BYKdb

Dataset for cluster tadcd of phylum ignavibacteriae

[Download (right click)] [Edit] [Sequences] [Repertoires]

25 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2G6EB58      ---------------------MAKQNLNGNDLQYIKDFMAEEETHSIKDYINIIRQHQFA
A0A1G0X4V9      --------------------------------MVNNNNNTSIRANTLWDYINLIRNNIVL
A0A3A0BB82      -------------------------------MVKKSRDKDKHNIDILKEFIGIIRVDWIY
A0A2G6EAS5      -----------------------------MENKKVINNSLSNPSNTFNDYISLIRTNIYT
A0A1G0P817      -------------------------------MNKTNNSSKNLNQSILKEYLRLIRANFSS
A0A1G0QLK5      -------------------------------MNKTNNSSKNLNQSILKEYLRLIRANFSS
A0A2N1VFP3      ------------------------------MNGSQGNSPLNQDAHTMRDYINLIRLNFVA
A0A1G0VGZ5      -------------------------------MNKAAVQPHVQDTHTLRDYINLVKLNFVP
A0A1G1B9H5      -------------------------------MNKAAVQPHVQDTHTLRDYINLVKLNFVP
A0A419H3A3      -------------------------------MNKAAVQPHVQDTHTLRDYINLVKLNFVP
A0A2M7ZEP7      ------------------------------MENKVFHNLREQENSSIKDYINLIKINFLP
A0A3D6BED1      ----------------------------MSNPNLNDTDVDESQSSTLKDYLILFSANIKP
A0A3N5Q7G8      ------------------------------------------------------------
A0A1G0P4D7      ----------------------------MSEENKNENLVE---TNSLKDYINLVRNNLFP
A0A1G0QKB6      ----------------------------MSEENKNENLVE---TNSLKDYINLVRNNLFP
A0A1G0V7G7      ----------------------------MSEENKNENLVE---TNSLKDYINLVRNNLFP
A0A419EVC1      MIRRGKVDNNNFQ--------------------------RVQEGSSLKDYLFLIRNNLVP
A0A2E0W055      ------------------------------------MNYREQEGNSLKDYINLIKINIIP
A0A2N1VVT2      MVCNNAIHNFHITIFNNSYTEHQQLIKGNILENKLFQNLRDEESNSLHDFINILRLNLVI
A0A2H0FVC7      ---------------------------MNNGLNNNGAGFEVEETNSLKDYVNLIKLNLIP
I6ZVA1          --------------------------------MNNNDNNFYQENNSLKDYINLIRLNIGS
A0A2H0DC71      ------------------------------MSNNNNTNSNEVREQGLQHYYNIIVDNLFP
A0A2M7MN42      ------------------------------MSNNNNTNSNEVREQGLQHYYNIIVDNLFP
A0A1V5TPD0      --------------------------MKNTIPNNF------KKEKSLLEIINIVYRGRIK
I0AMF0          --------------------MEQNKNNEEYIPLRFSNKNVPKREKTLVEIFQIIAKNKKI
                                                                            

A0A2G6EB58      VMIISLIILTLAVVYAVVAKDIYEASTMLKISEPQ-GSILDASSF-LPEFGG-GNKADRF
A0A1G0X4V9      ITIILAIIFLVTTIYAIVAPNKYTSTVSLKISPPS-GNILSSRFGDLQNFGG--QGSDRF
A0A3A0BB82      VLLIFLGVLLTTVFYVLNARNIYESTTVIKITKPQ-GSILTSSP--IPEFQDFGFLSDRY
A0A2G6EAS5      ILIISFVFLVGAIAYALFKNDVYQASTTLKITQNK-QNILKGPS--FDDLTGT-GGNNFF
A0A1G0P817      LLIINIIIIIVATIYAITAQDIYTATTDIKITTPQ-GSILTSPL--IPNSGNLGFGNDLL
A0A1G0QLK5      LLIINIIIIIVATIYAITAQDIYTATTDIKITTPQ-GSILTSPL--IPNSGNLGFGNDLL
A0A2N1VFP3      IALITLTGLLVALVYAINAPNIYKSTTVLKLSKPQ-GNILSGSL--IPEFQD--FGSDRF
A0A1G0VGZ5      IFLIALTGLLVAIIYAVNAPDIYKSTTVLKLSKPQ-GSVLSGSL--LPEFQD--FGSDRF
A0A1G1B9H5      IFLIALTGLLVAIIYAVNAPDIYKSTTVLKLSKPQ-GSVLSGSL--LPEFQD--FGSDRF
A0A419H3A3      IFLIALTGLLVAIIYAVNAPDIYKSTTVLKLSKPQ-GSVLSGSL--LPEFQD--FGSDRF
A0A2M7ZEP7      VLLISLTGLIVASLYAIYAIDIYKSTVVLKVAKPS-GSILNSPL--MPEFSD--FGSDRF
A0A3D6BED1      VSAILIASLIISIIYAISARDIFKTSTALKITKPG-GSILQSPL--MPEISD--YGNDRF
A0A3N5Q7G8      -VLIIATALIVSIIYAVNARDIYKSTATLKVVKPQ-GNILYSPV--IPEFQD--FGNDRF
A0A1G0P4D7      IILIVAASLIISIVYAVNARNIYKSTAALKVVKPQ-GSILNSPV--ISDFQD--FGSDRF
A0A1G0QKB6      IILIVAASLIISIVYAVNARNIYKSTAALKVVKPQ-GSILNSPV--ISDFQD--FGSDRF
A0A1G0V7G7      IILIVAASLIISIVYAVNARNIYKSTAALKVVKPQ-GSILNSPV--ISDFQD--FGSDRF
A0A419EVC1      IILITLAGLAVAVIYAINAPNIYKATTSLKVSKPQ-GSILESPL--IPEFQD--FGSDRF
A0A2E0W055      ILLISAAGLIVSVLYALTAQNIYKSTTVMKLSKPQ-GSILEAPL--MPEFQD--FGSDRF
A0A2N1VVT2      ILLISVTGLIVSVYYASRTPDIYTATALIKLQQPK-GSIISGPL--IPTISS--FGNDRF
A0A2H0FVC7      ILLITFTGLTVAIIFAIISKDIYTASTSLKIAKPNGGGILDAPL--LPEFSD--FGNDRF
I6ZVA1          IVVISLTALIVAVVYALNAPDIYKSTTTLKITKPQ-GSILDAPL--IPEFQD--FGSDRF
A0A2H0DC71      FSLIAIVAIVVSVVYAVSSINIYKSTTVLKVSKPS-GNILNSPL--MPEFQD--FGSDRF
A0A2M7MN42      FSLIAIVAIVVSVVYAVSSINIYKSTTVLKVSKPS-GNILNSPL--MPEFQD--FGSDRF
A0A1V5TPD0      IVISVFLSLVLAFLYIKFTPPVYESKALLKKEAAE-NP---GQKDEFSELVK--LQTSDQ
I0AMF0          LFATVGVLLIAALIYSFTATPIYEASATLKKEGNP-NDRRLGSGTDISTLLS--LQSTDE
                        :  :  :       : :.. :*           .    :             

