BYKdb

Dataset for cluster tadcd of phylum gemmatimonadetes

[Download (right click)] [Edit] [Sequences] [Repertoires]

93 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2D5ZJF2      ------------------------------------------------------------
A0A0S8H9P3      ------------------------------------------------------------
A0A1E4BBP7      ------------------------------------------------------------
A0A3M2G737      ------------------------------------------------------------
A0A0H4TUX7      ------------------------------------------------------------
A0A1G0LUG0      ------------------------------------------------------------
A0A1Q7E3T7      ------------------------------------------------------------
A0A1G0L906      ------------------------------------------------------------
A0A1G0LCC0      ------------------------------------------------------------
A0A2D5ZJE2      ------------------------------------------------------------
A0A3M2G624      ------------------------------------------------------------
W0RI74          ------------------------------------------------------------
A0A3M2BJA6      ------------------------------------------------------------
A0A6M4IRY1      ------------------------------------------------------------
A0A3D4VBZ5      ------------------------------------------------------------
C1A5W1          ------------------------------------------------------------
A0A2V7PX99      ------------------------------------------------------------
A0A2V7ERC7      ------------------------------------------------------------
A0A5Q4D6Y4      ------------------------------------------------------------
A0A2V7JTZ5      ------------------------------------------------------------
A0A3D4YTR6      ------------------------------------------------------------
A0A5Q4DA46      ------------------------------------------------------------
A0A2V7F1M1      ------------------------------------------------------------
A0A2V7KXK7      ------------------------------------------------------------
A0A651HKD3      ------------------------------------------------------------
A0A2V7QDU7      ------------------------------------------------------------
A0A6J4M9S2      ------------------------------------------------------------
A0A2V7ITT6      ------------------------------------------------------------
A0A2V7NJW1      -----------------------------------------------------MLVVHDE
A0A2V7GFB5      ------------------------------------------------------------
A0A2V7RQ86      ------------------------------------------------------------
A0A2V7IWX2      ------------------------------------------------------------
A0A1Q7KE95      ------------------------------------------------------------
A0A1Q7T8X5      ------------------------------------------------------------
A0A2V7MS64      ------------------------------------------------------------
A0A2V7Q7N9      ------------------------------------------------------------
A0A2V7IRW6      ------------------------------------------------------------
A0A1Q7DVU6      ------------------------------------------------------------
A0A1Q7JSV2      ------------------------------------------------------------
A0A2V7FK98      ------------------------------------------------------------
A0A2V7R3Z8      MIGPQSGAQQGEAIDLRHVQVHEHEVECAALQQVEGFLPPAADGYVVAFVAQNRRAALAQ
A0A2V7J3C0      ------------------------------------------------------------
A0A2V7KWV9      ------------------------------------------------------------
A0A1Q6ZHP2      ------------------------------------------------------------
A0A1Q7R6Z6      ------------------------------------------------------------
A0A2V7FYT7      ------------------------------------------------------------
A0A2V7IGR0      ------------------------------------------------------------
A0A2V7MR23      ------------------------------------------------------------
A0A2V7L1V3      ------------------------------------------------------------
A0A1Q7E5D3      ------------------------------------------------------------
A0A2V7ISE2      ------------------------------------------------------------
A0A1Q7J2X5      ------------------------------------------------------------
A0A2V7NPD1      ------------------------------------------------------------
A0A2V7QPD8      ------------------------------------------------------------
A0A2V7Q8M6      ------------------------------------------------------------
A0A2V7QBC3      ------------------------------------------------------------
A0A2V7LMU1      ------------------------------------------------------------
A0A2V7PBY9      ------------------------------------------------------------
A0A3M2BLV5      ------------------------------------------------------------
A0A2V7KS68      ------------------------------------------------------------
A0A2V7N4L3      ------------------------------------------------------------
A0A1Q7AZK2      ------------------------------------------------------------
A0A1Q7TNP7      ------------------------------------------------------------
A0A1Q7KG39      ------------------------------------------------------------
A0A1Q7GX75      ------------------------------------------------------------
A0A1Q7LL80      ------------------------------------------------------------
A0A2V7PFU2      ------------------------------------------------------------
A0A2V7MFS9      ------------------------------------------------------------
A0A2V7T933      ------------------------------------------------------------
A0A2V7J4D7      ------------------------------------------------------------
A0A2V7LN90      ------------------------------------------------------------
A0A2V7LFN9      ------------------------------------------------------------
A0A2V7MEK4      ------------------------------------------------------------
A0A2V7P8B1      ------------------------------------------------------------
A0A7C2QQS2      ------------------------------------------------------------
A0A2V7QN41      ------------------------------------------------------------
A0A2V7R603      ------------------------------------------------------------
A0A2V7LJS2      ------------------------------------------------------------
A0A1Q7GLJ7      ------------------------------------------------------------
A0A2V7GRE3      ------------------------------------------------------------
A0A2V7EU00      ------------------------------------------------------------
A0A1Q6WE01      ------------------------------------------------------------
A0A2V7S9K3      ------------------------------------------------------------
A0A1Q7DXB9      ------------------------------------------------------------
A0A1Q7JD32      ------------------------------------------------------------
A0A2V7MVP8      ------------------------------------------------------------
A0A2V7N0A9      ------------------------------------------------------------
A0A1Q7DLS9      ------------------------------------------------------------
A0A1Q7JK96      ------------------------------------------------------------
A0A2V7KQV7      ------------------------------------------------------------
A0A1Q7JGF6      ------------------------------------------------------------
A0A2V7SG67      ------------------------------------------------------------
A0A1Q7GIK9      ------------------------------------------------------------
                                                                            

A0A2D5ZJF2      ------------------------------------------------------------
A0A0S8H9P3      ------------------------------------------------------------
A0A1E4BBP7      ------------------------------------------------------------
A0A3M2G737      ------------------------------------------------------------
A0A0H4TUX7      ------------------------------------------------------------
A0A1G0LUG0      ------------------------------------------------------------
A0A1Q7E3T7      ------------------------------------------------------------
A0A1G0L906      ------------------------------------------------------------
A0A1G0LCC0      ------------------------------------------------------------
A0A2D5ZJE2      ------------------------------------------------------------
A0A3M2G624      ------------------------------------------------------------
W0RI74          ------------------------------------------------------------
A0A3M2BJA6      ------------------------------------------------------------
A0A6M4IRY1      ------------------------------------------------------------
A0A3D4VBZ5      ------------------------------------------------------------
C1A5W1          ------------------------------------------------------------
A0A2V7PX99      ------------------------------------------------------------
A0A2V7ERC7      ------------------------------------------------------------
A0A5Q4D6Y4      ------------------------------------------------------------
A0A2V7JTZ5      ------------------------------------------------------------
A0A3D4YTR6      ------------------------------------------------------------
A0A5Q4DA46      ------------------------------------------------------------
A0A2V7F1M1      ------------------------------------------------------------
A0A2V7KXK7      ------------------------------------------------------------
A0A651HKD3      ------------------------------------------------------------
A0A2V7QDU7      ------------------------------------------------------------
A0A6J4M9S2      ------------------------------------------------------------
A0A2V7ITT6      ------------------------------------------------------------
A0A2V7NJW1      HPDVGPRPGLDCEQVRHLLREIRRDARGRLARLRFRPGWRHADDSPGGAGGRAVCDLPHA
A0A2V7GFB5      ------------------------------------------------------------
A0A2V7RQ86      ------------------------------------------------------------
A0A2V7IWX2      ------------------MFNGVPFLCKRTNRGRALRGAIPLAPMHMTCAPPRPAGRLPE
A0A1Q7KE95      ------------------------------------------------------------
A0A1Q7T8X5      ------------------------------------------------------------
A0A2V7MS64      ------------------------------------------------------------
A0A2V7Q7N9      ------------------------------------------------------------
A0A2V7IRW6      ------------------------------------------------------------
A0A1Q7DVU6      ------------------------------------------------------------
A0A1Q7JSV2      ------------------------------------------------------------
A0A2V7FK98      --------------------------------------MRC-------------------
A0A2V7R3Z8      RVFVIDHQNPHPGLGFRPDGEHGRRLASLDGGGHAVMSKRCRHRGRPRFPVDPPLRRVRA
A0A2V7J3C0      ------------------------------------------------------------
A0A2V7KWV9      ------------------------------------------------------------
A0A1Q6ZHP2      ------------------------------------------------------------
A0A1Q7R6Z6      ------------------------------------------------------------
A0A2V7FYT7      ------------------------------------------------------------
A0A2V7IGR0      ------------------------------------------------------------
A0A2V7MR23      ------------------------------------------------------------
A0A2V7L1V3      ------------------------------------------------------------
A0A1Q7E5D3      ------------------------------------------------------------
A0A2V7ISE2      ------------------------------MDIGFVPARVWPPLTQGSGQSVATSQRPDS
A0A1Q7J2X5      ------------------------------------------------------------
A0A2V7NPD1      ------------------------------------------------------------
A0A2V7QPD8      -MASMADGSRPSTEGLTPSWASGMDIAVVLDFRLTPPYAGFGPTCREVAAARILRITTAK
A0A2V7Q8M6      -----------------------MDIALVLDNGRPHSYAQFGPHCRDPAAWPGLPHGFSN
A0A2V7QBC3      -----------------------------------------------------MPQRRRF
A0A2V7LMU1      -----------------------------------------------------MNSATTD
A0A2V7PBY9      -----------------------------------------------------MKWATNG
A0A3M2BLV5      ------------------------------------------------------------
A0A2V7KS68      ------------------------------------------------------------
A0A2V7N4L3      ------------------------------------------------------------
A0A1Q7AZK2      ------------------------------------------------------------
A0A1Q7TNP7      ------------------------------------------------------------
A0A1Q7KG39      ------------------------------------------------------------
A0A1Q7GX75      ------------------------------------------------------------
A0A1Q7LL80      ------------------------------------------------------------
A0A2V7PFU2      ------------------------------------------------------------
A0A2V7MFS9      ------------------------------------------------------------
A0A2V7T933      ------------------------------------------------------------
A0A2V7J4D7      ------------------------------------------------------------
A0A2V7LN90      ------------------------------------------------------------
A0A2V7LFN9      ------------------------------------------------------------
A0A2V7MEK4      ------------------------------------------------------------
A0A2V7P8B1      ------------------------------------------------------------
A0A7C2QQS2      ------------------------------------------------------------
A0A2V7QN41      ------------------------------------------------------------
A0A2V7R603      ------------------------------------------------------------
A0A2V7LJS2      ------------------------------------------------------------
A0A1Q7GLJ7      ------------------------------------------------------------
A0A2V7GRE3      ------------------------------------------------------------
A0A2V7EU00      ------------------------------------------------------------
A0A1Q6WE01      ------------------------------------------------------------
A0A2V7S9K3      ------------------------------------------------------------
A0A1Q7DXB9      ------------------------------------------------------------
A0A1Q7JD32      ------------------------------------------------------------
A0A2V7MVP8      ------------------------------------------------------------
A0A2V7N0A9      ------------------------------------------------------------
A0A1Q7DLS9      ------------------------------------------------------------
A0A1Q7JK96      ------------------------------------------------------------
A0A2V7KQV7      ------------------------------------------------------------
A0A1Q7JGF6      ------------------------------------------------------------
A0A2V7SG67      ------------------------------------------------------------
A0A1Q7GIK9      ------------------------------------------------------------
                                                                            

A0A2D5ZJF2      ------------------------------------------------------------
A0A0S8H9P3      ------------------------------------------------------------
A0A1E4BBP7      ------------------------------------------------------------
A0A3M2G737      ------------------------------------------------------------
A0A0H4TUX7      ------------------------------------------------------------
A0A1G0LUG0      ------------------------------------------------------------
A0A1Q7E3T7      ------------------------------------------------------------
A0A1G0L906      ------------------------------------------------------------
A0A1G0LCC0      ------------------------------------------------------------
A0A2D5ZJE2      ------------------------------------------------------------
A0A3M2G624      ------------------------------------------------------------
W0RI74          ------------------------------------------------------------
A0A3M2BJA6      ------------------------------------------------------------
A0A6M4IRY1      ------------------------------------------------------------
A0A3D4VBZ5      ------------------------------------------------------------
C1A5W1          ------------------------------------------------------------
A0A2V7PX99      ------------------------------------------------------------
A0A2V7ERC7      ------------------------------------------------------------
A0A5Q4D6Y4      ------------------------------------------------------------
A0A2V7JTZ5      ------------------------------------------------------------
A0A3D4YTR6      ------------------------------------------------------------
A0A5Q4DA46      ------------------------------------------------------------
A0A2V7F1M1      ------------------------------------------------------------
A0A2V7KXK7      ------------------------------------------------------------
A0A651HKD3      ------------------------------------------------------------
A0A2V7QDU7      ------------------------------------------------------------
A0A6J4M9S2      ------------------------------------------------------------
A0A2V7ITT6      ------------------------------------------------------------
A0A2V7NJW1      DAESGPVRPLQLHLSGEAVKGDCCANDTGFPCVPLAQQPLQRARQVTAACVGSRADCITS
A0A2V7GFB5      ------------------------------------------------------------
A0A2V7RQ86      ------------------------------------------------------------
A0A2V7IWX2      PIALQRVAPASRREHAPARAAHVLRICGATCCAYATRRHRHAPRRRCGREAGVRSQRYRP
A0A1Q7KE95      ------------------------------------------------------------
A0A1Q7T8X5      ------------------------------------------------------------
A0A2V7MS64      ------------------------------------------------------------
A0A2V7Q7N9      ---------------------------------------------------------MQA
A0A2V7IRW6      ------------------------------------------------------------
A0A1Q7DVU6      ------------------------------------------------------------
A0A1Q7JSV2      ------------------------------------------------------------
A0A2V7FK98      --------TDLRHGDG--------------------------------VGGVPRGIG-LA
A0A2V7R3Z8      NLSRGRSGTDSPHNDGKILSSARRGGVVARTKVHPAPGCGAPICGMWTVGAPHRAVSDLP
A0A2V7J3C0      ------------------------------------------------------------
A0A2V7KWV9      ------------------------------------------------------------
A0A1Q6ZHP2      ------------------------------------------------------------
A0A1Q7R6Z6      ------------------------------------------------------------
A0A2V7FYT7      ------------------------------------------------------------
A0A2V7IGR0      ------------------------------------------------------------
A0A2V7MR23      ------------------------------------------------------------
A0A2V7L1V3      ------------------------------------------------------------
A0A1Q7E5D3      ------------------------------------------------------------
A0A2V7ISE2      QAIAAPAARRTRAPGWTVAPTCIHRLPHAAPICGMTSPAGGEGVGPCAVSDLLSSRRDAG
A0A1Q7J2X5      ------------------------------------------------------------
A0A2V7NPD1      ------------------------------------------------------------
A0A2V7QPD8      SASLAVAAGTRPAPRCIRLRE---------AVHRFAACGRCGLRAARYRTCH--------
A0A2V7Q8M6      NRS--CGAGRPRSER-TKLHPFFGC-----DCTELRHQLNRSAGRARYRTCHTLSRDETQ
A0A2V7QBC3      AAR--IGQQRPRASRATPFRPHQGASVPPGDCTELRHQSHRSAGSARYRTCHTSSANEPQ
A0A2V7LMU1      RAY--SRRHRPNAPRCIRYGAL--------IALNCGISADG-LRRRTGIGLATCSAHDTT
A0A2V7PBY9      AQE--GQRRYPSRTKVHRRDVH--------PCTQLRHGGGR-LGVARGIGLAVRRWDDTH
A0A3M2BLV5      ------------------------------------------------------------
A0A2V7KS68      ------------------------------------------------------------
A0A2V7N4L3      ------------------------------------------------------------
A0A1Q7AZK2      ------------------------------------------------------------
A0A1Q7TNP7      ------------------------------------------------------------
A0A1Q7KG39      ------------------------------------------------------------
A0A1Q7GX75      ------------------------------------------------------------
A0A1Q7LL80      ------------------------------------------------------------
A0A2V7PFU2      ------------------------------------------------------------
A0A2V7MFS9      ------------------------------------------------------------
A0A2V7T933      ------------------------------------------------------------
A0A2V7J4D7      ------------------------------------------------------------
A0A2V7LN90      ------------------------------------------------------------
A0A2V7LFN9      ------------------------------------------------------------
A0A2V7MEK4      ------------------------------------------------------------
A0A2V7P8B1      ------------------------------------------------------------
A0A7C2QQS2      ------------------------------------------------------------
A0A2V7QN41      ------------------------------------------------------------
A0A2V7R603      --------------------------------------------------------MRRS
A0A2V7LJS2      ------------------------------------------------------------
A0A1Q7GLJ7      ------------------------------------------------------------
A0A2V7GRE3      ------------------------------------------------------------
A0A2V7EU00      ------------------------------------------------------------
A0A1Q6WE01      ------------------------------------------------------------
A0A2V7S9K3      ------------------------------------MSLAGTSTCCRRTTAYASSPRRAV
A0A1Q7DXB9      ------------------------------------------------------------
A0A1Q7JD32      ------------------------------------------------------------
A0A2V7MVP8      ------------------------------------------------------------
A0A2V7N0A9      ------------------------------------MQMRPTAFRGRRRRPRWYRACSAA
A0A1Q7DLS9      ------------------------------------------------------------
A0A1Q7JK96      ------------------------------------------------------------
A0A2V7KQV7      ------------------------------------------------------------
A0A1Q7JGF6      ------------------------------------------------------------
A0A2V7SG67      ------------------------------------------------------------
A0A1Q7GIK9      ------------------------------------------------------------
                                                                            

A0A2D5ZJF2      ------MITTRDRATTRGTPCRTPRTIWCGPSWHPSIRHPRKVIMSRMGSQATGEGNGSQ
A0A0S8H9P3      ------------------------------------------------------------
A0A1E4BBP7      ---------------------------MSANLVPSAANAAAVPRQDGFAPMPQWGGAPSA
A0A3M2G737      ----------------------------------------MYFGRMVPSDSAPKLQAPIS
A0A0H4TUX7      ------------------------MNLRSGTWSHSLSFLSSATTWENRLDAVRRPEGTEA
A0A1G0LUG0      ------------------------------------------------------------
A0A1Q7E3T7      ------------------------------------------------------------
A0A1G0L906      ------------------------------------------------------------
A0A1G0LCC0      ------------------------------------------------------------
A0A2D5ZJE2      ------------------------------------------------------------
A0A3M2G624      -----------------------------------------------MYFGNGKNYPVEV
W0RI74          -----------------------MSANLPPLPAGSDAPLPVPAAEHALQPYDPAAYAPPA
A0A3M2BJA6      -------------------------------------------------------MEKPT
A0A6M4IRY1      ----------------------------MSGQQIQPVTTRENALDNFQDGAPPADWGGGQ
A0A3D4VBZ5      ----------------------------MSGQQIQSVTPQAVALEPYQEGTPPGDWGGGT
C1A5W1          ----------------------------MSGQQIQSVTPQAVALEPYQEGTPPGDWGGGT
A0A2V7PX99      ------------------------MSNSPSWPVERAGPEVALQPVPDRGTAAAHGRA---
A0A2V7ERC7      ---------------MPPLILPPRKSLMSVRLTPSPETPPPFTGAPYGAFPGNTGPSTGP
A0A5Q4D6Y4      ---------------------MSNLVPRDPIPGHPQGLIGGAAPHGYADQGGARGGSWPN
A0A2V7JTZ5      -----------------------------MSVRSLQPDYPLAPHHPGSIPTAEWTPARPR
A0A3D4YTR6      -------------------------MLLRTRVYPSPSDFAIAPSNAGSPSPAPYKGGPQR
A0A5Q4DA46      --------------------MSDRSLPSGDPNGSQRDLPAEYYPAPAPAPAPAGW-----
A0A2V7F1M1      -----------------------MSSQRGAQLMSELLPEPTPLRLTGPPGSLRPSRDGGG
A0A2V7KXK7      -----MRDGERHRACVAHPCMEPKEPHEMSGSNGEGTRIPVLRSESSLDTIRMKSLTTPS
A0A651HKD3      -------------------------MSDRERFDLTPHGGTGVPSEHARQSTPGVHAGDAG
A0A2V7QDU7      -------------------------------------------MSHDVTHSQGLRSPSLD
A0A6J4M9S2      ---------------------------------MPNLVKAEARGYPAPPVLYSESRPGPG
A0A2V7ITT6      -------------MACRPPPRPSPRSKDPVPSIEPPQPPPDGFPEVWSGSPFRGAQPVPS
A0A2V7NJW1      RSRRGAGRYQDCGIACRPPPRPSPRSKDPVSSIEPPQPPPDGFPEVWSGSPFRGAQPVPS
A0A2V7GFB5      ------------------MERQLPERVDPAVLG--APRPWAAEEV---------------
A0A2V7RQ86      ------------------MERQLPERVDPAVLG--APRPWVAEEV---------------
A0A2V7IWX2      CSGDPWSRDVESRAIRFALDMAHEGPSLPEPARLDAIAATPRSRAPTRYEQLPRL-----
A0A1Q7KE95      --------------------MRIAVSAYPPSNG--TPVPADQLAAPFGAGRGGRLEE---
A0A1Q7T8X5      --------------------MRIAVSAYPPSNG--TPVPADQLSAPFGAGRGGRLEE---
A0A2V7MS64      -----------------------MIGELPSP------RPENDPRTTTTVIQPHGTRPVSI
A0A2V7Q7N9      RGPPLVPTLRCWEPVNQETLRGMTTGDLPVPFE--PTRAE----------FVARNRPPP-
A0A2V7IRW6      --------------MKKSPETDMDTGDLPARLD--PVQPERLPSPAGSFDAIARYAPPAA
A0A1Q7DVU6      --------------MKESPETDMETGDLPAALD--PERPERLPSTAAPFDTIARYAPPAA
A0A1Q7JSV2      ----------------------METGDLPAALD--PERPERLPSTAAPFDTIARYAPPAA
A0A2V7FK98      TGRRDAAPTGRSPANTVEVRVPMSTSPLPFHSG--STVPAVAPAAPPPMGADMGFGQ---
A0A2V7R3Z8      QGRGDAAPPGAAPPTHVEVRFPMSTSPLPLHAG--ATVPAVAPSAAPPMAADLGFSQ---
A0A2V7J3C0      ------------------------------------------------------------
A0A2V7KWV9      ------------------------MTDLPSAPRSQLPARPALSSIDLAA-----------
A0A1Q6ZHP2      ----------------------MTISNLPAPLG---PAPMAAPGMPQRG--ISVFD----
A0A1Q7R6Z6      ----------------------MTISNLPAPLG---PAPMAAPGMPQRG--ISVFD----
A0A2V7FYT7      ----------------------MTISNLPAPLG---PAPMAAPGMPQRG--ISVFD----
A0A2V7IGR0      ----------------------MTNSDNHAALARLPPSSDAGAALQPAA--LSLVEP---
A0A2V7MR23      ----------------------MTISNLPAA-L--VPPAATPPALPQRG--VSPF-----
A0A2V7L1V3      ----------------------MTMSHLPLPPG--STPPVMVPPSAPPA--TTGW-----
A0A1Q7E5D3      ----------------------MTTSNL-LAPL--APPPAVAPVAPSCA--VAES-----
A0A2V7ISE2      ARHDAARPARRNRPYRSIGNGSMAFSNLPAAPL--VPPPVVAPGTPHRG--MTEF-----
A0A1Q7J2X5      ----------------------MTLSNLPAAPL--VSPPVVAPGTSHRG--VTEF-----
A0A2V7NPD1      ----------------------MAFSNLPAAPL--VPPPVVAPGTPHRG--MTEF-----
A0A2V7QPD8      -GKTRRRATRRGPANTVEVRFPMSTSPLPLHAG--STVPAVAPAAPLPTGADMGFGQ---
A0A2V7Q8M6      FSEASPRATPRGTRS-------MSMSHLPLPPG--STAPVMVPPSPPPP--TAGW-----
A0A2V7QBC3      FSEATPSATWRGTRS-------MTMSHLPLPPG--STSPVMVPPSPPPP--TTEW-----
A0A2V7LMU1      LCGATPRATRRGTPS-------MTLSHLPLPPS--SPPPVIVPPSSKSL--STEW-----
A0A2V7PBY9      RAPLRRALPTRGLPS-------MSISRLPIPHG--APPPAAAPPPAPPAVPGTYA-----
A0A3M2BLV5      --------------------------------------------------MDRQPDLRPP
A0A2V7KS68      -------------------MLIRHMMTSRHLPALRSDTASPARAERASVSTRALRPE--A
A0A2V7N4L3      -------------------------MTPSPFPLIRNQPTGSVASAAPPPSSAGLRRGSPE
A0A1Q7AZK2      ------------------------------------------------------------
A0A1Q7TNP7      ------------------------------------------------------------
A0A1Q7KG39      ------------------------------------------------------------
A0A1Q7GX75      -----------------------------------------------------------M
A0A1Q7LL80      -----------------------------------------------------------M
A0A2V7PFU2      -------------------------MNPRPLPAIRSQSA-PVLRRANASAA--------P
A0A2V7MFS9      -------------------------MNPLPLPAVRGQTAAPALRRASPPHT--------P
A0A2V7T933      -------------------------MTPRPLPAIRGQSAPAVLRRGGTSDR--------T
A0A2V7J4D7      --------------------------------MMPGESIARFRSTA----------PTVA
A0A2V7LN90      --------------------------------MTTGDLPVPFEPVRTE---VVARYPPPP
A0A2V7LFN9      --------------------------------MTTGSLPARLDTPKAEDRNAVAR-PAPA
A0A2V7MEK4      --------------------------------MTTGSLPARLDTPKAADRNAVAR-PAPA
A0A2V7P8B1      ------------------------MTRVTEPLPSDSRAASGPFAEREEVEASA-------
A0A7C2QQS2      ---------------------------MTDLVPSRGSGGSLPQGVDSDGRGASTVPAYVD
A0A2V7QN41      -----------------MSRERSRLPEVASVDGTWLRAPAPSTADVASRTGPP-------
A0A2V7R603      VASPAAPRYPPCSADLAMSRERSRLPEVASVEGAWMRAPALPAGDVVSRAGAP-------
A0A2V7LJS2      ---------------------------MSQPHPNDARAASDSVADRGELDAPV-------
A0A1Q7GLJ7      ---------------------------MSEQLRSEPPAPSRRLADRADPEAFV-------
A0A2V7GRE3      ---------------------------MVEP--SNRPAASSFHGDR-EPEVSV-------
A0A2V7EU00      ---------------------------------------------MQPYGAP--------
A0A1Q6WE01      --------------------------MTEYLPGVA----ASPLVREAPLPVPARVTTAPD
A0A2V7S9K3      RQRPAVGRGSPRPGAAGGIGLAVGNRVPELLPSGA----APQLTHAVPLVAPAGNGLRLD
A0A1Q7DXB9      ----------------------MAHEGPSLPESAR----LEAIAATPRPRAPTRYDQPP-
A0A1Q7JD32      ----------------------MAHEGPSLPESAR----LEAIAATPRPRAPTRYDQPP-
A0A2V7MVP8      ----------------------MAQDPLLIPESAR----VDEVAPLLERRPARPYAEPP-
A0A2V7N0A9      LVPNAGPEPAPRPSPGKFETHTMPSQLTVPPQEGTPDRRL---GAAAAAAGPVRRSEAA-
A0A1Q7DLS9      ------------------MFNDLPELPPSSPETPG----------RATVPAPARRRSPP-
A0A1Q7JK96      ------------------MFNDLPELPPSSPETPG----------RATVPAPARRRSPP-
A0A2V7KQV7      ----------------------MASDATLPPNQPA--------------LVPFQTGFQA-
A0A1Q7JGF6      ----------------------MPSDPTADPEQSAPDRRLVLAAATAARLAPRRDEAPP-
A0A2V7SG67      ----------------------MPSDPTADPEQSAPDRRLVLAAATAARLAPRRDEAPP-
A0A1Q7GIK9      -------------------------------------------MVTSTLVVPARPKGPSV
                                                                            

