BYKdb

Dataset for cluster tadcd of phylum ignavibacteriae

[Download (right click)] [Edit] [Sequences] [Repertoires]

31 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2G6EB58      ---------------------MAKQNLNGNDLQYIKDFMAEEETHSIKDYINIIRQHQFA
A0A1G0X4V9      --------------------------------MVNNNNNTSIRANTLWDYINLIRNNIVL
A0A3A0BB82      -------------------------------MVKKSRDKDKHNIDILKEFIGIIRVDWIY
A0A2G6EAS5      -----------------------------MENKKVINNSLSNPSNTFNDYISLIRTNIYT
A0A6N6SN85      -------------------------------MDTDFNNSQFQDTKSIVDYLQLIRGNLLP
A0A1G0P817      -------------------------------MNKTNNSSKNLNQSILKEYLRLIRANFSS
A0A1G0QLK5      -------------------------------MNKTNNSSKNLNQSILKEYLRLIRANFSS
A0A2N1VFP3      ------------------------------MNGSQGNSPLNQDAHTMRDYINLIRLNFVA
A0A6A4UG68      -------------------------------MNKPAIQPHVQETHTLRDYINLVKLNFVP
A0A1G0VGZ5      -------------------------------MNKAAVQPHVQDTHTLRDYINLVKLNFVP
A0A1G1B9H5      -------------------------------MNKAAVQPHVQDTHTLRDYINLVKLNFVP
A0A419H3A3      -------------------------------MNKAAVQPHVQDTHTLRDYINLVKLNFVP
A0A6N7BD63      -------------------------------MNKAAVQPHVQDTHTLRDYINLVKLNFVP
A0A2M7ZEP7      ------------------------------MENKVFHNLREQENSSIKDYINLIKINFLP
A0A3D6BED1      ----------------------------MSNPNLNDTDVDESQSSTLKDYLILFSANIKP
A0A3N5Q7G8      ------------------------------------------------------------
A0A1G0P4D7      ----------------------------MSEENKNENLVE---TNSLKDYINLVRNNLFP
A0A1G0QKB6      ----------------------------MSEENKNENLVE---TNSLKDYINLVRNNLFP
A0A1G0V7G7      ----------------------------MSEENKNENLVE---TNSLKDYINLVRNNLFP
A0A419EVC1      MIRRGKVDNN--------------------------NFQRVQEGSSLKDYLFLIRNNLVP
A0A7C2NJJ5      --------------------------------MKNQDFMNEQNETTLKDYINLIRQNLLP
A0A2E0W055      ------------------------------------MNYREQEGNSLKDYINLIKINIIP
A0A2N1VVT2      MVCNNAIHNFHITIFNNSYTEHQQLIKGNILENKLFQNLRDEESNSLHDFINILRLNLVI
A0A2H0FVC7      ---------------------------MNNGLNNNGAGFEVEETNSLKDYVNLIKLNLIP
I6ZVA1          --------------------------------MNNNDNNFYQENNSLKDYINLIRLNIGS
A0A2H0DC71      ------------------------------MSNNNNTNSNEVREQGLQHYYNIIVDNLFP
A0A2M7MN42      ------------------------------MSNNNNTNSNEVREQGLQHYYNIIVDNLFP
A0A1V5TPD0      -------------------------------MKNTIPNNFKK-EKSLLEIINIVYRGRIK
A0A6M8V2X9      -------------------------------MIDNISKSHKK-EKSLLELIYIIYKGKWI
A0A6M8UVD7      -------------------------------MADISSKNTSK-DKSLLEIFNIVYQGRIK
I0AMF0          --------------------MEQNKNNEEYIPLRFSNKNVPKREKTLVEIFQIIAKNKKI
                                                                            

A0A2G6EB58      VMIISLIILTLAVVYAVVAKDIYEASTMLKISEPQ-GSILDASSF--LPEFGG-GNKADR
A0A1G0X4V9      ITIILAIIFLVTTIYAIVAPNKYTSTVSLKISPPS-GNILSS-RFGDLQNFGG--QGSDR
A0A3A0BB82      VLLIFLGVLLTTVFYVLNARNIYESTTVIKITKPQ-GSILTS-SP--IPEFQDFGFLSDR
A0A2G6EAS5      ILIISFVFLVGAIAYALFKNDVYQASTTLKITQNK-QNILKG-PS--FDDLTG-TGGNNF
A0A6N6SN85      ILIITAVSFVFALIYAINAVDIYNSSALVKVNKNS-GSILESNPL--LQTFGQ----EDR
A0A1G0P817      LLIINIIIIIVATIYAITAQDIYTATTDIKITTPQ-GSILTS-PL--IPNSGNLGFGNDL
A0A1G0QLK5      LLIINIIIIIVATIYAITAQDIYTATTDIKITTPQ-GSILTS-PL--IPNSGNLGFGNDL
A0A2N1VFP3      IALITLTGLLVALVYAINAPNIYKSTTVLKLSKPQ-GNILSG-SL--IPEFQD--FGSDR
A0A6A4UG68      IFLIALTGLLVAIIYAVNAPDIYKSTTVLKLSKPQ-GSVLSG-SL--LPEFQD--FGSDR
A0A1G0VGZ5      IFLIALTGLLVAIIYAVNAPDIYKSTTVLKLSKPQ-GSVLSG-SL--LPEFQD--FGSDR
A0A1G1B9H5      IFLIALTGLLVAIIYAVNAPDIYKSTTVLKLSKPQ-GSVLSG-SL--LPEFQD--FGSDR
A0A419H3A3      IFLIALTGLLVAIIYAVNAPDIYKSTTVLKLSKPQ-GSVLSG-SL--LPEFQD--FGSDR
A0A6N7BD63      IFLIALTGLLVAIIYAVNAPDIYKSTTVLKLSKPQ-GSVLSG-SL--LPEFQD--FGSDR
A0A2M7ZEP7      VLLISLTGLIVASLYAIYAIDIYKSTVVLKVAKPS-GSILNS-PL--MPEFSD--FGSDR
A0A3D6BED1      VSAILIASLIISIIYAISARDIFKTSTALKITKPG-GSILQS-PL--MPEISD--YGNDR
A0A3N5Q7G8      -VLIIATALIVSIIYAVNARDIYKSTATLKVVKPQ-GNILYS-PV--IPEFQD--FGNDR
A0A1G0P4D7      IILIVAASLIISIVYAVNARNIYKSTAALKVVKPQ-GSILNS-PV--ISDFQD--FGSDR
A0A1G0QKB6      IILIVAASLIISIVYAVNARNIYKSTAALKVVKPQ-GSILNS-PV--ISDFQD--FGSDR
A0A1G0V7G7      IILIVAASLIISIVYAVNARNIYKSTAALKVVKPQ-GSILNS-PV--ISDFQD--FGSDR
A0A419EVC1      IILITLAGLAVAVIYAINAPNIYKATTSLKVSKPQ-GSILES-PL--IPEFQD--FGSDR
A0A7C2NJJ5      IIIITLAAVGIAVFYALTATNIFSSTTSMKLNKPS-GNILEA-PL--LPEFQD--FGSDR
A0A2E0W055      ILLISAAGLIVSVLYALTAQNIYKSTTVMKLSKPQ-GSILEA-PL--MPEFQD--FGSDR
A0A2N1VVT2      ILLISVTGLIVSVYYASRTPDIYTATALIKLQQPK-GSIISG-PL--IPTISS--FGNDR
A0A2H0FVC7      ILLITFTGLTVAIIFAIISKDIYTASTSLKIAKPNGGGILDA-PL--LPEFSD--FGNDR
I6ZVA1          IVVISLTALIVAVVYALNAPDIYKSTTTLKITKPQ-GSILDA-PL--IPEFQD--FGSDR
A0A2H0DC71      FSLIAIVAIVVSVVYAVSSINIYKSTTVLKVSKPS-GNILNS-PL--MPEFQD--FGSDR
A0A2M7MN42      FSLIAIVAIVVSVVYAVSSINIYKSTTVLKVSKPS-GNILNS-PL--MPEFQD--FGSDR
A0A1V5TPD0      IVISVFLSLVLAFLYIKFTPPVYESKALLKKEAAENPGQ---KDE--FSELVK--LQTSD
A0A6M8V2X9      IISIIIASVILAFTYNQLTTPIYESKALLKKEVTDNSGQ---RDE--LYEIVK--LQTSD
A0A6M8UVD7      IVISVIIALILAYLYNHFSTPVYESKALLKKEAADNRQE----DE--FSELVR--LQSSD
I0AMF0          LFATVGVLLIAALIYSFTATPIYEASATLKKEGNPNDRRLGSGTD--ISTLLS--LQSTD
                        .  :  :       : :.. :*                 :            

