BYKdb

Dataset for cluster tadcd of phylum gemmatimonadetes

[Download (right click)] [Edit] [Sequences] [Repertoires]

116 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A838NTH4      MSPPVRHDPAKCEVCADYQQEYFLFARGALPELARAYLEADEEATEARERARKQLQFLRE
A0A2D5ZJF2      ------------------------------------------------------------
A0A0S8H9P3      ------------------------------------------------------------
A0A1E4BBP7      ------------------------------------------------------------
A0A3M2G737      ------------------------------------------------------------
A0A0H4TUX7      ------------------------------------------------------------
A0A1G0LUG0      ------------------------------------------------------------
A0A1Q7E3T7      ------------------------------------------------------------
A0A1G0L906      ------------------------------------------------------------
A0A1G0LCC0      ------------------------------------------------------------
A0A2D5ZJE2      ------------------------------------------------------------
A0A3M2G624      ------------------------------------------------------------
A0A6M4IRY1      ------------------------------------------------------------
A0A3D4VBZ5      ------------------------------------------------------------
C1A5W1          ------------------------------------------------------------
W0RI74          ------------------------------------------------------------
A0A3M2BJA6      ------------------------------------------------------------
A0A7Y5QXY3      ------------------------------------------------------------
A0A2V7PX99      ------------------------------------------------------------
A0A2V7ERC7      ------------------------------------------------------------
A0A7V9QLH4      ------------------------------------------------------------
A0A7Y4RSP8      ------------------------------------------------------------
A0A838W6Q3      ------------------------------------------------------------
A0A7V9U4Z2      ------------------------------------------------------------
A0A5Q4D6Y4      ------------------------------------------------------------
A0A7Y3MUW4      ------------------------------------------------------------
A0A848XQ54      ------------------------------------------------------------
A0A7V9QB34      ------------------------------------------------------------
A0A2V7JTZ5      ------------------------------------------------------------
A0A3D4YTR6      ------------------------------------------------------------
A0A7V8VRF0      ------------------------------------------------------------
A0A2V7F1M1      ------------------------------------------------------------
A0A841GJ36      ------------------------------------------------------------
A0A838NJX4      ------------------------------------------------------------
A0A2V7KXK7      ------------------------------------------------------------
A0A651HKD3      ------------------------------------------------------------
A0A843T4K9      ------------------------------------------------------------
A0A2V7QDU7      ------------------------------------------------------------
A0A6J4M9S2      ------------------------------------------------------------
A0A2V7ITT6      ------------------------------------------------------------
A0A2V7NJW1      ------------------------------------------------------------
A0A7V4KNE3      ------------------------------------------------------------
A0A7Y5PAU0      ------------------------------------------------------------
A0A7V9TKH4      ------------------------------------------------------------
A0A2V7GFB5      ------------------------------------------------------------
A0A2V7RQ86      ------------------------------------------------------------
A0A2V7IWX2      ------------------------------------------------------------
A0A1Q7KE95      ------------------------------------------------------------
A0A1Q7T8X5      ------------------------------------------------------------
A0A2V7MS64      ------------------------------------------------------------
A0A2V7Q7N9      ------------------------------------------------------------
A0A2V7IRW6      ------------------------------------------------------------
A0A1Q7DVU6      ------------------------------------------------------------
A0A1Q7JSV2      ------------------------------------------------------------
A0A2V7FK98      ------------------------------------------------------------
A0A2V7R3Z8      ------------------------------------------------------------
A0A2V7J3C0      ------------------------------------------------------------
A0A2V7KWV9      ------------------------------------------------------------
A0A1Q6ZHP2      ------------------------------------------------------------
A0A1Q7R6Z6      ------------------------------------------------------------
A0A2V7FYT7      ------------------------------------------------------------
A0A2V7IGR0      ------------------------------------------------------------
A0A2V7MR23      ------------------------------------------------------------
A0A2V7L1V3      ------------------------------------------------------------
A0A1Q7E5D3      ------------------------------------------------------------
A0A2V7ISE2      ------------------------------------------------------------
A0A1Q7J2X5      ------------------------------------------------------------
A0A2V7NPD1      ------------------------------------------------------------
A0A2V7QPD8      ------------------------------------------------------------
A0A2V7Q8M6      ------------------------------------------------------------
A0A2V7QBC3      ------------------------------------------------------------
A0A2V7LMU1      ------------------------------------------------------------
A0A2V7PBY9      ------------------------------------------------------------
A0A2V7J4D7      ------------------------------------------------------------
A0A2V7LN90      ------------------------------------------------------------
A0A2V7LFN9      ------------------------------------------------------------
A0A2V7MEK4      ------------------------------------------------------------
A0A2V7EU00      ------------------------------------------------------------
A0A1Q6WE01      ------------------------------------------------------------
A0A2V7S9K3      ------------------------------------------------------------
A0A1Q7DXB9      ------------------------------------------------------------
A0A1Q7JD32      ------------------------------------------------------------
A0A2V7MVP8      ------------------------------------------------------------
A0A2V7N0A9      ------------------------------------------------------------
A0A1Q7DLS9      ------------------------------------------------------------
A0A1Q7JK96      ------------------------------------------------------------
A0A2V7KQV7      ------------------------------------------------------------
A0A1Q7JGF6      ------------------------------------------------------------
A0A2V7SG67      ------------------------------------------------------------
A0A1Q7GIK9      ------------------------------------------------------------
A0A7W0YSQ1      ------------------------------------------------------------
A0A3M2BLV5      ------------------------------------------------------------
A0A2V7KS68      ------------------------------------------------------------
A0A2V7N4L3      ------------------------------------------------------------
A0A1Q7AZK2      ------------------------------------------------------------
A0A1Q7TNP7      ------------------------------------------------------------
A0A1Q7KG39      ------------------------------------------------------------
A0A1Q7GX75      ------------------------------------------------------------
A0A1Q7LL80      ------------------------------------------------------------
A0A2V7PFU2      ------------------------------------------------------------
A0A2V7MFS9      ------------------------------------------------------------
A0A2V7T933      ------------------------------------------------------------
A0A841GX23      ------------------------------------------------------------
A0A7V9AJ94      ------------------------------------------------------------
A0A7Y3MYM3      ------------------------------------------------------------
A0A848XLS5      ------------------------------------------------------------
A0A7V9FIM2      ------------------------------------------------------------
A0A7W0WMB8      ------------------------------------------------------------
A0A2V7P8B1      ------------------------------------------------------------
A0A7C2QQS2      ------------------------------------------------------------
A0A2V7QN41      ------------------------------------------------------------
A0A2V7R603      ------------------------------------------------------------
A0A7Y5VC49      ------------------------------------------------------------
A0A2V7LJS2      ------------------------------------------------------------
A0A1Q7GLJ7      ------------------------------------------------------------
A0A2V7GRE3      ------------------------------------------------------------
                                                                            

A0A838NTH4      IHAESDVLQRELDARALKIEKLQRSIDVREAQPEREALQRELDARTSMFETLQHELKART
A0A2D5ZJF2      ------------------------------------------------------------
A0A0S8H9P3      ------------------------------------------------------------
A0A1E4BBP7      ------------------------------------------------------------
A0A3M2G737      ------------------------------------------------------------
A0A0H4TUX7      ------------------------------------------------------------
A0A1G0LUG0      ------------------------------------------------------------
A0A1Q7E3T7      ------------------------------------------------------------
A0A1G0L906      ------------------------------------------------------------
A0A1G0LCC0      ------------------------------------------------------------
A0A2D5ZJE2      ------------------------------------------------------------
A0A3M2G624      ------------------------------------------------------------
A0A6M4IRY1      ------------------------------------------------------------
A0A3D4VBZ5      ------------------------------------------------------------
C1A5W1          ------------------------------------------------------------
W0RI74          ------------------------------------------------------------
A0A3M2BJA6      ------------------------------------------------------------
A0A7Y5QXY3      ------------------------------------------------------------
A0A2V7PX99      ------------------------------------------------------------
A0A2V7ERC7      ------------------------------------------------------------
A0A7V9QLH4      ------------------------------------------------------------
A0A7Y4RSP8      ------------------------------------------------------------
A0A838W6Q3      ------------------------------------------------------------
A0A7V9U4Z2      ------------------------------------------------------------
A0A5Q4D6Y4      ------------------------------------------------------------
A0A7Y3MUW4      ------------------------------------------------------------
A0A848XQ54      ------------------------------------------------------------
A0A7V9QB34      ------------------------------------------------------------
A0A2V7JTZ5      ------------------------------------------------------------
A0A3D4YTR6      ------------------------------------------------------------
A0A7V8VRF0      ------------------------------------------------------------
A0A2V7F1M1      ------------------------------------------------------------
A0A841GJ36      ------------------------------------------------------------
A0A838NJX4      ------------------------------------------------------------
A0A2V7KXK7      ------------------------------------------------------------
A0A651HKD3      ------------------------------------------------------------
A0A843T4K9      ------------------------------------------------------------
A0A2V7QDU7      ------------------------------------------------------------
A0A6J4M9S2      ------------------------------------------------------------
A0A2V7ITT6      ------------------------------------------------------------
A0A2V7NJW1      ------------------------------------------------------------
A0A7V4KNE3      ------------------------------------------------------------
A0A7Y5PAU0      ------------------------------------------------------------
A0A7V9TKH4      ------------------------------------------------------------
A0A2V7GFB5      ------------------------------------------------------------
A0A2V7RQ86      ------------------------------------------------------------
A0A2V7IWX2      ------------------------------------------------------------
A0A1Q7KE95      ------------------------------------------------------------
A0A1Q7T8X5      ------------------------------------------------------------
A0A2V7MS64      ------------------------------------------------------------
A0A2V7Q7N9      ------------------------------------------------------------
A0A2V7IRW6      ------------------------------------------------------------
A0A1Q7DVU6      ------------------------------------------------------------
A0A1Q7JSV2      ------------------------------------------------------------
A0A2V7FK98      ------------------------------------------------------------
A0A2V7R3Z8      ------------------------------------------------------------
A0A2V7J3C0      ------------------------------------------------------------
A0A2V7KWV9      ------------------------------------------------------------
A0A1Q6ZHP2      ------------------------------------------------------------
A0A1Q7R6Z6      ------------------------------------------------------------
A0A2V7FYT7      ------------------------------------------------------------
A0A2V7IGR0      ------------------------------------------------------------
A0A2V7MR23      ------------------------------------------------------------
A0A2V7L1V3      ------------------------------------------------------------
A0A1Q7E5D3      ------------------------------------------------------------
A0A2V7ISE2      ------------------------------------------------------------
A0A1Q7J2X5      ------------------------------------------------------------
A0A2V7NPD1      ------------------------------------------------------------
A0A2V7QPD8      ------------------------------------------------------------
A0A2V7Q8M6      ------------------------------------------------------------
A0A2V7QBC3      ------------------------------------------------------------
A0A2V7LMU1      ------------------------------------------------------------
A0A2V7PBY9      ------------------------------------------------------------
A0A2V7J4D7      ------------------------------------------------------------
A0A2V7LN90      ------------------------------------------------------------
A0A2V7LFN9      ------------------------------------------------------------
A0A2V7MEK4      ------------------------------------------------------------
A0A2V7EU00      ------------------------------------------------------------
A0A1Q6WE01      ------------------------------------------------------------
A0A2V7S9K3      ------------------------------------------------------------
A0A1Q7DXB9      ------------------------------------------------------------
A0A1Q7JD32      ------------------------------------------------------------
A0A2V7MVP8      ------------------------------------------------------------
A0A2V7N0A9      ------------------------------------------------------------
A0A1Q7DLS9      ------------------------------------------------------------
A0A1Q7JK96      ------------------------------------------------------------
A0A2V7KQV7      ------------------------------------------------------------
A0A1Q7JGF6      ------------------------------------------------------------
A0A2V7SG67      ------------------------------------------------------------
A0A1Q7GIK9      ------------------------------------------------------------
A0A7W0YSQ1      ------------------------------------------------------------
A0A3M2BLV5      ------------------------------------------------------------
A0A2V7KS68      ------------------------------------------------------------
A0A2V7N4L3      ------------------------------------------------------------
A0A1Q7AZK2      ------------------------------------------------------------
A0A1Q7TNP7      ------------------------------------------------------------
A0A1Q7KG39      ------------------------------------------------------------
A0A1Q7GX75      ------------------------------------------------------------
A0A1Q7LL80      ------------------------------------------------------------
A0A2V7PFU2      ------------------------------------------------------------
A0A2V7MFS9      ------------------------------------------------------------
A0A2V7T933      ------------------------------------------------------------
A0A841GX23      ------------------------------------------------------------
A0A7V9AJ94      ------------------------------------------------------------
A0A7Y3MYM3      ------------------------------------------------------------
A0A848XLS5      ------------------------------------------------------------
A0A7V9FIM2      ------------------------------------------------------------
A0A7W0WMB8      ------------------------------------------------------------
A0A2V7P8B1      ------------------------------------------------------------
A0A7C2QQS2      ------------------------------------------------------------
A0A2V7QN41      ------------------------------------------------------------
A0A2V7R603      ------------------------------------------------------------
A0A7Y5VC49      ------------------------------------------------------------
A0A2V7LJS2      ------------------------------------------------------------
A0A1Q7GLJ7      ------------------------------------------------------------
A0A2V7GRE3      ------------------------------------------------------------
                                                                            

A0A838NTH4      ARLEMLQRELEAGALRLEELHHRVAARETESETLKRDLDASVWRAAELEKELRQDSLARD
A0A2D5ZJF2      ------------------------------------------------------------
A0A0S8H9P3      ------------------------------------------------------------
A0A1E4BBP7      ------------------------------------------------------------
A0A3M2G737      ------------------------------------------------------------
A0A0H4TUX7      ------------------------------------------------------------
A0A1G0LUG0      ------------------------------------------------------------
A0A1Q7E3T7      ------------------------------------------------------------
A0A1G0L906      ------------------------------------------------------------
A0A1G0LCC0      ------------------------------------------------------------
A0A2D5ZJE2      ------------------------------------------------------------
A0A3M2G624      ------------------------------------------------------------
A0A6M4IRY1      ------------------------------------------------------------
A0A3D4VBZ5      ------------------------------------------------------------
C1A5W1          ------------------------------------------------------------
W0RI74          ------------------------------------------------------------
A0A3M2BJA6      ------------------------------------------------------------
A0A7Y5QXY3      ------------------------------------------------------------
A0A2V7PX99      ------------------------------------------------------------
A0A2V7ERC7      ------------------------------------------------------------
A0A7V9QLH4      ------------------------------------------------------------
A0A7Y4RSP8      ------------------------------------------------------------
A0A838W6Q3      ------------------------------------------------------------
A0A7V9U4Z2      ------------------------------------------------------------
A0A5Q4D6Y4      ------------------------------------------------------------
A0A7Y3MUW4      ------------------------------------------------------------
A0A848XQ54      ------------------------------------------------------------
A0A7V9QB34      ------------------------------------------------------------
A0A2V7JTZ5      ------------------------------------------------------------
A0A3D4YTR6      ------------------------------------------------------------
A0A7V8VRF0      ------------------------------------------------------------
A0A2V7F1M1      ------------------------------------------------------------
A0A841GJ36      ------------------------------------------------------------
A0A838NJX4      ------------------------------------------------------------
A0A2V7KXK7      ------------------------------------------------------------
A0A651HKD3      ------------------------------------------------------------
A0A843T4K9      ------------------------------------------------------------
A0A2V7QDU7      ------------------------------------------------------------
A0A6J4M9S2      ------------------------------------------------------------
A0A2V7ITT6      ------------------------------------------------------------
A0A2V7NJW1      ------------------------------------------------------------
A0A7V4KNE3      ------------------------------------------------------------
A0A7Y5PAU0      ------------------------------------------------------------
A0A7V9TKH4      ------------------------------------------------------------
A0A2V7GFB5      ------------------------------------------------------------
A0A2V7RQ86      ------------------------------------------------------------
A0A2V7IWX2      ------------------------------------------------------------
A0A1Q7KE95      ------------------------------------------------------------
A0A1Q7T8X5      ------------------------------------------------------------
A0A2V7MS64      ------------------------------------------------------------
A0A2V7Q7N9      ------------------------------------------------------------
A0A2V7IRW6      ------------------------------------------------------------
A0A1Q7DVU6      ------------------------------------------------------------
A0A1Q7JSV2      ------------------------------------------------------------
A0A2V7FK98      ------------------------------------------------------------
A0A2V7R3Z8      ------------------------------------------------------------
A0A2V7J3C0      ------------------------------------------------------------
A0A2V7KWV9      ------------------------------------------------------------
A0A1Q6ZHP2      ------------------------------------------------------------
A0A1Q7R6Z6      ------------------------------------------------------------
A0A2V7FYT7      ------------------------------------------------------------
A0A2V7IGR0      ------------------------------------------------------------
A0A2V7MR23      ------------------------------------------------------------
A0A2V7L1V3      ------------------------------------------------------------
A0A1Q7E5D3      ------------------------------------------------------------
A0A2V7ISE2      ------------------------------------------------------------
A0A1Q7J2X5      ------------------------------------------------------------
A0A2V7NPD1      ------------------------------------------------------------
A0A2V7QPD8      ------------------------------------------------------------
A0A2V7Q8M6      ------------------------------------------------------------
A0A2V7QBC3      ------------------------------------------------------------
A0A2V7LMU1      ------------------------------------------------------------
A0A2V7PBY9      ------------------------------------------------------------
A0A2V7J4D7      ------------------------------------------------------------
A0A2V7LN90      ------------------------------------------------------------
A0A2V7LFN9      ------------------------------------------------------------
A0A2V7MEK4      ------------------------------------------------------------
A0A2V7EU00      ------------------------------------------------------------
A0A1Q6WE01      ------------------------------------------------------------
A0A2V7S9K3      ------------------------------------------------------------
A0A1Q7DXB9      ------------------------------------------------------------
A0A1Q7JD32      ------------------------------------------------------------
A0A2V7MVP8      ------------------------------------------------------------
A0A2V7N0A9      ------------------------------------------------------------
A0A1Q7DLS9      ------------------------------------------------------------
A0A1Q7JK96      ------------------------------------------------------------
A0A2V7KQV7      ------------------------------------------------------------
A0A1Q7JGF6      ------------------------------------------------------------
A0A2V7SG67      ------------------------------------------------------------
A0A1Q7GIK9      ------------------------------------------------------------
A0A7W0YSQ1      ------------------------------------------------------------
A0A3M2BLV5      ------------------------------------------------------------
A0A2V7KS68      ------------------------------------------------------------
A0A2V7N4L3      ------------------------------------------------------------
A0A1Q7AZK2      ------------------------------------------------------------
A0A1Q7TNP7      ------------------------------------------------------------
A0A1Q7KG39      ------------------------------------------------------------
A0A1Q7GX75      ------------------------------------------------------------
A0A1Q7LL80      ------------------------------------------------------------
A0A2V7PFU2      ------------------------------------------------------------
A0A2V7MFS9      ------------------------------------------------------------
A0A2V7T933      ------------------------------------------------------------
A0A841GX23      ------------------------------------------------------------
A0A7V9AJ94      ------------------------------------------------------------
A0A7Y3MYM3      ------------------------------------------------------------
A0A848XLS5      ------------------------------------------------------------
A0A7V9FIM2      ------------------------------------------------------------
A0A7W0WMB8      ------------------------------------------------------------
A0A2V7P8B1      ------------------------------------------------------------
A0A7C2QQS2      ------------------------------------------------------------
A0A2V7QN41      ------------------------------------------------------------
A0A2V7R603      ------------------------------------------------------------
A0A7Y5VC49      ------------------------------------------------------------
A0A2V7LJS2      ------------------------------------------------------------
A0A1Q7GLJ7      ------------------------------------------------------------
A0A2V7GRE3      ------------------------------------------------------------
                                                                            

A0A838NTH4      GEADELRRELNARMERIDELQMELLHISSAHDVERDALQRELESRASIPEALQGELETRA
A0A2D5ZJF2      ------------------------------------------------------------
A0A0S8H9P3      ------------------------------------------------------------
A0A1E4BBP7      ------------------------------------------------------------
A0A3M2G737      ------------------------------------------------------------
A0A0H4TUX7      ------------------------------------------------------------
A0A1G0LUG0      ------------------------------------------------------------
A0A1Q7E3T7      ------------------------------------------------------------
A0A1G0L906      ------------------------------------------------------------
A0A1G0LCC0      ------------------------------------------------------------
A0A2D5ZJE2      ------------------------------------------------------------
A0A3M2G624      ------------------------------------------------------------
A0A6M4IRY1      ------------------------------------------------------------
A0A3D4VBZ5      ------------------------------------------------------------
C1A5W1          ------------------------------------------------------------
W0RI74          ------------------------------------------------------------
A0A3M2BJA6      ------------------------------------------------------------
A0A7Y5QXY3      ------------------------------------------------------------
A0A2V7PX99      ------------------------------------------------------------
A0A2V7ERC7      ------------------------------------------------------------
A0A7V9QLH4      ------------------------------------------------------------
A0A7Y4RSP8      ------------------------------------------------------------
A0A838W6Q3      ------------------------------------------------------------
A0A7V9U4Z2      ------------------------------------------------------------
A0A5Q4D6Y4      ------------------------------------------------------------
A0A7Y3MUW4      ------------------------------------------------------------
A0A848XQ54      ------------------------------------------------------------
A0A7V9QB34      ------------------------------------------------------------
A0A2V7JTZ5      ------------------------------------------------------------
A0A3D4YTR6      ------------------------------------------------------------
A0A7V8VRF0      ------------------------------------------------------------
A0A2V7F1M1      ------------------------------------------------------------
A0A841GJ36      ------------------------------------------------------------
A0A838NJX4      ------------------------------------------------------------
A0A2V7KXK7      ------------------------------------------------------------
A0A651HKD3      ------------------------------------------------------------
A0A843T4K9      ------------------------------------------------------------
A0A2V7QDU7      ------------------------------------------------------------
A0A6J4M9S2      ------------------------------------------------------------
A0A2V7ITT6      ------------------------------------------------------------
A0A2V7NJW1      ------------------------------------------------------------
A0A7V4KNE3      ------------------------------------------------------------
A0A7Y5PAU0      ------------------------------------------------------------
A0A7V9TKH4      ------------------------------------------------------------
A0A2V7GFB5      ------------------------------------------------------------
A0A2V7RQ86      ------------------------------------------------------------
A0A2V7IWX2      ------------------------------------------------------------
A0A1Q7KE95      ------------------------------------------------------------
A0A1Q7T8X5      ------------------------------------------------------------
A0A2V7MS64      ------------------------------------------------------------
A0A2V7Q7N9      ------------------------------------------------------------
A0A2V7IRW6      ------------------------------------------------------------
A0A1Q7DVU6      ------------------------------------------------------------
A0A1Q7JSV2      ------------------------------------------------------------
A0A2V7FK98      ------------------------------------------------------------
A0A2V7R3Z8      ------------------------------------------------------------
A0A2V7J3C0      ------------------------------------------------------------
A0A2V7KWV9      ------------------------------------------------------------
A0A1Q6ZHP2      ------------------------------------------------------------
A0A1Q7R6Z6      ------------------------------------------------------------
A0A2V7FYT7      ------------------------------------------------------------
A0A2V7IGR0      ------------------------------------------------------------
A0A2V7MR23      ------------------------------------------------------------
A0A2V7L1V3      ------------------------------------------------------------
A0A1Q7E5D3      ------------------------------------------------------------
A0A2V7ISE2      ------------------------------------------------------------
A0A1Q7J2X5      ------------------------------------------------------------
A0A2V7NPD1      ------------------------------------------------------------
A0A2V7QPD8      ------------------------------------------------------------
A0A2V7Q8M6      ------------------------------------------------------------
A0A2V7QBC3      ------------------------------------------------------------
A0A2V7LMU1      ------------------------------------------------------------
A0A2V7PBY9      ------------------------------------------------------------
A0A2V7J4D7      ------------------------------------------------------------
A0A2V7LN90      ------------------------------------------------------------
A0A2V7LFN9      ------------------------------------------------------------
A0A2V7MEK4      ------------------------------------------------------------
A0A2V7EU00      ------------------------------------------------------------
A0A1Q6WE01      ------------------------------------------------------------
A0A2V7S9K3      ------------------------------------------------------------
A0A1Q7DXB9      ------------------------------------------------------------
A0A1Q7JD32      ------------------------------------------------------------
A0A2V7MVP8      ------------------------------------------------------------
A0A2V7N0A9      ------------------------------------------------------------
A0A1Q7DLS9      ------------------------------------------------------------
A0A1Q7JK96      ------------------------------------------------------------
A0A2V7KQV7      ------------------------------------------------------------
A0A1Q7JGF6      ------------------------------------------------------------
A0A2V7SG67      ------------------------------------------------------------
A0A1Q7GIK9      ------------------------------------------------------------
A0A7W0YSQ1      ------------------------------------------------------------
A0A3M2BLV5      ------------------------------------------------------------
A0A2V7KS68      ------------------------------------------------------------
A0A2V7N4L3      ------------------------------------------------------------
A0A1Q7AZK2      ------------------------------------------------------------
A0A1Q7TNP7      ------------------------------------------------------------
A0A1Q7KG39      ------------------------------------------------------------
A0A1Q7GX75      ------------------------------------------------------------
A0A1Q7LL80      ------------------------------------------------------------
A0A2V7PFU2      ------------------------------------------------------------
A0A2V7MFS9      ------------------------------------------------------------
A0A2V7T933      ------------------------------------------------------------
A0A841GX23      ------------------------------------------------------------
A0A7V9AJ94      ------------------------------------------------------------
A0A7Y3MYM3      ------------------------------------------------------------
A0A848XLS5      ------------------------------------------------------------
A0A7V9FIM2      ------------------------------------------------------------
A0A7W0WMB8      ------------------------------------------------------------
A0A2V7P8B1      ------------------------------------------------------------
A0A7C2QQS2      ------------------------------------------------------------
A0A2V7QN41      ------------------------------------------------------------
A0A2V7R603      ------------------------------------------------------------
A0A7Y5VC49      ------------------------------------------------------------
A0A2V7LJS2      ------------------------------------------------------------
A0A1Q7GLJ7      ------------------------------------------------------------
A0A2V7GRE3      ------------------------------------------------------------
                                                                            

A0A838NTH4      SRIAEMERDAGAHAAEEEALKRELEALNGRIQGLQEELLQLSAARDTENQALERELDVRA
A0A2D5ZJF2      ------------------------------------------------------------
A0A0S8H9P3      ------------------------------------------------------------
A0A1E4BBP7      ------------------------------------------------------------
A0A3M2G737      ------------------------------------------------------------
A0A0H4TUX7      ------------------------------------------------------------
A0A1G0LUG0      ------------------------------------------------------------
A0A1Q7E3T7      ------------------------------------------------------------
A0A1G0L906      ------------------------------------------------------------
A0A1G0LCC0      ------------------------------------------------------------
A0A2D5ZJE2      ------------------------------------------------------------
A0A3M2G624      ------------------------------------------------------------
A0A6M4IRY1      ------------------------------------------------------------
A0A3D4VBZ5      ------------------------------------------------------------
C1A5W1          ------------------------------------------------------------
W0RI74          ------------------------------------------------------------
A0A3M2BJA6      ------------------------------------------------------------
A0A7Y5QXY3      ------------------------------------------------------------
A0A2V7PX99      ------------------------------------------------------------
A0A2V7ERC7      ------------------------------------------------------------
A0A7V9QLH4      ------------------------------------------------------------
A0A7Y4RSP8      ------------------------------------------------------------
A0A838W6Q3      ------------------------------------------------------------
A0A7V9U4Z2      ------------------------------------------------------------
A0A5Q4D6Y4      ------------------------------------------------------------
A0A7Y3MUW4      ------------------------------------------------------------
A0A848XQ54      ------------------------------------------------------------
A0A7V9QB34      ------------------------------------------------------------
A0A2V7JTZ5      ------------------------------------------------------------
A0A3D4YTR6      ------------------------------------------------------------
A0A7V8VRF0      ------------------------------------------------------------
A0A2V7F1M1      ------------------------------------------------------------
A0A841GJ36      ------------------------------------------------------------
A0A838NJX4      ------------------------------------------------------------
A0A2V7KXK7      ------------------------------------------------------------
A0A651HKD3      ------------------------------------------------------------
A0A843T4K9      ------------------------------------------------------------
A0A2V7QDU7      ------------------------------------------------------------
A0A6J4M9S2      ------------------------------------------------------------
A0A2V7ITT6      ------------------------------------------------------------
A0A2V7NJW1      ------------------------------------------------------------
A0A7V4KNE3      ------------------------------------------------------------
A0A7Y5PAU0      ------------------------------------------------------------
A0A7V9TKH4      ------------------------------------------------------------
A0A2V7GFB5      ------------------------------------------------------------
A0A2V7RQ86      ------------------------------------------------------------
A0A2V7IWX2      ------------------------------------------------------------
A0A1Q7KE95      ------------------------------------------------------------
A0A1Q7T8X5      ------------------------------------------------------------
A0A2V7MS64      ------------------------------------------------------------
A0A2V7Q7N9      ------------------------------------------------------------
A0A2V7IRW6      ------------------------------------------------------------
A0A1Q7DVU6      ------------------------------------------------------------
A0A1Q7JSV2      ------------------------------------------------------------
A0A2V7FK98      ------------------------------------------------------------
A0A2V7R3Z8      ------------------------------------------------------------
A0A2V7J3C0      ------------------------------------------------------------
A0A2V7KWV9      ------------------------------------------------------------
A0A1Q6ZHP2      ------------------------------------------------------------
A0A1Q7R6Z6      ------------------------------------------------------------
A0A2V7FYT7      ------------------------------------------------------------
A0A2V7IGR0      ------------------------------------------------------------
A0A2V7MR23      ------------------------------------------------------------
A0A2V7L1V3      ------------------------------------------------------------
A0A1Q7E5D3      ------------------------------------------------------------
A0A2V7ISE2      ------------------------------------------------------------
A0A1Q7J2X5      ------------------------------------------------------------
A0A2V7NPD1      ------------------------------------------------------------
A0A2V7QPD8      ------------------------------------------------------------
A0A2V7Q8M6      ------------------------------------------------------------
A0A2V7QBC3      ------------------------------------------------------------
A0A2V7LMU1      ------------------------------------------------------------
A0A2V7PBY9      ------------------------------------------------------------
A0A2V7J4D7      ------------------------------------------------------------
A0A2V7LN90      ------------------------------------------------------------
A0A2V7LFN9      ------------------------------------------------------------
A0A2V7MEK4      ------------------------------------------------------------
A0A2V7EU00      ------------------------------------------------------------
A0A1Q6WE01      ------------------------------------------------------------
A0A2V7S9K3      ------------------------------------------------------------
A0A1Q7DXB9      ------------------------------------------------------------
A0A1Q7JD32      ------------------------------------------------------------
A0A2V7MVP8      ------------------------------------------------------------
A0A2V7N0A9      ------------------------------------------------------------
A0A1Q7DLS9      ------------------------------------------------------------
A0A1Q7JK96      ------------------------------------------------------------
A0A2V7KQV7      ------------------------------------------------------------
A0A1Q7JGF6      ------------------------------------------------------------
A0A2V7SG67      ------------------------------------------------------------
A0A1Q7GIK9      ------------------------------------------------------------
A0A7W0YSQ1      ------------------------------------------------------------
A0A3M2BLV5      ------------------------------------------------------------
A0A2V7KS68      ------------------------------------------------------------
A0A2V7N4L3      ------------------------------------------------------------
A0A1Q7AZK2      ------------------------------------------------------------
A0A1Q7TNP7      ------------------------------------------------------------
A0A1Q7KG39      ------------------------------------------------------------
A0A1Q7GX75      ------------------------------------------------------------
A0A1Q7LL80      ------------------------------------------------------------
A0A2V7PFU2      ------------------------------------------------------------
A0A2V7MFS9      ------------------------------------------------------------
A0A2V7T933      ------------------------------------------------------------
A0A841GX23      ------------------------------------------------------------
A0A7V9AJ94      ------------------------------------------------------------
A0A7Y3MYM3      ------------------------------------------------------------
A0A848XLS5      ------------------------------------------------------------
A0A7V9FIM2      ------------------------------------------------------------
A0A7W0WMB8      ------------------------------------------------------------
A0A2V7P8B1      ------------------------------------------------------------
A0A7C2QQS2      ------------------------------------------------------------
A0A2V7QN41      ------------------------------------------------------------
A0A2V7R603      ------------------------------------------------------------
A0A7Y5VC49      ------------------------------------------------------------
A0A2V7LJS2      ------------------------------------------------------------
A0A1Q7GLJ7      ------------------------------------------------------------
A0A2V7GRE3      ------------------------------------------------------------
                                                                            

A0A838NTH4      ARIEDLQREVGAGATEQEALKRELNALTATVQAQLQGAAVRNAEIEALQEQLRASTMRSA
A0A2D5ZJF2      ------------------------------------------------------------
A0A0S8H9P3      ------------------------------------------------------------
A0A1E4BBP7      ------------------------------------------------------------
A0A3M2G737      ------------------------------------------------------------
A0A0H4TUX7      ------------------------------------------------------------
A0A1G0LUG0      ------------------------------------------------------------
A0A1Q7E3T7      ------------------------------------------------------------
A0A1G0L906      ------------------------------------------------------------
A0A1G0LCC0      ------------------------------------------------------------
A0A2D5ZJE2      ------------------------------------------------------------
A0A3M2G624      ------------------------------------------------------------
A0A6M4IRY1      ------------------------------------------------------------
A0A3D4VBZ5      ------------------------------------------------------------
C1A5W1          ------------------------------------------------------------
W0RI74          ------------------------------------------------------------
A0A3M2BJA6      ------------------------------------------------------------
A0A7Y5QXY3      ------------------------------------------------------------
A0A2V7PX99      ------------------------------------------------------------
A0A2V7ERC7      ------------------------------------------------------------
A0A7V9QLH4      ------------------------------------------------------------
A0A7Y4RSP8      ------------------------------------------------------------
A0A838W6Q3      ------------------------------------------------------------
A0A7V9U4Z2      ------------------------------------------------------------
A0A5Q4D6Y4      ------------------------------------------------------------
A0A7Y3MUW4      ------------------------------------------------------------
A0A848XQ54      ------------------------------------------------------------
A0A7V9QB34      ------------------------------------------------------------
A0A2V7JTZ5      ------------------------------------------------------------
A0A3D4YTR6      ------------------------------------------------------------
A0A7V8VRF0      ------------------------------------------------------------
A0A2V7F1M1      ------------------------------------------------------------
A0A841GJ36      ------------------------------------------------------------
A0A838NJX4      ------------------------------------------------------------
A0A2V7KXK7      ------------------------------------------------------------
A0A651HKD3      ------------------------------------------------------------
A0A843T4K9      ------------------------------------------------------------
A0A2V7QDU7      ------------------------------------------------------------
A0A6J4M9S2      ------------------------------------------------------------
A0A2V7ITT6      ------------------------------------------------------------
A0A2V7NJW1      ------------------------------------------------------------
A0A7V4KNE3      ------------------------------------------------------------
A0A7Y5PAU0      ------------------------------------------------------------
A0A7V9TKH4      ------------------------------------------------------------
A0A2V7GFB5      ------------------------------------------------------------
A0A2V7RQ86      ------------------------------------------------------------
A0A2V7IWX2      ------------------------------------------------------------
A0A1Q7KE95      ------------------------------------------------------------
A0A1Q7T8X5      ------------------------------------------------------------
A0A2V7MS64      ------------------------------------------------------------
A0A2V7Q7N9      ------------------------------------------------------------
A0A2V7IRW6      ------------------------------------------------------------
A0A1Q7DVU6      ------------------------------------------------------------
A0A1Q7JSV2      ------------------------------------------------------------
A0A2V7FK98      ------------------------------------------------------------
A0A2V7R3Z8      ------------------------------------------------------------
A0A2V7J3C0      ------------------------------------------------------------
A0A2V7KWV9      ------------------------------------------------------------
A0A1Q6ZHP2      ------------------------------------------------------------
A0A1Q7R6Z6      ------------------------------------------------------------
A0A2V7FYT7      ------------------------------------------------------------
A0A2V7IGR0      ------------------------------------------------------------
A0A2V7MR23      ------------------------------------------------------------
A0A2V7L1V3      ------------------------------------------------------------
A0A1Q7E5D3      ------------------------------------------------------------
A0A2V7ISE2      ------------------------------------------------------------
A0A1Q7J2X5      ------------------------------------------------------------
A0A2V7NPD1      ------------------------------------------------------------
A0A2V7QPD8      ------------------------------------------------------------
A0A2V7Q8M6      ------------------------------------------------------------
A0A2V7QBC3      ------------------------------------------------------------
A0A2V7LMU1      ------------------------------------------------------------
A0A2V7PBY9      ------------------------------------------------------------
A0A2V7J4D7      ------------------------------------------------------------
A0A2V7LN90      ------------------------------------------------------------
A0A2V7LFN9      ------------------------------------------------------------
A0A2V7MEK4      ------------------------------------------------------------
A0A2V7EU00      ------------------------------------------------------------
A0A1Q6WE01      ------------------------------------------------------------
A0A2V7S9K3      ------------------------------------------------------------
A0A1Q7DXB9      ------------------------------------------------------------
A0A1Q7JD32      ------------------------------------------------------------
A0A2V7MVP8      ------------------------------------------------------------
A0A2V7N0A9      ------------------------------------------------------------
A0A1Q7DLS9      ------------------------------------------------------------
A0A1Q7JK96      ------------------------------------------------------------
A0A2V7KQV7      ------------------------------------------------------------
A0A1Q7JGF6      ------------------------------------------------------------
A0A2V7SG67      ------------------------------------------------------------
A0A1Q7GIK9      ------------------------------------------------------------
A0A7W0YSQ1      ------------------------------------------------------------
A0A3M2BLV5      ------------------------------------------------------------
A0A2V7KS68      ------------------------------------------------------------
A0A2V7N4L3      ------------------------------------------------------------
A0A1Q7AZK2      ------------------------------------------------------------
A0A1Q7TNP7      ------------------------------------------------------------
A0A1Q7KG39      ------------------------------------------------------------
A0A1Q7GX75      ------------------------------------------------------------
A0A1Q7LL80      ------------------------------------------------------------
A0A2V7PFU2      ------------------------------------------------------------
A0A2V7MFS9      ------------------------------------------------------------
A0A2V7T933      ------------------------------------------------------------
A0A841GX23      ------------------------------------------------------------
A0A7V9AJ94      ------------------------------------------------------------
A0A7Y3MYM3      ------------------------------------------------------------
A0A848XLS5      ------------------------------------------------------------
A0A7V9FIM2      ------------------------------------------------------------
A0A7W0WMB8      ------------------------------------------------------------
A0A2V7P8B1      ------------------------------------------------------------
A0A7C2QQS2      ------------------------------------------------------------
A0A2V7QN41      ------------------------------------------------------------
A0A2V7R603      ------------------------------------------------------------
A0A7Y5VC49      ------------------------------------------------------------
A0A2V7LJS2      ------------------------------------------------------------
A0A1Q7GLJ7      ------------------------------------------------------------
A0A2V7GRE3      ------------------------------------------------------------
                                                                            

A0A838NTH4      RLEDDLRRSFAARDAEGQELSGSAVAHKAERDALQRELDARTSMFETLQHELKARTARLE
A0A2D5ZJF2      ------------------------------------------------------------
A0A0S8H9P3      ------------------------------------------------------------
A0A1E4BBP7      ------------------------------------------------------------
A0A3M2G737      ------------------------------------------------------------
A0A0H4TUX7      ------------------------------------------------------------
A0A1G0LUG0      ------------------------------------------------------------
A0A1Q7E3T7      ------------------------------------------------------------
A0A1G0L906      ------------------------------------------------------------
A0A1G0LCC0      ------------------------------------------------------------
A0A2D5ZJE2      ------------------------------------------------------------
A0A3M2G624      ------------------------------------------------------------
A0A6M4IRY1      ------------------------------------------------------------
A0A3D4VBZ5      ------------------------------------------------------------
C1A5W1          ------------------------------------------------------------
W0RI74          ------------------------------------------------------------
A0A3M2BJA6      ------------------------------------------------------------
A0A7Y5QXY3      ------------------------------------------------------------
A0A2V7PX99      ------------------------------------------------------------
A0A2V7ERC7      ------------------------------------------------------------
A0A7V9QLH4      ------------------------------------------------------------
A0A7Y4RSP8      ------------------------------------------------------------
A0A838W6Q3      ------------------------------------------------------------
A0A7V9U4Z2      ------------------------------------------------------------
A0A5Q4D6Y4      ------------------------------------------------------------
A0A7Y3MUW4      ------------------------------------------------------------
A0A848XQ54      ------------------------------------------------------------
A0A7V9QB34      ------------------------------------------------------------
A0A2V7JTZ5      ------------------------------------------------------------
A0A3D4YTR6      ------------------------------------------------------------
A0A7V8VRF0      ------------------------------------------------------------
A0A2V7F1M1      ------------------------------------------------------------
A0A841GJ36      ------------------------------------------------------------
A0A838NJX4      ------------------------------------------------------------
A0A2V7KXK7      ------------------------------------------------------------
A0A651HKD3      ------------------------------------------------------------
A0A843T4K9      ------------------------------------------------------------
A0A2V7QDU7      ------------------------------------------------------------
A0A6J4M9S2      ------------------------------------------------------------
A0A2V7ITT6      ------------------------------------------------------------
A0A2V7NJW1      ------------------------------------------------------------
A0A7V4KNE3      ------------------------------------------------------------
A0A7Y5PAU0      ------------------------------------------------------------
A0A7V9TKH4      ------------------------------------------------------------
A0A2V7GFB5      ------------------------------------------------------------
A0A2V7RQ86      ------------------------------------------------------------
A0A2V7IWX2      ------------------------------------------------------------
A0A1Q7KE95      ------------------------------------------------------------
A0A1Q7T8X5      ------------------------------------------------------------
A0A2V7MS64      ------------------------------------------------------------
A0A2V7Q7N9      ------------------------------------------------------------
A0A2V7IRW6      ------------------------------------------------------------
A0A1Q7DVU6      ------------------------------------------------------------
A0A1Q7JSV2      ------------------------------------------------------------
A0A2V7FK98      ------------------------------------------------------------
A0A2V7R3Z8      ------------------------------------------------------------
A0A2V7J3C0      ------------------------------------------------------------
A0A2V7KWV9      ------------------------------------------------------------
A0A1Q6ZHP2      ------------------------------------------------------------
A0A1Q7R6Z6      ------------------------------------------------------------
A0A2V7FYT7      ------------------------------------------------------------
A0A2V7IGR0      ------------------------------------------------------------
A0A2V7MR23      ------------------------------------------------------------
A0A2V7L1V3      ------------------------------------------------------------
A0A1Q7E5D3      ------------------------------------------------------------
A0A2V7ISE2      ------------------------------------------------------------
A0A1Q7J2X5      ------------------------------------------------------------
A0A2V7NPD1      ------------------------------------------------------------
A0A2V7QPD8      ------------------------------------------------------------
A0A2V7Q8M6      ------------------------------------------------------------
A0A2V7QBC3      ------------------------------------------------------------
A0A2V7LMU1      ------------------------------------------------------------
A0A2V7PBY9      ------------------------------------------------------------
A0A2V7J4D7      ------------------------------------------------------------
A0A2V7LN90      ------------------------------------------------------------
A0A2V7LFN9      ------------------------------------------------------------
A0A2V7MEK4      ------------------------------------------------------------
A0A2V7EU00      ------------------------------------------------------------
A0A1Q6WE01      ------------------------------------------------------------
A0A2V7S9K3      ------------------------------------------------------------
A0A1Q7DXB9      ------------------------------------------------------------
A0A1Q7JD32      ------------------------------------------------------------
A0A2V7MVP8      ------------------------------------------------------------
A0A2V7N0A9      ------------------------------------------------------------
A0A1Q7DLS9      ------------------------------------------------------------
A0A1Q7JK96      ------------------------------------------------------------
A0A2V7KQV7      ------------------------------------------------------------
A0A1Q7JGF6      ------------------------------------------------------------
A0A2V7SG67      ------------------------------------------------------------
A0A1Q7GIK9      ------------------------------------------------------------
A0A7W0YSQ1      ------------------------------------------------------------
A0A3M2BLV5      ------------------------------------------------------------
A0A2V7KS68      ------------------------------------------------------------
A0A2V7N4L3      ------------------------------------------------------------
A0A1Q7AZK2      ------------------------------------------------------------
A0A1Q7TNP7      ------------------------------------------------------------
A0A1Q7KG39      ------------------------------------------------------------
A0A1Q7GX75      ------------------------------------------------------------
A0A1Q7LL80      ------------------------------------------------------------
A0A2V7PFU2      ------------------------------------------------------------
A0A2V7MFS9      ------------------------------------------------------------
A0A2V7T933      ------------------------------------------------------------
A0A841GX23      ------------------------------------------------------------
A0A7V9AJ94      ------------------------------------------------------------
A0A7Y3MYM3      ------------------------------------------------------------
A0A848XLS5      ------------------------------------------------------------
A0A7V9FIM2      ------------------------------------------------------------
A0A7W0WMB8      ------------------------------------------------------------
A0A2V7P8B1      ------------------------------------------------------------
A0A7C2QQS2      ------------------------------------------------------------
A0A2V7QN41      ------------------------------------------------------------
A0A2V7R603      ------------------------------------------------------------
A0A7Y5VC49      ------------------------------------------------------------
A0A2V7LJS2      ------------------------------------------------------------
A0A1Q7GLJ7      ------------------------------------------------------------
A0A2V7GRE3      ------------------------------------------------------------
                                                                            