A0A2D5ZJF2      AAPAGLSPEITPPGLLEILWRRRWIVTLVTLASIVGAFI--YLMKATPIYTSTSRIYVEQ
A0A0S8H9P3      ---MGRYERTHLEDYWRVVRRRAWLILLTALVALLAATW--AASRRPRLYRATLTLQVGD
A0A1E4BBP7      PPPSQGGVGDQLARTLAAIKRYKWLVLAVIAVGSTAGV--TLTRFVKPKYDVSASIWIAA
A0A3M2G737      TSNGAYHSENPIHEYFQIIVRGRWIILVVFTLVMAATMIYVLRNKPRLVYSTTATIALKN
A0A0H4TUX7      LRRIVHQREVHLRDLVGVVSRH-WRLVALLTVLVAGGAW-YSARRQVPRYQSRLTVQVSS
A0A1G0LUG0      ----MHQREVHLRDLVAVVTRH-WRLVAAVTAVLVGFSW-YNGRNQVARYQSQLTVQISS
A0A1Q7E3T7      -------MRVNLRDPLAVVRRHLWLVLGMTAV--VGGIVGYRAYAAVPSYRAIAVIRLSD
A0A1G0L906      ----------MHLRDLAQVLFSHWKVVVFLTVLVVFSTS-YASRKAVPRYQSSATVQVSS
A0A1G0LCC0      ----------MHLRDLAQVLFSHWKVVVFLTALVVFSTS-YASRKAVPRYQSSATVQVSS
A0A2D5ZJE2      -MDEHQAHGVTLADYVRIIWSRKWMVGLVATAVLAFTIF--FTLRMQPVYESQTTLLIEP
A0A3M2G624      TTSSYLEADFDVRKYVRMLWRRRYIVLLLFVLIFGFSTYRALTQKVTPVYRSTVYLEVDE
W0RI74          APADEAGGALSVGRFMAAMSRYKWLVAALVVLGLGGGFV-AT-RFIDPEYEVNATIFSSG
A0A3M2BJA6      FEGGYVDDEISLRDIWNLLRRNQWLIFLCVLLVTGGA-A-AYSYFAVPVYESATTIRIEE
A0A6M4IRY1      -DATPEPKGPSLARYVGAVNRFKWLILLFGVLGGAGG-Y-AATKFIEPEYEVKATILLEQ
A0A3D4VBZ5      AEGAPEPKGPSLRRYLAAVNRFKWLVLVFAILGGAGG-Y-AATRFIEPEYEVQATILLEQ
C1A5W1          AEGAPEPKGPSLRRYLAAVNRFKWLVLVFAILGGAGG-Y-AATRFIEPEYEVQATILLEQ
A0A2V7PX99      -YEPPTPEPSDWQRMLAAAMRRRWLVILVTLAGTAAGVI-GS-RFLDPRFAARAVLWIEA
A0A2V7ERC7      AVVLQESEGVQWGRYFDVLKRHALLIVLLVAVGTVWGLN-AA-RQVRPDYETQATIWING
A0A5Q4D6Y4      GQPPPPNDSIELSELLQILRRRIWLILACVLVGGALA-W-GVHEIREPRYRATAVIQIED
A0A2V7JTZ5      SEDFEDAEGIPWSRYVDAIRRHVLLIVGLAAVGSVLGVV-AA-RRVRPIYEAQATVWIST
A0A3D4YTR6      MDGPSDSEGIPWSRYIDAISRHSLLILAIALLGSLVGLY-AA-RQVRLSYDADATIWINT
A0A5Q4DA46      -GGDEEEQGLDWRRYVAAIVRNKWLVLAGLVVGLGAGFL-VR-QVTSPVYSVSSTVLLES
A0A2V7F1M1      RSADSAEIRTDFKQLLMLLRRRIGLVAGIAALIVFVVAL-FV-VLERPVYRSTATVRLAY
A0A2V7KXK7      APPPPPAEHSDWQRYFNSVMRHKWFVIVVTLVGTALGIV-AT-RFLDPRYTAKAILWVDV
A0A651HKD3      HGEGEEPGGLDFRKLPSTLLRYKWLVLASVVLGALAA-S-ASMALTPPRYTVSALIHTPN
A0A2V7QDU7      GAPAGFLPGAGAAELVDILRRRLWSILGCTVLCVGAAVL-YV-VLARPSYRAEAAIRMDD
A0A6J4M9S2      RGESDAEESVSLRDILAILRRHVALIAAIAAVVLALTAW-LVLR-QPPVYQATAQIRLAD
A0A2V7ITT6      AFRPEHDGVHDWQQYRGAVARYKWVVVLVSTVGTLIG-V-AATRFLRPEYEVQATIWIES
A0A2V7NJW1      AFRPENDGVHDWQQYRGAVARYKWVVVLVSTVGTLIG-V-AATRFLRPEYEVQATIWIES
A0A2V7GFB5      -ATTSPEGALDWRRIAQVVTRFKWLVFGITVAGGAAG-F-AATKVVRPQYLTQVTVFIDQ
A0A2V7RQ86      -ATTSPEGALDWRRIAQVVTRFKWLVFGITVAGGAAG-F-AATKVVRPQYLTQVTVFIDQ
A0A2V7IWX2      ----LPAAEPDWRRILGAIGRRRWVVLAVTLLGTAAGVV-AAAKFVGPRYLARARLWVGA
A0A1Q7KE95      -SGAGLVQPTDWRRHGATALRYRWWILGLAALGTLGG-T-AAGRLLPPRYQVQATIWIQS
A0A1Q7T8X5      -SGAGLVQPTDWRRHGATALRYRWWILGLAALGTLGG-T-AAGRLLPPRYQVQATIWIQS
A0A2V7MS64      ASAQEPPPLAQWPRYVSAALRYKWLVVGATLVATAAG-V-GASFLLAPEYVARATVWISI
A0A2V7Q7N9      -PPPDPEPLAEWQRYLLAARRYRWLVFGVTLLGTAAG-I-GLSLLLPPTYLARATVWVQV
A0A2V7IRW6      GAPQDGDVLADLRRYLSAVWRYKWAVTGITVLGTAAG-V-AGKMLLPPNYVARATVWIQV
A0A1Q7DVU6      GAPRDADALAELRRYLSAVWRYKWAVAGVTVLGTAAG-V-AGKMLLAPSYVARATVWIQV
A0A1Q7JSV2      GAPRDADALAELRRYLSAVWRYKWAVAGVTVLGTAAG-V-AGKMLLAPSYVARATVWIQV
A0A2V7FK98      -GFAQPETGVDWRRVLSAVARFKWLIAVVTIVGTVGG-L-AATRFIKPQYMVQATLWIDQ
A0A2V7R3Z8      -GFAQPETGVDWRRVLSAVARFKWLIAVVTIVGTVGG-L-AATRFIKPQYMVQATLWIDQ
A0A2V7J3C0      ------------------TRRYRWWVLALTGVGILGG-I-LAGRLLPPRYQVQATIWIQS
A0A2V7KWV9      ----DSGGAPDWRRHGTAVWRHRWWILGLTVLGTIGG-V-GASRVLPPRYLVQATIWIQS
A0A1Q6ZHP2      --LDGRESGVDWRRILSALLRFKWLIATTTLVGTIAG-V-GATRFLKPQYSAQAKIWIDV
A0A1Q7R6Z6      --LDGRESGVDWRRILSALLRFKWLIATTTLVGTIAG-V-GATRFLKPQYSAQAKIWIDV
A0A2V7FYT7      --LDGRESGVDWRRILSALLRFKWLIATTTLVGTIAG-V-GATRFLKPQYSAQAKIWIDV
A0A2V7IGR0      -GFSEVEGALDWRRVWSAVVRFKWLILAVTLLGVAAG-G-AATRFLKPQYLVQATIWIDQ
A0A2V7MR23      -DLDGPEGGLDWRRILSALLRFKWLIATFTLVGTVAG-V-GATRFIKPVYSAQAKIWIDV
A0A2V7L1V3      -GGPESEGGVDWRRVYSAVMRFKWLICAVTVLGTVAG-F-GLARFVRPQYGAQATIWIDA
A0A1Q7E5D3      -GFPGLDDGLDWRRVLSALLRFKWLIAAVTLAGTAAG-V-GATRFLTPEYVAQATVWIDG
A0A2V7ISE2      -DLAGSDSGLDWRRILSALLRFKWLIAGFTLVGTVAG-V-GATRFLKPEYAAQAKIWIDV
A0A1Q7J2X5      -DLAGSDSGLDWRRILSALLRFKWLIAGFTLVGTAAG-F-GATRFLKPEYSAQAKIWIDV
A0A2V7NPD1      -DLAGSDSGLDWRRILSALLRFKWLIAGFTLVGTVAG-V-GATRFLKPEYAAQAKIWIDV
A0A2V7QPD8      -GFAAPETGVDWRRVLSAVLRFKWLIAVVTIVGTVGG-V-AATRFIKPQYMVQATLWIDQ
A0A2V7Q8M6      -GGADSEGGVDWRRVFSAVLRFKWLICAVTVLGTTAG-F-GVARFVRPQYGAQATIWIDA
A0A2V7QBC3      -GGADSEGGVDWRRVFSAVLRFKWLICGVTVLGTTAG-F-GVARFVRPQYGAQSTIWIDA
A0A2V7LMU1      -GGAESEGGVDWRRVLSAVLRFKWLICGVTILGTAAG-F-GVARFVRPQYGAQATIWIDA
A0A2V7PBY9      -GFAEPEGGVDWRRVVSAVMRFKWLICGVTFLGTLAG-F-GAARFVKPQYGAQATIWIDA
A0A3M2BLV5      LDSELLSASPHLSDYIQVVTRRLWLVLLIFAVTTASAIW-AV-SRQKTLWRSEMAVQVTD
A0A2V7KS68      AAFPDDEHGPDWRRVGSALLRFKWLVLAALLAGLAAAFG-AT-KVLRPAYKAQANVWVDV
A0A2V7N4L3      GPPEGHEAGPDWHRIASALLRFKWVVILAVLLGLGAAFA-AT-RVLRPVYRAQANVWVDV
A0A1Q7AZK2      -----------------MLLRFKWVVILMLALGLGAGFA-AT-RVLRPVYRAQANVWVDV
A0A1Q7TNP7      -----------------MLLRFKWVVILMLALGLGAGFA-AT-RVLRPVYRAQANVWVDV
A0A1Q7KG39      -----------------MLLRFKWVVILMLALGLGAGFA-AT-RVLRPVYRAQANVWVDV
A0A1Q7GX75      AGLDDEESGLDWRRIVSALLRFKWLVLLAVALGLGGGFA-AT-RKLPPVYSAQANVWVDV
A0A1Q7LL80      AGLDDEESGLDWRRIVSALLRFKWLVLLAVALGLGGGFA-AT-RKLPPVYSAQANVWVDV
A0A2V7PFU2      SLPE-AESGPDWRRLASALLRFKWIVLLMVLLGLGGAVA-AT-RLLRPIYRAQANVWVDV
A0A2V7MFS9      SLPDGGEPGPDWRRIASALLRFKWLLVLTLTMGIGAAFA-AI-RLLRPVYRAQANVWVDV
A0A2V7T933      SLPE-EEAAPDWRRIGSVLLRFKWVVILMLALGLGAGFA-AT-RVLRPVYRAQANVWVDV
A0A2V7J4D7      GPFEDPNPPPDWWRYVAAIRRFKWLVLGVTVGATALGVV-GTMF-LRPTYAAQATLWIQV
A0A2V7LN90      LRPDS-EPLAEWRRYLMAARRYRWMVLGVTLFGTAAGVG-LSLL-LPPTYLARATVWIQV
A0A2V7LFN9      LPPDAGDWLADAQRYLRSVRRHKWLVLSLTLFATAAGIE-LSVYALPPNYAARATVWIQV
A0A2V7MEK4      LPPDAGDWLADAQRYLRSVRRHKWLVLSLTLFATAAGIE-LSVYALPPNYAARATVWIQV
A0A2V7P8B1      -------STVRLEDLFATVRRHIWLVLGVAAGVVAAAGG-VA-YVTGSVYRAVAVIRLSD
A0A7C2QQS2      YVDLDRDDEIDLRELLLLLRRRWRTVLGVTALIVAAAAW-WV-LRQRPVYEADATIRLKD
A0A2V7QN41      -------GETDWQHYFGAVRRRKWTVIGVTLLGTALGLF-AS-RLLHPPYSATALLWFET
A0A2V7R603      -------GETDWQHYIGAVRRRKWTVIAITLLGTALGLF-AS-RLLHPPYSATALLWFET
A0A2V7LJS2      -------STVRLDDLFAVLRRHIRLVLGVTAAAMMAAGY-VA-YVTGSVYRAVAVIRLSD
A0A1Q7GLJ7      -------HTVGLEELLSTLRRHVWLVLGVAAVAVAATGF-VA-YTTGPVYRAVAVIRLSD
A0A2V7GRE3      -------RTVRLEELLAILRRHVRLVVGVVVATVTAAGV-VA-YVTGPAYRAVAVIRMSD
A0A2V7EU00      --ATPDDAAVDWRRYWAAIVRYRWWVVLCTALGLVGGFV-AA-SVLKPQYRAQATVWIDV
A0A1Q6WE01      PVASPFEQGVDWRRCWGAVRRHRWWILGCAVLGTAGGVV-GA-RMRPPRYQAQATIWIQA
A0A2V7S9K3      PLAAAGEPFLDWRRSWAAALRYRWWVVGFMGLGVLGGLA-AS-RFLPPRYLAQATIWIQT
A0A1Q7DXB9      --RLLPAVEPDWRRIFGAIRRRRWVVLGVTLLGTVAGVV-AAAKFVGPRYLARARLWVGA
A0A1Q7JD32      --RLLPAVEPDWRRIFGAIRRRRWVVLGVTLLGTVAGVV-AAAKFVGPRYLARARLWVGA
A0A2V7MVP8      --RPLAAGEPDWHRILGAIRRRRWLVLAVTLLGTAAGVV-AAVRFVGPRYLARARLWVGA
A0A2V7N0A9      ------PLPDDWRRVVAAIGTYRWFVVAVTAAGTLVGAV-AA-HFLKPTYQARATVWVEV
A0A1Q7DLS9      --MVEAAPDVDWGRYRTAIWRFRWWVLLITLLGTAAGVG-AS-RIVRPVYVARATIWIEG
A0A1Q7JK96      --MVEAAPDVDWGRYRTAIWRFRWWVLLITLLGTAAGVG-AS-RIVRPVYVARATIWIEG
A0A2V7KQV7      --AAAPAPMSDWARVFAAARRYKMLVATVTVVGSLAGLV-IG-KFLKPVYQAQATIWIQS
A0A1Q7JGF6      --------PEDWRRVVTAIRTYRWLVIAVTGVGTLAGII-GA-RFLKPTYQARATVWLEI
A0A2V7SG67      --------PEDWRRVVTAIRTYRWLVIAVTGVGTLAGII-GA-RFLKPTYQARATVWLEI
A0A1Q7GIK9      YPAVVPAGPDDWRRVFAAMRTSRWLILAVTAVGTLAGIV-GS-RFLKPTYEARATVWLEI
                                         :                       :     :    

A0A2D5ZJF2      SG------------------PKVITEFEGVMTQSKNYLYTQ---AEIFLSTEVLRPVAEA
A0A0S8H9P3      PRGRMG--------------QLGD----IDVTPNMLWTDPVESEVQQLTTQAVAQYVADT
A0A1E4BBP7      TPG---------PSGRMG--PVSA---PGLVNSDVAW-------MELARSFSVLDKVVSK
A0A3M2G737      KSGNLNPY------------PVYR----DPAKINNE--------LVILKSRRLAETIADS
A0A0H4TUX7      PKQVFAQL----EGMRVDELALQT----DPVLSE----------ALILTTQQLALEVVRG
A0A1G0LUG0      PRGVFSQL----NDRTVDELALQT----DPVLSE----------ALVLTTQALALQVVDA
A0A1Q7E3T7      PRRALTGGVADGPTGDLA--GSSA----DPLLSQ----------VELLTSRRVGGVVVDS
A0A1G0L906      KKQALT--------------PLEAMRVDEMSMQTDPVLSE----ALVLSTQALALRVVDA
A0A1G0LCC0      KKQALT--------------PLEAMRVDEMSMQTDPVLSE----ALVLSTQALALRVVDA
A0A2D5ZJE2      QDAGALSIFDPTGFMKQKILINNE--------------------CELLRSRSLAQQVLD-
A0A3M2G624      KETNIRLL------------PQFS----SVRQQSIYWGSPEGKIIAEVLSTSVIEEVVQM
W0RI74          SGNEKPS-------------MINP----AQLTGNAGW-------RDLFQSFAIIDPVVQK
A0A3M2BJA6      ERANLPVL------------DILQELSSGSQVETE---------MEVLRSRTLAEDVVDS
A0A6M4IRY1      GTGTNQD-----GANSRG--PIQA----EELLKASGW-------QDLLRSFAIADPVVND
A0A3D4VBZ5      GTGVNNG-----AG--RG--PIQA----AELLQASGW-------QDLLRSYAIADPVVIG
C1A5W1          GTGVNNG-----AG--RG--PIQA----AELLQASGW-------QDLLRSYAIADPVVIG
A0A2V7PX99      AGRAPGR--------DGG--SIVD----EALVQTPSW-------GELVTSGAVLEDVVRE
A0A2V7ERC7      ARGQ-----------QAG--SIGT----QQLLEQTSW-------VELLRSFAVVDAVVHQ
A0A5Q4D6Y4      PRTQMSERLGSVDPARSGADPIRS------------S-------LEVLRSRTVLAQIVDE
A0A2V7JTZ5      TPSSA--L-------QTG--PIRQ----QQLLTTGSW-------VELLRSFAIVDPIVRD
A0A3D4YTR6      TPNGTQQT-------QTG--PIRQ----PQLLTSVSW-------VELLRSFAVVDPVVRD
A0A5Q4DA46      TDRGTAGD----AA------PIRP----SQLLTNTGW-------MDLLRSYIVLDPVVDN
A0A2V7F1M1      PRRALTV--------GVEDLPAKD----QRSDPLLSL-------IELLRGRGIVGAVVDS
A0A2V7KXK7      AVGR-----------DRG---VQS----DQLLDSRGW-------EELVVSNAVLDTVVKE
A0A651HKD3      G--------------QTGVTAIET----GQRQSSLNW-------QNLLPSFSVVEPVVRE
A0A2V7QDU7      ---------------RRQPIPTLDVLALYRGNELSTE-------IEMLGSRTLAEDVVAA
A0A6J4M9S2      VRRAVTGG----IEGAAL--EASMGRTTDPLLSQ----------LEVLKGRVVLGQVVDR
A0A2V7ITT6      HDPRTE---------DRG--PIRG----DQLLQASSW-------LQLLRSYVVLDHVVRD
A0A2V7NJW1      HDPRTE---------DRG--PIRG----DQLLQASSW-------LQLLRSYVVLDHVVRD
A0A2V7GFB5      PDP----R----GN-DRG-GPIRS----GQVLDPESW-------IDLLRSYAVLDRVARD
A0A2V7RQ86      PDP----R----GN-DRG-GPIRS----GQVLDPESW-------IDLLRSYAVLDRVARD
A0A2V7IWX2      AEPNPNAL----RG-TTP--PPGA----ERLLGVAAW-------VDFVRSDAVLDTVVRD
A0A1Q7KE95      SEPR---G----GT-SRG--PIGA----NQLFESYAW-------GELLKSYVVLDEVARE
A0A1Q7T8X5      SEPR---G----GT-SRG--PIGA----NQLFESYAW-------GELLKSYVVLDEVARE
A0A2V7MS64      S---AHPA----PR-DQG--PIWS----GQLPISTGW-------TDLLRTNVVLEEVVRA
A0A2V7Q7N9      PSGHARDA-----R-DRG--PIWQ----GQLPISSGW-------MDLLQTNVVLEDVVRR
A0A2V7IRW6      P---ARPT-----R-DEG--PIWS----GQLPISSGW-------TDLLHTNVVLEEVVRQ
A0A1Q7DVU6      P---QRPT-----R-DEG--PIWS----GQLPISSGW-------TDLLQTNVVLEDVVRQ
A0A1Q7JSV2      P---QRPT-----R-DEG--PIWS----GQLPISSGW-------TDLLQTNVVLEDVVRQ
A0A2V7FK98      PDQR---G----GQ-DRG--PIRA----GQPLEPEAW-------LDLLKSYRVLDQVVRD
A0A2V7R3Z8      PDQR---G----GQ-ERG--PIRA----GQPLEPEAW-------LDLLKSYRVLDQVVRD
A0A2V7J3C0      SEP----R----GT-GRG--PIGA----NQLFESYAW-------VDLLKSYVVLDQVARD
A0A2V7KWV9      SEAR---G----TP-DRG--PIGA----NQLLAPTAW-------GDLLKSYVVLDAVARE
A0A1Q6ZHP2      EGR----R----GP-ERGPTPIRS----GQLLDAESW-------VDLLESYVVLDQVVRD
A0A1Q7R6Z6      EGR----R----GP-ERGPTPIRS----GQLLDAESW-------VDLLESYVVLDQVVRD
A0A2V7FYT7      EGR----R----GP-ERGPTPIRS----GQLLDAESW-------VDLLESYVVLDQVVRD
A0A2V7IGR0      ADR----R----GP-DRGPTPIRS----GQLLEPEAW-------VDLLRSYIVLDQVVRE
A0A2V7MR23      EGR----R----SP-DRSLAPIRP----GQLLDAESW-------VDLLRSYVVLDQVVHD
A0A2V7L1V3      TERERWGQ----AQ-DRG--PIRQ----GQLLDPQSW-------VDLLKSYVVLDTVVRD
A0A1Q7E5D3      PDR----R----GP-DRG--PIRP----GQLLDPEAW-------VELLKSYVVLDEVVRE
A0A2V7ISE2      EGR----R----GP-DRGPAPIRP----SQLLDAESW-------VDLLKSYVVLDQVVRD
A0A1Q7J2X5      EGR----R----GP-DRGPAPIRP----GQLLDAESW-------VDLLKSYVVLDQVVRD
A0A2V7NPD1      EGR----R----GP-DRGPAPIRP----SQLLDAESW-------VDLLKSYVVLDQVVRD
A0A2V7QPD8      PDQR---G----GQ-ERG--PIRS----GQALEPEAW-------LDLLKSYRVLDQVVRD
A0A2V7Q8M6      TESERWGQ----GQ-DRG--PIRQ----GQLLDPQAW-------VDLLKSYVVLDQVVRD
A0A2V7QBC3      TESERWGQ----GQ-DRG--PIRQ----GQLLDPQAW-------VDLLKSYVVLDQVVRD
A0A2V7LMU1      TERERWGQ----GQ-DRG--PIRQ----GQLLDPQAW-------VDLLKSYVVLDQVVRD
A0A2V7PBY9      SERER--R----AD-DRG--PIRQ----GQLLDAQAW-------VDLLKSYVVLDQVARD
A0A3M2BLV5      PLERARS--------LTS--PTRVSGMDIFVDPMQSQ-------IEVLQSRSIAERVADE
A0A2V7KS68      PGRAEGDR----SADNRG--PIRT----AALLEADDW-------IELLRSYIVLDQVVRD
A0A2V7N4L3      PDR-RGEN----PSDARG--PIRQ----GALLDADAW-------VELMRSYVVLDQVVKD
A0A1Q7AZK2      PDR-RGNG----SSDARG--PIRQ----GALLDADAW-------VELLRSYVVLDQVVRD
A0A1Q7TNP7      PDR-RGNG----SSDARG--PIRQ----GALLDADAW-------VELLRSYVVLDQVVRD
A0A1Q7KG39      PDR-RGNG----SSDARG--PIRQ----GALLDADAW-------VELLRSYVVLDQVVRD
A0A1Q7GX75      LDR-RGEG----GAEARG--PIQQ----RALLDEDAW-------VELLRSYIVLDQVVRD
A0A1Q7LL80      LDR-RGEG----GAEARG--PIQQ----RALLDEDAW-------VELLRSYIVLDQVVRD
A0A2V7PFU2      PDR-RGDP----HADTRG--PIRQ----GALLDADAW-------VELLRSYVVMDQVVRD
A0A2V7MFS9      PDR-RGEG----PSDARG--PIRQ----GALLDADAW-------VELLRSYIVLDQVVRD
A0A2V7T933      PDR-RGNG----SSDARG--PIRQ----GALLDADAW-------VELLRSYVVLDQVVRD
A0A2V7J4D7      PARQP-------R--EAG--PIWQ----AQLPISTGW-------MDLLQSYAVLDDVVRG
A0A2V7LN90      PSARARDI----R--DRG--PIWQ----GQLPITSGW-------MDLLQTNVVLEDVVRR
A0A2V7LFN9      PAHQA-------R--DEG--PIWS----GHLPISSGW-------IDLIRTNIVLEEVARR
A0A2V7MEK4      PAHQA-------R--DEG--PIWS----GHLPISSGW-------IDLIRTNIVLEEVARR
A0A2V7P8B1      PRRAFTGG----VVEDPA--LLADGRYADPLLSQ----------VELLKSRTVAGGVVDS
A0A7C2QQS2      ERGALTGV----LEQRVP--EEILGRQSDPLLSK----------MEVLKSATIVGGVVDR
A0A2V7QN41      KDRAAAA-------RDPR--TASE---ADELLNPSGW-------IDLVESNAVLEEVVRQ
A0A2V7R603      KDRAAAG-------RDPR--TASE---ADELLNPSGW-------IDLVESNAVLEEVVRQ
A0A2V7LJS2      PRRAFTGG----VVDDPA--LLADGRYADPLLSQ----------VELLKSRTVAGGVVDS
A0A1Q7GLJ7      PRRALTGG----VVEDPG--PSADERFADPLLSQ----------VELLTSGTVAGAVVDS
A0A2V7GRE3      ARRALTGG----VVLDPA---RADERFSDPLLSQ----------AELLTSRAVAGAVVDS
A0A2V7EU00      AKERQDA--------TRG--PIRQ---GQLLE-ATAW-------VDLLQSYAVLDDVVRQ
A0A1Q6WE01      GEPR-GP--------DRG--PIGA---NRLLD-ASAW-------VDLLKSYVVLDDVVRD
A0A2V7S9K3      SEPR-AT--------DRG--PIGA---NQLLE-ASAW-------VDLLKSYVVLDDVVRE
A0A1Q7DXB9      AEPDPNAI----R--GTT--PAPG---AERLLGVEAW-------VDFVRSDAVLDTVVRE
A0A1Q7JD32      AEPDPNAI----R--GTT--PAPG---AERLLGVEAW-------VDFVRSDAVLDTVVRE
A0A2V7MVP8      AEPDPNAL----R--GTT--PLPG---TDRLLGVEAW-------VDFVRSDAVLDTVVRD
A0A2V7N0A9      PNPAARER-------DQG--PIET---GQLLGTATSW-------LDLLRSHVVLDDVVRQ
A0A1Q7DLS9      ANEKQP---------GPG--PAGS---GDLLG-ATGW-------VDLVRSYVVVAAVVND
A0A1Q7JK96      ANEKQP---------GPG--PAGS---GDLLG-ATGW-------VDLVRSYVVVAAVVND
A0A2V7KQV7      SEQD-HDR----GRADQG--PIQS---AQLLGTSGGW-------LDLIRSHVVLNDVVRE
A0A1Q7JGF6      PDQSAHER-------DQG--PFQS---GQLLGTATGW-------LDLLRSHVVLDDVVRQ
A0A2V7SG67      PDQSAHER-------DQG--PFQS---GQLLGTATGW-------LDLLRSHVVLDDVVRQ
A0A1Q7GIK9      PDEASHAR-------ERG--PIES---GELFPTATGW-------LDLLRSHVVLDDVVRR
                                                                    :   :   