A0A2G6EB58      FIANEIETIK-NITITEKVAREITDSFIAINNN---------------------------
A0A1G0X4V9      FIANEIQTIY-NSTIMNEVAEAIIDSFKVKKNE---------------------------
A0A3A0BB82      YISNEIEVLK-SFSIRSLTAKTLLDSAEANGNI---------------------------
A0A2G6EAS5      FIANEIETIR-NVTIREQVAGVVLDSFQNKADK---------------------------
A0A6N6SN85      FISNEIEVIK-SFTLRERVATALIDSFNNYQKK---------------------------
A0A1G0P817      LIANEIQTVTYNYTIREQVADAVIDSVESSSPS---------------------------
A0A1G0QLK5      LIANEIQTVTYNYTIREEVADAIIDSVESSSPS---------------------------
A0A2N1VFP3      FIANEIEVLK-SYHLRERVSRCLIDSFKLSPEK---------------------------
A0A6A4UG68      FIANEIEILK-SYKLRTKVANALLDSFNISTQK---------------------------
A0A1G0VGZ5      FIANEIEILK-SYKLRSKVANALLDSFNVSSTK---------------------------
A0A1G1B9H5      FIANEIEILK-SYKLRSKVANALLDSFNVSSTK---------------------------
A0A419H3A3      FIANEIEILK-SYKLRSKVANALLDSFNVSSTK---------------------------
A0A6N7BD63      FIANEIEILK-SYKLRSKVANALLDSFNVSSTK---------------------------
A0A2M7ZEP7      FIANEIEILK-SEKIRSLIIKQIQDSFKVIDA----------------------------
A0A3D6BED1      FIANEIEILK-SNNIRERIAKILLDTLLKSNDP---------------------------
A0A3N5Q7G8      FLANEIEVLK-TFNTRERVAKSLIDTYNDVASK---------------------------
A0A1G0P4D7      FIANEIEILK-TFNTRERVAEALIDSFNTFGVK---------------------------
A0A1G0QKB6      FIANEIEILK-TFNTRERVAEALIDSFNTFGVK---------------------------
A0A1G0V7G7      FIANEIEILK-TFNTRERVAEALIDSFNTFGVK---------------------------
A0A419EVC1      FIANEIEILK-SYSVRERVANAMLSYYKDSSIK---------------------------
A0A7C2NJJ5      FIANEIEILK-SYTIRENVAKALIDSFRLSNHP---------------------------
A0A2E0W055      FIANEIEIMK-SYTIREKVAKSLIDTFHNIGVR---------------------------
A0A2N1VVT2      FIANELEILK-SYRMREIVAKALLDSFRTANRV---------------------------
A0A2H0FVC7      FIANEIEILK-SYRLRTIVATSLIDSFNVIAQP---------------------------
I6ZVA1          FIANEIEILK-SYSLRNQVAETLSDTFKLSRDK---------------------------
A0A2H0DC71      FIANEIEVLK-SYKVREIASTALKDSFNALNQI---------------------------
A0A2M7MN42      FIANEIEVLK-SYKVREIASTALKDSFNALNQI---------------------------
A0A1V5TPD0      QLETEMELIK-TNEVLSGVINELKLYVELRKVV-DPNGNSYEFNNIFVDFPDSANNYTKQ
A0A6M8V2X9      RLETEMELVK-TSEVLGRVIRDLKLRFDVKKIV-DPKGNSYHLKNVFVDFPDSGNNYAKE
A0A6M8UVD7      QLETEMELIK-TNEVLGGVINELKLFVELSKVM-DPNGSAWELNNVFIEFPDSGNSYAKE
I0AMF0          EIETELELIK-TFKVASEVAKELDLYVNVKEIKWNSNDKNYEINKTFVEMNDPSFIGKNS
                 : .*:: :  .          :                                     

A0A2G6EB58      ---------------------EMFSLIVNKNY----FEDGSSGLK---------------
A0A1G0X4V9      ---------------------DDFSLIFDKSY----FQSKGTLLK---------------
A0A3A0BB82      ---------------------SSFYHLLNDPDDL------SKGLK---------------
A0A2G6EAS5      ---------------------ENYDVVFRKNSFF---DDSDKKIR---------------
A0A6N6SN85      ---------------------DTFSVILTADK----VDPTKKVLM---------------
A0A1G0P817      ---------------------D-FALIIDDEN----TAKSRGKLK---------------
A0A1G0QLK5      ---------------------D-FDLIIDDEN----TAKPRGKLK---------------
A0A2N1VFP3      ---------------------NKFSLIYEDARGI---STTGRKLK---------------
A0A6A4UG68      ---------------------NKYYLIFEDPSEL---KQGKFRVK---------------
A0A1G0VGZ5      ---------------------NKYYMIFEDPSEL---KQGKFRLK---------------
A0A1G1B9H5      ---------------------NKYYMIFEDPSEL---KQGKFRLK---------------
A0A419H3A3      ---------------------NKYYMIFEDPSEL---KQGKFRLK---------------
A0A6N7BD63      ---------------------NKYYMIFEDPSEL---KQGKFRLK---------------
A0A2M7ZEP7      ---------------------DSFYLVLDQDSKFFSNNKNKKKLL---------------
A0A3D6BED1      ---------------------KSFHLLLTDEF-----GED-SRPK---------------
A0A3N5Q7G8      ---------------------DSFYILLDVSSAF--QETK-ARLL---------------
A0A1G0P4D7      ---------------------DSFFLLLNQKS----DKQK-GKLL---------------
A0A1G0QKB6      ---------------------DSFFLLLNQKS----DKQK-GKLL---------------
A0A1G0V7G7      ---------------------DSFFLLLNQQS----DKQK-SRLL---------------
A0A419EVC1      ---------------------DSFYIIKNKDYGK--DRTVKSPVK---------------
A0A7C2NJJ5      ---------------------DKFHLIYDQESLF--SDNDRKELR---------------
A0A2E0W055      ---------------------DSFYWVLNQDLDL--TPDS--EVK---------------
A0A2N1VVT2      ---------------------DTQNFMINYSKLL--SEKS--DTN---------------
A0A2H0FVC7      ---------------------DSFYNIFDRSIDF---DREAYKLK---------------
I6ZVA1          ---------------------DKFELIVDREDR-----NTKPTLM---------------
A0A2H0DC71      ---------------------DSFKVLVHTPSKL---TNDKPKLL---------------
A0A2M7MN42      ---------------------DSFKVLVHTPSKL---TNDKPKLL---------------
A0A1V5TPD0      MSFSFP--IFKNFQLLNDYTEKEYYIKKINQNRFELWDAKGKNIITSFNDFSVSKSDSIK
A0A6M8V2X9      ISFSLP--KIKYLKIKDENTELELFIKKIATNKFELWDVEKNKLIISFNVSSVSKSDSLI
A0A6M8UVD7      IGFHLP--IFKNFQLLNDYTELELYIIKTGEKSFELRDVPDNKLITSFNSSSVSDSDTLK
I0AMF0          RKFRIPEKFKIKFERAEDLLLGDFSIVKKSNDKYELIDLLSGNKI----SESTIEKPKYD
                                                                            

A0A2G6EB58      ----------------------------------------------EFDAIIKVLE---N
A0A1G0X4V9      ----------------------------------------------SANEVAGNLY---S
A0A3A0BB82      ----------------------------------------------NEFEIAKMLK---Q
A0A2G6EAS5      ----------------------------------------------TVESLAGALL---K
A0A6N6SN85      ----------------------------------------------TPDKLAEQLS---G
A0A1G0P817      ----------------------------------------------EYDDILDILE---N
A0A1G0QLK5      ----------------------------------------------EYDDILDILE---N
A0A2N1VFP3      ----------------------------------------------TVEEIAVMLT---S
A0A6A4UG68      ----------------------------------------------TIAEIVRVLP---K
A0A1G0VGZ5      ----------------------------------------------TIASIVGMLP---S
A0A1G1B9H5      ----------------------------------------------TIASIVGMLP---S
A0A419H3A3      ----------------------------------------------TIASIVGMLP---S
A0A6N7BD63      ----------------------------------------------TIPSIVGMLP---S
A0A2M7ZEP7      ----------------------------------------------PYREISKLLE----
A0A3D6BED1      ----------------------------------------------TVPEIAGVLG---S
A0A3N5Q7G8      ----------------------------------------------STDDIAERLS---S
A0A1G0P4D7      ----------------------------------------------PVSEIAEELF---H
A0A1G0QKB6      ----------------------------------------------PVSEIAEELF---H
A0A1G0V7G7      ----------------------------------------------PASEIAEELF---Y
A0A419EVC1      ----------------------------------------------SVQQITDMLT---S
A0A7C2NJJ5      ----------------------------------------------AVNDLATLFGDKNS
A0A2E0W055      ----------------------------------------------TVVQLSELLS-KIA
A0A2N1VVT2      ----------------------------------------------ISQNLGSIIG-ILS
A0A2H0FVC7      ----------------------------------------------NINDLVLMLE----
I6ZVA1          ----------------------------------------------PIEDIVELLE---S
A0A2H0DC71      ----------------------------------------------EVDEIASLLS---T
A0A2M7MN42      ----------------------------------------------EVDEIASLLS---T
A0A1V5TPD0      ESNALD-LSDSTKSSVQDAEGVTVITDAAKFEFSWSDAPVGSKIYFNIKNYLKFLTRFGD
A0A6M8V2X9      ESNIEN-SFDLKQELQKNQNQLNVNTDFLQFDFSWDDAPVGSKIYFDIENYSKFYTTFSK
A0A6M8UVD7      DYSAAN-FPDSTNKLEKVTSEENVSTDFAKFEFSWDGAPIGSKIYFNIKNYLKFILNFSN
I0AMF0          GFSPLDTIPGFTIKRDTSVVYIIPMNDKVNIEFSWNGAPVKSEFIFTVNDINQTAIGVSK
                                                                            