A0A2G6EB58      IANEIETIK-NITITEKVAREI--------------------------------------
A0A1G0X4V9      IANEIQTIY-NSTIMNEVAEAI--------------------------------------
A0A3A0BB82      ISNEIEVLK-SFSIRSLTAKTL--------------------------------------
A0A2G6EAS5      IANEIETIR-NVTIREQVAGVV--------------------------------------
A0A1G0P817      IANEIQTVTYNYTIREQVADAV--------------------------------------
A0A1G0QLK5      IANEIQTVTYNYTIREEVADAI--------------------------------------
A0A2N1VFP3      IANEIEVLK-SYHLRERVSRCL--------------------------------------
A0A1G0VGZ5      IANEIEILK-SYKLRSKVANAL--------------------------------------
A0A1G1B9H5      IANEIEILK-SYKLRSKVANAL--------------------------------------
A0A419H3A3      IANEIEILK-SYKLRSKVANAL--------------------------------------
A0A2M7ZEP7      IANEIEILK-SEKIRSLIIKQI--------------------------------------
A0A3D6BED1      IANEIEILK-SNNIRERIAKIL--------------------------------------
A0A3N5Q7G8      LANEIEVLK-TFNTRERVAKSL--------------------------------------
A0A1G0P4D7      IANEIEILK-TFNTRERVAEAL--------------------------------------
A0A1G0QKB6      IANEIEILK-TFNTRERVAEAL--------------------------------------
A0A1G0V7G7      IANEIEILK-TFNTRERVAEAL--------------------------------------
A0A419EVC1      IANEIEILK-SYSVRERVANAM--------------------------------------
A0A2E0W055      IANEIEIMK-SYTIREKVAKSL--------------------------------------
A0A2N1VVT2      IANELEILK-SYRMREIVAKAL--------------------------------------
A0A2H0FVC7      IANEIEILK-SYRLRTIVATSL--------------------------------------
I6ZVA1          IANEIEILK-SYSLRNQVAETL--------------------------------------
A0A2H0DC71      IANEIEVLK-SYKVREIASTAL--------------------------------------
A0A2M7MN42      IANEIEVLK-SYKVREIASTAL--------------------------------------
A0A1V5TPD0      LETEMELIK-TNEVLSGVINELKLYVELRKVV-DPNGNSYEFNNIFVDFPDSANNYTKQM
I0AMF0          IETELELIK-TFKVASEVAKELDLYVNVKEIKWNSNDKNYEINKTFVEMNDPS--FIGKN
                : .*:: :  .          :                                      

A0A2G6EB58      ---------------------TDSFIAINNNEMFSLIVNKNYF----EDGS---------
A0A1G0X4V9      ---------------------IDSFKVKKNEDDFSLIFDKSYF----QSKG---------
A0A3A0BB82      ---------------------LDSAEANGNISSFYHLLNDPDD------LS---------
A0A2G6EAS5      ---------------------LDSFQNKADKENYDVVFRKNSF---FDDSD---------
A0A1G0P817      ---------------------IDSVESSSPSD-FALIIDDENT----AKSR---------
A0A1G0QLK5      ---------------------IDSVESSSPSD-FDLIIDDENT----AKPR---------
A0A2N1VFP3      ---------------------IDSFKLSPEKNKFSLIYEDARG---ISTTG---------
A0A1G0VGZ5      ---------------------LDSFNVSSTKNKYYMIFEDPSE---LKQGK---------
A0A1G1B9H5      ---------------------LDSFNVSSTKNKYYMIFEDPSE---LKQGK---------
A0A419H3A3      ---------------------LDSFNVSSTKNKYYMIFEDPSE---LKQGK---------
A0A2M7ZEP7      ---------------------QDSFKVIDA-DSFYLVLDQDSKFFSNNKNK---------
A0A3D6BED1      ---------------------LDTLLKSNDPKSFHLLLT-DEF-----GED---------
A0A3N5Q7G8      ---------------------IDTYNDVASKDSFYILLD-VSS--AFQETK---------
A0A1G0P4D7      ---------------------IDSFNTFGVKDSFFLLLN-QKS----DKQK---------
A0A1G0QKB6      ---------------------IDSFNTFGVKDSFFLLLN-QKS----DKQK---------
A0A1G0V7G7      ---------------------IDSFNTFGVKDSFFLLLN-QQS----DKQK---------
A0A419EVC1      ---------------------LSYYKDSSIKDSFYIIKNKDYG--KDRTVK---------
A0A2E0W055      ---------------------IDTFHNIGVRDSFYWVLN--QD--LDLTPD---------
A0A2N1VVT2      ---------------------LDSFRTANRVDTQNFMIN--YS--KLLSEK---------
A0A2H0FVC7      ---------------------IDSFNVIAQPDSFYNIFDRSID---FDREA---------
I6ZVA1          ---------------------SDTFKLSRDKDKFELIVDREDR-----NTK---------
A0A2H0DC71      ---------------------KDSFNALNQIDSFKVLVHTPSK---LTNDK---------
A0A2M7MN42      ---------------------KDSFNALNQIDSFKVLVHTPSK---LTNDK---------
A0A1V5TPD0      SFSFPIFKNFQLLNDYTEK----EYYIKKINQNRFELWDAKGKNIITSFNDFSVSKSDSI
I0AMF0          SRKFRIPEKFKIKFERAEDLLLGDFSIVKKSNDKYELID------LLSGNKISESTIEKP
                                               .    :                       

A0A2G6EB58      ------------------------------------------------SGLKEFDAIIKV
A0A1G0X4V9      ------------------------------------------------TLLKSANEVAGN
A0A3A0BB82      ------------------------------------------------KGLKNEFEIAKM
A0A2G6EAS5      ------------------------------------------------KKIRTVESLAGA
A0A1G0P817      ------------------------------------------------GKLKEYDDILDI
A0A1G0QLK5      ------------------------------------------------GKLKEYDDILDI
A0A2N1VFP3      ------------------------------------------------RKLKTVEEIAVM
A0A1G0VGZ5      ------------------------------------------------FRLKTIASIVGM
A0A1G1B9H5      ------------------------------------------------FRLKTIASIVGM
A0A419H3A3      ------------------------------------------------FRLKTIASIVGM
A0A2M7ZEP7      ------------------------------------------------KKLLPYREISKL
A0A3D6BED1      ------------------------------------------------SRPKTVPEIAGV
A0A3N5Q7G8      ------------------------------------------------ARLLSTDDIAER
A0A1G0P4D7      ------------------------------------------------GKLLPVSEIAEE
A0A1G0QKB6      ------------------------------------------------GKLLPVSEIAEE
A0A1G0V7G7      ------------------------------------------------SRLLPASEIAEE
A0A419EVC1      ------------------------------------------------SPVKSVQQITDM
A0A2E0W055      ------------------------------------------------SEVKTVVQLSEL
A0A2N1VVT2      ------------------------------------------------SDTNISQNLGSI
A0A2H0FVC7      ------------------------------------------------YKLKNINDLVLM
I6ZVA1          ------------------------------------------------PTLMPIEDIVEL
A0A2H0DC71      ------------------------------------------------PKLLEVDEIASL
A0A2M7MN42      ------------------------------------------------PKLLEVDEIASL
A0A1V5TPD0      KESNALDLSDSTKSSVQDAEGVTVI---TDAAKFEFSWSDAPVGSKIYFNIKNYLKFLTR
I0AMF0          KYDGFSPLDTIPGFTIKRDTSVVYIIPMNDKVNIEFSWNGAPVKSEFIFTVNDINQTAIG
                                                                            