A0A2D5ZJF2      A----------------------EDAKTRILSSRTRATKGSTTSVAEESVQEVGQPEQGA
A0A0S8H9P3      L--QLRARS--------------PDISRDLLLSGVRI---DREAPSGDYRIRVGSDGSV-
A0A1E4BBP7      L--ALYVYP--------------DVAADTLVVRDLYP---SDSLQPGPYRLTIQGSSYV-
A0A3M2G737      LLKRVYIDP--------------ETKNEKLHIIHRRV-----------------------
A0A0H4TUX7      L--ALHLEL------------DDPGLRRGDLFAAVAV---DSTTPPGAYRLTVQPTSGF-
A0A1G0LUG0      L--QLQVEL------------TDPRLRRDDVIAAIAV---DSSSTPGRFALVRRGPDGY-
A0A1Q7E3T7      M--LMLRVR--------------ARNFPTSILAVVQL---PSDVGGDSLRLEFNRDSLT-
A0A1G0L906      I--GLRLAM------------DDWRLSRTTFLYDAQV---DTLARPDSFVLELKGTGYQ-
A0A1G0LCC0      I--GLRLAM------------DDWRLSRTTFLYDAQV---DTLARPDSFVLELKGTGYQ-
A0A2D5ZJE2      ------------------------------------------------------------
A0A3M2G624      L--DLDKAV--------------HSISPNLSFSMTNI--QSHNAPLGTYRVHILDNQHY-
W0RI74          L--SLYIQP--------------AKASDSLLFATFQIDPVKKQFRPGTYTLKTERGRFS-
A0A3M2BJA6      L--NLQVEI------------IEPRGVSRAVLLDRLV---AERWAPEG-EFLIEPGGDA-
A0A6M4IRY1      L--ALFVTP--------------KRVSDSTMFRAFRVAPDQQRLKPGTYVLTVTGTTYSL
A0A3D4VBZ5      L--GLFVTP--------------AVVADSVLFRTFRV--DQSRLRPGDYKLTIAGERYVL
C1A5W1          L--GLFVTP--------------AVVADSVLFRTFRV--DQSRLRPGDYKLTIAGERYVL
A0A2V7PX99      L--RLYVTP--------------KSPADAPVFAGFGL---GKMVRPGRYELVVDRGAR--
A0A2V7ERC7      L--KLNVVY--------------KVPGDSLLFRTFQT---GTTPFYGSYVLQIDRSGRG-
A0A5Q4D6Y4      E--GLRLIG-------------LHANAAQQALQEVTV---EAFALDDTLTLEFSSTGLG-
A0A2V7JTZ5      L--KLNVSY--------------KQPSDSVLFRNFEW---TPATRSGAYLLKIDGAGPK-
A0A3D4YTR6      L--KLNVSY---------------TPADSALYANFVW---TPATRSGAYALKIDEHGRS-
A0A5Q4DA46      L--RLYVTP--------------ADPAHAPLFEDFSV---GNEVFSASYEIGRDASGGD-
A0A2V7F1M1      L--ALRLQPLGSRFGG-------SSRVVRAALRDVRV---SPGAQQDTLRLT--------
A0A2V7KXK7      R--RLFIHP--------------ETPQDSAALTTFDI---TDRVAPGDYRVVVDKAGRA-
A0A651HKD3      L--RLYIEP--------------REPEDAELFEEVEL---AGDVVPGRYRLQVDSSGRT-
A0A2V7QDU7      L--GLQLEI-----------TKPRAVLREEVFASVRV---TRDAPAATYRLEPADSDG--
A0A6J4M9S2      E--GLRLRS-------------VTPEFRVGRLEGVSVQLPPSSFDTVSLRFAADQ-----
A0A2V7ITT6      L--RLYVTP--------------ALPADSDLFQSFEV---AAPFRPGAYRLAVDESGRA-
A0A2V7NJW1      L--RLYVTP--------------ALPADSDLFQSFEV---AAPFRPGAYRLAVDESGRA-
A0A2V7GFB5      L--RLFLQL--------------PKGPD-PALRSLNV---ADQFRPGAYRLTTD-AARA-
A0A2V7RQ86      L--RLFLQL--------------PKGPD-PALRSLNV---ADQFRPGAYRLTTD-AARA-
A0A2V7IWX2      V--RLYLDP--------------RTPLDGTALLRFGL---KDQVLPGRYRLEVDRDGAG-
A0A1Q7KE95      R--RLYLAP--------------Q-HGWAGAFAGFTV---SDTYRPGRYRVVVDGTGRN-
A0A1Q7T8X5      R--RLYLAP--------------Q-HGWAGAFAGFTV---SDTYRPGRYRVVVDGTGRN-
A0A2V7MS64      R--QLYLTP--------------KEPADSDLFSGFRA---ADRIRPGRYYLVIDATGHR-
A0A2V7Q7N9      Q--RLYVTA--------------RRPGDSDALATFEI---KDRVRPGVYRLVVDTAGNT-
A0A2V7IRW6      Q--RLYVAP--------------QEPRDSDALAGFGI---KDRVRGGTYRLVVNDGGTA-
A0A1Q7DVU6      Q--RLYVTP--------------KEPGDADALTGFGI---KDRVRGGTYRLVVNDAGTA-
A0A1Q7JSV2      Q--RLYVTP--------------KEPGDADALTGFGI---KDRVRGGTYRLVVNDAGTA-
A0A2V7FK98      Q--RLFLTP--------------KAREDAPLFETFRV---AEQYRPGVYRLALDGSART-
A0A2V7R3Z8      Q--RLFVTP--------------RAREDAPVFEAFRV---AEQYRPGVYRLALDGSGKT-
A0A2V7J3C0      L--KLYLTP--------------ERGANG-AFAGFEV---GDTYRPGRYRIVADRTGRS-
A0A2V7KWV9      R--RLYLQA--------------RPR-DLPALAGFAV---ADQFTPGRYHLTIDHDGQT-
A0A1Q6ZHP2      Q--RLYVSP--------------NAPADAQAVAKLGV---ADQFQAGAYRFTVDHSGQG-
A0A1Q7R6Z6      Q--RLYVSP--------------NAPADAQAVAKLGV---ADQFQAGAYRFTVDHSGQG-
A0A2V7FYT7      Q--RLYVSP--------------NAPADAQAVAKLGV---ADQFQAGAYRFTVDHSGQG-
A0A2V7IGR0      Q--RLFLTV--------------RPLADSVALGTFGV---ADQYRPGKYRLTVDSTGQH-
A0A2V7MR23      Q--RLFVGS--------------AARADTQAIDRIRV---ADQYQPGAYRLSVDRSGQG-
A0A2V7L1V3      Q--RLFVSP--------------KSRADEDVLASLRV---TGQYRPGTYRLKVDSDRRS-
A0A1Q7E5D3      Q--RLFLGL--------------GSPADAHVFDAFRP---AEQYRPGAYRLKVDATGQN-
A0A2V7ISE2      E--RLFVDP--------------SSPADAQALEGLRV---ADQYRPGAYRFTVDRAGQG-
A0A1Q7J2X5      E--RLFVAP--------------SSPADAQAVEGLRV---ADQYRPGAYRFTVDRSGQG-
A0A2V7NPD1      E--RLFVDP--------------SSPADAQALEGLRV---ADQYRPGAYRFTVDHAGQG-
A0A2V7QPD8      Q--RLFLTT--------------KAREDAPLLETFRV---AEQYRPGAYRLAVDGSGKA-
A0A2V7Q8M6      Q--RLFVSP--------------KSRVDEAVLATLQV---TGQYRPGVYRLKVDSDRRS-
A0A2V7QBC3      Q--RLFVSP--------------KSRADEGVLATLQV---TGQYRPGVYRLKVDSDRRS-
A0A2V7LMU1      Q--RLFVSP--------------ESRADEPLVATLQV---TGQYRPGAYRLKVDSDRRT-
A0A2V7PBY9      Q--RMFVSP--------------KSRADARFLTTFQT---AGQYRPGAYRLSLDADRQS-
A0A3M2BLV5      L--GLRLRR------------RGTNTVRSELFSDAVV---TDEAEPGWYELRYSADGAS-
A0A2V7KS68      L--RLYLTV--------------KRPAERAIFSTFNV---ADDFRPGLYRLRASADGRS-
A0A2V7N4L3      Q--RLYLET--------------KRASDRGNFVAFRV---DDTFRPGDYRLNISDNGRT-
A0A1Q7AZK2      L--RLYLKV--------------KRTSDRATFDAFRV---NDIFRPGDYRLSVSDDGRQ-
A0A1Q7TNP7      L--RLYLKV--------------KRTSDRATFDAFRV---NDIFRPGDYRLSVSDDGRQ-
A0A1Q7KG39      L--RLYLKV--------------KRTSDRATFDAFRV---NDIFRPGDYRLSVSDDGRQ-
A0A1Q7GX75      L--RLYLAV--------------KRPADQATFVGFRV---NDTFRPGQYAFSVSADGRE-
A0A1Q7LL80      L--RLYLAV--------------KRPADQATFVGFRV---NDTFRPGQYAFSVSADGRE-
A0A2V7PFU2      L--RLYLDV--------------KRLGDRPSFAGFSV---SDDFRPGEYRLNISDNGRQ-
A0A2V7MFS9      L--RLYLEV--------------KRPADRPSFSGFGV---ADAFRPGAYRLSVSDDSKT-
A0A2V7T933      L--RLYLKV--------------KRTSDRATFDAFRV---NDIFRPGDYRLSVSDDGRQ-
A0A2V7J4D7      Q--RLYLHA--------------KVPGDSDILATLRI---KDHVAPGKYRLVVEDTGDAP
A0A2V7LN90      H--RLYLTP--------------RQPGDTDALATFGI---KPHVRPALYRLVVDSIGKT-
A0A2V7LFN9      E--RLYLV---------------NVSGDSAALTSFAI---KERVRPGTYLLAVDTVGTG-
A0A2V7MEK4      E--RLYLV---------------NVSGDSAALTSFAI---KERVRPGTYLLAVDTVGTG-
A0A2V7P8B1      M--PM-LRVLLRKASPSLLDRVLRRRFSTSLLGSVAV---AADAPADSIELAFDQDGFV-
A0A7C2QQS2      L--GLRASP-------------VDAEWPRSWLVVRQV---PTNVARDTFILEFGSADYR-
A0A2V7QN41      R--RLYLRP--------------GNPVDSSVLATLRL---DGTPLPGAYRYSVDREGRT-
A0A2V7R603      R--RLYLRA--------------RDPADSSGLATLRL---DGTPVPGAYRYTLDREGRT-
A0A2V7LJS2      M--PM-LRVVLRKSSPSLLDRVLRRRFSPNLLGVVAV---RPDAAADSLSLTFERDGFL-
A0A1Q7GLJ7      V--PM-LRV------------L-TRKFSPSLLGGVAV---AADSAAHSFQLTFGRDDFV-
A0A2V7GRE3      M--PA-LRM------------VTTRDLPLSFLGEVAV---PAAAGPVSLQIAFGRDSFV-
A0A2V7EU00      R--RLYLTP--------------GARGDSLAFASFDM---GERFRSGNYRLSVDASGKN-
A0A1Q6WE01      R--QLYLGV--------------VAR-DTRALTGFAV---GDPVMPGRYRVVLDRSGST-
A0A2V7S9K3      L--RLYLRV--------------DPR-RSPVFAEFTV---SDEFRPGQYRLVVDQAGRT-
A0A1Q7DXB9      V--RLYLSP--------------KTPIDGTALLGLRL---KDQVLPGRYRLEVDRDGQA-
A0A1Q7JD32      V--RLYLSP--------------KTPIDGTALLGLRL---KDQVLPGRYRLEVDRDGQA-
A0A2V7MVP8      A--RLYLFP--------------RTPADSAALVAFGL---KARVVPGRYRLEVDRQARG-
A0A2V7N0A9      W--RLYLKP--------------QSPADTAALATFAV---PGDVRPGRYRLQVDATGHS-
A0A1Q7DLS9      R--QLYLTP--------------ASPSDSAVFAGFSV---APRFRPGSYRLEVDQAGRG-
A0A1Q7JK96      R--QLYLTP--------------ASPSDSAVFAGFSV---APRFRPGSYRLEVDQAGRG-
A0A2V7KQV7      A--RLYLAP--------------KSRADSAALATLTV---FGDVRPGTYRLEVDQTGQH-
A0A1Q7JGF6      W--RLYLKP--------------QSAADSAALATLTV---TGDVRPGRYRLQVAAAANR-
A0A2V7SG67      W--RLYLKP--------------QSAADSAALATLTV---PGDVRPGRYRLEVAAAANR-
A0A1Q7GIK9      W--RLYLKP--------------KSAADSAALATLTV---PGDVRPGHYRLVLDRAGKR-
                                                                            

A0A2D5ZJF2      NGALLQRRQILEGVADLLAFFAKTFNDTGGSTAVASDESEEEP---DEGKQVVFYDRLKT
A0A0S8H9P3      ----------FIEPGSGAPAVRGQVGEPIEFTAGSLVVRPQ-----IEPGDYRV--HVIS
A0A1E4BBP7      -LA----RPAQQRGEQDVVVERGAVGDSIG-RAVGFQWQPSAQLL-AGREQVGF--YVVT
A0A3M2G737      ----------------------------------------------ESNGHVDY--EPLN
A0A0H4TUX7      ----------EVRDGFGTVVAQGQPGETVVGPGFTLRLVPS-----PEARTVGF--RLVR
A0A1G0LUG0      ----------EVQDASGAAVGGGAYSQPVTVSGVTLTVQPT-----TSEDVVPF--RITR
A0A1Q7E3T7      ----------VLGRSRAIRTSYGTSVELDG---------------------MRF--TVVA
A0A1G0L906      ----------LRSVAGGTLVAAGGYDV----PAVGSGFSFRVREYRGDPRSVRI--SIMP
A0A1G0LCC0      ----------LRSVAGGTLVAAGGYDV----PAVGSGFSFRVREYRGDPRSVRI--SIMP
A0A2D5ZJE2      -------------------------------RAMREGWTPPPESD--------------P
A0A3M2G624      ----------VVYDTANRELGRGISGVPFQHEFFEFTISNIEG---PPQSEFYF--TLYP
W0RI74          ----------LTDK-VGFTHEVGTVGDSVG-RSAGFAWVPPARLLGTRSREVEF--TVLT
A0A3M2BJA6      ----------FRITDEETLESLGEVSERLPAALAGVTFTLTEAAR-DYPR-IRV--RVLP
A0A6M4IRY1      AIK------------LGPEVEKGAVGDSVG-RVVGFLWQPAARTL-AGRKDIEF--DVQT
A0A3D4VBZ5      NLQ------------PGVEVEKGVVGDSIG-RPVGFQWQPVAGQF-GRRTEVVF--NVQT
C1A5W1          NLQ------------PGVEVEKGVVGDSIG-RPVGFQWQPVAGQF-GRRTEVVF--NVQT
A0A2V7PX99      -YE-------LLDQ-NGALVERGAVGDSVG-RSVGFSWAPSSSML-LEGRRITF--NVSS
A0A2V7ERC7      -YT-------LATA-TGRILESGTVGDSVG-RKMGFFWNPDPALL-PPGRLIAF--SVTT
A0A5Q4D6Y4      -VT-------SARGHASVNVSYGQRATVGG---------------------ISF--RVDE
A0A2V7JTZ5      -YM-------LSTA-KGVFIESGAIGDSIG-RKAGMNWLPDARFL-GRGRAIEF--GVTS
A0A3D4YTR6      -YV-------LSTA-TGTVLERGAVGDSVG-RKIGMSWLPDRRLL-GANSIFKF--AVSS
A0A5Q4DA46      -LL-------LFDS-DGNVLERAAPGQPIG-AERGIEWTPPAGAI-EAGQRIAF--RVTR
A0A2V7F1M1      -FG------------GDRVTAQGLQGEAQS----------PYGTP-LAVGSVQF--TIPS
A0A2V7KXK7      -FR-------LELE-DGTVVQRGRVGQPVG-ESVGFDWTPTAAML-KPGTTVKF--GVSA
A0A651HKD3      -LQ-------ILGR-EGELVEEASVTEGIG-ASLGIRLTPRPEHL-RPGRNAEF--RLTS
A0A2V7QDU7      -FV-------VRNDSSEAVLGRTVPGKPLTFAGVELEVSPHALGL-GP---VAF--SVVA
A0A6J4M9S2      -VT-------LQVGGETAKAPYGAPLRAAG-VGLTVPSRPASL------EEAKL--VVVT
A0A2V7ITT6      -FT-------LFTT-AGDSLQHAAVGDSIG-NGLGFRWTARAGAL-LPGRVVDF--TVGT
A0A2V7NJW1      -FT-------LFTT-AGDSLQHAAVGDSIG-NGLGFRWTARAGAL-LPGRVVDF--TVGT
A0A2V7GFB5      -YV-------LAKV-DGAVLERGTVGDSIG-RSIGFLWAPPAESL-PPGHTVEF--RLQT
A0A2V7RQ86      -YV-------LAKV-DGAVLERGTVGDSIG-RSIGFLWAPPAESL-PPGHTVEF--RLQT
A0A2V7IWX2      -FT-------LFSA-QGGVVQHGERGDSVG-PALGFAWVPGAAVL-TPGRRIEF--TLLT
A0A1Q7KE95      -FR-------LAGA-GGEGLQEGAIGDSVG-AALGFRWVPTAAVL-PAGSDLTF--TVRP
A0A1Q7T8X5      -FR-------LAGA-GGEGLQEGAIGDSVG-AALGFRWVPTAAVL-PAGSDLTF--TVRP
A0A2V7MS64      -FA-------LQDK-HKTELQHGATGEPVG-TALGFLWTPPAEKL-TPGRRVEF--DVDA
A0A2V7Q7N9      -FT-------LTDT-KHLVRLHGTVADSVG-PALGFAWVPPSGVL-TPGRTMEF--TVTA
A0A2V7IRW6      -FT-------LEEM-KAGTVQHGVTGDSVG-AALGFAWVPPSAAL-SRGRRVEF--TVSA
A0A1Q7DVU6      -FT-------LEEK-KAGVLQHGAAGDSVG-APLGFVWVPPAAAL-TRGRTVEF--TVSA
A0A1Q7JSV2      -FT-------LEEK-KAGVLQHGAAGDSVG-APLGFVWVPPAAAL-TRGRTVEF--TVSA
A0A2V7FK98      -FT-------LSTD-KGVEVEHGAVGDSIG-ARLGFTWAPPAGTV-PAGRTIEF--SVAT
A0A2V7R3Z8      -FT-------LSTD-KGVEVEHGAAGDSIG-ARLGFVWAPPAGTV-PAGRTIEF--SVAT
A0A2V7J3C0      -FS-------LLGA-KGEELQQGAIGDSIG-AALGFRWAPAAAAL-HAGSDLTF--TVRP
A0A2V7KWV9      -FH-------LQRE-DGTELEQGAVGSPVG-RTLGFIWTPTTAVL-TPGREVRF--VVSP
A0A1Q6ZHP2      -YT-------LATA-DGVELERGTLGDSVG-SRYGLRWVPDASTV-APGRVVEF--TLTT
A0A1Q7R6Z6      -YT-------LATA-DGVELERGTLGDSVG-SRYGLRWVPDASTV-APGRVVEF--TLTT
A0A2V7FYT7      -YT-------LATA-DGVELERGTLGDSVG-SRYGLRWVPDASTV-APGRVVEF--TLTT
A0A2V7IGR0      -YT-------LADG-EGVALEHGVVGDSVG-ARLGFLWVPTRDAL-GAGRTVRF--ALAT
A0A2V7MR23      -YT-------LSTA-DGVELERGSFGDSVG-TRYGLRWAPDASTV-PPGHTVEF--TLTT
A0A2V7L1V3      -YT-------LSTAPENQVVERGTVGDSIG-IKLGFVWAPAAGAL-PADRTIEF--RLAT
A0A1Q7E5D3      -WT-------LATE-DGIDLERGAVGDSIG-GRVGFHWAPGLGVL-TPGRSVGF--TVAS
A0A2V7ISE2      -YT-------LATA-DGIELERGTLGDSVG-TRYGLQWAPDAGTV-APGRTVEF--TLTT
A0A1Q7J2X5      -YT-------LGTA-DGIELERGTLGDSVG-TRYGLQWAPDAGTV-APGRTVEF--TLTT
A0A2V7NPD1      -YT-------LATA-DGIELERGTLGDSVG-TRYGLQWAPDAGSV-APGRTVEF--TLTT
A0A2V7QPD8      -FT-------LSTD-KGVEVEHGAVGDSIG-ARLGFTWAPPAGTI-PAGRTIEF--SVAT
A0A2V7Q8M6      -YA-------LATV-EGQVLERGTVGDSIG-TRLGLAWAPAATTL-PADRAVEF--ALST
A0A2V7QBC3      -YA-------LATL-EGQVVERGTVGDSIG-TRLGLAWAPAASTL-PTDRAVEF--GLST
A0A2V7LMU1      -YT-------LATV-EGQVVERGTVGDSIG-TRLGLAWAPAASTL-PTDRAVGF--GLST
A0A2V7PBY9      -YT-------LATV-EGRVLEQGRVGDSIG-TRLGFAWAPTAATL-PPDRAVEF--ELLT
A0A3M2BLV5      -----------------AALVHAPTGDTVG--------TADAGEV-LEAPGLRF--VLKR
A0A2V7KS68      -YT-------LSNKDG-VELERGTVGDSVG-RRLGFLWQPS--SL-PRDHAVEF--SLAA
A0A2V7N4L3      -YT-------LASAEG-KELERGTVGDSVG-NRLGFRWVPAAGSL-PPGRTIEF--SLMT
A0A1Q7AZK2      -YT-------LASAEG-VDLERGTVGDSVG-NRLGFRWAPPAGSL-PPGRTVEF--SVVP
A0A1Q7TNP7      -YT-------LASAEG-VDLERGTVGDSVG-NRLGFRWAPPAGSL-PPGRTVEF--SVVP
A0A1Q7KG39      -YT-------LASAEG-VDLERGTVGDSVG-NRLGFRWAPPAGSL-PPGRTVEF--SVVP
A0A1Q7GX75      -YT-------LDGANG-VELERGMVGDSVG-RRLGFQWVPASGRL-APSRTVEF--SLVS
A0A1Q7LL80      -YT-------LDGANG-VELERGMVGDSVG-RRLGFQWVPASGRL-APSRTVEF--SLVS
A0A2V7PFU2      -YT-------LTSAAG-LTLERGTVGDSVG-SRFGFRWVPAPGTL-PAGRSVEF--AVMP
A0A2V7MFS9      -YT-------LAAAEG-VDLERGTVGDSVG-RRLGFRWVPGPESL-SPGRTIEF--SVVQ
A0A2V7T933      -YT-------LASAEG-VDLERGTVGDSVG-NRLGFRWAPPAGSL-PPGRTVEF--SVVP
A0A2V7J4D7      HFT-------LYNARSKTPVQTGVAGDSVG-PDMGLAWVPPRAVL-AGPREVDF--TLDP
A0A2V7LN90      -FT-------LSDKKHLV-QLHGTVGDSIG-AELGFAWVPPSGTL-TPGRLVDF--TVVA
A0A2V7LFN9      -FT-------LTDDAGAV-LDRGAVGDSIG-AALGFAWVPPEGVL-LAGHVVEF--TVTT
A0A2V7MEK4      -FT-------LTDDAGAV-LDRGAVGDSIG-AALGFAWVPPEGVL-LAGHVVEF--TVTT
A0A2V7P8B1      -VG---------RPPGRR--------------------RAPYGTV-VEVGGVRF--AVLR
A0A7C2QQS2      -VR---------YRGQVA--------------------RAPYGQE-VEVGGLVL--AMRQ
A0A2V7QN41      -FS---------LQNGGRVVQTDSLATTVG-QGLGFSWSPARGLV-APGHAVDF--ALNT
A0A2V7R603      -FT---------LQNGGRVVQTDSVGTPAG-QGLGFSWSPPRGLV-A-GHSVDF--ALST
A0A2V7LJS2      -V----------GTGPAR-------------------RRAAYGTV-VEVGGVRF--AILR
A0A1Q7GLJ7      -VE---------GPAGQQ-------------------RRAAYGRV-VDLGVIRF--AVLH
A0A2V7GRE3      -VR---------GTSG-Q-------------------WSAPYGSA-VESHDIRF--AVLH
A0A2V7EU00      -FTLTAVGGVLMAVGG-VVLQRGTPGEAVG-DAIGFRWTPPAAAL-PAGASIAF--SVVT
A0A1Q6WE01      -FR-------LLGDDG-VELQRGTVGDSIG-QAVGFRWAPAAAVL-PPGSEVTL--IVSS
A0A2V7S9K3      -FR-------LEGRGG-AELQRGAVGDSVG-QALGFRWAPSATLL-APGTELPF--VVTT
A0A1Q7DXB9      -FA-------LFS-AE-GVVQRGERGDSVG-PALGFAWVPGAAVL-TPGRRIEF--TLLT
A0A1Q7JD32      -FA-------LFS-AE-GVVQRGERGDSVG-PALGFAWVPGAAVL-TPGRRIEF--TLLT
A0A2V7MVP8      -FT-------VVAVGG-GVVQRGAVGDSVG-PALGFAWVPGKTVL-NPGRTIDF--TVYT
A0A2V7N0A9      -FR-------LLDVDENAVLEQGAVGSNLG-VGLGFAWLPPAASL-RGGARVEF--TVAT
A0A1Q7DLS9      -FT-------LATHDA-VVLQRGAAGDSVG-GALGFVWLPPAAEL-SPLRRLEF--VVES
A0A1Q7JK96      -FT-------LATHDA-VVLQRGAAGDSVG-GALGFVWLPPAAEL-SPLRRLDF--VVES
A0A2V7KQV7      -FT-------LRDVAENAVLQQGSVGDSVG-GLLGLAWVPPAGTL-RPRAVIRF--TMTA
A0A1Q7JGF6      -FR-------LLDVDAKVVLQEGAVGDSVG-AALGFTWVPPAAVL-RPGASVQF--TVAT
A0A2V7SG67      -FR-------LLDVDAKVVLQEGAVGDSVG-ATLGFTWVPPAAVL-RPGASVQF--TVAT
A0A1Q7GIK9      -FR-------LLDADEKQVLQEATPGEAIG-AALGLVWVPPAGTV-QPGGRVDF--TVTT
                                                                            