A0A2G6EB58      KVSVEQKRGLDFIEIKVESPSAQEAALIADTYARVYREFNLLDNRKQVSKVKDFLFNQRN
A0A1G0X4V9      NVKITQLNDLDWVDIVVESQTPQEAALIANIFAKKYQKFNLLENRKQIRIIKEFLGEQLK
A0A3A0BB82      VVQVVQKKGLDVVDLSVESPSPYEAAIICNAYAKTYSDYSLEFSRLDLTNIINYLNTEKE
A0A2G6EAS5      SVEITQKNNLNFMEIMVESESPEEAAMIANSYAEVYRNFNLLENRKQFTIVKDFLNEQKE
A0A6N6SN85      LTTIEQKRGLDFVILSANSPSPLEAAMIANTYAAEYKNLNLALNRDQLVVVKNYLDQQRN
A0A1G0P817      HVEVEQIGNLDFISISVESPSAKEAAVIANSYAEAYRVFNLMVNRNELTTIRKTLEEQRK
A0A1G0QLK5      HVEVEQIGNLDFISISVESPSAKEAAVIANSYAEAYRVFNLMVNRNELTTIRKTLEEQRK
A0A2N1VFP3      KVSIDQKRGLDIIEISVESQAPFEAAMIANSYASSYKEINLTYNRQQLTVIKNFLAQQRE
A0A6A4UG68      QVSIDQKRGLDIVEISVESPSPLESSMIVNCYAEAYKGINLSYNREQLTRVKNFLAQQRD
A0A1G0VGZ5      KVSIDQKRGLDIVEISVESPSPTESAMIVNCYAEAYKGINLSYNREQLTRVKNFLASQRD
A0A1G1B9H5      KVSIDQKRGLDIVEISVESPSPTESAMIVNCYAEAYKGINLSYNREQLTRVKNFLASQRD
A0A419H3A3      KVSIDQKRGLDIVEISVESPSPTESAMIVNCYAEAYKGINLSYNREQLTRVKNFLASQRD
A0A6N7BD63      KVSIDQKRGLDIVEISVESPSPTESAMIVNCYAEAYKGINLSYNREQLTRVKNFLASQRD
A0A2M7ZEP7      KVSIDQKRGLDIIEISVESPSPFEAAFLANAYAKAYESLNLSYNRQQLVVVRDFLMEQRE
A0A3D6BED1      AVQIEQKRGLDIIDISVESQAPKEAALIANVYAKEYLTYNLEISRDQLTFVREFLANQRL
A0A3N5Q7G8      AVSIDQKRGLDIIEISAESPSPYEAMLVANSYANEYKTLNLEVNRNQLTIVKNFLLEQRN
A0A1G0P4D7      AVSIDQKRGLDIIEITVESPSPYEAVLAANCYTNEYKNLNLEVNRDQLTLVKDFLLDQKQ
A0A1G0QKB6      AVSIDQKRGLDIIEITVESPSPYEAVLAANCYTNEYRNLNLEVNRDQLTLVKDFLLDQKQ
A0A1G0V7G7      AVSIDQKRGLDIIEITVESPSPYEAVLAANCYTNEYKNLNLEVNRDQLTLVKDFLLDQKQ
A0A419EVC1      VVSIDQKRGLDIVEISVESQSPYEAALLANEYATAYNQMNLQTNRAQLTNIKNFLEEQRK
A0A7C2NJJ5      IVTIEQKRGLDVVEISVESPSPEEAALIANIYAKSYLDLNLAYNRKQLVVVKEFLETQRK
A0A2E0W055      --VIEQKRGLDILEISVESPSSFEAALIANSYAEAYKQQNLTYNRLQLITVKNFLEEQRV
A0A2N1VVT2      GVSVNQKQGLDLVEISATSTSPLEAKIIANTYAKSYENLNLKYERQQLISVKNFLEKQRN
A0A2H0FVC7      DTKIEQKRGLDIVTISYESHSPFEARLITNAYADAYENLSLKYTRQQLTTVVQFLKEQRK
I6ZVA1          EVDISQKRGLDIVEITVESRSPYEASLIANCYAEAYKKLNLTYNRQQLTAIKEFLAQQRE
A0A2H0DC71      NVTIEQKRGLDIVEISSQSPSPFEAALITNLYAQAYKTLNLEINRNQLTLVKAFLLDQKN
A0A2M7MN42      NVTIEQKRGLDIVEISSQSPSPFEAALITNLYAQAYKTLNLEINRNQLTLVKAFLLDQKN
A0A1V5TPD0      AINVSRVGHTGVFELNVRSVSPLACNIIANSVIRHFREVRMEQQKQMVRYSFHFVDQQLS
A0A6M8V2X9      DINVSRIGHTDVFELSIKSSSPLACKIIADDLINQFREVRMEQQKQSVRYSYNFIDEQLT
A0A6M8UVD7      NINVSRVGHTDIFQLNVQSTSPLACNVIANSIIRHFRKVRMEQQKQMVRYSFHFVDEQLT
I0AMF0          SIKVSRVGKTNIFNLGYSSSSAYAAALITNTVVDKYREARMDQKKQTIRYSYNTVDKQLV
                   : .    . . :   * :.  . .  :     :    :   .  .      :  :  

A0A2G6EB58      DKLNELIAAEDKLKNYQLKGGVVELSSQAQSLIETITDLEAKINANAVELSIARENLNQF
A0A1G0X4V9      EKQLALYAAEDAVKEYQLRKGGVQLDAQAQLLISKLADFESQKNTAKVNMSITKEKLNQY
A0A3A0BB82      KKFRDLKLSEAALEDFQQREGVVQLDVQADELVRSLSAIDKEKTMTSIELAANEKKYSEL
A0A2G6EAS5      QKYDELLVAEENIKVYQANSGGIELNSQAKAMINTLTKFESDKNITQMEIAIERKKLNEF
A0A6N6SN85      EKLGELNNAEDALQSFQEQGGIIALDNQASNLISQISTLEANKGMNEIELQSTQNAIASY
A0A1G0P817      EKLSDLILAENNIKAYQLKGGVIQLDAQAKNLIDKLSNYEAQRNTAQIDLSILKGSLEKY
A0A1G0QLK5      EKLSDLILAENNIKAYQLKGGVIQLDAQAKNLIDKLSNYEAQRNTAQIDLSILKGSLEKY
A0A2N1VFP3      EKLAQLVGVEETLKNFQEKSGIVQLPEQARALIDQSSDFQAKMNAAKVDLTISEKTLNNY
A0A6A4UG68      EKQSELAAIEESWTAYKQSKGIVELPEQARALIDQSSDIQAKLNLTKIDLTMTEKNLNQF
A0A1G0VGZ5      EKQSELISVEETLKNYQEQRGIVELPEQAKALIEQSSDIQAKMNATRIDLTMTEKSLNQY
A0A1G1B9H5      EKQSELISVEETLKNYQEQRGIVELPEQAKALIEQSSDIQAKMNATRIDLTMTEKSLNQY
A0A419H3A3      EKQSELISVEETLKNYQEQRGIVELPEQAKALIEQSSDIQAKMNATRIDLTMTEKSLNQY
A0A6N7BD63      EKQSELISVEETLKNYQEQRGIVELPEQAKALIEQSSDIQAKMNATRIDLTMTEKSLNQY
A0A2M7ZEP7      EKYHELILAEEKLKNYQEKGGIIALDEQAKSLIAALSDFQSQRDASQIEVAMTQKALDQY
A0A3D6BED1      EKKEQLNDAEEILRSYQERGGIIALDQQAQTLIQQLAQFEAQKNATQIEIEASSEVLKQY
A0A3N5Q7G8      EKQTLLNEAEETLRKFQERGGVIALDEQANNLIAQLSNFEAQKNAAQIDLMASDKILAQY
A0A1G0P4D7      EKQNQLSQAEETLKKFQEKGGVIALDEQANKLISQLSDFEAQKNATQIELMASSKVLNQY
A0A1G0QKB6      EKQNQLSQAEETLKKFQEKGGVIALDEQANKLISQLSDFEAQKNATQIELMASSKVLNQY
A0A1G0V7G7      EKQNQLSQAEETLKKFQEKGGVIALDEQANKLISQLSDFEAQKNATQIELMASSKVLNQY
A0A419EVC1      GKQGELSRSEDSLRRYQQQGGIIALDEQAKSLIDQLTNFEAQKNSTNIELTVARNNLAQY
A0A7C2NJJ5      GKLDELLFAEEQLKVYQEERGVVDLTQQARALIDQLTTFESQRNATKIDLTISKKSLDQY
A0A2E0W055      DKLNELREAEDAVKKYQEQGGIVVLDEQARALIDLISEFESQLNAAKIEMMSSELTLKLY
A0A2N1VVT2      QKLDELMQSEDNLKRFQEQGGIIAIDEQAKALIDVITDFQSQRDATQIELSISGKRLQQY
A0A2H0FVC7      DKYSALLEVEEKIKTFQVEGGIIALDEQAKALIDMLSTFESQRDAAAIEMMATEKMVNSY
I6ZVA1          EKLAELSAVEEALRTYQEQKGIVELPEQARALIEQTTDFESKMNATKIDLTIAENNLKQY
A0A2H0DC71      EKLAQLNNSEELLKMFQEKGGIIALDDQAKELITQLSKFEADLNLGKMELAISEKTLKQY
A0A2M7MN42      EKLAQLNSAEDILKIFQEKGGIIALDDQAKELITQLSKFEADQNLAKMELAISEKTLKQY
A0A1V5TPD0      EVQKKLLDAENNLSSFKGSQQIMNIDQNTQELLNYQSTLEAENLQTDLLLSDYRNKEVAL
A0A6M8V2X9      EVQKKLIDSEGNLSNFKGSGRIINIDQNTQELLNYQSTLEAEKLQTDLLLSNYRDKAAAM
A0A6M8UVD7      EVQKKLLDAENNLSHFKGSEQIVNIDQNTQELLNYQSTLEAEKLQGDLLLTDYKNKETAL
I0AMF0          EVQEKLQEAEKILSDFKSSGQIMSIDASSQEIVGFLSRLEAEKVSTDLLLSDYKNKVADL
                     *   *     ::     : :  .:  ::   :  : .     : :          