A0A2G6EB58      LENKV--SVEQKRGLDFIEIKVESPSAQEAALIADTYARVYREFNLLDNRKQVSKVKDFL
A0A1G0X4V9      LYSNV--KITQLNDLDWVDIVVESQTPQEAALIANIFAKKYQKFNLLENRKQIRIIKEFL
A0A3A0BB82      LKQVV--QVVQKKGLDVVDLSVESPSPYEAAIICNAYAKTYSDYSLEFSRLDLTNIINYL
A0A2G6EAS5      LLKSV--EITQKNNLNFMEIMVESESPEEAAMIANSYAEVYRNFNLLENRKQFTIVKDFL
A0A1G0P817      LENHV--EVEQIGNLDFISISVESPSAKEAAVIANSYAEAYRVFNLMVNRNELTTIRKTL
A0A1G0QLK5      LENHV--EVEQIGNLDFISISVESPSAKEAAVIANSYAEAYRVFNLMVNRNELTTIRKTL
A0A2N1VFP3      LTSKV--SIDQKRGLDIIEISVESQAPFEAAMIANSYASSYKEINLTYNRQQLTVIKNFL
A0A1G0VGZ5      LPSKV--SIDQKRGLDIVEISVESPSPTESAMIVNCYAEAYKGINLSYNREQLTRVKNFL
A0A1G1B9H5      LPSKV--SIDQKRGLDIVEISVESPSPTESAMIVNCYAEAYKGINLSYNREQLTRVKNFL
A0A419H3A3      LPSKV--SIDQKRGLDIVEISVESPSPTESAMIVNCYAEAYKGINLSYNREQLTRVKNFL
A0A2M7ZEP7      LEKV---SIDQKRGLDIIEISVESPSPFEAAFLANAYAKAYESLNLSYNRQQLVVVRDFL
A0A3D6BED1      LGSAV--QIEQKRGLDIIDISVESQAPKEAALIANVYAKEYLTYNLEISRDQLTFVREFL
A0A3N5Q7G8      LSSAV--SIDQKRGLDIIEISAESPSPYEAMLVANSYANEYKTLNLEVNRNQLTIVKNFL
A0A1G0P4D7      LFHAV--SIDQKRGLDIIEITVESPSPYEAVLAANCYTNEYKNLNLEVNRDQLTLVKDFL
A0A1G0QKB6      LFHAV--SIDQKRGLDIIEITVESPSPYEAVLAANCYTNEYRNLNLEVNRDQLTLVKDFL
A0A1G0V7G7      LFYAV--SIDQKRGLDIIEITVESPSPYEAVLAANCYTNEYKNLNLEVNRDQLTLVKDFL
A0A419EVC1      LTSVV--SIDQKRGLDIVEISVESQSPYEAALLANEYATAYNQMNLQTNRAQLTNIKNFL
A0A2E0W055      LSKIA--VIEQKRGLDILEISVESPSSFEAALIANSYAEAYKQQNLTYNRLQLITVKNFL
A0A2N1VVT2      IGILSGVSVNQKQGLDLVEISATSTSPLEAKIIANTYAKSYENLNLKYERQQLISVKNFL
A0A2H0FVC7      LE-DT--KIEQKRGLDIVTISYESHSPFEARLITNAYADAYENLSLKYTRQQLTTVVQFL
I6ZVA1          LESEV--DISQKRGLDIVEITVESRSPYEASLIANCYAEAYKKLNLTYNRQQLTAIKEFL
A0A2H0DC71      LSTNV--TIEQKRGLDIVEISSQSPSPFEAALITNLYAQAYKTLNLEINRNQLTLVKAFL
A0A2M7MN42      LSTNV--TIEQKRGLDIVEISSQSPSPFEAALITNLYAQAYKTLNLEINRNQLTLVKAFL
A0A1V5TPD0      FGDAI--NVSRVGHTGVFELNVRSVSPLACNIIANSVIRHFREVRMEQQKQMVRYSFHFV
I0AMF0          VSKSI--KVSRVGKTNIFNLGYSSSSAYAAALITNTVVDKYREARMDQKKQTIRYSYNTV
                .       : .    . . :   * :.  . .  :     :    :   .  .      :

A0A2G6EB58      FNQRNDKLNELIAAEDKLKNYQLKGGVVELSSQAQSLIETITDLEAKINANAVELSIARE
A0A1G0X4V9      GEQLKEKQLALYAAEDAVKEYQLRKGGVQLDAQAQLLISKLADFESQKNTAKVNMSITKE
A0A3A0BB82      NTEKEKKFRDLKLSEAALEDFQQREGVVQLDVQADELVRSLSAIDKEKTMTSIELAANEK
A0A2G6EAS5      NEQKEQKYDELLVAEENIKVYQANSGGIELNSQAKAMINTLTKFESDKNITQMEIAIERK
A0A1G0P817      EEQRKEKLSDLILAENNIKAYQLKGGVIQLDAQAKNLIDKLSNYEAQRNTAQIDLSILKG
A0A1G0QLK5      EEQRKEKLSDLILAENNIKAYQLKGGVIQLDAQAKNLIDKLSNYEAQRNTAQIDLSILKG
A0A2N1VFP3      AQQREEKLAQLVGVEETLKNFQEKSGIVQLPEQARALIDQSSDFQAKMNAAKVDLTISEK
A0A1G0VGZ5      ASQRDEKQSELISVEETLKNYQEQRGIVELPEQAKALIEQSSDIQAKMNATRIDLTMTEK
A0A1G1B9H5      ASQRDEKQSELISVEETLKNYQEQRGIVELPEQAKALIEQSSDIQAKMNATRIDLTMTEK
A0A419H3A3      ASQRDEKQSELISVEETLKNYQEQRGIVELPEQAKALIEQSSDIQAKMNATRIDLTMTEK
A0A2M7ZEP7      MEQREEKYHELILAEEKLKNYQEKGGIIALDEQAKSLIAALSDFQSQRDASQIEVAMTQK
A0A3D6BED1      ANQRLEKKEQLNDAEEILRSYQERGGIIALDQQAQTLIQQLAQFEAQKNATQIEIEASSE
A0A3N5Q7G8      LEQRNEKQTLLNEAEETLRKFQERGGVIALDEQANNLIAQLSNFEAQKNAAQIDLMASDK
A0A1G0P4D7      LDQKQEKQNQLSQAEETLKKFQEKGGVIALDEQANKLISQLSDFEAQKNATQIELMASSK
A0A1G0QKB6      LDQKQEKQNQLSQAEETLKKFQEKGGVIALDEQANKLISQLSDFEAQKNATQIELMASSK
A0A1G0V7G7      LDQKQEKQNQLSQAEETLKKFQEKGGVIALDEQANKLISQLSDFEAQKNATQIELMASSK
A0A419EVC1      EEQRKGKQGELSRSEDSLRRYQQQGGIIALDEQAKSLIDQLTNFEAQKNSTNIELTVARN
A0A2E0W055      EEQRVDKLNELREAEDAVKKYQEQGGIVVLDEQARALIDLISEFESQLNAAKIEMMSSEL
A0A2N1VVT2      EKQRNQKLDELMQSEDNLKRFQEQGGIIAIDEQAKALIDVITDFQSQRDATQIELSISGK
A0A2H0FVC7      KEQRKDKYSALLEVEEKIKTFQVEGGIIALDEQAKALIDMLSTFESQRDAAAIEMMATEK
I6ZVA1          AQQREEKLAELSAVEEALRTYQEQKGIVELPEQARALIEQTTDFESKMNATKIDLTIAEN
A0A2H0DC71      LDQKNEKLAQLNNSEELLKMFQEKGGIIALDDQAKELITQLSKFEADLNLGKMELAISEK
A0A2M7MN42      LDQKNEKLAQLNSAEDILKIFQEKGGIIALDDQAKELITQLSKFEADQNLAKMELAISEK
A0A1V5TPD0      DQQLSEVQKKLLDAENNLSSFKGSQQIMNIDQNTQELLNYQSTLEAENLQTDLLLSDYRN
I0AMF0          DKQLVEVQEKLQEAEKILSDFKSSGQIMSIDASSQEIVGFLSRLEAEKVSTDLLLSDYKN
                  :       *   *  :  ::     : :  .:  ::   :  : .     : :     