A0A2D5ZJF2      FQDVDNIQVF----------LKKELEV-KVG-----------------------------
A0A0S8H9P3      QLAAEAV-------------VTGGLAA-STR-----------------------------
A0A1E4BBP7      PREAAFN-------------LGSQLSV-TVG-----------------------------
A0A3M2G737      KRSVVRR-------------LQSSASF-SPI-----------------------------
A0A0H4TUX7      PEEAAAW-------------VSGGLSY-NVR-----------------------------
A0A1G0LUG0      REEAAAW-------------VSGGLSY-RVR-----------------------------
A0A1Q7E3T7      RPTVERGTISVVSREEAINGLLGGLRV-TLR-----------------------------
A0A1G0L906      RIAAGNM-------------VRGGIGF-AVP-----------------------------
A0A1G0LCC0      RIAAGNM-------------VRGGIGF-AVP-----------------------------
A0A2D5ZJE2      MADWVEA-------------LRSRLSV-SPL-----------------------------
A0A3M2G624      LQRAVNS-------------VRAATHA-QATTRAAIQDNVAGGGIAGAASAKRSRKDAAI
W0RI74          PREASRD-------------VQKRLAI-TIK-----------------------------
A0A3M2BJA6      FDKAVTK-------------LQKALSVSRPN-----------------------------
A0A6M4IRY1      PREASIA-------------LIKKLRL-SLQ-----------------------------
A0A3D4VBZ5      PREASRA-------------LIKKLAL-SLQ-----------------------------
C1A5W1          PREASRA-------------LIKKLAL-SLQ-----------------------------
A0A2V7PX99      PYEATQG-------------LVKALRL-KQD-----------------------------
A0A2V7ERC7      PRNTSLG-------------LLASMRS-TLP-----------------------------
A0A5Q4D6Y4      HPGVDQASFELLSRDQAIELVGRNLTS-QPR-----------------------------
A0A2V7JTZ5      PRNVSVF-------------LVNAVHA-SLP-----------------------------
A0A3D4YTR6      PRNTSAS-------------LVAAVHA-TLP-----------------------------
A0A5Q4DA46      PREVARG-------------LLADLDV---R-----------------------------
A0A2V7F1M1      PPSVKAGALAVRSREEVIDDVLKSLAV-LRR-----------------------------
A0A2V7KXK7      ITDASAS-------------LAKSIKT-RLD-----------------------------
A0A651HKD3      PREAAGG-------------IARSMNI-QTN-----------------------------
A0A2V7QDU7      FDDAVRG-------------LRKALSIKRRN-----------------------------
A0A6J4M9S2      RESAISA-------------LSGSLVP-RPQ-----------------------------
A0A2V7ITT6      PRSAAEQ-------------LARRLRA-KTD-----------------------------
A0A2V7NJW1      PRSAAEQ-------------LARRLRA-KTD-----------------------------
A0A2V7GFB5      AREAALH-------------LSDALDA-HMD-----------------------------
A0A2V7RQ86      AREAALH-------------LSDALDA-HMD-----------------------------
A0A2V7IWX2      PHDAAEL-------------LASQLQV-TTD-----------------------------
A0A1Q7KE95      LRDAARQ-------------LGNALTV-TMD-----------------------------
A0A1Q7T8X5      LRDAARQ-------------LGNALTV-TMD-----------------------------
A0A2V7MS64      PYEAARK-------------LGKHLKT-SLD-----------------------------
A0A2V7Q7N9      PYEAAKL-------------LTKRLKI-TAD-----------------------------
A0A2V7IRW6      PYEAARA-------------LGKRLKT-SLD-----------------------------
A0A1Q7DVU6      PYEAARA-------------LGKRLKT-SLD-----------------------------
A0A1Q7JSV2      PYEAARA-------------LGKRLKT-SLD-----------------------------
A0A2V7FK98      VRDSARA-------------LSDELEV-ATD-----------------------------
A0A2V7R3Z8      VRDSARA-------------LSEELEV-ATD-----------------------------
A0A2V7J3C0      LRDAARK-------------LANSLAV-TLD-----------------------------
A0A2V7KWV9      LRDAAKK-------------LADNLNV-TLD-----------------------------
A0A1Q6ZHP2      LRDAATS-------------LGEGLDA-RMD-----------------------------
A0A1Q7R6Z6      LRDAATS-------------LGEGLDA-RMD-----------------------------
A0A2V7FYT7      LRDAATS-------------LGEGLDA-RMD-----------------------------
A0A2V7IGR0      VRDGARH-------------LDEALDV-RAA-----------------------------
A0A2V7MR23      LRDAATS-------------LADALDT-WMD-----------------------------
A0A2V7L1V3      FRDAARS-------------LADSMSA-QLD-----------------------------
A0A1Q7E5D3      VRDASRH-------------LAERLDV-HMD-----------------------------
A0A2V7ISE2      LRDAATG-------------LGEALDV-RMD-----------------------------
A0A1Q7J2X5      LRDAATG-------------LGEALDT-RMD-----------------------------
A0A2V7NPD1      LRDAATG-------------LGEALDV-RMD-----------------------------
A0A2V7QPD8      VRDSARA-------------LSEGLEV-NND-----------------------------
A0A2V7Q8M6      LRDAARS-------------LADSLSA-QLD-----------------------------
A0A2V7QBC3      LRDAARS-------------LADSLSA-QLD-----------------------------
A0A2V7LMU1      LRDAARS-------------LADSLSA-QLD-----------------------------
A0A2V7PBY9      LRDAARS-------------LADSLRT-ELD-----------------------------
A0A3M2BLV5      APEEFRTYLLEVVPSVAQVASEVRLVG-TAR-----------------------------
A0A2V7KS68      PRDAATG-------------LGNALDV-HMD-----------------------------
A0A2V7N4L3      PRDAALR-------------LGEQLDV-RMD-----------------------------
A0A1Q7AZK2      PRDAALR-------------LGEQLDV-RMD-----------------------------
A0A1Q7TNP7      PRDAALR-------------LGEQLDV-RMD-----------------------------
A0A1Q7KG39      PRDAALR-------------LGEQLDV-RMD-----------------------------
A0A1Q7GX75      PRDAALT-------------LGEQLSV-RME-----------------------------
A0A1Q7LL80      PRDAALT-------------LGEQLSV-RME-----------------------------
A0A2V7PFU2      PRDAATR-------------LGEELQV-QMD-----------------------------
A0A2V7MFS9      PRDAALR-------------LGEQLDV-RMD-----------------------------
A0A2V7T933      PRDAALR-------------LGEQLDV-RMD-----------------------------
A0A2V7J4D7      PYEAALG-------------LARNLKV-AAD-----------------------------
A0A2V7LN90      PYEAAKL-------------LAKRLKT-SAD-----------------------------
A0A2V7LFN9      PAEAATR-------------LRRELKV-SSD-----------------------------
A0A2V7MEK4      PAEAATR-------------LRRELKV-SSD-----------------------------
A0A2V7P8B1      RPDAARGLLRVVSRDAAISQLLTELRV-RPR-----------------------------
A0A7C2QQS2      RPDVEATPVAIEPRHRVIEALQKAITV-RNR-----------------------------
A0A2V7QN41      PADAARQLKTTLSVTTDVDPAL----M-RAG-----------------------------
A0A2V7R603      PADAARQLMKTLNVSTDVDPAL----M-RAG-----------------------------
A0A2V7LJS2      RPEVRQGVLRVLSRDAAISALLTELRV-RPR-----------------------------
A0A1Q7GLJ7      RPSAKQGFLQVLDQESAISYLIAKVRV-RPR-----------------------------
A0A2V7GRE3      RPDAATARLRVLSREAAISGLLARLRV-KPR-----------------------------
A0A2V7EU00      PRDAAQR-------------LSARLGV-RLD-----------------------------
A0A1Q6WE01      VRDAAKR-------------LGDELNV-TID-----------------------------
A0A2V7S9K3      LRDAAKH-------------LGEALTV-AID-----------------------------
A0A1Q7DXB9      PHDAAEL-------------LASQLQV-TTD-----------------------------
A0A1Q7JD32      PHDAAEL-------------LASQLQV-TTD-----------------------------
A0A2V7MVP8      PHDAAEL-------------LAGELQV-TTD-----------------------------
A0A2V7N0A9      TSEAAQK-------------LAEELRV-RAA-----------------------------
A0A1Q7DLS9      PHEAASR-------------LAERLRV-KTD-----------------------------
A0A1Q7JK96      PHEAASR-------------LAERLRV-KTD-----------------------------
A0A2V7KQV7      LSDVALE-------------LSQSLRI-RAT-----------------------------
A0A1Q7JGF6      TSEAAQK-------------LSEELRV-RAG-----------------------------
A0A2V7SG67      TSEAAQK-------------LSEELRV-RAG-----------------------------
A0A1Q7GIK9      TSEAALQ-------------LAEELRI-RAA-----------------------------
                                                                            

A0A2D5ZJF2      KKDDIISVSFDSPWPDEAELIVYEVVESYRRYQSTTKQTTAGGVLKILEKARKKADGKWN
A0A0S8H9P3      PETNLIDVTYSGPDQRLVPRTLNAVAAALRDLGVRRVRQWARGRTRFIRDQLDESGRQLR
A0A1E4BBP7      QNSNLMRFQLSGSKAGLLATTLNTLAREFVSEAVRLKRENLTVSAEATEEQLQQAAQQLA
A0A3M2G737      PQSDIIQISVKSTHPEEAKLIANLFAETYYQWNVERSRTELIGTRKFLEKQLEQKRERLY
A0A0H4TUX7      EGTNAVDISFAGTDPTLVPQILNAAAVALRLDGVRRAQEIAARKRTYVAEQLAKADSSYR
A0A1G0LUG0      EATNAVDITFTSTDPLLVPRILNAAGLALQSDGVRRAREVAARRRAYIAEQLAGADAAYK
A0A1Q7E3T7      PHTDIFDVAYVASDPQHAQQVVNRVVEVFRAVNAEEAQRQSRLRREFLETQLRVNDSVLA
A0A1G0L906      PTTSLVNVTFTGTDPSLVPEILNEALIALQNYGVDRVRDVASLRLRYINERVDDARTRYL
A0A1G0LCC0      PTTSLVNVTFTGTDPSLVPEILNEALIALQNYGVDRVRDVASLRLRYINERVDDARTRYL
A0A2D5ZJE2      KDADVITIKMTAGDPDEAAYFANLFAEEYRNQNISQNRGELSGVRQFLEEQLHQVETRLA
A0A3M2G624      QDAGIVQVDVYWQDPETATQIANALADVIRHRELEDKRLEHTKTREYIERQLNTYTQKLK
W0RI74          QASPVIGLTLTGTAQQKPAATMNAMLTQFVDVATELKKREMVASTTTLNTQLDEASKGLQ
A0A3M2BJA6      RDAGIVTVRYESSDTLLVHEVPNRLAASFISRRQRIQKTEASSTVRFLEDQIDTLARQLA
A0A6M4IRY1      DGSSFLFLNLTGENAQRTAATLNAWVEQFVVVATALKKKNITSVAAILEGQTQYAAENLS
A0A3D4VBZ5      DGSSFLFLRMNGPDAQRSAATLNAWVEQFVTVATQYKKQNVVQVAGILEGQREYAAQELA
C1A5W1          DGSSFLFLRMNGPDAQRSAATLNAWVEQFVTVATQYKKQNVVQVAGILEGQREYAAQELA
A0A2V7PX99      PGGSFLRIELKGTDPALTAATVNAVAGRTVTLAAELKRRKYAELAKILGEQAQQAQQALH
A0A2V7ERC7      EDGQFLTISLTGTNPQRSARTVNVWAEQFVGAAIELKKRHLLEFKKMLGDQLNVAEHELN
A0A5Q4D6Y4      PETNVVDVSYTATDPDVAQRLANRAVQVFQARTASEARAESQRRRQFLEEQLAVADTTLR
A0A2V7JTZ5      EDGQFLKITLSGADPRRTARTVNAWAEQLVNSSGDLKTRHLFEFKKILGDQLALAEAQLR
A0A3D4YTR6      EDGQFLKITLTGSDPRRTARTVNAWAAQLVSSSGDLKKSHLLEFKRILGDQLALAEGQLR
A0A5Q4DA46      IQGTFMTVGMSGTDPVRTTRVLNGILDRFAIVAEDLKRAKFEELQAILEEQLDYAAQNLQ
A0A2V7F1M1      KSTDIVDVTYSDPDPLLAQRVANLLVRVFQARDAGSAQEQARSRAEFLAAQLSATDSELS
A0A2V7KXK7      PDGNFLRLQLKSTSAAGAAATLNAISARIVAVESEMKRRKFEELAGVMDEQHQHAKEALD
A0A651HKD3      QFIEYISVSLSGGDPVHAARLLNTVLESFLREATELSRATSDQLSSTLEQQLVTARQTLQ
A0A2V7QDU7      REANIVDVGYRGTDPQLVQAVPNLLATRFIIDRQKTQQTETRSTGAFLRDQTAKLARQLR
A0A6J4M9S2      EKTDAVRVEYTSTDPHLAQRIVNASVEVFQEANARAAQQASRRRRIFLQKQLETTDSMLA
A0A2V7ITT6      EAGNFLSVQLTGNDARHVTAVLNAVVQRYVAVAADLKRDKLTELSKILQQQLQYAEHNLR
A0A2V7NJW1      EAGNFLSVQLTGNDARHVTVVLNAVVQRYVAVAADLKRDKLTELSKILQQQLQYAEHNLR
A0A2V7GFB5      YNGNFLKIELRGGDPARITRILNAVAERYVEVAAELKRGRLTELTSIIGDQVRTAKQSLD
A0A2V7RQ86      YNGNFLKIELRGGDPARITRILNAVAERYVEVAAELKRGRLTELTSIIGDQVRTAKQSLD
A0A2V7IWX2      PEGTFVTVQLTGTDPQLTAAIVKGVADRTVAVAADLRRHKVAALADILGEQVRHAQASLT
A0A1Q7KE95      QGGNFLRVGLTGADPAHTAATVNAVAQRSVAVGAELKRAKLNQLGKLLDEQRQSARENLQ
A0A1Q7T8X5      QGGNFLRVGLTGADPAHTAATVNAVAQRSVAVGAELKRAKLNQLGKLLDEQRQSARENLQ
A0A2V7MS64      LDGNFLRLELAGDDPVQITDIVNTVGQRFVAAAADLKRQNLTELSRILGDQLDKARTELT
A0A2V7Q7N9      ADGNFLRLELGGSDPGEVTAVVNMVAERFVSVAADLKKQNLQQLTGILGGQLERARDKLQ
A0A2V7IRW6      LDGNFLRLELGGPDAAGITAVVNAVAERFVAAAAELKRQNLTELTRILSGQLERAQANLR
A0A1Q7DVU6      LDGNFLRLELGGPDAAGITAVVNAVAERFVAAAADLKRQNLTELTRILNGQLERAQANLR
A0A1Q7JSV2      LDGNFLRLELGGPDAAGITAVVNAVAERFVAAAADLKRQNLTELTRILNGQLERAQANLR
A0A2V7FK98      PAGNFLRMHLKGADAARITSTINGIAERFVQVAADLRRQKLTELTKILDQQLAAAHQNLL
A0A2V7R3Z8      PAGNFLRMHLKGADAVRITSTINAIAERFVLVAADLRRQKLTELTKILDQQLAAAHQNLL
A0A2V7J3C0      PGGNFLRIGLTAEDATRGAATANAIAQRFVEVGADLKRAKLHQLGTLLDEQLRAARDNLR
A0A2V7KWV9      LSGNFLRVALTSPNGTDAAATVNAVADRYVAVATDLKRVKVTELSRLLNEQLQAAEANLH
A0A1Q6ZHP2      QEGSFLRLELRGANPVDITAIVNAVAQRYVTVYADLKRQKLIELTKILGEQLQHAQENLH
A0A1Q7R6Z6      QEGSFLRLELRGANPVDITAIVNAVAQRYVTVYADLKRQKLIELTKILGEQLQHAQENLH
A0A2V7FYT7      QEGSFLRLELRGANPVDITAIVNAVAQRYVTVYADLKRQKLIELTKILGEQLQHAQENLH
A0A2V7IGR0      PDGSFLHIELRGAQPARITAIVNAIAQRYVEVAAELKREKVTELTKILDQQVESARQRLR
A0A2V7MR23      IDGNFLRIEMRGPDPVRITTLVNAVAQRYVTVYADLKRQKLIELTKILGEQLQHSQDNLR
A0A2V7L1V3      PQGNFLRLELRGPDAPRITAVVNAVADRYVLVAADLKRKKLTELTKILGEQLQSAEDKLR
A0A1Q7E5D3      MNGNFLRVELTGAYPARITAIVNAVVERYVQVAADLKRQKVTELTKILNDQVESARRNLQ
A0A2V7ISE2      MDGNFLRFELRGPYPTRITAIVNAVAQRYVQVYADLKRQKVIELTKILGEQVQHSQENLR
A0A1Q7J2X5      MDGNFLRVELRGVYPTRITAIVNAVAQRYVQVYADLKRQKVMELTKILGEQVQHSQENLR
A0A2V7NPD1      MDGNFLRFELRGPYPTRITAIVNAVAQRYVQVYADLKRQKVIELTKILGEQVQHSQENLR
A0A2V7QPD8      PAGTFLRMHLKGADAVRITSTINAIAERFVQVAAELRRQKLTELTKILDQQLAAAHQNLQ
A0A2V7Q8M6      EKGNFLRLELRGPDAPRITAVVNAVAERYVQVASDLKRKKLTELTKILAEQLRSAQGNLR
A0A2V7QBC3      EKGNFLRLELRGPDAPRITAVVNAVAERYVQVASDLKRKKLTELTKILAEQLQSAQGNLR
A0A2V7LMU1      AEGNFLRLELRGPDAPRITAVVNAVAERYVQVASDLKRKKLSELTKILAEQFQSAQGNLR
A0A2V7PBY9      LEGNFLRIEMRGPDAAQITAIVNAVAERYVQVAADLKRTKLSELTKILADQLQRAQGTLR
A0A3M2BLV5      EQTNIIDIYLTHEDPELAPKMLGAAARALSEFGARQVRERAESDLEFAEAQLDSARNNLQ
A0A2V7KS68      INGNFLAVELSGQNPVLIANILNAVTQRYVDVAAQLKREKLTELTKLLENQLNTARSNLD
A0A2V7N4L3      LNGNFLALELRGANPVLISNILNAVSQRYVAVAAQLKREKLTELTKLLEDQLTTAQRNLD
A0A1Q7AZK2      MNGNFLALELRGPNPVLITSILNAVAQRYVEVAAQLNREKLTQLTKILEDQLTTAKRNLD
A0A1Q7TNP7      MNGNFLALELRGPNPVLITSILNAVAQRYVEVAAQLNREKLTQLTKILEDQLTTAKRNLD
A0A1Q7KG39      MNGNFLALELRGPNPVLITTILNAVAQRYVEVAAQLNREKLTQLTKILEDQLTTAKRNLD
A0A1Q7GX75      MNSNFLALELRGSNPVLIANILNAVSQRYVEVAAQLKREKLTELTKILEDQLRTAQGNLD
A0A1Q7LL80      MNSNFLALELRGSNPVLIANILNAVSQRYVEVAAQLKREKLTELTKILEDQLRTAQGNLD
A0A2V7PFU2      MNGNFLALELRGTNPMLISKILNAVTQRYVEVAAQLKREKLTELTKILEDQLTTAKRNLD
A0A2V7MFS9      LNGNFLALQLQGTNPVLISSILNAVSQRYVAVAAQLKREKLSELTKILEDQLTTAQRNLD
A0A2V7T933      MNGNFLALELRGPNPVLITTILNAVAQRYVEVAAQLNREKLTQLTKILEDQLTTAKRNLD
A0A2V7J4D7      LDGNFLRMELGGHDPAQIAATVNAVAERFVAVAAGLKRDNLTELTRILGDQLAQAQANLR
A0A2V7LN90      ADGNFLRLELGGSDPAEVTAIVNLVAERFVAIAADLKKENLQQLTGILSGQLERARDKLQ
A0A2V7LFN9      MDGNFLRLELTGPDAAGVTGTVNAVASRFVAAAADLKRDNLTQLTGILGAQLEQAQARLR
A0A2V7MEK4      MDGNFLRLELTGPDAAGVTGTVNAVASRFVAAAADLKRDNLTQLTGILGAQLEQAQARLR
A0A2V7P8B1      VRTDIVDVAYAAPDPSRAQQVVNRVVDVFRAASAEAAQGQSRLRREFLEAQLKVNDSVVA
A0A7C2QQS2      RNTDVIDVSFRDHDPVHAQQVVNTLIDVFQEYDARQAQEKSRRRRLFIEEQMRNTERDLA
A0A2V7QN41      TDANFLRIQLTGSRPAELAATVNAIADRVVVVAADLKRIKLVELGRILDEQRQHALRGLR
A0A2V7R603      TDANFLRIQITGSRPAELAATVNAIADRVVVVAADLKRIKLVELGRILDEQRQHALGSLR
A0A2V7LJS2      MRTDIVDVAYSAPDPARAQEVVNRVVDVFRAASAEAAQGQSRLRREFLEAQLRVNDSLVA
A0A1Q7GLJ7      LRTDIVDVAYSAPDPARAQEVVNRVVDVFRAASADAAQRQSKLRREFLEAQLKVNDSLLA
A0A2V7GRE3      LNTDIVDVTYSAPDPYVAQHVLNRVVDLFKSASAEDAQQQSTRRREFLESQLKVNDSLLA
A0A2V7EU00      ENGNFMRLELDGTDPKSIAATLNAIAQRLVAVAAELKRAKLTELTRILNEQLTTAARNLR
A0A1Q6WE01      PNGNFLRLSLSGTDGPTVAATLNAVAQRYVDAALKLKRAKLSELAALLAEQLQSARASLQ
A0A2V7S9K3      PSGNFLGISLTDANGTAAAKTVNYVAQRYVLAASGLKRSKLTELARLLDEQLQSARGNLQ
A0A1Q7DXB9      REGTFVTVQLTGTDPQLTAAIVKGVADRTVAVAADLRRHKVAALADILGQQVQHAQASLT
A0A1Q7JD32      REGTFVTVQLTGTDPQLTAAIVKGVADRTVAVAADLRRHKVAALADILGQQVQHAQASLT
A0A2V7MVP8      PGGSFVTVQLTGTDPHLTTAILRGVANRTVAVANELRRHKVAALADMLGQQVQHAQTSLT
A0A2V7N0A9      QDGNFIRIERRGPDRRVVTGTVNAVAERFVAAAAELKRQRLTQLTAILKDQLDHAQDNLR
A0A1Q7DLS9      LEGNFLRVELRGQDPRKITVIVNAVAQRFVAVAADLKRQQLTELVRILGEQLNHSQVNLS
A0A1Q7JK96      LEGNFLRVELRGQDPRKITVIVNAVAQRFVAVAADLKRQQLTELVRILGEQLNHSQVNLS
A0A2V7KQV7      ADGYFVRLERRGHDPVLITTTVNAVADRLVAVAADLKRERRTELSSILHEQRDRAKANLS
A0A1Q7JGF6      TDGNFVRIERRGPDAAVVTRTVNAVAERFVAAAADLKRQRLTELTAILKDQLDRAETNLR
A0A2V7SG67      TDGNFVRIERRGPDAAVVTRTVNAVAERFVAAAADLKRQRLTELTAILKDQLDRAETNLR
A0A1Q7GIK9      PEGNFVRIARRGPDPDQATGIANAVAERFVAAAADLKRQRLTELTAILQDQLNHAQANLR
                     . .                                                    