A0A838NTH4      MLQRELEAGALRLEELHHRVAARETESETLKRDLDASVWRATELEKELRQDSLARDGEAD
A0A2D5ZJF2      ------------------------------------------------------------
A0A0S8H9P3      ------------------------------------------------------------
A0A1E4BBP7      ------------------------------------------------------------
A0A3M2G737      ------------------------------------------------------------
A0A0H4TUX7      ------------------------------------------------------------
A0A1G0LUG0      ------------------------------------------------------------
A0A1Q7E3T7      ------------------------------------------------------------
A0A1G0L906      ------------------------------------------------------------
A0A1G0LCC0      ------------------------------------------------------------
A0A2D5ZJE2      ------------------------------------------------------------
A0A3M2G624      ------------------------------------------------------------
A0A6M4IRY1      ------------------------------------------------------------
A0A3D4VBZ5      ------------------------------------------------------------
C1A5W1          ------------------------------------------------------------
W0RI74          ------------------------------------------------------------
A0A3M2BJA6      ------------------------------------------------------------
A0A7Y5QXY3      ------------------------------------------------------------
A0A2V7PX99      ------------------------------------------------------------
A0A2V7ERC7      ------------------------------------------------------------
A0A7V9QLH4      ------------------------------------------------------------
A0A7Y4RSP8      ------------------------------------------------------------
A0A838W6Q3      ------------------------------------------------------------
A0A7V9U4Z2      ------------------------------------------------------------
A0A5Q4D6Y4      ------------------------------------------------------------
A0A7Y3MUW4      ------------------------------------------------------------
A0A848XQ54      ------------------------------------------------------------
A0A7V9QB34      ------------------------------------------------------------
A0A2V7JTZ5      ------------------------------------------------------------
A0A3D4YTR6      ------------------------------------------------------------
A0A7V8VRF0      ------------------------------------------------------------
A0A2V7F1M1      ------------------------------------------------------------
A0A841GJ36      ------------------------------------------------------------
A0A838NJX4      ------------------------------------------------------------
A0A2V7KXK7      ------------------------------------------------------------
A0A651HKD3      ------------------------------------------------------------
A0A843T4K9      ------------------------------------------------------------
A0A2V7QDU7      ------------------------------------------------------------
A0A6J4M9S2      ------------------------------------------------------------
A0A2V7ITT6      ------------------------------------------------------------
A0A2V7NJW1      ------------------------------------------------------------
A0A7V4KNE3      ------------------------------------------------------------
A0A7Y5PAU0      ------------------------------------------------------------
A0A7V9TKH4      ------------------------------------------------------------
A0A2V7GFB5      ------------------------------------------------------------
A0A2V7RQ86      ------------------------------------------------------------
A0A2V7IWX2      ------------------------------------------------------------
A0A1Q7KE95      ------------------------------------------------------------
A0A1Q7T8X5      ------------------------------------------------------------
A0A2V7MS64      ------------------------------------------------------------
A0A2V7Q7N9      ------------------------------------------------------------
A0A2V7IRW6      ------------------------------------------------------------
A0A1Q7DVU6      ------------------------------------------------------------
A0A1Q7JSV2      ------------------------------------------------------------
A0A2V7FK98      ------------------------------------------------------------
A0A2V7R3Z8      ------------------------------------------------------------
A0A2V7J3C0      ------------------------------------------------------------
A0A2V7KWV9      ------------------------------------------------------------
A0A1Q6ZHP2      ------------------------------------------------------------
A0A1Q7R6Z6      ------------------------------------------------------------
A0A2V7FYT7      ------------------------------------------------------------
A0A2V7IGR0      ------------------------------------------------------------
A0A2V7MR23      ------------------------------------------------------------
A0A2V7L1V3      ------------------------------------------------------------
A0A1Q7E5D3      ------------------------------------------------------------
A0A2V7ISE2      ------------------------------------------------------------
A0A1Q7J2X5      ------------------------------------------------------------
A0A2V7NPD1      ------------------------------------------------------------
A0A2V7QPD8      ------------------------------------------------------------
A0A2V7Q8M6      ------------------------------------------------------------
A0A2V7QBC3      ------------------------------------------------------------
A0A2V7LMU1      ------------------------------------------------------------
A0A2V7PBY9      ------------------------------------------------------------
A0A2V7J4D7      ------------------------------------------------------------
A0A2V7LN90      ------------------------------------------------------------
A0A2V7LFN9      ------------------------------------------------------------
A0A2V7MEK4      ------------------------------------------------------------
A0A2V7EU00      ------------------------------------------------------------
A0A1Q6WE01      ------------------------------------------------------------
A0A2V7S9K3      ------------------------------------------------------------
A0A1Q7DXB9      ------------------------------------------------------------
A0A1Q7JD32      ------------------------------------------------------------
A0A2V7MVP8      ------------------------------------------------------------
A0A2V7N0A9      ------------------------------------------------------------
A0A1Q7DLS9      ------------------------------------------------------------
A0A1Q7JK96      ------------------------------------------------------------
A0A2V7KQV7      ------------------------------------------------------------
A0A1Q7JGF6      ------------------------------------------------------------
A0A2V7SG67      ------------------------------------------------------------
A0A1Q7GIK9      ------------------------------------------------------------
A0A7W0YSQ1      ------------------------------------------------------------
A0A3M2BLV5      ------------------------------------------------------------
A0A2V7KS68      ------------------------------------------------------------
A0A2V7N4L3      ------------------------------------------------------------
A0A1Q7AZK2      ------------------------------------------------------------
A0A1Q7TNP7      ------------------------------------------------------------
A0A1Q7KG39      ------------------------------------------------------------
A0A1Q7GX75      ------------------------------------------------------------
A0A1Q7LL80      ------------------------------------------------------------
A0A2V7PFU2      ------------------------------------------------------------
A0A2V7MFS9      ------------------------------------------------------------
A0A2V7T933      ------------------------------------------------------------
A0A841GX23      ------------------------------------------------------------
A0A7V9AJ94      ------------------------------------------------------------
A0A7Y3MYM3      ------------------------------------------------------------
A0A848XLS5      ------------------------------------------------------------
A0A7V9FIM2      ------------------------------------------------------------
A0A7W0WMB8      ------------------------------------------------------------
A0A2V7P8B1      ------------------------------------------------------------
A0A7C2QQS2      ------------------------------------------------------------
A0A2V7QN41      ------------------------------------------------------------
A0A2V7R603      ------------------------------------------------------------
A0A7Y5VC49      ------------------------------------------------------------
A0A2V7LJS2      ------------------------------------------------------------
A0A1Q7GLJ7      ------------------------------------------------------------
A0A2V7GRE3      ------------------------------------------------------------
                                                                            

A0A838NTH4      ELRRELNARMERIDELQMELLHVSSAHDVERDALQRELESRASIPEVLQGELETRASRIA
A0A2D5ZJF2      ------------------------------------------------------------
A0A0S8H9P3      ------------------------------------------------------------
A0A1E4BBP7      ------------------------------------------------------------
A0A3M2G737      ------------------------------------------------------------
A0A0H4TUX7      ------------------------------------------------------------
A0A1G0LUG0      ------------------------------------------------------------
A0A1Q7E3T7      ------------------------------------------------------------
A0A1G0L906      ------------------------------------------------------------
A0A1G0LCC0      ------------------------------------------------------------
A0A2D5ZJE2      ------------------------------------------------------------
A0A3M2G624      ------------------------------------------------------------
A0A6M4IRY1      ------------------------------------------------------------
A0A3D4VBZ5      ------------------------------------------------------------
C1A5W1          ------------------------------------------------------------
W0RI74          ------------------------------------------------------------
A0A3M2BJA6      ------------------------------------------------------------
A0A7Y5QXY3      ------------------------------------------------------------
A0A2V7PX99      ------------------------------------------------------------
A0A2V7ERC7      ------------------------------------------------------------
A0A7V9QLH4      ------------------------------------------------------------
A0A7Y4RSP8      ------------------------------------------------------------
A0A838W6Q3      ------------------------------------------------------------
A0A7V9U4Z2      ------------------------------------------------------------
A0A5Q4D6Y4      ------------------------------------------------------------
A0A7Y3MUW4      ------------------------------------------------------------
A0A848XQ54      ------------------------------------------------------------
A0A7V9QB34      ------------------------------------------------------------
A0A2V7JTZ5      ------------------------------------------------------------
A0A3D4YTR6      ------------------------------------------------------------
A0A7V8VRF0      ------------------------------------------------------------
A0A2V7F1M1      ------------------------------------------------------------
A0A841GJ36      ------------------------------------------------------------
A0A838NJX4      ------------------------------------------------------------
A0A2V7KXK7      ------------------------------------------------------------
A0A651HKD3      ------------------------------------------------------------
A0A843T4K9      ------------------------------------------------------------
A0A2V7QDU7      ------------------------------------------------------------
A0A6J4M9S2      ------------------------------------------------------------
A0A2V7ITT6      ------------------------------------------------------------
A0A2V7NJW1      ------------------------------------------------------------
A0A7V4KNE3      ------------------------------------------------------------
A0A7Y5PAU0      ------------------------------------------------------------
A0A7V9TKH4      ------------------------------------------------------------
A0A2V7GFB5      ------------------------------------------------------------
A0A2V7RQ86      ------------------------------------------------------------
A0A2V7IWX2      ------------------------------------------------------------
A0A1Q7KE95      ------------------------------------------------------------
A0A1Q7T8X5      ------------------------------------------------------------
A0A2V7MS64      ------------------------------------------------------------
A0A2V7Q7N9      ------------------------------------------------------------
A0A2V7IRW6      ------------------------------------------------------------
A0A1Q7DVU6      ------------------------------------------------------------
A0A1Q7JSV2      ------------------------------------------------------------
A0A2V7FK98      ------------------------------------------------------------
A0A2V7R3Z8      ----------------------------------------------------------MI
A0A2V7J3C0      ------------------------------------------------------------
A0A2V7KWV9      ------------------------------------------------------------
A0A1Q6ZHP2      ------------------------------------------------------------
A0A1Q7R6Z6      ------------------------------------------------------------
A0A2V7FYT7      ------------------------------------------------------------
A0A2V7IGR0      ------------------------------------------------------------
A0A2V7MR23      ------------------------------------------------------------
A0A2V7L1V3      ------------------------------------------------------------
A0A1Q7E5D3      ------------------------------------------------------------
A0A2V7ISE2      ------------------------------------------------------------
A0A1Q7J2X5      ------------------------------------------------------------
A0A2V7NPD1      ------------------------------------------------------------
A0A2V7QPD8      ------------------------------------------------------------
A0A2V7Q8M6      ------------------------------------------------------------
A0A2V7QBC3      ------------------------------------------------------------
A0A2V7LMU1      ------------------------------------------------------------
A0A2V7PBY9      ------------------------------------------------------------
A0A2V7J4D7      ------------------------------------------------------------
A0A2V7LN90      ------------------------------------------------------------
A0A2V7LFN9      ------------------------------------------------------------
A0A2V7MEK4      ------------------------------------------------------------
A0A2V7EU00      ------------------------------------------------------------
A0A1Q6WE01      ------------------------------------------------------------
A0A2V7S9K3      ------------------------------------------------------------
A0A1Q7DXB9      ------------------------------------------------------------
A0A1Q7JD32      ------------------------------------------------------------
A0A2V7MVP8      ------------------------------------------------------------
A0A2V7N0A9      ------------------------------------------------------------
A0A1Q7DLS9      ------------------------------------------------------------
A0A1Q7JK96      ------------------------------------------------------------
A0A2V7KQV7      ------------------------------------------------------------
A0A1Q7JGF6      ------------------------------------------------------------
A0A2V7SG67      ------------------------------------------------------------
A0A1Q7GIK9      ------------------------------------------------------------
A0A7W0YSQ1      ------------------------------------------------------------
A0A3M2BLV5      ------------------------------------------------------------
A0A2V7KS68      ------------------------------------------------------------
A0A2V7N4L3      ------------------------------------------------------------
A0A1Q7AZK2      ------------------------------------------------------------
A0A1Q7TNP7      ------------------------------------------------------------
A0A1Q7KG39      ------------------------------------------------------------
A0A1Q7GX75      ------------------------------------------------------------
A0A1Q7LL80      ------------------------------------------------------------
A0A2V7PFU2      ------------------------------------------------------------
A0A2V7MFS9      ------------------------------------------------------------
A0A2V7T933      ------------------------------------------------------------
A0A841GX23      ------------------------------------------------------------
A0A7V9AJ94      ------------------------------------------------------------
A0A7Y3MYM3      ------------------------------------------------------------
A0A848XLS5      ------------------------------------------------------------
A0A7V9FIM2      ------------------------------------------------------------
A0A7W0WMB8      ------------------------------------------------------------
A0A2V7P8B1      ------------------------------------------------------------
A0A7C2QQS2      ------------------------------------------------------------
A0A2V7QN41      ------------------------------------------------------------
A0A2V7R603      ------------------------------------------------------------
A0A7Y5VC49      ------------------------------------------------------------
A0A2V7LJS2      ------------------------------------------------------------
A0A1Q7GLJ7      ------------------------------------------------------------
A0A2V7GRE3      ------------------------------------------------------------
                                                                            

A0A838NTH4      EMERDAGAHAAEEEALKRELEALTATTQAQLQRAASRDAKIEALQEQLHASTMRSARLED
A0A2D5ZJF2      ------------------------------------------------------------
A0A0S8H9P3      ------------------------------------------------------------
A0A1E4BBP7      ------------------------------------------------------------
A0A3M2G737      ------------------------------------------------------------
A0A0H4TUX7      ------------------------------------------------------------
A0A1G0LUG0      ------------------------------------------------------------
A0A1Q7E3T7      ------------------------------------------------------------
A0A1G0L906      ------------------------------------------------------------
A0A1G0LCC0      ------------------------------------------------------------
A0A2D5ZJE2      ------------------------------------------------------------
A0A3M2G624      ------------------------------------------------------------
A0A6M4IRY1      ------------------------------------------------------------
A0A3D4VBZ5      ------------------------------------------------------------
C1A5W1          ------------------------------------------------------------
W0RI74          ------------------------------------------------------------
A0A3M2BJA6      ------------------------------------------------------------
A0A7Y5QXY3      ------------------------------------------------------------
A0A2V7PX99      ------------------------------------------------------------
A0A2V7ERC7      ------------------------------------------------------------
A0A7V9QLH4      ------------------------------------------------------------
A0A7Y4RSP8      ------------------------------------------------------------
A0A838W6Q3      ------------------------------------------------------------
A0A7V9U4Z2      ------------------------------------------------------------
A0A5Q4D6Y4      ------------------------------------------------------------
A0A7Y3MUW4      ------------------------------------------------------------
A0A848XQ54      ------------------------------------------------------------
A0A7V9QB34      ------------------------------------------------------------
A0A2V7JTZ5      ------------------------------------------------------------
A0A3D4YTR6      ------------------------------------------------------------
A0A7V8VRF0      ------------------------------------------------------------
A0A2V7F1M1      ------------------------------------------------------------
A0A841GJ36      ------------------------------------------------------------
A0A838NJX4      ------------------------------------------------------------
A0A2V7KXK7      ------------------------------------------------------------
A0A651HKD3      ------------------------------------------------------------
A0A843T4K9      ------------------------------------------------------------
A0A2V7QDU7      ------------------------------------------------------------
A0A6J4M9S2      ------------------------------------------------------------
A0A2V7ITT6      ------------------------------------------------------------
A0A2V7NJW1      ---------------------------------------------------MLVVHDEHP
A0A7V4KNE3      ------------------------------------------------------------
A0A7Y5PAU0      ------------------------------------------------------------
A0A7V9TKH4      ------------------------------------------------------------
A0A2V7GFB5      ------------------------------------------------------------
A0A2V7RQ86      ------------------------------------------------------------
A0A2V7IWX2      ------------------------------------------------------------
A0A1Q7KE95      ------------------------------------------------------------
A0A1Q7T8X5      ------------------------------------------------------------
A0A2V7MS64      ------------------------------------------------------------
A0A2V7Q7N9      ------------------------------------------------------------
A0A2V7IRW6      ------------------------------------------------------------
A0A1Q7DVU6      ------------------------------------------------------------
A0A1Q7JSV2      ------------------------------------------------------------
A0A2V7FK98      ------------------------------------------------------------
A0A2V7R3Z8      GPQSGAQQGEAIDLRHVQVHEHEVECAALQQVEGFLPPAADGYVVAFVAQNRRAALAQRV
A0A2V7J3C0      ------------------------------------------------------------
A0A2V7KWV9      ------------------------------------------------------------
A0A1Q6ZHP2      ------------------------------------------------------------
A0A1Q7R6Z6      ------------------------------------------------------------
A0A2V7FYT7      ------------------------------------------------------------
A0A2V7IGR0      ------------------------------------------------------------
A0A2V7MR23      ------------------------------------------------------------
A0A2V7L1V3      ------------------------------------------------------------
A0A1Q7E5D3      ------------------------------------------------------------
A0A2V7ISE2      ------------------------------------------------------------
A0A1Q7J2X5      ------------------------------------------------------------
A0A2V7NPD1      ------------------------------------------------------------
A0A2V7QPD8      -----------------------------------------------------------M
A0A2V7Q8M6      ------------------------------------------------------------
A0A2V7QBC3      ------------------------------------------------------------
A0A2V7LMU1      ------------------------------------------------------------
A0A2V7PBY9      ------------------------------------------------------------
A0A2V7J4D7      ------------------------------------------------------------
A0A2V7LN90      ------------------------------------------------------------
A0A2V7LFN9      ------------------------------------------------------------
A0A2V7MEK4      ------------------------------------------------------------
A0A2V7EU00      ------------------------------------------------------------
A0A1Q6WE01      ------------------------------------------------------------
A0A2V7S9K3      ------------------------------------------------------------
A0A1Q7DXB9      ------------------------------------------------------------
A0A1Q7JD32      ------------------------------------------------------------
A0A2V7MVP8      ------------------------------------------------------------
A0A2V7N0A9      ------------------------------------------------------------
A0A1Q7DLS9      ------------------------------------------------------------
A0A1Q7JK96      ------------------------------------------------------------
A0A2V7KQV7      ------------------------------------------------------------
A0A1Q7JGF6      ------------------------------------------------------------
A0A2V7SG67      ------------------------------------------------------------
A0A1Q7GIK9      ------------------------------------------------------------
A0A7W0YSQ1      ------------------------------------------------------------
A0A3M2BLV5      ------------------------------------------------------------
A0A2V7KS68      ------------------------------------------------------------
A0A2V7N4L3      ------------------------------------------------------------
A0A1Q7AZK2      ------------------------------------------------------------
A0A1Q7TNP7      ------------------------------------------------------------
A0A1Q7KG39      ------------------------------------------------------------
A0A1Q7GX75      ------------------------------------------------------------
A0A1Q7LL80      ------------------------------------------------------------
A0A2V7PFU2      ------------------------------------------------------------
A0A2V7MFS9      ------------------------------------------------------------
A0A2V7T933      ------------------------------------------------------------
A0A841GX23      ------------------------------------------------------------
A0A7V9AJ94      ------------------------------------------------------------
A0A7Y3MYM3      ------------------------------------------------------------
A0A848XLS5      ------------------------------------------------------------
A0A7V9FIM2      ------------------------------------------------------------
A0A7W0WMB8      ------------------------------------------------------------
A0A2V7P8B1      ------------------------------------------------------------
A0A7C2QQS2      ------------------------------------------------------------
A0A2V7QN41      ------------------------------------------------------------
A0A2V7R603      ------------------------------------------------------------
A0A7Y5VC49      ------------------------------------------------------------
A0A2V7LJS2      ------------------------------------------------------------
A0A1Q7GLJ7      ------------------------------------------------------------
A0A2V7GRE3      ------------------------------------------------------------
                                                                            

A0A838NTH4      DLELSFAARGAEGQELKRELDARAARIEELQAELLQSFATRETEEGALQQHPEVATSAAS
A0A2D5ZJF2      ------------------------------------------------------------
A0A0S8H9P3      ------------------------------------------------------------
A0A1E4BBP7      ------------------------------------------------------------
A0A3M2G737      ------------------------------------------------------------
A0A0H4TUX7      ------------------------------------------------------------
A0A1G0LUG0      ------------------------------------------------------------
A0A1Q7E3T7      ------------------------------------------------------------
A0A1G0L906      ------------------------------------------------------------
A0A1G0LCC0      ------------------------------------------------------------
A0A2D5ZJE2      ------------------------------------------------------------
A0A3M2G624      ------------------------------------------------------------
A0A6M4IRY1      ------------------------------------------------------------
A0A3D4VBZ5      ------------------------------------------------------------
C1A5W1          ------------------------------------------------------------
W0RI74          ------------------------------------------------------------
A0A3M2BJA6      ------------------------------------------------------------
A0A7Y5QXY3      ------------------------------------------------------------
A0A2V7PX99      ------------------------------------------------------------
A0A2V7ERC7      ------------------------------------------------------------
A0A7V9QLH4      ------------------------------------------------------------
A0A7Y4RSP8      ------------------------------------------------------------
A0A838W6Q3      ------------------------------------------------------------
A0A7V9U4Z2      ------------------------------------------------------------
A0A5Q4D6Y4      ------------------------------------------------------------
A0A7Y3MUW4      ------------------------------------------------------------
A0A848XQ54      ------------------------------------------------------------
A0A7V9QB34      ------------------------------------------------------------
A0A2V7JTZ5      ------------------------------------------------------------
A0A3D4YTR6      ------------------------------------------------------------
A0A7V8VRF0      ------------------------------------------------------------
A0A2V7F1M1      ------------------------------------------------------------
A0A841GJ36      ------------------------------------------------------------
A0A838NJX4      ------------------------------------------------------------
A0A2V7KXK7      ------------------------------------------------------------
A0A651HKD3      ------------------------------------------------------------
A0A843T4K9      ------------------------------------------------------------
A0A2V7QDU7      ------------------------------------------------------------
A0A6J4M9S2      ------------------------------------------------------------
A0A2V7ITT6      ------------------------------------------------------------
A0A2V7NJW1      DVGPRPGLDCEQVRHLLREIRRDARGRLARLRFRPGWRHADDSPGGAGGRAVCDLPHADA
A0A7V4KNE3      ------------------------------------------------------------
A0A7Y5PAU0      ------------------------------------------------------------
A0A7V9TKH4      ------------------------------------------------------------
A0A2V7GFB5      ------------------------------------------------------------
A0A2V7RQ86      ------------------------------------------------------------
A0A2V7IWX2      ----------------MFNGVPFLCKRTNRGRALRGAIPLAPMHMTCAPPRPAGRLPEPI
A0A1Q7KE95      ------------------------------------------------------------
A0A1Q7T8X5      ------------------------------------------------------------
A0A2V7MS64      ------------------------------------------------------------
A0A2V7Q7N9      ------------------------------------------------------------
A0A2V7IRW6      ------------------------------------------------------------
A0A1Q7DVU6      ------------------------------------------------------------
A0A1Q7JSV2      ------------------------------------------------------------
A0A2V7FK98      ------------------------------------MRC---------------------
A0A2V7R3Z8      FVIDHQNPHPGLGFRPDGEHGRRLASLDGGGHAVMSKRCRHRGRPRFPVDPPLRRVRANL
A0A2V7J3C0      ------------------------------------------------------------
A0A2V7KWV9      ------------------------------------------------------------
A0A1Q6ZHP2      ------------------------------------------------------------
A0A1Q7R6Z6      ------------------------------------------------------------
A0A2V7FYT7      ------------------------------------------------------------
A0A2V7IGR0      ------------------------------------------------------------
A0A2V7MR23      ------------------------------------------------------------
A0A2V7L1V3      ------------------------------------------------------------
A0A1Q7E5D3      ------------------------------------------------------------
A0A2V7ISE2      ----------------------------MDIGFVPARVWPPLTQGSGQSVATSQRPDSQA
A0A1Q7J2X5      ------------------------------------------------------------
A0A2V7NPD1      ------------------------------------------------------------
A0A2V7QPD8      ASMADGSRPSTEGLTPSWASGMDIAVVLDFRLTPPYAGFGPTCREVAAARILRITTAKSA
A0A2V7Q8M6      ---------------------MDIALVLDNGRPHSYAQFGPHCRDPAAWPGLPHGFSNNR
A0A2V7QBC3      ---------------------------------------------------MPQRRRFAA
A0A2V7LMU1      ---------------------------------------------------MNSATTDRA
A0A2V7PBY9      ---------------------------------------------------MKWATNGAQ
A0A2V7J4D7      ------------------------------------------------------------
A0A2V7LN90      ------------------------------------------------------------
A0A2V7LFN9      ------------------------------------------------------------
A0A2V7MEK4      ------------------------------------------------------------
A0A2V7EU00      ------------------------------------------------------------
A0A1Q6WE01      ------------------------------------------------------------
A0A2V7S9K3      ------------------------------------------------------------
A0A1Q7DXB9      ------------------------------------------------------------
A0A1Q7JD32      ------------------------------------------------------------
A0A2V7MVP8      ------------------------------------------------------------
A0A2V7N0A9      ------------------------------------------------------------
A0A1Q7DLS9      ------------------------------------------------------------
A0A1Q7JK96      ------------------------------------------------------------
A0A2V7KQV7      ------------------------------------------------------------
A0A1Q7JGF6      ------------------------------------------------------------
A0A2V7SG67      ------------------------------------------------------------
A0A1Q7GIK9      ------------------------------------------------------------
A0A7W0YSQ1      ------------------------------------------------------------
A0A3M2BLV5      ------------------------------------------------------------
A0A2V7KS68      ------------------------------------------------------------
A0A2V7N4L3      ------------------------------------------------------------
A0A1Q7AZK2      ------------------------------------------------------------
A0A1Q7TNP7      ------------------------------------------------------------
A0A1Q7KG39      ------------------------------------------------------------
A0A1Q7GX75      ------------------------------------------------------------
A0A1Q7LL80      ------------------------------------------------------------
A0A2V7PFU2      ------------------------------------------------------------
A0A2V7MFS9      ------------------------------------------------------------
A0A2V7T933      ------------------------------------------------------------
A0A841GX23      ------------------------------------------------------------
A0A7V9AJ94      ------------------------------------------------------------
A0A7Y3MYM3      ------------------------------------------------------------
A0A848XLS5      ------------------------------------------------------------
A0A7V9FIM2      ------------------------------------------------------------
A0A7W0WMB8      ------------------------------------------------------------
A0A2V7P8B1      ------------------------------------------------------------
A0A7C2QQS2      ------------------------------------------------------------
A0A2V7QN41      ------------------------------------------------------------
A0A2V7R603      ------------------------------------------------------------
A0A7Y5VC49      ------------------------------------------------------------
A0A2V7LJS2      ------------------------------------------------------------
A0A1Q7GLJ7      ------------------------------------------------------------
A0A2V7GRE3      ------------------------------------------------------------
                                                                            

A0A838NTH4      SLREDAAFRDKGQAQGDDGFLGEASAHDAEPDTVQRDTNGMKPITDVLKPELNGQSVGPE
A0A2D5ZJF2      ------------------------------------------------------------
A0A0S8H9P3      ------------------------------------------------------------
A0A1E4BBP7      ------------------------------------------------------------
A0A3M2G737      ------------------------------------------------------------
A0A0H4TUX7      ------------------------------------------------------------
A0A1G0LUG0      ------------------------------------------------------------
A0A1Q7E3T7      ------------------------------------------------------------
A0A1G0L906      ------------------------------------------------------------
A0A1G0LCC0      ------------------------------------------------------------
A0A2D5ZJE2      ------------------------------------------------------------
A0A3M2G624      ------------------------------------------------------------
A0A6M4IRY1      ------------------------------------------------------------
A0A3D4VBZ5      ------------------------------------------------------------
C1A5W1          ------------------------------------------------------------
W0RI74          ------------------------------------------------------------
A0A3M2BJA6      ------------------------------------------------------------
A0A7Y5QXY3      ------------------------------------------------------------
A0A2V7PX99      ------------------------------------------------------------
A0A2V7ERC7      ------------------------------------------------------------
A0A7V9QLH4      ------------------------------------------------------------
A0A7Y4RSP8      ------------------------------------------------------------
A0A838W6Q3      ------------------------------------------------------------
A0A7V9U4Z2      ------------------------------------------------------------
A0A5Q4D6Y4      ------------------------------------------------------------
A0A7Y3MUW4      ------------------------------------------------------------
A0A848XQ54      ------------------------------------------------------------
A0A7V9QB34      ------------------------------------------------------------
A0A2V7JTZ5      ------------------------------------------------------------
A0A3D4YTR6      ------------------------------------------------------------
A0A7V8VRF0      ------------------------------------------------------------
A0A2V7F1M1      ------------------------------------------------------------
A0A841GJ36      ------------------------------------------------------------
A0A838NJX4      ------------------------------------------------------------
A0A2V7KXK7      ------------------------------------------------------------
A0A651HKD3      ------------------------------------------------------------
A0A843T4K9      ------------------------------------------------------------
A0A2V7QDU7      ------------------------------------------------------------
A0A6J4M9S2      ------------------------------------------------------------
A0A2V7ITT6      ------------------------------------------------------------
A0A2V7NJW1      ESGPVRPLQLHLSGEAVKGDCCANDTGFPCVPLAQQPLQRARQVTAACVGSRADCITSRS
A0A7V4KNE3      ------------------------------------------------------------
A0A7Y5PAU0      ------------------------------------------------------------
A0A7V9TKH4      ------------------------------------------------------------
A0A2V7GFB5      ------------------------------------------------------------
A0A2V7RQ86      ------------------------------------------------------------
A0A2V7IWX2      ALQRVAPASRREHAPARAAHVLRICGATCCAYATRRHRHAPRRRCGREAGVRSQRYRPCS
A0A1Q7KE95      ------------------------------------------------------------
A0A1Q7T8X5      ------------------------------------------------------------
A0A2V7MS64      ------------------------------------------------------------
A0A2V7Q7N9      -------------------------------------------------------MQARG
A0A2V7IRW6      ------------------------------------------------------------
A0A1Q7DVU6      ------------------------------------------------------------
A0A1Q7JSV2      ------------------------------------------------------------
A0A2V7FK98      ------TDLRHGDG--------------------------------VGGVPRGIG-LATG
A0A2V7R3Z8      SRGRSGTDSPHNDGKILSSARRGGVVARTKVHPAPGCGAPICGMWTVGAPHRAVSDLPQG
A0A2V7J3C0      ------------------------------------------------------------
A0A2V7KWV9      ------------------------------------------------------------
A0A1Q6ZHP2      ------------------------------------------------------------
A0A1Q7R6Z6      ------------------------------------------------------------
A0A2V7FYT7      ------------------------------------------------------------
A0A2V7IGR0      ------------------------------------------------------------
A0A2V7MR23      ------------------------------------------------------------
A0A2V7L1V3      ------------------------------------------------------------
A0A1Q7E5D3      ------------------------------------------------------------
A0A2V7ISE2      IAAPAARRTRAPGWTVAPTCIHRLPHAAPICGMTSPAGGEGVGPCAVSDLLSSRRDAGAR
A0A1Q7J2X5      ------------------------------------------------------------
A0A2V7NPD1      ------------------------------------------------------------
A0A2V7QPD8      SLAVAAGTRPAPRCIRLRE---------AVHRFAACGRCGLRAARYRTCH---------G
A0A2V7Q8M6      S--CGAGRPRSER-TKLHPFFGC-----DCTELRHQLNRSAGRARYRTCHTLSRDETQFS
A0A2V7QBC3      R--IGQQRPRASRATPFRPHQGASVPPGDCTELRHQSHRSAGSARYRTCHTSSANEPQFS
A0A2V7LMU1      Y--SRRHRPNAPRCIRYGAL--------IALNCGISADG-LRRRTGIGLATCSAHDTTLC
A0A2V7PBY9      E--GQRRYPSRTKVHRRDVH--------PCTQLRHGGGR-LGVARGIGLAVRRWDDTHRA
A0A2V7J4D7      ------------------------------------------------------------
A0A2V7LN90      ------------------------------------------------------------
A0A2V7LFN9      ------------------------------------------------------------
A0A2V7MEK4      ------------------------------------------------------------
A0A2V7EU00      ------------------------------------------------------------
A0A1Q6WE01      ------------------------------------------------------------
A0A2V7S9K3      ----------------------------------MSLAGTSTCCRRTTAYASSPRRAVRQ
A0A1Q7DXB9      ------------------------------------------------------------
A0A1Q7JD32      ------------------------------------------------------------
A0A2V7MVP8      ------------------------------------------------------------
A0A2V7N0A9      ----------------------------------MQMRPTAFRGRRRRPRWYRACSAALV
A0A1Q7DLS9      ------------------------------------------------------------
A0A1Q7JK96      ------------------------------------------------------------
A0A2V7KQV7      ------------------------------------------------------------
A0A1Q7JGF6      ------------------------------------------------------------
A0A2V7SG67      ------------------------------------------------------------
A0A1Q7GIK9      ------------------------------------------------------------
A0A7W0YSQ1      ------------------------------------------------------------
A0A3M2BLV5      ------------------------------------------------------------
A0A2V7KS68      ------------------------------------------------------------
A0A2V7N4L3      ------------------------------------------------------------
A0A1Q7AZK2      ------------------------------------------------------------
A0A1Q7TNP7      ------------------------------------------------------------
A0A1Q7KG39      ------------------------------------------------------------
A0A1Q7GX75      ------------------------------------------------------------
A0A1Q7LL80      ------------------------------------------------------------
A0A2V7PFU2      ------------------------------------------------------------
A0A2V7MFS9      ------------------------------------------------------------
A0A2V7T933      ------------------------------------------------------------
A0A841GX23      ------------------------------------------------------------
A0A7V9AJ94      ------------------------------------------------------------
A0A7Y3MYM3      ------------------------------------------------------------
A0A848XLS5      ------------------------------------------------------------
A0A7V9FIM2      ------------------------------------------------------------
A0A7W0WMB8      ------------------------------------------------------------
A0A2V7P8B1      ------------------------------------------------------------
A0A7C2QQS2      ------------------------------------------------------------
A0A2V7QN41      ------------------------------------------------------------
A0A2V7R603      ------------------------------------------------------------
A0A7Y5VC49      ------------------------------------------------------------
A0A2V7LJS2      ------------------------------------------------------------
A0A1Q7GLJ7      ------------------------------------------------------------
A0A2V7GRE3      ------------------------------------------------------------
                                                                            

A0A838NTH4      ADRGEPEPGASRTSEMQQDERAKEESRSALVVAATRSQPRNSDMRGPGGMPDPGLTFAQA
A0A2D5ZJF2      ----MITTRDRATTRGTPCRTPRTIWCGPSWHPSIRHPRKVIMSRMGSQATGEGNGSQAA
A0A0S8H9P3      ------------------------------------------------------------
A0A1E4BBP7      -------------------------MSANLVPSAANAAAVPRQDGFAPMPQWGGAPSAPP
A0A3M2G737      --------------------------------------MYFGRMVPSDSAPKLQAPISTS
A0A0H4TUX7      ----------------------MNLRSGTWSHSLSFLSSATTWENRLDAVRRPEGTEALR
A0A1G0LUG0      ------------------------------------------------------------
A0A1Q7E3T7      ------------------------------------------------------------
A0A1G0L906      ------------------------------------------------------------
A0A1G0LCC0      ------------------------------------------------------------
A0A2D5ZJE2      -----------------------------------------------------------M
A0A3M2G624      ---------------------------------------------MYFGNGKNYPVEVTT
A0A6M4IRY1      --------------------------MSGQQIQPVTTRENALDNFQDGAPPADWGGGQ-D
A0A3D4VBZ5      --------------------------MSGQQIQSVTPQAVALEPYQEGTPPGDWGGGTAE
C1A5W1          --------------------------MSGQQIQSVTPQAVALEPYQEGTPPGDWGGGTAE
W0RI74          ---------------------MSANLPPLPAGSDAPLPVPAAEHALQPYDPAAYAPPAAP
A0A3M2BJA6      -----------------------------------------------------MEKPTFE
A0A7Y5QXY3      ------------------------------------MFMTPDPTNAPLDESVDLASVAPS
A0A2V7PX99      --------------------------MSNSPSWPVERAGPEVALQPVPDRGTAAAHGRAY
A0A2V7ERC7      -------------MPPLILPPRKSLMSVRLTPSPETPPPFTGAPYGAFPGNTGPSTGPAV
A0A7V9QLH4      ------------------------------------------MSLPVRHYTQPLAILEPR
A0A7Y4RSP8      ----------------------------------------------------MTQAGLGP
A0A838W6Q3      -----------------------------------------------MQHKLSSPHERAA
A0A7V9U4Z2      ---------------------------------MSDLVPFSARGSSRTPPENLDLQAPDD
A0A5Q4D6Y4      -------------------MSNLVPRDPIPGHPQGLIGGAAPHGYADQGGARGGSWPNGQ
A0A7Y3MUW4      ----------------------------------------------MTNDELRPYPTTGP
A0A848XQ54      ----------------------------------------------MTNDELRPYPTTGP
A0A7V9QB34      -------------------------------------------------MSDPKLLPTVR
A0A2V7JTZ5      ---------------------------MSVRSLQPDYPLAPHHPGSIPTAEWTPARPRSE
A0A3D4YTR6      -----------------------MLLRTRVYPSPSDFAIAPSNAGSPSPAPYKGGPQRMD
A0A7V8VRF0      -----------------------------MRLTNFPTGPESVPPALPAPSLPPLHSFDQS
A0A2V7F1M1      ---------------------MSSQRGAQLMSELLPEPTPLRLTGPPGSLRPSRDGGGRS
A0A841GJ36      -----------------------------------------------MISKATPPRLTTE
A0A838NJX4      --------------------------------------MRPAPHDRQLPGSFEPHMRPVE
A0A2V7KXK7      ---MRDGERHRACVAHPCMEPKEPHEMSGSNGEGTRIPVLRSESSLDTIRMKSLTTPSAP
A0A651HKD3      -----------------------MSDRERFDLTPHGGTGVPSEHARQSTPGVHAGDAGHG
A0A843T4K9      ----------------------------MSNNPPMVPVQGSGGVPDEWQEIPMGGPAESA
A0A2V7QDU7      -----------------------------------------MSHDVTHSQGLRSPSLDGA
A0A6J4M9S2      -------------------------------MPNLVKAEARGYPAPPVLYSESRPGPGRG
A0A2V7ITT6      -----------MACRPPPRPSPRSKDPVPSIEPPQPPPDGFPEVWSGSPFRGAQPVPSAF
A0A2V7NJW1      RRGAGRYQDCGIACRPPPRPSPRSKDPVSSIEPPQPPPDGFPEVWSGSPFRGAQPVPSAF
A0A7V4KNE3      --------------------MSDAQLPVPVSAGDRGIPVPAGYPRYTPTF---------G
A0A7Y5PAU0      --------------------------------MAEEEASYEVVPAVAGGAPVAAQGWGDE
A0A7V9TKH4      --------------------------MTAPQFPSNLPVEPNREPTSVAYGQNYQPTWAQQ
A0A2V7GFB5      ----------------MERQLPERVDPAVLG--APRPWAAEEV----------------A
A0A2V7RQ86      ----------------MERQLPERVDPAVLG--APRPWVAEEV----------------A
A0A2V7IWX2      GDPWSRDVESRAIRFALDMAHEGPSLPEPARLDAIAATPRSRAPTRYEQLPRL-------
A0A1Q7KE95      ------------------MRIAVSAYPPSNG--TPVPADQLAAPFGAGRGGRLEE----S
A0A1Q7T8X5      ------------------MRIAVSAYPPSNG--TPVPADQLSAPFGAGRGGRLEE----S
A0A2V7MS64      ---------------------MIGELPSP------RPENDPRTTTTVIQPHGTRPVSIAS
A0A2V7Q7N9      PPLVPTLRCWEPVNQETLRGMTTGDLPVPFE--PTRAE----------FVARNRPPP--P
A0A2V7IRW6      ------------MKKSPETDMDTGDLPARLD--PVQPERLPSPAGSFDAIARYAPPAAGA
A0A1Q7DVU6      ------------MKESPETDMETGDLPAALD--PERPERLPSTAAPFDTIARYAPPAAGA
A0A1Q7JSV2      --------------------METGDLPAALD--PERPERLPSTAAPFDTIARYAPPAAGA
A0A2V7FK98      RRDAAPTGRSPANTVEVRVPMSTSPLPFHSG--STVPAVAPAAPPPMGADMGFGQ----G
A0A2V7R3Z8      RGDAAPPGAAPPTHVEVRFPMSTSPLPLHAG--ATVPAVAPSAAPPMAADLGFSQ----G
A0A2V7J3C0      ------------------------------------------------------------
A0A2V7KWV9      ----------------------MTDLPSAPRSQLPARPALSSIDLAA-------------
A0A1Q6ZHP2      --------------------MTISNLPAPLG---PAPMAAPGMPQRG--ISVFD------
A0A1Q7R6Z6      --------------------MTISNLPAPLG---PAPMAAPGMPQRG--ISVFD------
A0A2V7FYT7      --------------------MTISNLPAPLG---PAPMAAPGMPQRG--ISVFD------
A0A2V7IGR0      --------------------MTNSDNHAALARLPPSSDAGAALQPAA--LSLVEP----G
A0A2V7MR23      --------------------MTISNLPAA-L--VPPAATPPALPQRG--VSPF------D
A0A2V7L1V3      --------------------MTMSHLPLPPG--STPPVMVPPSAPPA--TTGW------G
A0A1Q7E5D3      --------------------MTTSNL-LAPL--APPPAVAPVAPSCA--VAES------G
A0A2V7ISE2      HDAARPARRNRPYRSIGNGSMAFSNLPAAPL--VPPPVVAPGTPHRG--MTEF------D
A0A1Q7J2X5      --------------------MTLSNLPAAPL--VSPPVVAPGTSHRG--VTEF------D
A0A2V7NPD1      --------------------MAFSNLPAAPL--VPPPVVAPGTPHRG--MTEF------D
A0A2V7QPD8      KTRRRATRRGPANTVEVRFPMSTSPLPLHAG--STVPAVAPAAPLPTGADMGFGQ----G
A0A2V7Q8M6      EASPRATPRGTRS-------MSMSHLPLPPG--STAPVMVPPSPPPP--TAGW------G
A0A2V7QBC3      EATPSATWRGTRS-------MTMSHLPLPPG--STSPVMVPPSPPPP--TTEW------G
A0A2V7LMU1      GATPRATRRGTPS-------MTLSHLPLPPS--SPPPVIVPPSSKSL--STEW------G
A0A2V7PBY9      PLRRALPTRGLPS-------MSISRLPIPHG--APPPAAAPPPAPPAVPGTYA------G
A0A2V7J4D7      --------------------MMPGESIARFRSTA----------PTVAGPFEDPNPP---
A0A2V7LN90      --------------------MTTGDLPVPFEPVRTE---VVARYPPPPLRPDS-EPL---
A0A2V7LFN9      --------------------MTTGSLPARLDTPKAEDRNAVAR-PAPALPPDAGDWL---
A0A2V7MEK4      --------------------MTTGSLPARLDTPKAADRNAVAR-PAPALPPDAGDWL---
A0A2V7EU00      -------------------------------------------MQPYGAP----------
A0A1Q6WE01      ------------------------MTEYLPGVA----ASPLVREAPLPVPARVTTAPDPV
A0A2V7S9K3      RPAVGRGSPRPGAAGGIGLAVGNRVPELLPSGA----APQLTHAVPLVAPAGNGLRLDPL
A0A1Q7DXB9      --------------------MAHEGPSLPESAR----LEAIAATPRPRAPTRYDQPP---
A0A1Q7JD32      --------------------MAHEGPSLPESAR----LEAIAATPRPRAPTRYDQPP---
A0A2V7MVP8      --------------------MAQDPLLIPESAR----VDEVAPLLERRPARPYAEPP---
A0A2V7N0A9      PNAGPEPAPRPSPGKFETHTMPSQLTVPPQEGTPDRRL---GAAAAAAGPVRRSEAA---
A0A1Q7DLS9      ----------------MFNDLPELPPSSPETPG----------RATVPAPARRRSPP---
A0A1Q7JK96      ----------------MFNDLPELPPSSPETPG----------RATVPAPARRRSPP---
A0A2V7KQV7      --------------------MASDATLPPNQPA--------------LVPFQTGFQA---
A0A1Q7JGF6      --------------------MPSDPTADPEQSAPDRRLVLAAATAARLAPRRDEAPP---
A0A2V7SG67      --------------------MPSDPTADPEQSAPDRRLVLAAATAARLAPRRDEAPP---
A0A1Q7GIK9      -----------------------------------------MVTSTLVVPARPKGPSVYP
A0A7W0YSQ1      ----------------------------------------------MSEYSDELQPEASA
A0A3M2BLV5      ------------------------------------------------MDRQPDLRPPLD
A0A2V7KS68      -----------------MLIRHMMTSRHLPALRSDTASPARAERASVSTRALRPE--AAA
A0A2V7N4L3      -----------------------MTPSPFPLIRNQPTGSVASAAPPPSSAGLRRGSPEGP
A0A1Q7AZK2      ------------------------------------------------------------
A0A1Q7TNP7      ------------------------------------------------------------
A0A1Q7KG39      ------------------------------------------------------------
A0A1Q7GX75      ---------------------------------------------------------MAG
A0A1Q7LL80      ---------------------------------------------------------MAG
A0A2V7PFU2      -----------------------MNPRPLPAIRSQSA-PVLRRANASAA--------PSL
A0A2V7MFS9      -----------------------MNPLPLPAVRGQTAAPALRRASPPHT--------PSL
A0A2V7T933      -----------------------MTPRPLPAIRGQSAPAVLRRGGTSDR--------TSL
A0A841GX23      -------------------------------MSDIVPRQDRPYPEAVAAAPVLRSMPVLD
A0A7V9AJ94      -------------------------------------------MTDKLAPISPARAGDPI
A0A7Y3MYM3      -------------------------------------MANHLVPHQPSNVPGRVRAVSSR
A0A848XLS5      -------------------------------------MANHLVPHQPSNVPGRVRAVSSR
A0A7V9FIM2      -------------------------------------MPPLPPHRQLPGGFEPTPMRPVE
A0A7W0WMB8      -------------------------------------MP--PNNRLLPGHIEP-PLRPIE
A0A2V7P8B1      -----------------------------------MTRVTEPLPSDSRAASGPFAEREEV
A0A7C2QQS2      -------------------------MTDLVPSRGSGGSLPQGVDSDGRGASTVPAYVDYV
A0A2V7QN41      -------------------------MSRERSRLPEVASVDGTWLRAPAPSTADVASRTGP
A0A2V7R603      ----MRRSVASPAAPRYPPCSADLAMSRERSRLPEVASVEGAWMRAPALPAGDVVSRAGA
A0A7Y5VC49      --------------------------------------MSDHLDRATTNPPDATPGREPY
A0A2V7LJS2      --------------------------------------MSQPHPNDARAASDSVADRGEL
A0A1Q7GLJ7      --------------------------------------MSEQLRSEPPAPSRRLADRADP
A0A2V7GRE3      --------------------------------------MVEP--SNRPAASSFHGDR-EP
                                                                            