A0A2G6EB58      NLNQFKEELNKKDPTIIQYLENKSAEPYLLRLQEQIAEVQTQKDIALS-SLGDSKSSKDV
A0A1G0X4V9      KLNQYKNELEKRDPSISNFLANKTSEPYLQKLQEEIASLQTQRDVALA-SSKTANANN--
A0A3A0BB82      KYSELSQKIDEIDPKLKVYLESEISKGYLPELQKQIAQLEIERELQLS-IISNDRVRQ--
A0A2G6EAS5      KLNEFKNELSERDPSLSNYFDLQSARPSIEMLQKEIASIETQKAIALS-GKGSREQKN--
A0A1G0P817      SLEKYKNELKQKDPSLITYLESKTSEPYLTSLQTQIAQLETQRDMALS-GSSGSRVNS--
A0A1G0QLK5      SLEKYKNELKQKDPSLITYLESKTSEPYLTSLQTQIAQLETQRDMALS-GSSGSRVNS--
A0A2N1VFP3      TLNNYKQELNKHDPNLTDYIENLATEPYIKKLQEQIGEQKIQRDRALA-SQS--SNKQ--
A0A1G0VGZ5      SLNQYKDELKRRNPEIQNYIDNLASEPYIKRMQDELAEQKSQRDRAIK-DAG--PN-S--
A0A1G1B9H5      SLNQYKDELKRRNPEIQNYIDNLASEPYIKRMQDELAEQKSQRDRAIK-DAG--PN-S--
A0A419H3A3      SLNQYKDELKRRNPEIQNYIDNLASEPYIKRMQDELAEQKSQRDRAIK-DAG--PN-S--
A0A2M7ZEP7      ALDQYKEELEKKNPSLTQYIESYAAEPRLKSLQEQIAKLETQRDLAIA-NKN-VPENK--
A0A3D6BED1      VLKQYRDELSKQDPKLADYLASATSETYIKALQDQIAELQIRRDLALA-KTDTKTDFS--
A0A3N5Q7G8      ILAQYKRELAEQNPRLADYLKGLSSEAYFTSLQEQLVKLEVNRDIALS-NNNPIENRN--
A0A1G0P4D7      VLNQYRNELDKQNPRLADYLKGLSSEAYFKSLQEQLVRLEVNRDLALS-TKSSLEDDS--
A0A1G0QKB6      VLNQYRNELDKQNPRLADYLKGLSSEAYFKSLQEQLVRLEVNRDLALS-TKSSLEDDS--
A0A1G0V7G7      VLNQYRNELDKQNPRLADYLKGLSSEAYFKSLQEQLVRLEVNRDLALS-TKSSLEDDS--
A0A419EVC1      NLAQYRDELKKQDPRLADYLQSFAAEPYLKSLQEEIAKLETNRDIALA-SKGQYTSNS--
A0A2E0W055      TLKLYNEELDRQNPEIKKYIENFAAQKELEQYQTSIAKLTVDKELAMA-NLNRTNKEQ--
A0A2N1VVT2      RLQQYNNELEKKNPTIAQYIKNAATQPRLENLQKSIAQMETQRDVAIS-NTQGASRRK--
A0A2H0FVC7      MVNSYKTEINRLNPSISKYIESFATKPKMKGLQEQIAQLEMQRDLAISDSSVTIESEA--
I6ZVA1          NLKQYKAELAKQDPNINDYIESFATEPYIKNLQLQIADLQTQKDRALS-SYKDSPRRS--
A0A2H0DC71      TLKQYKDELRRQDPQLTAYLENFSSEEYLKNLQTELARLEVNRDVALS-SVKDKNVDT--
A0A2M7MN42      TLKQYKEELRNQDPQLTAYLENFSSEEYLKSLQTELAKLEVNRDIALS-SSKDKNNDN--
A0A1V5TPD0      KEVALKSELKSSGYFDQGFLSPSTESQSSSPFTTLMSRLSDLELQRLE-LLQKRTEKH--
I0AMF0          KVADLQTQLSQKGFFDQSYLNPRGEGEGMSPFAELMRQLSNLELQRIE-LLQKRTENH--
                       ::   .     ::               :          :             

A0A2G6EB58      QIIKKFDEKLAELKNKLSKNVKSYQSSVLAASPEEIKTLTQQIFEEQVKAQALQASHDKL
A0A1G0X4V9      TAVAELNSKINSLKDKLNKSMKEYGNQILASSPEEIKVLSQKTFEEEVTYQSLAESYNSF
A0A3A0BB82      KAKEEYDRKISSLQESLDKNVKSLDAGMYVMTPEERREMVWELVKTGVMVNSDRIKNRVL
A0A2G6EAS5      TLVKGLDQKLGELRKKLKTDIDAYESKVYAATPEEVKELSAKIFESEVKIQSLAAKNSQL
A0A1G0P817      EVINDYNNRIDELKDKLKKSVSKYQSMILSSSPEEIKDLTKKVFETEVKYQAEMSSYNQL
A0A1G0QLK5      EVINDYNNRIDELKDKLKKSVSKYQSMILSSSPEEIKDLTKKVFETEVKYQAEMSSYNQL
A0A2N1VFP3      QMVREVDAKISELRDKLNSQLSVFRAGVLASSPEEIKELAKRVVDEEIKYQSIVASYKKL
A0A1G0VGZ5      PLVKKAETKINEIDARLKNQLSVFKAGVLAATPEEIKTLTAKVLEEETKYQSLNASYRKL
A0A1G1B9H5      PLVKKAETKINEIDARLKNQLSVFKAGVLAATPEEIKTLTAKVLEEETKYQSLNASYRKL
A0A419H3A3      PLVKKAETKINEIDARLKNQLSVFKAGVLAATPEEIKTLTAKVLEEETKYQSLNASYRKL
A0A2M7ZEP7      RLIKDYDESIKELKLKLDEQLKIYKTSIFALSPEEVRELSLNVLEQEVKLISAQSKKENL
A0A3D6BED1      DQLRDYDNKIKDLKGKLAEKIKVLKAGIFASSPEEVKNLSQKIIEEEIKNGSLKTTLNEL
A0A3N5Q7G8      KIVSDYDEKIKELQNKLNSKVDEIKTGIFASSPAEVKELSQKIIEEEVKNQALKISVSEL
A0A1G0P4D7      KSVQNLNEKIIDLRNKLNDRVEEIKLGIFASSPEEVKELSQKMIEEEIKNQSLKISVTEL
A0A1G0QKB6      KSVQNLNEKIIDLRNKLNDRVEEIKLGIFASSPEEVKELSQKMIEEEIKNQSLKISVTEL
A0A1G0V7G7      KSVQNLNEKIIDLRNKLNDRVEEIKLGIFASSPEEVKELSQKMIEEEIKNQSLKISVTEL
A0A419EVC1      KVIADYEAKIKSLKDKVTEKMSVYKAGIFASSPEEVKSLTQKIIEEETKVKAATASLQEL
A0A2E0W055      EIAKYYDDKIADLNKKVDKLLEKYEASIFASSPEEIKELTLKKLEEEVKYNAYKASYNEL
A0A2N1VVT2      ELVEDYNARINELKSTLDEQLAVYKASIFASSPAELKDLSLKVLEEEIKSKATASKFESL
A0A2H0FVC7      KLISETNKRIAELKIELNKELETYKQSIFAASPEELKELSISLLEAEVKYESLKSTISKT
I6ZVA1          EIIREFDAKINDLKEKLNNQLTVYRAGILASSPEEIKELTRKVLEEEVKYQSLKASYEKL
A0A2H0DC71      QAIREYDAKIKELRNKLNSKIEGFKASIFASSPEEVKLMTKNVIEEEIKSKSLEIKVKNL
A0A2M7MN42      QTIKEYDAKIKELRNKLKSKVEGVKASIFASSPEEVKLITKNVIEEEIKSQGYAIKVKNL
A0A1V5TPD0      PDVVKLDEQIRLTKEQLSS----YNQNTLASYRIVIDAMEKKQA--------------KI
I0AMF0          PDVKAVDEQINSVKQKLSS----FNENTITAYQIMIGTLEKKLL--------------KI
                      :  :      :                     :                     

