQL-----NKLSKA-APLCEAYRMIRTAA---EEKL---GEG--
A0A348XG41      LGIVPQLPSSLTDVNEIPLLTDGESEFGRARSSVRETFRVIRANI---MESRDFEGDR--
                                                   *: * :*                  

A0A1V5GU03      -YSLLLTSADAGEGKSCTTANLGIAFSWTGKRVLLIDADLRRPNLHTALG----EKNAAK
A0A1V5V8D4      CRVFLITSTLSGEGKSGCTSSIAVLTAKTGKKVLLLDADLRKSTVERIF-----DLSPKV
A0A524MSC4      -NTIMLTSAESGEGKTITALNLAVMTAQAGSKVLLVDMDLRRPRLHRAL-----GLERTP
A0A1V6FKM9      -RVLAISSATPSEGKTFIAANLARSFARDKKRTLLIDMDLRKPQLHKLLQDFLPPDSGKR
A0A1G1AKK0      -KIVMVTSADSREGKTLTALNLAIMIAQMEKKVLLVDMDLRRGRLHRSL-----GLEREP
A0A7C5AIN4      -KIVLVTSADSKEGKTLTTLNLAIMVAQMGKRVLLVDMDLRRGRLHRSL-----GIEREP
A6DFD0          -KIVLFTSSGPSEGKTCTSLNTALCSSWTDKKVLLIDGDFRRVTLRKIF-----PNKSKE
A0A7C1AX00      -KALVVTSAVPLEGKTTTCLNVGISLGQAGSRVLLVDADLRRGTMHKFF-----GSEADR
A6DSE4          -KLIMFTSFGPAEGKTTTSLNTALCCAWTDKKILLIDADFRRSTLRKSF-----PEMPHK
A0A1G1C9Z9      -KVLLFTSSEQSEGKTFTSAYTAVACTWTKTKVLLVDGDFRRPSQRKLF-----SLPDSK
A0A348XG41      -QVIMVTSSIPKEGKSLVSSNLALSFASVGEKTLLIDADIRRRSLSRTF-----NRGSGR
                   . .:*    ***:      .        . **:* *:*.      :           

A0A1V5GU03      GLTQFFLGEVTDWREIVRPTAYENVDFIPAGRFVYEATELCSASVLRRLMQSWAEQYDLI
A0A1V5V8D4      GLAQILAGETTLEQSILKGIVEPTFDVLPCGPIPPNPAELLVSESFGTILKKLREEYDYI
A0A524MSC4      GVTDALKGEH-TLGEIAVQTTIPNLWFIAAGSLCEHAAELLQKSDLVSLFAKARSEYDYV
A0A1V6FKM9      GISNVLVGDC-ALSDIVIPIKELGLDAALAGPIPPNPNELLGGGGLKKLLKDAQEKYDLV
A0A1G1AKK0      GVTDVLKEGR-SLKEVIMKTRIANLNLAPTGTTVEDSAEMLQSASVVDMFVGVQDDYDYI
A0A7C5AIN4      GVTDCLRGGK-SLREVIQPTRIENLWLAPTGSSEENAAELLQSSDIPGLFVQIQDDYDYI
A6DFD0          GLMDYLKNDTMNIEKYIIKKPVGDLDYLPAGTSDEYVTELIDGKKIKELFSELKNKYDLI
A0A7C1AX00      GLTDILVGRAKP-EAVIQRTPIPNVDFVSSGPYPPNPAELLMRPELAAFLDYARRTYDRV
A6DSE4          GLLDFLKSDDHDIEDYIISKASGKMDYLPAGNNDEYVTELLDGKKMETLLTHLRNTYDLV
A0A1G1C9Z9      GLAECLSDSSLDWRDLLVREVVPRLDLLQTGHADGHGAELIQLESAERLFKEFRDEYDLI
A0A348XG41      GLSDVLKNYT-TLDDACVLTDHDYLHLLAAGTLTSQAPELLAGANFTQLMQELRQRYQRI
                *: : :                  .     *       *:        ::      *: :