A0A838NTH4      TQDQDDHLSFRQLTRTVRRNRWLVLGITLATIASATV-YN-RLADPIYQSSATIRIDDKD
A0A2D5ZJF2      PAGLSPEITPPGLLEILWRRRWIVTLVTLASIVGAFI-YL-MKATPIYTSTSRIYVEQSG
A0A0S8H9P3      -MGRYERTHLEDYWRVVRRRAWLILLTALVALLAATW-AA-SRRPRLYRATLTLQVGDPR
A0A1E4BBP7      PSQGGVGDQLARTLAAIKRYKWLVLAVIAVGSTAGVT-LT-RFVKPKYDVSASIWIAATP
A0A3M2G737      NGAYHSENPIHEYFQIIVRGRWIILVVFTLVMAATMIYVLRNKPRLVYSTTATIALKNKS
A0A0H4TUX7      RIVHQREVHLRDLVGVVSRHWRLVALLTVLVAGGAWY-SA-RRQVPRYQSRLTVQVSSPK
A0A1G0LUG0      --MHQREVHLRDLVAVVTRHWRLVAAVTAVLVGFSWY-NG-RNQVARYQSQLTVQISSPR
A0A1Q7E3T7      -----MRVNLRDPLAVVRRHLWLVLGMTAV--VGGIVGYRAYAAVPSYRAIAVIRLSDPR
A0A1G0L906      -------MHLRDLAQVLFSHWKVVVFLTVLVVFSTSY-AS-RKAVPRYQSSATVQVSSKK
A0A1G0LCC0      -------MHLRDLAQVLFSHWKVVVFLTALVVFSTSY-AS-RKAVPRYQSSATVQVSSKK
A0A2D5ZJE2      DEHQAHGVTLADYVRIIWSRKWMVGLVATAVLAFTIF-FT-LRMQPVYESQTTLLIEPQD
A0A3M2G624      SSYLEADFDVRKYVRMLWRRRYIVLLLFVLIFGFSTYRALTQKVTPVYRSTVYLEVDEKE
A0A6M4IRY1      ATPEPKGPSLARYVGAVNRFKWLILLFGVLGGAGGYA-AT-KFIEPEYEVKATILLEQGT
A0A3D4VBZ5      GAPEPKGPSLRRYLAAVNRFKWLVLVFAILGGAGGYA-AT-RFIEPEYEVQATILLEQGT
C1A5W1          GAPEPKGPSLRRYLAAVNRFKWLVLVFAILGGAGGYA-AT-RFIEPEYEVQATILLEQGT
W0RI74          ADEAGGALSVGRFMAAMSRYKWLVAALVVLGLGGGFV-AT-RFIDPEYEVNATIFSSGSG
A0A3M2BJA6      GGYVDDEISLRDIWNLLRRNQWLIFLCVLLVTGGAAA-YS-YFAVPVYESATTIRIEEER
A0A7Y5QXY3      QESGAAGLTPREVLGVIRRRWILIATAFAVVTAIGAW-RT-VRQPRIYEATATVRFQQPT
A0A2V7PX99      EPPTPEPSDWQRMLAAAMRRRWLVILVTLAGTAAGVI-GS-RFLDPRFAARAVLWIEAAG
A0A2V7ERC7      VLQESEGVQWGRYFDVLKRHALLIVLLVAVGTVWGLN-AA-RQVRPDYETQATIWINGAR
A0A7V9QLH4      RPAKSDELRLDDMWRMLQRNVVLIAACVIACATAAWI-YV-HYARPVYEANALFDINGQR
A0A7Y4RSP8      ALDDPGSGKFLRIFSAIRRFAWLIVLVTVAGATVSVL-AT-RMIEKEFEVSGTIYIKNDR
A0A838W6Q3      TPDHGNGNLWVETWPVLRRRKLLILGCGIVALVAAQL-ST-GRGTPEYQAVASIRVDERQ
A0A7V9U4Z2      QKSATEFVGVREYFGMVRRHWYVVLGILFVSTAYTAN-QT-MKERPYYRASSTVRLVDSR
A0A5Q4D6Y4      PPPPNDSIELSELLQILRRRIWLILACVLVGGALA-W-GVHEIREPRYRATAVIQIEDPR
A0A7Y3MUW4      TAQGGLAPHLMDYWYVVSRHLGLVITALVVTLALSVY-AL-TRKATYYQADVTLQISDPM
A0A848XQ54      TAQGGLAPHLMDYWYVVSRHLGLVITALVVTLALSVY-AL-TRKATYYQADVTLQISDPM
A0A7V9QB34      STDRDEEIELSRLWYAVLRQRWLVLGVTALAIVAGGL-LA-AFQPPTYRSEATLHIQQDK
A0A2V7JTZ5      DFEDAEGIPWSRYVDAIRRHVLLIVGLAAVGSVLGVV-AA-RRVRPIYEAQATVWISTTP
A0A3D4YTR6      GPSDSEGIPWSRYIDAISRHSLLILAIALLGSLVGLY-AA-RQVRLSYDADATIWINTTP
A0A7V8VRF0      GSRAAGDLALRDIVAALRRRYRLVLAVAVFTTAAAAF-LA-LNEAPTFTASAVIQVSETR
A0A2V7F1M1      ADSAEIRTDFKQLLMLLRRRIGLVAGIAALIVFVVAL-FV-VLERPVYRSTATVRLAYPR
A0A841GJ36      GDDPGQDISLREVWGTVVRHRILIALTALALVVAAGI-YT-WMQVPAYQSVVTLRIDESN
A0A838NJX4      SPDTAGVISFRQALAVVRRRFQLILAVTACGAALGFF-VA-SREPTSYKASAMLRLAGER
A0A2V7KXK7      PPPPAEHSDWQRYFNSVMRHKWFVIVVTLVGTALGIV-AT-RFLDPRYTAKAILWVDVAV
A0A651HKD3      EGEEPGGLDFRKLPSTLLRYKWLVLASVVLGALAASA-SM-ALTPPRYTVSALIHTPNGQ
A0A843T4K9      GGSVGGMQMLRQYLDSVWRRKWLVLLLGVLGLAGG-Y-GYSLTQMSTYTAQSTVWIEGDD
A0A2V7QDU7      PAGFLPGAGAAELVDILRRRLWSILGCTVLCVGAAVL-YV-VLARPSYRAEAAIRMDDRR
A0A6J4M9S2      ESDAEESVSLRDILAILRRHVALIAAIAAVVLALTAW-LV-LRQPPVYQATAQIRLADVR
A0A2V7ITT6      RPEHDGVHDWQQYRGAVARYKWVVVLVSTVGTLIGVA-AT-RFLRPEYEVQATIWIESHD
A0A2V7NJW1      RPENDGVHDWQQYRGAVARYKWVVVLVSTVGTLIGVA-AT-RFLRPEYEVQATIWIESHD
A0A7V4KNE3      DEGEGSGLNLQRLLSALRRHLWLVAVVTILATAAGVL-VA-RFIPPTYTVRATVWVERDE
A0A7Y5PAU0      PSLAPARSPLERPIAAIRRYKWLLLGTVALAVLGGVV-AT-RLVQPEYEVRATIWINSET
A0A7V9TKH4      SPMEEPGISWSRYFSALKRYKWLILLVVIAGTGIG-F-GVTQFMTPAYQTQGTVWISEDG
A0A2V7GFB5      TTSPEGALDWRRIAQVVTRFKWLVFGITVAGGAAG-F-AATKVVRPQYLTQVTVFIDQPD
A0A2V7RQ86      TTSPEGALDWRRIAQVVTRFKWLVFGITVAGGAAG-F-AATKVVRPQYLTQVTVFIDQPD
A0A2V7IWX2      --LPAAEPDWRRILGAIGRRRWVVLAVTLLGTAAGVV-AAAKFVGPRYLARARLWVGAAE
A0A1Q7KE95      GAGLVQPTDWRRHGATALRYRWWILGLAALGTLGG-T-AAGRLLPPRYQVQATIWIQSSE
A0A1Q7T8X5      GAGLVQPTDWRRHGATALRYRWWILGLAALGTLGG-T-AAGRLLPPRYQVQATIWIQSSE
A0A2V7MS64      AQEPPPLAQWPRYVSAALRYKWLVVGATLVATAAG-V-GASFLLAPEYVARATVWISIS-
A0A2V7Q7N9      PPDPEPLAEWQRYLLAARRYRWLVFGVTLLGTAAG-I-GLSLLLPPTYLARATVWVQVPS
A0A2V7IRW6      PQDGDVLADLRRYLSAVWRYKWAVTGITVLGTAAG-V-AGKMLLPPNYVARATVWIQVP-
A0A1Q7DVU6      PRDADALAELRRYLSAVWRYKWAVAGVTVLGTAAG-V-AGKMLLAPSYVARATVWIQVP-
A0A1Q7JSV2      PRDADALAELRRYLSAVWRYKWAVAGVTVLGTAAG-V-AGKMLLAPSYVARATVWIQVP-
A0A2V7FK98      FAQPETGVDWRRVLSAVARFKWLIAVVTIVGTVGG-L-AATRFIKPQYMVQATLWIDQPD
A0A2V7R3Z8      FAQPETGVDWRRVLSAVARFKWLIAVVTIVGTVGG-L-AATRFIKPQYMVQATLWIDQPD
A0A2V7J3C0      ----------------TRRYRWWVLALTGVGILGG-I-LAGRLLPPRYQVQATIWIQSSE
A0A2V7KWV9      --DSGGAPDWRRHGTAVWRHRWWILGLTVLGTIGG-V-GASRVLPPRYLVQATIWIQSSE
A0A1Q6ZHP2      LDGRESGVDWRRILSALLRFKWLIATTTLVGTIAG-V-GATRFLKPQYSAQAKIWIDVEG
A0A1Q7R6Z6      LDGRESGVDWRRILSALLRFKWLIATTTLVGTIAG-V-GATRFLKPQYSAQAKIWIDVEG
A0A2V7FYT7      LDGRESGVDWRRILSALLRFKWLIATTTLVGTIAG-V-GATRFLKPQYSAQAKIWIDVEG
A0A2V7IGR0      FSEVEGALDWRRVWSAVVRFKWLILAVTLLGVAAG-G-AATRFLKPQYLVQATIWIDQAD
A0A2V7MR23      LDGPEGGLDWRRILSALLRFKWLIATFTLVGTVAG-V-GATRFIKPVYSAQAKIWIDVEG
A0A2V7L1V3      GPESEGGVDWRRVYSAVMRFKWLICAVTVLGTVAG-F-GLARFVRPQYGAQATIWIDATE
A0A1Q7E5D3      FPGLDDGLDWRRVLSALLRFKWLIAAVTLAGTAAG-V-GATRFLTPEYVAQATVWIDGPD
A0A2V7ISE2      LAGSDSGLDWRRILSALLRFKWLIAGFTLVGTVAG-V-GATRFLKPEYAAQAKIWIDVEG
A0A1Q7J2X5      LAGSDSGLDWRRILSALLRFKWLIAGFTLVGTAAG-F-GATRFLKPEYSAQAKIWIDVEG
A0A2V7NPD1      LAGSDSGLDWRRILSALLRFKWLIAGFTLVGTVAG-V-GATRFLKPEYAAQAKIWIDVEG
A0A2V7QPD8      FAAPETGVDWRRVLSAVLRFKWLIAVVTIVGTVGG-V-AATRFIKPQYMVQATLWIDQPD
A0A2V7Q8M6      GADSEGGVDWRRVFSAVLRFKWLICAVTVLGTTAG-F-GVARFVRPQYGAQATIWIDATE
A0A2V7QBC3      GADSEGGVDWRRVFSAVLRFKWLICGVTVLGTTAG-F-GVARFVRPQYGAQSTIWIDATE
A0A2V7LMU1      GAESEGGVDWRRVLSAVLRFKWLICGVTILGTAAG-F-GVARFVRPQYGAQATIWIDATE
A0A2V7PBY9      FAEPEGGVDWRRVVSAVMRFKWLICGVTFLGTLAG-F-GAARFVKPQYGAQATIWIDASE
A0A2V7J4D7      -------PDWWRYVAAIRRFKWLVLGVTVGATALGVV-GTMF-LRPTYAAQATLWIQVPA
A0A2V7LN90      -------AEWRRYLMAARRYRWMVLGVTLFGTAAGVG-LSLL-LPPTYLARATVWIQVPS
A0A2V7LFN9      -------ADAQRYLRSVRRHKWLVLSLTLFATAAGIE-LSVYALPPNYAARATVWIQVPA
A0A2V7MEK4      -------ADAQRYLRSVRRHKWLVLSLTLFATAAGIE-LSVYALPPNYAARATVWIQVPA
A0A2V7EU00      ATPDDAAVDWRRYWAAIVRYRWWVVLCTALGLVGGFV-AA-SVLKPQYRAQATVWIDVAK
A0A1Q6WE01      ASPFEQGVDWRRCWGAVRRHRWWILGCAVLGTAGGVV-GA-RMRPPRYQAQATIWIQAGE
A0A2V7S9K3      AAAGEPFLDWRRSWAAALRYRWWVVGFMGLGVLGGLA-AS-RFLPPRYLAQATIWIQTSE
A0A1Q7DXB9      RLLPAVEPDWRRIFGAIRRRRWVVLGVTLLGTVAGVV-AAAKFVGPRYLARARLWVGAAE
A0A1Q7JD32      RLLPAVEPDWRRIFGAIRRRRWVVLGVTLLGTVAGVV-AAAKFVGPRYLARARLWVGAAE
A0A2V7MVP8      RPLAAGEPDWHRILGAIRRRRWLVLAVTLLGTAAGVV-AAVRFVGPRYLARARLWVGAAE
A0A2V7N0A9      ----PLPDDWRRVVAAIGTYRWFVVAVTAAGTLVGAV-AA-HFLKPTYQARATVWVEVPN
A0A1Q7DLS9      MVEAAPDVDWGRYRTAIWRFRWWVLLITLLGTAAGVG-AS-RIVRPVYVARATIWIEGAN
A0A1Q7JK96      MVEAAPDVDWGRYRTAIWRFRWWVLLITLLGTAAGVG-AS-RIVRPVYVARATIWIEGAN
A0A2V7KQV7      AAAPAPMSDWARVFAAARRYKMLVATVTVVGSLAGLV-IG-KFLKPVYQAQATIWIQSSE
A0A1Q7JGF6      ------PEDWRRVVTAIRTYRWLVIAVTGVGTLAGII-GA-RFLKPTYQARATVWLEIPD
A0A2V7SG67      ------PEDWRRVVTAIRTYRWLVIAVTGVGTLAGII-GA-RFLKPTYQARATVWLEIPD
A0A1Q7GIK9      AVVPAGPDDWRRVFAAMRTSRWLILAVTAVGTLAGIV-GS-RFLKPTYEARATVWLEIPD
A0A7W0YSQ1      SREPDRALAVRNAIAAIRQRWWLVLGVFAVIVATSIW-RT-SRETRLYQSSAVIQIDEE-
A0A3M2BLV5      SELLSASPHLSDYIQVVTRRLWLVLLIFAVTTASAIW-AV-SRQKTLWRSEMAVQVTDPL
A0A2V7KS68      FPDDEHGPDWRRVGSALLRFKWLVLAALLAGLAAAFG-AT-KVLRPAYKAQANVWVDVPG
A0A2V7N4L3      PEGHEAGPDWHRIASALLRFKWVVILAVLLGLGAAFA-AT-RVLRPVYRAQANVWVDVPD
A0A1Q7AZK2      ---------------MLLRFKWVVILMLALGLGAGFA-AT-RVLRPVYRAQANVWVDVPD
A0A1Q7TNP7      ---------------MLLRFKWVVILMLALGLGAGFA-AT-RVLRPVYRAQANVWVDVPD
A0A1Q7KG39      ---------------MLLRFKWVVILMLALGLGAGFA-AT-RVLRPVYRAQANVWVDVPD
A0A1Q7GX75      LDDEESGLDWRRIVSALLRFKWLVLLAVALGLGGGFA-AT-RKLPPVYSAQANVWVDVLD
A0A1Q7LL80      LDDEESGLDWRRIVSALLRFKWLVLLAVALGLGGGFA-AT-RKLPPVYSAQANVWVDVLD
A0A2V7PFU2      PE-AESGPDWRRLASALLRFKWIVLLMVLLGLGGAVA-AT-RLLRPIYRAQANVWVDVPD
A0A2V7MFS9      PDGGEPGPDWRRIASALLRFKWLLVLTLTMGIGAAFA-AI-RLLRPVYRAQANVWVDVPD
A0A2V7T933      PE-EEAAPDWRRIGSVLLRFKWVVILMLALGLGAGFA-AT-RVLRPVYRAQANVWVDVPD
A0A841GX23      GYPVSEGIPLGEYLAALRRYAWLIALAVALSLGFATY-RI-KRELPRYAASSSVQLVNPR
A0A7V9AJ94      AHTGNEEIELRRFGDALRRNRWVVLGTTAVMVGAAAL-FA-ALQRPVYESEATILIAEER
A0A7Y3MYM3      PLDDPSKNEIGTLFEALRNHWWLVLASGALALFAGWW-GQ-RNQLPEYTAEVLLQHSQDT
A0A848XLS5      PLDDPSKNEIGTLFEALRNHWWLVLASGALALFAGWW-GQ-RNQLPEYTAEVLLQHSQDT
A0A7V9FIM2      YAEVSGTVSFRQAFTMLRRRYLLILGMTVLGTTIGLF-LA-SRTPATYQASAMIRLAGER
A0A7W0WMB8      TVDASGSVSFRQVFTVLRRRYQLILAMTLAGATLGLF-LA-SREPATYRANAMLRFAGER
A0A2V7P8B1      EASAST-VRLEDLFATVRRHIWLVLGVAAGVVAAAGG-VA-YVTGSVYRAVAVIRLSDPR
A0A7C2QQS2      DLDRDDEIDLRELLLLLRRRWRTVLGVTALIVAAAAW-WV-LRQRPVYEADATIRLKDER
A0A2V7QN41      PGE----TDWQHYFGAVRRRKWTVIGVTLLGTALGLF-AS-RLLHPPYSATALLWFETKD
A0A2V7R603      PGE----TDWQHYIGAVRRRKWTVIAITLLGTALGLF-AS-RLLHPPYSATALLWFETKD
A0A7Y5VC49      AAADRSGIPWERYVAALRRRRLLVGGIVLGALLLGAL-AT-RYFRPTYEVHSTIWLSSAG
A0A2V7LJS2      DAPVST-VRLDDLFAVLRRHIRLVLGVTAAAMMAAGY-VA-YVTGSVYRAVAVIRLSDPR
A0A1Q7GLJ7      EAFVHT-VGLEELLSTLRRHVWLVLGVAAVAVAATGF-VA-YTTGPVYRAVAVIRLSDPR
A0A2V7GRE3      EVSVRT-VRLEELLAILRRHVRLVVGVVVATVTAAGV-VA-YVTGPAYRAVAVIRMSDAR
                                       :                       :     .      

A0A838NTH4      AGTALLTGVAAMPGLSGSK-------IQTEMEVLRSRQLAENVARKLHLNLQVLEPSGAR
A0A2D5ZJF2      PKVITEFEGVMTQSKNYLY---------TQAEIFLSTEVLRPVAE---------------
A0A0S8H9P3      GRMGQLGDIDVTPN------MLWTDPVESEVQQLTTQAVAQYVADTLQLRAR--------
A0A1E4BBP7      G---------PSGRMGPVSAPGLVNSDVAWMELARSFSVLDKVVSKLALYVY--------
A0A3M2G737      G------------NLNPYPVYRDPAKINNELVILKSRRLAETIADSLLKRVY--------
A0A0H4TUX7      QVFAQLEGMRVDEL------ALQTDPVLSEALILTTQQLALEVVRGLALHLE--------
A0A1G0LUG0      GVFSQLNDRTVDEL------ALQTDPVLSEALVLTTQALALQVVDALQLQVE--------
A0A1Q7E3T7      R---ALTGGVADGPTGDLA-GSSADPLLSQVELLTSRRVGGVVVDSMLMLRV--------
A0A1G0L906      QALTPLEAMRVDEM------SMQTDPVLSEALVLSTQALALRVVDAIGLRLA--------
A0A1G0LCC0      QALTPLEAMRVDEM------SMQTDPVLSEALVLSTQALALRVVDAIGLRLA--------
A0A2D5ZJE2      A--------GALSIFDPTGFMKQKILINNECELLRSRSLAQQVLDR--------------
A0A3M2G624      TNIRLLPQFSSVRQQSIYW----GSPEGKIIAEVLSTSVIEEVVQMLDLDKA--------
A0A6M4IRY1      G-----TNQDGANSRGPIQ-AEELLKASGWQDLLRSFAIADPVVNDLALFVT--------
A0A3D4VBZ5      G-----VNNGAG--RGPIQ-AAELLQASGWQDLLRSYAIADPVVIGLGLFVT--------
C1A5W1          G-----VNNGAG--RGPIQ-AAELLQASGWQDLLRSYAIADPVVIGLGLFVT--------
W0RI74          N-----------EKPSMIN-PAQLTGNAGWRDLFQSFAIIDPVVQKLSLYIQ--------
A0A3M2BJA6      ANLPVLDILQELSSGSQVE---------TEMEVLRSRTLAEDVVDSLNLQVE--------
A0A7Y5QXY3      P-------AVQGMSQPQVR-SFTIDPLQSEQLLIRSESVAERAATLSGLRVQ--------
A0A2V7PX99      R--------APGRDGGSIV-DEALVQTPSWGELVTSGAVLEDVVRELRLYVT--------
A0A2V7ERC7      G-----------QQAGSIG-TQQLLEQTSWVELLRSFAVVDAVVHQLKLNVV--------
A0A7V9QLH4      S-----------VEFAPTS-GPEHDQVSTEMEVLTSRTMAEQVIENLGLQLM--------
A0A7Y4RSP8      S-----------QNGGPIQ-APELLSSSNWIELLKSYAVLEPVVNKLKLYLL--------
A0A838W6Q3      S---QPPLQDVVRLSSGNSRSAVANNISTEMQMLQTRSLARSVVDSLGLRTR--------
A0A7V9U4Z2      R---AIAGGMAGSGGTESQFSGMSDPIESQIQVLMSRAVASVAVDLKGLRLI--------
A0A5Q4D6Y4      T-------QMSERLGSVDPARSGADPIRSSLEVLRSRTVLAQIVDEEGLRLI--------
A0A7Y3MUW4      E-----QSRSLTSGSGFSNSDIFVDPIQSEIELLSSSALARTVVDQAGLRLR--------
A0A848XQ54      E-----QSRSLTSGSGFSNSDIFVDPIQSEIELLSSSALARTVVDQAGLRLR--------
A0A7V9QB34      SGFDLLGGLVPAQLGLAAGLGGGGGNIQTDIAVLRSRQVAEDVVDSLALHVA--------
A0A2V7JTZ5      S-------SA--LQTGPIR-QQQLLTTGSWVELLRSFAIVDPIVRDLKLNVS--------
A0A3D4YTR6      N-------GTQQTQTGPIR-QPQLLTSVSWVELLRSFAVVDPVVRDLKLNVS--------
A0A7V8VRF0      R-----VLATGIELPTATD-DRLTSPFLSQIALLRSRTLAGTVVDSAGLRLV--------
A0A2V7F1M1      R------ALTVGVEDLPAK-DQRSDPLLSLIELLRGRGIVGAVVDSLALRLQ------PL
A0A841GJ36      S------TGSVLSSLSPVA-GLSRGKIETEMRVLQSRRVTEAVVDSLNLTLR--------
A0A838NJX4      Q------TLTGVAEEAALT-SRTTDPMLSIIELVRSRSVAGVAVDSLGLQLV--------
A0A2V7KXK7      G------------RDRGVQ-SDQLLDSRGWEELVVSNAVLDTVVKERRLFIH--------
A0A651HKD3      T------------GVTAIE-TGQRQSSLNWQNLLPSFSVVEPVVRELRLYIE--------
A0A843T4K9      S---------RAAELDPIG-SADLLQPMAWVQLLRTFSVLEPVVVERQLYVS--------
A0A2V7QDU7      Q---------PIPTLDVLA-LYRGNELSTEIEMLGSRTLAEDVVAALGLQLE--------
A0A6J4M9S2      R---AVTGGIEGAALEASM-GRTTDPLLSQLEVLKGRVVLGQVVDREGLRLRSVTPEFRV
A0A2V7ITT6      P---------RTEDRGPIR-GDQLLQASSWLQLLRSYVVLDHVVRDLRLYVT--------
A0A2V7NJW1      P---------RTEDRGPIR-GDQLLQASSWLQLLRSYVVLDHVVRDLRLYVT--------
A0A7V4KNE3      G------------ERGPIR-TSQLLASRSWLELLASYSVLDSVVEKERLYLE--------
A0A7Y5PAU0      P---------LQEQAGPIR-SHELLNAAAWVELIKSYRIADAVVRKLALYVK--------
A0A7V9TKH4      K---------GGAAQGPIQ-GQPLVTPGAWADLIKSSSIMDNVVRKYSLYIW--------
A0A2V7GFB5      P-------RGNDRG-GPIR-SGQVLDPESWIDLLRSYAVLDRVARDLRLFLQ--------
A0A2V7RQ86      P-------RGNDRG-GPIR-SGQVLDPESWIDLLRSYAVLDRVARDLRLFLQ--------
A0A2V7IWX2      P---NPNALRGTTP--PPG-AERLLGVAAWVDFVRSDAVLDTVVRDVRLYLD--------
A0A1Q7KE95      P---R---GGTSRG--PIG-ANQLFESYAWGELLKSYVVLDEVARERRLYLA--------
A0A1Q7T8X5      P---R---GGTSRG--PIG-ANQLFESYAWGELLKSYVVLDEVARERRLYLA--------
A0A2V7MS64      -----AHPAPRDQG--PIW-SGQLPISTGWTDLLRTNVVLEEVVRARQLYLT--------
A0A2V7Q7N9      G---HARDA-RDRG--PIW-QGQLPISSGWMDLLQTNVVLEDVVRRQRLYVT--------
A0A2V7IRW6      -----ARPT-RDEG--PIW-SGQLPISSGWTDLLHTNVVLEEVVRQQRLYVA--------
A0A1Q7DVU6      -----QRPT-RDEG--PIW-SGQLPISSGWTDLLQTNVVLEDVVRQQRLYVT--------
A0A1Q7JSV2      -----QRPT-RDEG--PIW-SGQLPISSGWTDLLQTNVVLEDVVRQQRLYVT--------
A0A2V7FK98      Q---R---GGQDRG--PIR-AGQPLEPEAWLDLLKSYRVLDQVVRDQRLFLT--------
A0A2V7R3Z8      Q---R---GGQERG--PIR-AGQPLEPEAWLDLLKSYRVLDQVVRDQRLFVT--------
A0A2V7J3C0      P-------RGTGRG--PIG-ANQLFESYAWVDLLKSYVVLDQVARDLKLYLT--------
A0A2V7KWV9      A---R---GTPDRG--PIG-ANQLLAPTAWGDLLKSYVVLDAVARERRLYLQ--------
A0A1Q6ZHP2      R-------RGPERGPTPIR-SGQLLDAESWVDLLESYVVLDQVVRDQRLYVS--------
A0A1Q7R6Z6      R-------RGPERGPTPIR-SGQLLDAESWVDLLESYVVLDQVVRDQRLYVS--------
A0A2V7FYT7      R-------RGPERGPTPIR-SGQLLDAESWVDLLESYVVLDQVVRDQRLYVS--------
A0A2V7IGR0      R-------RGPDRGPTPIR-SGQLLEPEAWVDLLRSYIVLDQVVREQRLFLT--------
A0A2V7MR23      R-------RSPDRSLAPIR-PGQLLDAESWVDLLRSYVVLDQVVHDQRLFVG--------
A0A2V7L1V3      R---ERWGQAQDRG--PIR-QGQLLDPQSWVDLLKSYVVLDTVVRDQRLFVS--------
A0A1Q7E5D3      R-------RGPDRG--PIR-PGQLLDPEAWVELLKSYVVLDEVVREQRLFLG--------
A0A2V7ISE2      R-------RGPDRGPAPIR-PSQLLDAESWVDLLKSYVVLDQVVRDERLFVD--------
A0A1Q7J2X5      R-------RGPDRGPAPIR-PGQLLDAESWVDLLKSYVVLDQVVRDERLFVA--------
A0A2V7NPD1      R-------RGPDRGPAPIR-PSQLLDAESWVDLLKSYVVLDQVVRDERLFVD--------
A0A2V7QPD8      Q---R---GGQERG--PIR-SGQALEPEAWLDLLKSYRVLDQVVRDQRLFLT--------
A0A2V7Q8M6      S---ERWGQGQDRG--PIR-QGQLLDPQAWVDLLKSYVVLDQVVRDQRLFVS--------
A0A2V7QBC3      S---ERWGQGQDRG--PIR-QGQLLDPQAWVDLLKSYVVLDQVVRDQRLFVS--------
A0A2V7LMU1      R---ERWGQGQDRG--PIR-QGQLLDPQAWVDLLKSYVVLDQVVRDQRLFVS--------
A0A2V7PBY9      R---ER--RADDRG--PIR-QGQLLDAQAWVDLLKSYVVLDQVARDQRMFVS--------
A0A2V7J4D7      R---QP---R--EAGPIWQ-AQLPI-STGWMDLLQSYAVLDDVVRGQRLYLH--------
A0A2V7LN90      A---RARDIR--DRGPIWQ-GQLPI-TSGWMDLLQTNVVLEDVVRRHRLYLT--------
A0A2V7LFN9      H---QA---R--DEGPIWS-GHLPI-SSGWIDLIRTNIVLEEVARRERLYLV--------
A0A2V7MEK4      H---QA---R--DEGPIWS-GHLPI-SSGWIDLIRTNIVLEEVARRERLYLV--------
A0A2V7EU00      E---RQDA----TRGPIRQ-GQLLE-ATAWVDLLQSYAVLDDVVRQRRLYLT--------
A0A1Q6WE01      P---R-GP----DRGPIGA-NRLLD-ASAWVDLLKSYVVLDDVVRDRQLYLG--------
A0A2V7S9K3      P---R-AT----DRGPIGA-NQLLE-ASAWVDLLKSYVVLDDVVRELRLYLR--------
A0A1Q7DXB9      P---DPNAIR--GTTPAPG-AERLLGVEAWVDFVRSDAVLDTVVREVRLYLS--------
A0A1Q7JD32      P---DPNAIR--GTTPAPG-AERLLGVEAWVDFVRSDAVLDTVVREVRLYLS--------
A0A2V7MVP8      P---DPNALR--GTTPLPG-TDRLLGVEAWVDFVRSDAVLDTVVRDARLYLF--------
A0A2V7N0A9      P---AARER---DQGPIET-GQLLGTATSWLDLLRSHVVLDDVVRQWRLYLK--------
A0A1Q7DLS9      E---KQP-----GPGPAGS-GDLLG-ATGWVDLVRSYVVVAAVVNDRQLYLT--------
A0A1Q7JK96      E---KQP-----GPGPAGS-GDLLG-ATGWVDLVRSYVVVAAVVNDRQLYLT--------
A0A2V7KQV7      Q---D-HDRGRADQGPIQS-AQLLGTSGGWLDLIRSHVVLNDVVREARLYLA--------
A0A1Q7JGF6      Q---SAHER---DQGPFQS-GQLLGTATGWLDLLRSHVVLDDVVRQWRLYLK--------
A0A2V7SG67      Q---SAHER---DQGPFQS-GQLLGTATGWLDLLRSHVVLDDVVRQWRLYLK--------
A0A1Q7GIK9      E---ASHAR---ERGPIES-GELFPTATGWLDLLRSHVVLDDVVRRWRLYLK--------
A0A7W0YSQ1      ------QGPVAAQTAPTPG-SWRIDPMLSAQEIIKSKEIAERVARDLGLQLV--------
A0A3M2BLV5      E----RARSLTSPTRVSGM-DIFVDPMQSQIEVLQSRSIAERVADELGLRLR--------
A0A2V7KS68      R----AEGDRSADNRGPIR-TAALLEADDWIELLRSYIVLDQVVRDLRLYLT--------
A0A2V7N4L3      R-----RGENPSDARGPIR-QGALLDADAWVELMRSYVVLDQVVKDQRLYLE--------
A0A1Q7AZK2      R-----RGNGSSDARGPIR-QGALLDADAWVELLRSYVVLDQVVRDLRLYLK--------
A0A1Q7TNP7      R-----RGNGSSDARGPIR-QGALLDADAWVELLRSYVVLDQVVRDLRLYLK--------
A0A1Q7KG39      R-----RGNGSSDARGPIR-QGALLDADAWVELLRSYVVLDQVVRDLRLYLK--------
A0A1Q7GX75      R-----RGEGGAEARGPIQ-QRALLDEDAWVELLRSYIVLDQVVRDLRLYLA--------
A0A1Q7LL80      R-----RGEGGAEARGPIQ-QRALLDEDAWVELLRSYIVLDQVVRDLRLYLA--------
A0A2V7PFU2      R-----RGDPHADTRGPIR-QGALLDADAWVELLRSYVVMDQVVRDLRLYLD--------
A0A2V7MFS9      R-----RGEGPSDARGPIR-QGALLDADAWVELLRSYIVLDQVVRDLRLYLE--------
A0A2V7T933      R-----RGNGSSDARGPIR-QGALLDADAWVELLRSYVVLDQVVRDLRLYLK--------
A0A841GX23      Q---QLAPATAQGQAQDVA-GWYTDPVLSQIQVLRSRAVAAEVVDSLGMRLQ--------
A0A7V9AJ94      PGLDILRGMLPAGLGAMAG-LSGRSDLQTDVLVLRSRQVAEGVVDSLGMRVV--------
A0A7Y3MYM3      E---MAIFGLGAQSGTDYG-TR--------LEIIRSRAVMGRVVDSLGLQVR--------
A0A848XLS5      E---MAIFGLGAQSGTDYG-TR--------LEIIRSRAVMGRVVDSLGLQVR--------
A0A7V9FIM2      Q---TLTGAEEAAP--VLG-R-TADPLLSIVELLRSRAIAGVVVDSLGLQVA--------
A0A7W0WMB8      R---ALTGDQEQTP--AGS-KSTADPLQSILELVRSRAVVGVVVDSLGLQLH--------
A0A2V7P8B1      R---AFTGGVVEDPALLAD-GRYADPLLSQVELLKSRTVAGGVVDSMPMLRVLLRKASPS
A0A7C2QQS2      G---ALTGVLEQRVPEEIL-GRQSDPLLSKMEVLKSATIVGGVVDRLGLRAS--------
A0A2V7QN41      R---AAAA---RDPRTASE-ADELLNPSGWIDLVESNAVLEEVVRQRRLYLR--------
A0A2V7R603      R---AAAG---RDPRTASE-ADELLNPSGWIDLVESNAVLEEVVRQRRLYLR--------
A0A7Y5VC49      P---APRVGENAHPGGTLA-AT------AWAELLRSYSVLDPVVDELSLFVM--------
A0A2V7LJS2      R---AFTGGVVDDPALLAD-GRYADPLLSQVELLKSRTVAGGVVDSMPMLRVVLRKSSPS
A0A1Q7GLJ7      R---ALTGGVVEDPGPSAD-ERFADPLLSQVELLTSGTVAGAVVDSVPMLRV--------
A0A2V7GRE3      R---ALTGGVVLDPA-RAD-ERFSDPLLSQAELLTSRAVAGAVVDSMPALRM--------
                                                      :                     

A0A838NTH4      RFVRIVDMPSDVARLEVVL--------TRQGASSYVIVPEGNGAH-----------IGVP
A0A2D5ZJF2      -----AAEDAKTRILSSRTRATKGSTTSVAEESVQEVGQPEQGANGALLQ------RRQI
A0A0S8H9P3      -----SPDISRDLLLSGVR--IDR---EAPSGD-YRIRVGSDGSV-----------FIEP
A0A1E4BBP7      -----PDVAADTLVVRDLY--PSD---SLQPGP-YRLTIQGSSYV--LA-------RPAQ
A0A3M2G737      ---------------------IDP---ETKNEK-----------------------LHII
A0A0H4TUX7      ---LDDPGLRRGDLFAAVA--VDS---TTPPGA-YRLTVQPTSG---FE-------VRDG
A0A1G0LUG0      ---LTDPRLRRDDVIAAIA--VDS---SSTPGR-FALVRRGPDG---YE-------VQDA
A0A1Q7E3T7      -----RARNFPTSILAVVQ--LPS---DVGGDS-LRLEFNRDSLT-----------VLGR
A0A1G0L906      ---MDDWRLSRTTFLYDAQ--VDT---LARPDS-FVLELKGTGYQ-----------LRSV
A0A1G0LCC0      ---MDDWRLSRTTFLYDAQ--VDT---LARPDS-FVLELKGTGYQ-----------LRSV
A0A2D5ZJE2      ------------------------------------------------------------
A0A3M2G624      -----VHSISPNLSFSMTN--IQS---HNAPLGTYRVHILDNQHY--VVYDTANRELGRG
A0A6M4IRY1      -----PKRVSDSTMFRAFR--VAPDQQRLKPGT-YVLTVTGTTYS-----------LAIK
A0A3D4VBZ5      -----PAVVADSVLFRTFR--V--DQSRLRPGD-YKLTIAGERYV-----------LNLQ
C1A5W1          -----PAVVADSVLFRTFR--V--DQSRLRPGD-YKLTIAGERYV-----------LNLQ
W0RI74          -----PAKASDSLLFATFQ--IDPVKKQFRPGT-YTLKTERGRFS-----------LTDK
A0A3M2BJA6      --IIEPRGVSRAVLLDRL---VAE---RWAPEG--EFLIEPGGDA--FR-------ITDE
A0A7Y5QXY3      ---IVRPSQSRRVVFGDSVPLVED---SAKAGE-YTLQFRPDSYA--LT-----------
A0A2V7PX99      -----PKSPADAPVFAGFG--LGK---MVRPGR-YELVVDRGAR---YE-------LLDQ
A0A2V7ERC7      -----YKVPGDSLLFRTFQ--TGT---TPFYGS-YVLQIDRSGRG--YT-------LATA
A0A7V9QLH4      --LREPRSLSRNDVMRAVA--VSS---EADSGT-YWLVREPDRR---FA-------LQRS
A0A7Y4RSP8      -----PGQGAAPNLFADLE--LSE---RFLPGQ-YILSVDDSGRG--YS-------LKNN
A0A838W6Q3      --VRAPAGVARSSIFSEIA--VSP---EGERGE-YAIERTARGTV--EL-------LDRT
A0A7V9U4Z2      ----PAEGQAFVEEVTDIK--VAD---SATATS-IALSFSQAGYT-----------IRSG
A0A5Q4D6Y4      ----GLHANAAQQALQEVT--VEA---FALDDT-LTLEFSSTGLG--VT-------SARG
A0A7Y3MUW4      ---PEAAGLFRSDLWTGGW--IAP---TVPPGTRYELVREEDGS---VE-------LLGP
A0A848XQ54      ---PEAAGLFRSDLWTGGW--IAP---TVPPGTRYELVREEDGS---VE-------LLGP
A0A7V9QB34      ---LVEPRRARDEVLHVLS--APR---TERKSS-YTLQREQDGS---YR-------IRTE
A0A2V7JTZ5      -----YKQPSDSVLFRNFE--WTP---ATRSGA-YLLKIDGAGPK--YM-------LSTA
A0A3D4YTR6      -----Y-TPADSALYANFV--WTP---ATRSGA-YALKIDEHGRS--YV-------LSTA
A0A7V8VRF0      ----PDFEGFRPSFLREAR--VSA---DAVSDT-LRLRFDPDGVTGLFN-----------
A0A2V7F1M1      GSRFGGSSRVVRAALRDVR--VSP---GAQQDT-LRLTFGGDRVT-----------AQGL
A0A841GJ36      -----VQEPAGARTLIVIHD-LPR---TGGEGH-YELARRSDGS---YA-------MTAT
A0A838NJX4      ----SLTPEFSVEDLSGVR--VDP---RAAGDT-VQMVFRAEGVS--AR-----------
A0A2V7KXK7      -----PETPQDSAALTTFD--ITD---RVAPGD-YRVVVDKAGRA--FR-------LELE
A0A651HKD3      -----PREPEDAELFEEVE--LAG---DVVPGR-YRLQVDSSGRT--LQ-------ILGR
A0A843T4K9      -----PVPKLDETAFDTFE--PNE---DLQPGS-YRLLVGSDGEQ--FT-------FFDP
A0A2V7QDU7      --ITKPRAVLREEVFASVR--VTR---DAPAAT-YRLEPADSDG---FV-------VRND
A0A6J4M9S2      GRLEGVSVQLPPSSFDT----VSL---RFAADQ-VTLQVGGETAK---------------
A0A2V7ITT6      -----PALPADSDLFQSFE--VAA---PFRPGA-YRLAVDESGRA--FT-------LFTT
A0A2V7NJW1      -----PALPADSDLFQSFE--VAA---PFRPGA-YRLAVDESGRA--FT-------LFTT
A0A7V4KNE3      -----YPNRADSALFAGFS--IDS---TLVPGR-YHLKAGASAGQ--YV-------LERE
A0A7Y5PAU0      -----PKHVADSAMFSNFT--VAD---RFVPGT-YTLDVEKDGRR--WT-------LSLI
A0A7V9TKH4      -----PSLARDSAVFQGFQ--PRP---GLRAGS-YTLRTDAANTH--YT-------LITT
A0A2V7GFB5      -----LPKGPD-PALRSLN--VAD---QFRPGA-YRLTTD-AARA--YV-------LAKV
A0A2V7RQ86      -----LPKGPD-PALRSLN--VAD---QFRPGA-YRLTTD-AARA--YV-------LAKV
A0A2V7IWX2      -----PRTPLDGTALLRFG--LKD---QVLPGR-YRLEVDRDGAG--FT-------LFSA
A0A1Q7KE95      -----PQ-HGWAGAFAGFT--VSD---TYRPGR-YRVVVDGTGRN--FR-------LAGA
A0A1Q7T8X5      -----PQ-HGWAGAFAGFT--VSD---TYRPGR-YRVVVDGTGRN--FR-------LAGA
A0A2V7MS64      -----PKEPADSDLFSGFR--AAD---RIRPGR-YYLVIDATGHR--FA-------LQDK
A0A2V7Q7N9      -----ARRPGDSDALATFE--IKD---RVRPGV-YRLVVDTAGNT--FT-------LTDT
A0A2V7IRW6      -----PQEPRDSDALAGFG--IKD---RVRGGT-YRLVVNDGGTA--FT-------LEEM
A0A1Q7DVU6      -----PKEPGDADALTGFG--IKD---RVRGGT-YRLVVNDAGTA--FT-------LEEK
A0A1Q7JSV2      -----PKEPGDADALTGFG--IKD---RVRGGT-YRLVVNDAGTA--FT-------LEEK
A0A2V7FK98      -----PKAREDAPLFETFR--VAE---QYRPGV-YRLALDGSART--FT-------LSTD
A0A2V7R3Z8      -----PRAREDAPVFEAFR--VAE---QYRPGV-YRLALDGSGKT--FT-------LSTD
A0A2V7J3C0      -----PERGANG-AFAGFE--VGD---TYRPGR-YRIVADRTGRS--FS-------LLGA
A0A2V7KWV9      -----ARPR-DLPALAGFA--VAD---QFTPGR-YHLTIDHDGQT--FH-------LQRE
A0A1Q6ZHP2      -----PNAPADAQAVAKLG--VAD---QFQAGA-YRFTVDHSGQG--YT-------LATA
A0A1Q7R6Z6      -----PNAPADAQAVAKLG--VAD---QFQAGA-YRFTVDHSGQG--YT-------LATA
A0A2V7FYT7      -----PNAPADAQAVAKLG--VAD---QFQAGA-YRFTVDHSGQG--YT-------LATA
A0A2V7IGR0      -----VRPLADSVALGTFG--VAD---QYRPGK-YRLTVDSTGQH--YT-------LADG
A0A2V7MR23      -----SAARADTQAIDRIR--VAD---QYQPGA-YRLSVDRSGQG--YT-------LSTA
A0A2V7L1V3      -----PKSRADEDVLASLR--VTG---QYRPGT-YRLKVDSDRRS--YT-------LSTA
A0A1Q7E5D3      -----LGSPADAHVFDAFR--PAE---QYRPGA-YRLKVDATGQN--WT-------LATE
A0A2V7ISE2      -----PSSPADAQALEGLR--VAD---QYRPGA-YRFTVDRAGQG--YT-------LATA
A0A1Q7J2X5      -----PSSPADAQAVEGLR--VAD---QYRPGA-YRFTVDRSGQG--YT-------LGTA
A0A2V7NPD1      -----PSSPADAQALEGLR--VAD---QYRPGA-YRFTVDHAGQG--YT-------LATA
A0A2V7QPD8      -----TKAREDAPLLETFR--VAE---QYRPGA-YRLAVDGSGKA--FT-------LSTD
A0A2V7Q8M6      -----PKSRVDEAVLATLQ--VTG---QYRPGV-YRLKVDSDRRS--YA-------LATV
A0A2V7QBC3      -----PKSRADEGVLATLQ--VTG---QYRPGV-YRLKVDSDRRS--YA-------LATL
A0A2V7LMU1      -----PESRADEPLVATLQ--VTG---QYRPGA-YRLKVDSDRRT--YT-------LATV
A0A2V7PBY9      -----PKSRADARFLTTFQ--TAG---QYRPGA-YRLSLDADRQS--YT-------LATV
A0A2V7J4D7      -----AKVPGDSDILATLR--IKD---HVAPGK-YRLVVEDTGDAPHFT-------LYNA
A0A2V7LN90      -----PRQPGDTDALATFG--IKP---HVRPAL-YRLVVDSIGKT--FT-------LSDK
A0A2V7LFN9      ------NVSGDSAALTSFA--IKE---RVRPGT-YLLAVDTVGTG--FT-------LTDD
A0A2V7MEK4      ------NVSGDSAALTSFA--IKE---RVRPGT-YLLAVDTVGTG--FT-------LTDD
A0A2V7EU00      -----PGARGDSLAFASFD--MGE---RFRSGN-YRLSVDASGKN--FTLTAVGGVLMAV
A0A1Q6WE01      -----VVAR-DTRALTGFA--VGD---PVMPGR-YRVVLDRSGST--FR-------LLGD
A0A2V7S9K3      -----VDPR-RSPVFAEFT--VSD---EFRPGQ-YRLVVDQAGRT--FR-------LEGR
A0A1Q7DXB9      -----PKTPIDGTALLGLR--LKD---QVLPGR-YRLEVDRDGQA--FA-------LFS-
A0A1Q7JD32      -----PKTPIDGTALLGLR--LKD---QVLPGR-YRLEVDRDGQA--FA-------LFS-
A0A2V7MVP8      -----PRTPADSAALVAFG--LKA---RVVPGR-YRLEVDRQARG--FT-------VVAV
A0A2V7N0A9      -----PQSPADTAALATFA--VPG---DVRPGR-YRLQVDATGHS--FR-------LLDV
A0A1Q7DLS9      -----PASPSDSAVFAGFS--VAP---RFRPGS-YRLEVDQAGRG--FT-------LATH
A0A1Q7JK96      -----PASPSDSAVFAGFS--VAP---RFRPGS-YRLEVDQAGRG--FT-------LATH
A0A2V7KQV7      -----PKSRADSAALATLT--VFG---DVRPGT-YRLEVDQTGQH--FT-------LRDV
A0A1Q7JGF6      -----PQSAADSAALATLT--VTG---DVRPGR-YRLQVAAAANR--FR-------LLDV
A0A2V7SG67      -----PQSAADSAALATLT--VPG---DVRPGR-YRLEVAAAANR--FR-------LLDV
A0A1Q7GIK9      -----PKSAADSAALATLT--VPG---DVRPGH-YRLVLDRAGKR--FR-------LLDA
A0A7W0YSQ1      --ISQPQKIQRSRVFGETTPIVDS---SLRFAE-FLVRFEDSGYA--LT-------QNGA
A0A3M2BLV5      ---RRGTNTVRSELFSDAV--VTD---EAEPGW-YELRYSADGAS--AA-------LVHA
A0A2V7KS68      -----VKRPAERAIFSTFN--VAD---DFRPGL-YRLRASADGRS--YT-------LSNK
A0A2V7N4L3      -----TKRASDRGNFVAFR--VDD---TFRPGD-YRLNISDNGRT--YT-------LASA
A0A1Q7AZK2      -----VKRTSDRATFDAFR--VND---IFRPGD-YRLSVSDDGRQ--YT-------LASA
A0A1Q7TNP7      -----VKRTSDRATFDAFR--VND---IFRPGD-YRLSVSDDGRQ--YT-------LASA
A0A1Q7KG39      -----VKRTSDRATFDAFR--VND---IFRPGD-YRLSVSDDGRQ--YT-------LASA
A0A1Q7GX75      -----VKRPADQATFVGFR--VND---TFRPGQ-YAFSVSADGRE--YT-------LDGA
A0A1Q7LL80      -----VKRPADQATFVGFR--VND---TFRPGQ-YAFSVSADGRE--YT-------LDGA
A0A2V7PFU2      -----VKRLGDRPSFAGFS--VSD---DFRPGE-YRLNISDNGRQ--YT-------LTSA
A0A2V7MFS9      -----VKRPADRPSFSGFG--VAD---AFRPGA-YRLSVSDDSKT--YT-------LAAA
A0A2V7T933      -----VKRTSDRATFDAFR--VND---IFRPGD-YRLSVSDDGRQ--YT-------LASA
A0A841GX23      ----PRDRLFPYASIQHIQ--VMK---SARTGD-TLRATFAADRV--VA-------RMNG
A0A7V9AJ94      ---LRERGKLRDEFLQVLE--SGR---GAGQGV-YRLQRSSDGAY--TL-------HFEE
A0A7Y3MYM3      ----SEHPELRTDVIQAVE--VDA---EAPLGA-YVLRSAGSGVV--LE-------SRSE
A0A848XLS5      ----SEHPELRTDVIQAVE--VDA---EAPLGA-YVLRSAGSGVV--LE-------SRSE
A0A7V9FIM2      ----SWTPEFSFEDLVRVG--VDP---RAAGDS-VQLVFGENEVK--AT-------RGER
A0A7W0WMB8      ----SRTPEFSTSELEQVR--VDS---RATGDS-IALEFRPADVI--AR-------RADR
A0A2V7P8B1      LLDRVLRRRFSTSLLGSVA--VAA---DAPADS-IELAFDQDGFV--VG-------RPPG
A0A7C2QQS2      ----PVDAEWPRSWLVVRQ--VPT---NVARDT-FILEFGSADYR--VR-------YRGQ
A0A2V7QN41      -----PGNPVDSSVLATLR--LDG---TPLPGA-YRYSVDREGRT--FS-------LQNG
A0A2V7R603      -----ARDPADSSGLATLR--LDG---TPVPGA-YRYTLDREGRT--FT-------LQNG
A0A7Y5VC49      -----PAKAADSAAVAGFH--AAP---GIVPGK-YALALSPDGRR--YT-------LRDA
A0A2V7LJS2      LLDRVLRRRFSPNLLGVVA--VRP---DAAADS-LSLTFERDGFL--V--------GTGP
A0A1Q7GLJ7      ----L-TRKFSPSLLGGVA--VAA---DSAAHS-FQLTFGRDDFV--VE-------GPAG
A0A2V7GRE3      ----VTTRDLPLSFLGEVA--VPA---AAGPVS-LQIAFGRDSFV--VR-------GTSG
                                                                            