A0A2G6EB58      KGFLAGYEKRFNSLPQRTIDLARYEREKLAYEKLYSLLEEKYQEALINEQSTTGSVLIMN
A0A1G0X4V9      TNVINKYEQEFNKLPTSTLDYARLERRRLAEENLFNTLTEKYQEAQLNEQATPGNVLIMN
A0A3A0BB82      GNYVNEYETRFNKLPSQIIEYARLERDKLTNEKIYILLEEKYQEALINQNARIGNVTIID
A0A2G6EAS5      SQVLNSYESEFQSLPAKSLEIARLERKRQSLEKMYLVLEDKYQEALLNEQSIPGNVLILS
A0A1G0P817      GQIISSYEGRFNNLPGRTLDLARLERERSVFEKLYLALEEKYQEALINEQAMPGNVFIMN
A0A1G0QLK5      GQIISSYEGRFNNLPGRTLDLARLERERSVFEKLYLALEEKYQEALINEQAMPGNVFIMN
A0A2N1VFP3      NEIVGEYDKKMNLLPTTATDQARLEREKSANEKLYLQVEERYQEAIINEQSVPGNALVID
A0A1G0VGZ5      NEIGGDYDRKLSALPTSSTDLARLTREKMAYEKLYLQVEERYQEAIISEQSVPGNVLIID
A0A1G1B9H5      NEIGGDYDRKLSALPTSSTDLARLTREKMAYEKLYLQVEERYQEAIISEQSVPGNVLIID
A0A419H3A3      NEIGGDYDRKLSALPTSSTDLARLTREKMAYEKLYLQVEERYQEAIISEQSVPGNVLIID
A0A2M7ZEP7      EKIVGKYDKKFNELPSQTIDLARYQRELSAYEKLYLLVEEKYQEALINEQSTPGNVLIID
A0A3D6BED1      NLVVKKYDERFNKLPKTSIELARFERNRESLEKLYTLVEEKYQEAVINEQSQPGNVLIID
A0A3N5Q7G8      EIIVKSYESKFNNLPKTAIELARYQRSRESLEKLYTLVEEKYQEALINEQSQPGNVLIID
A0A1G0P4D7      GSIVRNYEKKFNKLPQTAIELARYQRSRESLEKLYTLVEEKFQEALINEQSQPGNVLIID
A0A1G0QKB6      GSIVRNYEKKFNKLPQTAIELARYQRSRESLEKLYTLVEEKFQEALINEQSQPGNVLIID
A0A1G0V7G7      GSIVRNYEKKFNKLPQTAIELARYQRSRESLEKLYTLVEEKFQEALINEQSQPGNVLIID
A0A419EVC1      NDVVRSYDAKFNSLPKATIELAKLERDRTANEKMYLLVEEKYQEAIINEQSQPGNVLIID
A0A2E0W055      DKIVKNYERRFNQLPERTIDLARLQREREAYEKLYLLVEEKYQEALINEQSTPGNVIIVD
A0A2N1VVT2      DDIVRRYERRFNELPRQTIDYARFQRELTSYEKLYLLVEGKYQEALINEQSTPGTVLIID
A0A2H0FVC7      KEIVNQYEARFNELPKQTISLARLTRELNANEKLYLLVEEKYQESLIVEQSTAGNVLIID
I6ZVA1          SEIVADYDKRLNKLPTSSIDLARLTREKQAYEKLYLQVEEKYQEAIINEQSVPGNVMIID
A0A2H0DC71      SEIVNKYDSKFNQLPKSAIEYARLQRGRESLEKLYILVEEKYQEAVINEQSQPGNVLIID
A0A2M7MN42      DAIVKTYDAKFNQLPKSAIEYARLQRGRESLEKLYILVEEKYQEAVINEQSQPGNVLIID
A0A1V5TPD0      KDLMSGFEAQIKRLPGQESQLARLIREKEVYEKIFNVLLNKREEMRVAELSKLQDIIIVD
I0AMF0          NDMMSKYEAKLQSLPAQENKLAQILRQKATYEKIFTILLDQREAMRVAELSSPQDISIVD
                      ::  :. **    . *.  *     *:::  :  . :   : : :      ::.