A0A2D5ZJF2      ESYEKLILSQKK----------------------------HPVLSLKDDRGSFLVRGLST
A0A0S8H9P3      EALQAVQDYKGR-----------------------------RGLISLTVEESRVMQRVAT
A0A1E4BBP7      AAQTALERFKIN-----TITLPSEQMAITPGV---------------STTMNPVFQAYFS
A0A3M2G737      QAEDSLRKYMEA-----------------------------SNVMTDDAGATATIEKIAQ
A0A0H4TUX7      IKLAELQRFKEG-----------------------------EQITDLSVEEQSVVQSIQA
A0A1G0LUG0      GKLTELQRYKEG-----------------------------QQITDLSAEELSIVQSIQT
A0A1Q7E3T7      DARRALTAFRRH-----------------------------AGRAGSDQQGPTQQAGIDQ
A0A1G0L906      SALSGVQSYKES-----------------------------ENTTNFTAEEVAIINSIHG
A0A1G0LCC0      SALSGVQSYKES-----------------------------ENTTNFTAEEVAIINSIHG
A0A2D5ZJE2      ISEEELRSFKTK-----------------------------SGLVSLSDEVEWLVRQLAE
A0A3M2G624      ASEEALQTYKEQNRIYEL-----------------------------DAIARDVTYKVFD
W0RI74          AAEQAFEDYRVK-----TIAEPSETPTVISSDPKSQN----------MAVGQPIFNAFFT
A0A3M2BJA6      AAEERLVAFREE-----------------------------GQVVSIEAEANAQVTELAR
A0A6M4IRY1      NAENALESFRVR-----TVTEPNERQSITPGI---------------EMTNSPVFENYFR
A0A3D4VBZ5      SAEAALEGFRVR-----TVTEPSERQTIQPGI---------------EMTNSPVFENYFR
C1A5W1          SAEAALEGFRVR-----TVTEPSERQTIQPGI---------------EMTNSPVFENYFR
A0A2V7PX99      ASDAALASFRVR-----TAGVVQRGAPTVSPTM--------------DGKGDPVYSRAFE
A0A2V7ERC7      TSELLLEQFRAS-----TITLPSGGSPLASSG---------------QTAGDPAFTTYFQ
A0A5Q4D6Y4      EAQGYLTAFRSDEQVVST-----------------------------QAQGTEEQLGLIN
A0A2V7JTZ5      TSENELEHFRVS-----TITLPSGVAASAGPG---------------VTQGDPVVASYFQ
A0A3D4YTR6      SSEDELERFRVN-----TITLPHG-ATPIGPG---------------AGQVDPVVGNYFQ
A0A5Q4DA46      QAEYALEGFKVR-----TISLPSEQGMPVAGGT--------------QQTTNPVFQNFFN
A0A2V7F1M1      IAQAELSAFRRQRMLGSS-----------------------------RDKLAVEQARLTA
A0A2V7KXK7      QADEALRNFRVRTADRPLVTQAPGGGLTVEGSG-----------------------VVTQ
A0A651HKD3      EAEGELEAFHRA-----NVLSPAQQGA--------------------VDGSSPAMDAYID
A0A2V7QDU7      ASEDSLERFRVV-----------------------------EHIVSLPQQASSGVTQFAE
A0A6J4M9S2      QAQLSLSNFRSRERVFSS-----------------------------REKFASRQEGLMT
A0A2V7ITT6      SAEEVFEDFRVQ-----TITLPADRVTPVAPGV--------------ELTRDPGVAAFFN
A0A2V7NJW1      SAEEVFEDFRVQ-----TITLPADRVTPVAPGV--------------ELTRDPGVAAFFN
A0A2V7GFB5      SAEGDLQTFRRR-----TITLPPDAVAAGG-----------------DTPRDPVLGDFFE
A0A2V7RQ86      SAEGDLQSFRRR-----TITLPPDAVAAGG-----------------DTPRDPVLGDFFE
A0A2V7IWX2      AAELALKSFRVR-----AAGVLPAGVA--------------------APPPSPAFTNAFE
A0A1Q7KE95      RAESALEQLQVT-----VGPDLGAAPVPP--------------------GGGPPLGTLLG
A0A1Q7T8X5      RAESALEQLQVT-----VGPDLGAAPVPP--------------------GGGPPLGTLLG
A0A2V7MS64      SAEQSLKQFRMS-----AVTEYTEGTASIAPNM--------------QFPHDPVFAGLFD
A0A2V7Q7N9      SAEAELKRFRVG-----AVTQYADGSAPVTPNM--------------EFPRDPVFAGLVG
A0A2V7IRW6      DAETALKTFRVS-----AVTEYADGAAPVTPNM--------------QFPRDPVFAGLLD
A0A1Q7DVU6      DAETTLKTFRVS-----AVTEYADGAAPVTPNM--------------QFPRDPVFAGLLD
A0A1Q7JSV2      DAETTLKTFRVS-----AVTEYADGAAPVTPNM--------------QFPRDPVFAGLLD
A0A2V7FK98      DAEQALERFQVK-----TITLPS-------TAAGGARAAGGVPTASGASADDPAFASFFR
A0A2V7R3Z8      DAEKALERFQVK-----TITLPS-------TAVGGSRGA-GVPSA-GASADDPAFASFFR
A0A2V7J3C0      RTESALEQFQVG-----TATFTPTVGTAAA-----------------SAGRDAAFGSLFA
A0A2V7KWV9      KAERALEDFRVR-----TIMLPAEPVAG-------------------SAARTSPVSEFLT
A0A1Q6ZHP2      GAEASLQRFREE-----TITLPGDRPSVGGASVAGAAVGGPGATGA-VAARDPVFGSFFD
A0A1Q7R6Z6      GAEASLQRFREE-----TITLPGDRPSVGGASVAGAAVGGPGATGA-VAARDPVFGSFFD
A0A2V7FYT7      GAEASLQRFREE-----TITLPGDRPSVGGASVAGAAVGGPGATGA-VAARDPVFGSFFD
A0A2V7IGR0      DAEAGLRSFGVR-----TITLPSGRAAA-------------GVTGT-GADRDPALTSFFD
A0A2V7MR23      SAEAALQRFREE-----TITLPGERPVTGGASVAGPVVAGAAPGTGPAGARDPLFGSFFE
A0A2V7L1V3      GAEAALERFRER-----TITLPADRPAPVALGAPGGA--GGGSQGQ-VGEADPKFGTFFT
A0A1Q7E5D3      DAEVALEAFRVR-----TITLPSDRPAPSRAGVAGAT----GAAAG-DVAGDPVFTHFFD
A0A2V7ISE2      NAEAALQRFREE-----TITLPSDRPAAG-ASVAGAG--VGGAGAA-GGARDPVFGGFFE
A0A1Q7J2X5      NAEAALQRFREE-----TITLPSDRAAAG-ASVAGAGGVGAGAGAA-GGTRDPVFGGFFD
A0A2V7NPD1      NAEAALQRFREE-----TITLPSDRPAAG-ASVAGAG--VGGAGAA-GGTRDPVFGGFFE
A0A2V7QPD8      DAEKALERFQVS-----VITRPSQVPKAGP-------------------GDDPAFKNFFT
A0A2V7Q8M6      SAEAGFERFRER-----TITLPGDRTPPGALGMAGGA--GGGQGA----ESDPKFGTFFG
A0A2V7QBC3      SAEAAFEGFRER-----TITLPGDRTPPVSLGVPSAA--GGGQGA----ESDPKFGTFFG
A0A2V7LMU1      SAEAALERFRER-----TITLPSDRPPPVALGAPGGA--GGGAQGA---ELDPKFGTFFN
A0A2V7PBY9      SSEAALERFRVR-----TITLPTDRPPPVALGAPGGA--GGGGGSA-NGEASAQFGTFFN
A0A3M2BLV5      RSFQKIREFKET---------------EAFTNL--------------TAEEQQLVQRRQD
A0A2V7KS68      DAESALQHFRTR------TITLPSEQA--GPSA--------------TETRDPIRSNYFD
A0A2V7N4L3      EAETALQRFRTR------TITLPSERSPSAAVS--------------GDTHDP-RAGFFD
A0A1Q7AZK2      SAETALQGFRTR------TITLPSDQAADRKAA--------------ADTRDPIRTSFFD
A0A1Q7TNP7      SAETALQGFRTR------TITLPSDQAADRKAA--------------ADTRDPIRTSFFD
A0A1Q7KG39      SAETALQGFRTR------TITLPSDQAADRKAA--------------ADTRDPIRTSFFD
A0A1Q7GX75      DAETALERFRTR------TITLPSDQT----TG--------------VESRDPRRANFFE
A0A1Q7LL80      DAETALERFRTR------TITLPSDQT----TG--------------VESRDPRRANFFE
A0A2V7PFU2      EAEDAQRRFRTR------TITLPSDQQR-PGAA--------------AETRDPIRASFFD
A0A2V7MFS9      DAEAAQQRFRTR------TITLPSDQQAGQAAA--------------AGTRDPIRASFFD
A0A2V7T933      SAETALQGFRTR------TITLPSDQAADRKAA--------------ADTRDPIRTSFFD
A0A2V7J4D7      QAEASLKSFRVG-----AVTTVAAGAGSVTESS--------------QYPRDPMFAGLVD
A0A2V7LN90      SAEAGLKRFRVG-----AVTQYADGAAPVTPNM--------------EFPRDPAFAGLLG
A0A2V7LFN9      SAETALQRFRVT-----AVTEYAEGAAPVTPNM--------------QYPQDPVFAGLLD
A0A2V7MEK4      SAETALQRFRVT-----AVTEYAEGAAPVTPNM--------------RYPQDPVFAGLLD
A0A2V7P8B1      DAQAALTALQRRARSDGWGQSSGREQTEVPGLE--------------LQRQQLLAERRTD
A0A7C2QQS2      LAQSQLSAFRRQRQVFSSQQQFAAQQQMLLELE--------------ARRDSLAAARAAF
A0A2V7QN41      DAEAAQRDFRIR-----SAGVLRQGAPPVSATL--------------RGGGDPVFERSFD
A0A2V7R603      AAEAAQRDFRIH-----SAGVLRQGAPPVSASL--------------RGGGDPVFERSFD
A0A2V7LJS2      DAQDALTAFQRRARSDGSGQTSGREQTELPGLE--------------LQRQQLLAERRTD
A0A1Q7GLJ7      DARQALTEFQRRARPYGSGGSSAREQSELPGLE--------------LERQQLMAERRTD
A0A2V7GRE3      DARQAVTAFRQRAGTYGSRDALAREQAGLAGVE--------------LQRQQLEAERRTD
A0A2V7EU00      DAEGSLESFRVK-----TITLPSEQSTPVSPGL--------------EATRDPVFRNFFE
A0A1Q6WE01      RAESAYEAFRTR-----TITLPPDPGAAAAAA----------------AGVQSPMSEFFG
A0A2V7S9K3      RAEAALEQFRTR-----TITLPPDPGATGTAA----------------PPKGSPLGDFFD
A0A1Q7DXB9      VAELALKNFRVR-----AAGVLPAGVAAPPP--------------------SPAFTNAFE
A0A1Q7JD32      VAELALKNFRVR-----AAGVLPAGVAAPPP--------------------SPAFTNAFE
A0A2V7MVP8      AAELALKDFRIR-----TAGVLPAGVVTPPP--------------------SPAFTNAFE
A0A2V7N0A9      AAEAALMAFRVR-----NAVRPSEGPAQGPDGR--------------RITADPTYAGYMD
A0A1Q7DLS9      AAESALRDLLSK-----TVSFVADGATPVAPGL--------------QFTHDPGFASYFE
A0A1Q7JK96      AAESALRDLLSK-----TVSFVADGATPVAPGL--------------QFTHDPGFASYFE
A0A2V7KQV7      SAELALTQFRVR-----NAVRPSEGPAEGPDGR--------------RITADPTFASYVD
A0A1Q7JGF6      AAERGLTAFRVR-----NAVRPSEGPAQGPDGR--------------RITADPTFASYVD
A0A2V7SG67      AAERGLTAFRVR-----NAVRPSEGPAQGPDGR--------------RITADPTFASYVD
A0A1Q7GIK9      TAEAALTVFRVH-----NAVRPSEGPAQGPDGR--------------RITADPTFASYVD
                                                                            

A0A2D5ZJF2      LHEELAAAQSAAIVAKATYEA----AEQMQGDPERLRQLVESQFGRVGTTPFNQEKVQLH
A0A0S8H9P3      LQTEIEQLLIE----KSLYTSLV--DRI--GSV-GLRPGDVQQFVVLSTEEVNRTVQFYY
A0A1E4BBP7      DRVNYEQVRRD----REALERIV--EEGRGRGG-KISLEALRSVGSATA--SNTSLQAEI
A0A3M2G737      LEATRSALEID----IQAFAEKIKSYEDKLGSK-----SNVNVIAEQNDPYITQ-LQEQI
A0A0H4TUX7      LEQQRQQITVQIATLREALG----------QPGDSIGVGTLNRLAAVQDIGQNTALGFQI
A0A1G0LUG0      LEQERQLLAVQLSTLRGSLG----------DSATQIDVGTLNRLSAVQGIAQNNALGFQI
A0A1Q7E3T7      LQLQRDQLDAD----RRMYRSILVSLDSGGGRGNREALRTAASTPAISANAVVAPLFTQL
A0A1G0L906      FDREKERLQVD----LSTLQGIM-------GPEAQVTLETLNRLAALTGIANNTAMTFQI
A0A1G0LCC0      FDREKERLQVD----LSTLQGIM-------GPEAQVTLETLNRLAALTGIANNTAMTFQI
A0A2D5ZJE2      FESAENAAITD----QKSLERRLEHLEG------ELERARAGLVEDLDDAAASP-LVIQL
A0A3M2G624      IEAEISQIQAE----RERIKLFREKVTS------GLQPEDYLLISAIPF--QDE-EGYGY
W0RI74          RKTEVDQLKRD----RESLERLL--GQIKAPGS-TLAPEILLTVPTLANDPGAAGVKQTV
A0A3M2BJA6      LQADRNAIDAE----RSALQELMDEIDREATTADPAGPSPYRRLLSFPTLLKNQSTSELL
A0A6M4IRY1      DQILADSYKRD----RQALEGIL--AKGRQAGG-VITREAVLSIPSVNTDPAAENLRRVL
A0A3D4VBZ5      DKILADNYRRD----REALERIL--QSGR-SGT-AITREAVLSVPAVNADPAAENLRRAL
C1A5W1          DKILADNYRRD----REALERIL--QSGR-SGT-AITREAVLSVPAVNADPAAENLRRAL
A0A2V7PX99      LRLNIEQLRRE----RRVIEKAL--ADQ--PKS-GLPVEALAVLPTVGT--SPE-LNTAL
A0A2V7ERC7      QKATLDEVRND----RMAIERIL--SDA--RGG-PINPQAFLVLPSILNN-TPQ-LRTAI
A0A5Q4D6Y4      IEMRREELLAD----RSMYQSIL--GELGSADP-GEMGERIQAIVATPEVAANP-VVSSL
A0A2V7JTZ5      QKVALDEIRSE----RQALERMV--SEA--KGGPINPQDFLQLPTILNN--APQ-LRSAI
A0A3D4YTR6      QKAALDEVRSE----REALERMI--ADA--KGGPIDTQGFLQLPTILNN--APQ-LRSAI
A0A5Q4DA46      LRVEQDEARRD----QSALNRAM--ARS--QQEGRLATEALEVIPSVRE--STD-LVRAL
A0A2V7F1M1      LDARLGELEAE----RSVYESFL--TKFNTSND-SLRLDVARDLSYTPELAADP-VVSRI
A0A2V7KXK7      LRTDMDQQRRD----RQQILSLA--TRA--QSS-SVPVQLWNSIPSVQN--DPV-MKGAL
A0A651HKD3      LQLGAEELERD----RGALLRAL--EAG--GGA-GIRIQALEAIPAVQS--SSE-LMGAL
A0A2V7QDU7      LQAQRNALDAE----RRALEQLL--SSTASSVAGSTQSTPIAFPTLLRNEVAAS-LLSAL
A0A6J4M9S2      LQVRREELAADRQLFQSMAAGLT--GSPAARDRALMSVASYPGIAANPA--ISQ-LYTQL
A0A2V7ITT6      MKVEREQLRRD----REAIELAL--AQA--ADS-AASWDALSVIGSVQQ--SPG-LMQAL
A0A2V7NJW1      MKVEREQLRRD----REAIELAL--AQA--ADS-AASWDALSVIGSVQQ--SPG-LMQAL
A0A2V7GFB5      QQVQRQQVARD----RAALTRVL--AQP--ADS-GLA-SALEVIDAVQH--SPE-LKGAL
A0A2V7RQ86      QQVQRQQVARD----RAALTRVL--AQP--ADS-GLA-SALEVIDAVQH--SPE-LKGAL
A0A2V7IWX2      LRVAVDQLGRD----RQAIDRVL--AQQ--PDS-GLSVDALAAIDAVQK--SPE-LTQAL
A0A1Q7KE95      PKLEQEQLRRD----RDAIEQVL--VQM--RDS-GGSPDGLAFIGAVQR--SPD-VSQAL
A0A1Q7T8X5      PKLEQEQLRRD----RDAIEQVL--VQM--RDS-GGSPDGLAFIGAVQR--SPD-VSQAL
A0A2V7MS64      MKVNREELRRD----RAAIDRIL--AQG--SDA-DLAVDALTMIGSVQK--STE-LAQAL
A0A2V7Q7N9      MKVNREELRRD----REAIGRIL--ARG--PDS-ALAVDALATIGSVQK--STE-LSQAL
A0A2V7IRW6      MKVNREQLRRD----REAIARIL--AQG--RDS-GLAVDALAMIGSVEK--STE-LSQAL
A0A1Q7DVU6      MKVSREQLRRD----REAIARIL--AQG--RDS-GLAVDALAMIGSVEK--STA-LIQAL
A0A1Q7JSV2      MKVSREQLRRD----REAIARIL--AQG--RDS-GLAVDALAMIGSVEK--STA-LIQAL
A0A2V7FK98      MQVDRQQVQQD----RDALERVL--KQA--GDS-GVSPEALAIVGSVQQ--NVQ-LKQAL
A0A2V7R3Z8      MQVDRQQVQQD----RDALERVLAQAQA--SDS-GVSPEALAIVGSVQQ--NVQ-LKQAL
A0A2V7J3C0      PRLEEEQLRRD----RSAIQQVL--ARM--RDS-GGSPEGLAFIGAVQR--TAD-VSQAL
A0A2V7KWV9      RRVQEDQLRRD----QDALAQVL--AQG--PDSLGFS-ERLAAIGAVQG--SAD-LTRAL
A0A1Q6ZHP2      MQISREQARRD----RDALDRLL--AQA--GDS-GLSAEALSVVGLVQA--NPE-LTQAL
A0A1Q7R6Z6      MQISREQARRD----RDALDRLL--AQA--GDS-GLSAEALSVVGLVQA--NPE-LTQAL
A0A2V7FYT7      MQISREQARRD----RDALDRLL--AQA--GDS-GLSAEALSVVGLVQA--NPE-LTQAL
A0A2V7IGR0      LQIEQQQAHQD----RKAILQAL--AQA--RDS-GLSATALEAIGAVQH--NAD-LAQAL
A0A2V7MR23      MQISREEARRD----RDALQRLL--AQQ--GDS-GLSVEALSVVGLVQQ--NPE-LSQAL
A0A2V7L1V3      MQFDRERIQQD----REALQRLL--QAR--DSA-GLSADALAVVGSVQG--NPD-LAAAL
A0A1Q7E5D3      TQVEREQVRRD----RETLERVL--AQA--GDS-GSSADALSVIGSVQR--HAE-LSQAL
A0A2V7ISE2      TQLTREEARRD----REALGRLL--AQA--GDS-GLSPEALSVVGSVQQ--NPE-LSEAL
A0A1Q7J2X5      MQLTREEARRD----REALGRLL--AQA--GDS-GLSAEALSVVGSVQQ--NPE-LSEAL
A0A2V7NPD1      TQLTREEARRD----REALGRLL--AQA--GDS-GLSAEALSVVGSVQQ--NPE-LSEAL
A0A2V7QPD8      MQVDREQARRD----REALERVL--AQA--GDS-GVSPEALAIVGSVQQ--NAD-LKQAL
A0A2V7Q8M6      MQADRDRIQQD----REALQRLL--APA--SDSSGLSADALAVVGSVQG--NPD-LAAAL
A0A2V7QBC3      MQADRDRIQQD----REALQRLL--APT--SDSSGLSADALAVVGSVQG--NPD-LAAAL
A0A2V7LMU1      MQFDRERIQQD----REALQRLL--AQV--RDSTGISPDELAVVGSVQA--NPD-LAAAL
A0A2V7PBY9      MQFDRERLQQD----REALERVL--AQA--GDTAGLSPDALAVVGSVQS--NPD-LVGAL
A0A3M2BLV5      ALERLQQLDDQ----RQALQNLM--VDIQ-AAG-VEGVDIVAFLAALPQGVNPQ-ITAIA
A0A2V7KS68      MEADRDQLRRD----REAIEGLL--PAGG-G---PLPADALSAIESVQH--APE-LANAL
A0A2V7N4L3      IQVERDQVRRD----REAIDNLL--AQ-G-WDS-GVPTAALSAIGSVQH--APE-LSSAL
A0A1Q7AZK2      MAVERDQLRRD----GDAIDRLL--AQGG-GGD-GLPTEALSAIGSVQH--APE-LSNAL
A0A1Q7TNP7      MAVERDQLRRD----GAAIDRLL--AQGG-GGD-GLPTEALSAIGSVQH--APE-LSNAL
A0A1Q7KG39      MAVERDQLRRD----GDAIDRLL--AQGG-GGD-GLPTEALSAIGSVQH--APE-LSNAL
A0A1Q7GX75      MQVDRDQLRRD----RDAIDRLL--AEAG-GAS-GLPTAALSAIESVQH--APE-LSNAL
A0A1Q7LL80      MQVDRDQLRRD----RDAIDRLL--AEAG-GAS-GLPTAALSAIESVQH--APE-LSNAL
A0A2V7PFU2      MAVERDQLRRD----RDALERLL--TQAG-----GLQTDALSAIKSAQD--APE-LSNAL
A0A2V7MFS9      MQVERDQLRRD----RDALQRLL--TQ-G-GDS-GLPTDALSAIESAQR--APE-LSNAL
A0A2V7T933      MAVERDQLRRD----GDAIDRLL--AQGG-GGD-GLPTEALSAIGSVQH--APE-LSNAL
A0A2V7J4D7      LKVNLDEVRRD----RTAIERLL--APSTDPTV-EVPVDALSMVGSVQR--STE-LVQGL
A0A2V7LN90      MKVNREELRRD----RDAIGRIL--AQR--PDS-GLAVDALATIGAVQK--STE-LSQAL
A0A2V7LFN9      LKVRRGDLLRD----RAAIKRIL--AQG--PES-GLMVDALATLASVER--STE-LSQAL
A0A2V7MEK4      LKVRRGDLLRD----RAAIKRIL--AQG--PES-GLMVDALATLASVER--STE-LSQAL
A0A2V7P8B1      EDLLAAL--QDSSTSRKAIQTAL--STP--G------------VAPNPA--VVQ-LNTQL
A0A7C2QQS2      QSLLASL---QRNPQDPSVQGII--TAP--E------------IAANPV--IAQ-LYTQY
A0A2V7QN41      TKLALDSVQRD----RQALQRAL--AQT--GDS-GPPIEALQAIGAVQK--SAE-LSLAL
A0A2V7R603      TKLALDSVQRD----RQALQRAL--AQT--GDS-GPPIEALQAIGAVQK--SAE-LSLAL
A0A2V7LJS2      ETLLKAL--QDSSTSRRAIQTAL--STP--G------------VAPSPA--VVQ-LNTQL
A0A1Q7GLJ7      EALLAAL--RDSSTSRKAIQTAL--AAP--G------------MGASPA--LSQ-LSAQL
A0A2V7GRE3      ESLLAALRDRDSSVSRKALQTAL--ATP--G------------VAASPS--VMQ-LSTQL
A0A2V7EU00      MRIMREQLRRD----REAVLRVL--AQA--PES-GLAVAGLEVIGTVHN--SSD-LVEAL
A0A1Q6WE01      LRMAYDQMRRD----QLAVAHVL--TQA--HDS-AASIDALAAIGAVQQ--SLD-LKQAL
A0A2V7S9K3      LQVEQGQLRRD----QQAITQAL--DQM--RDS-GASVEGLGFIGAVQR--SPE-LSDAL
A0A1Q7DXB9      LRVAVDQHGRD----RQAIDRVL--AQP--PDS-GLSVDALAAIDAVQK--SPE-LTQAL
A0A1Q7JD32      LRVAVDQHGRD----RQAIDRVL--AQP--PDS-GLSVDALAAIDAVQK--SPE-LTQAL
A0A2V7MVP8      LRVTRDQLGHD----RQAIDRFL--AQ---PDS-GLSADALVVIDAVQK--SPE-LMQAL
A0A2V7N0A9      LQIAASGLARD----REAIAQML--VHA--PDS-GIAVDQLAMIGAVQR--SSE-LIAAL
A0A1Q7DLS9      TKVNLEQVRRD----RAAIERLL--AQV--RDS-GLPVDALAAIGAVDR--STE-LVAAL
A0A1Q7JK96      TKVNLEQVRRD----RAAIERLL--AQV--RDS-GLPVDALAAIGAVDR--STE-LVAAL
A0A2V7KQV7      LQVAIDGLARD----REAITQVV--ARA--RDG-SVPVDELSMIGAVQR--SSA-LAAAL
A0A1Q7JGF6      LQVALGALAHD----REAIARVV--AHA--ADS-GVAVDQLAMISAVQH--ASE-LTAAL
A0A2V7SG67      LQVALGALAHD----REAIARVV--AHA--ADS-GVAVDQLAMISAVQH--ASE-LTAAL
A0A1Q7GIK9      VQVTLDGLTRD----RAAIAQVL--THA--ADS-GVAVDQLAMIGAVQR--SSE-LTAAL
                                                                            