A0A838NTH4      -QEVQVGVPFSIGRATLVLDR-----------PPTGALP----PRIELQFRPLRRSVD-A
A0A2D5ZJF2      LEGVADLLAFFAKTFNDTGGSTAVASDESEEEPDEGKQVVFYDRLKTFQDVDNIQV---F
A0A0S8H9P3      GSGAP----AVRGQVGEPIEF----TAGSLVVRP-------QIEPGDYRVHVISQLAAEA
A0A1E4BBP7      -QRGEQDVVVERGAVGDSIGR----AVGFQWQPSAQLLA--GREQVGFYVVTPREAAF-N
A0A3M2G737      HRRVE------------------------------------SNGHVDYEPLNKRSVVR-R
A0A0H4TUX7      -FGTV----VAQGQPGETVVG---PGFTLRLVPSP------EARTVGFRLVRPEEAAA-W
A0A1G0LUG0      -SGAA----VGGGAYSQPVTV---SGVTLTVQPTT------SEDVVPFRITRREEAAA-W
A0A1Q7E3T7      SRAIR----TSYGTSVELDGM----RFTVVARPTVERGT--------ISVVSREEAIN-G
A0A1G0L906      AGGTL---VAAGGYDVPAVGS----GFSFRVREYRG-----DPRSVRISIMPRIAAGN-M
A0A1G0LCC0      AGGTL---VAAGGYDVPAVGS----GFSFRVREYRG-----DPRSVRISIMPRIAAGN-M
A0A2D5ZJE2      -------------------------AMREGWTPPPESDP----------MADWVEALR--
A0A3M2G624      ISGVPFQHEFFEFTISNIEGP-PQSEFYFTLYPLQRAVN--SVRAATHAQATTRAAIQDN
A0A6M4IRY1      -LGPE----VEKGAVGDSVGR----VVGFLWQPAARTLA--GRKDIEFDVQTPREASI-A
A0A3D4VBZ5      -PGVE----VEKGVVGDSIGR----PVGFQWQPVAGQFG--RRTEVVFNVQTPREASR-A
C1A5W1          -PGVE----VEKGVVGDSIGR----PVGFQWQPVAGQFG--RRTEVVFNVQTPREASR-A
W0RI74          -VGFT----HEVGTVGDSVGR----SAGFAWVPPARLLG-TRSREVEFTVLTPREASR-D
A0A3M2BJA6      ---------ETLESLGEVSERLPAALAGVTFTLTEAARD---YPRIRVRVLPFDKAVT-K
A0A7Y5QXY3      -SGATQLGTAPYGTRLTAAGL-------SLFVPERPALK---ESSVVLAVSSLVAAAG-E
A0A2V7PX99      -NGAL----VERGAVGDSVGR----SVGFSWAPSSSMLL--EGRRITFNVSSPYEATQ-G
A0A2V7ERC7      -TGRI----LESGTVGDSVGR----KMGFFWNPDPALLP--PGRLIAFSVTTPRNTSL-G
A0A7V9QLH4      KKGSP---ALAYYAPGDTVKT---VDFSFVLSQHAAGYP-----AISFHVQRFPEAVG-D
A0A7Y4RSP8      -SGLQ----LSAGALTDSVGR----EAGLKWMPGPQKLA--AGMSVSFSLLSPRDASA-Q
A0A838W6Q3      SGASL----GRIGPDGRIEAP----GASMRLASTAAQHP-----RIEFDIVSSDAAAR-A
A0A7V9U4Z2      DRTVS----AIYGVPAAIDGV----SLTVSKQPATASTV--------FDVVSKESAVG-H
A0A5Q4D6Y4      HASVN----VSYGQRATVGGI----SFRVDEHPGVDQAS--------FELLSRDQAIE-L
A0A7Y3MUW4      -DGIS----LDRTAAGGTLEA-----AGIQITPAAGA----PVGRHGLRVPSYGEVIG-E
A0A848XQ54      -DGIS----LDRAAAGGTLDA-----AGIQITPAVGA----PVGRHGLRVPSYGEVIG-E
A0A7V9QB34      -TGTPPAEPAARAVPGQPF------RLGEVTLELRPSLTLHLPEQIRVEIMPFRATVA-E
A0A2V7JTZ5      -KGVF----IESGAIGDSIGR----KAGMNWLPDARFLG--RGRAIEFGVTSPRNVSV-F
A0A3D4YTR6      -TGTV----LERGAVGDSVGR----KIGMSWLPDRRLLG--ANSIFKFAVSSPRNTSA-S
A0A7V8VRF0      -GDAS---RARYGVPLELPGV----ILVISERP--------ETQTSLWQVIPREAAID-D
A0A2V7F1M1      QGEAQ----SPYGTPLAVGSV----QFTIPSPP--------SVKAGALAVRSREEVID-D
A0A841GJ36      -ATAP----TVRAPASVAVGQ--PFTLGTARLSLGPDVARDKPQAIVFNISPFRGTVS-G
A0A838NJX4      -RGQR----SVKASYGQPINL-GVVQFMVRSRPAIEGAM--------LAIRARESAID-G
A0A2V7KXK7      -DGTV----VQRGRVGQPVGE----SVGFDWTPTAAMLK--PGTTVKFGVSAITDASA-S
A0A651HKD3      -EGEL----VEEASVTEGIGA----SLGIRLTPRPEHLR--PGRNAEFRLTSPREAAG-G
A0A843T4K9      -AGSP----VATGRLGEPFGD----QLGFRWIPQPEHFP--PDGEVTLRLRTLRDAAR-T
A0A2V7QDU7      SSEAV----LGRTVPGKPLTF---AGVELEVSPHALGLG-----PVAFSVVAFDDAVR-G
A0A6J4M9S2      ---------APYGAPLRAAGV----GLTVPSRPA-------SLEEAKLVVVTRESAIS-A
A0A2V7ITT6      -AGDS----LQHAAVGDSIGN----GLGFRWTARAGALL--PGRVVDFTVGTPRSAAE-Q
A0A2V7NJW1      -AGDS----LQHAAVGDSIGN----GLGFRWTARAGALL--PGRVVDFTVGTPRSAAE-Q
A0A7V4KNE3      -PDQV----VESVQAGDSIGR----SVGFRWRPSAAALT--SVGDVRFDVLVPRQASD-R
A0A7Y5PAU0      -DAPF----TESGAAGDSIGR----KVGLRWQPSAATLSRFSNKKVDFTVATPRETSI-E
A0A7V9TKH4      KEKKV----VESGIAGDSVGR----ALGFAWKPSALLLG--PNRAVAFTVVNPRDVST-G
A0A2V7GFB5      -DGAV----LERGTVGDSIGR----SIGFLWAPPAESLP--PGHTVEFRLQTAREAAL-H
A0A2V7RQ86      -DGAV----LERGTVGDSIGR----SIGFLWAPPAESLP--PGHTVEFRLQTAREAAL-H
A0A2V7IWX2      -QGGV----VQHGERGDSVGP----ALGFAWVPGAAVLT--PGRRIEFTLLTPHDAAE-L
A0A1Q7KE95      -GGEG----LQEGAIGDSVGA----ALGFRWVPTAAVLP--AGSDLTFTVRPLRDAAR-Q
A0A1Q7T8X5      -GGEG----LQEGAIGDSVGA----ALGFRWVPTAAVLP--AGSDLTFTVRPLRDAAR-Q
A0A2V7MS64      -HKTE----LQHGATGEPVGT----ALGFLWTPPAEKLT--PGRRVEFDVDAPYEAAR-K
A0A2V7Q7N9      -KHLV----RLHGTVADSVGP----ALGFAWVPPSGVLT--PGRTMEFTVTAPYEAAK-L
A0A2V7IRW6      -KAGT----VQHGVTGDSVGA----ALGFAWVPPSAALS--RGRRVEFTVSAPYEAAR-A
A0A1Q7DVU6      -KAGV----LQHGAAGDSVGA----PLGFVWVPPAAALT--RGRTVEFTVSAPYEAAR-A
A0A1Q7JSV2      -KAGV----LQHGAAGDSVGA----PLGFVWVPPAAALT--RGRTVEFTVSAPYEAAR-A
A0A2V7FK98      -KGVE----VEHGAVGDSIGA----RLGFTWAPPAGTVP--AGRTIEFSVATVRDSAR-A
A0A2V7R3Z8      -KGVE----VEHGAAGDSIGA----RLGFVWAPPAGTVP--AGRTIEFSVATVRDSAR-A
A0A2V7J3C0      -KGEE----LQQGAIGDSIGA----ALGFRWAPAAAALH--AGSDLTFTVRPLRDAAR-K
A0A2V7KWV9      -DGTE----LEQGAVGSPVGR----TLGFIWTPTTAVLT--PGREVRFVVSPLRDAAK-K
A0A1Q6ZHP2      -DGVE----LERGTLGDSVGS----RYGLRWVPDASTVA--PGRVVEFTLTTLRDAAT-S
A0A1Q7R6Z6      -DGVE----LERGTLGDSVGS----RYGLRWVPDASTVA--PGRVVEFTLTTLRDAAT-S
A0A2V7FYT7      -DGVE----LERGTLGDSVGS----RYGLRWVPDASTVA--PGRVVEFTLTTLRDAAT-S
A0A2V7IGR0      -EGVA----LEHGVVGDSVGA----RLGFLWVPTRDALG--AGRTVRFALATVRDGAR-H
A0A2V7MR23      -DGVE----LERGSFGDSVGT----RYGLRWAPDASTVP--PGHTVEFTLTTLRDAAT-S
A0A2V7L1V3      PENQV----VERGTVGDSIGI----KLGFVWAPAAGALP--ADRTIEFRLATFRDAAR-S
A0A1Q7E5D3      -DGID----LERGAVGDSIGG----RVGFHWAPGLGVLT--PGRSVGFTVASVRDASR-H
A0A2V7ISE2      -DGIE----LERGTLGDSVGT----RYGLQWAPDAGTVA--PGRTVEFTLTTLRDAAT-G
A0A1Q7J2X5      -DGIE----LERGTLGDSVGT----RYGLQWAPDAGTVA--PGRTVEFTLTTLRDAAT-G
A0A2V7NPD1      -DGIE----LERGTLGDSVGT----RYGLQWAPDAGSVA--PGRTVEFTLTTLRDAAT-G
A0A2V7QPD8      -KGVE----VEHGAVGDSIGA----RLGFTWAPPAGTIP--AGRTIEFSVATVRDSAR-A
A0A2V7Q8M6      -EGQV----LERGTVGDSIGT----RLGLAWAPAATTLP--ADRAVEFALSTLRDAAR-S
A0A2V7QBC3      -EGQV----VERGTVGDSIGT----RLGLAWAPAASTLP--TDRAVEFGLSTLRDAAR-S
A0A2V7LMU1      -EGQV----VERGTVGDSIGT----RLGLAWAPAASTLP--TDRAVGFGLSTLRDAAR-S
A0A2V7PBY9      -EGRV----LEQGRVGDSIGT----RLGFAWAPTAATLP--PDRAVEFELLTLRDAAR-S
A0A2V7J4D7      -RSKT---PVQTGVAGDSVGP----DMGLAWVPPRAVLA--GPREVDFTLDPPYEAAL-G
A0A2V7LN90      -KHLV----QLHGTVGDSIGA----ELGFAWVPPSGTLT--PGRLVDFTVVAPYEAAK-L
A0A2V7LFN9      -AGAV----LDRGAVGDSIGA----ALGFAWVPPEGVLL--AGHVVEFTVTTPAEAAT-R
A0A2V7MEK4      -AGAV----LDRGAVGDSIGA----ALGFAWVPPEGVLL--AGHVVEFTVTTPAEAAT-R
A0A2V7EU00      -GG-V---VLQRGTPGEAVGD----AIGFRWTPPAAALP--AGASIAFSVVTPRDAAQ-R
A0A1Q6WE01      -DG-V---ELQRGTVGDSIGQ----AVGFRWAPAAAVLP--PGSEVTLIVSSVRDAAK-R
A0A2V7S9K3      -GG-A---ELQRGAVGDSVGQ----ALGFRWAPSATLLA--PGTELPFVVTTLRDAAK-H
A0A1Q7DXB9      -AE-G---VVQRGERGDSVGP----ALGFAWVPGAAVLT--PGRRIEFTLLTPHDAAE-L
A0A1Q7JD32      -AE-G---VVQRGERGDSVGP----ALGFAWVPGAAVLT--PGRRIEFTLLTPHDAAE-L
A0A2V7MVP8      -GG-G---VVQRGAVGDSVGP----ALGFAWVPGKTVLN--PGRTIDFTVYTPHDAAE-L
A0A2V7N0A9      -DENA---VLEQGAVGSNLGV----GLGFAWLPPAASLR--GGARVEFTVATTSEAAQ-K
A0A1Q7DLS9      -DA-V---VLQRGAAGDSVGG----ALGFVWLPPAAELS--PLRRLEFVVESPHEAAS-R
A0A1Q7JK96      -DA-V---VLQRGAAGDSVGG----ALGFVWLPPAAELS--PLRRLDFVVESPHEAAS-R
A0A2V7KQV7      -AENA---VLQQGSVGDSVGG----LLGLAWVPPAGTLR--PRAVIRFTMTALSDVAL-E
A0A1Q7JGF6      -DAKV---VLQEGAVGDSVGA----ALGFTWVPPAAVLR--PGASVQFTVATTSEAAQ-K
A0A2V7SG67      -DAKV---VLQEGAVGDSVGA----TLGFTWVPPAAVLR--PGASVQFTVATTSEAAQ-K
A0A1Q7GIK9      -DEKQ---VLQEATPGEAIGA----ALGLVWVPPAGTVQ--PGGRVDFTVTTTSEAAL-Q
A0A7W0YSQ1      -TLDS----AAYGDSVSGGGI----QLAVPERPQIG------ESEAVLSVIPLTGAAG-T
A0A3M2BLV5      -PTGDTVGTADAGEVLEAPGL----RFVLKRAPE-------EFRTYLLEVVPSVAQVA-S
A0A2V7KS68      -DGVE----LERGTVGDSVGR----RLGFLWQPS--SLP--RDHAVEFSLAAPRDAAT-G
A0A2V7N4L3      -EGKE----LERGTVGDSVGN----RLGFRWVPAAGSLP--PGRTIEFSLMTPRDAAL-R
A0A1Q7AZK2      -EGVD----LERGTVGDSVGN----RLGFRWAPPAGSLP--PGRTVEFSVVPPRDAAL-R
A0A1Q7TNP7      -EGVD----LERGTVGDSVGN----RLGFRWAPPAGSLP--PGRTVEFSVVPPRDAAL-R
A0A1Q7KG39      -EGVD----LERGTVGDSVGN----RLGFRWAPPAGSLP--PGRTVEFSVVPPRDAAL-R
A0A1Q7GX75      -NGVE----LERGMVGDSVGR----RLGFQWVPASGRLA--PSRTVEFSLVSPRDAAL-T
A0A1Q7LL80      -NGVE----LERGMVGDSVGR----RLGFQWVPASGRLA--PSRTVEFSLVSPRDAAL-T
A0A2V7PFU2      -AGLT----LERGTVGDSVGS----RFGFRWVPAPGTLP--AGRSVEFAVMPPRDAAT-R
A0A2V7MFS9      -EGVD----LERGTVGDSVGR----RLGFRWVPGPESLS--PGRTIEFSVVQPRDAAL-R
A0A2V7T933      -EGVD----LERGTVGDSVGN----RLGFRWAPPAGSLP--PGRTVEFSVVPPRDAAL-R
A0A841GX23      -RTAQ----GLYRQPLDLGPV----VITFAQRPA-------GITSATFDVVDEQSAIL-N
A0A7V9AJ94      -GKRP----AQLPSRVEIAERFRLDDLTLRLNPA-LRAD--PPERLRFEILPFRTAVG-D
A0A7Y3MYM3      -QTEL----ARADGNGIIEGP----GFRMQIDPA-AIPP--GDDGFAFGIRFREDAIS-S
A0A848XLS5      -QTEL----ARADGNGIIEGP----GFRMQIDPA-AIPP--GDDGFAFGIRFREDAIS-S
A0A7V9FIM2      --VVT----APYGQLLNLGVV----QFAVRSNPG--------VESATLGIRPREQVID-A
A0A7W0WMB8      --TVT----APYGQVLNLGVV----QFAVRAKPA--------VETALLGIAGREQVID-E
A0A2V7P8B1      --RRR----APYGTVVEVGGV----RFAVLRRPD--------AARGLLRVVSRDAAIS-Q
A0A7C2QQS2      --VAR----APYGQEVEVGGL----VLAMRQRPD--------VEATPVAIEPRHRVIE-A
A0A2V7QN41      --GRV----VQTDSLATTVGQ----GLGFSWSPARGLVA--PGHAVDFALNTPADAAR-Q
A0A2V7R603      --GRV----VQTDSVGTPAGQ----GLGFSWSPPRGLVA---GHSVDFALSTPADAAR-Q
A0A7Y5VC49      -DGKP----VEAGAVGDSIGR----SVGFRWAPT--------AQTLGRDRTIKLAVLP-P
A0A2V7LJS2      -ARRR----AAYGTVVEVGGV----RFAILRRPE--------VRQGVLRVLSRDAAIS-A
A0A1Q7GLJ7      -QQRR----AAYGRVVDLGVI----RFAVLHRPS--------AKQGFLQVLDQESAIS-Y
A0A2V7GRE3      --QWS----APYGSAVESHDI----RFAVLHRPD--------AATARLRVLSREAAIS-G
                                                                            

A0A838NTH4      MR-KALTVARPQR---------EAQIINVRYESNDPVVAAAVPNLLLDEFIRYKAQTNKT
A0A2D5ZJF2      LK-KELEVKVGK----------KDDIISVSFDSPWPDEAELIVYEVVESYRRYQSTTKQT
A0A0S8H9P3      VVTGGLAASTRP----------ETNLIDVTYSGPDQRLVPRTLNAVAAALRDLGVRRVRQ
A0A1E4BBP7      LG-SQLSVTVGQ----------NSNLMRFQLSGSKAGLLATTLNTLAREFVSEAVRLKRE
A0A3M2G737      LQ-SSASFSPIP----------QSDIIQISVKSTHPEEAKLIANLFAETYYQWNVERSRT
A0A0H4TUX7      VS-GGLSYNVRE----------GTNAVDISFAGTDPTLVPQILNAAAVALRLDGVRRAQE
A0A1G0LUG0      VS-GGLSYRVRE----------ATNAVDITFTSTDPLLVPRILNAAGLALQSDGVRRARE
A0A1Q7E3T7      LL-GGLRVTLRP----------HTDIFDVAYVASDPQHAQQVVNRVVEVFRAVNAEEAQR
A0A1G0L906      VR-GGIGFAVPP----------TTSLVNVTFTGTDPSLVPEILNEALIALQNYGVDRVRD
A0A1G0LCC0      VR-GGIGFAVPP----------TTSLVNVTFTGTDPSLVPEILNEALIALQNYGVDRVRD
A0A2D5ZJE2      ---SRLSVSPLK----------DADVITIKMTAGDPDEAAYFANLFAEEYRNQNISQNRG
A0A3M2G624      VAGGGIAGAASAKRSRKDAAIQDAGIVQVDVYWQDPETATQIANALADVIRHRELEDKRL
A0A6M4IRY1      LI-KKLRLSLQD----------GSSFLFLNLTGENAQRTAATLNAWVEQFVVVATALKKK
A0A3D4VBZ5      LI-KKLALSLQD----------GSSFLFLRMNGPDAQRSAATLNAWVEQFVTVATQYKKQ
C1A5W1          LI-KKLALSLQD----------GSSFLFLRMNGPDAQRSAATLNAWVEQFVTVATQYKKQ
W0RI74          VQ-KRLAITIKQ----------ASPVIGLTLTGTAQQKPAATMNAMLTQFVDVATELKKR
A0A3M2BJA6      LQ-KALSVSRPNR---------DAGIVTVRYESSDTLLVHEVPNRLAASFISRRQRIQKT
A0A7Y5QXY3      VR-GGTTTRVIP----------QTDVIEITFRGTDPGAVRDVANSLASAYAQFSSELQTT
A0A2V7PX99      LV-KALRLKQDP----------GGSFLRIELKGTDPALTAATVNAVAGRTVTLAAELKRR
A0A2V7ERC7      LL-ASMRSTLPE----------DGQFLTISLTGTNPQRSARTVNVWAEQFVGAAIELKKR
A0A7V9QLH4      LG-DALRVARPSA---------QANLVRLSYSGSDAPLLAATLNSLGRTYMGRRQNVGTT
A0A7Y4RSP8      LK-EDLEPFMPTE---------NGNFLELKLKGTDPQLLASTMQAIQEQFLKVAADLKKQ
A0A838W6Q3      LS-GAVEVTRQSR---------DTEIIEVRYRGTDPELVRDVTNALVTQFIEERNQSSSH
A0A7V9U4Z2      AL-GGFSPSSRS----------KTDILDLSYTGSEPWEAKRIANAMAEAFQVQNAQNAQQ
A0A5Q4D6Y4      VG-RNLTSQPRP----------ETNVVDVSYTATDPDVAQRLANRAVQVFQARTASEARA
A0A7Y3MUW4      IQ-PNIWAESRE----------GTNLIDVRFTMLDSVLAPSIANVWAAALRDLGAERVRE
A0A848XQ54      IQ-PNIWAESRE----------GTNLIDVRFTMLDSVLAPSIANVWAAALRDLGAERVRE
A0A7V9QB34      MQ-KQLRVNRASS---------GAQVIDVQYRHRDPALAAEVPNAVTASFIQYKNRVGRA
A0A2V7JTZ5      LV-NAVHASLPE----------DGQFLKITLSGADPRRTARTVNAWAEQLVNSSGDLKTR
A0A3D4YTR6      LV-AAVHATLPE----------DGQFLKITLTGSDPRRTARTVNAWAAQLVSSSGDLKKS
A0A7V8VRF0      LL-GKLYVKPRT----------QTNVVEIAYSARRPSVAQRVVNRVATLYQSMSAHSAQD
A0A2V7F1M1      VL-KSLAVLRRK----------STDIVDVTYSDPDPLLAQRVANLLVRVFQARDAGSAQE
A0A841GJ36      VRSGIAVERADL----------VSHVVNVTYTSADPRVAADVPNVLAARFLEEKLSGLRS
A0A838NJX4      LL-AGLMVYRRE----------LTDVIDVSFTAEDPRTAQRVVNSSVQAFQTLNVQWARE
A0A2V7KXK7      LA-KSIKTRLDP----------DGNFLRLQLKSTSAAGAAATLNAISARIVAVESEMKRR
A0A651HKD3      IA-RSMNIQTNQ----------FIEYISVSLSGGDPVHAARLLNTVLESFLREATELSRA
A0A843T4K9      LG-QQLQTSVNE----------DGTFLEIAYAADDPVEAAGVLNAVTSRYVQVATELKRA
A0A2V7QDU7      LR-KALSIKRRNR---------EANIVDVGYRGTDPQLVQAVPNLLATRFIIDRQKTQQT
A0A6J4M9S2      LS-GSLVPRPQE----------KTDAVRVEYTSTDPHLAQRIVNASVEVFQEANARAAQQ
A0A2V7ITT6      LA-RRLRAKTDE----------AGNFLSVQLTGNDARHVTAVLNAVVQRYVAVAADLKRD
A0A2V7NJW1      LA-RRLRAKTDE----------AGNFLSVQLTGNDARHVTVVLNAVVQRYVAVAADLKRD
A0A7V4KNE3      LKRDGLRLDMQE----------NSNFMRVGYTSGDPVRGARVLNTLLDKFVAQAADLKSY
A0A7Y5PAU0      LM-KRLDARLPE----------RSPMLGLTLQDPNPQLAARTLNTWVEEYVAVAGELKRR
A0A7V9TKH4      LI-SRVEVALPQ----------NSQFIKLTLAGASAQRTAMILNGIMREFVYTAGELKRR
A0A2V7GFB5      LS-DALDAHMDY----------NGNFLKIELRGGDPARITRILNAVAERYVEVAAELKRG
A0A2V7RQ86      LS-DALDAHMDY----------NGNFLKIELRGGDPARITRILNAVAERYVEVAAELKRG
A0A2V7IWX2      LA-SQLQVTTDP----------EGTFVTVQLTGTDPQLTAAIVKGVADRTVAVAADLRRH
A0A1Q7KE95      LG-NALTVTMDQ----------GGNFLRVGLTGADPAHTAATVNAVAQRSVAVGAELKRA
A0A1Q7T8X5      LG-NALTVTMDQ----------GGNFLRVGLTGADPAHTAATVNAVAQRSVAVGAELKRA
A0A2V7MS64      LG-KHLKTSLDL----------DGNFLRLELAGDDPVQITDIVNTVGQRFVAAAADLKRQ
A0A2V7Q7N9      LT-KRLKITADA----------DGNFLRLELGGSDPGEVTAVVNMVAERFVSVAADLKKQ
A0A2V7IRW6      LG-KRLKTSLDL----------DGNFLRLELGGPDAAGITAVVNAVAERFVAAAAELKRQ
A0A1Q7DVU6      LG-KRLKTSLDL----------DGNFLRLELGGPDAAGITAVVNAVAERFVAAAADLKRQ
A0A1Q7JSV2      LG-KRLKTSLDL----------DGNFLRLELGGPDAAGITAVVNAVAERFVAAAADLKRQ
A0A2V7FK98      LS-DELEVATDP----------AGNFLRMHLKGADAARITSTINGIAERFVQVAADLRRQ
A0A2V7R3Z8      LS-EELEVATDP----------AGNFLRMHLKGADAVRITSTINAIAERFVLVAADLRRQ
A0A2V7J3C0      LA-NSLAVTLDP----------GGNFLRIGLTAEDATRGAATANAIAQRFVEVGADLKRA
A0A2V7KWV9      LA-DNLNVTLDL----------SGNFLRVALTSPNGTDAAATVNAVADRYVAVATDLKRV
A0A1Q6ZHP2      LG-EGLDARMDQ----------EGSFLRLELRGANPVDITAIVNAVAQRYVTVYADLKRQ
A0A1Q7R6Z6      LG-EGLDARMDQ----------EGSFLRLELRGANPVDITAIVNAVAQRYVTVYADLKRQ
A0A2V7FYT7      LG-EGLDARMDQ----------EGSFLRLELRGANPVDITAIVNAVAQRYVTVYADLKRQ
A0A2V7IGR0      LD-EALDVRAAP----------DGSFLHIELRGAQPARITAIVNAIAQRYVEVAAELKRE
A0A2V7MR23      LA-DALDTWMDI----------DGNFLRIEMRGPDPVRITTLVNAVAQRYVTVYADLKRQ
A0A2V7L1V3      LA-DSMSAQLDP----------QGNFLRLELRGPDAPRITAVVNAVADRYVLVAADLKRK
A0A1Q7E5D3      LA-ERLDVHMDM----------NGNFLRVELTGAYPARITAIVNAVVERYVQVAADLKRQ
A0A2V7ISE2      LG-EALDVRMDM----------DGNFLRFELRGPYPTRITAIVNAVAQRYVQVYADLKRQ
A0A1Q7J2X5      LG-EALDTRMDM----------DGNFLRVELRGVYPTRITAIVNAVAQRYVQVYADLKRQ
A0A2V7NPD1      LG-EALDVRMDM----------DGNFLRFELRGPYPTRITAIVNAVAQRYVQVYADLKRQ
A0A2V7QPD8      LS-EGLEVNNDP----------AGTFLRMHLKGADAVRITSTINAIAERFVQVAAELRRQ
A0A2V7Q8M6      LA-DSLSAQLDE----------KGNFLRLELRGPDAPRITAVVNAVAERYVQVASDLKRK
A0A2V7QBC3      LA-DSLSAQLDE----------KGNFLRLELRGPDAPRITAVVNAVAERYVQVASDLKRK
A0A2V7LMU1      LA-DSLSAQLDA----------EGNFLRLELRGPDAPRITAVVNAVAERYVQVASDLKRK
A0A2V7PBY9      LA-DSLRTELDL----------EGNFLRIEMRGPDAAQITAIVNAVAERYVQVAADLKRT
A0A2V7J4D7      LA-RNLKVAADL----------DGNFLRMELGGHDPAQIAATVNAVAERFVAVAAGLKRD
A0A2V7LN90      LA-KRLKTSADA----------DGNFLRLELGGSDPAEVTAIVNLVAERFVAIAADLKKE
A0A2V7LFN9      LR-RELKVSSDM----------DGNFLRLELTGPDAAGVTGTVNAVASRFVAAAADLKRD
A0A2V7MEK4      LR-RELKVSSDM----------DGNFLRLELTGPDAAGVTGTVNAVASRFVAAAADLKRD
A0A2V7EU00      LS-ARLGVRLDE----------NGNFMRLELDGTDPKSIAATLNAIAQRLVAVAAELKRA
A0A1Q6WE01      LG-DELNVTIDP----------NGNFLRLSLSGTDGPTVAATLNAVAQRYVDAALKLKRA
A0A2V7S9K3      LG-EALTVAIDP----------SGNFLGISLTDANGTAAAKTVNYVAQRYVLAASGLKRS
A0A1Q7DXB9      LA-SQLQVTTDR----------EGTFVTVQLTGTDPQLTAAIVKGVADRTVAVAADLRRH
A0A1Q7JD32      LA-SQLQVTTDR----------EGTFVTVQLTGTDPQLTAAIVKGVADRTVAVAADLRRH
A0A2V7MVP8      LA-GELQVTTDP----------GGSFVTVQLTGTDPHLTTAILRGVANRTVAVANELRRH
A0A2V7N0A9      LA-EELRVRAAQ----------DGNFIRIERRGPDRRVVTGTVNAVAERFVAAAAELKRQ
A0A1Q7DLS9      LA-ERLRVKTDL----------EGNFLRVELRGQDPRKITVIVNAVAQRFVAVAADLKRQ
A0A1Q7JK96      LA-ERLRVKTDL----------EGNFLRVELRGQDPRKITVIVNAVAQRFVAVAADLKRQ
A0A2V7KQV7      LS-QSLRIRATA----------DGYFVRLERRGHDPVLITTTVNAVADRLVAVAADLKRE
A0A1Q7JGF6      LS-EELRVRAGT----------DGNFVRIERRGPDAAVVTRTVNAVAERFVAAAADLKRQ
A0A2V7SG67      LS-EELRVRAGT----------DGNFVRIERRGPDAAVVTRTVNAVAERFVAAAADLKRQ
A0A1Q7GIK9      LA-EELRIRAAP----------EGNFVRIARRGPDPDQATGIANAVAERFVAAAADLKRQ
A0A7W0YSQ1      VR-GGIVTKLRP----------QTNIIEITYTGPDPFTVQRIANSVAGEYREFSSEDRRK
A0A3M2BLV5      EV-RLVGTARE-----------QTNIIDIYLTHEDPELAPKMLGAAARALSEFGARQVRE
A0A2V7KS68      LG-NALDVHMDI----------NGNFLAVELSGQNPVLIANILNAVTQRYVDVAAQLKRE
A0A2V7N4L3      LG-EQLDVRMDL----------NGNFLALELRGANPVLISNILNAVSQRYVAVAAQLKRE
A0A1Q7AZK2      LG-EQLDVRMDM----------NGNFLALELRGPNPVLITSILNAVAQRYVEVAAQLNRE
A0A1Q7TNP7      LG-EQLDVRMDM----------NGNFLALELRGPNPVLITSILNAVAQRYVEVAAQLNRE
A0A1Q7KG39      LG-EQLDVRMDM----------NGNFLALELRGPNPVLITTILNAVAQRYVEVAAQLNRE
A0A1Q7GX75      LG-EQLSVRMEM----------NSNFLALELRGSNPVLIANILNAVSQRYVEVAAQLKRE
A0A1Q7LL80      LG-EQLSVRMEM----------NSNFLALELRGSNPVLIANILNAVSQRYVEVAAQLKRE
A0A2V7PFU2      LG-EELQVQMDM----------NGNFLALELRGTNPMLISKILNAVTQRYVEVAAQLKRE
A0A2V7MFS9      LG-EQLDVRMDL----------NGNFLALQLQGTNPVLISSILNAVSQRYVAVAAQLKRE
A0A2V7T933      LG-EQLDVRMDM----------NGNFLALELRGPNPVLITTILNAVAQRYVEVAAQLNRE
A0A841GX23      AL-GSLTAAQRE-VTNFV----DIQY-----GANDPVMAQRGANAFASAFQEISTRSAQT
A0A7V9AJ94      VQ-KKLRVASSAPGAQIV----KVHF-----RNSDPVLAAAVPNVVAESFLRYKSRVGRA
A0A7Y3MYM3      LQ-GRARVEPGD-GLDLI----RIRY-----TDNDPVHAAAVVNTISTAYQAHRANTARD
A0A848XLS5      LQ-GRARVEPGD-GLDLI----RIRY-----TDNDPVHAAAVVNTISTAYQAHRANTARD
A0A7V9FIM2      LV-AGLLVSRRE-FTDVI----DVRY-----IAEDPRTAQRVVNSTVQAFQTLNVQWARE
A0A7W0WMB8      LV-LGLQLARLT-ETDVI----HIGY-----VSSDPVKAQRVVNTTVQAFQSLNVQWARE
A0A2V7P8B1      LL-TELRVRPRV-RTDIV----DVAY-----AAPDPSRAQQVVNRVVDVFRAASAEAAQG
A0A7C2QQS2      LQ-KAITVRNRR-NTDVI----DVSF-----RDHDPVHAQQVVNTLIDVFQEYDARQAQE
A0A2V7QN41      LK-TTLSVTTDV-DPALMRAGTDANFLRIQLTGSRPAELAATVNAIADRVVVVAADLKRI
A0A2V7R603      LM-KTLNVSTDV-DPALMRAGTDANFLRIQITGSRPAELAATVNAIADRVVVVAADLKRI
A0A7Y5VC49      RQ-AALKLRNRI-ELGFP----DTSFISLRLTGPQPARDARVINAIDRQFVATASSLVRG
A0A2V7LJS2      LL-TELRVRPRM-RTDIV----DVAY-----SAPDPARAQEVVNRVVDVFRAASAEAAQG
A0A1Q7GLJ7      LI-AKVRVRPRL-RTDIV----DVAY-----SAPDPARAQEVVNRVVDVFRAASADAAQR
A0A2V7GRE3      LL-ARLRVKPRL-NTDIV----DVTY-----SAPDPYVAQHVLNRVVDLFKSASAEDAQQ
                                                                            

A0A838NTH4      EATSTVGFLRQQVASYEGQLRAAETALGGFREQARVVSI---------------------
A0A2D5ZJF2      TAGGVLKILEKARKKADGKWNESYEKLILSQKKHPVL-----------------------
A0A0S8H9P3      WARGRTRFIRDQLDESGRQLREALQAVQDYKGRRGLISL---------------------
A0A1E4BBP7      NLTVSAEATEEQLQQAAQQLAAAQTALERFKINTITLPSEQMAITPGV------------
A0A3M2G737      ELIGTRKFLEKQLEQKRERLYQAEDSLRKYMEASNVMTDDAGATATIEKIAQLEATRSAL
A0A0H4TUX7      IAARKRTYVAEQLAKADSSYRIKLAELQRFKEGEQITDL---------------------
A0A1G0LUG0      VAARRRAYIAEQLAGADAAYKGKLTELQRYKEGQQITDL---------------------
A0A1Q7E3T7      QSRLRREFLETQLRVNDSVLADARRALTAFRRHAGRAGS---------------------
A0A1G0L906      VASLRLRYINERVDDARTRYLSALSGVQSYKESENTTNF---------------------
A0A1G0LCC0      VASLRLRYINERVDDARTRYLSALSGVQSYKESENTTNF---------------------
A0A2D5ZJE2      ELSGVRQFLEEQLHQVETRLAISEEELRSFKTKSGLVSL---------------------
A0A3M2G624      EHTKTREYIERQLNTYTQKLKASEEALQTYKEQNRIYEL---------------------
A0A6M4IRY1      NITSVAAILEGQTQYAAENLSNAENALESFRVRTVTEPNERQSITPGI------------
A0A3D4VBZ5      NVVQVAGILEGQREYAAQELASAEAALEGFRVRTVTEPSERQTIQPGI------------
C1A5W1          NVVQVAGILEGQREYAAQELASAEAALEGFRVRTVTEPSERQTIQPGI------------
W0RI74          EMVASTTTLNTQLDEASKGLQAAEQAFEDYRVKTIAEPSETPTVISSDPKSQN-------
A0A3M2BJA6      EASSTVRFLEDQIDTLARQLAAAEERLVAFREEGQVVSI---------------------
A0A7Y5QXY3      SARNKTDFIAKALGSQKEGLDAAQARLQAFKEAHQTSDV---------------------
A0A2V7PX99      KYAELAKILGEQAQQAQQALHASDAALASFRVRTAGVVQRGAPTVSPTM-----------
A0A2V7ERC7      HLLEFKKMLGDQLNVAEHELNTSELLLEQFRASTITLPSGGSPLASSG------------
A0A7V9QLH4      EARERVKFLQGQIATLSGQLTASEDQLEDFRTKGSVVDP---------------------
A0A7Y4RSP8      KLRELSSLLADQVSQQEKRLRAAEQGLASFRVATITQPRENVAVASGL------------
A0A838W6Q3      STLSTVGFIRAQISGIETRLAAAEEALRAYRESAGVVSV---------------------
A0A7V9U4Z2      ISRRRRRFLEDQLRQTDSMLSGASGAYTSYRSGRQVFSS---------------------
A0A5Q4D6Y4      ESQRRRQFLEEQLAVADTTLREAQGYLTAFRSDEQVVST---------------------
A0A7Y3MUW4      HASRDVGFIQEQLDSARAQLTRSLNAIRSFKESEAFTSL---------------------
A0A848XQ54      HASRDVGFIQEQLDSARAQLTRSLNAIRSFKESEAFTSL---------------------
A0A7V9QB34      ESRSSVDFLQEQSATYAGQLGDAEARLQQFREQAQIVEP---------------------
A0A2V7JTZ5      HLFEFKKILGDQLALAEAQLRTSENELEHFRVSTITLPSGVAASAGPG------------
A0A3D4YTR6      HLLEFKRILGDQLALAEGQLRSSEDELERFRVNTITLPHG-ATPIGPG------------
A0A7V8VRF0      QSRRRREFLEARIAQTDSDLMRAQSALTEFRRQVRVYGA---------------------
A0A2V7F1M1      QARSRAEFLAAQLSATDSELSIAQAELSAFRRQRMLGSSRDKLAVEQAR-----------
A0A841GJ36      ESRSTVQFLREQVSSYNEQLRLAEERVRSYRESQQVVSLTEEASEQVRR-----------
A0A838NJX4      RSRRKGEFLAEQLAQTDSMLEKAQAALSSFRSRQQLASSRDKLAAEQTA-----------
A0A2V7KXK7      KFEELAGVMDEQHQHAKEALDQADEALRNFRVRTADRPLVTQAPG---------------
A0A651HKD3      TSDQLSSTLEQQLVTARQTLQEAEGELEAFHRANVLSPAQQGA-----------------
A0A843T4K9      RLVELTTVLSEQLATAERNLREAEIGLEGFRVQTITLPSEQAMAITPGI-----------
A0A2V7QDU7      ETRSTGAFLRDQTAKLARQLRASEDSLERFRVVEHIVSLPQQASSGVTQ-----------
A0A6J4M9S2      ASRRRRIFLQKQLETTDSMLAQAQLSLSNFRSRERVFSS---------------------
A0A2V7ITT6      KLTELSKILQQQLQYAEHNLRSAEEVFEDFRVQTITLPADRVTPVAPGV-----------
A0A2V7NJW1      KLTELSKILQQQLQYAEHNLRSAEEVFEDFRVQTITLPADRVTPVAPGV-----------
A0A7V4KNE3      KLTESSKALEEQLQTVGTQLRQAEQELEAYRTRIITLPGEGVPVSSGV------------
A0A7Y5PAU0      NLVEFANILGGQLSFAENSLRSAEAALEGFRIHTITLPAEGGPVQPGV------------
A0A7V9TKH4      NLTEESKALADQLDTASRALRSSETSLESFRKNTITLPSEALIAAPATGMAS--------
A0A2V7GFB5      RLTELTSIIGDQVRTAKQSLDSAEGDLQTFRRRTITLPPDAVAAGG--------------
A0A2V7RQ86      RLTELTSIIGDQVRTAKQSLDSAEGDLQSFRRRTITLPPDAVAAGG--------------
A0A2V7IWX2      KVAALADILGEQVRHAQASLTAAELALKSFRVRAAGVLPAGVA-----------------
A0A1Q7KE95      KLNQLGKLLDEQRQSARENLQRAESALEQLQVTVGPDLGAAPVPP---------------
A0A1Q7T8X5      KLNQLGKLLDEQRQSARENLQRAESALEQLQVTVGPDLGAAPVPP---------------
A0A2V7MS64      NLTELSRILGDQLDKARTELTSAEQSLKQFRMSAVTEYTEGTASIAPNM-----------
A0A2V7Q7N9      NLQQLTGILGGQLERARDKLQSAEAELKRFRVGAVTQYADGSAPVTPNM-----------
A0A2V7IRW6      NLTELTRILSGQLERAQANLRDAETALKTFRVSAVTEYADGAAPVTPNM-----------
A0A1Q7DVU6      NLTELTRILNGQLERAQANLRDAETTLKTFRVSAVTEYADGAAPVTPNM-----------
A0A1Q7JSV2      NLTELTRILNGQLERAQANLRDAETTLKTFRVSAVTEYADGAAPVTPNM-----------
A0A2V7FK98      KLTELTKILDQQLAAAHQNLLDAEQALERFQVKTITLPS-------TAAGGARAAGGVPT
A0A2V7R3Z8      KLTELTKILDQQLAAAHQNLLDAEKALERFQVKTITLPS-------TAVGGSRGA-GVPS
A0A2V7J3C0      KLHQLGTLLDEQLRAARDNLRRTESALEQFQVGTATFTPTVGTAAA--------------
A0A2V7KWV9      KVTELSRLLNEQLQAAEANLHKAERALEDFRVRTIMLPAEPVAG----------------
A0A1Q6ZHP2      KLIELTKILGEQLQHAQENLHGAEASLQRFREETITLPGDRPSVGGASVAGAAVGGPGAT
A0A1Q7R6Z6      KLIELTKILGEQLQHAQENLHGAEASLQRFREETITLPGDRPSVGGASVAGAAVGGPGAT
A0A2V7FYT7      KLIELTKILGEQLQHAQENLHGAEASLQRFREETITLPGDRPSVGGASVAGAAVGGPGAT
A0A2V7IGR0      KVTELTKILDQQVESARQRLRDAEAGLRSFGVRTITLPSGRAAA-------------GVT
A0A2V7MR23      KLIELTKILGEQLQHSQDNLRSAEAALQRFREETITLPGERPVTGGASVAGPVVAGAAPG
A0A2V7L1V3      KLTELTKILGEQLQSAEDKLRGAEAALERFRERTITLPADRPAPVALGAPGGA--GGGSQ
A0A1Q7E5D3      KVTELTKILNDQVESARRNLQDAEVALEAFRVRTITLPSDRPAPSRAGVAGAT----GAA
A0A2V7ISE2      KVIELTKILGEQVQHSQENLRNAEAALQRFREETITLPSDRPAAG-ASVAGAG--VGGAG
A0A1Q7J2X5      KVMELTKILGEQVQHSQENLRNAEAALQRFREETITLPSDRAAAG-ASVAGAGGVGAGAG
A0A2V7NPD1      KVIELTKILGEQVQHSQENLRNAEAALQRFREETITLPSDRPAAG-ASVAGAG--VGGAG
A0A2V7QPD8      KLTELTKILDQQLAAAHQNLQDAEKALERFQVSVITRPSQVPKAGP--------------
A0A2V7Q8M6      KLTELTKILAEQLRSAQGNLRSAEAGFERFRERTITLPGDRTPPGALGMAGGA--GGGQG
A0A2V7QBC3      KLTELTKILAEQLQSAQGNLRSAEAAFEGFRERTITLPGDRTPPVSLGVPSAA--GGGQG
A0A2V7LMU1      KLSELTKILAEQFQSAQGNLRSAEAALERFRERTITLPSDRPPPVALGAPGGA--GGGAQ
A0A2V7PBY9      KLSELTKILADQLQRAQGTLRSSEAALERFRVRTITLPTDRPPPVALGAPGGA--GGGGG
A0A2V7J4D7      NLTELTRILGDQLAQAQANLRQAEASLKSFRVGAVTTVAAGAGSVTESS-----------
A0A2V7LN90      NLQQLTGILSGQLERARDKLQSAEAGLKRFRVGAVTQYADGAAPVTPNM-----------
A0A2V7LFN9      NLTQLTGILGAQLEQAQARLRSAETALQRFRVTAVTEYAEGAAPVTPNM-----------
A0A2V7MEK4      NLTQLTGILGAQLEQAQARLRSAETALQRFRVTAVTEYAEGAAPVTPNM-----------
A0A2V7EU00      KLTELTRILNEQLTTAARNLRDAEGSLESFRVKTITLPSEQSTPVSPGL-----------
A0A1Q6WE01      KLSELAALLAEQLQSARASLQRAESAYEAFRTRTITLPPDPGAAAAAA------------
A0A2V7S9K3      KLTELARLLDEQLQSARGNLQRAEAALEQFRTRTITLPPDPGATGTAA------------
A0A1Q7DXB9      KVAALADILGQQVQHAQASLTVAELALKNFRVRAAGVLPAGVAAPPP-------------
A0A1Q7JD32      KVAALADILGQQVQHAQASLTVAELALKNFRVRAAGVLPAGVAAPPP-------------
A0A2V7MVP8      KVAALADMLGQQVQHAQTSLTAAELALKDFRIRTAGVLPAGVVTPPP-------------
A0A2V7N0A9      RLTQLTAILKDQLDHAQDNLRAAEAALMAFRVRNAVRPSEGPAQGPDGR-----------
A0A1Q7DLS9      QLTELVRILGEQLNHSQVNLSAAESALRDLLSKTVSFVADGATPVAPGL-----------
A0A1Q7JK96      QLTELVRILGEQLNHSQVNLSAAESALRDLLSKTVSFVADGATPVAPGL-----------
A0A2V7KQV7      RRTELSSILHEQRDRAKANLSSAELALTQFRVRNAVRPSEGPAEGPDGR-----------
A0A1Q7JGF6      RLTELTAILKDQLDRAETNLRAAERGLTAFRVRNAVRPSEGPAQGPDGR-----------
A0A2V7SG67      RLTELTAILKDQLDRAETNLRAAERGLTAFRVRNAVRPSEGPAQGPDGR-----------
A0A1Q7GIK9      RLTELTAILQDQLNHAQANLRTAEAALTVFRVHNAVRPSEGPAQGPDGR-----------
A0A7W0YSQ1      VAEAKTVTIEERLVEQRRRLDSAQQALKRFKEDAQL---------GNVT-----------
A0A3M2BLV5      RAESDLEFAEAQLDSARNNLQRSFQKIREFKETEAFTNLTAEEQQLVQR-----------
A0A2V7KS68      KLTELTKLLENQLNTARSNLDDAESALQHFRTRTITLPSEQA--GPSAT-----------
A0A2V7N4L3      KLTELTKLLEDQLTTAQRNLDEAETALQRFRTRTITLPSERSPSAAVSG-----------
A0A1Q7AZK2      KLTQLTKILEDQLTTAKRNLDSAETALQGFRTRTITLPSDQAADRKAAA-----------
A0A1Q7TNP7      KLTQLTKILEDQLTTAKRNLDSAETALQGFRTRTITLPSDQAADRKAAA-----------
A0A1Q7KG39      KLTQLTKILEDQLTTAKRNLDSAETALQGFRTRTITLPSDQAADRKAAA-----------
A0A1Q7GX75      KLTELTKILEDQLRTAQGNLDDAETALERFRTRTITLPSDQT----TGV-----------
A0A1Q7LL80      KLTELTKILEDQLRTAQGNLDDAETALERFRTRTITLPSDQT----TGV-----------
A0A2V7PFU2      KLTELTKILEDQLTTAKRNLDEAEDAQRRFRTRTITLPSDQQR-PGAAA-----------
A0A2V7MFS9      KLSELTKILEDQLTTAQRNLDDAEAAQQRFRTRTITLPSDQQAGQAAAA-----------
A0A2V7T933      KLTQLTKILEDQLTTAKRNLDSAETALQGFRTRTITLPSDQAADRKAAA-----------
A0A841GX23      MSRRRRVFVEQQLRSTDSLLVVLQAQLSAFRKGVRSFSPRE----TFRT-----------
A0A7V9AJ94      EAHSTIEFLEQQSATYEAELRAAEARLQGFREQAQIVEPKT----QATE-----------
A0A7Y3MYM3      AATRSREFIRVQMEVLNDSLRKVQEQLVAYQEQSQIVAPEV----EVGS-----------
A0A848XLS5      AATRSREFIRVQMEVLNDSLRKVQEQLVAYQEQSQIVAPEV----EVGS-----------
A0A7V9FIM2      RSRRRREFLAEQLGQTDSMLERAQAELSSFRSRQQLASSRD----AMAA-----------
A0A7W0WMB8      RSRRRREFLSEQLAQTDSVLARAQGELSLFRSRQQIASSSA----KLQA-----------
A0A2V7P8B1      QSRLRREFLEAQLKVNDSVVADAQAALTALQRRARSDGWGQ----SSGR-----------
A0A7C2QQS2      KSRRRRLFIEEQMRNTERDLALAQSQLSAFRRQRQVFSSQQ----QFAA-----------
A0A2V7QN41      KLVELGRILDEQRQHALRGLRDAEAAQRDFRIRSAGVLRQGA--PPVSA-----------
A0A2V7R603      KLVELGRILDEQRQHALGSLRAAEAAQRDFRIHSAGVLRQGA--PPVSA-----------
A0A7Y5VC49      GQAQSAQQLGQQVSQAEAALRRSEDALRNYRAGTVGLPSQDD--PSVAV-----------
A0A2V7LJS2      QSRLRREFLEAQLRVNDSLVADAQDALTAFQRRARSDGSGQ----TSGR-----------
A0A1Q7GLJ7      QSKLRREFLEAQLKVNDSLLADARQALTEFQRRARPYGSGG----SSAR-----------
A0A2V7GRE3      QSTRRREFLESQLKVNDSLLADARQAVTAFRQRAGTYGSRD----ALAR-----------
                                                                            