A0A2G6EB58      KEELNKKDPTIIQYLENKS---AEPYLLRLQEQIAEVQTQKDIALSSLGDSKSSKDVQII
A0A1G0X4V9      KNELEKRDPSISNFLANKT---SEPYLQKLQEEIASLQTQRDVALASSKTA-NANN-TAV
A0A3A0BB82      SQKIDEIDPKLKVYLESEI---SKGYLPELQKQIAQLEIERELQLSIISND-RVRQ-KAK
A0A2G6EAS5      KNELSERDPSLSNYFDLQS---ARPSIEMLQKEIASIETQKAIALSGKGSR-EQKN-TLV
A0A6N6SN85      REKLDSLDPNAKEYLKQFE---IKGYFDELQNEIAKLEIQKMLVSGNDKD--PKTK-AAF
A0A1G0P817      KNELKQKDPSLITYLESKT---SEPYLTSLQTQIAQLETQRDMALSGSSGS-RVNS-EVI
A0A1G0QLK5      KNELKQKDPSLITYLESKT---SEPYLTSLQTQIAQLETQRDMALSGSSGS-RVNS-EVI
A0A2N1VFP3      KQELNKHDPNLTDYIENLA---TEPYIKKLQEQIGEQKIQRDRALASQS---SNKQ-QMV
A0A6A4UG68      KDELKRRNPEVQNYIDNMA---TEPYIKRMQEDLAEEKSRRDRAMKAAG---AN-S-VEV
A0A1G0VGZ5      KDELKRRNPEIQNYIDNLA---SEPYIKRMQDELAEQKSQRDRAIKDAG---PN-S-PLV
A0A1G1B9H5      KDELKRRNPEIQNYIDNLA---SEPYIKRMQDELAEQKSQRDRAIKDAG---PN-S-PLV
A0A419H3A3      KDELKRRNPEIQNYIDNLA---SEPYIKRMQDELAEQKSQRDRAIKDAG---PN-S-PLV
A0A6N7BD63      KDELKRRNPEIQNYIDNLA---SEPYIKRMQDELAEQKSQRDRAIKDAG---PN-S-PLV
A0A2M7ZEP7      KEELEKKNPSLTQYIESYA---AEPRLKSLQEQIAKLETQRDLAIANKNV--PENK-RLI
A0A3D6BED1      RDELSKQDPKLADYLASAT---SETYIKALQDQIAELQIRRDLALAKTDTK-TDFS-DQL
A0A3N5Q7G8      KRELAEQNPRLADYLKGLS---SEAYFTSLQEQLVKLEVNRDIALSNNNPI-ENRN-KIV
A0A1G0P4D7      RNELDKQNPRLADYLKGLS---SEAYFKSLQEQLVRLEVNRDLALSTKSSL-EDDS-KSV
A0A1G0QKB6      RNELDKQNPRLADYLKGLS---SEAYFKSLQEQLVRLEVNRDLALSTKSSL-EDDS-KSV
A0A1G0V7G7      RNELDKQNPRLADYLKGLS---SEAYFKSLQEQLVRLEVNRDLALSTKSSL-EDDS-KSV
A0A419EVC1      RDELKKQDPRLADYLQSFA---AEPYLKSLQEEIAKLETNRDIALASKGQY-TSNS-KVI
A0A7C2NJJ5      KEELEKQDPRIKDYLESFA---TEPYIKNLQTQIAQLQSQKDLALSTVDRSGGANT-AII
A0A2E0W055      NEELDRQNPEIKKYIENFA---AQKELEQYQTSIAKLTVDKELAMANLNRT-NKEQ-EIA
A0A2N1VVT2      NNELEKKNPTIAQYIKNAA---TQPRLENLQKSIAQMETQRDVAISNTQGA-SRRK-ELV
A0A2H0FVC7      KTEINRLNPSISKYIESFA---TKPKMKGLQEQIAQLEMQRDLAISDSSVTIESEA-KLI
I6ZVA1          KAELAKQDPNINDYIESFA---TEPYIKNLQLQIADLQTQKDRALS-SYKDSPRRS-EII
A0A2H0DC71      KDELRRQDPQLTAYLENFS---SEEYLKNLQTELARLEVNRDVALS-SVKDKNVDT-QAI
A0A2M7MN42      KEELRNQDPQLTAYLENFS---SEEYLKSLQTELAKLEVNRDIALS-SSKDKNNDN-QTI
A0A1V5TPD0      KSELKSSGYFDQGFLSPSTESQSSSPFTTLMSRLSDLELQRLELLQKRTEKHPDVV----
A0A6M8V2X9      QKELEASGYFDQSFLQPSGENQGESPFSGLMSRLSELELQKLDLMQKRTEKHPDVI----
A0A6M8UVD7      RKELEASGYFDQGFLQPSSESQSSSPFTGLMARLSDLELQRLELLQKRTEKHPDVI----
I0AMF0          QTQLSQKGFFDQSYLNPRGEGEGMSPFAELMRQLSNLELQRIELLQKRTENHPDVK----
                  ::   .     ::           :      :      .                   

A0A2G6EB58      KKFDEKLAELKNKLSKNVKSYQSSVLAASPEEIKTLTQQIFEEQVKAQALQASHDKLKGF
A0A1G0X4V9      AELNSKINSLKDKLNKSMKEYGNQILASSPEEIKVLSQKTFEEEVTYQSLAESYNSFTNV
A0A3A0BB82      EEYDRKISSLQESLDKNVKSLDAGMYVMTPEERREMVWELVKTGVMVNSDRIKNRVLGNY
A0A2G6EAS5      KGLDQKLGELRKKLKTDIDAYESKVYAATPEEVKELSAKIFESEVKIQSLAAKNSQLSQV
A0A6N6SN85      TELDNKIKVLKKELDKKIVEFQSSAVANTPEEYRTLAMKILDLEVQEKGFDLAVKQLSNQ
A0A1G0P817      NDYNNRIDELKDKLKKSVSKYQSMILSSSPEEIKDLTKKVFETEVKYQAEMSSYNQLGQI
A0A1G0QLK5      NDYNNRIDELKDKLKKSVSKYQSMILSSSPEEIKDLTKKVFETEVKYQAEMSSYNQLGQI
A0A2N1VFP3      REVDAKISELRDKLNSQLSVFRAGVLASSPEEIKELAKRVVDEEIKYQSIVASYKKLNEI
A0A6A4UG68      KRTETKISEIENRLKNQLAVYKQGVLASTPDEIKTLTAKVLEEETKFQSLSASFRKLNEI
A0A1G0VGZ5      KKAETKINEIDARLKNQLSVFKAGVLAATPEEIKTLTAKVLEEETKYQSLNASYRKLNEI
A0A1G1B9H5      KKAETKINEIDARLKNQLSVFKAGVLAATPEEIKTLTAKVLEEETKYQSLNASYRKLNEI
A0A419H3A3      KKAETKINEIDARLKNQLSVFKAGVLAATPEEIKTLTAKVLEEETKYQSLNASYRKLNEI
A0A6N7BD63      KKTETKINEIDARLKNQLSVFKAGVLAATPEEIKTLTAKVLEEETKYQSLNASYRKLNEI
A0A2M7ZEP7      KDYDESIKELKLKLDEQLKIYKTSIFALSPEEVRELSLNVLEQEVKLISAQSKKENLEKI
A0A3D6BED1      RDYDNKIKDLKGKLAEKIKVLKAGIFASSPEEVKNLSQKIIEEEIKNGSLKTTLNELNLV
A0A3N5Q7G8      SDYDEKIKELQNKLNSKVDEIKTGIFASSPAEVKELSQKIIEEEVKNQALKISVSELEII
A0A1G0P4D7      QNLNEKIIDLRNKLNDRVEEIKLGIFASSPEEVKELSQKMIEEEIKNQSLKISVTELGSI
A0A1G0QKB6      QNLNEKIIDLRNKLNDRVEEIKLGIFASSPEEVKELSQKMIEEEIKNQSLKISVTELGSI
A0A1G0V7G7      QNLNEKIIDLRNKLNDRVEEIKLGIFASSPEEVKELSQKMIEEEIKNQSLKISVTELGSI
A0A419EVC1      ADYEAKIKSLKDKVTEKMSVYKAGIFASSPEEVKSLTQKIIEEETKVKAATASLQELNDV
A0A7C2NJJ5      NEYEKKITDLREKLNEQILVYKAGIFASNPEQIQQLTAKVLEEEVRYQSLLSSYKELDEL
A0A2E0W055      KYYDDKIADLNKKVDKLLEKYEASIFASSPEEIKELTLKKLEEEVKYNAYKASYNELDKI
A0A2N1VVT2      EDYNARINELKSTLDEQLAVYKASIFASSPAELKDLSLKVLEEEIKSKATASKFESLDDI
A0A2H0FVC7      SETNKRIAELKIELNKELETYKQSIFAASPEELKELSISLLEAEVKYESLKSTISKTKEI
I6ZVA1          REFDAKINDLKEKLNNQLTVYRAGILASSPEEIKELTRKVLEEEVKYQSLKASYEKLSEI
A0A2H0DC71      REYDAKIKELRNKLNSKIEGFKASIFASSPEEVKLMTKNVIEEEIKSKSLEIKVKNLSEI
A0A2M7MN42      KEYDAKIKELRNKLKSKVEGVKASIFASSPEEVKLITKNVIEEEIKSQGYAIKVKNLDAI
A0A1V5TPD0      -----KLDEQIRLTKEQLSSYNQNTLASYRIVIDAMEKKQA--------------KIKDL
A0A6M8V2X9      -----NINEQIELVKQKLSSYNQNTLTAYKIIIGTLEKKLY--------------KINSL
A0A6M8UVD7      -----KLDEQIRLVKEQLSSYNQNTLTSYRIMIDALEKKQA--------------KINSL
I0AMF0          -----AVDEQINSVKQKLSSFNENTITAYQIMIGTLEKKLL--------------KINDM
                      :          :                 :                        