A0A2G6EB58      YARVPKVPAKPNRKLIILIGLVLGLGLAFGYALIMNYFDKAIKSPEDIEER-NINLIGWV
A0A1G0X4V9      TANPSRNPSGPNRMMIILMGLFIGIGFALGFVYVRNYFDKTIKTPEDIEAQ-NVNVLAWI
A0A3A0BB82      PAFESLLPSKPNRVFLLVSGAVFGLILGIGFVITRNYLDKSIKTPDDLENN-GYSILAWI
A0A2G6EAS5      KARAPESPAEPNRLKIAIMGLFAGLFFAVVFVYVKSFFDKTVKTPDDLENL-GLYVLGSV
A0A1G0P817      YAFPPPDPNKPSRPLIIVFGVIIGFGFGFGFIYLKDFLNKRIKTPEDIQDL-GTTLLTWI
A0A1G0QLK5      YAFPPPDPNKPSRPLIIVFGVIIGFGFGFGFIYLKDFLNKRIKTPEDIQDL-GTTLLTWI
A0A2N1VFP3      AGLVPILPAKPNRLLIVIIGLFLGIGMGIGFAFIRNYLDNTVKTPEDIQNK-NINILSWI
A0A1G0VGZ5      EGLVPVKPAKPNRLLIVLIGLILGFGMGIGFAFIRNYLDNTVKTPEDIQNK-NLNILAWI
A0A1G1B9H5      EGLVPVKPAKPNRLLIVLIGLILGFGMGIGFAFIRNYLDNTVKTPEDIQNK-NLNILAWI
A0A419H3A3      EGLVPVKPAKPNRLLIVLIGLILGFGMGIGFAFIRNYLDNTVKTPEDIQNK-NLNILAWI
A0A2M7ZEP7      EARRPELPSKPNRMLIVLVGLVIGVGMGAGFAFVKNYFDNSVKTPEDIQNN-DINVLAWI
A0A3D6BED1      DARVPYSPAKPNRALIIIVGLLIGAGLAFAYVFLKNYFDNTVKTPEDLQKR-NINVLAWL
A0A3N5Q7G8      NARKPSNPSKPNRVLIIIIGLILASGLAFGYVLIKNYFDNTVKTPEDLQSR-NIPVLGWV
A0A1G0P4D7      NARRPLLPSKPNRLLIVIIGLVLGSGLAFGYVIAKNYFDNTVKTPEDLQKR-NISVLAWI
A0A1G0QKB6      NARRPLLPSKPNRLLIVIIGLVLGSGLAFGYVIAKNYFDNTVKTPEDLQKR-NISVLAWI
A0A1G0V7G7      NARRPLLPSKPNRLLIVIIGLVLGSGLAFGYVIAKNYFDNTVKTPEDLQKR-NISVLAWI
A0A419EVC1      YARIPYKPAKPNRMLIVIVGFIFGLGMGLGYAFIKNYFDNTIKTPDDIENR-NINVLAWI
A0A2E0W055      QARRATKPSKPNRMLIVLVGIVLGTGMGLGFAFVRNYFDSTVKTPEDIQNK-NINLLTWI
A0A2N1VVT2      EAIQPSSPSAPNRMRIILTGFIFSLVVGFSFAFIRHYLDNTVNTPEDIQKN-RLNVLTWI
A0A2H0FVC7      PAIRPLLPSKPNRKLIVLIGLILGMGIGFAFAFIKDFLDNTVKTPEDIQKK-NINVLGWI
I6ZVA1          PAIVPTIPSKPNRLLIVFAGLVIGVGLGLGFAFLRHNFDNTIKTPEDIQNR-NINILAWI
A0A2H0DC71      VARRPDKPSKPNRLLIVLVGTILGLGFGLGYAFLRNYFDNTVKTPEDLKDR-NINVIGWV
A0A2M7MN42      VARRPDKPSKPNRLLIVLVGTILGLGFGLGYAFLRNYFDNTVKTPEDLKDR-NINVIGWV
A0A1V5TPD0      YPSSPFKPVLPKKLFTLIIAVFLGGFVGIVIIFIGELSKTRLISLDDLENEFNMPILALI
I0AMF0          EAKIPTDPSWPKKSFIVLISLVLGSFLGILLIFTIELKKTKYVNLDELEEEFKIPILSLI
                    .  *  *..    . . . .  ..          ..   . ::::      ::  :

A0A2G6EB58      PKVVS-----IDSENRQRGEGFIISNKADSVASEAFKAIRTRIRYSMVEGE--AKRILIT
A0A1G0X4V9      PKISH-----EESVGLKNP-ELIVAQKPDSLSSEAFRTIRTRLQFSHISKG--AKLILIT
A0A3A0BB82      PSIDI-----KEKSDLSSPDEFIVASDAKSSISEAFKVLRTRVQYAKIEEE-PLKTILIT
A0A2G6EAS5      PRFER-----KVSSEGDDS-EIFMSSKNEIAASEAYRAMRTRIQFSKLSEG--TKAILIT
A0A1G0P817      PRT---------KRNISDP-ELIVFNNSDFPTIESFRALRTRIQFSKNKSE--VKVLLIT
A0A1G0QLK5      PRT---------KRNISDP-ELIVFNNSDFPTIESFRALRTRIQFSKNKSE--VKVLLIT
A0A2N1VFP3      PQIEG-----M-EGGNKDF-EFIVAKKPDASASEAYRALRTRIKFSKIDKD-SLKTILVT
A0A1G0VGZ5      PQIEG-----L-ESGIKDF-EFVVARKPDASASEAYRALRTRIKFSKLDKE-SLKVLLVT
A0A1G1B9H5      PQIEG-----L-ESGIKDF-EFVVARKPDASASEAYRALRTRIKFSKLDKE-SLKVLLVT
A0A419H3A3      PQIEG-----L-ESGIKDF-EFVVARKPDASASEAYRALRTRIKFSKLDKE-SLKVLLVT
A0A2M7ZEP7      PQIDI-----LEENK--DF-EFIVAKKPDSLHAEAYRALRTRIQFSKLDQKRGIQTLLVT
A0A3D6BED1      PRVDE-----LLLKESSKV-DFIILNKPDSVTSESFRALRTRIQFSRPDKE-TLKTIVVT
A0A3N5Q7G8      PQFEI-----EGRNGMTGN-EFVVSSKPDSMAGESFRTIRTRIQLTKLDKD-SLKTILIT
A0A1G0P4D7      PQFEG-----ASKNGTQDY-EFIVAKKPDSMASEAFRALRTRIQLLRFDKD-SLKTFLVT
A0A1G0QKB6      PQFEG-----ASKNGTQDY-EFIVAKKPDSMASEAFRALRTRIQLLRFDKD-SLKTFLVT
A0A1G0V7G7      PQFEG-----ASKNGTQDY-EFIVAKKPDSMASEAFRALRTRIQLLRFDKD-SLKTFLVT
A0A419EVC1      PTIEG-----LGQNGNSDY-EFIVAKKPDSIPSEAYRALRTRVQFSKLEKD-AIKSVLIT
A0A2E0W055      PEIEG-----VGSEDHKEF-EFIVAKRPDSIPSEAFRALRTRIQFSKIRPD-ALKTILVT
A0A2N1VVT2      PKMEQ-----LATKD--EF-QFIVHSKPDSIYSESFRALRTRITFSKIQES-PVQTILIT
A0A2H0FVC7      PKIEG-----ITL--NKEF-EFIIAKKSDSIYSEAFRALRTKIQFAKIDKK-SINTIHVT
I6ZVA1          PHIEG-----IET--NPEL-EFIVSKKPDASASEAYRALRTRIKFSKIDKD-SLRTILVT
A0A2H0DC71      PKIQS-----LDKSISKDL-EFIIYNKPDSVPSEAFRALRTRVQFSKVDQG-NMKVIHVT
A0A2M7MN42      PQIQS-----LDKSISEDL-EFIIYNKPDSVPSEAFRALRTRVQFSKVDQG-NMKVIHIT
A0A1V5TPD0      PIFDKSIRNKMKKSNDKKD-QFVMLQTDNSGISESYRLLNTKL--SHLDLK--DKTIMVT
I0AMF0          PRLPKEIVKVVD--NNPEH-KVALLTVQDDGLRETYRVLKTKL-FQNLNPE--TKLLMVT
                *                    . :    .    *::. :.*.:           . . :*