A0A838NTH4      ---GDEAQAQVRQMADMQAERDQLQSERQALAAIMAKVPLQGEN--------AARDIAAF
A0A2D5ZJF2      ---SLKDDRGSFLVRGLSTLHEELAAAQSAAIVAKATYE-AAEQMQGDPERLRQLVESQF
A0A0S8H9P3      ---TVEESRVMQRVATLQTEIEQLLIEKSLYTSLVDRIG------SVGLRPGDVQQFVVL
A0A1E4BBP7      ---STTMNPVFQAYFSDRVNYEQVRRDREALERIVEEGRGRGGK-------ISLEALRSV
A0A3M2G737      EIDIQAFAEKIKSYEDKLGSKSNVNVIAEQNDPYITQLQ------------EQIANLEVQ
A0A0H4TUX7      ---SVEEQSVVQSIQALEQQRQQITVQIATLREALGQPGDSIGV-------GTLNRLAAV
A0A1G0LUG0      ---SAEELSIVQSIQTLEQERQLLAVQLSTLRGSLGDSATQIDV-------GTLNRLSAV
A0A1Q7E3T7      ---DQQGPTQQAGIDQLQLQRDQLDADRRMYRSILVSLDSGGGR----GNREALRTAAST
A0A1G0L906      ---TAEEVAIINSIHGFDREKERLQVDLSTLQGIMGPEAQVTLE--------TLNRLAAL
A0A1G0LCC0      ---TAEEVAIINSIHGFDREKERLQVDLSTLQGIMGPEAQVTLE--------TLNRLAAL
A0A2D5ZJE2      ---SDEVEWLVRQLAEFESAENAAITDQKSLERRLEHLEGELER-------ARAGLVEDL
A0A3M2G624      ---DAIARDVTYKVFDIEAEISQIQAERERIKLFREKVTSGLQP-------EDYLLISAI
A0A6M4IRY1      ---EMTNSPVFENYFRDQILADSYKRDRQALEGILAKGRQAGGV-------ITREAVLSI
A0A3D4VBZ5      ---EMTNSPVFENYFRDKILADNYRRDREALERILQSGR-SGTA-------ITREAVLSV
C1A5W1          ---EMTNSPVFENYFRDKILADNYRRDREALERILQSGR-SGTA-------ITREAVLSV
W0RI74          ---MAVGQPIFNAFFTRKTEVDQLKRDRESLERLLGQIKAPGST-------LAPEILLTV
A0A3M2BJA6      ---EAEANAQVTELARLQADRNAIDAERSALQELMDEIDREATT-ADPAGPSPYRRLLSF
A0A7Y5QXY3      ---SSEITALYTNVHELEGQQQAAMLERSVYEQLLGKLT-QADTVD-----DDLRRLAGT
A0A2V7PX99      ---DGKGDPVYSRAFELRLNIEQLRRERRVIEKALADQP---------KSGLPVEALAVL
A0A2V7ERC7      ---QTAGDPAFTTYFQQKATLDEVRNDRMAIERILSDAR-GGPI--------NPQAFLVL
A0A7V9QLH4      ---KSQGSSQVTRLVDMQAERSKIETERSALAQLLKEVNAAAAAPQAAGVASPYRRLIAF
A0A7Y4RSP8      ---QMTEQTAYGRYFDQRVQLETVRNDRRAIEDVLRRLT-SGEI--------AVDAFQTI
A0A838W6Q3      ---QDQATTEVRQTADLVAQHNVIEAERVALARVLNYAEVNRSSNTDNTTSSSYRDLVAF
A0A7V9U4Z2      ---AARAGAQEAGIIQIDTKRSELDAEKRTATSLIAQAK-ASPQ----NMSGSLRVLISQ
A0A5Q4D6Y4      ---QAQGTEEQLGLINIEMRREELLADRSMYQSILGELG-SADP-G--EMGERIQAIVAT
A0A7Y3MUW4      ---SFEEQDLVNEGHRLADEVERYEWHLSVFRALIGGME-QSGA-------EGVDLVRFL
A0A848XQ54      ---SFEEQDLVNEGHRLADEVERYEWHLSVFRALIGGME-QSGA-------EGVDLVRFL
A0A7V9QB34      ---RTQATEQVRRLAELQASRDGMDAERETLQRVLTGIE-HSAQGN--AGPSPYRQLAAF
A0A2V7JTZ5      ---VTQGDPVVASYFQQKVALDEIRSERQALERMVSEAK-GGPI-------NPQDFLQLP
A0A3D4YTR6      ---AGQVDPVVGNYFQQKAALDEVRSEREALERMIADAK-GGPI-------DTQGFLQLP
A0A7V8VRF0      ---SNKLQSEQHDLAQLDARIDELAAQRQMYGSLLGALQ-AGQT---DRRQDGLRTLMAS
A0A2V7F1M1      -------------LTALDARLGELEAERSVYESFLTKFN-TSND---SLRLDVARDLSYT
A0A841GJ36      -------------LAADQAEYDRLRSERQSLATLLAEVT-AAARAGVSNGTSGTSPYRRL
A0A838NJX4      -------------LLTLESQRAELDSDRRTFGTLLAQLK-TSDEAS---RQEALRALATS
A0A2V7KXK7      ---GGLTVEGSGVVTQLRTDMDQQRRDRQQILSLATRAQ-SSSV--------PVQLWNSI
A0A651HKD3      ---VDGSSPAMDAYIDLQLGAEELERDRGALLRALEAGG-GAGI--------RIQALEAI
A0A843T4K9      ---EQTRDPAISSFFEMRLDREALRQDRDQLETILQRIE-SGEL--------TVGALSAV
A0A2V7QDU7      -------------FAELQAQRNALDAERRALEQLLSSTA-SSVA-G-----STQSTPIAF
A0A6J4M9S2      ---REKFASRQEGLMTLQVRREELAADRQLFQSMAAGLT-GSPA----ARDRALMSVASY
A0A2V7ITT6      ---ELTRDPGVAAFFNMKVEREQLRRDREAIELALAQAA-DSAA--------SWDALSVI
A0A2V7NJW1      ---ELTRDPGVAAFFNMKVEREQLRRDREAIELALAQAA-DSAA--------SWDALSVI
A0A7V4KNE3      ---QQTQPQVLTQYFGEKLELERLRREREEVERAVALTG-RSDF--------SPDALLTV
A0A7Y5PAU0      ---EMSRDPVLKSYFDRKIEYDNLRNDREALERVLANAQ-NGTV--------PYESLLLI
A0A7V9TKH4      ---PGGGDPMIGNYFGQKAQYLTVQHDIAMLQIL---AR-DPNT-------ITADAFIGI
A0A2V7GFB5      ---DTPRDPVLGDFFEQQVQRQQVARDRAALTRVL--AQ-PADS-G-----LA-SALEVI
A0A2V7RQ86      ---DTPRDPVLGDFFEQQVQRQQVARDRAALTRVL--AQ-PADS-G-----LA-SALEVI
A0A2V7IWX2      ---APPPSPAFTNAFELRVAVDQLGRDRQAIDRVL--AQ-QPDS-G-----LSVDALAAI
A0A1Q7KE95      -----GGGPPLGTLLGPKLEQEQLRRDRDAIEQVL--VQ-MRDS-G-----GSPDGLAFI
A0A1Q7T8X5      -----GGGPPLGTLLGPKLEQEQLRRDRDAIEQVL--VQ-MRDS-G-----GSPDGLAFI
A0A2V7MS64      ---QFPHDPVFAGLFDMKVNREELRRDRAAIDRIL--AQ-GSDA-D-----LAVDALTMI
A0A2V7Q7N9      ---EFPRDPVFAGLVGMKVNREELRRDREAIGRIL--AR-GPDS-A-----LAVDALATI
A0A2V7IRW6      ---QFPRDPVFAGLLDMKVNREQLRRDREAIARIL--AQ-GRDS-G-----LAVDALAMI
A0A1Q7DVU6      ---QFPRDPVFAGLLDMKVSREQLRRDREAIARIL--AQ-GRDS-G-----LAVDALAMI
A0A1Q7JSV2      ---QFPRDPVFAGLLDMKVSREQLRRDREAIARIL--AQ-GRDS-G-----LAVDALAMI
A0A2V7FK98      ASGASADDPAFASFFRMQVDRQQVQQDRDALERVL--KQ-AGDS-G-----VSPEALAIV
A0A2V7R3Z8      A-GASADDPAFASFFRMQVDRQQVQQDRDALERVLAQAQ-ASDS-G-----VSPEALAIV
A0A2V7J3C0      ---SAGRDAAFGSLFAPRLEEEQLRRDRSAIQQVL--AR-MRDS-G-----GSPEGLAFI
A0A2V7KWV9      ---SAARTSPVSEFLTRRVQEDQLRRDQDALAQVL--AQ-GPDSLG-----FS-ERLAAI
A0A1Q6ZHP2      GA-VAARDPVFGSFFDMQISREQARRDRDALDRLL--AQ-AGDS-G-----LSAEALSVV
A0A1Q7R6Z6      GA-VAARDPVFGSFFDMQISREQARRDRDALDRLL--AQ-AGDS-G-----LSAEALSVV
A0A2V7FYT7      GA-VAARDPVFGSFFDMQISREQARRDRDALDRLL--AQ-AGDS-G-----LSAEALSVV
A0A2V7IGR0      GT-GADRDPALTSFFDLQIEQQQAHQDRKAILQAL--AQ-ARDS-G-----LSATALEAI
A0A2V7MR23      TGPAGARDPLFGSFFEMQISREEARRDRDALQRLL--AQ-QGDS-G-----LSVEALSVV
A0A2V7L1V3      GQ-VGEADPKFGTFFTMQFDRERIQQDREALQRLL--QA-RDSA-G-----LSADALAVV
A0A1Q7E5D3      AG-DVAGDPVFTHFFDTQVEREQVRRDRETLERVL--AQ-AGDS-G-----SSADALSVI
A0A2V7ISE2      AA-GGARDPVFGGFFETQLTREEARRDREALGRLL--AQ-AGDS-G-----LSPEALSVV
A0A1Q7J2X5      AA-GGTRDPVFGGFFDMQLTREEARRDREALGRLL--AQ-AGDS-G-----LSAEALSVV
A0A2V7NPD1      AA-GGTRDPVFGGFFETQLTREEARRDREALGRLL--AQ-AGDS-G-----LSAEALSVV
A0A2V7QPD8      -----GDDPAFKNFFTMQVDREQARRDREALERVL--AQ-AGDS-G-----VSPEALAIV
A0A2V7Q8M6      A----ESDPKFGTFFGMQADRDRIQQDREALQRLL--AP-ASDSSG-----LSADALAVV
A0A2V7QBC3      A----ESDPKFGTFFGMQADRDRIQQDREALQRLL--AP-TSDSSG-----LSADALAVV
A0A2V7LMU1      GA---ELDPKFGTFFNMQFDRERIQQDREALQRLL--AQ-VRDSTG-----ISPDELAVV
A0A2V7PBY9      SA-NGEASAQFGTFFNMQFDRERLQQDREALERVL--AQ-AGDTAG-----LSPDALAVV
A0A2V7J4D7      ---QYPRDPMFAGLVDLKVNLDEVRRDRTAIERLLAPST-DPTV-E-----VPVDALSMV
A0A2V7LN90      ---EFPRDPAFAGLLGMKVNREELRRDRDAIGRILAQR---PDS-G-----LAVDALATI
A0A2V7LFN9      ---QYPQDPVFAGLLDLKVRRGDLLRDRAAIKRILAQG---PES-G-----LMVDALATL
A0A2V7MEK4      ---RYPQDPVFAGLLDLKVRRGDLLRDRAAIKRILAQG---PES-G-----LMVDALATL
A0A2V7EU00      ---EATRDPVFRNFFEMRIMREQLRRDREAVLRVLAQA---PES-G-----LAVAGLEVI
A0A1Q6WE01      ----AGVQSPMSEFFGLRMAYDQMRRDQLAVAHVLTQA---HDS-A-----ASIDALAAI
A0A2V7S9K3      ----PPKGSPLGDFFDLQVEQGQLRRDQQAITQALDQM---RDS-G-----ASVEGLGFI
A0A1Q7DXB9      -------SPAFTNAFELRVAVDQHGRDRQAIDRVLAQP---PDS-G-----LSVDALAAI
A0A1Q7JD32      -------SPAFTNAFELRVAVDQHGRDRQAIDRVLAQP---PDS-G-----LSVDALAAI
A0A2V7MVP8      -------SPAFTNAFELRVTRDQLGHDRQAIDRFLAQ----PDS-G-----LSADALVVI
A0A2V7N0A9      ---RITADPTYAGYMDLQIAASGLARDREAIAQMLVHA---PDS-G-----IAVDQLAMI
A0A1Q7DLS9      ---QFTHDPGFASYFETKVNLEQVRRDRAAIERLLAQV---RDS-G-----LPVDALAAI
A0A1Q7JK96      ---QFTHDPGFASYFETKVNLEQVRRDRAAIERLLAQV---RDS-G-----LPVDALAAI
A0A2V7KQV7      ---RITADPTFASYVDLQVAIDGLARDREAITQVVARA---RDG-S-----VPVDELSMI
A0A1Q7JGF6      ---RITADPTFASYVDLQVALGALAHDREAIARVVAHA---ADS-G-----VAVDQLAMI
A0A2V7SG67      ---RITADPTFASYVDLQVALGALAHDREAIARVVAHA---ADS-G-----VAVDQLAMI
A0A1Q7GIK9      ---RITADPTFASYVDVQVTLDGLTRDRAAIAQVLTHA---ADS-G-----VAVDQLAMI
A0A7W0YSQ1      ---A-EQTSLIQSINLFEGQRDAVLVERGVYQQLLGSLS-AADT-T----TEDLRRLGGT
A0A3M2BLV5      ---R----------QDALERLQQLDDQRQALQNLMVDIQ-AAGV-E------GVDIVAFL
A0A2V7KS68      ---E-TRDPIRSNYFDMEADRDQLRRDREAIEGLLPAGG-G--P-L------PADALSAI
A0A2V7N4L3      ---D-THDP-RAGFFDIQVERDQVRRDREAIDNLLAQ-G-WDSG-V------PTAALSAI
A0A1Q7AZK2      ---D-TRDPIRTSFFDMAVERDQLRRDGDAIDRLLAQGG-GGDG-L------PTEALSAI
A0A1Q7TNP7      ---D-TRDPIRTSFFDMAVERDQLRRDGAAIDRLLAQGG-GGDG-L------PTEALSAI
A0A1Q7KG39      ---D-TRDPIRTSFFDMAVERDQLRRDGDAIDRLLAQGG-GGDG-L------PTEALSAI
A0A1Q7GX75      ---E-SRDPRRANFFEMQVDRDQLRRDRDAIDRLLAEAG-GASG-L------PTAALSAI
A0A1Q7LL80      ---E-SRDPRRANFFEMQVDRDQLRRDRDAIDRLLAEAG-GASG-L------PTAALSAI
A0A2V7PFU2      ---E-TRDPIRASFFDMAVERDQLRRDRDALERLLTQAG----G-L------QTDALSAI
A0A2V7MFS9      ---G-TRDPIRASFFDMQVERDQLRRDRDALQRLLTQ-G-GDSG-L------PTDALSAI
A0A2V7T933      ---D-TRDPIRTSFFDMAVERDQLRRDGDAIDRLLAQGG-GGDG-L------PTEALSAI
A0A841GX23      ---T------EEGLANFRLQRQKLVGEKSIYDQMGRELT-SDAG-R--EGAEQIAALAAS
A0A7V9AJ94      ---Q------VRRLAELQANRDALQMERESLRRLLGRIE-SQPA-ARPSERSPYRELAAF
A0A7Y3MYM3      ---R---------MEALFAAERELDELRFTQTVLQGRLD-QLAG-A--PAEQEGEILSSI
A0A848XLS5      ---R---------MEALFAAERELDELRFTQTVLQGRLD-QLAG-A--PAEQEGEILSSI
A0A7V9FIM2      ---E------QTALLALDSRREELDADRQTFTSLLGRLK-APDD-A--SRAEALRALATS
A0A7W0WMB8      ---E------QVAAISLDTRIAELGADRETFGALVGRLK-SGDE-A--GRTEALRALATS
A0A2V7P8B1      ---E------QTEVPGLELQRQQLLAERRTDEDLLAAL---QDS-S--TSRKAIQTALST
A0A7C2QQS2      ---Q------QQMLLELEARRDSLAAARAAFQSLLASL----QR-N--PQDPSVQGIITA
A0A2V7QN41      ---T-LRGGGDPVFERSFDTKLALDSVQRDRQALQRAL---AQT-G--DSGPPIEALQAI
A0A2V7R603      ---S-LRGGGDPVFERSFDTKLALDSVQRDRQALQRAL---AQT-G--DSGPPIEALQAI
A0A7Y5VC49      ---R------DPSFTALYDQRAELDSVRADRAALERALD-GAKA-G--VDPAAL---LAI
A0A2V7LJS2      ---E------QTELPGLELQRQQLLAERRTDETLLKAL---QDS-S--TSRRAIQTALST
A0A1Q7GLJ7      ---E------QSELPGLELERQQLMAERRTDEALLAAL---RDS-S--TSRKAIQTALAA
A0A2V7GRE3      ---E------QAGLAGVELQRQQLEAERRTDESLLAALR-DRDS-S--VSRKALQTALAT
                                                                            

A0A838NTH4      PSFITN--R---AMQDILQSLIQLENERSQLLI---RRNPENADVVAVSKRIGDLERQLS
A0A2D5ZJF2      GRVGTT--PFNQEKVQLHRDASQLQLELADLQR---QVTSDHPAVESLESKIARIKGE-L
A0A0S8H9P3      STEEVN------RTVQFYYDQLLELLEERSSQLGPLGKDPSHPVIMALDQRISETQDQLV
A0A1E4BBP7      GSATAS----NTSLQAEIANLNQARGQLVNLQK---TYTDEYRMVKDLKQQIEVMESQSI
A0A3M2G737      RDVTITQNPALAGQEAYIEKMAEINAQIEALRSKLQQRTEEYRKSILKDENLTASDILEL
A0A0H4TUX7      QDIGQN--T---ALGFQIQNLLTLYDQRRTLTAGALGLRERNPQVDALSERIRQGYQALR
A0A1G0LUG0      QGIAQN--N---ALGFQIQSLLTQYEERRKLTAGALGLRERSPQISALDDRIQQGHQALR
A0A1Q7E3T7      PAISAN--A---VVAPLFTQLVQYENTRDSLT----ARSTTHPDVPRLNQLLVATEGKLL
A0A1G0L906      TGIANN--T---AMTFQIQNLLKLHDDRRTLVAGSLGLRESNPQVQAIDQRITQAAAALR
A0A1G0LCC0      TGIANN--T---AMTFQIQNLLKLHDDRRTLVAGSLGLRESNPQVQAIDQRITQAAAALR
A0A2D5ZJE2      DDAAAS--P---LVIQLREQLVALQIEHTSLLVR--GASEDSPQIIDLESKVKQAKTRLA
A0A3M2G624      PFQDEEGYGYWDVLSQLTSQLMELEIQLPLKLE---EMTENHPDIIALKNQIQQVRLRLQ
A0A6M4IRY1      PSVNTD--PAAENLRRVLADFADRELSLRKLRE---SYTDELPRVQNEIAALASLRSS-I
A0A3D4VBZ5      PAVNAD--PAAENLRRALEERAARELELRRLRE---TYTDEYQRVKDAQAALVALRDTVV
C1A5W1          PAVNAD--PAAENLRRALEERAARELELRRLRE---TYTDEYQRVKDAQAALVALRDTVV
W0RI74          PTLAND--PGAAGVKQTVDELTHATVDLRVKLQ---TLTDSNPLVVDARRNIAELHDRVL
A0A3M2BJA6      PTLLKN--Q---STSELLRSLTEVENQRSVLLQ---RRTMADDDVQQFTQRIRELEAQLR
A0A7Y5QXY3      EAITKN--TYVANLYNRWFDLLKTREEIMAT-----GKNSNDRDVQATEKLIQRTKRDLQ
A0A2V7PX99      PTVGTS--P---ELNTALQEINQKEADLRALRT---RYTDASAPVQQARSDLDALEQRTV
A0A2V7ERC7      PSILNN-TP---QLRTAIEELSSRQAALRTEQQ---YLTNANPRIKQLGEAIRVLEIETI
A0A7V9QLH4      PTLLRN--E---AASEILRSLSSVEDERAKLLT---RRTAADPDVAVLTNRITELEDQLR
A0A7Y4RSP8      SSVRSA--P---ELSKVLAELTVADAELRALRT---KYTDEFKGVKDLQDRVNTLRSSTI
A0A838W6Q3      PSLLRN--QAVSSLLSSLNQVEDRRADLLA------RRSPSDHDVMILTRRAEEIEQQLH
A0A7V9U4Z2      PGIGSN--P---VVQQLYGQLTQYEKARDDLLTA--GQAPSNPDVVALSSLIPATASKMI
A0A5Q4D6Y4      PEVAAN--P---VVSSLHAQLMELETERQALTSGPWGLSQTNPDVARIDQQIATTGGRLE
A0A7Y3MUW4      AELPADANP---EIRMGATRIQEKTNELDRVLTLD-LKTRAHPAAQALINQIGLLEVELL
A0A848XQ54      AELPADANP---EIRMGATRIQEKTNELDRVLTLD-LKTRAHPAAQALINQIGLLEVELL
A0A7V9QB34      PTFIAN--G---TVQNILQSLILLENRRAELLV---QRTPQHVDVQGVEGRVRELEVQLY
A0A2V7JTZ5      TILNNA--P---QLRSAIEELSLRQATLRTEQQ---FLTDANPRIRQLAEAVRVLERETI
A0A3D4YTR6      TILNNA--P---QLRSAIEELSLRKATLRTEQQ---FLTDANPRIKQLAEAVRVLETETI
A0A7V8VRF0      PGIRDN--L---AVAQLHGRLTKLQATYDSLSTGPWRRAETDPDVVRLRSLIAGVDSQLV
A0A2V7F1M1      PELAAD--P---VVSRISQQVLVYRTRLDSLTTGPLPAAPTNPDVLGLKALIRSTQEELV
A0A841GJ36      ASFPVF--LVNRAVQDMLQSLTALETRRSEVLV---QRTEVDNDVQSINERIGQIEEQLL
A0A838NJX4      PAMADN--P---AIGGLYQQLLRYQMRIDSMTTGPWKASATNPDLIQANALARSTQNQLV
A0A2V7KXK7      PSVQND--P---VMKGALDELGLKQAQLRQLRL---QYTDSAAPVRQLQSDLTTLEHQQI
A0A651HKD3      PAVQSS--S---ELMGALEQVAEARAERRALLQ---RYTEEYPSVAELDAQLRTLEGQVV
A0A843T4K9      PSVERS--F---ELRDAITEWASKQSELQTLEQ---RYTDEYPPLQRVRGDVARLEEIVI
A0A2V7QDU7      PTLLRN--EVAASLLSALAQTEDRRSELLS------RRSPQDADVQVLTRRIEDLRAQLR
A0A6J4M9S2      PGIAAN--P---AISQLYTQLSQYQNRRDSLTSGSMGSTGDHPDVERLNGLIARTEAKLV
A0A2V7ITT6      GSVQQS--P---GLMQALKELTDKQAEQRALGY---RYTADFSRVGYVREQVDTLERKTI
A0A2V7NJW1      GSVQQS--P---GLMQALKELTDKQAEQRALGY---RYTADFSRVGYVREQVDTLERKTI
A0A7V4KNE3      DAVRQA--P---ELNRTLNDLTAAEAELRDLRV---KYTDRAQPVQQQLERIDSL-RQLV
A0A7Y5PAU0      PSVSNN--PGASGLRSSFEELNKRQSELNAARQ---IYTDAFPQVRDLAGVVQTLKTKTI
A0A7V9TKH4      PSAQAS--P---ALQATLTDLSKREAALRAARE---SYTDEHRIVQDLRLSVQTMRTQTL
A0A2V7GFB5      DAVQHS--P---ELKGALQELTTKQADLRNLRY---HYTEAYPPLARKAAEVATLERQTI
A0A2V7RQ86      DAVQHS--P---ELKGALQELTTKQADLRNLRY---HYTEAYPPLARKAAEVATLERQTI
A0A2V7IWX2      DAVQKS--P---ELTQALKELTDKQAELRALRY---TYTDQHFPVQQLADAVATLDRRTI
A0A1Q7KE95      GAVQRS--P---DVSQALRELTTKQAERRALAS---KYTDDHPAVQRLIGEIELLERGTV
A0A1Q7T8X5      GAVQRS--P---DVSQALRELTTKQAERRALAS---KYTDDHPAVQRLIGEIELLERGTV
A0A2V7MS64      GSVQKS--T---ELAQALRDLTSKQAELRAIRS---RYTDASPAVQRIALDVKTLQRQTI
A0A2V7Q7N9      GSVQKS--T---ELSQALHDLTTKQAELRALRT---RYADANPAVRRVAVEVQDLERRTI
A0A2V7IRW6      GSVEKS--T---ELSQALRDLTGKVAELRALRG---RYTDANVAVRRVSDEVAVLEQQTI
A0A1Q7DVU6      GSVEKS--T---ALIQALRDLTGKVAELRALRG---RYTDANVAVRRVSDEVAVLEQQTI
A0A1Q7JSV2      GSVEKS--T---ALIQALRDLTGKVAELRALRG---RYTDANVAVRRVSDEVAVLEQQTI
A0A2V7FK98      GSVQQN--V---QLKQALDELTTKQAELRALRY---KYSDEYPLVQRRLSEVATLERQTI
A0A2V7R3Z8      GSVQQN--V---QLKQALDELTTKQAELRALRY---KYNDAYPLVQRRLSEVATLQRQTI
A0A2V7J3C0      GAVQRT--A---DVSQALRDLTVKQADERALRA---RYTPEHHAVQQLRAEIAALEQRTI
A0A2V7KWV9      GAVQGS--A---DLTRALTELTTKRAERRALLY---RYTDDHPAVQRVTTDLEQLEHQTI
A0A1Q6ZHP2      GLVQAN--P---ELTQALTELMTKQAELRALRY---KYSDAYPPVQRLLGEIATLQRQTI
A0A1Q7R6Z6      GLVQAN--P---ELTQALTELMTKQAELRALRY---KYSDAYPPVQRLLGEIATLQRQTI
A0A2V7FYT7      GLVQAN--P---ELTQALTELMTKQAELRALRY---KYSDAYPPVQRLLGEIATLQRQTI
A0A2V7IGR0      GAVQHN--A---DLAQALKELVTKQADLRVLRY---QYTDAYPRVQRLTAEIATLQRQTI
A0A2V7MR23      GLVQQN--P---ELSQALTELNNKQAELRSLRY---KYTDEYMPVQRLLGEIRTLQRQTI
A0A2V7L1V3      GSVQGN--P---DLAAALTELTSKRANLRALRY---RYSDQYPPVQRLVGEIGTLERQTI
A0A1Q7E5D3      GSVQRH--A---ELSQALKELTAKQAELRALRY---RYSDAYPPVQRLLAEIATLKRQAI
A0A2V7ISE2      GSVQQN--P---ELSEALKELTDKQALLRTYRY---KYSDEYPPVQRLLGEIATLQRQTI
A0A1Q7J2X5      GSVQQN--P---ELSEALKELTDKQAQLRAYRY---KYSDEYPPVQRLLGEIATLQRQTI
A0A2V7NPD1      GSVQQN--P---ELSEALKELTDKQAQLRAYRY---KYSDEYPPVQRLLGEIATLQRQTI
A0A2V7QPD8      GSVQQN--A---DLKQALAELTTKQAELRALRY---KYSDQYPLVQRRLSDVATLERQTI
A0A2V7Q8M6      GSVQGN--P---DLAAALTELTSKRASLRALRY---RYSDQYPPVQRLVAEIATLEHQTI
A0A2V7QBC3      GSVQGN--P---DLAAALTELTSKRASLRALRY---RYSDQYPPVQRLVAEIATLERQTI
A0A2V7LMU1      GSVQAN--P---DLAAALTELTSKRANLRALQY---RYSDQYPPVQHLTGEIATLERQTI
A0A2V7PBY9      GSVQSN--P---DLVGALGELTSKRASLRALRY---KYSDQYPPVQRLIEEITTLQRQTI
A0A2V7J4D7      GSVQRS--T---ELVQGLRDLTSKQAELRALRA---HYTDANPPVRRLASEVDELAHRTV
A0A2V7LN90      GAVQKS--T---ELSQALHDLTVKQAELRALRT---RYADANPAVRRVAAEVAELERRAI
A0A2V7LFN9      ASVERS--T---ELSQALRDLTAKQAVLRALRV---RYTAEAPAVRRVAAEAATLERQTI
A0A2V7MEK4      ASVERS--T---ELSQALRDLTAKQAVLRALRV---RYTAEAPAVRRVAAEAATLERQTI
A0A2V7EU00      GTVHNS--S---DLVEALKELTAKQAELRALRY---RYTDEHPPVKRLQASIETLERHTI
A0A1Q6WE01      GAVQQS--L---DLKQALSELTTKRAELRALRY---RYTEDHPAVRRLTTDIDVLQRQAI
A0A2V7S9K3      GAVQRS--P---ELSDALREVTTKRAELRALRY---RYTDDHPTVRRLAAEIDVLEHQTI
A0A1Q7DXB9      DAVQKS--P---ELTQALKELTDKQAELRALRY---TYTDQHFPVQQLADAVATLERRTI
A0A1Q7JD32      DAVQKS--P---ELTQALKELTDKQAELRALRY---TYTDQHFPVQQLADAVATLERRTI
A0A2V7MVP8      DAVQKS--P---ELMQALKELTDKQAELRALRY---TYTDQNFPVQQLADAVATLEHRTI
A0A2V7N0A9      GAVQRS--S---ELIAALKELTDRQAELRALRF---RYADTHPPVRRLAAQVDTLARRVI
A0A1Q7DLS9      GAVDRS--T---ELVAALRELTAKRAELRALQQ---RYTEEHGTVRRLAGEVQALEGRTI
A0A1Q7JK96      GAVDRS--T---ELVAALRELTAKRAELRALQQ---RYTEEHGTVRRLAGEVQALEGRTI
A0A2V7KQV7      GAVQRS--S---ALAAALKDLADRQAELRVLRF---RYADTHPPVRRLAQQVDTLARYVI
A0A1Q7JGF6      SAVQHA--S---ELTAALKELSDRQAELRVMRF---RYADTHPPVRRLAQQVDTLARRVI
A0A2V7SG67      SAVQHA--S---ELTAALKELSDRQAELRVMRF---RYADTHPPVRRLAQQVDTLARRVI
A0A1Q7GIK9      GAVQRS--S---ELTAALKELTDRQADLRALRF---RYADTHPPVRRLALQVDTLAQRVI
A0A7W0YSQ1      SAIESN--P---YIASLYTQWFDLVKRRSELITQE-RRGTDYIDVEATDSLIAATKTDLQ
A0A3M2BLV5      AALPQGVNP---QITAIAEDIRDKQDEIQRLLTEE-RVTPDHPRVQAIRTQLARDEGSLR
A0A2V7KS68      ESVQHA--P---ELANALKELGDKRAELRTLRY---HYSDAYPPLQRLAGQVAQLEQQTI
A0A2V7N4L3      GSVQHA--P---ELSSALKELGDKEAEVRTYRY---HYSDAYPPLQRLLAQVGELQQRTI
A0A1Q7AZK2      GSVQHA--P---ELSNALKELSDKQAQLRTYRY---HYSEAYPPVQRLAREISELQQRTI
A0A1Q7TNP7      GSVQHA--P---ELSNALKELSDKQAQLRTYRY---HYSEAYPPVQRLAREISELQQRTI
A0A1Q7KG39      GSVQHA--P---ELSNALKELSDKQAQLRTYRY---HYSEAYPPVQRLAREISELQQRTI
A0A1Q7GX75      ESVQHA--P---ELSNALKELSDKEAQLRALRY---HYSDAYPPVQRLAAEIAELQQRTI
A0A1Q7LL80      ESVQHA--P---ELSNALKELSDKEAQLRALRY---HYSDAYPPVQRLAAEIAELQQRTI
A0A2V7PFU2      KSAQDA--P---ELSNALKELSDKQAQARTYRY---HYSEAYPPLQHLAAEITELQERTI
A0A2V7MFS9      ESAQRA--P---ELSNALKELSDKQAQLRAYRY---HYSEAYPPLQRLVSEIAQLQQRTI
A0A2V7T933      GSVQHA--P---ELSNALKELSDKQAQLRTYRY---HYSEAYPPVQRLAREISELQQRTI
A0A841GX23      PEVASN--S---GIMLLYQSLVRYQTARDSATTGQWARAGSNPDVQQLDSLIATYRGRLI
A0A7V9AJ94      PAFITN--A---TVQNILESLIQQENERARLLV---QRTPQSIDVQGIDQRIGELELQLY
A0A7Y3MYM3      MNLGDTYVQ---GASAYNSQYQQLISERRALTGGRFGMTAESERVQMLDSRIGSLVVSMR
A0A848XLS5      MNLGDTYVQ---GASAYNSQYQQLISERRALTGGRFGMTAESERVQMLDSRIGSLVVSMR
A0A7V9FIM2      PAMADN--P---AIGGLYQQLLRYQVRLDSMTTGPWRASPTNPDVLQLKSLARTTQDQLV
A0A7W0WMB8      PAMADN--P---NVTNLYRSLINYQDKLDSLTTGPWRSSATNPDVIQLKALATNTQTRLG
A0A2V7P8B1      PGVAPN--P---AVVQLNTQLLHYEMARDSLV----SLSPTHPDLRRLSLLIPPTEAKLL
A0A7C2QQS2      PEIAAN--P---VIAQLYTQYVRLQLSRDSLISGPWGSTRTNPDVQRLEALIASTQAR--
A0A2V7QN41      GAVQKS--A---ELSLALQEVTQRQATLRALRY---RYTDASDPVQRVRGEVRTLLQTTI
A0A2V7R603      GAVQKS--A---ELSLALQEVTQRQATLRALRY---RYTDASDPVQRVRGEVRTLLQTTI
A0A7Y5VC49      PSVRSA--P---ELAPALDDLTKAQTRLETLRR---TYTDEYKAVRDARADVDRIRQQTL
A0A2V7LJS2      PGVAPS--P---AVVQLNTQLFQYEIARDSL-A---SLSPSHPDLPRLNLLISSTEAKLL
A0A1Q7GLJ7      PGMGAS--P---ALSQLSAQLFQYEMARDSL-A---SRSARHPDLPRLNLLVSSTEAKLL
A0A2V7GRE3      PGVAAS--P---SVMQLSTQLYQYERARDSL-A---SRSTSHPDLPRLNQLVSSTEADLL
                                                                            

A0A838NTH4      QMARA-----------------------YLA----GVD--------SKLASLNSGVQSFG
A0A2D5ZJF2      EALDR-----------------------TTGEAYLELARQQWLVARERETELDQRYRTQL
A0A0S8H9P3      AAAEN-----------------------AAV----ALD--------TRIGALTGRLSNLQ
A0A1E4BBP7      PTLVA-----------------------SSL---QELR--------SREAEMKRRIDGAS
A0A3M2G737      RTSIF-----------------------AAQMEMQTLK--------TKKEILDSTIADYE
A0A0H4TUX7      GAVSA-----------------------ALE----SLE--------SRTEALDQRVASAR
A0A1G0LUG0      TAVGA-----------------------ALE----SIE--------ARRQALDLRVQELR
A0A1Q7E3T7      RAVQS-----------------------ALKGLIASLD--------VRIATLDDLRVRRV
A0A1G0L906      EAANA-----------------------TVR----GIQ--------ANIASLDQNVANLR
A0A1G0LCC0      EAANA-----------------------TVR----GIQ--------ANIASLDQNVANLR
A0A2D5ZJE2      AETQKIVDRDLLPGDPLLYSQGLVEKVLELRTELETAR--------SRAAELNRFVADYA
A0A3M2G624      QQVDA-----------------------RLT----MLD--------SREESLRLQLLPYQ
A0A6M4IRY1      PSVLE-----------------------SYL---TQLK--------LREQTLVSTIDQSS
A0A3D4VBZ5      PRSLD-----------------------AYL---GELR--------LREQTLNSTIEQSS
C1A5W1          PRSLD-----------------------AYL---GELR--------LREQTLNSTIEQSS
W0RI74          PQRLT-----------------------DYI---ATLR--------TRESQYGQELQTAT
A0A3M2BJA6      TVATT-----------------------YLQ----GLT--------NQVQSYDQTLEQFA
A0A7Y5QXY3      EASRV-----------------------YLE----GIQ--------SRLASYDKSIADLR
A0A2V7PX99      PALAR-----------------------KLA---ADLS--------AREAALTPQVDSAF
A0A2V7ERC7      PRIAQ-----------------------SVL---ESLR--------SRENQLTGRIDTQE
A0A7V9QLH4      QIAVT-----------------------YEE----GLK--------NQVAAEDASMAAFS
A0A7Y4RSP8      PAYAR-----------------------ALA---RQLA--------IQEGDLDSRINSAG
A0A838W6Q3      TVAVG-----------------------YLQ----GLN--------SQAAALDGVLASSN
A0A7V9U4Z2      DAVES-----------------------HIQ----SID--------AQIQAMDRQRATGA
A0A5Q4D6Y4      SAVRS-----------------------HMQ----NLD--------ARLAAMTDLRARTA
A0A7Y3MUW4      AAVRA-----------------------SI----GVTE--------QRLIQASSDLADIR
A0A848XQ54      AAVRA-----------------------SI----GVTE--------QRLIQASSDLADIR
A0A7V9QB34      QLARN-----------------------YLD----GVD--------SGIVSLDAQLGRFA
A0A2V7JTZ5      PQITV-----------------------AVL---NSLK--------AREPELDTRISVGS
A0A3D4YTR6      PQITQ-----------------------AVL---NSLK--------AREPELGARIDVGS
A0A7V8VRF0      STVQG-----------------------ELV----WIE--------TTLQTLGGTRARSV
A0A2V7F1M1      RAVRA-----------------------HLT----SIG--------AQSQALAALRSRTG
A0A841GJ36      QLARS-----------------------YLASLDSQIA--------SKQSSLNR----FG
A0A838NJX4      QAVSS-----------------------HI----GALG--------ARVDALGALSQRTG
A0A2V7KXK7      PSLAR-----------------------ILA---GTLG--------EVVATTKPRADTAI
A0A651HKD3      PSLAR-----------------------EIL---EDLE--------ARLGEVTSRLQTRS
A0A843T4K9      PATAG-----------------------RLA---AQIR--------MEEEQTEGQLAAAS
A0A2V7QDU7      GIAAT-----------------------YLQ----GLS--------NQVVAIDLTLAKSN
A0A6J4M9S2      DAVKS-----------------------HVS----VLD--------ARIAALDGLEARNS
A0A2V7ITT6      PGLAR-----------------------ALI---RELA--------MRESVGDARIRLAS
A0A2V7NJW1      PGLAR-----------------------ALI---RELA--------IRESVGDARIRLAS
A0A7V4KNE3      PRTAQ-----------------------ALL---GTLR--------AREQALDQKISAAT
A0A7Y5PAU0      PAQAN-----------------------ALL---TQLR--------EREGDYDRRIRGAS
A0A7V9TKH4      PQVLN-----------------------TLI---ADLQ--------ARGTDLSRQMASAS
A0A2V7GFB5      PTLVR-----------------------SLI---DELG--------TRMAELDRRIGSAS
A0A2V7RQ86      PTLVR-----------------------SLI---DELG--------TRMAELDRRIGSAS
A0A2V7IWX2      PGMLR-----------------------ALR---NNLA--------ARERDLGQRVDSTV
A0A1Q7KE95      PTLAQ-----------------------SLI---DELT--------ARERVLAPQVAAAD
A0A1Q7T8X5      PTLAQ-----------------------SLI---DELT--------ARERVLAPQVAAAD
A0A2V7MS64      PSLAT-----------------------QLA---SELG--------LRETELAQRINAAS
A0A2V7Q7N9      PDLAA-----------------------SLT---REMQ--------FREVELAQRVDSAA
A0A2V7IRW6      PALAT-----------------------KLT---QEMA--------VQEAGLAQRVDSAA
A0A1Q7DVU6      PALAT-----------------------KLT---QEMA--------VQERVLAQRVDSAA
A0A1Q7JSV2      PALAT-----------------------KLT---QEMA--------VQERVLAQRVDSAA
A0A2V7FK98      PTLAR-----------------------QLM---AELS--------GREAELGRRVTADA
A0A2V7R3Z8      PTLAR-----------------------QLM---AELS--------GRDAELGRRVAADT
A0A2V7J3C0      PALAE-----------------------SLS---AELL--------ARERVLAPQIAAGE
A0A2V7KWV9      PGLIR-----------------------GLV---AELA--------TQRRALASQLETGG
A0A1Q6ZHP2      PTLAR-----------------------QLA---GQLA--------AKETELGRRVDADS
A0A1Q7R6Z6      PTLAR-----------------------QLA---GQLA--------AKETELGRRVDADS
A0A2V7FYT7      PTLAR-----------------------QLA---GQLA--------AKETELGRRVDADS
A0A2V7IGR0      PALAQ-----------------------ALA---GELA--------AREAELGRRVETGS
A0A2V7MR23      PTLAR-----------------------TLA---GQLA--------AKEAELGRRTDADS
A0A2V7L1V3      PALAR-----------------------VLL---DQLA--------AREAELGRRLGADS
A0A1Q7E5D3      PVLAR-----------------------ALV---GELA--------SRETELGRRVDADS
A0A2V7ISE2      PTLAR-----------------------ALA---GQLA--------GKEAELGRRVDADS
A0A1Q7J2X5      PGLAR-----------------------ALA---GQLA--------GKESELGRRVDADS
A0A2V7NPD1      PTLAR-----------------------ALA---GQLA--------GKEAELGRRVDADS
A0A2V7QPD8      PTLAR-----------------------RLL---AELS--------GREAELGRRVAEDT
A0A2V7Q8M6      PALAR-----------------------GLM---DQLA--------ARETELGRRLGTDS
A0A2V7QBC3      PALAR-----------------------GLM---DQLA--------AREMELGRRLGADS
A0A2V7LMU1      PALAR-----------------------GLL---DQLT--------ARDAELGRRLGADS
A0A2V7PBY9      PTLAR-----------------------GLL---AQLT--------AREADLGRRLGTDS
A0A2V7J4D7      PALAA-----------------------SLV---AELR--------VRESELVQRVDAAS
A0A2V7LN90      PGLAT-----------------------SLT---REMA--------FREAELAQRVDSAA
A0A2V7LFN9      PQLAT-----------------------GLA---RELE--------RRAAELGQRADSVA
A0A2V7MEK4      PQLAT-----------------------GLA---RELE--------RRAAELGQRADSVA
A0A2V7EU00      PALAG-----------------------ALL---EEVG--------TRERVLDSLVQSGG
A0A1Q6WE01      PGLAR-----------------------ALH---AELG--------ARAQTLATEISAGG
A0A2V7S9K3      PVLVR-----------------------TLL---TELG--------TRQRLLASEVAAGG
A0A1Q7DXB9      PGMLR-----------------------ALR---NNLA--------AREHDLGQRVDSTV
A0A1Q7JD32      PGMLR-----------------------ALR---NNLA--------AREHDLGQRVDSTV
A0A2V7MVP8      PALLR-----------------------AVR---DNLA--------VRERDLGQRVDSTV
A0A2V7N0A9      PGLGR-----------------------ALI---AGLA--------ARERELRQRADSIT
A0A1Q7DLS9      PALAR-----------------------VLV---SELA--------ARDAELTQRVRAAS
A0A1Q7JK96      PALAR-----------------------VLV---SELA--------ARDAELTQRVRAAS
A0A2V7KQV7      PELGG-----------------------ALV---AALA--------AREHELQQRIDSIA
A0A1Q7JGF6      PELGR-----------------------AVV---AGLA--------AREHELQQRIDSIS
A0A2V7SG67      PELGR-----------------------AVV---AGLA--------AREHELQQRIDSIS
A0A1Q7GIK9      PGLAR-----------------------TLM---DGLA--------ARARELASRRDSIA
A0A7W0YSQ1      QASGL-----------------------YLR----NLQ--------SRIESFEARITSLR
A0A3M2BLV5      DAVDR-----------------------HLQ----GID--------REMAEVRTELDRIQ
A0A2V7KS68      PTLAR-----------------------GLA---AQLA--------ARESEIGRQVDAAS
A0A2V7N4L3      PSLAR-----------------------ALS---SQLA--------ARATELGRQVDAAS
A0A1Q7AZK2      PTLAR-----------------------ALS---AQLA--------TRESELGRQVGAAS
A0A1Q7TNP7      PTLAR-----------------------ALS---AQLA--------TRESELGRQVGAAS
A0A1Q7KG39      PTLAR-----------------------ALS---AQLA--------TRESELGRQVGAAS
A0A1Q7GX75      PTLAR-----------------------ALS---VQLA--------ARESELGRHVDAAS
A0A1Q7LL80      PTLAR-----------------------ALS---VQLA--------ARESELGRHVDAAS
A0A2V7PFU2      PTLAR-----------------------ALA---SQLA--------DRESELERQVNSAS
A0A2V7MFS9      PTLAR-----------------------TLA---SQLA--------SRESELGRQVDAAS
A0A2V7T933      PTLAR-----------------------ALS---AQLA--------TRESELGRQVGAAS
A0A841GX23      RAVQS-----------------------RSG----SLA--------GQIGILDQVMASDV
A0A7V9AJ94      QLARN-----------------------YLD----GLD--------NRIVSLDGQLARFA
A0A7Y3MYM3      DAATI-----------------------SGQ----LLN--------RRISDVQGRIASLR
A0A848XLS5      DAATI-----------------------SGQ----LLN--------RRISDVQGRIASLR
A0A7V9FIM2      QAVSS-----------------------HVQ----ALD--------ARVTALAGLRQRTG
A0A7W0WMB8      DAVSS-----------------------HVK----AID--------ARMASLTALRRRTG
A0A2V7P8B1      RAVQA-----------------------GVQGAIASLD--------GRIAAINDLRARRA
A0A7C2QQS2      --LRA-----------------------ATQSYLQTLD--------ARLRAMDEQRAKLA
A0A2V7QN41      PTLAR-----------------------GLD---ADLA--------AREEALSRRADAAF
A0A2V7R603      PTLAR-----------------------LLD---ADLA--------AREEALSHRADAAF
A0A7Y5VC49      PSLAA-----------------------GV---LARLR--------NRESELSREVARAS
A0A2V7LJS2      RAVQA-----------------------GVQGAIASLD--------GRIAAINDLRARRA
A0A1Q7GLJ7      RAVQA-----------------------GVQGSIASLD--------GRIAAIDDLRAHWA
A0A2V7GRE3      HAVQG-----------------------GVQSAIASLE--------GRITAMNDLRARQQ
                                                                            