A0A2G6EB58      LAGYEKRFNSLPQRTIDLARYEREKLAYEKLYSLLEEKYQEALINEQSTTGSVLIMNYAR
A0A1G0X4V9      INKYEQEFNKLPTSTLDYARLERRRLAEENLFNTLTEKYQEAQLNEQATPGNVLIMNTAN
A0A3A0BB82      VNEYETRFNKLPSQIIEYARLERDKLTNEKIYILLEEKYQEALINQNARIGNVTIIDPAF
A0A2G6EAS5      LNSYESEFQSLPAKSLEIARLERKRQSLEKMYLVLEDKYQEALLNEQSIPGNVLILSKAR
A0A6N6SN85      LALYENKFGTLPRNAIELAKLTRTREALEKLYSLIEQRYQESVINEQAQPGNVVVIEAAR
A0A1G0P817      ISSYEGRFNNLPGRTLDLARLERERSVFEKLYLALEEKYQEALINEQAMPGNVFIMNYAF
A0A1G0QLK5      ISSYEGRFNNLPGRTLDLARLERERSVFEKLYLALEEKYQEALINEQAMPGNVFIMNYAF
A0A2N1VFP3      VGEYDKKMNLLPTTATDQARLEREKSANEKLYLQVEERYQEAIINEQSVPGNALVIDAGL
A0A6A4UG68      GGDYDRKLSALPTSSTDLARLEREKQAYEKLYIQVEERYQEAIISEQSVPGNVLIIDEGL
A0A1G0VGZ5      GGDYDRKLSALPTSSTDLARLTREKMAYEKLYLQVEERYQEAIISEQSVPGNVLIIDEGL
A0A1G1B9H5      GGDYDRKLSALPTSSTDLARLTREKMAYEKLYLQVEERYQEAIISEQSVPGNVLIIDEGL
A0A419H3A3      GGDYDRKLSALPTSSTDLARLTREKMAYEKLYLQVEERYQEAIISEQSVPGNVLIIDEGL
A0A6N7BD63      GGDYDRKLSALPTSSTDLARLTREKMAYEKLYLQVEERYQEAIISEQSVPGNVLIIDEGL
A0A2M7ZEP7      VGKYDKKFNELPSQTIDLARYQRELSAYEKLYLLVEEKYQEALINEQSTPGNVLIIDEAR
A0A3D6BED1      VKKYDERFNKLPKTSIELARFERNRESLEKLYTLVEEKYQEAVINEQSQPGNVLIIDDAR
A0A3N5Q7G8      VKSYESKFNNLPKTAIELARYQRSRESLEKLYTLVEEKYQEALINEQSQPGNVLIIDNAR
A0A1G0P4D7      VRNYEKKFNKLPQTAIELARYQRSRESLEKLYTLVEEKFQEALINEQSQPGNVLIIDNAR
A0A1G0QKB6      VRNYEKKFNKLPQTAIELARYQRSRESLEKLYTLVEEKFQEALINEQSQPGNVLIIDNAR
A0A1G0V7G7      VRNYEKKFNKLPQTAIELARYQRSRESLEKLYTLVEEKFQEALINEQSQPGNVLIIDNAR
A0A419EVC1      VRSYDAKFNSLPKATIELAKLERDRTANEKMYLLVEEKYQEAIINEQSQPGNVLIIDYAR
A0A7C2NJJ5      VQRYEVRFNEMPKRTLDLARLQRIKEANEKLYLLVEEKYQEAQINEQSTPGNVLIIDDAR
A0A2E0W055      VKNYERRFNQLPERTIDLARLQREREAYEKLYLLVEEKYQEALINEQSTPGNVIIVDQAR
A0A2N1VVT2      VRRYERRFNELPRQTIDYARFQRELTSYEKLYLLVEGKYQEALINEQSTPGTVLIIDEAI
A0A2H0FVC7      VNQYEARFNELPKQTISLARLTRELNANEKLYLLVEEKYQESLIVEQSTAGNVLIIDPAI
I6ZVA1          VADYDKRLNKLPTSSIDLARLTREKQAYEKLYLQVEEKYQEAIINEQSVPGNVMIIDPAI
A0A2H0DC71      VNKYDSKFNQLPKSAIEYARLQRGRESLEKLYILVEEKYQEAVINEQSQPGNVLIIDVAR
A0A2M7MN42      VKTYDAKFNQLPKSAIEYARLQRGRESLEKLYILVEEKYQEAVINEQSQPGNVLIIDVAR
A0A1V5TPD0      MSGFEAQIKRLPGQESQLARLIREKEVYEKIFNVLLNKREEMRVAELSKLQDIIIVDYPS
A0A6M8V2X9      LSLHESEIKQLPAKETQMARLIREKDVYEKMFKLLLDKREEMRVAELAQLQDIIIVDHPY
A0A6M8UVD7      MSGFESQIQKLPRQESEMARLIREKDVFEKIFNLLLNKREEMRVAELSKLQDIIIVDYPS
I0AMF0          MSKYEAKLQSLPAQENKLAQILRQKATYEKIFTILLDQREAMRVAELSSPQDISIVDEAK
                   .:  :  :*    . *.  *     *:::  :  . :   : : :      ::.   

