BYKdb

Dataset for cluster orphancd of phylum kiritimatiellaeota

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A6C2U416      --MDKEGIYQGGTQKVIPRAAQAGKATGGSLFEPMNLLRMVLRRWMTVALLTLFGGLAGV
A0A6C2UNA8      MISTSETPSGAESHSGHQRSTQPNVSGGGSGLNPIKLLRMVLRRWYLPGALAFVGLGVGV
                    .*    . ::.   *::*.. : *** ::*::*********   . *::.*  .**

A0A6C2U416      FVAQHATRTYVAKAELEMSVRRPKVINNEAVYDD-STARDEGVIFNTRFKKFKSPAMERL
A0A6C2UNA8      YLAMTAVRIYKAEAEIEMSVSRPQIIKSDVVFDDGGESRDIDVVFNTRFAKFRSPAMEEL
                ::*  *.* * *:**:**** **::*:.:.*:** . :** .*:***** **.***** *

A0A6C2U416      ATQEYFKRYPEDEQSKGGT-IGKYTLATLIRDVNWYKDPSANIVYVSYLSTNPEFAAKLV
A0A6C2UNA8      VTEEYFKRYSNDEYITCPSWVGLEELAYWVRQVYWWKDGQANIVHISFECPDAEFAAQLV
                .*:******.:**  .  : :*   **  :*:* *:** .****::*: ..:.****:**

A0A6C2U416      NVLSHCAGLLMMQENQTMSDEAVKWLITQLDDQRDELEEVELQLAGIRDELQLGSLEQRK
A0A6C2UNA8      NVMIDCASKLMVQENKARSDGAVQWLVDQAEEQRSDLEELEQQLADLRQDLQMDSLLQRR
                **:  **. **:***:: ** **:**: * ::**.:***:* ***.:*::**:.** **.

A0A6C2U416      EAQSQALVAVSGEREGLVSTLASRETVYGFVMELNGTDPNLEILPTGLPKEEQLNELIGT
A0A6C2UNA8      EVLSQMLGTLTQEKAQIENRLASKNTNWEYVTSWKDGNNALETLPAGLPKEERLVELIDA
                *. ** * ::: *.  : . ***.:* : :* . :. :  ** **:******.* ***.:

A0A6C2U416      WRSAHDELLSVASRYTDIHPEYKAAEDKEARAKNRLEQFIDMSAKAVQNEIDLLGKQLKQ
A0A6C2UNA8      WRAASDELDQLATRYSEIHPRYQQAATTKARTLARLEQFVDVSAQAVENEIQLLEKQIEQ
                **:* *** .:*:**::*** *: *  .:**:  *****:*:**:**:***:** **::*

A0A6C2U416      VDERIVKIEREILDLEQQIVSGNQKLQRLERKRDAADNAYQSMLRRMEEARLSADENMAF
A0A6C2UNA8      MSVRIASMETELLELEMTLAAGERKVQKFERKRDAAEVSYLSVLERTESTRLAAEQDTAF
                :. **..:* *:*:**  :.:*:.*:*.:*******: :* *:* * *.:**:*::: **

A0A6C2U416      TKIIRNAEVPRIPESPSKKKIVATGIFFGGAAGCALVLLLSIFGDKIESVTDLKSLGLHI
A0A6C2UNA8      VKILRAAEIPIIPVAPDKKKIVITCIFVALLFGAGLAVLIEFLMDRITSVNDLKEYNLNI
                .**:* **:* ** :*.***** * **..   *..*.:*:.:: *.* **.***. .*:*

A0A6C2U416      LGTLPTHKKVDSRSELATIGLRDKFCHMIEIFAGVNALISSNKYAEKTKVLLVNSAMPGE
A0A6C2UNA8      LGALPSDKLVKSRAELATASIRDKFGPMVEVFAGINGIMLSEAFKSRSKVVVVCSVSPGE
                **:**: * *.**:**** .:****  *:*:***:*.:: *: : ..:**::* *. ***

A0A6C2U416      GKTVASCNLAISAAMNGSRTLLIDGDLRRPQLAKVFAIGEDHPSLLEWLVDGDSLMGHRD
A0A6C2UNA8      GKTVSACNLATSSARNGAKTLLIDGDLRRPRIAEVFAVDEKHPSLFEWFFNSDTGLDHAH
                ****::**** *:* **:.***********.:*:***:.*.****:**:.:.*: :.*  

A0A6C2U416      LVSHGVIENLDVVTSRPIKEINPAELLGRGRLSELLDWARVHYDRIIIDSPPLGAVGDAQ
A0A6C2UNA8      LISSNVIEDLDLITSRPLKESNPATILGRKELVALINWARLHYDRVIIDSPPLGPVGDGM
                *:* .***:**::****:** *** :***  *  *::***:****:********.***. 

A0A6C2U416      VLANLSDAIIIVSRIGKTRRRTLKFVLAKFEEIDALVFGCIANDVPHSISGMFQGAEGYG
A0A6C2UNA8      ILASHADSVILVSRIGKTSRRKLKLVLSRLIKVDVYILGCIANDVPYSLAGKFGGAEGYG
                :**. :*::*:******* **.**:**:.: ::*. ::********:*::* * ******

A0A6C2U416      YTSKYGAYKPYGGE
A0A6C2UNA8      YGQ---GYKSYTSD
                * .   .**.* .:

© 1998-2021Legal notice