A0A838NTH4      KRIETIPAKEIAFARLSRDQKLLEDISTLLQTRLKEAE-IKEAIQPGDVRGIDRALVPDR
A0A2D5ZJF2      VEAQELGAKATELAKLESEVSKTEKMLDILDDRIKEVD-VTEKADVLNINILEYAEVEDE
A0A0S8H9P3      AELRQLPAVESELTRLQNEVEIHSDMYKYLLSRYQESQ-IAEAEISPYVEVLDPASWA-R
A0A1E4BBP7      QELKQIPARTVEEMRLNRELQIAQTMYVDLQQRAMSAR-LSERNALPDVSILDTAVAPRF
A0A3M2G737      RKIKTLPQKSIDYARLVRQRSSAEKLYLLVEQHYNEAS-IAEQSEFGNVEIIESAETPTK
A0A0H4TUX7      ARLRTFPGKESRIAQLQLEASILNDTYRYLLTEYESAR-LTEATIGPYINLLDPASPAFR
A0A1G0LUG0      GTLGTFPGKQSRIAQLQLETSIHNDTYRYLLGQLEAAR-LQENTIAPYINLLDPASPAFR
A0A1Q7E3T7      ANVEQRSSTDAEEARLEERVENGRKIADELRIEYQRAR-IAEAVEVGHVEIVDLAVPPTA
A0A1G0L906      QRLGTYPGKETRFAQLALDIELQNGIYKYLLSELESAR-ISAATISPYIQIVETATVAAR
A0A1G0LCC0      QRLGTYPGKETRFAQLALDIELQNGIYKYLLSELESAR-ISAATISPYIQIVETATVAAR
A0A2D5ZJE2      TKLHSLPDKELALARKTREYTVNENTYLMMKEKYEEVR-ISEAGEIGNVRIIDAALPFLD
A0A3M2G624      QQLETFPLKEVELARLEREFRLNEEIYSLLTRQHEQTR-LAEAAIVNDIQVLDYASIPTA
A0A6M4IRY1      KDLRKIPTRTIEEQRLKRQVAQSEELYRSLNIKAAEAK-LAEAATIPDVSVLDPAVAPLK
A0A3D4VBZ5      KDLKGIPSRTIEEQRLKRQVEVAARVYESLNMKAAEAK-LAEASTIPDVSILDAAVPPLS
C1A5W1          KDLKGIPSRTIEEQRLKRQVEVAARVYESLNMKAAEAK-LAEASTIPDVSILDAAVPPLS
W0RI74          HELQGIPERTIQTGVLARERDVRAEIYTKLRTASAQAQ-LAQQSAVPDVKILDTAITPLA
A0A3M2BJA6      AQLEVIPQKQVQLARLEREEKVLSELFTLLQTRLKEAQ-IAQAVEDASIRVVDPAILPSE
A0A7Y5QXY3      RQAERYPPLESEQARLMADVRTTQTAYDNLLAQLQLAR-IAESGDGATVRVVDAASLPSY
A0A2V7PX99      GYMRTVPPLALEEDQLKRAVAGAEAFSATVNQRYEAAR-LGLISSSPDVRLLDSAVQPGK
A0A2V7ERC7      RVLRQIPSRSIEEMRLVRRVSASETMYNSLKARYEEVS-LAEAQTTPDLSILDYAIPPVH
A0A7V9QLH4      RDLSKIPAQEATYQRLQRQPKVLEDMYGMLQTKLKEAE-IQAATVDATVQVVDSAVAPQK
A0A7Y4RSP8      EELKGIPVRTITEGRLERELESAKILYINLQSRYEETK-LAEISAIPDVSVLDHAAVPTR
A0A838W6Q3      RKLGQIPEKEMRFAQLQREVTGLEQVYEQLQARLKEAE-IAGAAEDVSVRLVDAAMLPTR
A0A7V9U4Z2      TAISAAPAIEAREMQLNQRVQSVQSTADQLRTELQQAK-MAEAVEAGQVEIVQLSESPGY
A0A5Q4D6Y4      AQIAGRPQALAEEERLLQDVASIRRTMEQLQDEFYRAR-MAEAVEEGPVQIVDLAPTPHT
A0A7Y3MUW4      ARQRAFPALANELQTLELERELDQDAYQYLLSQLYQAR-IMEAAAGPYVHIVDPAETSYE
A0A848XQ54      ARQRAFPALANELQTLELERELDQDAYQYLLSQLYQAR-IMEAAAGPYVHIVDPAETSYE
A0A7V9QB34      GQVELVPAREVAFLRLTREQKLLEEVHTMIQTRLKEAE-IREASEMANVQVIDTALVPET
A0A2V7JTZ5      QELRGIPARATEEARLVRQVAATENLYNSLKARYEEVS-LAEVQTAPDLSVLDTAVAPTL
A0A3D4YTR6      QELRAIPARATEEMRLARRVVASESLYNTLKARYEELS-IAEAQTTPDLAVLDTAVGPNF
A0A7V8VRF0      RSLDSLSGLEPEEMRLAQQIDALRNTGDKLRDDYQNAR-MAEAVEVGPVEIIDLADLPYA
A0A2V7F1M1      ASFQRLPATEAEGGRLERLVEDLRSTGDRIRQDYKNAR-MAEAISAGDARVIDWAPLPYK
A0A841GJ36      GELARIPSREVGFARLSREQDLLTQIYNLLQTRLKEAE-IQAAAEPSDVEIIDSALVPIT
A0A838NJX4      ASMSLLPAMAEEEMRLTRRVDALANMGDELRADFQRAR-MAQAVEAGDMDVVGLAPLPST
A0A2V7KXK7      GQLRAAPSIALEGSRLEREQRLAEEQFNNVDGEYQKAK-LGLISALPDVRVLDPAQEPRR
A0A651HKD3      AELGAIPTRSIREASLRREVGRAETLYEDVSQRYESAR-LASISADPNVRVVDWAEPPTH
A0A843T4K9      GELRRIPPRAIEEARLQRQVSIAGGLFTTLKQRYEEAR-LAAESSIPDVRLLDAATVPYA
A0A2V7QDU7      AQLQTIPAKEIRLAQLERNVSGLAQIYTQLESRLKESE-IAAAAEDPSVRLVDAALLPRE
A0A6J4M9S2      NEMQTLPSAEAEEVRLVQRVETTSKIADQVREELQKAH-MAEAVEAGQVEIVYPAPLPGS
A0A2V7ITT6      QDLRQIPPRAIQEGRLRREVAVAENLFTTLQQRYEEAR-LAEASSIPDVRVLDVATPPLV
A0A2V7NJW1      QDLRQIPPRAIQEGRLRREVAVAENLFTTLQQRYEEAR-LAEASSIPDVRVLDVATPPLV
A0A7V4KNE3      RELQNIPSRTITEQRLQRNVITLAEIFAQVQARFQAAR-LAEASSIPDVRVLDRAVAPDS
A0A7Y5PAU0      SDLQQIPARTIEEMRLRRAVAVSEGLYTTLKSRYAEAK-LAEASATPDVNIMDSAIAPLN
A0A7V9TKH4      TELQNIPSRTIEQMRLQRDVVSRSSLYSMLQQRYAETK-LAEAGAIPDVSILDTAVAPLA
A0A2V7GFB5      QELRRIPARSVEEARLRRSVTIADNLYTSLQQNYEAAK-LAEASSIPDIRIFDKAVVPLQ
A0A2V7RQ86      QELRRIPARSVEEARLRRSVTIADNLYTSLQQNYEAAK-LAEASSIPDIRIFDKAVVPLQ
A0A2V7IWX2      RYLSNIPPLLFEQTRLEREVQVAGQLYASLQQRYDEAR-VAEASALPDVRILDAPVQPYQ
A0A1Q7KE95      RDLRRIPQRAIEEARRRRDVDLATNLYTSVQQRYDEAR-LAEASSVADVRILDAAVPPQE
A0A1Q7T8X5      RDLRRIPQRAIEEARRRRDVDLATNLYTSVQQRYDEAR-LAEASSVADVRILDAAVPPQE
A0A2V7MS64      TGLRRIPPLAVEEERLVREVTLRDQAVSNLTARYQEAR-LAEVSAIPDVRLIDPAVQPED
A0A2V7Q7N9      SNLRRIPPLAVEETRLEREVTRGEQAVASLQTLYDEAR-LAEVSAIPDVRLVDPAVQPEE
A0A2V7IRW6      GGLRRIPPLAVEETQLQRSVTLAEQVVTNLQQRYEEAR-LAEVSAIPDVRLIDPAIEPQQ
A0A1Q7DVU6      GGLRRIPPLAVAETQLQRDVTLAEQVVTNLQRRYEEAR-LAEVSAIPDVRLIDPAIEPQQ
A0A1Q7JSV2      GGLRRIPPLAVAETQLQRDVTLAEQVVTNLQRRYEEAR-LAEVSAIPDVRLIDPAIEPQQ
A0A2V7FK98      RSIQAVPPRAIDEARLQRQVTLAENLFTSLQKNYDEAR-LAEESAVPDARILDHAVVPQD
A0A2V7R3Z8      RSIQLVPPRAIDEARLQRQVTLAENLFTNLQKNYDEAR-LAEESAVPDARILDHAVVPQD
A0A2V7J3C0      HELRGIPQRAIDEARLRRDLELATNLFTGVQQRYDEAR-LAEASSIADVRILDVAVPPQE
A0A2V7KWV9      RELQGIPQRAIEDARLRRDVSIAENLFTSVQQRYSEAR-LAEASSIADVRVLDAAVAPET
A0A1Q6ZHP2      RTLKQIPARAIEEARLRRDAALAENLYLSLQGKYDEAR-LAEASTLSDVRVLDSAVVPRR
A0A1Q7R6Z6      RTLKQIPARAIEEARLRRDAALAENLYLSLQGKYDEAR-LAEASTLSDVRVLDSAVVPRR
A0A2V7FYT7      RTLKQIPARAIEEARLRRDAALAENLYLSLQGKYDEAR-LAEASTLSDVRVLDSAVVPRR
A0A2V7IGR0      QNLRQIPPRAIDEARLRRDMTLAENLYATLQQRYEEAR-LAEASTIPDVRILDSAVSPQR
A0A2V7MR23      RTLRQIPARAIEEARLRRDAGLAENLYTGLQAKYDEAR-LAEVSSLSDVRVLDSAVVPRR
A0A2V7L1V3      RSLQQIRARAIEEARLRRTKTMSENLYTMLKERYEEAR-LAEASTIPDVRILDAAVVSRE
A0A1Q7E5D3      RTLRQIPPRLIEEARLRRADTLAANLYTTLQQRYEEAR-LAQASTVPDVRILDSAVVPQR
A0A2V7ISE2      RSLRQIPARTIEEARLRRDASLAENLYTSLQQKYDEAR-LAEASTLADVRVLDSAVVPRR
A0A1Q7J2X5      RSLRQIPGRTIEEARLRRDASLAENLYTSLQQKYDEAR-LAEASTLADVRVLDSAVVPRR
A0A2V7NPD1      RSLRQIPGRTIEEARLRRDASLAENLYTSLQQKYDEAR-LAEASTLADVRVLDSAVVPRR
A0A2V7QPD8      RSIQAVPPRAIDEARLQRQVTLAENLFTSLQKNYDEAR-LAEESAVPDARILDHAVVPQD
A0A2V7Q8M6      RSLRQIPARAIEEARLRRTLSMAEDLYTLLQKRYEEAR-LAEASTIPDVRILDAAVVSRE
A0A2V7QBC3      RSLRQIPARAIEEARLRRTLSMAEDLYTLLQKRYEEAR-LAEASTIPDVRILDAAVVSRE
A0A2V7LMU1      KSLRQIPARAVEEARLRRSVTMAENIYTMLQQRYEEAR-LAEASTIPDVRILDAAVVSRQ
A0A2V7PBY9      RTLRDIPARAIEEARLRRDVSLSENLFTMLQQRYEEAR-LAEASTIPDVRILDAAVVSRR
A0A2V7J4D7      SSIQKIPPLAVEESRLQRGVTLAEQTVTNLQARYEEAR-LAEISAIADVRLLDRAVEPQV
A0A2V7LN90      TDLRRIPPLAVEETRLEREVTRGEQAVASLQTLYEEAR-LAEVSAIPDVRLVDPAVQPEE
A0A2V7LFN9      RDLRRIPPLAVEETRLQRDVTQSAQTVANLQQHYEEAR-LAEASSIPDVRFVDPALEPQE
A0A2V7MEK4      RDLRRIPPLAVEETRLQRDVTQSAQTVANLQQHYEEAR-LAEASSIPDVRFVDPALEPQE
A0A2V7EU00      RELQQIPLRAVEEARLRREVTIAENLYTTLQQRYEEAR-LAEASTIPDVRVLDAAVVPHQ
A0A1Q6WE01      RELQAIPQRSIEEGRLRRDVSIAENLYASVQQRYNEAR-LGEASTVADVQVLDAAVSPQE
A0A2V7S9K3      RALQAIPQRAVEEARLRRDVAIAENLYSSVQQRYDEAR-LAEASTVADVRILDAAVAPQD
A0A1Q7DXB9      RYLSNIPPLLFEQTRLEREVQVAGQLYASLQQHYDEAR-VAEASALPDVRILDAPVQPYQ
A0A1Q7JD32      RYLSNIPPLLFEQTRLEREVQVAGQLYASLQQHYDEAR-VAEASALPDVRILDAPVQPYQ
A0A2V7MVP8      RYLSNIPPLLFEQTRLEREVQVAGQLYASLQQHHDEAR-VAEASAVPDVRILDAPDQPYR
A0A2V7N0A9      GVLRRAPPAALEEVRLARDQANAEQLFSDLQHRYQEAR-LAEVSTLPDVRILERAVQPTR
A0A1Q7DLS9      AELRQIPSLAIEDARLRREVANAERLFTSIQQRYDEAR-LAEVSTIPEVSVLDAAVEPEE
A0A1Q7JK96      AELRQIPSLAIEDARLRREVANAERLFTSIQQRYDEAR-LAEVSTIPEVSVLDAAVEPEE
A0A2V7KQV7      RALRGAPPVALEEIRLARDQANATELFSNLEQRYNEAR-LAEVSTLPDVRILERASRPAR
A0A1Q7JGF6      RDLRSAPPVALEEVRLARDQANAEQLFSNLQQRYQEAR-LAEVSTLPDVRILEPAVRPTR
A0A2V7SG67      RDLRSAPPVALEEVRLARDQANAEQLFSNLQQRYQEAR-LAEVSTLPDVRILEPAVRPTR
A0A1Q7GIK9      RDLQSAPPVALTEIRLARDQTNAEQLFSNLQQRYQEAR-LAEVSTLPDVRILERAVRPTR
A0A7W0YSQ1      AELTKYPALEASEANLLGDVRTLQRVYDELNSEHQRAL-IGQSAGATRVRIVDEAGRPSA
A0A3M2BLV5      EAQRRFPQLQNRYDELDLQRSIDREMVLYLQSQLYQAQILAQGAGDGFIDVVDPPGAPIE
A0A2V7KS68      TDLRQIPARTIEEVRLRRNADLKEQTYTSLQQRFDQAR-LAAESTVPDVRVLDPAVVPQR
A0A2V7N4L3      PGLRQIPGRTIEEARLTRNAQLKEQTYTQLQQRFDQAR-LAAEATVPDVRILDPAIVPQR
A0A1Q7AZK2      RDLRQIPARDIEDVRLNRNAQLKEQTYTALQQRFDQAR-LAAEATLPDVRILDPAVVPQR
A0A1Q7TNP7      RDLRQIPARDIEDVRLNRNAQLKEQTYTALQQRFDQAR-LAAEATLPDVRILDPAVVPQR
A0A1Q7KG39      RDLRQIPARDIEDVRLNRNAQLKEQTYTALQQRFDQAR-LAAEATLPDVRILDPAVVPQR
A0A1Q7GX75      SDLRQIPARTIEEARLNRNVQLKEQTYTALQQRFDQAR-LAAEATVPDVRILDSAIVPQR
A0A1Q7LL80      SDLRQIPARTIEEARLNRNVQLKEQTYTALQQRFDQAR-LAAEATVPDVRILDSAIVPQR
A0A2V7PFU2      NDLRQIPGRAIEEVRLNRNVELKEQTYTQLQQRYDQAR-LSAEATVPDVRVLDPAVVPQR
A0A2V7MFS9      HDLRQIPGRAIEEVRLNRNAQLKEQTYTALQQRYDQAR-LAAEATVPDVRILDPAIVPQR
A0A2V7T933      RDLRQIPARDIEDVRLNRNAQLKEQTYTALQQRFDQAR-LAAEATLPDVRILDPAVVPQR
A0A841GX23      AAISGLPDAEAEETRLSREVETLQKLVDDLRRDRQEAR-INEAVQAGQVELVDWAMLPGG
A0A7V9AJ94      GQIEQVPAREVEFFRLGREQKLLEEVYTLIQTKLKEAQ-IQEASEPGNVRLVDSALVPEK
A0A7Y3MYM3      TEVARVPSQTAELTRLQQLVDAVRQPYETMANEYYQAQ-IAEGVEAGDVEVVDPAPVPLR
A0A848XLS5      TEVARVPSQTAELTRLQQLVDAVRQPYETMANEYYQAQ-IAEGVEAGDVEVVDPAPVPLR
A0A7V9FIM2      ASMQILPAMAEEEMRLNRRVDALANMGDELRRDFQRAR-MAEAVEAGDIDVVALAPLPSS
A0A7W0WMB8      TSMETLPAMEEEEMRLRRRVEGLANMGDEVRRDYQRAR-MAEAVEAGDVDVVDLADLPYS
A0A2V7P8B1      GNLQHDA----DEARLTERLDNARKVADALRTEYQKAG-IAEAVTVGQVEIVDHATLPTK
A0A7C2QQS2      SIFQVLPDAEAEEVRLRQRLEAILKVADQLREEYQKAR-IAEAVEAGQVEVVDRAERPIV
A0A2V7QN41      GYLHDLPPLALEEARLQRDVAIAEQLFTTVQQSYNQTQ-LAAVSTLPDVRILDRATAPDR
A0A2V7R603      GYLHDLPPLALEEARLQRDVAIAEQLFTTVQQSYNQTQ-LAAVSTLPDVRILDRATAPDR
A0A7Y5VC49      GALRSVPARAIDQQRLQRDVQVNATLYNTLRSEYDAAR-LSGLGAAPGIAVLDSAVAPLE
A0A2V7LJS2      GNLQHVA----QEARLTERVENARKVADELRTEYQKAG-IAEAVTVGQVEIVDHATLPMK
A0A1Q7GLJ7      GGLQQDA----EEARLKERVDNARKVADELRVEYQKAG-IAEAITVGQVEIVDHAALPAK
A0A2V7GRE3      QLSTSEE----EEARLTERVDNAQKVADELRVEYQKAK-IAEAVTVGQVEIVDHAALPAK
                                             :         :           .  .     

A0A838NTH4      PT--SPKPARNILFGIFGGLFLGIVAAVAREMLDTKVRTKEDVQSVTGGMPILGAIPRI-
A0A2D5ZJF2      PS--KPEKARIMGAALVAGLILGAGLALLVDWKDHRFRSADEITAIL-GVPVLGVVPSM-
A0A0S8H9P3      PV--SGGRRINIIFGGLLGLLLGLGAAFFLEYLDRSLKSTSDVETSL-GVPVLGWIPKI-
A0A1E4BBP7      PS--SDTTLSIILVAIAASIGLGLALAILLDRLDKRFRYPEQATHEL-GLDIVGAIPTY-
A0A3M2G737      PIN-PPKPLRTVFLGGFLGLGLGLGIVFVREFFNTQIRTPEDIKKR--GYTLLSVIPSM-
A0A0H4TUX7      V---GTTLRQKIVLGMLVGLLLGLGGAFFLEYLDQTIKNAGDVERVI-GVPVLGLIPHD-
A0A1G0LUG0      I---GRTPWQTAMLGLLVGLLLGFGAAFLLEYLDQTIKSAADVERAL-GVPVLGQIPDD-
A0A1Q7E3T7      PL--GIGFAERLALGLLFGLVLGGGSAWLTEHLRSSIARPNEIVEL--GLPLLGAVPRC-
A0A1G0L906      I---GVGTRQKVTIGLLVGLFLGIVAAFFLEYLDQTIKTAADVERAL-EIPVLGLIPL--
A0A1G0LCC0      I---GVGTRQKVTIGLLVGLFLGIVAAFFLEYLDQTIKTAADVERAL-EIPVLGLIPL--
A0A2D5ZJE2      PV--RPNRRMNALLGLVVGLGLALSLAFFFEYLDTSLRTIDEVEQKL-DTVVLGAVAAL-
A0A3M2G624      PIGGGPNRQKAILLGALLGIGVGLGVAFLLEFLDNTIRETDEIERHI-QLPVYGMIPQI-
A0A6M4IRY1      PT--RNTAPVIILGAIGAALALGVLLAIVLDQVDKRFRYPEQATDDL-GLFILGVVPVI-
A0A3D4VBZ5      PT--RNTAPMIILGAVGAALALGLLLAIVLDQLDKRFRYPEQATDDL-GLFVLGVVPVI-
C1A5W1          PT--RNTAPMIILGAVGAALALGLLLAIVLDQLDKRFRYPEQATDDL-GLFVLGVVPVI-
W0RI74          PS--SNTAPTFIGGGLFAGLVIGIGLAFLLDLLDNRFRYPEQARVDL-GLEVLGVVPVV-
A0A3M2BJA6      PI--KPKTVLNIALGLILGMMLGVGLAFTREHMDDTVHTREDLVEATGGAPIMGMIPRI-
A0A7Y5QXY3      AV--APNRKRALLVSMMLGLVLGIGLALGLEKIDDSVKSPDELPQRF-QLPVLGQIPSI-
A0A2V7PX99      PS--LDLGPLLIALSFLTSLGLGMVGAVVLDRADPRVRTPEQVTRGM-RLPILAALPHV-
A0A2V7ERC7      PT--SNGARRLLILAVLASIALACAIALIRDRFDRLFRYPKEATHEL-GLIIAGTVPRF-
A0A7V9QLH4      PV--RPRALLDLAAALVLGAVIGLLLAVAREHLDATVRTREQLQTIT-EVPVLGLIPRIR
A0A7Y4RSP8      PL--GNQASKIITMGFLASLGLGLGLAVLLDRMDRRFRYPDQASHEL-GLTILGAVPAI-
A0A838W6Q3      SL--PTKRNLLLALSLVVGLAGGVGLAFVRELKDGSVRTRGDAQFAV-GVPVLGMIPRF-
A0A7V9U4Z2      QI--PTKGRRKLVIGMIVGLMLGCGAAVLVDGLNNSIRRRSDIERLL-KVPGLAVIPRL-
A0A5Q4D6Y4      SE--QAGLPLMLVLGLMLGAMVGSGGAFLLEMLNTKVRRREDMEDAM-QVTTMGIIPRL-
A0A7Y3MUW4      AP--RGGRGYLI-LGTALGLFLGICASFFVEYLDRTVRTRAEAEGLL-GHPVLGTVPEW-
A0A848XQ54      AP--RGGRGYLI-LGTALGLFLGICASFFVEYLDRTVRTRAEAEGLL-GHPVLGTVPEW-
A0A7V9QB34      PA--SPKPLLYLVFSSVLGLAMGLGTAVIRAYVDPKVRNREDVITATSGLPVLGTIPRA-
A0A2V7JTZ5      PT--SNDAPRLLLLAVVASMGLAVGIALIRDRLDRRFRYPEQATREL-GLSVAGTVPKF-
A0A3D4YTR6      PT--SNDAPRLLLLAVAASIGLAFGIALILDRLDPRFRYPEQATHDL-GLSITGTVPRI-
A0A7V8VRF0      PD--ARLRMLKLFLGAVLGLGLGGALAVLFETRDTSIRNTEGLERVL-QMPGLATIPRQ-
A0A2V7F1M1      AA--GIPPWAKLGLGLLLGLLLGCGAAGLAESGNSLLMRPEELERAL-NVRDLGVIPPLL
A0A841GJ36      PI--SPNPVKNVGLGLILGLGLGVALAFVRQAVDTKIRSRQDVEQATSGAPVLGMIPRI-
A0A838NJX4      PL--LNGAVLKVALGLFIGLMLGMIIAYILEALNTSIRRPEDLEAVL-HVPGLAVIPRI-
A0A2V7KXK7      PA--ADFGPLLILLAAMASFGLAVMGVTLRDKMDPKVRYPEQITGRM-QLPILGAVPHV-
A0A651HKD3      PE--SDRSTLMAMVVFFGFMGGGLVGALVLDRADRRVRSPADVEWQL-GVQVLGAIPHL-
A0A843T4K9      VV--QSPI-LMILLGGAGGIGLGAGIAILLGIIDPKLRYPEQVIGEF-GLPIIGAIAYV-
A0A2V7QDU7      PV--SPRRAFSIVLALLGGLTLGLGAALTREHLDRAVHTRHDLLAVT-GRPVLGIIPHA-
A0A6J4M9S2      PV--PARKGLKLGLGLILGLVLGGATAFMREHMNSVIRHQDEIPELL-GVPGLAIIPRL-
A0A2V7ITT6      PV--RNTAPGVILGAFLGSMALGLVGVVRRDRADPRVRCPEQVTHDI-GLPILGVLPHV-
A0A2V7NJW1      PV--RNTAPGVILGAFLGSMALGLVGVVRRDRADPRVRCPEQVTHDI-GLPILGVLPHV-
A0A7V4KNE3      PD--KQLGPMIIGGAFLGGLGLAVVLVFLLDRFDRRLRYPDQVDQDM-GLVILGAVPSV-
A0A7Y5PAU0      PT--KNTTPRIMLMAVLGGLAAAVALALLLDKIDGRIRYPDQATNEL-GLPIAATVPLF-
A0A7V9TKH4      PT--KNTAPTILLLALVVSFGASVGLALLLDHTDPRLRYSEQVTREL-GLSILGAVPTI-
A0A2V7GFB5      PV--KNTAPRLLLLGFLGGLGLALAGVVLLDRFDPRVRYPEQVSHDL-GLPILGAVPHL-
A0A2V7RQ86      PV--KNTAPRLLLLGFLGGLGLALAGVVLLDRFDPRVRYPEQVSHDL-GLPILGAVPHL-
A0A2V7IWX2      PI--GSVAPFLVIMAFLASAGLGVLGAVVIDTLDPRFRDPGHVTQGL-GLRILGALPHL-
A0A1Q7KE95      SL--GNSTLRFIVLGLAAGLGLGLVGAVVGDRLDPRMRYPEQVTRQM-GLPILGVLPHV-
A0A1Q7T8X5      SL--GNSTLRFIVLGLAAGLGLGLVGAVVGDRLDPRMRYPEQVTRQM-GLPILGVLPHV-
A0A2V7MS64      PA--ASWTKILIALALLGGLSAGIAGAVVLDQNDKRVQYPEEVTGAL-GLTILGAVPHL-
A0A2V7Q7N9      PT--ENWRPVLIALAFLASLGAGVAGAAVLDHTDRSVRYPQQVTGAM-GLPILGAVPHL-
A0A2V7IRW6      PA--ASWAVLLVVLAFLGSLGAGVAGAVVRDRTDRRVHYPEHVTGTM-GLAILGAVPHL-
A0A1Q7DVU6      PA--ASWSVLLVALAFLGSLGAGVAGAVLRDRTDRHVHYPEHVTGTM-GLAILGAVPHL-
A0A1Q7JSV2      PA--ASWSVLLVALAFLGSLGAGVAGAVLRDRTDRHVHYPEHVTGTM-GLAILGAVPHL-
A0A2V7FK98      PV--RNTAPRVVFLGFAASLALGLCGAVVLDRIDPKVRYPDQVSRGL-GIPILGAVPHL-
A0A2V7R3Z8      PV--RNTAPRVIFLGFAASLALGLCGAVVLDRIDPKVRYPDQVSRGL-GIPILGAVPHL-
A0A2V7J3C0      PL--KDTASRLLVLGFIAGLGLGLVGAVVADRVDPRMRYPDQVTRQM-GLPILGVLPHV-
A0A2V7KWV9      PV--KNTAARLLILGLFAGLGLGVVGAVVVDRFDPRVRYPAQVTTDM-GLRILGALPHV-
A0A1Q6ZHP2      PV--KNTRRRVILLAFFGSFAMAVVGAVLIDRVDPRVRYPDQVSREM-GLTILGAVPHI-
A0A1Q7R6Z6      PV--KNTRRRVILLAFFGSFAMAVVGAVLIDRVDPRVRYPDQVSREM-GLTILGAVPHI-
A0A2V7FYT7      PV--KNTRRRVILLAFFGSFAMAVVGAVLIDRVDPRVRYPDQVSREM-GLTILGAVPHI-
A0A2V7IGR0      PV--KNTAPRIVLFALFASLGLAVAGAVLLDRVDPRVRYPEQVSRGM-GLTILGAVPHL-
A0A2V7MR23      PV--KNTAPRVILLAFFGSFALAVLGAVLIDRIDPRVRYPDQVSREM-GLTILGAVPHI-
A0A2V7L1V3      PV--SAMGGRLILLGFCGSFGLAVVGAVLLDRVDPRVRYPDQVSREM-GLAILGAVPHL-
A0A1Q7E5D3      PV--KNRAPRVILLAFFASFGLAVMGAVFIDRVDPRVRYYDQVSREM-GLTILGAVPHL-
A0A2V7ISE2      PV--KNTAPRVILMAFFGSFALAVMGAVLIDRIDPRVRYPDQVSREM-GLTILGAVPHV-
A0A1Q7J2X5      PV--KNTAPRVILMAFVGSFALAVMGAVLIDRIDPRVRYPDQVSREM-GLTILGAVPHV-
A0A2V7NPD1      PV--KNTAPRVILMAFFGSFALAVMGAVLIDRIDPRVRYPDQVSREM-GLTILGAVPHV-
A0A2V7QPD8      PV--RNTAPRVVFLGFAASLALGLCGAVVLDRIDPKLRYPDQVSRGL-GIPILGAVPHL-
A0A2V7Q8M6      PV--SSAGGRMILLGFCGSFGLAVVGAVLLDRIDPRVRYPDQVSREM-GLAILGAVPHL-
A0A2V7QBC3      PV--SSAGGRLILLGFCGSFGLAVVGAVLLDRIDPRVRYPDQVSREM-GLAILGAVPHL-
A0A2V7LMU1      PV--RDLAGRMILLGFCGSFGLAVVGAVLLDRIDPRVRYPDQVSREM-GLTILGAVPHL-
A0A2V7PBY9      PV--QDLAGRLIVMGFCGSFGLAVVGAVLLDRIDPRVRYPDQVSREM-GLAILGAVPHM-
A0A2V7J4D7      PV--GHMRAILIFLAFWGGLGVGVAGAVLLDRTDRKVHYPEHVTRAM-GLSILGAVPHV-
A0A2V7LN90      PA--ENWRPLLIALAFLASLGAGVTGAAVLDHTDGRVHYPQQVTGAM-GLPILGAVPHL-
A0A2V7LFN9      PT--ENWAPVLVLFTLITGLGAGVGSAVALDHRDRRVHDPEDITRTM-GLTILGVVPHL-
A0A2V7MEK4      PT--ENWAPVLVLFTLITGLGAGVGSAVALDHRDRRVHDPEDITRTM-GLTILGVVPHL-
A0A2V7EU00      PI--KNTAPRLILVGLFGGLGLSLLGAVMMDRLDRHFRYPQQVTREM-GLAILGAVPRI-
A0A1Q6WE01      AA--KNTASRLVAFGFVVGLSLGMVAAVVVDRLDPRVHHPDQVTEQM-GLSIIGVLPHV-
A0A2V7S9K3      PV--KDMTRRLIVLGLVAGFGLALVGAVVADRLDPRVRYPDQVTNQM-GLPILGVLPHV-
A0A1Q7DXB9      PI--GSVAPFLVIMAFLASGGLGVLGAVLIDTLDPRFRDPGHVTQGL-GLRILGALPHL-
A0A1Q7JD32      PI--GSVAPFLVIMAFLASGGLGVLGAVLIDTLDPRFRDPGHVTQGL-GLRILGALPHL-
A0A2V7MVP8      PL--GSLAPFVLIMSFLASAGLGVLGAVVVDSLDPRFRDPGHVTRDL-GLRILGALPHL-
A0A2V7N0A9      PA--TNTAPLLVVVACLTSFGAGVLGAALRDRADPKVRSPEEVTRTM-GLLILGAVPHV-
A0A1Q7DLS9      PL--LDPTPFLVLVSFLGSLGLAALGAVVLERADRKVRYPDQVTRTM-GLPILGAVPHV-
A0A1Q7JK96      PL--LDPTPFLVLVSFLGSLGLAALGAVVLERADRKVRYPDQVTRTM-GLPILGAVPHV-
A0A2V7KQV7      PV--VNATPLVLLLALVVSLGTGVGGAALLDRADPKIRDPEQVTRAM-GLSILGAVPHV-
A0A1Q7JGF6      PV--SDTAPLVIIVACIMSLGAGVLGAVLLERADPKVRYPDEVTRAI-GLPILGAVPHV-
A0A2V7SG67      PV--SDTAPLVIIVACIMSLGAGVLGAVLLERADPKVRYPDEVTRAI-GLPILGAVPHV-
A0A1Q7GIK9      PA--SRTAPLLIIAAFLTSFGAGVAGAVVRERADPKVRYPDQVTSAM-GLPILGAVPHV-
A0A7W0YSQ1      PI--SPNRRRAAMTAMILGLLMGLAGAVAVEQLDDSVKSPDEIRDQI-GLSVLGTIPGI-
A0A3M2BLV5      -V--TPRGKINLMLGALLGLILGVGAAFFLEYLDRTVRTSADVETLL-GIPVLGIIPRL-
A0A2V7KS68      PV--KNTTPRLLLLGLIAGLGLGMVGAVVLDRVDPKVRYPEQVSREL-GLPILGVLPHL-
A0A2V7N4L3      PF--KNTAPRLLLMGLIAGLGLGIVAALVLDRADPRVRYPQQVSRDL-GLPILGAVPHL-
A0A1Q7AZK2      PV--KNTAPRLLFMGLLGGLGLGVLGAILLDRADPRVRYPEHVSRDL-GLPIIGAVPHL-
A0A1Q7TNP7      PV--KNTAPRLLFMGLLGGLGLGVLGAILLDRADPRVRYPEHVSRDL-GLPIIGAVPHL-
A0A1Q7KG39      PV--KNTAPRLLFMGLLGGLGLGVLGAILLDRADPRVRYPEHVSRDL-GLPIIGAVPHL-
A0A1Q7GX75      PV--KNTASRILLMGLLAGLGLGIVGAVLLDRIDPSVRYPQQVSRDL-GLPILGALPHL-
A0A1Q7LL80      PV--KNTASRILLMGLLAGLGLGIVGAVLLDRIDPSVRYPQQVSRDL-GLPILGALPHL-
A0A2V7PFU2      PV--KNTAPRLLLMGLVAGLGLGVLGAIVLDRADPRVRYPEQVSRDL-GVPILGAVPHL-
A0A2V7MFS9      PI--KNTAPRLLLMGLLAGLGLGVVGAILLDRVDPKVRYPEQVSREL-GLSILGAVPHL-
A0A2V7T933      PV--KNTAPRLLFMGLLGGLGLGVLGAILLDRADPRVRYPEHVSRDL-GLPIIGAVPHL-
A0A841GX23      PV--GSGGKKRLMFALLIGLALGGGGALALDRLNTSIARREDVEHAT-RIPVISVIPRM-
A0A7V9AJ94      PV--SPRPLLYMLLATVVGLMLGAGGVVVREVLDTRVRTREDV-AAA-GLPLFGVIPRF-
A0A7Y3MYM3      PD--PSQKALNMAIALLAGLLLGSMGAVVLERLDSSIKDATDAERAS-GYAVLGNVPLI-
A0A848XLS5      PD--ASQKALNMAIALLAGLLLGSMGAVVLERLDSSIKDATDAERAS-GYAVLGNVPLI-
A0A7V9FIM2      SL--LSGAVLKLFLGLALGLMLGTVLAFIFEALNTSIRRPEDLEAVL-HVPGLAVIPRI-
A0A7W0WMB8      PL--LSGSALKLALGLVLGLLLGLVLAYVLEALNTSIRRPEDLEAFL-HVPGLAVIPRI-
A0A2V7P8B1      PA--GIGLVEQLVLGLLVGLMLGAAGAFVADRMASAIARRVQV-EHL-GLSVLGVVPR--
A0A7C2QQS2      PV--PQRRGLKLALATMLGLFFGGSLALLLESLNTKVRRPEDLENLL-KVPNLVLVPSV-
A0A2V7QN41      PD--RDLTPLLVCASFVVSLGLAVFGVVMLDELDHKVRYPEHVTHQM-RLSILGAVPRF-
A0A2V7R603      PD--RNLTPLLACASFVLSLGLAVFGVVMLDGLDHKVRYPEHVTHQM-RLSILGAVPRF-
A0A7Y5VC49      PS--TNTVPGILLASLLGGVALAVAAALLLDASDPRIWHPDQV-EEM-GYAIVGAIPR--
A0A2V7LJS2      PA--GIGLAEQLALGLLVGLILGAGGAFVAERVGSSIARRVEV-EHL-GLSVLGIVPR--
A0A1Q7GLJ7      PA--GIGLPEQIALGLLVGLMLGSAGAFLAERLGSTIAQRVQV-ERL-GMSVFGVITH--
A0A2V7GRE3      PA--GIGLPEQIALGLLLGLMLGSGGAFLAERLGSTIAQRVQV-EQL-GMSVIGVITH--
                                      .             .                  :.   