A0A2G6EB58      VPKVPAKPNRKLIILIGLVLGLGLAFGYALIMNYFDKAIKSPEDIEER-NINLIGWVPKV
A0A1G0X4V9      PSRNPSGPNRMMIILMGLFIGIGFALGFVYVRNYFDKTIKTPEDIEAQ-NVNVLAWIPKI
A0A3A0BB82      ESLLPSKPNRVFLLVSGAVFGLILGIGFVITRNYLDKSIKTPDDLENN-GYSILAWIPSI
A0A2G6EAS5      APESPAEPNRLKIAIMGLFAGLFFAVVFVYVKSFFDKTVKTPDDLENL-GLYVLGSVPRF
A0A6N6SN85      VMDKPAKPNRTLIVIIGLVLGLVVSISYVFIRDYFDKTIKTPDELSKL-GFNVLSWIPRI
A0A1G0P817      PPPDPNKPSRPLIIVFGVIIGFGFGFGFIYLKDFLNKRIKTPEDIQDL-GTTLLTWIPRT
A0A1G0QLK5      PPPDPNKPSRPLIIVFGVIIGFGFGFGFIYLKDFLNKRIKTPEDIQDL-GTTLLTWIPRT
A0A2N1VFP3      VPILPAKPNRLLIVIIGLFLGIGMGIGFAFIRNYLDNTVKTPEDIQNK-NINILSWIPQI
A0A6A4UG68      VPDNPAKPNRLLIIVIGLVLGTGMGVGFAFVRNYLDNTVKTPEDIQNK-NLNILAWIPQI
A0A1G0VGZ5      VPVKPAKPNRLLIVLIGLILGFGMGIGFAFIRNYLDNTVKTPEDIQNK-NLNILAWIPQI
A0A1G1B9H5      VPVKPAKPNRLLIVLIGLILGFGMGIGFAFIRNYLDNTVKTPEDIQNK-NLNILAWIPQI
A0A419H3A3      VPVKPAKPNRLLIVLIGLILGFGMGIGFAFIRNYLDNTVKTPEDIQNK-NLNILAWIPQI
A0A6N7BD63      VPVKPAKPNRLLIVLIGLILGFGMGIGFAFIRNYLDNTVKTPEDIQNK-NLNILAWIPQI
A0A2M7ZEP7      RPELPSKPNRMLIVLVGLVIGVGMGAGFAFVKNYFDNSVKTPEDIQNN-DINVLAWIPQI
A0A3D6BED1      VPYSPAKPNRALIIIVGLLIGAGLAFAYVFLKNYFDNTVKTPEDLQKR-NINVLAWLPRV
A0A3N5Q7G8      KPSNPSKPNRVLIIIIGLILASGLAFGYVLIKNYFDNTVKTPEDLQSR-NIPVLGWVPQF
A0A1G0P4D7      RPLLPSKPNRLLIVIIGLVLGSGLAFGYVIAKNYFDNTVKTPEDLQKR-NISVLAWIPQF
A0A1G0QKB6      RPLLPSKPNRLLIVIIGLVLGSGLAFGYVIAKNYFDNTVKTPEDLQKR-NISVLAWIPQF
A0A1G0V7G7      RPLLPSKPNRLLIVIIGLVLGSGLAFGYVIAKNYFDNTVKTPEDLQKR-NISVLAWIPQF
A0A419EVC1      IPYKPAKPNRMLIVIVGFIFGLGMGLGYAFIKNYFDNTIKTPDDIENR-NINVLAWIPTI
A0A7C2NJJ5      VPENPSKPNRILIIAVGLVLGVGFGFGFAFIRNYFDNTVKTPEELQQK-NISLLAWIPEM
A0A2E0W055      RATKPSKPNRMLIVLVGIVLGTGMGLGFAFVRNYFDSTVKTPEDIQNK-NINLLTWIPEI
A0A2N1VVT2      QPSSPSAPNRMRIILTGFIFSLVVGFSFAFIRHYLDNTVNTPEDIQKN-RLNVLTWIPKM
A0A2H0FVC7      RPLLPSKPNRKLIVLIGLILGMGIGFAFAFIKDFLDNTVKTPEDIQKK-NINVLGWIPKI
I6ZVA1          VPTIPSKPNRLLIVFAGLVIGVGLGLGFAFLRHNFDNTIKTPEDIQNR-NINILAWIPHI
A0A2H0DC71      RPDKPSKPNRLLIVLVGTILGLGFGLGYAFLRNYFDNTVKTPEDLKDR-NINVIGWVPKI
A0A2M7MN42      RPDKPSKPNRLLIVLVGTILGLGFGLGYAFLRNYFDNTVKTPEDLKDR-NINVIGWVPQI
A0A1V5TPD0      SPFKPVLPKKLFTLIIAVFLGGFVGIVIIFIGELSKTRLISLDDLENEFNMPILALIPIF
A0A6M8V2X9      KPLKPIQPRKLLNMLIGLALGGFIGILTVFIIELRKTNLIDLDYLEDELKLPLLALIPSF
A0A6M8UVD7      SPVKPVRPKKFFNMLIALILGGFLGIVVIFLMELRKTKLINVDELEKQFNIPILALIPNY
I0AMF0          IPTDPSWPKKSFIVLISLVLGSFLGILLIFTIELKKTKYVNLDELEEEFKIPILSLIPRL
                    *  * .      .   .  ..          ..     : :.      ::  :*  

A0A2G6EB58      VSIDSENRQRGEG----FIISNKADSVASEAFKAIRTRIRYSMVEGE--AKRILITSSTP
A0A1G0X4V9      SHEESVGLKNP-E----LIVAQKPDSLSSEAFRTIRTRLQFSHISKG--AKLILITSSAP
A0A3A0BB82      DIKEKSDLSSPDE----FIVASDAKSSISEAFKVLRTRVQYAKIEEE-PLKTILITSTIP
A0A2G6EAS5      ERKVSSEGDDS-E----IFMSSKNEIAASEAYRAMRTRIQFSKLSEG--TKAILITSSAP
A0A6N6SN85      EGVDESKGGSN-E----FIVYSKPDSIPAEAFRALRTRLQFSSPDAA-KLKTLLITSSAP
A0A1G0P817      ----KRNISDP-E----LIVFNNSDFPTIESFRALRTRIQFSKNKSE--VKVLLITSSAP
A0A1G0QLK5      ----KRNISDP-E----LIVFNNSDFPTIESFRALRTRIQFSKNKSE--VKVLLITSSAP
A0A2N1VFP3      EGM-EGGNKDF-E----FIVAKKPDASASEAYRALRTRIKFSKIDKD-SLKTILVTSPTS
A0A6A4UG68      EGL-ESGIKDF-E----FVVARKPDSSASEAYRALRTRIKFSKLDKE-ALKVMLVTSPTS
A0A1G0VGZ5      EGL-ESGIKDF-E----FVVARKPDASASEAYRALRTRIKFSKLDKE-SLKVLLVTSPTS
A0A1G1B9H5      EGL-ESGIKDF-E----FVVARKPDASASEAYRALRTRIKFSKLDKE-SLKVLLVTSPTS
A0A419H3A3      EGL-ESGIKDF-E----FVVARKPDASASEAYRALRTRIKFSKLDKE-SLKVLLVTSPTS
A0A6N7BD63      EGL-ESGIKDF-E----FVVARKPDASASEAYRALRTRIKFSKLDKE-SLKVLLVTSPTS
A0A2M7ZEP7      DILEENK--DF-E----FIVAKKPDSLHAEAYRALRTRIQFSKLDQKRGIQTLLVTSSAP
A0A3D6BED1      DELLLKESSKV-D----FIILNKPDSVTSESFRALRTRIQFSRPDKE-TLKTIVVTSPAP
A0A3N5Q7G8      EIEGRNGMTGN-E----FVVSSKPDSMAGESFRTIRTRIQLTKLDKD-SLKTILITSSAP
A0A1G0P4D7      EGASKNGTQDY-E----FIVAKKPDSMASEAFRALRTRIQLLRFDKD-SLKTFLVTSSAP
A0A1G0QKB6      EGASKNGTQDY-E----FIVAKKPDSMASEAFRALRTRIQLLRFDKD-SLKTFLVTSSAP
A0A1G0V7G7      EGASKNGTQDY-E----FIVAKKPDSMASEAFRALRTRIQLLRFDKD-SLKTFLVTSSAP
A0A419EVC1      EGLGQNGNSDY-E----FIVAKKPDSIPSEAYRALRTRVQFSKLEKD-AIKSVLITSSTP
A0A7C2NJJ5      FVADKNRTPGS-E----FIVNKKSDSTASEAYRALRTRIRYSGVEGT-IPKKLLVTSSSA
A0A2E0W055      EGVGSEDHKEF-E----FIVAKRPDSIPSEAFRALRTRIQFSKIRPD-ALKTILVTSSTP
A0A2N1VVT2      EQLATKD--EF-Q----FIVHSKPDSIYSESFRALRTRITFSKIQES-PVQTILITSSAP
A0A2H0FVC7      EGITL--NKEF-E----FIIAKKSDSIYSEAFRALRTKIQFAKIDKK-SINTIHVTSSTP
I6ZVA1          EGIET--NPEL-E----FIVSKKPDASASEAYRALRTRIKFSKIDKD-SLRTILVTSPRS
A0A2H0DC71      QSLDKSISKDL-E----FIIYNKPDSVPSEAFRALRTRVQFSKVDQG-NMKVIHVTSSTP
A0A2M7MN42      QSLDKSISEDL-E----FIIYNKPDSVPSEAFRALRTRVQFSKVDQG-NMKVIHITSSTP
A0A1V5TPD0      DKSIRNKMKKSNDKKDQFVMLQTDNSGISESYRLLNTKLSH-LDLKD---KTIMVTSCEE
A0A6M8V2X9      DKSILNRMKKSNDEKDKFVTLNTDDSGINESYRLLNTKLSH-LDLKG---KTIMVTSCEE
A0A6M8UVD7      DKAILKRIKNPSDEKDLFATMQTENSGIRESYRLLNTKLFQ-IDLRD---KTLLVTSCEE
I0AMF0          PKEIVKVVDNNPEHK--VALLTVQDDGLRETYRVLKTKLFQNLNPET---KLLMVTSCEE
                                 .      .    *::. :.*.:           . . :**   