A0A1V5GU03      ILDSAPVGRIVDTAMIARGCDGVLL-VSLHGKSSVPAIRHALRRLEG--CNVLGFCLNAI
A0A1V5V8D4      FIDSPPALFLADPLSIAHYADAILF-IVACHMAKIGLIRKTIRQISRVSSIPLSIIVNRF
A0A524MSC4      IIDTSPILRTTDASIIATPELCSVVMVVHVDRTAKPIVKYALDFLGN--AKILGVVMNSI
A0A1V6FKM9      IIDTAPLLVVSDTLIIASHGVPIIL-ATRLYTVTKPIIRHLSERLKQVNISLAGLIANNA
A0A1G1AKK0      VVDTSPILRVTDTVILVTQGIGVVLYVARVNHTPKPMVRYSLDMLKD--ARVLGLVMNSI
A0A7C5AIN4      FLDSSPVLRVTDTVIVANQGVGVVLYVARVNHTPKPLVRYSLDMLRD--AHILGMILNSI
A6DFD0          IIDSAPAIRVIDTVHLAEVADSTVI-VVRAGKTLAPNVSATVKRLPK--EKLLGFVVNGF
A0A7C1AX00      MFDCPPVLAVSEAAILCTLVDGVIF-VVWAGQTSRKLSQLAVQTLRERGANILGCVLNNL
A6DSE4          IFDTAPAVRVVDTVHLAEKTDGTII-VARMGRTYPKDVEATLNRLPK--DKVVGIVMNDF
A0A1G1C9Z9      IIDTAPINPVVDTLLLAKHADGVIL-VVQPGKTSMTSIQ--RALRRLGDAPLLGYVANRI
A0A348XG41      ILDTPPILGLSEACEVLRCVDGVVL-VIWSAYTPMHQVKDSTALMRANGARFFGFVLNRL
                ..* .*     :.  :       :.                            .   *  

A0A1V5GU03      DMPRGHGYYYGGSYGYKWRYGLYSYYY-YYSNSLYGYGYDDYYATKDAETAKKKATAGEP
A0A1V5V8D4      NRNDISCKY------RYSRYGSYGGYG------GYKYAYRASSKDSSTHSN---------
A0A524MSC4      EMNKISSLY------YSYQYPNYAYYA-----YAYSYGYDYDYFYGEG--GPKKGKSRPS
A0A1V6FKM9      DVPKNA---------YYSYKDGYGYGYGHGHGYGYGYGYGKTKERQKR------------
A0A1G1AKK0      EMHKISSLY------YAYQYPNYAYYS-----NAYAYGYDYYYYGDRHTAGRRQGHRRSE
A0A7C5AIN4      EMHKISSLY------YTYHYPNYAYYS-----NAYAYGYDYYYYGEGRRDVRMRRRRRTS
A6DFD0          RSQDTK---------YTGTV--HSPNG-----YGYTYGYKGYNYKKEY------------
A0A7C1AX00      DFSRVG---------YYYYS--TYYGY-----YDYDYRYPSQQRAGESAG----------
A6DSE4          KQSDLK---------FTSQSENNAYGS-----NAYAYSYNSYSTYKDSY-----------
A0A1G1C9Z9      TASTEK---------YYYD---SKYGY-----YGHAYHYQPEKSDQPS------------
A0A348XG41      DLSGAK---------NYYQ---Y---Y-----YYSDYYYRSYSS----------------
                                                    * *                     

A0A1V5GU03      AEETKEAKEGEAVEEGKREEETEEKA
A0A1V5V8D4      --------------------------
A0A524MSC4      LRKGLRNMIERIRRTIMPLE------
A0A1V6FKM9      --------------------------
A0A1G1AKK0      WDRRRNAFGQWVRRTFMPME------
A0A7C5AIN4      FGRALEAAGRWFRRTFLPME------
A6DFD0          --------------------------
A0A7C1AX00      --------------------------
A6DSE4          --------------------------
A0A1G1C9Z9      --------------------------
A0A348XG41      --------------------------
                                          

© 1998-2021Legal notice