A0A838NTH4      --------------------PDNGNARPSRKRARRGPTEVVAAMGLPGNRLITQMSSR--
A0A2D5ZJF2      --------------------SRKASRPDHGQQVSRASS----------------------
A0A0S8H9P3      --------------------TGDGQRRISLVAAHDPE-----------------------
A0A1E4BBP7      --------------------RNPTSAAARLEEA---------------------------
A0A3M2G737      --------------------SLDNANRKKRKSKSVAENPQLLTFANPR------------
A0A0H4TUX7      --------------------PALRRSGNGKPPITIVAREGMD------------------
A0A1G0LUG0      --------------------QRLARGNSHRGTVGIITQLPHD------------------
A0A1Q7E3T7      --------------------QDGRNGSSVKAV----------------------------
A0A1G0L906      --------------------DPRGPHDGPQRNGRRRASISLISHAAPD------------
A0A1G0LCC0      --------------------DPRGPHDGPQRNGRRRASISLISHAAPD------------
A0A2D5ZJE2      --------------------EEAAEA---EDESARLVTLHEPQ-----------------
A0A3M2G624      --------------------ESIKNGRRTHKAKARFETLVTHLAPK--------------
A0A6M4IRY1      --------------------NTKGKRKSADEA----------------------------
A0A3D4VBZ5      --------------------GGKG-RRNADQA----------------------------
C1A5W1          --------------------GGKG-RRNADQA----------------------------
W0RI74          --------------------DQSGRQSPEQI-----------------------------
A0A3M2BJA6      --------------------RQRGLRPSKTSAAANGASHLGERLVAGRDPR---------
A0A7Y5QXY3      --------------------RALEKQVNPNVPLSRLVSHVDPR-----------------
A0A2V7PX99      --------------------SLRQAPGASLRS----------------------------
A0A2V7ERC7      --------------------KPNRRGDFQLLTL---------------------------
A0A7V9QLH4      VRSTDGAFKRFAVHLKRKVKRERAPVPLVGLTPTSRRSELSKSAAAIARALDLDVESR--
A0A7Y4RSP8      -----------------------------PRSRNGKAVPSDHL-----------------
A0A838W6Q3      -----GHPRRRFYQSVRTLLHPRTKGLGSGQSSDSTAIIPAATGEAAER-----------
A0A7V9U4Z2      --------------------STSNGA---GNRMMRALPSLKSNNKSPSGKHEEDLVTVTD
A0A5Q4D6Y4      --------------------SSGGRKRLKHAAASSNGARGGRELVTLHESR---------
A0A7Y3MUW4      --------------------RHPEGQREDGKVPRLVVRDPF-------------------
A0A848XQ54      --------------------REPEGQREVGKVPRLVVRDPF-------------------
A0A7V9QB34      --------------------PARSLNGNGRRSSWTRRIPARTIVGEALVTREDPW-----
A0A2V7JTZ5      --------------------KANHRGEFQIAMM---------------------------
A0A3D4YTR6      --------------------KANGRGDIKLELM---------------------------
A0A7V8VRF0      --------------------AVSSPSSS--------------------------------
A0A2V7F1M1      ETSASRPLRRLPIPLFISASRRPEAASRGEQATWEVVADSAPL-----------------
A0A841GJ36      --------------------RISQLAPLSPNGNGKGKAAQGGRGKHVDDVREYGPVTRRN
A0A838NJX4      --------------------TDGSRN---AQSHFRRLLGSGKAAHPTVGSPLTGNQTF--
A0A2V7KXK7      --------------------SWRLGA---NGDGP--------------------------
A0A651HKD3      --------------------RTRGGR---VQPADH-------------------------
A0A843T4K9      --------------------PSNGRR---SEQLV--------------------------
A0A2V7QDU7      --------------------DGEMWS---ARLARGKGPGRARRRPIGAGSR---------
A0A6J4M9S2      --------------------SNGNGS---SSRFGLPAFLSRSNGKAHDAEGSTELVTVSN
A0A2V7ITT6      --------------------KVRGAG---PEDEHV-------------------------
A0A2V7NJW1      --------------------KVRGAG---PEDEHV-------------------------
A0A7V4KNE3      --------------------KSPKRM---DAESEEA------------------------
A0A7Y5PAU0      --------------------PKGNGG---HHSTEQV------------------------
A0A7V9TKH4      --------------------KRSRAG---DPDPEEA------------------------
A0A2V7GFB5      --------------------KARTG----------GQLTREQR-----------------
A0A2V7RQ86      --------------------KARTG----------GQLTREQR-----------------
A0A2V7IWX2      --------------------S--------------RAGNGEGT-----------------
A0A1Q7KE95      --------------------KDRG-----------AGPNDEHV-----------------
A0A1Q7T8X5      --------------------KDRG-----------AGPNDEHV-----------------
A0A2V7MS64      --------------------ERNG-----------NGRAKAGA-----------------
A0A2V7Q7N9      --------------------NRNG-----------GRRKPDGV-----------------
A0A2V7IRW6      --------------------ERGR-----------NGKKAGAV-----------------
A0A1Q7DVU6      --------------------ERGR-----------NGKKSGAV-----------------
A0A1Q7JSV2      --------------------ERGR-----------NGKKSGAV-----------------
A0A2V7FK98      --------------------RNLPRG---GRGN--GARVPDDV-----------------
A0A2V7R3Z8      --------------------RNLPRG---GRGG--GARVPDDV-----------------
A0A2V7J3C0      --------------------KDRA-----------AGPDDEEV-----------------
A0A2V7KWV9      --------------------KKRA-----------GASDDESG-----------------
A0A1Q6ZHP2      --------------------RAGARP---ERSG-RRVRPPEDV-----------------
A0A1Q7R6Z6      --------------------RAGARP---ERSG-RRVRPPEDV-----------------
A0A2V7FYT7      --------------------RAGARP---ERSG-RRVRPPEDV-----------------
A0A2V7IGR0      --------------------RKSEAQ---RQGT-GPL--SENV-----------------
A0A2V7MR23      --------------------RPGARP----ERSGRRVRPPEDV-----------------
A0A2V7L1V3      --------------------RTLPHA---GRHG--RARVPEDV-----------------
A0A1Q7E5D3      --------------------RPRAGL---GRSGG--AHPPEDI-----------------
A0A2V7ISE2      --------------------RPGARP---TPRNGRRVRPPEDV-----------------
A0A1Q7J2X5      --------------------RPGARP---TPRNGRRVRPPEDV-----------------
A0A2V7NPD1      --------------------RLGARP---TPRNGRRVRPPEDV-----------------
A0A2V7QPD8      --------------------RNLPRG---GRGG--GARVPDDV-----------------
A0A2V7Q8M6      --------------------RTLPHA---GRHG--KGRVPEDV-----------------
A0A2V7QBC3      --------------------RTLPHA---GRHG--KGRVPEDV-----------------
A0A2V7LMU1      --------------------RTLPH----GRHG--RGRVPEDV-----------------
A0A2V7PBY9      --------------------RTLAH----GR-G--RGRIPEDV-----------------
A0A2V7J4D7      --------------------DWRNGN---RDA---------------AA-----------
A0A2V7LN90      --------------------ARNGGT---RKPD--------------GV-----------
A0A2V7LFN9      --------------------ERKRRA---KQPE--------------DG-----------
A0A2V7MEK4      --------------------ERKRRA---KQPE--------------DG-----------
A0A2V7EU00      --------------------KRGGNG---VDPE--------------EA-----------
A0A1Q6WE01      --------------------RDRRAG---PDDQ--------------QV-----------
A0A2V7S9K3      --------------------RNRAAG---PDDE--------------HV-----------
A0A1Q7DXB9      --------------------SRAGNG---EGTA---------------------------
A0A1Q7JD32      --------------------SRAGNG---EGTA---------------------------
A0A2V7MVP8      --------------------SRAKNG---EATT---------------------------
A0A2V7N0A9      --------------------HRGKDM---GDDG---------------------------
A0A1Q7DLS9      --------------------SWHDGA---NGDG---------------V-----------
A0A1Q7JK96      --------------------SWHDGA---NGDG---------------V-----------
A0A2V7KQV7      --------------------HRNGNG---NGNGNGRAH------AETDD-----------
A0A1Q7JGF6      --------------------QRGNGK---RRAG-----------GEDDI-----------
A0A2V7SG67      --------------------QRGNGK---RRAG-----------GEDDI-----------
A0A1Q7GIK9      --------------------RQTAPS---RRPAEVRATWRAPEVDAEDG-----------
A0A7W0YSQ1      --------------------KASGSR---ADTREGHR-----------------LVTHID
A0A3M2BLV5      --------------------RKVDEE---DDRRAGLP-----------------LIVALD
A0A2V7KS68      --------------------RTKEP-----------------------------------
A0A2V7N4L3      --------------------RAKEP-----------------------------------
A0A1Q7AZK2      --------------------RAKEP-----------------------------------
A0A1Q7TNP7      --------------------RAKEP-----------------------------------
A0A1Q7KG39      --------------------RAKEP-----------------------------------
A0A1Q7GX75      --------------------RAKEP-----------------------------------
A0A1Q7LL80      --------------------RAKEP-----------------------------------
A0A2V7PFU2      --------------------RAKEP-----------------------------------
A0A2V7MFS9      --------------------RAKDP-----------------------------------
A0A2V7T933      --------------------RAKEP-----------------------------------
A0A841GX23      --------------------SEPREA---PGRLGAAG---KMLARRRDTDSADGLVVVND
A0A7V9AJ94      --------------------RLPARV---NGNGAAKR---SLLHPESRKLLARPLVARED
A0A7Y3MYM3      --------------------TSGSGR---SQTVWLGQ-----------------------
A0A848XLS5      --------------------TSGSGR---SQTVWLGQ-----------------------
A0A7V9FIM2      --------------------TSGPRN---GPSQFRKL--LGGGRMKPG---AGSPMAGNQ
A0A7W0WMB8      --------------------QGGSGN---GRSRLKGL--LGGGR--PGGTESGSPMAGGQ
A0A2V7P8B1      ---------------------WGRLG---NKKGPKSA-----------------------
A0A7C2QQS2      --------------------TGDGTR---PRQVLPVPFIGRDGADRGELPLAESLIIVRH
A0A2V7QN41      --------------------DWRQLG---NGKTAEAA-----------------------
A0A2V7R603      --------------------DWRHLG---NGKTAEAA-----------------------
A0A7Y5VC49      ---------------------AAAAR---PGEEPVAM-----------------------
A0A2V7LJS2      ---------------------WGRET---DKKGPGSA-----------------------
A0A1Q7GLJ7      ---------------------WDRDA---REKGVKNP-----------------------
A0A2V7GRE3      ---------------------LDRDG---AETGMKSP-----------------------
                                                                            

A0A838NTH4      --DVFAESYRALRTNITFTA----ADHPNQVLVITSALVGDGKSTSASNLAVTLAQQGVR
A0A2D5ZJF2      --SMIAEAYRTIRTAVYFGAP---NGEAR-TILVTSPSPGDGKSTTASNLAIAMAQAGQR
A0A0S8H9P3      --GVAAEAYRVLRTNIAFSTA---RERPLSSLAFTSPGPDEGKSTSVANLAAVLADRGDR
A0A1E4BBP7      --SQLIESFRTIALSVRSAFE---GLGPV-QLAVSSPGPGDGKSFVSANLASALADSGYR
A0A3M2G737      --STVAESYRQLRTYVQFSK----TDTPVKTIMVSSANPSEGKTTTASNMAVAFATMGKK
A0A0H4TUX7      --QPAAEAFRALRTNVTFVG----AEKPLQFMSVTSPGPGEGKSTTAVNLAVALAQGGQR
A0A1G0LUG0      --EPSAEAFRALRTNVTFVG----AERPLQLISVTSPGPGEGKSTTAANLAVALAQSGQR
A0A1Q7E3T7      --GAVIEAFRGLRLNLAYAYG---AAGPV-LLVLSSPRSREGKSFIAANLALAFAQANYR
A0A1G0L906      --DPTSEAYRALRTNVTFVSA---EQHALQLICVTSPGPGEGKSTTAANLAITLAQQGAR
A0A1G0LCC0      --DPTSEAYRALRTNVTFVSA---EQHALQLICVTSPGPGEGKSTTAANLAITLAQQGAR
A0A2D5ZJE2      --SPMAEAYRTIRTNVGFAA----VGAPLRSIAITSSGPQEGKSTTASNLAITIAQSGKR
A0A3M2G624      --SIPSEAFRSLRTNIQFFDL---SRQSE-AILITSAVSEEGKSTTCANLAITTAQVGRK
A0A6M4IRY1      --SQVVEAFRTIRMNVRYAAD---PSRPL-AMTITSPGPNDGKSLISSNLALSFAEAGAR
A0A3D4VBZ5      --AQVVESFRTIRMNVRYAAD---PTRPL-TMTITSPGPNDGKSLISSNLALSFAESGLR
C1A5W1          --AQVVESFRTIRMNVRYAAD---PTRPL-TMTITSPGPNDGKSLISSNLALSFAESGLR
W0RI74          --AQIVEAFRSLRMNVRYAAGAG-SQRSV-VFGITSPGPGDGKSLVASNLALSFAEGGWR
A0A3M2BJA6      --NPVSEAYRSLRTNITFSNP---DRPPK-TIVFTSPLPQDGKSTSAANLAITLAQQGTR
A0A7Y5QXY3      --SVVAEAYRSLRTNIAFARA---QSRAR-TLVLTSPGPADGKSTTVANLAITFAQQGQR
A0A2V7PX99      --AEVIEALRGLRVRVLHSQG---VEGPL-LLTVTSPSVGDGKSFLSVNLALSFAYAGYR
A0A2V7ERC7      --SQAVESFRTLHLAVRYDFP---GGGPI-SLSVASPGPGDGKSLVSSNLAIAFASAGYR
A0A7V9QLH4      --SGIIEAFGQLQTNIQYARP---DQRVK-SIVVTSALPGEGKTTTAVNLALTLAQHGTS
A0A7Y4RSP8      --AQVVEAFRSIRLNLAHSFE---PGSPI-CITVSSPSPGDGKSLISSNLGLSFAEAGYR
A0A838W6Q3      --AYAADAYERLHTNLLYAHV---RNGCR-VVVFTSALPGDGKSTSAANFALALATRGLR
A0A7V9U4Z2      VRSAGAEAYRTLRTNLMFSQA---VQALR-SLVVTSAGPGEGKTTTSANLAVSFAQQGMR
A0A5Q4D6Y4      --SSEAEAFRTLRTNLLYAQ----HHKPLRAVVVASANPGEGKTTTAANLAITYAQQGLS
A0A7Y3MUW4      --ERAGEAFRGLRLNLSFLHV---DGRPVKSILVTSPGPVEGKSTTSLNLAATFAQYGER
A0A848XQ54      --ERAGEAFRGLRLNLSFLHV---DGRPVKSILVTSPGPVEGKSTTSLNLAATFAQYGER
A0A7V9QB34      --TPGAEAYRTLRTNLALADS---RSESR-VLVVTSAAAEDGKSTCASNLAVALAQQGSR
A0A2V7JTZ5      --SQAVESFRTLRLALRYDFP---TDAPI-VVGVSSPAAGDGKSLVSSNLALAFASAGSR
A0A3D4YTR6      --SQTVEAFRTIRLALRYDFP---DGLPI-VLGVTSPARGDGKSLVASNLGLAFASAGSR
A0A7V8VRF0      --GLAREAYRVLRTNLLFSRT---GQLPG-SLVITSATSGEGKSTTAANLAITCAESGMR
A0A2V7F1M1      --SSAAEAFRLLYSGLLFGWG----EGQR-TILVTSAAPQEGKTVIAANLAVTFAREGVR
A0A841GJ36      PQSPVAESYRALRTNIMFAGA---DSSPR-VLVVTSAFPGDGKSTSASNLAITLAQQGTR
A0A838NJX4      --SIGIEAFRNLRTGLIWSDG---GEALR-TLVVTSAAPGEGKTMTAANLAVTLAYDGLR
A0A2V7KXK7      --AQVIEALRGLRLRVLHAHA---GEGPL-TLTITSPGIGDGKSFVSLNLALSFADAGYR
A0A651HKD3      --EHAIEAFRSIRTGILFAHG---SAGPL-VITVTSPDAGDGKSFTVSNLALCFAELGRR
A0A843T4K9      --RQAAEAFREIRMSITEGAQ---PDQPI-VLTISSPESGDGKSFVALNLAMSFAKQRIP
A0A2V7QDU7      --AELAEAFVRLATNVSFAGP---NGPPQ-VVTVTSALRGEGKTTSAVNLALASAN-GRR
A0A6J4M9S2      LRSSGAEAYRTLRTNLIFSQA---VRSLR-TILVTSAAPSEGKTTTSSNLAVTFAQQGLR
A0A2V7ITT6      --AQVIEAMRSVRLSLSQTHG---GGGPM-LVTVSSPGIGDGKSFVSANLALAYSGAGQR
A0A2V7NJW1      --AQVIEAMRSVRLSLSQTHG---GGGPM-LVTVSSPGIGDGKSFVSANLALAYSGAGQR
A0A7V4KNE3      --AQVVEAFRAIRMAVLHSVH---DRRPT-MLVITSPGPGDGKSFVASNLALSFAEAGQR
A0A7Y5PAU0      --SQLVESFRTLRMNVLNSAG-----GRV-TLAVSSPSPGDGKSFISSNLAMSFADAGFR
A0A7V9TKH4      --AQVIESFRTIRMAITNQYD---ASGSA-MLTVSSPGAGDGKSLVCSNLALSFAEAGYR
A0A2V7GFB5      --VQLVEAMRGVCLGVSYTYG---AAGPV-VVAVSSPGPGDGKSFITANLAVTFADAGRR
A0A2V7RQ86      --VQLVEAMRGVCLGVSYTYG---AAGPV-VVAVSSPGPGDGKSFITANLAVTFADAGRR
A0A2V7IWX2      --AQAIEAMRTVRVKLQHASN---GGNPL-LLTVTSPGVGEGKSLVSANLALAFAYAGLR
A0A1Q7KE95      --IHVIEAMRSVRLSLIHFYG---GNGPV-VVTVTSPGIGDGKSFLSANLALACAEAGQP
A0A1Q7T8X5      --IHVIEAMRSVRLSLIHFYG---GNGPV-VVTVTSPGIGDGKSFLSANLALACAEAGQP
A0A2V7MS64      --LEAVEALRAIRLNLLHAHG---A-GPT-VVTVTSPGHSDGKSFVASNVAVAFADAGFR
A0A2V7Q7N9      --MQVVEAVRGIRLNVLHAHG---T-GPI-VVTVTSPGRSDGKSFLASNLALAFADAGSR
A0A2V7IRW6      --LQVVEAVRGIRLNVLHAHG---A-GPA-VLTVTSPGRSDGKSFVASNLALAFADAGYR
A0A1Q7DVU6      --LQVVEAVRGIRLNVLHAHG---A-GPA-VLTVTSPGRSDGKSFLASNLALAFADAGYR
A0A1Q7JSV2      --LQVVEAVRGIRLNVLHAHG---A-GPA-VLTVTSPGRSDGKSFLASNLALAFADAGYR
A0A2V7FK98      --NEVVEALRGVCLNLVYAHG---GRAPL-LVTITSPGAGDGKSFISANLAHTFADGGHR
A0A2V7R3Z8      --NEVVEALRGVCLNLVYAHG---GRAPL-LVTITSPGAGDGKSFISANLAHTFADGGHR
A0A2V7J3C0      --AQVIEAMRSVRLSLMHFYG---GNGPV-VVTVTSPGAGDGKSFVSANLALACAESGKA
A0A2V7KWV9      --PLVIETMRGVRLSLIHAYG---TAGPL-VVTITSPAPGDGKSFVSANLALACAQAGQR
A0A1Q6ZHP2      --AVVVEALRGVCLNLVYTHG---AVAPL-VVTITSPGAGDGKSFLAANLGHTFAEAGHR
A0A1Q7R6Z6      --AVVVEALRGVCLNLVYTHG---AVAPL-VVTITSPGAGDGKSFLAANLGHTFAEAGHR
A0A2V7FYT7      --AVVVEALRGVCLNLVYTHG---AVAPL-VVTITSPGAGDGKSFLAANLGHTFAEAGHR
A0A2V7IGR0      --AEVLEALRGVCLNLEHAYG---TAGPL-IAAVTSPGPGEGKSFIAANLAYTFAESGHR
A0A2V7MR23      --AVVVEALRGVCLNLVYTHG---AVAPL-VVTITSPGAGDGKSFLAANLGHTFAEAGHR
A0A2V7L1V3      --NQVVEALRGVCLNLVYAHG---GRAPL-LVTVTSPGAGDGKSFLAANLGHTFADGGHR
A0A1Q7E5D3      --AVVVEALRGACLNLVYAHG---AEGPL-LVTITSPGAGDGKSFLAANLARTFVEGGHR
A0A2V7ISE2      --AVVVEALRGVCLNLVYTHG---AASPM-LVTITSPGAGDGKSFLAANLGHTFAEAGHR
A0A1Q7J2X5      --AVVVEALRGVCLNLVYTHG---AESPM-LVTITSPGAGDGKSFLAANLGHTFAEAGHR
A0A2V7NPD1      --AVVVEALRGVCLNLVYTHG---AASPM-LVTVTSPGAGDGKSFLAANLGHTFAEAGHR
A0A2V7QPD8      --NEVVEALRGVCLNLVYAHG---GRAPL-LVTITSPGAGDGKSFISANLAHTFADGGHR
A0A2V7Q8M6      --NQVVEALRGVCLNLVYAHG---GRAPL-LVTVTSPGAGDGKSFLAANLAHTFADGGHR
A0A2V7QBC3      --NQVVEALRGVCLNLVYAHG---GRAPL-LVTVTSPGAGDGKSFLAANLAHTFADGGHR
A0A2V7LMU1      --NQVVEALRAVCLNLVYAHG---GRAPL-LVTITSPGAGDGKSFLAANLAHTFADGGHR
A0A2V7PBY9      --NQVVEALRGVCLNLVYAHG---GRAPL-LVTVTSPGAGDGKSFIAANLAHTFADGGHR
A0A2V7J4D7      --TQVIESLRGVRLNVVHRHG---TAGPV-RLTVTSPGKSDGKSFVASNLALAFADAGYR
A0A2V7LN90      --MQVVEAVRGIRLNVQHAHG---T-GPV-VVTVTSAGRSDGKSFLASNLALAFADAGSR
A0A2V7LFN9      --LPVLEAMRGICLNVLHSHG---V-GPV-IVTVTSPGRADGKSFVASNLAVAFADAGYR
A0A2V7MEK4      --LPVLEAMRGICLNVLHSHG---V-GPV-IVTVTSPGRADGKSFVASNLAVAFADAGYR
A0A2V7EU00      --RQVIEALRTVRLNLTHAYG---SAGPL-LVTITSPGPGDGKSFVSGNLARAFADAGQR
A0A1Q6WE01      --AHAIEAMRSIRLSLTHAHG---AAGPM-LVTISSPGVGDGKSFVSANLALAFAEAGRR
A0A2V7S9K3      --AHAIEAMRSVRLSVSHAYG---AAGPM-VLTVSSPGAGDGKSFVAANLALAFAEGGRR
A0A1Q7DXB9      ---QAIEAMRTVRVKLQHASN---GGNPL-LLTVTSPGVGEGKSLVSANLALAFAYAGLR
A0A1Q7JD32      ---QAIEAMRTVRVKLQHASN---GGNPL-LLTVTSPGVGEGKSLVSANLALAFAYAGLR
A0A2V7MVP8      ---QAIEAMRTVRVKLQHACN---GGSPL-LLTVTSPGVGEGKSLVSANLALAFAYAGLR
A0A2V7N0A9      --VKAVEALRGIRLNVQYAYG---AAGPL-VLTVSSPGRGEGKSFVTSNLAQAFADVGCR
A0A1Q7DLS9      --SRVIEALRGIRLNVLHAYG---TAGPL-LVTVTSPGRSDGKSFLTSNLAVAFVDAGYS
A0A1Q7JK96      --SRVIEALRGIRLNVLHAYG---TAGPL-LVTVTSPGRSDGKSFLTSNLAVAFVDAGYS
A0A2V7KQV7      --TGALEALRGIRLNVQHAYG---AAGPL-LITVTSPGRGDGKSFVTCNLALAFAQVGYR
A0A1Q7JGF6      --AKAVEALRGIRLNLQHAYG---AAGPL-LITVSSPGRGEGKSFVTSNLAQAFADVGYR
A0A2V7SG67      --AKAVEALRGIRLNLQHAYG---AAGPL-LITVSSPGRGEGKSFVTSNLAQAFADVGYR
A0A1Q7GIK9      --AKAVEALRGIRLNVHHASG---AVGPL-LATITSPGRGEGKSFVSANLAYAFSAVGYR
A0A7W0YSQ1      PRSPVAEAYRSLRTNLAFARA---HEALR-TIVLTSPGPADGKSTTVANLAITFAQQGQR
A0A3M2BLV5      PLDPAAEAYRNLRMNLMFMST---EDEPIRTILFSSPGPHEGKSTTAVNFAVMLAQQGQR
A0A2V7KS68      --AEVVEALRGLRLNVIHEYGTAEAAQPL-IFTVTSPGPGDGKTFLSSNLALAFAEGGHR
A0A2V7N4L3      --AEVIEALRGIRLSVLHEHG---PG-PL-VVTITSPEQGDGKSFMSANLAMSFADAGHK
A0A1Q7AZK2      --AEVVEALRGVRLSLVHEYG---PG-PL-LVTVTSPGPGDGKSFLSANLALTFADAGHR
A0A1Q7TNP7      --AEVVEALRGVRLSLVHEYG---PG-PL-LVTVTSPGPGDGKSFLSANLALTFADAGHR
A0A1Q7KG39      --AEVVEALRGVRLSLVHEYG---PG-PL-LVTVTSPGPGDGKSFLSANLALTFADAGHR
A0A1Q7GX75      --AEVVEALRGVRLNLLHEYG---PG-PV-VLTISSPGSGDGKSFLSANLGLTFADGGHK
A0A1Q7LL80      --AEVVEALRGVRLNLLHEYG---PG-PV-VLTISSPGSGDGKSFLSANLGLTFADGGHK
A0A2V7PFU2      --VEVIEALRGLRLNVLNEYG---AETPV-LFTVTSPGPGDGKSFLSANLALAFADGGHR
A0A2V7MFS9      --VEVVEALRGVRLNLMNEHG---PG-PL-LVTVTSPGPGDGKSFLSANLALAFADGGHR
A0A2V7T933      --AEVVEALRGVRLSLVHEYG---PG-PL-LVTVTSPGPGDGKSFLSANLALTFADAGHR
A0A841GX23      VQAPGSQAYRKLRTHLIFSQQ---GAPMR-TLMVTSPAASEGKTTVTSNLAAVFAQQGLR
A0A7V9AJ94      PGSPASEAFRSLRTSLLLSAA---EGLPQ-VLVVTSATADDGKSTTAANLAITLAQQGTR
A0A7Y3MYM3      ------ESFRSIRTNLRFAF----TEEPR-VLAVSSPAPGEGKSTVVANLASCYVDQGAR
A0A848XLS5      ------ESFRSIRTNLRFAF----TEEPR-VLAVSSPAPGEGKSTVVANLASCYVDQGAR
A0A7V9FIM2      TFSIGIEAFRNLRTSLIWSDG---GEALK-TLVVTSAAPGEGKTLTAANLAVTLAYDGLR
A0A7W0WMB8      TFSIGIEAFRNLRTSLIWSDG---GEALK-TLVVTSAAPGEGKTMTAANLAVTLAYDGLR
A0A2V7P8B1      --EATVEAFRGIRLNVLNAHG---ATGPV-VVGVTSPGSGDGKSFVSSNLALAFAYGNHR
A0A7C2QQS2      PHAPASEAYRALRTSLLFAQS---VPIRR-VV-ITSAGAAEGKTTVASNLAAAFAQQGMR
A0A2V7QN41      --APVVEALRGLRLRL-SHAG---GSGPL-LVTVTSPGVGEGKSFLSCNLALAFADAGFR
A0A2V7R603      --APVVEALRGLRLRL-SHAG---GSGPL-LVTVTSPGVGEGKSFLSCNLALAFADAGFR
A0A7Y5VC49      --AQVDEAMRVLRLALLSEMH---GARPM-ALSVMSPEIGDGKSFVAVELARSFAKAGCR
A0A2V7LJS2      --DAAVEAFRGIRLNVLNAHG---AAGPA-VVAVTSPGSGDGKSFVSSNLALAFAYANHR
A0A1Q7GLJ7      --DAVVEAFRGLRLTLVNEYG---APGPI-VVTVTSPGSGDGKSFVSSNLALAFAYAKQR
A0A2V7GRE3      --DAVVEAFRGLRLSLVNEYG---APGPL-VITVTSPGSGDGKSFVSSNLSLAFAYAKQR
                      ::       :                 . *.   :**:    :..         

A0A838NTH4      TLLVDADLRKGVLHSTFA-LPREPGLTQLLIGECS-------I--EAALQKVSLGDEGQS
A0A2D5ZJF2      TLLMDSDFRKPVQHVIFE-MDDKQGLSSVLSGQAT-------L--DEVL-RPSEVAG---
A0A0S8H9P3      TLLVDADLRRGTLHEDFD-LLRSPGLSDLLVGELD-------P--REAI-RPAVRPA---
A0A1E4BBP7      TVIVDGDIRRGTLHDIFAPCAQAPGLVDYLAGEAT-------L--DEVLRPTQQHIN---
A0A3M2G737      VLLIDCDMRKPQLHNRFS-LDREPGLSNIFFYTAA-------V--EKIC-HKTSVDN---
A0A0H4TUX7      TLLIDGDLRRPLIHRAFA-LVQEPGLTDVLVGRAT-------A--REAV-RPDAAPG---
A0A1G0LUG0      TLLVDADLRRPQVHRAFS-LVQEPGLTDVLIGRVP-------A--REAI-RPEVQPQ---
A0A1Q7E3T7      TLLIDGDTRRGALHKVLA-VARKPGLTDFLGGDVS-------W--GEII-QVTRHGT---
A0A1G0L906      TLLVDADLRRPVVHRAFN-LVQEHGLTDILVGTAT-------L--RETV-RPNLIPK---
A0A1G0LCC0      TLLVDADLRRPVVHRAFN-LVQEHGLTDILVGTAT-------L--RETV-RPNLIPK---
A0A2D5ZJE2      TLLLDADLRRPVLHKLFS-LKRQKGVTDHLAGNAT-------L--EEVI-QKTEIEG---
A0A3M2G624      TLLIDGDLRKPVIHHLFE-APSEPGLTDVLLGRYT-------W--QEVI-HSTSVPG---
A0A6M4IRY1      TLLIDGDIRRGELAKTFG-TQSRPGLVEYLDGTAL-------I--AEVLHPATAHPN---
A0A3D4VBZ5      TLLIDGDIRRGELAKTFK-IHSRPGLVEYLEGSAL-------L--AEVLNPIASHAN---
C1A5W1          TLLIDGDIRRGELAKTFK-IHSRPGLVEYLEGSAL-------L--AEVLNPIASHAN---
W0RI74          TVLIDADTRRGQLNATFD-TPAVPGLVEYLEGTSL-------F--GEVC-YPTRHDN---
A0A3M2BJA6      VLLVDADLRRGVLNNVFD-LPREPGLSDVITGQAK-------L--SEAL-RVVDLGESGR
A0A7Y5QXY3      TLLVDGDLRRAVLDKTFG-VPRTPGLTEVIVGVSP-------L--NEAV-HQTTVEN---
A0A2V7PX99      TLLIDGDVRRGTQHRVVD-AASEPGLTDVLAGQAA-------A--EAAV-QQTGYPN---
A0A2V7ERC7      TLLIDGDVRCGTQHSTFS-VSPTPGLVDYLRSATG-------V--EGAI-RTTSFSN---
A0A7V9QLH4      VLLIDADLRCGSVASAFD-INIAPGLSELLEGKAQ-------L--DATL-HRLEVGGMGR
A0A7Y4RSP8      TILIDGDTRRGDLHRTFG-AERRPGLLDYLGNPQ--------VSYESTL-RPTSHRN---
A0A838W6Q3      VVLIDADLRRGSLSTVFR-VPRAPGLTELVSDEKR-------S--SEST-RTVYAAGSGQ
A0A7V9U4Z2      ILLIDCDLRRARLHKVFG-VPREPGLSDLVLGYKD----------EDAVTRPTSVPG---
A0A5Q4D6Y4      VVLVDCDLRKPRVGELFG-MERRPGMTELVLGQAT-------L--EECARPFVPAEN---
A0A7Y3MUW4      VLLIDADLRRPVVHSALD-LARDPGLTHLLIGSAE-------A--DDVI-HRDVIPN---
A0A848XQ54      VLLIDADLRRPVVHSALD-LARDPGLTHLLIGSAE-------A--DDVI-HRDVIPN---
A0A7V9QB34      TLLVDADLRRGALHVLFE-VSRGPGLTETLGGQVP-------L--DDAVHEIAVGATGLP
A0A2V7JTZ5      TLLIDGDVRCGGLHNTFE-IPVTPGLVDYLNGHAA-------V--DSIV-RSTTSEN---
A0A3D4YTR6      TLLIDGDVRCGGLHNTFG-IPVTPGLVDYLHGLAS-------V--ESIV-RSTASKN---
A0A7V8VRF0      VLLIDCDLRRAKQHHVFG-VPRSPGVAQLLLGTAK-------A--EEAL-RPSPVPG---
A0A2V7F1M1      VLLVDCDLRRPRLHRVFG-VAPAPGLIELLKADRATLADSP----GGPLRRPTKIAG---
A0A841GJ36      TLLVDADLRRGVLHSVFG-ISSDPGLSHVLLGKVP-------L--DEAISTVSAGENGVV
A0A838NJX4      VLLVDCDIRRPRVHGLFQ-LPRAPGLMELLRASGDPDAPP-----PRAI-RETPVAR---
A0A2V7KXK7      TLLVDGDTRRGVQHKALK-TPSTPGLTDVVAGRVA-------L--DAAL-RLTSYPG---
A0A651HKD3      TVIVDGDVRRGIQHKLLD-VERKPGLTDCLSGQAT-------L--EEVL-SPAEHPL---
A0A843T4K9      TLLIDGDIRRGHLHRKFD-LEREPGLTNLLLDEAS-------S--DEVL-HATDSNW---
A0A2V7QDU7      VLLIDADLRCGTIHALFR-LSRTPGLAEVLAGWMPLENAVRRM-------DTGDGTH---
A0A6J4M9S2      VLLVDCDLRKARLHKVFG-VPREPGLTQLVLGHNA-------M--TEVI-HSTPVDG---
A0A2V7ITT6      TLLIDGDVRRGSLHRAML-TQRTPGLTDVLAKRAP-------L--ERVT-QATSYTA---
A0A2V7NJW1      TLLIDGDVRRGSLHRAML-TQRTPGLTDVLAKRAP-------L--ERVT-QATSYTA---
A0A7V4KNE3      TLLVDGDIRRGALHHLFS-VQGRPGLVDVLAGDCP-------L--ADAV-RATHHER---
A0A7Y5PAU0      TLLVDGDTRRGILHEIFG-LPRTSGLTDYLAGHVD-------Q--QAII-HATNHDK---
A0A7V9TKH4      TVLVDGDTRRGQLHAMFG-ANRRPGLLDLLGGDVP-------F--EAVL-RSTTHDR---
A0A2V7GFB5      TLLVDGDLRRGAQHRLFG-ADRRPGLTDVLRGDVP-------L--EAGL-RPTGYDA---
A0A2V7RQ86      TLLVDGDLRRGAQHRLFG-ADRRPGLTDVLRGDVP-------L--EAGL-RPTGYDA---
A0A2V7IWX2      TVVIDGDIRRGALHRLLR-GSRRPGLTDHLTGRAP-------L--EKVL-QTTPYKC---
A0A1Q7KE95      TLLIDGDARRGGLHRALR-RPRKPGLTDCLAGAAP-------L--EGVT-QTTMYPC---
A0A1Q7T8X5      TLLIDGDARRGGLHRALR-RPRKPGLTDCLAGAAP-------L--EGVT-QTTMYPC---
A0A2V7MS64      TLLIDGDVRKGVLHRTLK-APRLPGLVDVLMGKVP-------V--AQAI-QSTTYRT---
A0A2V7Q7N9      TLLVDGDIRCGRLHRVLQ-LARKPGLTDLLGGEAA-------E--EQVL-QATAYRT---
A0A2V7IRW6      TLLVDGDVRCGTLHRALK-LARKPGLVDVLGGKAS-------T--ELVV-QATSYRA---
A0A1Q7DVU6      TLLVDGDVRCGTLHRALK-LARKPGLVDVLGGKAS-------T--ELVV-QATSYRA---
A0A1Q7JSV2      TLLVDGDVRCGTLHRALK-LARKPGLVDVLGGKAS-------T--ELVV-QATSYRA---
A0A2V7FK98      TLLIDADIRRGVLHRRLS-VRRRPGLSDFLRGEAQ-------L--DAIV-QATQFPA---
A0A2V7R3Z8      TLLIDADIRRGVLHRRLS-VRRRPGLSDFLRGEAQ-------L--DAIV-QATQFPA---
A0A2V7J3C0      TLLIDGDSRRGGLHRILH-RPRKLGLTDHLAGAAS-------L--EAVT-QSTPFAA---
A0A2V7KWV9      TLLIDGDTRRGALHRVLG-GVRRPGLTDFLAGNVS-------F--EALI-QTPNFGS---
A0A1Q6ZHP2      TLLIDGDLRRGVLHRRLG-ARRRPGVSDFLRGEVP-------I--EAIV-QTTPYPS---
A0A1Q7R6Z6      TLLIDGDLRRGVLHRRLG-ARRRPGVSDFLRGEVP-------I--EAIV-QTTPYPS---
A0A2V7FYT7      TLLIDGDLRRGVLHRRLG-ARRRPGVSDFLRGEVP-------I--EAIV-QTTPYPS---
A0A2V7IGR0      VLLVDADIRRGVLHRRLG-RPRRPGLCDFLRSEAP-------L--EAIV-QSTTHPS---
A0A2V7MR23      TLLIDGDLRRGVLHRRLG-ARRRPGVSDFLRGEVP-------L--EAIV-QATPYPS---
A0A2V7L1V3      TLLIDADIRRGVLHRRLS-ARRRPGLSDFLRGETP-------L--DAVV-QATPYPS---
A0A1Q7E5D3      TLLVDGDNRRGVLHRRLA-ARRRPGLTDLLRGDVT-------F--EAIA-QPTPYPG---
A0A2V7ISE2      TLLIDGDIRRGVLHRRLG-ARRRPGLTDFLRGEVP-------L--EAIV-QATPYPS---
A0A1Q7J2X5      TLLIDGDLRRGVLHRRLG-ARRRPGLTDFLRGEVP-------L--EAIV-QATPYPS---
A0A2V7NPD1      TLLIDGDLRRGVLHRRLG-ARRRPGLTDFLRGEVP-------L--EAIV-QATPYPS---
A0A2V7QPD8      TLLIDADIRRGVLHRRLS-VRRRPGLSDFLRGEAQ-------L--DAIV-QATQFQA---
A0A2V7Q8M6      TLLIDADIRRGVLHRRLS-ARRRPGLSDFLRGETP-------L--DAIV-QATPYPS---
A0A2V7QBC3      TLLIDADIRRGVLHRRLS-ARRRPGLSDFLRGETP-------L--DAIV-QATPYPS---
A0A2V7LMU1      TLLIDADIRRGVLHRRLS-AHRRPGLSDLLRGETP-------L--DAIV-QATPYPS---
A0A2V7PBY9      TLLIDADIRRGVLHRRLS-ARRRPGLSDFLRGEAP-------L--DAVV-QATPYPA---
A0A2V7J4D7      TLLVDGDVRRGRLHHTLS-AARRPGLTELLEGSAP-------Q--DAAV-QATRYKN---
A0A2V7LN90      TLLVDGDIRCGRLHRVLK-LARKPGLTDLLAGDAT-------P--EQVL-QGTAYRT---
A0A2V7LFN9      TLLVDGDVRCGRLHRTLK-LPRRPGLTDLLQGRAS-------K--EQAV-QLSAYGM---
A0A2V7MEK4      TLLVDGDVRCGRLHRTLK-LPRRPGLTDLLQGRAS-------K--EQAV-QLSAYGM---
A0A2V7EU00      TLLIDGDSRRGVLHRLFK-GLRKPGLTDYLAGVVP-------L--DAVV-QRTDHPA---
A0A1Q6WE01      TLLIDGDVRRGSLHRAVR-ARRQPGLTDFLAGRAP-------F--EATV-QGTPYPD---
A0A2V7S9K3      TLLIDGDVRRGGLHRALR-AHRRPGLTDFLAGRVP-------L--EETI-VATSYAD---
A0A1Q7DXB9      TIVIDGDIRRGALHRLLR-GSRRPGLTDHLTGRAP-------L--EKVL-QPTPYKG---
A0A1Q7JD32      TIVIDGDIRRGALHRLLR-GSRRPGLTDHLTGRAP-------L--EKVL-QPTPYKG---
A0A2V7MVP8      TIVIDGDIRRGALHRLLR-ASRRPGLTDHLTGRAP-------L--EQVL-QATPYKD---
A0A2V7N0A9      TLLIDGDVRLGALHRALR-RARRPGLTDALAGRVT-------A--DQTL-QATDHAF---
A0A1Q7DLS9      TLLIDGDIRRGGLHRVLD-AARTPGLTDLLAGTAA-------V--QQVIQQAKSYPS---
A0A1Q7JK96      TLLIDGDIRRGGLHRVLD-AARTPGLTDLLAGTAA-------V--QQVIQQAKSYPS---
A0A2V7KQV7      TLLIDGDVRCGALHRLLK-AARRPGLTDVLANEVT-------P--DQVV-QSTPYAH---
A0A1Q7JGF6      TLLIDGDVRLGVLHRALR-GTRRPGLTDLLASRAT-------V--DQVV-QGTPHPL---
A0A2V7SG67      TLLIDGDVRLGVLHRALR-GTRRPGLTDLLASRAT-------V--DQVV-QGTPHQL---
A0A1Q7GIK9      TLLIDGDVRLGALHRTLR-AARRPGLTDVLAGHVE-------Y--AAVL-QSTPHTR---
A0A7W0YSQ1      TLLIDADLRRAVLDKLFE-VPREPGLTDVLVGKAS-------L--AQSV-SATAIPN---
A0A3M2BLV5      VLLIDADLRRPSLHRAMD-LLREPGLTNLLVGDAE-------A--REAI-RPNVLPN---
A0A2V7KS68      TVLVDADIRRGLLHRRLK-ANRQPGLADYLLGETT-------A--DEIV-QQTAYPR---
A0A2V7N4L3      TLLVDGDIRRGVLHRRFK-LSRQPGLVDFLLDEIG-------K--DQIV-QKTAYPH---
A0A1Q7AZK2      TLLVDGDVRRGVLHRRFK-ANRQPGLVDFLLGKAG-------L--DEIV-QGTEYPR---
A0A1Q7TNP7      TLLVDGDVRRGVLHRRFK-ANRQPGLVDFLLGKAG-------L--DEIV-QGTEYPR---
A0A1Q7KG39      TLLVDGDVRRGVLHRRFK-ANRQPGLVDFLLGKAG-------L--DEIV-QGTEYPR---
A0A1Q7GX75      TLLIDGDIRRGVLHRRFK-GNRQPGLVDYLLGDAG-------H--DAIV-QKTAYPR---
A0A1Q7LL80      TLLIDGDIRRGVLHRRFK-GNRQPGLVDYLLGDAG-------H--DAIV-QKTAYPR---
A0A2V7PFU2      TLLVDGDIRRGTLHRRFK-ANRRPGLVDYLRGEAG-------IGRELIV-QQTPYPQ---
A0A2V7MFS9      TVLVDGDIRRGVLHRRFK-ANRQPGLVDFLNGEVG-------H--DQIV-QPTPYPR---
A0A2V7T933      TLLVDGDVRRGVLHRRFK-ANRQPGLVDFLLGKAG-------L--DEIV-QGTEYPR---
A0A841GX23      VLVVDADLRRAKVHSVFG-LPRTPGLSETLLGELP-------V--EDAV-RPSGVEN---
A0A7V9AJ94      TVLVDADLRRGTLHQIFG-LERMPGLAELLEGEADLEDT---L--RQVS-AGPAGTP---
A0A7Y3MYM3      VLLIDADMRRPQIHRIVN-VPQEPGLSDVLLEDCEL------P--EAVQ-PSSVNAK---
A0A848XLS5      VLLIDADMRRPQIHRIVN-VPQEPGLSDVLLEDCEL------P--EAVQ-PSSVNAK---
A0A7V9FIM2      VLLVDCDIRRPRVHGLFH-LPRAPGLMELLTSSGEPGGPP--P--PPAI-RETSIAR---
A0A7W0WMB8      VLLIDCDIRRPRVHGLFH-LPRAPGLMELLVSPRTQNGQPATP--PKAI-RDTSVAG---
A0A2V7P8B1      TLLIDADLRRGALHRTLK-LPRQPGLMDLLVGHAT-------P--EQVV-HRTAYQS---
A0A7C2QQS2      VVLVDADLRRPAVHEVFG-VPREPGLSNVLVRQAT-------L--DQTL-RPAPIEG---
A0A2V7QN41      TLLIDGDVRRGGQHRMLG-LHREPGLVDFLAGDLP-------F--ETVV-QATRHPG---
A0A2V7R603      TLLIDGDVRRGGQHRMLG-LHREPGLVDFLAGDLP-------F--ETVV-QATRHPN---
A0A7Y5VC49      TILVDGDIRRGSLDRTFR-VERAPGLTDHLAGRAS-------L--DEAI-HASTQRD---
A0A2V7LJS2      TLLVDADLRRGALHRALQ-LRREPGLTDLLAAAAS-------P--EQVV-KATSHPS---
A0A1Q7GLJ7      TLLVDADLRRGALHRLLN-LRRQPGLTDFLIGDVS-------R--APAL-QTTAYPF---
A0A2V7GRE3      TLLVDADLRRGALHRVLN-LRRQPGLTDFLAGDVS-------R--APVV-QTTSHPC---
                 :::* * *       .       *:   .                              