A0A2G6EB58      GEGKSTMAVNLAGSFAIANKKTVIIDCDLRKPRIHGIFNE-KRFPGFTDYFIGRATLEEI
A0A1G0X4V9      GEGKTTISTNLAASFAQANKRSVIIDCDLRKPRLYSLFGG-NDSNGFLDYLFGNVQYDKI
A0A3A0BB82      GEGKTTVAINLAGSFALDGKNVLLIDCDLRKPRVHSVMGV-NRYPGLTDLLFGNNDLSEV
A0A2G6EAS5      QEGKTTVTVNLAAGFAQTNKKVIILDCDLRIPRIHSVFKG-KSSPGFTNFLFGQVSFDEI
A0A6N6SN85      TEGKTIVAINLAGSFSQINKRVLLVDCDLRKPRVHNVFDM-NRHPGLVDYLFDHNSLDEI
A0A1G0P817      GDGKTMVSTNIASSFARDDKRTIIVDCDLRKPRLHSIMGE-SISPGLSDYLFGRTNKEGI
A0A1G0QLK5      GDGKTMVSTNIASSFARDDKRTIIVDCDLRKPRLHSIMGE-SISPGLSDYLFGRTNKEGI
A0A2N1VFP3      QEGKTTTSINLAGSFAQANFRTIIIDADLRKPRIHSVFNQ-KRFPGFTDYFFGQATFEEI
A0A6A4UG68      GEGKTTTTINLAGSFAQANFKTLILDADLRKPRVHTVFNQ-KRYPGFTDYFFGQATFEEV
A0A1G0VGZ5      GEGKTTTTVNLAGSFAQANFKTIILDADLRKPRVHTVFNQ-KRFPGFTDYFFGQATFEEV
A0A1G1B9H5      GEGKTTTTVNLAGSFAQANFKTIILDADLRKPRVHTVFNQ-KRFPGFTDYFFGQATFEEV
A0A419H3A3      GEGKTTTTVNLAGSFAQANFKTIILDADLRKPRVHTVFNQ-KRFPGFTDYFFGQATFEEV
A0A6N7BD63      GEGKTTTTVNLAGSFAQANFKTIILDADLRKPRVHTVFNQ-KRFPGFTDYFFGQATFEEV
A0A2M7ZEP7      REGKTTTAVNIAGTFAQANKRTVIVDCDLRKPRMHTVFKA-QRFPGFSDYFFGQSTYEEI
A0A3D6BED1      QEGKTFVTINLAGSFAQANKKVLLVDCDLRKPRVHRVFDI-AKEPGLIDYLVGDKTLEEI
A0A3N5Q7G8      QEGKTVVGINLGGSFAQSNRRTLIIDCDLRKPRVHEIFRD-KRVPGLIDYLFGQAQLKDI
A0A1G0P4D7      QEGKTLIAINLAGSFAQSGRRTVIIDCDLRKPRVQELFNA-KRIPGLIDYLFGHLSLNEV
A0A1G0QKB6      QEGKTLIAINLAGSFAQSGRRTVIIDCDLRKPRVQELFNA-KRIPGLIDYLFGHLSLNEV
A0A1G0V7G7      QEGKTLIAINLAGSFAQSGRRTVIIDCDLRKPRVQELFNA-KRIPGLIDYLFGHLSLNEV
A0A419EVC1      QEGKTITAVNLAGSFAQANKKTLLLDCDLRKPRLHAVFKN-NRYPGFTDYFFGQATYSEI
A0A7C2NJJ5      GEGKTITAVNLAGSFAQANQKVLLLDCDLRKPRVHKIFNH-ERFPGFIDYFFGQATFDEL
A0A2E0W055      KEGKTTVSVNLAGSFAYTNKRTVVVDCDLRKPRMHNVFKA-QRFPGFTDYFFGQAEYEEI
A0A2N1VVT2      REGKTTVAVNLSGSFAQANKKTIVVDCDLRKPRIHNVFQA-QRFPGFSDYFFGQAPFEDI
A0A2H0FVC7      SEGKTTVSVNIAGSFAQTNRKTVIVDCDLRKPRMHKVFAS-QRFPGFTDYFLGEATFESI
I6ZVA1          QEGKTTTAVNLAGSLAYANNKTIIIDADLRKPRLHNVFGH-KRYPGFTDYFFGQVGYEEI
A0A2H0DC71      GEGKSLISSNLAGSFAQANHKTLLLDCDLRKPRVHTIFGM-NRQPGLVEYLFDQVNLATI
A0A2M7MN42      GEGKTLISSNLAGSFAQANHKTLLLDCDLRKPRVHTIFGM-NRQPGLVEYLFDQVNLATI
A0A1V5TPD0      NTGKTTIVANLAITLALNNKNVLIIDCDLRKGELSRRFNVFHNSSGLIDFL--EKGSSPV
A0A6M8V2X9      NTGKTTIVANLAITMALNDKNILIIDCDLRKGELSKLFNVFNNSSGLIDFL--EKGTSPV
A0A6M8UVD7      NTGKTTIVANLAITMALNDKNILIIDCDLRKGELSKMFNVFQNSPGLVDYI--EKGNPPA
I0AMF0          DSGKTTVVANLAASLAQEGKRVLLIDCDLRKGDLSGLFGLGKETKGLLDYL--LNDSPPK
                  **:    *:.  ::  . . :::*.***   :   :       *: : :         

A0A2G6EB58      KRKT-STENLTIITAGTIPPNPSEILDSKGMAALLEKLA-SDFDIVIIDSPPVLTVTDAE
A0A1G0X4V9      IKKS-EVRNLDFVTAGSIPPNPSEILGSPAMKSFLDKLK-NDYDIIIIDSPPIMAVSDAE
A0A3A0BB82      IRPT-KFDNMHFIPSGTIPPNPSELLGSLQMKKTLENLK-TQYDIIVLDSPPSISVTDSE
A0A2G6EAS5      VRKSNEVDNLYYIAAGTIPSNPSEILGSKQLEDFLKKLK-SEFDLVILDAPPVMTITDAE
A0A6N6SN85      IRST-QMPNLDFIPCGTIPPNPAELMESDAMLAFLDTVK-SKYDFVILDSPPIIAVTDSE
A0A1G0P817      IRNS-NLAKLDYITAGTIQNNSSEVLNSIKMVTLLQKLR-EDYDVVIIDSAPILAVADTE
A0A1G0QLK5      IRNS-NLAKLDYITAGTIQNNSSEVLNSIKMVTLLQKLR-EDYDVVIIDSAPILAVADTE
A0A2N1VFP3      VRKS-EVNNLDFITAGTIPPNPSEILGSSQMESFFEKLK-NEYDYIIVDSPPVIAVTDSE
A0A6A4UG68      VRKT-EVTNLDYITAGTIPPNPSEILSSTQMEAFIEKLK-TMYDYILIDSPPVIAVTDSE
A0A1G0VGZ5      VRKT-ELNNLDYITAGTIPPNPSEILSSTQMEAFIEKLK-TMYDYILIDSPPVIAVTDSE
A0A1G1B9H5      VRKT-ELNNLDYITAGTIPPNPSEILSSTQMEAFIEKLK-TMYDYILIDSPPVIAVTDSE
A0A419H3A3      VRKT-ELNNLDYITAGTIPPNPSEILSSTQMEAFIEKLK-TMYDYILIDSPPVIAVTDSE
A0A6N7BD63      VRKT-ELNNLDYITAGTIPPNPSEILSSTQMEAFIEKLK-TMYDYILIDSPPVIAVTDSE
A0A2M7ZEP7      IHKS-ELPNLFYITAGTIPPNPSELLSSDQMVAFLEKLK-SEFDMIVIDSPPIVAVTDSE
A0A3D6BED1      THTG-EMPNLSFISSGTIPPNPAEMLDSRQMDEFLALVR-GMYDYIIIDSPPIIAVTDAE
A0A3N5Q7G8      IHKA-DINNLEYITCGTIPPNPAEMLESEKMREFLADMR-EKYDIVILDSPPIIAVTDSE
A0A1G0P4D7      THKA-EIDNLDYITCGTIPPNPAEMLESEPMKRFLTEMR-EKYDIVILDSPPIIAVTDSE
A0A1G0QKB6      THKA-EIDNLDYITCGTIPPNPAEMLESEPMKRFLTEMR-EKYDIVILDSPPIIAVTDSE
A0A1G0V7G7      THKA-EIDNLDYITCGTIPPNPAEMLESEPMKRFLTEMR-EKYDIVILDSPPIIAVTDSE
A0A419EVC1      IRPS-GTNNLYIITAGTIPPNPSELLGSHQMLEFMEKLR-REFDIIIIDSAPVIAVTDSE
A0A7C2NJJ5      IRKT-EQASLYYITGGTIPPNPAEILGSHKMEEFLKKLE-SHFDLIVIDSPPIIAVTDSE
A0A2E0W055      VRTS-EIENLDFITAGTIPPNPSEILGSPQMEKFLEKLK-SLYDVVILDSPPVIAVTDSE
A0A2N1VVT2      IHAS-DVPNLFYITSGTIPPNPSEILASSQMEAFLEKLR-GEYDIIILDSPPIIAVTDSE
A0A2H0FVC7      VHKS-ELPNLDFITAGTIPPNPSEILGSQQMLAFIDKLK-VIYDLVVIDSPPIIAVTDSE
I6ZVA1          IRTT-DVNNLSYISAGTIPPNPSEILGSDQMINFIKKLK-GEYDYVVIDSPPLIAVTDSE
A0A2H0DC71      IKPT-KLANLDVITVGTIPPNPAEMLGSKKMQDFITHMK-TLYDYIIIDSPPIISVTDSE
A0A2M7MN42      IKPT-KLANLDVITVGTIPPNPAEMLGSKKMQDFITHMK-TLYDYIIIDSPPIISVTDSE
A0A1V5TPD0      IYTK-LLKKINILPSGGINENSSILLSSDRMKSLFEKIDTSAYNYVIIDTPPVTRVVDTL
A0A6M8V2X9      IYTK-ILKKINIIPSGGLRENSSILLSSDRMKSIFEKINTSAYDYVIIDTPPVTRVVDTL
A0A6M8UVD7      IYNR-VLKKINIIPAGGLRENSSILLNSDRMKSLFQVIDTSVYDFIIVDTPPVTRVVDTL
I0AMF0          IYTR-ASKNIDIIPSGGLSSDSGTLLDSARMRLLFRSLDTTQYDLIIVDTPPVTRVVDPL
                        .:  :. * :  :.. :: *  :   :  :    :: :::*:.*   : *. 