A0A2D5ZJF2      RD----AS--------------------QLQLELAD----LQRQVTSDHPAVESLESKIA
A0A0S8H9P3      DQLLELLE--------------------ERSSQLGP------LGKDPSHPVIMALDQRIS
A0A1E4BBP7      AN----LN--------------------QARGQLVN----LQKTYTDEYRMVKDLKQQIE
A0A3M2G737      AN----LEVQRDVTITQNPALAGQEAYIEKMAEINAQIEALRSKLQQRTEEYRKSILKDE
A0A0H4TUX7      QN-LLTLY--------------------DQRRTLTA----GALGLRERNPQVDALSERIR
A0A1G0LUG0      QS-LLTQY--------------------EERRKLTA----GALGLRERSPQISALDDRIQ
A0A1Q7E3T7      VQ----YE--------------------NTRDSLTA-----RSTTHPDVPRLNQLLVATE
A0A1G0L906      QN-LLKLH--------------------DDRRTLVA----GSLGLRESNPQVQAIDQRIT
A0A1G0LCC0      QN-LLKLH--------------------DDRRTLVA----GSLGLRESNPQVQAIDQRIT
A0A2D5ZJE2      REQLVALQ--------------------IEHTSL------LVRGASEDSPQIIDLESKVK
A0A3M2G624      WDVLSQLT--------------------SQLMELEIQLPLKLEEMTENHPDIIALKNQIQ
W0RI74          DE----LT--------------------HATVDLRV----KLQTLTDSNPLVVDARRNIA
A0A3M2BJA6      RS----LT--------------------EVENQRSV----LLQRRTMADDDVQQFTQRIR
A0A6M4IRY1      AD----FA--------------------DRELSLRK----LRESYTDELPRVQNEIAALA
A0A3D4VBZ5      EE----RA--------------------ARELELRR----LRETYTDEYQRVKDAQAALV
C1A5W1          EE----RA--------------------ARELELRR----LRETYTDEYQRVKDAQAALV
A0A2V7PX99      QE----IN--------------------QKEADLRA----LRTRYTDASAPVQQARSDLD
A0A2V7ERC7      EE----LS--------------------SRQAALRT----EQQYLTNANPRIKQLGEAIR
A0A5Q4D6Y4      HAQLMELE--------------------TERQALTS----GPWGLSQTNPDVARIDQQIA
A0A2V7JTZ5      EE----LS--------------------LRQATLRT----EQQFLTDANPRIRQLAEAVR
A0A3D4YTR6      EE----LS--------------------LRKATLRT----EQQFLTDANPRIKQLAEAVR
A0A5Q4DA46      SL----AS--------------------EKRAEVRA----LSLRYHEDWPEVQALRRDIV
A0A2V7F1M1      SQQVLVYR--------------------TRLDSLTT----GPLPAAPTNPDVLGLKALIR
A0A2V7KXK7      DE----LG--------------------LKQAQLRQ----LRLQYTDSAAPVRQLQSDLT
A0A651HKD3      EQ----VA--------------------EARAERRA----LLQRYTEEYPSVAELDAQLR
A0A2V7QDU7      AQ----TE--------------------DRRSELLS-------RRSPQDADVQVLTRRIE
A0A6J4M9S2      SQ----YQ--------------------NRRDSLTS----GSMGSTGDHPDVERLNGLIA
A0A2V7ITT6      KE----LT--------------------DKQAEQRA----LGYRYTADFSRVGYVREQVD
A0A2V7NJW1      KE----LT--------------------DKQAEQRA----LGYRYTADFSRVGYVREQVD
A0A2V7GFB5      QE----LT--------------------TKQADLRN----LRYHYTEAYPPLARKAAEVA
A0A2V7RQ86      QE----LT--------------------TKQADLRN----LRYHYTEAYPPLARKAAEVA
A0A2V7IWX2      KE----LT--------------------DKQAELRA----LRYTYTDQHFPVQQLADAVA
A0A1Q7KE95      RE----LT--------------------TKQAERRA----LASKYTDDHPAVQRLIGEIE
A0A1Q7T8X5      RE----LT--------------------TKQAERRA----LASKYTDDHPAVQRLIGEIE
A0A2V7MS64      RD----LT--------------------SKQAELRA----IRSRYTDASPAVQRIALDVK
A0A2V7Q7N9      HD----LT--------------------TKQAELRA----LRTRYADANPAVRRVAVEVQ
A0A2V7IRW6      RD----LT--------------------GKVAELRA----LRGRYTDANVAVRRVSDEVA
A0A1Q7DVU6      RD----LT--------------------GKVAELRA----LRGRYTDANVAVRRVSDEVA
A0A1Q7JSV2      RD----LT--------------------GKVAELRA----LRGRYTDANVAVRRVSDEVA
A0A2V7FK98      DE----LT--------------------TKQAELRA----LRYKYSDEYPLVQRRLSEVA
A0A2V7R3Z8      DE----LT--------------------TKQAELRA----LRYKYNDAYPLVQRRLSEVA
A0A2V7J3C0      RD----LT--------------------VKQADERA----LRARYTPEHHAVQQLRAEIA
A0A2V7KWV9      TE----LT--------------------TKRAERRA----LLYRYTDDHPAVQRVTTDLE
A0A1Q6ZHP2      TE----LM--------------------TKQAELRA----LRYKYSDAYPPVQRLLGEIA
A0A1Q7R6Z6      TE----LM--------------------TKQAELRA----LRYKYSDAYPPVQRLLGEIA
A0A2V7FYT7      TE----LM--------------------TKQAELRA----LRYKYSDAYPPVQRLLGEIA
A0A2V7IGR0      KE----LV--------------------TKQADLRV----LRYQYTDAYPRVQRLTAEIA
A0A2V7MR23      TE----LN--------------------NKQAELRS----LRYKYTDEYMPVQRLLGEIR
A0A2V7L1V3      TE----LT--------------------SKRANLRA----LRYRYSDQYPPVQRLVGEIG
A0A1Q7E5D3      KE----LT--------------------AKQAELRA----LRYRYSDAYPPVQRLLAEIA
A0A2V7ISE2      KE----LT--------------------DKQALLRT----YRYKYSDEYPPVQRLLGEIA
A0A1Q7J2X5      KE----LT--------------------DKQAQLRA----YRYKYSDEYPPVQRLLGEIA
A0A2V7NPD1      KE----LT--------------------DKQAQLRA----YRYKYSDEYPPVQRLLGEIA
A0A2V7QPD8      AE----LT--------------------TKQAELRA----LRYKYSDQYPLVQRRLSDVA
A0A2V7Q8M6      TE----LT--------------------SKRASLRA----LRYRYSDQYPPVQRLVAEIA
A0A2V7QBC3      TE----LT--------------------SKRASLRA----LRYRYSDQYPPVQRLVAEIA
A0A2V7LMU1      TE----LT--------------------SKRANLRA----LQYRYSDQYPPVQHLTGEIA
A0A2V7PBY9      GE----LT--------------------SKRASLRA----LRYKYSDQYPPVQRLIEEIT
A0A3M2BLV5      ED----IR--------------------DKQDEIQR--LLTEERVTPDHPRVQAIRTQLA
A0A2V7KS68      KE----LG--------------------DKRAELRT----LRYHYSDAYPPLQRLAGQVA
A0A2V7N4L3      KE----LG--------------------DKEAEVRT----YRYHYSDAYPPLQRLLAQVG
A0A1Q7AZK2      KE----LS--------------------DKQAQLRT----YRYHYSEAYPPVQRLAREIS
A0A1Q7TNP7      KE----LS--------------------DKQAQLRT----YRYHYSEAYPPVQRLAREIS
A0A1Q7KG39      KE----LS--------------------DKQAQLRT----YRYHYSEAYPPVQRLAREIS
A0A1Q7GX75      KE----LS--------------------DKEAQLRA----LRYHYSDAYPPVQRLAAEIA
A0A1Q7LL80      KE----LS--------------------DKEAQLRA----LRYHYSDAYPPVQRLAAEIA
A0A2V7PFU2      KE----LS--------------------DKQAQART----YRYHYSEAYPPLQHLAAEIT
A0A2V7MFS9      KE----LS--------------------DKQAQLRA----YRYHYSEAYPPLQRLVSEIA
A0A2V7T933      KE----LS--------------------DKQAQLRT----YRYHYSEAYPPVQRLAREIS
A0A2V7J4D7      RD----LT--------------------SKQAELRA----LRAHYTDANPPVRRLASEVD
A0A2V7LN90      HD----LT--------------------VKQAELRA----LRTRYADANPAVRRVAAEVA
A0A2V7LFN9      RD----LT--------------------AKQAVLRA----LRVRYTAEAPAVRRVAAEAA
A0A2V7MEK4      RD----LT--------------------AKQAVLRA----LRVRYTAEAPAVRRVAAEAA
A0A2V7P8B1      LH----YE--------------------MARDSLVS----LSPTHPDLR--------RLS
A0A7C2QQS2      VR----LQ--------------------LSRDSLISGPWGSTRTNPDVQ--------RLE
A0A2V7QN41      QE----VT--------------------QRQATLRA----LRYRYTDASDPVQRVRGEVR
A0A2V7R603      QE----VT--------------------QRQATLRA----LRYRYTDASDPVQRVRGEVR
A0A2V7LJS2      FQ----YE--------------------IARDSLAS----LSPSHPDLP--------RLN
A0A1Q7GLJ7      FQ----YE--------------------MARDSLAS----RSARHPDLP--------RLN
A0A2V7GRE3      YQ----YE--------------------RARDSLAS----RSTSHPDLP--------RLN
A0A2V7EU00      KE----LT--------------------AKQAELRA----LRYRYTDEHPPVKRLQASIE
A0A1Q6WE01      SE----LT--------------------TKRAELRA----LRYRYTEDHPAVRRLTTDID
A0A2V7S9K3      RE----VT--------------------TKRAELRA----LRYRYTDDHPTVRRLAAEID
A0A1Q7DXB9      KE----LT--------------------DKQAELRA----LRYTYTDQHFPVQQLADAVA
A0A1Q7JD32      KE----LT--------------------DKQAELRA----LRYTYTDQHFPVQQLADAVA
A0A2V7MVP8      KE----LT--------------------DKQAELRA----LRYTYTDQNFPVQQLADAVA
A0A2V7N0A9      KE----LT--------------------DRQAELRA----LRFRYADTHPPVRRLAAQVD
A0A1Q7DLS9      RE----LT--------------------AKRAELRA----LQQRYTEEHGTVRRLAGEVQ
A0A1Q7JK96      RE----LT--------------------AKRAELRA----LQQRYTEEHGTVRRLAGEVQ
A0A2V7KQV7      KD----LA--------------------DRQAELRV----LRFRYADTHPPVRRLAQQVD
A0A1Q7JGF6      KE----LS--------------------DRQAELRV----MRFRYADTHPPVRRLAQQVD
A0A2V7SG67      KE----LS--------------------DRQAELRV----MRFRYADTHPPVRRLAQQVD
A0A1Q7GIK9      KE----LT--------------------DRQADLRA----LRFRYADTHPPVRRLALQVD
                                                                            

A0A2D5ZJF2      RIKGE-LEALDRTTGEAY---------------LELARQQWLVARERETELDQRYRTQLV
A0A0S8H9P3      ETQDQLVAAAENAAVAL---------------------------DTRIGALTGRLSNLQA
A0A1E4BBP7      VMESQSIPTLVASSLQEL--------------------------RSREAEMKRRIDGASQ
A0A3M2G737      NLTASDILELRTSIFAAQ--------------------MEMQTLKTKKEILDSTIADYER
A0A0H4TUX7      Q-GYQALRGAVSAALESL--------------------------ESRTEALDQRVASARA
A0A1G0LUG0      Q-GHQALRTAVGAALESI--------------------------EARRQALDLRVQELRG
A0A1Q7E3T7      GKLLRAVQSALKGLIASL--------------------------DVRIATLDDLRVRRVA
A0A1G0L906      Q-AAAALREAANATVRGI--------------------------QANIASLDQNVANLRQ
A0A1G0LCC0      Q-AAAALREAANATVRGI--------------------------QANIASLDQNVANLRQ
A0A2D5ZJE2      QAKTRLAAETQKIVDRDLLPGDPLLYSQGLVEKVLELRTELETARSRAAELNRFVADYAT
A0A3M2G624      QVRLR-LQQQVDARLTML--------------------------DSREESLRLQLLPYQQ
W0RI74          ELHDRVLPQRLTDYIATL--------------------------RTRESQYGQELQTATH
A0A3M2BJA6      ELEAQ-LRTVATTYLQGL--------------------------TNQVQSYDQTLEQFAA
A0A6M4IRY1      SLRSS-IPSVLESYLTQL--------------------------KLREQTLVSTIDQSSK
A0A3D4VBZ5      ALRDTVVPRSLDAYLGEL--------------------------RLREQTLNSTIEQSSK
C1A5W1          ALRDTVVPRSLDAYLGEL--------------------------RLREQTLNSTIEQSSK
A0A2V7PX99      ALEQRTVPALARKLAADL--------------------------SAREAALTPQVDSAFG
A0A2V7ERC7      VLEIETIPRIAQSVLESL--------------------------RSRENQLTGRIDTQER
A0A5Q4D6Y4      TTGGR-LESAVRSHMQNL--------------------------DARLAAMTDLRARTAA
A0A2V7JTZ5      VLERETIPQITVAVLNSL--------------------------KAREPELDTRISVGSQ
A0A3D4YTR6      VLETETIPQITQAVLNSL--------------------------KAREPELGARIDVGSQ
A0A5Q4DA46      ELEQQTIPALVGTLQSEM--------------------------QARESEIERFVGRASS
A0A2V7F1M1      STQEELVRAV-RAHLTSI--------------------------GAQSQALAALRSRTGA
A0A2V7KXK7      TLEHQQIPSLARILAGTL--------------------------GEVVATTKPRADTAIG
A0A651HKD3      TLEGQVVPSLAREILEDL--------------------------EARLGEVTSRLQTRSA
A0A2V7QDU7      DL-RAQLRGIAATYLQGL--------------------------SNQVVAIDLTLAKSNA
A0A6J4M9S2      RTEAKLVDAV-KSHVSVL--------------------------DARIAALDGLEARNSN
A0A2V7ITT6      TLERKTIPGLARALIREL--------------------------AMRESVGDARIRLASQ
A0A2V7NJW1      TLERKTIPGLARALIREL--------------------------AIRESVGDARIRLASQ
A0A2V7GFB5      TLERQTIPTLVRSLIDEL--------------------------GTRMAELDRRIGSASQ
A0A2V7RQ86      TLERQTIPTLVRSLIDEL--------------------------GTRMAELDRRIGSASQ
A0A2V7IWX2      TLDRRTIPGMLRALRNNL--------------------------AARERDLGQRVDSTVR
A0A1Q7KE95      LLERGTVPTLAQSLIDEL--------------------------TARERVLAPQVAAADR
A0A1Q7T8X5      LLERGTVPTLAQSLIDEL--------------------------TARERVLAPQVAAADR
A0A2V7MS64      TLQRQTIPSLATQLASEL--------------------------GLRETELAQRINAAST
A0A2V7Q7N9      DLERRTIPDLAASLTREM--------------------------QFREVELAQRVDSAAS
A0A2V7IRW6      VLEQQTIPALATKLTQEM--------------------------AVQEAGLAQRVDSAAG
A0A1Q7DVU6      VLEQQTIPALATKLTQEM--------------------------AVQERVLAQRVDSAAG
A0A1Q7JSV2      VLEQQTIPALATKLTQEM--------------------------AVQERVLAQRVDSAAG
A0A2V7FK98      TLERQTIPTLARQLMAEL--------------------------SGREAELGRRVTADAR
A0A2V7R3Z8      TLQRQTIPTLARQLMAEL--------------------------SGRDAELGRRVAADTR
A0A2V7J3C0      ALEQRTIPALAESLSAEL--------------------------LARERVLAPQIAAGEH
A0A2V7KWV9      QLEHQTIPGLIRGLVAEL--------------------------ATQRRALASQLETGGR
A0A1Q6ZHP2      TLQRQTIPTLARQLAGQL--------------------------AAKETELGRRVDADSR
A0A1Q7R6Z6      TLQRQTIPTLARQLAGQL--------------------------AAKETELGRRVDADSR
A0A2V7FYT7      TLQRQTIPTLARQLAGQL--------------------------AAKETELGRRVDADSR
A0A2V7IGR0      TLQRQTIPALAQALAGEL--------------------------AAREAELGRRVETGSQ
A0A2V7MR23      TLQRQTIPTLARTLAGQL--------------------------AAKEAELGRRTDADSR
A0A2V7L1V3      TLERQTIPALARVLLDQL--------------------------AAREAELGRRLGADSR
A0A1Q7E5D3      TLKRQAIPVLARALVGEL--------------------------ASRETELGRRVDADSR
A0A2V7ISE2      TLQRQTIPTLARALAGQL--------------------------AGKEAELGRRVDADSR
A0A1Q7J2X5      TLQRQTIPGLARALAGQL--------------------------AGKESELGRRVDADSR
A0A2V7NPD1      TLQRQTIPTLARALAGQL--------------------------AGKEAELGRRVDADSR
A0A2V7QPD8      TLERQTIPTLARRLLAEL--------------------------SGREAELGRRVAEDTR
A0A2V7Q8M6      TLEHQTIPALARGLMDQL--------------------------AARETELGRRLGTDSR
A0A2V7QBC3      TLERQTIPALARGLMDQL--------------------------AAREMELGRRLGADSR
A0A2V7LMU1      TLERQTIPALARGLLDQL--------------------------TARDAELGRRLGADSK
A0A2V7PBY9      TLQRQTIPTLARGLLAQL--------------------------TAREADLGRRLGTDSR
A0A3M2BLV5      RDEGSLRDAVDRHLQ-GI--------------------------DREMAEVRTELDRIQE
A0A2V7KS68      QLEQQTIPTLARGLAAQL--------------------------AARESEIGRQVDAAST
A0A2V7N4L3      ELQQRTIPSLARALSSQL--------------------------AARATELGRQVDAASP
A0A1Q7AZK2      ELQQRTIPTLARALSAQL--------------------------ATRESELGRQVGAASR
A0A1Q7TNP7      ELQQRTIPTLARALSAQL--------------------------ATRESELGRQVGAASR
A0A1Q7KG39      ELQQRTIPTLARALSAQL--------------------------ATRESELGRQVGAASR
A0A1Q7GX75      ELQQRTIPTLARALSVQL--------------------------AARESELGRHVDAASS
A0A1Q7LL80      ELQQRTIPTLARALSVQL--------------------------AARESELGRHVDAASS
A0A2V7PFU2      ELQERTIPTLARALASQL--------------------------ADRESELERQVNSASN
A0A2V7MFS9      QLQQRTIPTLARTLASQL--------------------------ASRESELGRQVDAASH
A0A2V7T933      ELQQRTIPTLARALSAQL--------------------------ATRESELGRQVGAASR
A0A2V7J4D7      ELAHRTVPALAASLVAEL--------------------------RVRESELVQRVDAASS
A0A2V7LN90      ELERRAIPGLATSLTREM--------------------------AFREAELAQRVDSAAT
A0A2V7LFN9      TLERQTIPQLATGLAREL--------------------------ERRAAELGQRADSVAR
A0A2V7MEK4      TLERQTIPQLATGLAREL--------------------------ERRAAELGQRADSVAR
A0A2V7P8B1      LLIPPTEAKLLRAVQAGV--------------------------QGAIASLDGRIAA---
A0A7C2QQS2      ALIASTQARL----RAAT--------------------------QSYLQTLDARLRAMDE
A0A2V7QN41      TLLQTTIPTLARGLDADL--------------------------AAREEALSRRADAAFG
A0A2V7R603      TLLQTTIPTLARLLDADL--------------------------AAREEALSHRADAAFG
A0A2V7LJS2      LLISSTEAKLLRAVQAGV--------------------------QGAIASLDGRIAA---
A0A1Q7GLJ7      LLVSSTEAKLLRAVQAGV--------------------------QGSIASLDGRIAA---
A0A2V7GRE3      QLVSSTEADLLHAVQGGV--------------------------QSAIASLEGRITA---
A0A2V7EU00      TLERHTIPALAGALLEEV--------------------------GTRERVLDSLVQSGGR
A0A1Q6WE01      VLQRQAIPGLARALHAEL--------------------------GARAQTLATEISAGGR
A0A2V7S9K3      VLEHQTIPVLVRTLLTEL--------------------------GTRQRLLASEVAAGGR
A0A1Q7DXB9      TLERRTIPGMLRALRNNL--------------------------AAREHDLGQRVDSTVR
A0A1Q7JD32      TLERRTIPGMLRALRNNL--------------------------AAREHDLGQRVDSTVR
A0A2V7MVP8      TLEHRTIPALLRAVRDNL--------------------------AVRERDLGQRVDSTVR
A0A2V7N0A9      TLARRVIPGLGRALIAGL--------------------------AARERELRQRADSITG
A0A1Q7DLS9      ALEGRTIPALARVLVSEL--------------------------AARDAELTQRVRAASA
A0A1Q7JK96      ALEGRTIPALARVLVSEL--------------------------AARDAELTQRVRAASA
A0A2V7KQV7      TLARYVIPELGGALVAAL--------------------------AAREHELQQRIDSIAR
A0A1Q7JGF6      TLARRVIPELGRAVVAGL--------------------------AAREHELQQRIDSISR
A0A2V7SG67      TLARRVIPELGRAVVAGL--------------------------AAREHELQQRIDSISR
A0A1Q7GIK9      TLAQRVIPGLARTLMDGL--------------------------AARARELASRRDSIAR
                                                                            

A0A2D5ZJF2      EAQELGA-------KATELAKLESEVSKTEKMLDILDDRIKEVDVTEKADVLNINILEYA
A0A0S8H9P3      ELRQLPA-------VESELTRLQNEVEIHSDMYKYLLSRYQESQIAEAEISPYVEVLDPA
A0A1E4BBP7      ELKQIPA-------RTVEEMRLNRELQIAQTMYVDLQQRAMSARLSERNALPDVSILDTA
A0A3M2G737      KIKTLPQ-------KSIDYARLVRQRSSAEKLYLLVEQHYNEASIAEQSEFGNVEIIESA
A0A0H4TUX7      RLRTFPG-------KESRIAQLQLEASILNDTYRYLLTEYESARLTEATIGPYINLLDPA
A0A1G0LUG0      TLGTFPG-------KQSRIAQLQLETSIHNDTYRYLLGQLEAARLQENTIAPYINLLDPA
A0A1Q7E3T7      NVEQRSS-------TDAEEARLEERVENGRKIADELRIEYQRARIAEAVEVGHVEIVDLA
A0A1G0L906      RLGTYPG-------KETRFAQLALDIELQNGIYKYLLSELESARISAATISPYIQIVETA
A0A1G0LCC0      RLGTYPG-------KETRFAQLALDIELQNGIYKYLLSELESARISAATISPYIQIVETA
A0A2D5ZJE2      KLHSLPD-------KELALARKTREYTVNENTYLMMKEKYEEVRISEAGEIGNVRIIDAA
A0A3M2G624      QLETFPL-------KEVELARLEREFRLNEEIYSLLTRQHEQTRLAEAAIVNDIQVLDYA
W0RI74          ELQGIPE-------RTIQTGVLARERDVRAEIYTKLRTASAQAQLAQQSAVPDVKILDTA
A0A3M2BJA6      QLEVIPQ-------KQVQLARLEREEKVLSELFTLLQTRLKEAQIAQAVEDASIRVVDPA
A0A6M4IRY1      DLRKIPT-------RTIEEQRLKRQVAQSEELYRSLNIKAAEAKLAEAATIPDVSVLDPA
A0A3D4VBZ5      DLKGIPS-------RTIEEQRLKRQVEVAARVYESLNMKAAEAKLAEASTIPDVSILDAA
C1A5W1          DLKGIPS-------RTIEEQRLKRQVEVAARVYESLNMKAAEAKLAEASTIPDVSILDAA
A0A2V7PX99      YMRTVPP-------LALEEDQLKRAVAGAEAFSATVNQRYEAARLGLISSSPDVRLLDSA
A0A2V7ERC7      VLRQIPS-------RSIEEMRLVRRVSASETMYNSLKARYEEVSLAEAQTTPDLSILDYA
A0A5Q4D6Y4      QIAGRPQ-------ALAEEERLLQDVASIRRTMEQLQDEFYRARMAEAVEEGPVQIVDLA
A0A2V7JTZ5      ELRGIPA-------RATEEARLVRQVAATENLYNSLKARYEEVSLAEVQTAPDLSVLDTA
A0A3D4YTR6      ELRAIPA-------RATEEMRLARRVVASESLYNTLKARYEELSIAEAQTTPDLAVLDTA
A0A5Q4DA46      ELQQIPP-------RVVEEARLTREYQSAENLFRDLQGRFENARLGAVSTVPDVRILVRA
A0A2V7F1M1      SFQRLPA-------TEAEGGRLERLVEDLRSTGDRIRQDYKNARMAEAISAGDARVIDWA
A0A2V7KXK7      QLRAAPS-------IALEGSRLEREQRLAEEQFNNVDGEYQKAKLGLISALPDVRVLDPA
A0A651HKD3      ELGAIPT-------RSIREASLRREVGRAETLYEDVSQRYESARLASISADPNVRVVDWA
A0A2V7QDU7      QLQTIPA-------KEIRLAQLERNVSGLAQIYTQLESRLKESEIAAAAEDPSVRLVDAA
A0A6J4M9S2      EMQTLPS-------AEAEEVRLVQRVETTSKIADQVREELQKAHMAEAVEAGQVEIVYPA
A0A2V7ITT6      DLRQIPP-------RAIQEGRLRREVAVAENLFTTLQQRYEEARLAEASSIPDVRVLDVA
A0A2V7NJW1      DLRQIPP-------RAIQEGRLRREVAVAENLFTTLQQRYEEARLAEASSIPDVRVLDVA
A0A2V7GFB5      ELRRIPA-------RSVEEARLRRSVTIADNLYTSLQQNYEAAKLAEASSIPDIRIFDKA
A0A2V7RQ86      ELRRIPA-------RSVEEARLRRSVTIADNLYTSLQQNYEAAKLAEASSIPDIRIFDKA
A0A2V7IWX2      YLSNIPP-------LLFEQTRLEREVQVAGQLYASLQQRYDEARVAEASALPDVRILDAP
A0A1Q7KE95      DLRRIPQ-------RAIEEARRRRDVDLATNLYTSVQQRYDEARLAEASSVADVRILDAA
A0A1Q7T8X5      DLRRIPQ-------RAIEEARRRRDVDLATNLYTSVQQRYDEARLAEASSVADVRILDAA
A0A2V7MS64      GLRRIPP-------LAVEEERLVREVTLRDQAVSNLTARYQEARLAEVSAIPDVRLIDPA
A0A2V7Q7N9      NLRRIPP-------LAVEETRLEREVTRGEQAVASLQTLYDEARLAEVSAIPDVRLVDPA
A0A2V7IRW6      GLRRIPP-------LAVEETQLQRSVTLAEQVVTNLQQRYEEARLAEVSAIPDVRLIDPA
A0A1Q7DVU6      GLRRIPP-------LAVAETQLQRDVTLAEQVVTNLQRRYEEARLAEVSAIPDVRLIDPA
A0A1Q7JSV2      GLRRIPP-------LAVAETQLQRDVTLAEQVVTNLQRRYEEARLAEVSAIPDVRLIDPA
A0A2V7FK98      SIQAVPP-------RAIDEARLQRQVTLAENLFTSLQKNYDEARLAEESAVPDARILDHA
A0A2V7R3Z8      SIQLVPP-------RAIDEARLQRQVTLAENLFTNLQKNYDEARLAEESAVPDARILDHA
A0A2V7J3C0      ELRGIPQ-------RAIDEARLRRDLELATNLFTGVQQRYDEARLAEASSIADVRILDVA
A0A2V7KWV9      ELQGIPQ-------RAIEDARLRRDVSIAENLFTSVQQRYSEARLAEASSIADVRVLDAA
A0A1Q6ZHP2      TLKQIPA-------RAIEEARLRRDAALAENLYLSLQGKYDEARLAEASTLSDVRVLDSA
A0A1Q7R6Z6      TLKQIPA-------RAIEEARLRRDAALAENLYLSLQGKYDEARLAEASTLSDVRVLDSA
A0A2V7FYT7      TLKQIPA-------RAIEEARLRRDAALAENLYLSLQGKYDEARLAEASTLSDVRVLDSA
A0A2V7IGR0      NLRQIPP-------RAIDEARLRRDMTLAENLYATLQQRYEEARLAEASTIPDVRILDSA
A0A2V7MR23      TLRQIPA-------RAIEEARLRRDAGLAENLYTGLQAKYDEARLAEVSSLSDVRVLDSA
A0A2V7L1V3      SLQQIRA-------RAIEEARLRRTKTMSENLYTMLKERYEEARLAEASTIPDVRILDAA
A0A1Q7E5D3      TLRQIPP-------RLIEEARLRRADTLAANLYTTLQQRYEEARLAQASTVPDVRILDSA
A0A2V7ISE2      SLRQIPA-------RTIEEARLRRDASLAENLYTSLQQKYDEARLAEASTLADVRVLDSA
A0A1Q7J2X5      SLRQIPG-------RTIEEARLRRDASLAENLYTSLQQKYDEARLAEASTLADVRVLDSA
A0A2V7NPD1      SLRQIPG-------RTIEEARLRRDASLAENLYTSLQQKYDEARLAEASTLADVRVLDSA
A0A2V7QPD8      SIQAVPP-------RAIDEARLQRQVTLAENLFTSLQKNYDEARLAEESAVPDARILDHA
A0A2V7Q8M6      SLRQIPA-------RAIEEARLRRTLSMAEDLYTLLQKRYEEARLAEASTIPDVRILDAA
A0A2V7QBC3      SLRQIPA-------RAIEEARLRRTLSMAEDLYTLLQKRYEEARLAEASTIPDVRILDAA
A0A2V7LMU1      SLRQIPA-------RAVEEARLRRSVTMAENIYTMLQQRYEEARLAEASTIPDVRILDAA
A0A2V7PBY9      TLRDIPA-------RAIEEARLRRDVSLSENLFTMLQQRYEEARLAEASTIPDVRILDAA
A0A3M2BLV5      AQRRFPQ-----LQNRYDELDLQRSIDREMVLYLQ-SQLYQAQILAQGAGDGFIDVVDPP
A0A2V7KS68      DLRQIPA-------RTIEEVRLRRNADLKEQTYTSLQQRFDQARLAAESTVPDVRVLDPA
A0A2V7N4L3      GLRQIPG-------RTIEEARLTRNAQLKEQTYTQLQQRFDQARLAAEATVPDVRILDPA
A0A1Q7AZK2      DLRQIPA-------RDIEDVRLNRNAQLKEQTYTALQQRFDQARLAAEATLPDVRILDPA
A0A1Q7TNP7      DLRQIPA-------RDIEDVRLNRNAQLKEQTYTALQQRFDQARLAAEATLPDVRILDPA
A0A1Q7KG39      DLRQIPA-------RDIEDVRLNRNAQLKEQTYTALQQRFDQARLAAEATLPDVRILDPA
A0A1Q7GX75      DLRQIPA-------RTIEEARLNRNVQLKEQTYTALQQRFDQARLAAEATVPDVRILDSA
A0A1Q7LL80      DLRQIPA-------RTIEEARLNRNVQLKEQTYTALQQRFDQARLAAEATVPDVRILDSA
A0A2V7PFU2      DLRQIPG-------RAIEEVRLNRNVELKEQTYTQLQQRYDQARLSAEATVPDVRVLDPA
A0A2V7MFS9      DLRQIPG-------RAIEEVRLNRNAQLKEQTYTALQQRYDQARLAAEATVPDVRILDPA
A0A2V7T933      DLRQIPA-------RDIEDVRLNRNAQLKEQTYTALQQRFDQARLAAEATLPDVRILDPA
A0A2V7J4D7      SIQKIPP-------LAVEESRLQRGVTLAEQTVTNLQARYEEARLAEISAIADVRLLDRA
A0A2V7LN90      DLRRIPP-------LAVEETRLEREVTRGEQAVASLQTLYEEARLAEVSAIPDVRLVDPA
A0A2V7LFN9      DLRRIPP-------LAVEETRLQRDVTQSAQTVANLQQHYEEARLAEASSIPDVRFVDPA
A0A2V7MEK4      DLRRIPP-------LAVEETRLQRDVTQSAQTVANLQQHYEEARLAEASSIPDVRFVDPA
A0A2V7P8B1      -INDLRARRAGNLQHDADEARLTERLDNARKVADALRTEYQKAGIAEAVTVGQVEIVDHA
A0A7C2QQS2      QRAKLASIFQVLPDAEAEEVRLRQRLEAILKVADQLREEYQKARIAEAVEAGQVEVVDRA
A0A2V7QN41      YLHDLPP-------LALEEARLQRDVAIAEQLFTTVQQSYNQTQLAAVSTLPDVRILDRA
A0A2V7R603      YLHDLPP-------LALEEARLQRDVAIAEQLFTTVQQSYNQTQLAAVSTLPDVRILDRA
A0A2V7LJS2      -INDLRARRAGNLQHVAQEARLTERVENARKVADELRTEYQKAGIAEAVTVGQVEIVDHA
A0A1Q7GLJ7      -IDDLRAHWAGGLQQDAEEARLKERVDNARKVADELRVEYQKAGIAEAITVGQVEIVDHA
A0A2V7GRE3      -MNDLRARQQQLSTSEEEEARLTERVDNAQKVADELRVEYQKAKIAEAVTVGQVEIVDHA
A0A2V7EU00      ELQQIPL-------RAVEEARLRREVTIAENLYTTLQQRYEEARLAEASTIPDVRVLDAA
A0A1Q6WE01      ELQAIPQ-------RSIEEGRLRRDVSIAENLYASVQQRYNEARLGEASTVADVQVLDAA
A0A2V7S9K3      ALQAIPQ-------RAVEEARLRRDVAIAENLYSSVQQRYDEARLAEASTVADVRILDAA
A0A1Q7DXB9      YLSNIPP-------LLFEQTRLEREVQVAGQLYASLQQHYDEARVAEASALPDVRILDAP
A0A1Q7JD32      YLSNIPP-------LLFEQTRLEREVQVAGQLYASLQQHYDEARVAEASALPDVRILDAP
A0A2V7MVP8      YLSNIPP-------LLFEQTRLEREVQVAGQLYASLQQHHDEARVAEASAVPDVRILDAP
A0A2V7N0A9      VLRRAPP-------AALEEVRLARDQANAEQLFSDLQHRYQEARLAEVSTLPDVRILERA
A0A1Q7DLS9      ELRQIPS-------LAIEDARLRREVANAERLFTSIQQRYDEARLAEVSTIPEVSVLDAA
A0A1Q7JK96      ELRQIPS-------LAIEDARLRREVANAERLFTSIQQRYDEARLAEVSTIPEVSVLDAA
A0A2V7KQV7      ALRGAPP-------VALEEIRLARDQANATELFSNLEQRYNEARLAEVSTLPDVRILERA
A0A1Q7JGF6      DLRSAPP-------VALEEVRLARDQANAEQLFSNLQQRYQEARLAEVSTLPDVRILEPA
A0A2V7SG67      DLRSAPP-------VALEEVRLARDQANAEQLFSNLQQRYQEARLAEVSTLPDVRILEPA
A0A1Q7GIK9      DLQSAPP-------VALTEIRLARDQTNAEQLFSNLQQRYQEARLAEVSTLPDVRILERA
                                                            :          ..  .