A0A838NTH4      LHVLTSGRLPPNPAELLGSERMRKLLEELRQQFDMIVFDTPPLTLVTDAAVLGTLSDSTV
A0A2D5ZJF2      LDVLRCGPLPPNPSEFINSDAFREMLEELAVKYDRVVIDSPPVMAVSDARILAAGCDITL
A0A0S8H9P3      LDLLPAGKRPPNPSELLGSQAMAKLLASWREEYRWVLFDTPPVLAVTDASVLAALVDGAV
A0A1E4BBP7      LSIVPCGKRRRHGPELLASERMTTLIRDLRTQFDAIIVDTAPLGAGIDPFAIGTATGSMV
A0A3M2G737      LDVICSGIIPPNPAEILSSTRMIEFVKEMRDQYDLIIFDTPPILRVADPSIVSTLVDGVI
A0A0H4TUX7      LDVLPSGSIPPNPSELLGSAAMHSLISALRRDYHYIIIDTPPTLPVTDASVVASGADAAI
A0A1G0LUG0      LDVLPSGPAPPNPSELLGSHAMHALIGELRRSYDYIVMDTPPTLPVTDAAVVASAADGAI
A0A1Q7E3T7      LHFIGCGMRRPDSPELLSSPRMSDLFAQLRANFAVIIVDSPPLGAGVDAFALATITGHLV
A0A1G0L906      LDILTSGSLPPNPSELLGSEAMHRLLEEVRSHYDNIIFDTPPALAVTDAAVLGAGSDAVI
A0A1G0LCC0      LDILTSGSLPPNPSELLGSEAMHRLLEEVRSHYDNIIFDTPPALAVTDAAVLGAGSDAVI
A0A2D5ZJE2      LHVITSGSLPPNPSELLGSDAMARFIEEVGREFDQIIVDTPPVMAVTDALLLSALLDGVI
A0A3M2G624      LDIICSGTQPPNPSELLSSPELKSLITTLKEHYDMILFDSPPVIPVADSVALSTNVDGVL
A0A6M4IRY1      LTVMPAGARRKRAPELLATPRLQQLINQMSAEYDVVIVDSPPLGAGFDAYALATATGNLA
A0A3D4VBZ5      LTIMPAGVRRKRAPELLATPRLTQLISQMAGEYDVVVVDSPPLGAGYDAFALATATGNMA
C1A5W1          LTIMPAGVRRKRAPELLATPRLTQLISQMAGEYDVVVVDSPPLGAGYDAFALATATGNMA
W0RI74          LTIIPSGTRHRRAPELLATPRMQQLVASLAAEFDVVIIDTPPLGAGTDAYAIGTACGQLA
A0A3M2BJA6      MHFLPTGTLPPNPAELLGSERMKTLLRHLEEQFDAIILDSAPLTVVTDAAVLGTNAEGVL
A0A7Y5QXY3      LFVMGSGQLPPNPSELLGSDRMREVVAEARESFDVVLFDSPPLLAVTDAAVLSTMVDGAI
A0A2V7PX99      LSILSCGTRMYRSPELLLLPTLRETIARLRTTYQIIIVDSPPLVAGIDPLVLATVTGNLL
A0A2V7ERC7      LFLLPAGTRKNRAPELLVSDRMTALLLAARQEFEVIIIDSPPFIAGVDAYALGAAAGSML
A0A7V9QLH4      LSVIPSGLVPANPGGVLLSNELRDLLEQAEREYDIIIIDSPPLNVVADAAILSGVTQGVV
A0A7Y4RSP8      LTMIPCGTRLQHGPELLGSARMAELIGRLKSQYEVVLVDSPPLGAGIDPFVLGTHTGNML
A0A838W6Q3      LDLVPTGELPAHPTQVLDSPEMSALVETLRARYDLVVVDTPPLNVVSDATVFNTAADAVV
A0A7V9U4Z2      LYVIASGQLPPNPAELLGGEGMRRTLNSLMEGYDLVVVDTPPLLAASDAAILATLVDGVV
A0A5Q4D6Y4      LFILPSGTLPPNPTELLGGARTREVLQVLQENFDMVILDSPPLSGGADSSILGAAVDGVI
A0A7Y3MUW4      LDVIPAGPIPPNPAELVGSMVMSETLGELERGYDRVIVDSPPVLAVTDAAGTAGFVDGVL
A0A848XQ54      LDVIPAGPIPPNPAELVGSMVMSETLGELERGYDRVIVDSPPVLAVTDAAGTAGFVDGVL
A0A7V9QB34      LHLLSTGALPPNPAEVLGSVAMRKLLEQLHGLYDTVIVDAPPLNPVADAGVLGKIADHVI
A0A2V7JTZ5      LFLIPRGTRGNRAPELLVSELMSALVHAMRLQFDVVIIDSPPLVAGMDAYALGAAAGSML
A0A3D4YTR6      LFLIPRGTRRNRAPELLVSDLMNSLVHAMRLQFDVVIIDSPPLVAGIDAYALGAAAGSML
A0A7V8VRF0      LTLLTAGSEEADVIEVMRSARMLSMIRTLREQFDLLIIDSPPVLAGADASILSALADGVL
A0A2V7F1M1      LWLLPCGALPRRTSEVLQPHQLRRLLDDLSGHFDVIILDTPPVLVSADAALLAPLADGAI
A0A841GJ36      LDVLPTGVLPPNPAELLGHQRTRDLVETLRERYEMIIFDAPPLNLVTDAAVLGTVADATI
A0A838NJX4      LSVLTCGALPVNAANLLSGTRMRVLLGELQEQFDIIVLDTPPVLATADASIVASLTDGVL
A0A2V7KXK7      LTFLSSGTRMQRAPERLLSQNMRDLMSKLRSMFDVVIVDSPPLGAGADPLVLGTLTENLL
A0A651HKD3      LSVIPRGSGLQNGPELLSTPAMQDLLAHLKEEFDVILVDSCPIGAAADPVILGTLTGSLA
A0A843T4K9      LHFISSGRRTERGPELLTGQELPELLHALKRHYAVIIIDTPPLGAGIDPYVFGVATGSLM
A0A2V7QDU7      VDVLPAGSAVNNASQLLWRADLDGLLVRLRAAYDLIVIDSPPMNVVADATLLAPQSDAVI
A0A6J4M9S2      LYVMASGTLPPNPSELVGGPRMANVLKALSAEFDLVVLDTPPLTAAADAAILGKSADGVL
A0A2V7ITT6      LEFISAGTHFRDAPELLGSDAMVELVTRLRGSYGVILVDSPPLASGVDPYTLGMVTGSLL
A0A2V7NJW1      LEFISAGTHFRDAPELLGSDAMVELVTRLRGSYGVILVDSPPLASGVDPYTLGMVTGSLL
A0A7V4KNE3      LSLLPGGTRDRRAPELLQSPAMEALMAAARLQFDAIVIDSAPLGAGVDASVLAVHAANLV
A0A7Y5PAU0      LSIIPSGNPRKRSPELLTSPLLGRLIADLKARYDVVIFDTPPLAAGIDGYAIAAATGSLL
A0A7V9TKH4      LTLIPCGTRRHRGPELLHSQAMSQFIAELRRRYDVVVVDSPPLGAGVDPFVLAAATQNML
A0A2V7GFB5      LTLLPCGVRTSDAPELLGSAKMPELLARLRGDYDTILVDSPPLGAGIDPFVLGTLTGNLL
A0A2V7RQ86      LTLLPCGVRTSDAPELLGSAKMPELLARLRGDYDTILVDSPPLGAGIDPFVLGTLTGNLL
A0A2V7IWX2      LSFIGCGSRMHNSPELLSAATMVDLLAALRSRYDVVLVDTAPLAAGADPYTMASLTTNLL
A0A1Q7KE95      LDFIGAGSRFRDSPELLGSPAMVELLERVRSQYRVVLVDSPPLGSGVDPYTLGTLTGNLL
A0A1Q7T8X5      LDFIGAGSRFRDSPELLGSPAMVELLERVRSQYRVVLVDSPPLGSGVDPYTLGTLTGNLL
A0A2V7MS64      LSFLPSGTRTQIAPVLVSSAPLPRLLAELRPNYDAVIVDSPPLAAGVDALALGTATGAMV
A0A2V7Q7N9      LTFLGSGTRTHAGPTLISSAALPRALAALRPGYDVIIVDSSPLAAGADAFALGTATGSML
A0A2V7IRW6      LSFIGSGTRTHTGPSLVSSAALPRLLAALRPSYDAIIVDSPPLAAGADAFAIGTATGSMV
A0A1Q7DVU6      LSFIGSGTRTHTGPSLVSSAALPRLLATLRPGYDAIIVDSPPLAAGADAFAIGTATGSMV
A0A1Q7JSV2      LSFIGSGTRTHTGPSLVSSAALPRLLATLRPGYDAIIVDSPPLAAGADAFAIGTATGSMV
A0A2V7FK98      LSLIGCGTRAYNAPELLGSPAMTSLVNGLRGGYDVVLIDSPPLAAGVDPLILSTLTGTLA
A0A2V7R3Z8      LSLIGCGTRAYNAPELLGSPAMTSLVNGLRGGYDVVLIDSPPLAAGVDPLILSTLTGTLA
A0A2V7J3C0      LDFIAAGSRYRDSPELLGYPAMVELLEHARAHYAVVIVDSSPLGSGVDPYTLGTLTGSLL
A0A2V7KWV9      LQFIGAGSRIRESPELLGSPRMVELLVRLRAMYPVIIVDSPPLGAGVDPYTLGTMTGAMM
A0A1Q6ZHP2      FSLIGCGTRAYNAPELLGSQTMSQLLTTLRPSYDVILVDSPPLSAGVDPLILGTLTGHLV
A0A1Q7R6Z6      FSLIGCGTRAYNAPELLGSQTMSQLLTTLRPSYDVILVDSPPLSAGVDPLILGTLTGHLV
A0A2V7FYT7      FSLIGCGTRAYNAPELLGSQTMSQLLTTLRPSYDVILVDSPPLSAGVDPLILGTLTGHLV
A0A2V7IGR0      LALVSCGTRAHHAPELLGSPAMGQFVAGLRTHYDVILFDNPPLAAGVDPLIVGTLTGNLL
A0A2V7MR23      FSLIGCGTRAYNAPELLGSQTMSQLLTTLRPSYDVILVDSPPLSAGVDPLILGTLTGHLV
A0A2V7L1V3      LSLIACGTRAYNAPELLGSPAMSELVTGMRSGYDVILIDSPPLAAGVDPLILGTLTGTLA
A0A1Q7E5D3      CTLVGCGTRAHNAPELLGSEAMSQLIRHARRSYDVVVFDSPPLGAGVDPLILGTLTGSLV
A0A2V7ISE2      FSLIGCGTRAYNAPELLGSQTMSQLVTALRPSYDVILVDSPPLSAGVDPLILGTLTGHLV
A0A1Q7J2X5      FSLIGCGTRAYNAPELLGSQTMSQLVTALRPSYDVILVDSPPLGAGVDPLILGTLTGHLV
A0A2V7NPD1      FSLIGCGTRAYNAPELLGSQTMSQLVTALRPSYDVILVDSPPLGAGVDPLILGTLTGHLV
A0A2V7QPD8      LSLIGCGTRAYNAPELLGSPAMTSLVNGLRGSYDVILIDSPPLAAGVDPLILSTLTGTLT
A0A2V7Q8M6      LSLIACGTRAYNAPELLGSPPMSELVNGMRSGYDVILIDSPPLAAGVDPLILGTLTGTLA
A0A2V7QBC3      LSLIACGTRAYNAPELLGSPPMSELVNGMRSGYDVILIDSPPLAAGVDPLILGTLTGTLA
A0A2V7LMU1      LSLIACGTRAYNAPEMLASPAMSQLVNGMRSGYDVILIDSPPLGAGVDPLILGTLTGTLA
A0A2V7PBY9      LSLIGCGTRAYNAPELLGSPRMSELVTGMRSGYDVILFDSPPLAAGVDPLIVGTLTGTLA
A0A2V7J4D7      LSFISCGLRSHAGPALLSSVAMARLLDALRASYEAIIVDSPPLAAGADGLALATVTGSLV
A0A2V7LN90      LTLLAAGTRTHAGPALIGSAALPRALAALRPGYDVIIVDSSPLAAGADAFALATATGSML
A0A2V7LFN9      LSFLGCGTRTHDGPALVSSAALPRVLAGLRSSYHAIIIDSSPLAAGADAFALGTGTGTLL
A0A2V7MEK4      LSFLGCGTRTHDGPALVSSAALPRVLAGLRSSYHAIIIDSSPLAAGADAFALGTGTGTLL
A0A2V7EU00      LWFIGSGSRTPDAPELLGAPPMARLLASVRTSYQVILIDSSPLGAGVDPFLLGTLTGSLL
A0A1Q6WE01      LQFIGAGTRFRDSPELLGSGAMSELLARLRASWSVILVDSPPLGSGVDPYTLGTLTSNML
A0A2V7S9K3      LQFIGAGTRFRDSPELLGSVAMVELLTCVRSSYGVILLDSPPLGSGVDPYTLATLTGSLL
A0A1Q7DXB9      LSFIGCGSRMHNSPELLSAATMVDLLAALRSRYDVVLVDTAPLAAGADPYTMASLTTNLL
A0A1Q7JD32      LSFIGCGSRMHNSPELLSAATMVDLLAALRSRYDVVLVDTAPLAAGADPYTMASLTTNLL
A0A2V7MVP8      LSFIGCGSRMHNSPELLSATTMVDLLAALRSRYDVVLVDTAPLAAGADPYTMASHTKNLL
A0A2V7N0A9      LSFIGAGSRMHRGPELLCSATVPQLITALRPGYDVILVDSAPLAAGVDPYALGVATGNML
A0A1Q7DLS9      LAFIACGSRTRSGPELLSSTAMAGFVTSLRSRYAVILIDSPPLAAGVDACALGTMTGSLV
A0A1Q7JK96      LAFIACGSRTRSGPELLSSTAMAGFVTSLRSRYAVILIDSPPLAAGVDACALGTMTGSLV
A0A2V7KQV7      LSFIGGGSRLHRGPELLCSEALPRLITAMRPHYDAILVDSPPLAAGVDASALGAVTGSLL
A0A1Q7JGF6      LSFIGAGSRMHRGPELLCSVAMPRLITVMRPSYDVILVDSAPLAAGVDPYALGTATGSML
A0A2V7SG67      LSFIGAGSRMHRGPELLCSVAMPRLITVMRPSYDVILVDSAPLAAGVDPYALGTATGSML
A0A1Q7GIK9      LSFLGAGSRMHRGPELLGSAGMPRLLTALRSAYDVILVDSAPLAAGVDPYALGAATGNVL
A0A7W0YSQ1      LSVLGSGPFPPNPSELLGSARMRDTLREAKENFDVILLDSPPLLAVTDAAVLSTLVDGAI
A0A3M2BLV5      LDMLPSGPFPPNPSELLNSKAMQRLLEELQGKYSHIIVDSPPVLAVTDAALLGAHTDGVV
A0A2V7KS68      LSLIACGTRTQRAPELLDSDAMVTLLTRLRGEYDVVLIDSPPLTAGVDPFVLGTLTGALV
A0A2V7N4L3      LALIGCGTRTSRAPEVLGSTAMNDLLTEMRGQYDVIVVDSPPLAAGVDSFVLGTVTGTLL
A0A1Q7AZK2      LAFIGCGTRTQRAPEVLGSPAMTQFIADLRNQYDVILVDSPPLTAGVDPFVLGTVTGALL
A0A1Q7TNP7      LAFIGCGTRTQRAPEVLGSPAMTQFIADLRNQYDVILVDSPPLTAGVDPFVLGTVTGALL
A0A1Q7KG39      LAFIGCGTRTQRAPEVLGSPAMTQFIADLRNQYDVILVDSPPLTAGVDPFVLGTVTGALL
A0A1Q7GX75      LSLIGCGTRTQRAPEVLGSPAMNRLLAELRGRYDVIVVDSPPLAAGVDSFIIGTVTGSLL
A0A1Q7LL80      LSLIGCGTRTQRAPEVLGSPAMNRLLAELRGRYDVIVVDSPPLAAGVDSFIIGTVTGSLL
A0A2V7PFU2      LAFIGCGTRTQRAPEVLGSPAMAQLLAELREQYDVIVVDSPPLTAGVDPFILGTATGSLL
A0A2V7MFS9      LALIGGGTRTQRAPEVLGSQAMTELIAELRGQYDVILVDSPPLTAGVDPFILGTVTGSLL
A0A2V7T933      LAFIGCGTRTQRAPEVLGSPAMTQFIADLRNQYDVILVDSPPLTAGVDPFVLGTVTGALL
A0A841GX23      LDVLAAGRLVPHVSELLGGASMGRLLRELGARYDLVIVDTPPVMAAADAEILAAQCDALL
A0A7V9AJ94      LDVVLAGQAPTSPAEVLGSEAMRALLDHLRGRYGAIILDAPPLNPVTDTALLALAADGVL
A0A7Y3MYM3      LHVLPCGSVVSNPAELLGSERFERLIRYLRTVYDAILIDTPPVLAVTDAAVVGTVSDGVL
A0A848XLS5      LHVLPCGSVVSNPAELLGSERFERLIRYLRTVYDAILIDTPPVLAVTDAAVVGTVSDGVL
A0A7V9FIM2      LSVLPCGALPMNAANLLSSTRMRILLQELEDKYDIIVLDTPPVLATADAGIVGSLTDGVL
A0A7W0WMB8      LSVLPCGALPSNAANLLSGTRMRILLEELKERFDIIVLDTPPVLATADAGIVASLTDGVL
A0A2V7P8B1      LDFVASGSRRRDAPELIGSARMTEFMSGLRSRYGVIVVDSPPLGAGVDALLVASLAGSLL
A0A7C2QQS2      LRILTAGTLPPNPAELLGSPAMDEVLEQLDRSADLVVLDTPPVLAAADAAVLAPRVEGVV
A0A2V7QN41      LSFIGCGARRPSAPELLSSDVMTELIDRVREECGVVLVDSPPLAVGVDPYVLATRTGNVL
A0A2V7R603      LSFIGCGARRPSAPELLSSDVMTDLIDRVREECGVVLVDSPPLAVGVDPYVLATRTGNVL
A0A7Y5VC49      LDVMTSGTRIPDGPELLSSAALPALAGALGDRYDVVLFDTPPLGAGADAGCLAIATGRAV
A0A2V7LJS2      LDFLASGSRRGDAPELLGSARMADFMTKLRSSYGVIVVDTPPLGAGVDAFVLASLAGSLL
A0A1Q7GLJ7      LDFLPSGTRRRDAPELMGSAAMVDLVTSLRSTYDVIVLDTAPLGAGVDALALAKLAGNLL
A0A2V7GRE3      LDFIASGTRRRDAPELLGSAAMTDLVTSLRSTYEVIVVDTAPLGAGVDALVLAKLARNLL
                  .:  *         :                  ::.*  *     *            

A0A838NTH4      LVARAGVTDKRALHHAAEQLYHLRVQVSGTIVND----FNPKEA---GYGYEYGYGYSPG
A0A2D5ZJF2      LVLRAEKSTRKASEQARDGLLAVGGHLLGVVVND----AHHRREGYGYGYYGGYGQYGGY
A0A0S8H9P3      LVVKAGETDRRAGWQAIQQLRRVGARVVGAVLNE----IVL------QRGADRYY--FDY
A0A1E4BBP7      LVLRAGETDRKLAQAKLTVLDRMPIRLVGAILND----IGE------LPQF-KYY----Y
A0A3M2G737      LVVASGKTPAGGLNFAVETLVKVKANLLGIVLNDFDPKKAY------GGYYYGNYYKYYY
A0A0H4TUX7      LVLRSGDTQETAAQRALEQLRRVHARIAGAVLNG----V--------SSRHDRYY---TY
A0A1G0LUG0      LVLKSGDTEEVPAQRALEQLRRVHARVAGAVLNG----V--------NQQKDQYY---TY
A0A1Q7E3T7      MVLRPGTTNREVIEAKLDLLHRLPVRVLGAVLND----VQD------GPEY-TGY---SY
A0A1G0L906      LILRAGKTEEVAAQRALAQLSRVQARVAGSVLNG----VQKM-----RDRY-YYY---YY
A0A1G0LCC0      LILRAGKTEEVAAQRALAQLSRVQARVAGSVLNG----VQKM-----RDRY-YYY---YY
A0A2D5ZJE2      IIVEAGETLEQVAKRTKTLVETAARRCLGVVLNN----VDV------GGGY-GRYGGYHY
A0A3M2G624      LVVSAGKTDRHALQRTRDLLHNVNARIMGAVLNN----VRI------NEIY-GYQKHYYY
A0A6M4IRY1      LVLRAGTTDRKMAAAKMATVDTLPVRVMGAVLNG----IKL------TGVY-EYY----S
A0A3D4VBZ5      LVMRAGVTDRKMAEAKMATVDTLPIRVMGAILNG----IKM------TGAY-QYY----S
C1A5W1          LVMRAGVTDRKMAEAKMATVDTLPIRVMGAILNG----IKM------TGAY-QYY----S
W0RI74          VVLRSNRTNLKMAKAKLAVLAQLPVTLLGAVLNE----VRTD-----SGMY-QYY----S
A0A3M2BJA6      LVARANVTERGAIRYSVDQLKHVRAPILGVVLND----IDFRRDSRYSSSYGRYGYYYQY
A0A7Y5QXY3      LVVRMGTTSREAVRRAAAHLRAVHSRVLGAVLNDID--VTS------GGYY-GGY---GY
A0A2V7PX99      VVLRSEATDLELAAAKLSVADTLPVRTIGAVLNC----VRG------HGAF-RYY---TY
A0A2V7ERC7      VVLRPGVSDRKLAAAKLDIVDRLPIRVLGAVLNG----VPG------GGAY-RYYGTNYY
A0A7V9QLH4      LVARSGVTAKAAITYAAEQLRLVRAPLFGTILND----IEPKSYSSYDGAY-RYYGVPAL
A0A7Y4RSP8      IVLRSGETDRQMAEAKLRILDRLPVRVLGAVLNH----IHA------GAGAYKYY----S
A0A838W6Q3      MVARAGVTPVEALIYAGEVARNAGMPLVGTLLNGID--FER------DASYDPAYRWYSY
A0A7V9U4Z2      IVLRAGQTESSAAVQSMQQLNAVGARVVGAVLNDPDMQVPR------YGAY---------
A0A5Q4D6Y4      MVVRAGETEIEAVRYAARQLHTVGATLLGSVMND-----PD------GEAE-KYG---AY
A0A7Y3MUW4      LVLRSGHTEQRAAERTAEHLGRLGVRILGLVLNDIQRRVHE------ENYYLRYH---AR
A0A848XQ54      LVLRSGHTEQRAAERTAEHLGRLGVRILGLVLNDIQRRVQE------ENYYLRYH---AR
A0A7V9QB34      LVARAGATNKQALHEAVDQLRLLRVPVAGVVVND----VDS------QSAE-YYGTEAAY
A0A2V7JTZ5      IVLRPAVTDRKLASAKLEVLDRLPIRILGAVLNA----VPD------GGAY-------RY
A0A3D4YTR6      IVLRPARTDRKLAAAKLDVLDRLPIRILGAVLNA----VPG------GGAY-------RY
A0A7V8VRF0      LVLRAGCTNHREALAAVQQLNAVGAHMLGAVLND-----AP------VESY--------P
A0A2V7F1M1      LVVRAGQTNRSSAERACQYLIAAGAHFLGAVLNDPAGELAR------YGKY--------Y
A0A841GJ36      LVARNGITDRRALEHAALQLSHVGAVLGGVILND----VVG------DEN--------SY
A0A838NJX4      LVVRAGTTDRNAAQRAYQQLANVGARVVGTVLNDPGGEVAK------EGDY--------Y
A0A2V7KXK7      LVLRTGQSDINLASTKLEVLNALPVRVIGAVLND----VRS------SGVY-RYY---MY
A0A651HKD3      LVVRSGTTDSERAEGMLRNLRRFPVRVLGAVVND----VSQ------GDHY-NYY----G
A0A843T4K9      VVLRTNQTNRAFAAAKLELLNRLPIRVAGAVINA----VPK------SKAY-QYY----S
A0A2V7QDU7      VVARAGRTAPEALNFTLEQLRSVHA-LVWTVLNDID--YRR------DRVYGRAYGQRAS
A0A6J4M9S2      VVVRAGQTERGAAQHAVGQLNNVGARILGAVLNDPDAKVPR------YGGY-YYY---DY
A0A2V7ITT6      LVLRTGATSLELARTKLRVLDRLPIRLLGVVVND----VRP------RGVY-RYH----S
A0A2V7NJW1      LVLRTGATSLELARTKLRVLDRLPIRLLGVVVND----VRP------RGVY-RYH----S
A0A7V4KNE3      LVLRSGETDRTFAEAKLKELDRLPIRVLGAVIND----VSL------KERH-YAY---YS
A0A7Y5PAU0      VVIRIGQTAKRMAAAKLLLVDRLPISVVGTVLNA----VPS------TGEY-EYY----G
A0A7V9TKH4      IVLRTGATDRKMAENKLKLLDRLPVRMLGAVLND----IRA------QGEY-KYY----S
A0A2V7GFB5      LVLRTGVSHREVMAAKLEVLRRLPVRLLGAVLND----VPP------GAAY-QYY---SY
A0A2V7RQ86      LVLRTGVSHREVMAAKLEVLRRLPVRLLGAVLND----VPP------GAAY-QYY---SY
A0A2V7IWX2      MVLRAGVTDLELAQAKLESFEDLPVRVVGTVLND----VQP------KGAY-RYY---AY
A0A1Q7KE95      LVLRTGTTNLALARTKLTVLDHLPIRLLGVVLND----VRP------GGMY-RYY---S-
A0A1Q7T8X5      LVLRTGTTNLALARTKLTVLDHLPIRLLGVVLND----VRP------GGMY-RYY---S-
A0A2V7MS64      LVLRTGYSDREMAQNKLQALTHLPIRVLGAVLND----VR-------GSRY-KYY---SY
A0A2V7Q7N9      LVLRTGVSDRELVQAKLEVLQYLPIRVLGAVLND----VRP------GGVY-RYY---SY
A0A2V7IRW6      LVLRTGVSDRELAQTKLEVLAHLPIRMLGAVLND----VR-------GGLY-RYY---SY
A0A1Q7DVU6      LVLRTGVSDRELAQTKLEVLAHLPIRMLGAVLND----VR-------GGLY-RYY---SY
A0A1Q7JSV2      LVLRTGVSDRELAQTKLEVLAHLPIRMLGAVLND----VR-------GGLY-RYY---SY
A0A2V7FK98      LVLRTGYSHRDVAAAKLEVLQRLPVRMLGAVLND----VPA------GGAY-RYY---SY
A0A2V7R3Z8      LVLRTGYSHRDVAAAKLEVLQRLPVRMLGAVLND----VPA------GGAY-RYY---SY
A0A2V7J3C0      LVLRTGTTNLALARTKLAVLDHLPIRLLGAVLND----VRS------DDLY-RHY---S-
A0A2V7KWV9      LVLRTGATNLDLARTKVAMLENLPIRVLGAVLND----VRL------GQMY-GEY---YG
A0A1Q6ZHP2      VVLRTGFSHRDMASAKLEVLQRLPVRLLGAILNA----VPA------GEAY-RYY---SY
A0A1Q7R6Z6      VVLRTGFSHRDMASAKLEVLQRLPVRLLGAILNA----VPA------GEAY-RYY---SY
A0A2V7FYT7      VVLRTGFSHRDMASAKLEVLQRLPVRLLGAILNA----VPA------GEAY-RYY---SY
A0A2V7IGR0      LVLRTGQSDREMTAAKLEVLQRLPVRLLGAVLND----VPA------GATY-RYY---SY
A0A2V7MR23      VVLRTGFSHRDVASAKLEVLQRLPVRLLGAILNA----VPA------GDAY-RYY---SY
A0A2V7L1V3      LVLRTGYSHRDVAAAKLEMLQRLPVRMLGAILND----VPA------GGAY-RYY---SY
A0A1Q7E5D3      LVLRTGYSDRDVAAAKLEMLQRLPIRLLGAILND----VPA------GAAY-RYY---SY
A0A2V7ISE2      VVLRTGYSHRDVAAAKLEVLQRLPVRLLGAILNA----VPA------GAAY-RYY---SY
A0A1Q7J2X5      VVLRTGYSHRDVAAAKLEVLQRLPVRLLGAILNA----VPA------GAAY-RYY---SY
A0A2V7NPD1      VVLRTGYSHRDVAAAKLEVLQRLPVRLLGAILNA----VPA------GAAY-RYY---SY
A0A2V7QPD8      LVLRTGYSHRDVAAAKLEVLQRLPVRMLGAVLND----VPA------GGAY-RYY---SY
A0A2V7Q8M6      LVLRTGYSHRDVAAAKLEMLHRLPVRLLGAILND----VPA------GGAY-RYY---SY
A0A2V7QBC3      LVLRTGYSHRDVAAAKLETLQRLPVRLLGAILND----VPA------GGAY-RYY---SY
A0A2V7LMU1      LVLRTGYSHRDVATAKLEMLQRLPVRLLGAIMND----VPA------GGAY-RSY---SY
A0A2V7PBY9      LVLRTGYSHRDVAAAKLEVLQRLPIRLLGAILND----VPA------GGAY-RYY---SY
A0A2V7J4D7      LVLRTGVSDRELTETKLGALHHLPVRVLGAVLND----VRP------GGAY-RYY---SY
A0A2V7LN90      LVLRTGVSDRELAQAKLEVLQYLPIRVLGAVLND----VRL------GGVY-RYY---SY
A0A2V7LFN9      LVLRTGVSDGGLALAKLEVMSRLPIRVLGAVLND----VRG------GSLY-RDY---SY
A0A2V7MEK4      LVLRTGVSDGGLALAKLEVMSRLPIRVLGAVLND----VRG------GSLY-RDY---SY
A0A2V7EU00      IVLRSGTTDRELAQANLDGLLRLPIRVLGAVLND----IEP------RGAY-RYY---SY
A0A1Q6WE01      LVLRTDATDLSLARTKLSVLDQLPIRLLGVVVND----VRP------GGVY-RYY---SY
A0A2V7S9K3      LVLRTGATNLDLARTKLGMLDHLPIRLLGVVVND----VQP------GGAY-RYY---SY
A0A1Q7DXB9      MVLRAGVTDLELAQAKLESFEDLPVRVVGTVLND----VQP------KGAY-RYY---AY
A0A1Q7JD32      MVLRAGVTDLELAQAKLESFEDLPVRVVGTVLND----VQP------KGAY-RYY---AY
A0A2V7MVP8      VVLRAGVTDLELAQAKLESFDDMPVRVVGSVLND----VRP------KGAY-RYY---AY
A0A2V7N0A9      LVVRPDVTDRAIAEAKVEVLQRLPVRLLGAVLND----VRP------GLAY-NHY---SY
A0A1Q7DLS9      LVLRTGVSDRELVEAKLDVLERLPIRILGAVLND----VRP------GGAY-RSY---AY
A0A1Q7JK96      LVLRTGVSDRELVEAKLDVLERLPIRILGAVLND----VRP------GGAY-RSY---AY
A0A2V7KQV7      VVLRTGVTDRMIAEAKVELLRTLPIRMLGVVLND----VRP------GVAY-SYY---AY
A0A1Q7JGF6      LVLRTGVTDRTLAEAKVEVLHRLPIRVLGAVLND----VRP------GAAY-TYY---SY
A0A2V7SG67      LVLRTGVTDRTLAEAKVEVLHRLPIRVLGAVLND----VRP------GAAY-TYY---SY
A0A1Q7GIK9      LVLRTGVTDRSLAEAKVEVLHRLPLRVLGAILND----VRP------GSAY-SYY---SY
A0A7W0YSQ1      LVIRIGSTARTAVRRAIGQLHTVHGRVVGSVLNDVD--FRS------GAYG-GQYGYYYY
A0A3M2BLV5      LVLRSGETEQRAAERAVEQLRRVGVRVFGAVLNE----VST------SNAE-ESYYLQYY
A0A2V7KS68      LVLRTGHSNRNITGAKLDMLQRLPVRLLGAVLND----VPR------GGAY-GYYAYYSY
A0A2V7N4L3      VVLRTGHSHRDITGAKLEMLDRLPIRLLGAVLND----VPR------GAAY-GYYAYYSY
A0A1Q7AZK2      LVLRTGHSHRDITGAKLEVLDRLPIRLLGAVLND----VPH------GAAY-GYYSYYSY
A0A1Q7TNP7      LVLRTGHSHRDITGAKLEVLDRLPIRLLGAVLND----VPH------GAAY-GYYSYYSY
A0A1Q7KG39      LVLRTGHSHRDITGAKLEVLDRLPIRLLGAVLND----VPH------GAAY-GYYSYYSY
A0A1Q7GX75      LVLRTGHSHRDITGAKLEVLDRLPIRLLGAVLND----VPR------GAAY-GYYAYYSY
A0A1Q7LL80      LVLRTGHSHRDITGAKLEVLDRLPIRLLGAVLND----VPR------GAAY-GYYAYYSY
A0A2V7PFU2      LVLRTGHSHRDVTGAKLEMLDRLPIRLLGAVLND----IPR------EAAY-GYYAYYSY
A0A2V7MFS9      VVLRTGHSHREIAGAKLEVLERLPIRLLGAVLND----VPR------GAAY-GYYAYYSY
A0A2V7T933      LVLRTGHSHRDITGAKLEVLDRLPIRLLGAVLND----VPH------GAAY-GYYSYYSY
A0A841GX23      MVARAGQTDRQSARHAADQLRAVGARIVGAVLNDPDSKMGG------TGQY-------AY
A0A7V9AJ94      LVARSGATDREALQEAADQVRRLRVPLSGVVLND----VEP------VAS--------PY
A0A7Y3MYM3      VVVRANGTDKEALEKAVNELRRVKAPVAGVILNG----VES------EGSG-HSY-YESY
A0A848XLS5      VVVRANGTDKEALEKAVNELRRVKAPVAGVILNG----VES------EGSG-HSY-YESY
A0A7V9FIM2      LVVRAGTTDRNAAQRAYQQLANVGARVVGTVLNDPGGELAK------EGDY--------Y
A0A7W0WMB8      LVVRAGTTDRNAAQRAYQQLANVGARVVGTVLNDPGGEVAK------EGDY--------Y
A0A2V7P8B1      MVLRLGRTDRELAEAKLELLRAQPIRVLGAVLND----VRE------GSEY-HAY---SY
A0A7C2QQS2      LVARAGRVNREAVLRAFRQLQSVNARILGTVLNDPDAEVPR------YVSS-EAY---AY
A0A2V7QN41      IVLRAGVSDLDLAAAKLDVLDTLPVRVLGAVLND----VRP------YGAY-RYY---TY
A0A2V7R603      IVLRAGVSDLDLAAAKLDVLDTLPVRVLGAVLND----VRP------YGAY-RYY---TY
A0A7Y5VC49      LVMRAGKTNRRTARNRLAQLRRLPIQFLGVVLNA----IQP------EGGF-APY---A-
A0A2V7LJS2      LVLRLGRTDRELAEAKIDLLRQSSTRVLGVVLND----VRE------GSEY-RAY---SY
A0A1Q7GLJ7      MVLRLGRTDRELAEAKLEILRRLPLRLLGAVLND----VRD------ESEY-RAY---AY
A0A2V7GRE3      MVLRLGRTDRVLAEAKLEILRRLPLRLLGAVLND----VRD------ESEY-RAY---AY
                ::                            ::*                           

A0A838NTH4      YGRGYAYGPSR-------------------------------------------------
A0A2D5ZJF2      YGRDRAEGRREGGRGSSGTEKGSSTG----------------------------------
A0A0S8H9P3      YYSRSSS-----------------------------------------------------
A0A1E4BBP7      YLEGYRALEGAEEGNAALLGSGSGGNGRG-------------------------------
A0A3M2G737      YSSYYGSDRDKKKQRSIKLKS---------------------------------------
A0A0H4TUX7      YSYRREPARRGLLTAGSPRAGGCSPFGRSSAIPSENQ-----------------------
A0A1G0LUG0      YASRE-----------APRRSRTSLFTR--------------------------------
A0A1Q7E3T7      YLEGYEATAEGVREHHTVLRSSG-------------------------------------
A0A1G0L906      YRKDPRTTRGLLSALREQIAHLF-------------------------------------
A0A1G0LCC0      YRKDPRTTRGLLSALREQIAHLF-------------------------------------
A0A2D5ZJE2      HYHYHEDADNKTNSRATSIWRAARGVAIVATFFAIAAAMWHQRRPTLAEADTVESRMVPN
A0A3M2G624      YDTKKPVKV---------------------------------------------------
A0A6M4IRY1      YYQDYAAQDEEPVARISDGSARSDKPLPAKIS----------------------------
A0A3D4VBZ5      YYQDYAAEDEQPERLSAGSGSSRPVALSGGVSDA--------------------------
C1A5W1          YYQDYAAEDEQPERLSAGSGSSRPVALSGGVSDA--------------------------
W0RI74          YDPDYVLPEETPALSAGGGGGTSVAVREG-------------------------------
A0A3M2BJA6      YYGDNGKKKK--------------------------------------------------
A0A7Y5QXY3      YYYAYQSNDGDRNGRAALTAGERVRKLIGLGHDDRV------------------------
A0A2V7PX99      DLADYAEPDPAVAATRRDGWRHILGGRSS-------------------------------
A0A2V7ERC7      YGDTRAKEHVGNLATPKGLLLNA-------------------------------------
A0A7V9QLH4      KAYGEQYAATSDSKRE--------------------------------------------
A0A7Y4RSP8      YSYGYAAEDEIEGQEEPKGLTQGAKA----------------------------------
A0A838W6Q3      GKAYYTEVGS--------------------------------------------------
A0A7V9U4Z2      YRYEYSSAES--------------------------------------------------
A0A5Q4D6Y4      YSYGYYGSTE--------------------------------------------------
A0A7Y3MUW4      YGVDSAAQESVKTATADQLRGALAKVRLR-------------------------------
A0A848XQ54      YGVDSAAQESVKTATADQLRGALAKVRLR-------------------------------
A0A7V9QB34      PRSG--------------------------------------------------------
A0A2V7JTZ5      YGADYSYKDEVLKEPIADIATPKGLLVRS-------------------------------
A0A3D4YTR6      YGADYEYKGDSSTEPIADLATPQGLVLRA-------------------------------
A0A7V8VRF0      YLSAYDAYHTQAPEPV--------------------------------------------
A0A2V7F1M1      YSYGYPTPSD--------------------------------------------------
A0A841GJ36      YNSGYGYTYGAYRRN---------------------------------------------
A0A838NJX4      YPYDYAAQE---------------------------------------------------
A0A2V7KXK7      SSAEYELVDDEGQTREALPSILGGRT----------------------------------
A0A651HKD3      YVPGYGVDEVEQLHLVAGATQARGAVGSGGR-----------------------------
A0A843T4K9      YLPGYEVEEEEFSSLETAALQGG-------------------------------------
A0A2V7QDU7      YLETE-------------------------------------------------------
A0A6J4M9S2      YGSEA-------------------------------------------------------
A0A2V7ITT6      YLSGYGTADEAEYAMGPPRVRGVL------------------------------------
A0A2V7NJW1      YLSGYGTADEAEYAMGPPRVRGVL------------------------------------
A0A7V4KNE3      YVYGYSLDEEEASPRRLRGASTGAS-----------------------------------
A0A7Y5PAU0      YVSGYGTEDLEPGKQVAQIS----------------------------------------
A0A7V9TKH4      YLYGYTTSEDDDLPRTSPQVGELTGRT---------------------------------
A0A2V7GFB5      YTPGYEATDE----------KPARLTPSVG------------------------------
A0A2V7RQ86      YTPGYEATDE----------KPARLTPSVG------------------------------
A0A2V7IWX2      YVPGYETKEE----ADLGPEKPVLGVPSV-------------------------------
A0A1Q7KE95      YLSGYATTNEREGYAVAGRQARGVL-----------------------------------
A0A1Q7T8X5      YLSGYATTNEREGYAVAGRQARGVL-----------------------------------
A0A2V7MS64      YLEGYEARDE--QPASRLMRAPE-------------------------------------
A0A2V7Q7N9      YLEGYEAKDEPAEAAGQVLQAPEQVLPAPE------------------------------
A0A2V7IRW6      YLEGYEVKEEP-EPAWQLVRAPE-------------------------------------
A0A1Q7DVU6      YLEGYEVKEEP-EPAWQLVRAPE-------------------------------------
A0A1Q7JSV2      YLEGYEVKEEP-EPAWQLVRAPE-------------------------------------
A0A2V7FK98      YLPGYEAMDE----NSGSPRVPV-------------------------------------
A0A2V7R3Z8      YLPGYEAMDE----NSGSPRVPV-------------------------------------
A0A2V7J3C0      YLSGYATVDEQEGYAIAGRKAHGVL-----------------------------------
A0A2V7KWV9      YMAGYGTTTEDGGTRIARRRLQGAL-----------------------------------
A0A1Q6ZHP2      YLPGYEAVDEEAERASGGKGQPFVI-----------------------------------
A0A1Q7R6Z6      YLPGYEAVDEEAERASGGKGQPFVI-----------------------------------
A0A2V7FYT7      YLPGYEAVDEEAERASGGKGQPFVI-----------------------------------
A0A2V7IGR0      YLPGYEAVDEEAQ------AQPLVT-----------------------------------
A0A2V7MR23      YLPGYEAVDEEAEQASGGKGQPFVI-----------------------------------
A0A2V7L1V3      YLPGYEAADE----NSGSRRVPV-------------------------------------
A0A1Q7E5D3      YLPGYEAVD-EGERNSGPKVRSLVI-----------------------------------
A0A2V7ISE2      YLPGYEAVDEEAERTSGGNKQPFVI-----------------------------------
A0A1Q7J2X5      YLPGYEAVDEEAERTSGGNKQPFVI-----------------------------------
A0A2V7NPD1      YLPGYEAVDEEAERTSGGNKQPFVI-----------------------------------
A0A2V7QPD8      YLPGYEAMDE----NSGTPRVPV-------------------------------------
A0A2V7Q8M6      YLPGYEAADE----NSGSR-----------------------------------------
A0A2V7QBC3      YLPGYEAADE----NSGSRRVPV-------------------------------------
A0A2V7LMU1      YLPGYEAMDE----ERGSGRVPV-------------------------------------
A0A2V7PBY9      YLPGYEAADE----EAGSRRVPV-------------------------------------
A0A2V7J4D7      YLEGYEVHDEPAAADVHVLRGPER------------------------------------
A0A2V7LN90      YLEGYEATDEPAGAEGEVLRGPE-------------------------------------
A0A2V7LFN9      YLEGYETQDEPDEARGQVLRAPEYP-----------------------------------
A0A2V7MEK4      YLEGYETQDEPDEARGQVLRAPEYP-----------------------------------
A0A2V7EU00      -LSGYAAEDEPTAPPQQWAVARRLPGASSPDA----------------------------
A0A1Q6WE01      -FAGYGTRDEGVA-----IATHRVRGVL--------------------------------
A0A2V7S9K3      -LSGYATADEGTA-----SAAHRLRGVL--------------------------------
A0A1Q7DXB9      YVPGYETKEEADLGPEKPVLGVPSV-----------------------------------
A0A1Q7JD32      YVPGYETKEEADLGPEKPVLGVPSV-----------------------------------
A0A2V7MVP8      YVPGYETKEEADLGPEKPVLGVPGD-----------------------------------
A0A2V7N0A9      SLAGYEMQEEDSGREAGPILLPDSP-----------------------------------
A0A1Q7DLS9      SLSGYDLHDEEEPPKR---ILRSVE-----------------------------------
A0A1Q7JK96      SLSGYDLHDEEEPPKR---ILRSVE-----------------------------------
A0A2V7KQV7      SLEGYSVREEDPDGRAGT-LLPRRS-----------------------------------
A0A1Q7JGF6      SLAGSEVQEEDPGGVTSEILLPDRS-----------------------------------
A0A2V7SG67      SLAGSEVQEEDPGGVTSEILLPDRS-----------------------------------
A0A1Q7GIK9      SLEGYEVRDEDPEGKAGKMLLPDPA-----------------------------------
A0A7W0YSQ1      YYYGQDGHRNGR----------------------GVLDRVRRLTGLGAAGRGRS------
A0A3M2BLV5      Y--GYHPREETGWQRLRSGLSRARFW----------------------------------
A0A2V7KS68      YLPGYEAVEERD-GARQTGPVVVTE-----------------------------------
A0A2V7N4L3      YLPGYEAVDESKHGRRTPAPTVV-------------------------------------
A0A1Q7AZK2      YLPGYEAVDEGD--RQASGARVV-------------------------------------
A0A1Q7TNP7      YLPGYEAVDEGD--RQASGARVV-------------------------------------
A0A1Q7KG39      YLPGYEAVDEGD--RQASGARVV-------------------------------------
A0A1Q7GX75      YLPGYEAVEESS--GQASAPRVV-------------------------------------
A0A1Q7LL80      YLPGYEAVEESS--GQASAPRVV-------------------------------------
A0A2V7PFU2      YLPGYEAVDEGA--GRTSGPRVV-------------------------------------
A0A2V7MFS9      YLPGYEAVDEGD-GRRTSGPQVV-------------------------------------
A0A2V7T933      YLPGYEAVDEGD--RQASGARVV-------------------------------------
A0A841GX23      YYEYRQNKDDDAAG----------------------------------------------
A0A7V9AJ94      YSGQSA------------------------------------------------------
A0A7Y3MYM3      YKDSRSNDEEDRFLLQSSHK----------------------------------------
A0A848XLS5      YKDSRSNDEEDRFLLQSSHK----------------------------------------
A0A7V9FIM2      YPYDYAAQEQ--------------------------------------------------
A0A7W0WMB8      YPYDYAAEEQ--------------------------------------------------
A0A2V7P8B1      YLDGYELGDEPLFEPLV-----------------------SRPRGTTPVAGR--------
A0A7C2QQS2      YYQYYGRH----------------------------------------------------
A0A2V7QN41      DAAAYAEANGAA---------------------------SQRRGGSAGVLWGQS------
A0A2V7R603      DAAAYAEGNGAI---------------------------GQRRPGSAGVLWGRS------
A0A7Y5VC49      YLPQYALYAPRPYADASPADVERRMDVSRDGVDGATDSPKGARSSRPPRPENHW------
A0A2V7LJS2      YMDGYEFTGEPLFQPLG----------------------DATKRGRPPVTARQ-------
A0A1Q7GLJ7      YMDGYALTNEPPFRPLG-----------------------G-KQGASSHAAG--------
A0A2V7GRE3      YMDGYALTNEPLFRPLA-----------------------GNKQGVGSRPAR--------
                                                                            

A0A838NTH4      ----------------
A0A2D5ZJF2      ----------------
A0A0S8H9P3      ----------------
A0A1E4BBP7      ----------------
A0A3M2G737      ----------------
A0A0H4TUX7      ----------------
A0A1G0LUG0      ----------------
A0A1Q7E3T7      ----------------
A0A1G0L906      ----------------
A0A1G0LCC0      ----------------
A0A2D5ZJE2      TEDGRIAGLEEGVVGR
A0A3M2G624      ----------------
A0A6M4IRY1      ----------------
A0A3D4VBZ5      ----------------
C1A5W1          ----------------
W0RI74          ----------------
A0A3M2BJA6      ----------------
A0A7Y5QXY3      ----------------
A0A2V7PX99      ----------------
A0A2V7ERC7      ----------------
A0A7V9QLH4      ----------------
A0A7Y4RSP8      ----------------
A0A838W6Q3      ----------------
A0A7V9U4Z2      ----------------
A0A5Q4D6Y4      ----------------
A0A7Y3MUW4      ----------------
A0A848XQ54      ----------------
A0A7V9QB34      ----------------
A0A2V7JTZ5      ----------------
A0A3D4YTR6      ----------------
A0A7V8VRF0      ----------------
A0A2V7F1M1      ----------------
A0A841GJ36      ----------------
A0A838NJX4      ----------------
A0A2V7KXK7      ----------------
A0A651HKD3      ----------------
A0A843T4K9      ----------------
A0A2V7QDU7      ----------------
A0A6J4M9S2      ----------------
A0A2V7ITT6      ----------------
A0A2V7NJW1      ----------------
A0A7V4KNE3      ----------------
A0A7Y5PAU0      ----------------
A0A7V9TKH4      ----------------
A0A2V7GFB5      ----------------
A0A2V7RQ86      ----------------
A0A2V7IWX2      ----------------
A0A1Q7KE95      ----------------
A0A1Q7T8X5      ----------------
A0A2V7MS64      ----------------
A0A2V7Q7N9      ----------------
A0A2V7IRW6      ----------------
A0A1Q7DVU6      ----------------
A0A1Q7JSV2      ----------------
A0A2V7FK98      ----------------
A0A2V7R3Z8      ----------------
A0A2V7J3C0      ----------------
A0A2V7KWV9      ----------------
A0A1Q6ZHP2      ----------------
A0A1Q7R6Z6      ----------------
A0A2V7FYT7      ----------------
A0A2V7IGR0      ----------------
A0A2V7MR23      ----------------
A0A2V7L1V3      ----------------
A0A1Q7E5D3      ----------------
A0A2V7ISE2      ----------------
A0A1Q7J2X5      ----------------
A0A2V7NPD1      ----------------
A0A2V7QPD8      ----------------
A0A2V7Q8M6      ----------------
A0A2V7QBC3      ----------------
A0A2V7LMU1      ----------------
A0A2V7PBY9      ----------------
A0A2V7J4D7      ----------------
A0A2V7LN90      ----------------
A0A2V7LFN9      ----------------
A0A2V7MEK4      ----------------
A0A2V7EU00      ----------------
A0A1Q6WE01      ----------------
A0A2V7S9K3      ----------------
A0A1Q7DXB9      ----------------
A0A1Q7JD32      ----------------
A0A2V7MVP8      ----------------
A0A2V7N0A9      ----------------
A0A1Q7DLS9      ----------------
A0A1Q7JK96      ----------------
A0A2V7KQV7      ----------------
A0A1Q7JGF6      ----------------
A0A2V7SG67      ----------------
A0A1Q7GIK9      ----------------
A0A7W0YSQ1      ----------------
A0A3M2BLV5      ----------------
A0A2V7KS68      ----------------
A0A2V7N4L3      ----------------
A0A1Q7AZK2      ----------------
A0A1Q7TNP7      ----------------
A0A1Q7KG39      ----------------
A0A1Q7GX75      ----------------
A0A1Q7LL80      ----------------
A0A2V7PFU2      ----------------
A0A2V7MFS9      ----------------
A0A2V7T933      ----------------
A0A841GX23      ----------------
A0A7V9AJ94      ----------------
A0A7Y3MYM3      ----------------
A0A848XLS5      ----------------
A0A7V9FIM2      ----------------
A0A7W0WMB8      ----------------
A0A2V7P8B1      ----------------
A0A7C2QQS2      ----------------
A0A2V7QN41      ----------------
A0A2V7R603      ----------------
A0A7Y5VC49      ----------------
A0A2V7LJS2      ----------------
A0A1Q7GLJ7      ----------------
A0A2V7GRE3      ----------------
                                

© 1998-2022Legal notice