A0A2G6EB58      ILSRIVDETILVVSANTTDVDMMTKAVSLLKSGDKNSFVGAILNRFEVQNSYGSYYRYAY
A0A1G0X4V9      ILARFVDICLLVVSANSSEVDWLKESVSLLRH-DNVNLAGVLLNNFNYKSGYHSYYKYYD
A0A3A0BB82      ILFKITDGTLLVVQSLKTPMDAFSKVYDRFNSFSEPNLLGTVLNNFSYKRNYGYYYNYYY
A0A2G6EAS5      ILSHIVDITLLVVFANKTEVDWVTESAQILNRGEESSFVGAILNNFDYNTGYRSYHKYNS
A0A6N6SN85      VLAKQVDGSLLVVSADTTELELLKRAGEIMNQ-GTHHFVGVVLNNFVYKASYGSYYKYYY
A0A1G0P817      LLSNFVDASILVVSANNTEMEWAKQSISLLSH-GQSAFLGIVLNNYDYKFGYPSNYKYYN
A0A1G0QLK5      LLSNFVDASILVVSANNTEMEWAKQSISLLSH-GQSAFLGIVLNNYDYKFGYPSNYKYYN
A0A2N1VFP3      ILSSMVDGTVLVVSANNTEMELMEKAVQLINH-ERSSFLGVILNNFTYRSGYGSYYKYYY
A0A6A4UG68      ILSSIVDATVLVVSASNTEMELMEKAVELLNH-EQGSFIGIVLNNFTYRSGYGSYYKYYY
A0A1G0VGZ5      ILSSIVDATVLVVSANNTEMELMEKAVELLNH-EQGSFIGIILNNFTYRSGYGSYYKYYY
A0A1G1B9H5      ILSSIVDATVLVVSANNTEMELMEKAVELLNH-EQGSFIGIILNNFTYRSGYGSYYKYYY
A0A419H3A3      ILSSIVDATVLVVSANNTEMELMEKAVELLNH-EQGSFIGIILNNFTYRSGYGSYYKYYY
A0A6N7BD63      ILSSIVDATVLVVSANNTEMELMEKAVELLNH-EQGSFIGIILNNFTYRSGYGSYYKYYY
A0A2M7ZEP7      IISRLVDAAILVVSANNTEIELMRKAAELLTH-ESKSFIGAILNNFSYKSGYGSYYKYYY
A0A3D6BED1      ILSKKVDGAVLVVSSEITEYQMMERAYQLIKH-DNTTLIGTVLNNFDTRSAYGTYYKYKY
A0A3N5Q7G8      ILSTMVDGTILIISADTTEVELMERSVELMKN-DKSSFIGAILNNFSYKSGYGSYYKYYY
A0A1G0P4D7      ILATMVDGTVLVVSADTTEFDLMEKAVEIMKK-DKLTFLGTVLNNFSYKSGYGSYYKYYY
A0A1G0QKB6      ILATMVDGTVLVVSADTTEFDLMEKAVEIMKK-DKLTFLGTVLNNFSYKSGYGSYYKYYY
A0A1G0V7G7      ILATMVDGTVLVVSADTTEFDLMEKAVEIMKK-DKLTFLGTVLNNFSYKSGYGSYYKYYY
A0A419EVC1      IISRIVDATILVVSSNITEVDVMEKSVNLLKH-EQKTFIGVLLNNFTFRSSYGSYYKYYY
A0A7C2NJJ5      ILAQIVDGVMLVVSAGVTEYDILFKSLDVLKM-AKSQFLGTVLNKFAYRPGYGSYYKYYY
A0A2E0W055      ILSRMVDATVLVASANITENDLLEKSVELLTH-DHGSFIGVVLNRFMYRSGYGSYYKYYY
A0A2N1VVT2      ILSRLVDATILVVSAHTTEVELMRKSAELLDH-EQNTFIGVLLNNFSYKSGYGSYYKYYY
A0A2H0FVC7      ILSRIADASILVASAGETDIELMTKAVDLMRH-ENKSFIGVVLNKFSYRSGYGSYYKYYY
I6ZVA1          ILAQLVDATILVVSANFTETDLLEKSVEILRR-DNSTFIGTVLNNFNYRSGYSSYYKYYY
A0A2H0DC71      IIAAYCDAVYLVVSANYTEFDLLEKALDILKN-SNVNFVGTILNNFVFKNSYGSYYKYYY
A0A2M7MN42      IIAAYCDAVYLVVSANYTEFDLLEKALDILKN-SNVNFVGTILNNFVFKNSYGSYYKYYY
A0A1V5TPD0      ILGQYVTNAILVVRPDISMKDSVIGGIQDMNQ-AQIKILGIVANATEIQSSYRYRYSYGY
A0A6M8V2X9      VLGQYITNALLIVRPETSMKDSVIGGIQDMKQ-AKIKILGIVANATDIQNSYRYRYSYGY
A0A6M8UVD7      ALGYLTRNSILVVRPEMSIRETVIGGIQELNS-AHIKIRGLVANAAEIEKSYYYRYRYGY
I0AMF0          VLSHSLHNAIVVVRPEHSLLETVRWGISELLN-AKINVKGLVINAADIENSYYYKHRYGY
                 :        ::  .  :  :      . :       . * : *       *   : *  

A0A2G6EB58      --TYARGGVEGKREKVRIKKKKQNKSK-------------
A0A1G0X4V9      --HYTEKYKNT--KKKGKLNKPA-----------------
A0A3A0BB82      --YYSSGEKPN-----------------------------
A0A2G6EAS5      NKYYRRADES---RSKEWVKS-------------------
A0A6N6SN85      --YYSRSSKSGESV--------------------------
A0A1G0P817      --YYYSSDSTDKKKPSKKIKTNI-----------------
A0A1G0QLK5      --YYYSSDSTDKKKPSKKIKTNI-----------------
A0A2N1VFP3      --YYSRPTNG---AKKGRVKV-------------------
A0A6A4UG68      --YYSRPKDGS--SKKSKIKV-------------------
A0A1G0VGZ5      --YYSRPKDGS--SKKNKLKV-------------------
A0A1G1B9H5      --YYSRPKDGS--SKKNKLKV-------------------
A0A419H3A3      --YYSRPKDGS--SKKNKLKV-------------------
A0A6N7BD63      --YYSRPKDGS--SKKNKLKV-------------------
A0A2M7ZEP7      --YYSHQSKGNGVAKVKKIDKV------------------
A0A3D6BED1      --YYYYASKK------------------------------
A0A3N5Q7G8      --YYSENPPGGK-NKSKV----------------------
A0A1G0P4D7      --YYSENSEGKK-SRSSKRKA-------------------
A0A1G0QKB6      --YYSENSEGKK-SRSSKRKA-------------------
A0A1G0V7G7      --YYSENSEGKK-SRSSKRKA-------------------
A0A419EVC1      --YYSRPNENGR-KKSKKLDSV------------------
A0A7C2NJJ5      --YYYNTGNGKE-DKKKLLKV-------------------
A0A2E0W055      --YYSRPDQKNK-KPKAELKS-------------------
A0A2N1VVT2      --YYSQGGNGAA-K-KNRIKA-------------------
A0A2H0FVC7      --YYSHNRDN---SKVKHKTTV------------------
I6ZVA1          --YYSSPTNG---SKKNRVKAN------------------
A0A2H0DC71      --YYYNREKE---GTRSKKTT-------------------
A0A2M7MN42      --YYYNREKE---GTRSKKTT-------------------
A0A1V5TPD0      GYGYGNSPK----DKNGKHGVK---KLSSIVRKHSKVNSS
A0A6M8V2X9      GYGYGHGNNHNQGNKNSRNRVK---KDSSIIQKDSKVNSV
A0A6M8UVD7      GYGYSN-------SEKKRFKINFIKKNQSKVHKLSNVSHS
I0AMF0          GYGYGSKNGNGKAKDAKKIKPEFQLKFKDQITHKN-----
                   *                                    

© 1998-2021Legal notice