A0A2D5ZJF2      EVEDEPSKP--EKARIMGAALVAGLILGAGLALLVDWKDHRFRSADEITAIL-GVPVLGV
A0A0S8H9P3      -SWARPVSG--GRRINIIFGGLLGLLLGLGAAFFLEYLDRSLKSTSDVETSL-GVPVLGW
A0A1E4BBP7      VAPRFPSSD--TTLSIILVAIAASIGLGLALAILLDRLDKRFRYPEQATHEL-GLDIVGA
A0A3M2G737      ETPTKPINP-PKPLRTVFLGGFLGLGLGLGIVFVREFFNTQIRTPEDIKKR--GYTLLSV
A0A0H4TUX7      -SPAFRVGT--TLRQKIVLGMLVGLLLGLGGAFFLEYLDQTIKNAGDVERVI-GVPVLGL
A0A1G0LUG0      -SPAFRIGR--TPWQTAMLGLLVGLLLGFGAAFLLEYLDQTIKSAADVERAL-GVPVLGQ
A0A1Q7E3T7      VPPTAPLGI--GFAERLALGLLFGLVLGGGSAWLTEHLRSSIARPNEIVEL--GLPLLGA
A0A1G0L906      TVAARIGVG---TRQKVTIGLLVGLFLGIVAAFFLEYLDQTIKTAADVERAL-EIPVLGL
A0A1G0LCC0      TVAARIGVG---TRQKVTIGLLVGLFLGIVAAFFLEYLDQTIKTAADVERAL-EIPVLGL
A0A2D5ZJE2      LPFLDPVRP--NRRMNALLGLVVGLGLALSLAFFFEYLDTSLRTIDEVEQKL-DTVVLGA
A0A3M2G624      SIPTAPIGGGPNRQKAILLGALLGIGVGLGVAFLLEFLDNTIRETDEIERHI-QLPVYGM
W0RI74          ITPLAPSSN--TAPTFIGGGLFAGLVIGIGLAFLLDLLDNRFRYPEQARVDL-GLEVLGV
A0A3M2BJA6      ILPSEPIKP--KTVLNIALGLILGMMLGVGLAFTREHMDDTVHTREDLVEATGGAPIMGM
A0A6M4IRY1      VAPLKPTRN--TAPVIILGAIGAALALGVLLAIVLDQVDKRFRYPEQATDDL-GLFILGV
A0A3D4VBZ5      VPPLSPTRN--TAPMIILGAVGAALALGLLLAIVLDQLDKRFRYPEQATDDL-GLFVLGV
C1A5W1          VPPLSPTRN--TAPMIILGAVGAALALGLLLAIVLDQLDKRFRYPEQATDDL-GLFVLGV
A0A2V7PX99      VQPGKPSLD--LGPLLIALSFLTSLGLGMVGAVVLDRADPRVRTPEQVTRGM-RLPILAA
A0A2V7ERC7      IPPVHPTSN--GARRLLILAVLASIALACAIALIRDRFDRLFRYPKEATHEL-GLIIAGT
A0A5Q4D6Y4      PTPHTSEQA--GLPLMLVLGLMLGAMVGSGGAFLLEMLNTKVRRREDMEDAM-QVTTMGI
A0A2V7JTZ5      VAPTLPTSN--DAPRLLLLAVVASMGLAVGIALIRDRLDRRFRYPEQATREL-GLSVAGT
A0A3D4YTR6      VGPNFPTSN--DAPRLLLLAVAASIGLAFGIALILDRLDPRFRYPEQATHDL-GLSITGT
A0A5Q4DA46      QVPEFPSSD--PRNQFGLMAILAGLALGLVGAIVRDRMDPVLRRPDQVSGDL-GLPILAT
A0A2V7F1M1      PLPYKAAGI--PPWAKLGLGLLLGLLLGCGAAGLAESGNSLLMRPEELERAL-NVRDLGV
A0A2V7KXK7      QEPRRPAAD--FGPLLILLAAMASFGLAVMGVTLRDKMDPKVRYPEQITGRM-QLPILGA
A0A651HKD3      EPPTHPESD--RSTLMAMVVFFGFMGGGLVGALVLDRADRRVRSPADVEWQL-GVQVLGA
A0A2V7QDU7      LLPREPVSP--RRAFSIVLALLGGLTLGLGAALTREHLDRAVHTRHDLLAVT-GRPVLGI
A0A6J4M9S2      PLPGSPVPA--RKGLKLGLGLILGLVLGGATAFMREHMNSVIRHQDEIPELL-GVPGLAI
A0A2V7ITT6      TPPLVPVRN--TAPGVILGAFLGSMALGLVGVVRRDRADPRVRCPEQVTHDI-GLPILGV
A0A2V7NJW1      TPPLVPVRN--TAPGVILGAFLGSMALGLVGVVRRDRADPRVRCPEQVTHDI-GLPILGV
A0A2V7GFB5      VVPLQPVKN--TAPRLLLLGFLGGLGLALAGVVLLDRFDPRVRYPEQVSHDL-GLPILGA
A0A2V7RQ86      VVPLQPVKN--TAPRLLLLGFLGGLGLALAGVVLLDRFDPRVRYPEQVSHDL-GLPILGA
A0A2V7IWX2      VQPYQPIGS--VAPFLVIMAFLASAGLGVLGAVVIDTLDPRFRDPGHVTQGL-GLRILGA
A0A1Q7KE95      VPPQESLGN--STLRFIVLGLAAGLGLGLVGAVVGDRLDPRMRYPEQVTRQM-GLPILGV
A0A1Q7T8X5      VPPQESLGN--STLRFIVLGLAAGLGLGLVGAVVGDRLDPRMRYPEQVTRQM-GLPILGV
A0A2V7MS64      VQPEDPAAS--WTKILIALALLGGLSAGIAGAVVLDQNDKRVQYPEEVTGAL-GLTILGA
A0A2V7Q7N9      VQPEEPTEN--WRPVLIALAFLASLGAGVAGAAVLDHTDRSVRYPQQVTGAM-GLPILGA
A0A2V7IRW6      IEPQQPAAS--WAVLLVVLAFLGSLGAGVAGAVVRDRTDRRVHYPEHVTGTM-GLAILGA
A0A1Q7DVU6      IEPQQPAAS--WSVLLVALAFLGSLGAGVAGAVLRDRTDRHVHYPEHVTGTM-GLAILGA
A0A1Q7JSV2      IEPQQPAAS--WSVLLVALAFLGSLGAGVAGAVLRDRTDRHVHYPEHVTGTM-GLAILGA
A0A2V7FK98      VVPQDPVRN--TAPRVVFLGFAASLALGLCGAVVLDRIDPKVRYPDQVSRGL-GIPILGA
A0A2V7R3Z8      VVPQDPVRN--TAPRVIFLGFAASLALGLCGAVVLDRIDPKVRYPDQVSRGL-GIPILGA
A0A2V7J3C0      VPPQEPLKD--TASRLLVLGFIAGLGLGLVGAVVADRVDPRMRYPDQVTRQM-GLPILGV
A0A2V7KWV9      VAPETPVKN--TAARLLILGLFAGLGLGVVGAVVVDRFDPRVRYPAQVTTDM-GLRILGA
A0A1Q6ZHP2      VVPRRPVKN--TRRRVILLAFFGSFAMAVVGAVLIDRVDPRVRYPDQVSREM-GLTILGA
A0A1Q7R6Z6      VVPRRPVKN--TRRRVILLAFFGSFAMAVVGAVLIDRVDPRVRYPDQVSREM-GLTILGA
A0A2V7FYT7      VVPRRPVKN--TRRRVILLAFFGSFAMAVVGAVLIDRVDPRVRYPDQVSREM-GLTILGA
A0A2V7IGR0      VSPQRPVKN--TAPRIVLFALFASLGLAVAGAVLLDRVDPRVRYPEQVSRGM-GLTILGA
A0A2V7MR23      VVPRRPVKN--TAPRVILLAFFGSFALAVLGAVLIDRIDPRVRYPDQVSREM-GLTILGA
A0A2V7L1V3      VVSREPVSA--MGGRLILLGFCGSFGLAVVGAVLLDRVDPRVRYPDQVSREM-GLAILGA
A0A1Q7E5D3      VVPQRPVKN--RAPRVILLAFFASFGLAVMGAVFIDRVDPRVRYYDQVSREM-GLTILGA
A0A2V7ISE2      VVPRRPVKN--TAPRVILMAFFGSFALAVMGAVLIDRIDPRVRYPDQVSREM-GLTILGA
A0A1Q7J2X5      VVPRRPVKN--TAPRVILMAFVGSFALAVMGAVLIDRIDPRVRYPDQVSREM-GLTILGA
A0A2V7NPD1      VVPRRPVKN--TAPRVILMAFFGSFALAVMGAVLIDRIDPRVRYPDQVSREM-GLTILGA
A0A2V7QPD8      VVPQDPVRN--TAPRVVFLGFAASLALGLCGAVVLDRIDPKLRYPDQVSRGL-GIPILGA
A0A2V7Q8M6      VVSREPVSS--AGGRMILLGFCGSFGLAVVGAVLLDRIDPRVRYPDQVSREM-GLAILGA
A0A2V7QBC3      VVSREPVSS--AGGRLILLGFCGSFGLAVVGAVLLDRIDPRVRYPDQVSREM-GLAILGA
A0A2V7LMU1      VVSRQPVRD--LAGRMILLGFCGSFGLAVVGAVLLDRIDPRVRYPDQVSREM-GLTILGA
A0A2V7PBY9      VVSRRPVQD--LAGRLIVMGFCGSFGLAVVGAVLLDRIDPRVRYPDQVSREM-GLAILGA
A0A3M2BLV5      GAPIE-VTP--RGKINLMLGALLGLILGVGAAFFLEYLDRTVRTSADVETLL-GIPVLGI
A0A2V7KS68      VVPQRPVKN--TTPRLLLLGLIAGLGLGMVGAVVLDRVDPKVRYPEQVSREL-GLPILGV
A0A2V7N4L3      IVPQRPFKN--TAPRLLLMGLIAGLGLGIVAALVLDRADPRVRYPQQVSRDL-GLPILGA
A0A1Q7AZK2      VVPQRPVKN--TAPRLLFMGLLGGLGLGVLGAILLDRADPRVRYPEHVSRDL-GLPIIGA
A0A1Q7TNP7      VVPQRPVKN--TAPRLLFMGLLGGLGLGVLGAILLDRADPRVRYPEHVSRDL-GLPIIGA
A0A1Q7KG39      VVPQRPVKN--TAPRLLFMGLLGGLGLGVLGAILLDRADPRVRYPEHVSRDL-GLPIIGA
A0A1Q7GX75      IVPQRPVKN--TASRILLMGLLAGLGLGIVGAVLLDRIDPSVRYPQQVSRDL-GLPILGA
A0A1Q7LL80      IVPQRPVKN--TASRILLMGLLAGLGLGIVGAVLLDRIDPSVRYPQQVSRDL-GLPILGA
A0A2V7PFU2      VVPQRPVKN--TAPRLLLMGLVAGLGLGVLGAIVLDRADPRVRYPEQVSRDL-GVPILGA
A0A2V7MFS9      IVPQRPIKN--TAPRLLLMGLLAGLGLGVVGAILLDRVDPKVRYPEQVSREL-GLSILGA
A0A2V7T933      VVPQRPVKN--TAPRLLFMGLLGGLGLGVLGAILLDRADPRVRYPEHVSRDL-GLPIIGA
A0A2V7J4D7      VEPQVPVGH--MRAILIFLAFWGGLGVGVAGAVLLDRTDRKVHYPEHVTRAM-GLSILGA
A0A2V7LN90      VQPEEPAEN--WRPLLIALAFLASLGAGVTGAAVLDHTDGRVHYPQQVTGAM-GLPILGA
A0A2V7LFN9      LEPQEPTEN--WAPVLVLFTLITGLGAGVGSAVALDHRDRRVHDPEDITRTM-GLTILGV
A0A2V7MEK4      LEPQEPTEN--WAPVLVLFTLITGLGAGVGSAVALDHRDRRVHDPEDITRTM-GLTILGV
A0A2V7P8B1      TLPTKPAGI--GLVEQLVLGLLVGLMLGAAGAFVADRMASAIARRVQVEH-L-GLSVLGV
A0A7C2QQS2      ERPIVPVPQ--RRGLKLALATMLGLFFGGSLALLLESLNTKVRRPEDLENLL-KVPNLVL
A0A2V7QN41      TAPDRPDRD--LTPLLVCASFVVSLGLAVFGVVMLDELDHKVRYPEHVTHQM-RLSILGA
A0A2V7R603      TAPDRPDRN--LTPLLACASFVLSLGLAVFGVVMLDGLDHKVRYPEHVTHQM-RLSILGA
A0A2V7LJS2      TLPMKPAGI--GLAEQLALGLLVGLILGAGGAFVAERVGSSIARRVEVEH-L-GLSVLGI
A0A1Q7GLJ7      ALPAKPAGI--GLPEQIALGLLVGLMLGSAGAFLAERLGSTIAQRVQVER-L-GMSVFGV
A0A2V7GRE3      ALPAKPAGI--GLPEQIALGLLLGLMLGSGGAFLAERLGSTIAQRVQVEQ-L-GMSVIGV
A0A2V7EU00      VVPHQPIKN--TAPRLILVGLFGGLGLSLLGAVMMDRLDRHFRYPQQVTREM-GLAILGA
A0A1Q6WE01      VSPQEAAKN--TASRLVAFGFVVGLSLGMVAAVVVDRLDPRVHHPDQVTEQM-GLSIIGV
A0A2V7S9K3      VAPQDPVKD--MTRRLIVLGLVAGFGLALVGAVVADRLDPRVRYPDQVTNQM-GLPILGV
A0A1Q7DXB9      VQPYQPIGS--VAPFLVIMAFLASGGLGVLGAVLIDTLDPRFRDPGHVTQGL-GLRILGA
A0A1Q7JD32      VQPYQPIGS--VAPFLVIMAFLASGGLGVLGAVLIDTLDPRFRDPGHVTQGL-GLRILGA
A0A2V7MVP8      DQPYRPLGS--LAPFVLIMSFLASAGLGVLGAVVVDSLDPRFRDPGHVTRDL-GLRILGA
A0A2V7N0A9      VQPTRPATN--TAPLLVVVACLTSFGAGVLGAALRDRADPKVRSPEEVTRTM-GLLILGA
A0A1Q7DLS9      VEPEEPLLD--PTPFLVLVSFLGSLGLAALGAVVLERADRKVRYPDQVTRTM-GLPILGA
A0A1Q7JK96      VEPEEPLLD--PTPFLVLVSFLGSLGLAALGAVVLERADRKVRYPDQVTRTM-GLPILGA
A0A2V7KQV7      SRPARPVVN--ATPLVLLLALVVSLGTGVGGAALLDRADPKIRDPEQVTRAM-GLSILGA
A0A1Q7JGF6      VRPTRPVSD--TAPLVIIVACIMSLGAGVLGAVLLERADPKVRYPDEVTRAI-GLPILGA
A0A2V7SG67      VRPTRPVSD--TAPLVIIVACIMSLGAGVLGAVLLERADPKVRYPDEVTRAI-GLPILGA
A0A1Q7GIK9      VRPTRPASR--TAPLLIIAAFLTSFGAGVAGAVVRERADPKVRYPDQVTSAM-GLPILGA
                                           .   .   :     .                  

A0A2D5ZJF2      VPS----------------MSRKASRPDH-------------------GQQVSRASSSMI
A0A0S8H9P3      IPK----------------ITGDGQRRIS------------------------------L
A0A1E4BBP7      IPT----------------YRNPTSAAAR------------------------LEEASQL
A0A3M2G737      IPS----------------MSLDNANRKK-------------------RKSKSVAENPQL
A0A0H4TUX7      IPHDPA-------------LRRSGNGKPP----------------------------ITI
A0A1G0LUG0      IPDDQR-------------LARGNSHRGT----------------------------VGI
A0A1Q7E3T7      VPR----------------CQDGRNGSSV-------------------------KAVGAV
A0A1G0L906      IP-----------------LDPRGPHDGP-------------------QRNGRRRASISL
A0A1G0LCC0      IP-----------------LDPRGPHDGP-------------------QRNGRRRASISL
A0A2D5ZJE2      VAA----------------LEEAAEAEDE---------------------------SARL
A0A3M2G624      IPQ----------------IESIKNGRRT---------------------HKAKARFETL
W0RI74          VPV----------------VDQSGRQSPE--------------------------QIAQI
A0A3M2BJA6      IPR----------------IRQRGLRPSK----------------TSAAANGASHLGERL
A0A6M4IRY1      VPV----------------INTKGKRKSA-------------------------DEASQV
A0A3D4VBZ5      VPV----------------IGGKG-RRNA-------------------------DQAAQV
C1A5W1          VPV----------------IGGKG-RRNA-------------------------DQAAQV
A0A2V7PX99      LPH----------------VSLRQAPGAS-------------------------LRSAEV
A0A2V7ERC7      VPR----------------FKPNRRGDFQ------------------------LLTLSQA
A0A5Q4D6Y4      IPR----------------LSSGGRKRLK----------------HAAASSNGARGGREL
A0A2V7JTZ5      VPK----------------FKANHRGEFQ------------------------IAMMSQA
A0A3D4YTR6      VPR----------------IKANGRGDIK------------------------LELMSQT
A0A5Q4DA46      IPH----------------VRSRNGRLRP-------------------------EDHEQV
A0A2V7F1M1      IPPLLETSASRPLRRLPIPLFISASRRPE-------------------AASRGEQATWEV
A0A2V7KXK7      VPH----------------VSWRLGANGD--------------------------GPAQV
A0A651HKD3      IPH----------------LRTRGGRVQP-------------------------ADHEHA
A0A2V7QDU7      IPHADGEMWSAR-------LARGKGPGRA------------------RRRPIGAGSRAEL
A0A6J4M9S2      IPR----------------LSNGNGSSSRFGLPAFLSRSNG--------KAHDAEGSTEL
A0A2V7ITT6      LPH----------------VKVRGAGPED-------------------------EHVAQV
A0A2V7NJW1      LPH----------------VKVRGAGPED-------------------------EHVAQV
A0A2V7GFB5      VPH----------------LKARTG------------------------GQLTREQRVQL
A0A2V7RQ86      VPH----------------LKARTG------------------------GQLTREQRVQL
A0A2V7IWX2      LPH----------------LS----------------------------RAGNGEGTAQA
A0A1Q7KE95      LPH----------------VKDRG-------------------------AGPNDEHVIHV
A0A1Q7T8X5      LPH----------------VKDRG-------------------------AGPNDEHVIHV
A0A2V7MS64      VPH----------------LERNG-------------------------NGRAKAGALEA
A0A2V7Q7N9      VPH----------------LNRNG-------------------------GRRKPDGVMQV
A0A2V7IRW6      VPH----------------LERGR-------------------------NGKKAGAVLQV
A0A1Q7DVU6      VPH----------------LERGR-------------------------NGKKSGAVLQV
A0A1Q7JSV2      VPH----------------LERGR-------------------------NGKKSGAVLQV
A0A2V7FK98      VPH----------------LRNLPRGGRG-----------------N--GARVPDDVNEV
A0A2V7R3Z8      VPH----------------LRNLPRGGRG-----------------G--GARVPDDVNEV
A0A2V7J3C0      LPH----------------VKDRA-------------------------AGPDDEEVAQV
A0A2V7KWV9      LPH----------------VKKRA-------------------------GASDDESGPLV
A0A1Q6ZHP2      VPH----------------IRAGARPERS-----------------G-RRVRPPEDVAVV
A0A1Q7R6Z6      VPH----------------IRAGARPERS-----------------G-RRVRPPEDVAVV
A0A2V7FYT7      VPH----------------IRAGARPERS-----------------G-RRVRPPEDVAVV
A0A2V7IGR0      VPH----------------LRKSEAQRQG-----------------T-GPL--SENVAEV
A0A2V7MR23      VPH----------------IRPGARP-ER-----------------SGRRVRPPEDVAVV
A0A2V7L1V3      VPH----------------LRTLPHAGRH-----------------G--RARVPEDVNQV
A0A1Q7E5D3      VPH----------------LRPRAGLGRS-----------------GG--AHPPEDIAVV
A0A2V7ISE2      VPH----------------VRPGARPTPR-----------------NGRRVRPPEDVAVV
A0A1Q7J2X5      VPH----------------VRPGARPTPR-----------------NGRRVRPPEDVAVV
A0A2V7NPD1      VPH----------------VRLGARPTPR-----------------NGRRVRPPEDVAVV
A0A2V7QPD8      VPH----------------LRNLPRGGRG-----------------G--GARVPDDVNEV
A0A2V7Q8M6      VPH----------------LRTLPHAGRH-----------------G--KGRVPEDVNQV
A0A2V7QBC3      VPH----------------LRTLPHAGRH-----------------G--KGRVPEDVNQV
A0A2V7LMU1      VPH----------------LRTLPH-GRH-----------------G--RGRVPEDVNQV
A0A2V7PBY9      VPH----------------MRTLAH-GR------------------G--RGRIPEDVNQV
A0A3M2BLV5      IPR----------------LRKVDEEDDR---------------RAGLPLIVALDPLDPA
A0A2V7KS68      LPH----------------LRTK--------------------------------EPAEV
A0A2V7N4L3      VPH----------------LRAK--------------------------------EPAEV
A0A1Q7AZK2      VPH----------------LRAK--------------------------------EPAEV
A0A1Q7TNP7      VPH----------------LRAK--------------------------------EPAEV
A0A1Q7KG39      VPH----------------LRAK--------------------------------EPAEV
A0A1Q7GX75      LPH----------------LRAK--------------------------------EPAEV
A0A1Q7LL80      LPH----------------LRAK--------------------------------EPAEV
A0A2V7PFU2      VPH----------------LRAK--------------------------------EPVEV
A0A2V7MFS9      VPH----------------LRAK--------------------------------DPVEV
A0A2V7T933      VPH----------------LRAK--------------------------------EPAEV
A0A2V7J4D7      VPH----------------VDWRNGNRDA--------------------------AATQV
A0A2V7LN90      VPH----------------LARNGGTRKP-----------D--------------GVMQV
A0A2V7LFN9      VPH----------------LERKRRAKQP-----------E--------------DGLPV
A0A2V7MEK4      VPH----------------LERKRRAKQP-----------E--------------DGLPV
A0A2V7P8B1      VPR----------------WGRLGNKKGP-----------K--------------SAEAT
A0A7C2QQS2      VPSVTGDGTRPRQVLPVPFIGRDGADRGELPLAESLIIVRH--------------PHAPA
A0A2V7QN41      VPRFD--------------WRQLGNGKTA-----------E--------------AAAPV
A0A2V7R603      VPRFD--------------WRHLGNGKTA-----------E--------------AAAPV
A0A2V7LJS2      VPR----------------WGRETDKKGP-----------G--------------SADAA
A0A1Q7GLJ7      ITH----------------WDRDAREKGV-----------K--------------NPDAV
A0A2V7GRE3      ITH----------------LDRDGAETGM-----------K--------------SPDAV
A0A2V7EU00      VPR----------------IKRGGNGVDP-----------E--------------EARQV
A0A1Q6WE01      LPH----------------VRDRRAGPDD-----------Q--------------QVAHA
A0A2V7S9K3      LPH----------------VRNRAAGPDD-----------E--------------HVAHA
A0A1Q7DXB9      LPH----------------LSRAGNGEGT-----------A-----------------QA
A0A1Q7JD32      LPH----------------LSRAGNGEGT-----------A-----------------QA
A0A2V7MVP8      LPH----------------LSRAKNGEAT-----------T-----------------QA
A0A2V7N0A9      VPH----------------VHRGKDMGDD-----------G----------------VKA
A0A1Q7DLS9      VPH----------------VSWHDGANGD-----------G---------------VSRV
A0A1Q7JK96      VPH----------------VSWHDGANGD-----------G---------------VSRV
A0A2V7KQV7      VPH----------------VHRNGNGNGN-----------GNGRAH------AETDDTGA
A0A1Q7JGF6      VPH----------------VQRGNGKRRA-----------G-----------GEDDIAKA
A0A2V7SG67      VPH----------------VQRGNGKRRA-----------G-----------GEDDIAKA
A0A1Q7GIK9      VPH----------------VRQTAPSRRP-----------AEVRATWRAPEVDAEDGAKA
                :.                                                          