A0A2G6EB58      SSTPGEGKSTMAVNLAGSFAIANKKTVIIDCDLRKPRIHGIFNE-KRFPGFTDYFIGRAT
A0A1G0X4V9      SSAPGEGKTTISTNLAASFAQANKRSVIIDCDLRKPRLYSLFGG-NDSNGFLDYLFGNVQ
A0A3A0BB82      STIPGEGKTTVAINLAGSFALDGKNVLLIDCDLRKPRVHSVMGV-NRYPGLTDLLFGNND
A0A2G6EAS5      SSAPQEGKTTVTVNLAAGFAQTNKKVIILDCDLRIPRIHSVFKG-KSSPGFTNFLFGQVS
A0A1G0P817      SSAPGDGKTMVSTNIASSFARDDKRTIIVDCDLRKPRLHSIMGE-SISPGLSDYLFGRTN
A0A1G0QLK5      SSAPGDGKTMVSTNIASSFARDDKRTIIVDCDLRKPRLHSIMGE-SISPGLSDYLFGRTN
A0A2N1VFP3      SPTSQEGKTTTSINLAGSFAQANFRTIIIDADLRKPRIHSVFNQ-KRFPGFTDYFFGQAT
A0A1G0VGZ5      SPTSGEGKTTTTVNLAGSFAQANFKTIILDADLRKPRVHTVFNQ-KRFPGFTDYFFGQAT
A0A1G1B9H5      SPTSGEGKTTTTVNLAGSFAQANFKTIILDADLRKPRVHTVFNQ-KRFPGFTDYFFGQAT
A0A419H3A3      SPTSGEGKTTTTVNLAGSFAQANFKTIILDADLRKPRVHTVFNQ-KRFPGFTDYFFGQAT
A0A2M7ZEP7      SSAPREGKTTTAVNIAGTFAQANKRTVIVDCDLRKPRMHTVFKA-QRFPGFSDYFFGQST
A0A3D6BED1      SPAPQEGKTFVTINLAGSFAQANKKVLLVDCDLRKPRVHRVFDI-AKEPGLIDYLVGDKT
A0A3N5Q7G8      SSAPQEGKTVVGINLGGSFAQSNRRTLIIDCDLRKPRVHEIFRD-KRVPGLIDYLFGQAQ
A0A1G0P4D7      SSAPQEGKTLIAINLAGSFAQSGRRTVIIDCDLRKPRVQELFNA-KRIPGLIDYLFGHLS
A0A1G0QKB6      SSAPQEGKTLIAINLAGSFAQSGRRTVIIDCDLRKPRVQELFNA-KRIPGLIDYLFGHLS
A0A1G0V7G7      SSAPQEGKTLIAINLAGSFAQSGRRTVIIDCDLRKPRVQELFNA-KRIPGLIDYLFGHLS
A0A419EVC1      SSTPQEGKTITAVNLAGSFAQANKKTLLLDCDLRKPRLHAVFKN-NRYPGFTDYFFGQAT
A0A2E0W055      SSTPKEGKTTVSVNLAGSFAYTNKRTVVVDCDLRKPRMHNVFKA-QRFPGFTDYFFGQAE
A0A2N1VVT2      SSAPREGKTTVAVNLSGSFAQANKKTIVVDCDLRKPRIHNVFQA-QRFPGFSDYFFGQAP
A0A2H0FVC7      SSTPSEGKTTVSVNIAGSFAQTNRKTVIVDCDLRKPRMHKVFAS-QRFPGFTDYFLGEAT
I6ZVA1          SPRSQEGKTTTAVNLAGSLAYANNKTIIIDADLRKPRLHNVFGH-KRYPGFTDYFFGQVG
A0A2H0DC71      SSTPGEGKSLISSNLAGSFAQANHKTLLLDCDLRKPRVHTIFGM-NRQPGLVEYLFDQVN
A0A2M7MN42      SSTPGEGKTLISSNLAGSFAQANHKTLLLDCDLRKPRVHTIFGM-NRQPGLVEYLFDQVN
A0A1V5TPD0      SCEENTGKTTIVANLAITLALNNKNVLIIDCDLRKGELSRRFNVFHNSSGLIDFLEKGSS
I0AMF0          SCEEDSGKTTVVANLAASLAQEGKRVLLIDCDLRKGDLSGLFGLGKETKGLLDYLLNDSP
                *     **:    *:.  :*  . . :::*.***   :   :       *: : :     

A0A2G6EB58      LEEIKRKT-STENLTIITAGTIPPNPSEILDSKGMAALLEKL-ASDFDIVIIDSPPVLTV
A0A1G0X4V9      YDKIIKKS-EVRNLDFVTAGSIPPNPSEILGSPAMKSFLDKL-KNDYDIIIIDSPPIMAV
A0A3A0BB82      LSEVIRPT-KFDNMHFIPSGTIPPNPSELLGSLQMKKTLENL-KTQYDIIVLDSPPSISV
A0A2G6EAS5      FDEIVRKSNEVDNLYYIAAGTIPSNPSEILGSKQLEDFLKKL-KSEFDLVILDAPPVMTI
A0A1G0P817      KEGIIRNS-NLAKLDYITAGTIQNNSSEVLNSIKMVTLLQKL-REDYDVVIIDSAPILAV
A0A1G0QLK5      KEGIIRNS-NLAKLDYITAGTIQNNSSEVLNSIKMVTLLQKL-REDYDVVIIDSAPILAV
A0A2N1VFP3      FEEIVRKS-EVNNLDFITAGTIPPNPSEILGSSQMESFFEKL-KNEYDYIIVDSPPVIAV
A0A1G0VGZ5      FEEVVRKT-ELNNLDYITAGTIPPNPSEILSSTQMEAFIEKL-KTMYDYILIDSPPVIAV
A0A1G1B9H5      FEEVVRKT-ELNNLDYITAGTIPPNPSEILSSTQMEAFIEKL-KTMYDYILIDSPPVIAV
A0A419H3A3      FEEVVRKT-ELNNLDYITAGTIPPNPSEILSSTQMEAFIEKL-KTMYDYILIDSPPVIAV
A0A2M7ZEP7      YEEIIHKS-ELPNLFYITAGTIPPNPSELLSSDQMVAFLEKL-KSEFDMIVIDSPPIVAV
A0A3D6BED1      LEEITHTG-EMPNLSFISSGTIPPNPAEMLDSRQMDEFLALV-RGMYDYIIIDSPPIIAV
A0A3N5Q7G8      LKDIIHKA-DINNLEYITCGTIPPNPAEMLESEKMREFLADM-REKYDIVILDSPPIIAV
A0A1G0P4D7      LNEVTHKA-EIDNLDYITCGTIPPNPAEMLESEPMKRFLTEM-REKYDIVILDSPPIIAV
A0A1G0QKB6      LNEVTHKA-EIDNLDYITCGTIPPNPAEMLESEPMKRFLTEM-REKYDIVILDSPPIIAV
A0A1G0V7G7      LNEVTHKA-EIDNLDYITCGTIPPNPAEMLESEPMKRFLTEM-REKYDIVILDSPPIIAV
A0A419EVC1      YSEIIRPS-GTNNLYIITAGTIPPNPSELLGSHQMLEFMEKL-RREFDIIIIDSAPVIAV
A0A2E0W055      YEEIVRTS-EIENLDFITAGTIPPNPSEILGSPQMEKFLEKL-KSLYDVVILDSPPVIAV
A0A2N1VVT2      FEDIIHAS-DVPNLFYITSGTIPPNPSEILASSQMEAFLEKL-RGEYDIIILDSPPIIAV
A0A2H0FVC7      FESIVHKS-ELPNLDFITAGTIPPNPSEILGSQQMLAFIDKL-KVIYDLVVIDSPPIIAV
I6ZVA1          YEEIIRTT-DVNNLSYISAGTIPPNPSEILGSDQMINFIKKL-KGEYDYVVIDSPPLIAV
A0A2H0DC71      LATIIKPT-KLANLDVITVGTIPPNPAEMLGSKKMQDFITHM-KTLYDYIIIDSPPIISV
A0A2M7MN42      LATIIKPT-KLANLDVITVGTIPPNPAEMLGSKKMQDFITHM-KTLYDYIIIDSPPIISV
A0A1V5TPD0      PVIYTKLL---KKINILPSGGINENSSILLSSDRMKSLFEKIDTSAYNYVIIDTPPVTRV
I0AMF0          PKIYTRAS---KNIDIIPSGGLSSDSGTLLDSARMRLLFRSLDTTQYDLIIVDTPPVTRV
                     .      ::  :. * :  :.. :* *  :   :  :    :: :::*:.*   :

A0A2G6EB58      TDAEILSRIVDETILVVSANTTDVDMMTKAVSLLKSGDKNSFVGAILNRFEVQNSYGSYY
A0A1G0X4V9      SDAEILARFVDICLLVVSANSSEVDWLKESVSLLRH-DNVNLAGVLLNNFNYKSGYHSYY
A0A3A0BB82      TDSEILFKITDGTLLVVQSLKTPMDAFSKVYDRFNSFSEPNLLGTVLNNFSYKRNYGYYY
A0A2G6EAS5      TDAEILSHIVDITLLVVFANKTEVDWVTESAQILNRGEESSFVGAILNNFDYNTGYRSYH
A0A1G0P817      ADTELLSNFVDASILVVSANNTEMEWAKQSISLLSH-GQSAFLGIVLNNYDYKFGYPSNY
A0A1G0QLK5      ADTELLSNFVDASILVVSANNTEMEWAKQSISLLSH-GQSAFLGIVLNNYDYKFGYPSNY
A0A2N1VFP3      TDSEILSSMVDGTVLVVSANNTEMELMEKAVQLINH-ERSSFLGVILNNFTYRSGYGSYY
A0A1G0VGZ5      TDSEILSSIVDATVLVVSANNTEMELMEKAVELLNH-EQGSFIGIILNNFTYRSGYGSYY
A0A1G1B9H5      TDSEILSSIVDATVLVVSANNTEMELMEKAVELLNH-EQGSFIGIILNNFTYRSGYGSYY
A0A419H3A3      TDSEILSSIVDATVLVVSANNTEMELMEKAVELLNH-EQGSFIGIILNNFTYRSGYGSYY
A0A2M7ZEP7      TDSEIISRLVDAAILVVSANNTEIELMRKAAELLTH-ESKSFIGAILNNFSYKSGYGSYY
A0A3D6BED1      TDAEILSKKVDGAVLVVSSEITEYQMMERAYQLIKH-DNTTLIGTVLNNFDTRSAYGTYY
A0A3N5Q7G8      TDSEILSTMVDGTILIISADTTEVELMERSVELMKN-DKSSFIGAILNNFSYKSGYGSYY
A0A1G0P4D7      TDSEILATMVDGTVLVVSADTTEFDLMEKAVEIMKK-DKLTFLGTVLNNFSYKSGYGSYY
A0A1G0QKB6      TDSEILATMVDGTVLVVSADTTEFDLMEKAVEIMKK-DKLTFLGTVLNNFSYKSGYGSYY
A0A1G0V7G7      TDSEILATMVDGTVLVVSADTTEFDLMEKAVEIMKK-DKLTFLGTVLNNFSYKSGYGSYY
A0A419EVC1      TDSEIISRIVDATILVVSSNITEVDVMEKSVNLLKH-EQKTFIGVLLNNFTFRSSYGSYY
A0A2E0W055      TDSEILSRMVDATVLVASANITENDLLEKSVELLTH-DHGSFIGVVLNRFMYRSGYGSYY
A0A2N1VVT2      TDSEILSRLVDATILVVSAHTTEVELMRKSAELLDH-EQNTFIGVLLNNFSYKSGYGSYY
A0A2H0FVC7      TDSEILSRIADASILVASAGETDIELMTKAVDLMRH-ENKSFIGVVLNKFSYRSGYGSYY
I6ZVA1          TDSEILAQLVDATILVVSANFTETDLLEKSVEILRR-DNSTFIGTVLNNFNYRSGYSSYY
A0A2H0DC71      TDSEIIAAYCDAVYLVVSANYTEFDLLEKALDILKN-SNVNFVGTILNNFVFKNSYGSYY
A0A2M7MN42      TDSEIIAAYCDAVYLVVSANYTEFDLLEKALDILKN-SNVNFVGTILNNFVFKNSYGSYY
A0A1V5TPD0      VDTLILGQYVTNAILVVRPDISMKDSVIGGIQDMNQ-AQIKILGIVANATEIQSSYRYRY
I0AMF0          VDPLVLSHSLHNAIVVVRPEHSLLETVRWGISELLN-AKINVKGLVINAADIENSYYYKH
                 *. ::        ::  .  :  :      . :       . * : *       *   :

A0A2G6EB58      RYAY--TYARGGVEGKREKVRIKKKKQNKSK--------
A0A1G0X4V9      KYYD--HYTEKYKNTKKKGKLNKPA--------------
A0A3A0BB82      NYYY--YYSSGEKPN------------------------
A0A2G6EAS5      KYNSNKYYRRADESRSKEWVKS-----------------
A0A1G0P817      KYYN--YYYSSDSTDKKKPSKKIKTNI------------
A0A1G0QLK5      KYYN--YYYSSDSTDKKKPSKKIKTNI------------
A0A2N1VFP3      KYYY--YYSRPTNG-AKKGRVKV----------------
A0A1G0VGZ5      KYYY--YYSRPKDGSSKKNKLKV----------------
A0A1G1B9H5      KYYY--YYSRPKDGSSKKNKLKV----------------
A0A419H3A3      KYYY--YYSRPKDGSSKKNKLKV----------------
A0A2M7ZEP7      KYYY--YYSHQSKGNGVAKVKKIDKV-------------
A0A3D6BED1      KYKY--YYYYASKK-------------------------
A0A3N5Q7G8      KYYY--YYSENPPG-GKNKSKV-----------------
A0A1G0P4D7      KYYY--YYSENSEG-KKSRSSKRKA--------------
A0A1G0QKB6      KYYY--YYSENSEG-KKSRSSKRKA--------------
A0A1G0V7G7      KYYY--YYSENSEG-KKSRSSKRKA--------------
A0A419EVC1      KYYY--YYSRPNEN-GRKKSKKLDSV-------------
A0A2E0W055      KYYY--YYSRPDQK-NKKPKAELKS--------------
A0A2N1VVT2      KYYY--YYSQGGNG-AAK-KNRIKA--------------
A0A2H0FVC7      KYYY--YYSHNRDNSKVKHKTTV----------------
I6ZVA1          KYYY--YYSSPTNGSKKNRVKAN----------------
A0A2H0DC71      KYYY--YYYNREKEGTRSKKTT-----------------
A0A2M7MN42      KYYY--YYYNREKEGTRSKKTT-----------------
A0A1V5TPD0      SYGYGYGYGNSPKDKNGKHG--VKKLSSIVRKHSKVNSS
I0AMF0          RYGYGYGYGSKNGNGKAKDAKKIKPEFQLKFKDQITHKN
                 *     *                               

© 1998-2020Legal notice