A0A2D5ZJF2      A----------EAYRTIRTAVYFGAP---NGEAR-TILVTSPSPGDGKSTTASNLAIAMA
A0A0S8H9P3      VAAHDPEGVAAEAYRVLRTNIAFSTA---RERPLSSLAFTSPGPDEGKSTSVANLAAVLA
A0A1E4BBP7      I----------ESFRTIALSVRSAFE---GLGPV-QLAVSSPGPGDGKSFVSANLASALA
A0A3M2G737      LTFANPRSTVAESYRQLRTYVQFSK----TDTPVKTIMVSSANPSEGKTTTASNMAVAFA
A0A0H4TUX7      VAREGMDQPAAEAFRALRTNVTFVG----AEKPLQFMSVTSPGPGEGKSTTAVNLAVALA
A0A1G0LUG0      ITQLPHDEPSAEAFRALRTNVTFVG----AERPLQLISVTSPGPGEGKSTTAANLAVALA
A0A1Q7E3T7      I----------EAFRGLRLNLAYAYG---AAGPV-LLVLSSPRSREGKSFIAANLALAFA
A0A1G0L906      ISHAAPDDPTSEAYRALRTNVTFVSA---EQHALQLICVTSPGPGEGKSTTAANLAITLA
A0A1G0LCC0      ISHAAPDDPTSEAYRALRTNVTFVSA---EQHALQLICVTSPGPGEGKSTTAANLAITLA
A0A2D5ZJE2      VTLHEPQSPMAEAYRTIRTNVGFAA----VGAPLRSIAITSSGPQEGKSTTASNLAITIA
A0A3M2G624      VTHLAPKSIPSEAFRSLRTNIQFFDL---SRQSE-AILITSAVSEEGKSTTCANLAITTA
W0RI74          V----------EAFRSLRMNVRYAAG-AGSQRSV-VFGITSPGPGDGKSLVASNLALSFA
A0A3M2BJA6      VAGRDPRNPVSEAYRSLRTNITFSNP---DRPPK-TIVFTSPLPQDGKSTSAANLAITLA
A0A6M4IRY1      V----------EAFRTIRMNVRYAAD---PSRPL-AMTITSPGPNDGKSLISSNLALSFA
A0A3D4VBZ5      V----------ESFRTIRMNVRYAAD---PTRPL-TMTITSPGPNDGKSLISSNLALSFA
C1A5W1          V----------ESFRTIRMNVRYAAD---PTRPL-TMTITSPGPNDGKSLISSNLALSFA
A0A2V7PX99      I----------EALRGLRVRVLHSQG---VEGPL-LLTVTSPSVGDGKSFLSVNLALSFA
A0A2V7ERC7      V----------ESFRTLHLAVRYDFP---GGGPI-SLSVASPGPGDGKSLVSSNLAIAFA
A0A5Q4D6Y4      VTLHESRSSEAEAFRTLRTNLLYAQH----HKPLRAVVVASANPGEGKTTTAANLAITYA
A0A2V7JTZ5      V----------ESFRTLRLALRYDFP---TDAPI-VVGVSSPAAGDGKSLVSSNLALAFA
A0A3D4YTR6      V----------EAFRTIRLALRYDFP---DGLPI-VLGVTSPARGDGKSLVASNLGLAFA
A0A5Q4DA46      V----------EAFRSLRLALAYGRR---GAGPL-VLTISSPGVGDGKSFTTSNLALACA
A0A2V7F1M1      VADSAPLSSAAEAFRLLYSGLLFGWG----EGQR-TILVTSAAPQEGKTVIAANLAVTFA
A0A2V7KXK7      I----------EALRGLRLRVLHAHA---GEGPL-TLTITSPGIGDGKSFVSLNLALSFA
A0A651HKD3      I----------EAFRSIRTGILFAHG---SAGPL-VITVTSPDAGDGKSFTVSNLALCFA
A0A2V7QDU7      A----------EAFVRLATNVSFAGP---NGPPQ-VVTVTSALRGEGKTTSAVNLALASA
A0A6J4M9S2      VTVSNLRSSGAEAYRTLRTNLIFSQA---VRSLR-TILVTSAAPSEGKTTTSSNLAVTFA
A0A2V7ITT6      I----------EAMRSVRLSLSQTHG---GGGPM-LVTVSSPGIGDGKSFVSANLALAYS
A0A2V7NJW1      I----------EAMRSVRLSLSQTHG---GGGPM-LVTVSSPGIGDGKSFVSANLALAYS
A0A2V7GFB5      V----------EAMRGVCLGVSYTYG---AAGPV-VVAVSSPGPGDGKSFITANLAVTFA
A0A2V7RQ86      V----------EAMRGVCLGVSYTYG---AAGPV-VVAVSSPGPGDGKSFITANLAVTFA
A0A2V7IWX2      I----------EAMRTVRVKLQHASN---GGNPL-LLTVTSPGVGEGKSLVSANLALAFA
A0A1Q7KE95      I----------EAMRSVRLSLIHFYG---GNGPV-VVTVTSPGIGDGKSFLSANLALACA
A0A1Q7T8X5      I----------EAMRSVRLSLIHFYG---GNGPV-VVTVTSPGIGDGKSFLSANLALACA
A0A2V7MS64      V----------EALRAIRLNLLHAHG---A-GPT-VVTVTSPGHSDGKSFVASNVAVAFA
A0A2V7Q7N9      V----------EAVRGIRLNVLHAHG---T-GPI-VVTVTSPGRSDGKSFLASNLALAFA
A0A2V7IRW6      V----------EAVRGIRLNVLHAHG---A-GPA-VLTVTSPGRSDGKSFVASNLALAFA
A0A1Q7DVU6      V----------EAVRGIRLNVLHAHG---A-GPA-VLTVTSPGRSDGKSFLASNLALAFA
A0A1Q7JSV2      V----------EAVRGIRLNVLHAHG---A-GPA-VLTVTSPGRSDGKSFLASNLALAFA
A0A2V7FK98      V----------EALRGVCLNLVYAHG---GRAPL-LVTITSPGAGDGKSFISANLAHTFA
A0A2V7R3Z8      V----------EALRGVCLNLVYAHG---GRAPL-LVTITSPGAGDGKSFISANLAHTFA
A0A2V7J3C0      I----------EAMRSVRLSLMHFYG---GNGPV-VVTVTSPGAGDGKSFVSANLALACA
A0A2V7KWV9      I----------ETMRGVRLSLIHAYG---TAGPL-VVTITSPAPGDGKSFVSANLALACA
A0A1Q6ZHP2      V----------EALRGVCLNLVYTHG---AVAPL-VVTITSPGAGDGKSFLAANLGHTFA
A0A1Q7R6Z6      V----------EALRGVCLNLVYTHG---AVAPL-VVTITSPGAGDGKSFLAANLGHTFA
A0A2V7FYT7      V----------EALRGVCLNLVYTHG---AVAPL-VVTITSPGAGDGKSFLAANLGHTFA
A0A2V7IGR0      L----------EALRGVCLNLEHAYG---TAGPL-IAAVTSPGPGEGKSFIAANLAYTFA
A0A2V7MR23      V----------EALRGVCLNLVYTHG---AVAPL-VVTITSPGAGDGKSFLAANLGHTFA
A0A2V7L1V3      V----------EALRGVCLNLVYAHG---GRAPL-LVTVTSPGAGDGKSFLAANLGHTFA
A0A1Q7E5D3      V----------EALRGACLNLVYAHG---AEGPL-LVTITSPGAGDGKSFLAANLARTFV
A0A2V7ISE2      V----------EALRGVCLNLVYTHG---AASPM-LVTITSPGAGDGKSFLAANLGHTFA
A0A1Q7J2X5      V----------EALRGVCLNLVYTHG---AESPM-LVTITSPGAGDGKSFLAANLGHTFA
A0A2V7NPD1      V----------EALRGVCLNLVYTHG---AASPM-LVTVTSPGAGDGKSFLAANLGHTFA
A0A2V7QPD8      V----------EALRGVCLNLVYAHG---GRAPL-LVTITSPGAGDGKSFISANLAHTFA
A0A2V7Q8M6      V----------EALRGVCLNLVYAHG---GRAPL-LVTVTSPGAGDGKSFLAANLAHTFA
A0A2V7QBC3      V----------EALRGVCLNLVYAHG---GRAPL-LVTVTSPGAGDGKSFLAANLAHTFA
A0A2V7LMU1      V----------EALRAVCLNLVYAHG---GRAPL-LVTITSPGAGDGKSFLAANLAHTFA
A0A2V7PBY9      V----------EALRGVCLNLVYAHG---GRAPL-LVTVTSPGAGDGKSFIAANLAHTFA
A0A3M2BLV5      A----------EAYRNLRMNLMFMST---EDEPIRTILFSSPGPHEGKSTTAVNFAVMLA
A0A2V7KS68      V----------EALRGLRLNVIHEYGTAEAAQPL-IFTVTSPGPGDGKTFLSSNLALAFA
A0A2V7N4L3      I----------EALRGIRLSVLHEHG---PG-PL-VVTITSPEQGDGKSFMSANLAMSFA
A0A1Q7AZK2      V----------EALRGVRLSLVHEYG---PG-PL-LVTVTSPGPGDGKSFLSANLALTFA
A0A1Q7TNP7      V----------EALRGVRLSLVHEYG---PG-PL-LVTVTSPGPGDGKSFLSANLALTFA
A0A1Q7KG39      V----------EALRGVRLSLVHEYG---PG-PL-LVTVTSPGPGDGKSFLSANLALTFA
A0A1Q7GX75      V----------EALRGVRLNLLHEYG---PG-PV-VLTISSPGSGDGKSFLSANLGLTFA
A0A1Q7LL80      V----------EALRGVRLNLLHEYG---PG-PV-VLTISSPGSGDGKSFLSANLGLTFA
A0A2V7PFU2      I----------EALRGLRLNVLNEYG---AETPV-LFTVTSPGPGDGKSFLSANLALAFA
A0A2V7MFS9      V----------EALRGVRLNLMNEHG---PG-PL-LVTVTSPGPGDGKSFLSANLALAFA
A0A2V7T933      V----------EALRGVRLSLVHEYG---PG-PL-LVTVTSPGPGDGKSFLSANLALTFA
A0A2V7J4D7      I----------ESLRGVRLNVVHRHG---TAGPV-RLTVTSPGKSDGKSFVASNLALAFA
A0A2V7LN90      V----------EAVRGIRLNVQHAHG---T-GPV-VVTVTSAGRSDGKSFLASNLALAFA
A0A2V7LFN9      L----------EAMRGICLNVLHSHG---V-GPV-IVTVTSPGRADGKSFVASNLAVAFA
A0A2V7MEK4      L----------EAMRGICLNVLHSHG---V-GPV-IVTVTSPGRADGKSFVASNLAVAFA
A0A2V7P8B1      V----------EAFRGIRLNVLNAHG---ATGPV-VVGVTSPGSGDGKSFVSSNLALAFA
A0A7C2QQS2      S----------EAYRALRTSLLFAQS---VPIRR-VV-ITSAGAAEGKTTVASNLAAAFA
A0A2V7QN41      V----------EALRGLRLRLSHA-G---GSGPL-LVTVTSPGVGEGKSFLSCNLALAFA
A0A2V7R603      V----------EALRGLRLRLSHA-G---GSGPL-LVTVTSPGVGEGKSFLSCNLALAFA
A0A2V7LJS2      V----------EAFRGIRLNVLNAHG---AAGPA-VVAVTSPGSGDGKSFVSSNLALAFA
A0A1Q7GLJ7      V----------EAFRGLRLTLVNEYG---APGPI-VVTVTSPGSGDGKSFVSSNLALAFA
A0A2V7GRE3      V----------EAFRGLRLSLVNEYG---APGPL-VITVTSPGSGDGKSFVSSNLSLAFA
A0A2V7EU00      I----------EALRTVRLNLTHAYG---SAGPL-LVTITSPGPGDGKSFVSGNLARAFA
A0A1Q6WE01      I----------EAMRSIRLSLTHAHG---AAGPM-LVTISSPGVGDGKSFVSANLALAFA
A0A2V7S9K3      I----------EAMRSVRLSVSHAYG---AAGPM-VLTVSSPGAGDGKSFVAANLALAFA
A0A1Q7DXB9      I----------EAMRTVRVKLQHASN---GGNPL-LLTVTSPGVGEGKSLVSANLALAFA
A0A1Q7JD32      I----------EAMRTVRVKLQHASN---GGNPL-LLTVTSPGVGEGKSLVSANLALAFA
A0A2V7MVP8      I----------EAMRTVRVKLQHACN---GGSPL-LLTVTSPGVGEGKSLVSANLALAFA
A0A2V7N0A9      V----------EALRGIRLNVQYAYG---AAGPL-VLTVSSPGRGEGKSFVTSNLAQAFA
A0A1Q7DLS9      I----------EALRGIRLNVLHAYG---TAGPL-LVTVTSPGRSDGKSFLTSNLAVAFV
A0A1Q7JK96      I----------EALRGIRLNVLHAYG---TAGPL-LVTVTSPGRSDGKSFLTSNLAVAFV
A0A2V7KQV7      L----------EALRGIRLNVQHAYG---AAGPL-LITVTSPGRGDGKSFVTCNLALAFA
A0A1Q7JGF6      V----------EALRGIRLNLQHAYG---AAGPL-LITVSSPGRGEGKSFVTSNLAQAFA
A0A2V7SG67      V----------EALRGIRLNLQHAYG---AAGPL-LITVSSPGRGEGKSFVTSNLAQAFA
A0A1Q7GIK9      V----------EALRGIRLNVHHASG---AVGPL-LATITSPGRGEGKSFVSANLAYAFS
                           *:       :                 .:*.   :**:    *..    

A0A2D5ZJF2      QAGQRTLLMDSDFRKPVQHVIFE-MDDKQGLSSVLSGQATL--DE---VL-RPSEVAGLD
A0A0S8H9P3      DRGDRTLLVDADLRRGTLHEDFD-LLRSPGLSDLLVGELDP--RE---AI-RPAVRPALD
A0A1E4BBP7      DSGYRTVIVDGDIRRGTLHDIFAPCAQAPGLVDYLAGEATL--DE---VLRPTQQHINLS
A0A3M2G737      TMGKKVLLIDCDMRKPQLHNRFS-LDREPGLSNIFFYTAAV--EK---IC-HKTSVDNLD
A0A0H4TUX7      QGGQRTLLIDGDLRRPLIHRAFA-LVQEPGLTDVLVGRATA--RE---AV-RPDAAPGLD
A0A1G0LUG0      QSGQRTLLVDADLRRPQVHRAFS-LVQEPGLTDVLIGRVPA--RE---AI-RPEVQPQLD
A0A1Q7E3T7      QANYRTLLIDGDTRRGALHKVLA-VARKPGLTDFLGGDVSW--GE---II-QVTRHGTLH
A0A1G0L906      QQGARTLLVDADLRRPVVHRAFN-LVQEHGLTDILVGTATL--RE---TV-RPNLIPKLD
A0A1G0LCC0      QQGARTLLVDADLRRPVVHRAFN-LVQEHGLTDILVGTATL--RE---TV-RPNLIPKLD
A0A2D5ZJE2      QSGKRTLLLDADLRRPVLHKLFS-LKRQKGVTDHLAGNATL--EE---VI-QKTEIEGLH
A0A3M2G624      QVGRKTLLIDGDLRKPVIHHLFE-APSEPGLTDVLLGRYTW--QE---VI-HSTSVPGLD
W0RI74          EGGWRTVLIDADTRRGQLNATFD-TPAVPGLVEYLEGTSLF--GE---VC-YPTRHDNLT
A0A3M2BJA6      QQGTRVLLVDADLRRGVLNNVFD-LPREPGLSDVITGQAKL--SEALRVV-DLGESGRMH
A0A6M4IRY1      EAGARTLLIDGDIRRGELAKTFG-TQSRPGLVEYLDGTALI--AE---VLHPATAHPNLT
A0A3D4VBZ5      ESGLRTLLIDGDIRRGELAKTFK-IHSRPGLVEYLEGSALL--AE---VLNPIASHANLT
C1A5W1          ESGLRTLLIDGDIRRGELAKTFK-IHSRPGLVEYLEGSALL--AE---VLNPIASHANLT
A0A2V7PX99      YAGYRTLLIDGDVRRGTQHRVVD-AASEPGLTDVLAGQAAA--EA---AV-QQTGYPNLS
A0A2V7ERC7      SAGYRTLLIDGDVRCGTQHSTFS-VSPTPGLVDYLRSATGV--EG---AI-RTTSFSNLF
A0A5Q4D6Y4      QQGLSVVLVDCDLRKPRVGELFG-MERRPGMTELVLGQATL--EE---CARPFVPAENLF
A0A2V7JTZ5      SAGSRTLLIDGDVRCGGLHNTFE-IPVTPGLVDYLNGHAAV--DS---IV-RSTTSENLF
A0A3D4YTR6      SAGSRTLLIDGDVRCGGLHNTFG-IPVTPGLVDYLHGLASV--ES---IV-RSTASKNLF
A0A5Q4DA46      ELGHRTLVIDGDVRRGTLHTLFN-LSRRPGLTDFLAGEAEL--EA---VV-QSTEHDTMW
A0A2V7F1M1      REGVRVLLVDCDLRRPRLHRVFG-VAPAPGLIELLKADRATLADSPGGPLRRPTKIAGLW
A0A2V7KXK7      DAGYRTLLVDGDTRRGVQHKALK-TPSTPGLTDVVAGRVAL--DA---AL-RLTSYPGLT
A0A651HKD3      ELGRRTVIVDGDVRRGIQHKLLD-VERKPGLTDCLSGQATL--EE---VL-SPAEHPLLS
A0A2V7QDU7      N-GRRVLLIDADLRCGTIHALFR-LSRTPGLAEVLAGWMPLENAV---RRMDTGDGTHVD
A0A6J4M9S2      QQGLRVLLVDCDLRKARLHKVFG-VPREPGLTQLVLGHNAM--TE---VI-HSTPVDGLY
A0A2V7ITT6      GAGQRTLLIDGDVRRGSLHRAML-TQRTPGLTDVLAKRAPL--ER---VT-QATSYTALE
A0A2V7NJW1      GAGQRTLLIDGDVRRGSLHRAML-TQRTPGLTDVLAKRAPL--ER---VT-QATSYTALE
A0A2V7GFB5      DAGRRTLLVDGDLRRGAQHRLFG-ADRRPGLTDVLRGDVPL--EA---GL-RPTGYDALT
A0A2V7RQ86      DAGRRTLLVDGDLRRGAQHRLFG-ADRRPGLTDVLRGDVPL--EA---GL-RPTGYDALT
A0A2V7IWX2      YAGLRTVVIDGDIRRGALHRLLR-GSRRPGLTDHLTGRAPL--EK---VL-QTTPYKCLS
A0A1Q7KE95      EAGQPTLLIDGDARRGGLHRALR-RPRKPGLTDCLAGAAPL--EG---VT-QTTMYPCLD
A0A1Q7T8X5      EAGQPTLLIDGDARRGGLHRALR-RPRKPGLTDCLAGAAPL--EG---VT-QTTMYPCLD
A0A2V7MS64      DAGFRTLLIDGDVRKGVLHRTLK-APRLPGLVDVLMGKVPV--AQ---AI-QSTTYRTLS
A0A2V7Q7N9      DAGSRTLLVDGDIRCGRLHRVLQ-LARKPGLTDLLGGEAAE--EQ---VL-QATAYRTLT
A0A2V7IRW6      DAGYRTLLVDGDVRCGTLHRALK-LARKPGLVDVLGGKAST--EL---VV-QATSYRALS
A0A1Q7DVU6      DAGYRTLLVDGDVRCGTLHRALK-LARKPGLVDVLGGKAST--EL---VV-QATSYRALS
A0A1Q7JSV2      DAGYRTLLVDGDVRCGTLHRALK-LARKPGLVDVLGGKAST--EL---VV-QATSYRALS
A0A2V7FK98      DGGHRTLLIDADIRRGVLHRRLS-VRRRPGLSDFLRGEAQL--DA---IV-QATQFPALS
A0A2V7R3Z8      DGGHRTLLIDADIRRGVLHRRLS-VRRRPGLSDFLRGEAQL--DA---IV-QATQFPALS
A0A2V7J3C0      ESGKATLLIDGDSRRGGLHRILH-RPRKLGLTDHLAGAASL--EA---VT-QSTPFAALD
A0A2V7KWV9      QAGQRTLLIDGDTRRGALHRVLG-GVRRPGLTDFLAGNVSF--EA---LI-QTPNFGSLQ
A0A1Q6ZHP2      EAGHRTLLIDGDLRRGVLHRRLG-ARRRPGVSDFLRGEVPI--EA---IV-QTTPYPSFS
A0A1Q7R6Z6      EAGHRTLLIDGDLRRGVLHRRLG-ARRRPGVSDFLRGEVPI--EA---IV-QTTPYPSFS
A0A2V7FYT7      EAGHRTLLIDGDLRRGVLHRRLG-ARRRPGVSDFLRGEVPI--EA---IV-QTTPYPSFS
A0A2V7IGR0      ESGHRVLLVDADIRRGVLHRRLG-RPRRPGLCDFLRSEAPL--EA---IV-QSTTHPSLA
A0A2V7MR23      EAGHRTLLIDGDLRRGVLHRRLG-ARRRPGVSDFLRGEVPL--EA---IV-QATPYPSFS
A0A2V7L1V3      DGGHRTLLIDADIRRGVLHRRLS-ARRRPGLSDFLRGETPL--DA---VV-QATPYPSLS
A0A1Q7E5D3      EGGHRTLLVDGDNRRGVLHRRLA-ARRRPGLTDLLRGDVTF--EA---IA-QPTPYPGCT
A0A2V7ISE2      EAGHRTLLIDGDIRRGVLHRRLG-ARRRPGLTDFLRGEVPL--EA---IV-QATPYPSFS
A0A1Q7J2X5      EAGHRTLLIDGDLRRGVLHRRLG-ARRRPGLTDFLRGEVPL--EA---IV-QATPYPSFS
A0A2V7NPD1      EAGHRTLLIDGDLRRGVLHRRLG-ARRRPGLTDFLRGEVPL--EA---IV-QATPYPSFS
A0A2V7QPD8      DGGHRTLLIDADIRRGVLHRRLS-VRRRPGLSDFLRGEAQL--DA---IV-QATQFQALS
A0A2V7Q8M6      DGGHRTLLIDADIRRGVLHRRLS-ARRRPGLSDFLRGETPL--DA---IV-QATPYPSLS
A0A2V7QBC3      DGGHRTLLIDADIRRGVLHRRLS-ARRRPGLSDFLRGETPL--DA---IV-QATPYPSLS
A0A2V7LMU1      DGGHRTLLIDADIRRGVLHRRLS-AHRRPGLSDLLRGETPL--DA---IV-QATPYPSLS
A0A2V7PBY9      DGGHRTLLIDADIRRGVLHRRLS-ARRRPGLSDFLRGEAPL--DA---VV-QATPYPALS
A0A3M2BLV5      QQGQRVLLIDADLRRPSLHRAMD-LLREPGLTNLLVGDAEA--RE---AI-RPNVLPNLD
A0A2V7KS68      EGGHRTVLVDADIRRGLLHRRLK-ANRQPGLADYLLGETTA--DE---IV-QQTAYPRLS
A0A2V7N4L3      DAGHKTLLVDGDIRRGVLHRRFK-LSRQPGLVDFLLDEIGK--DQ---IV-QKTAYPHLA
A0A1Q7AZK2      DAGHRTLLVDGDVRRGVLHRRFK-ANRQPGLVDFLLGKAGL--DE---IV-QGTEYPRLA
A0A1Q7TNP7      DAGHRTLLVDGDVRRGVLHRRFK-ANRQPGLVDFLLGKAGL--DE---IV-QGTEYPRLA
A0A1Q7KG39      DAGHRTLLVDGDVRRGVLHRRFK-ANRQPGLVDFLLGKAGL--DE---IV-QGTEYPRLA
A0A1Q7GX75      DGGHKTLLIDGDIRRGVLHRRFK-GNRQPGLVDYLLGDAGH--DA---IV-QKTAYPRLS
A0A1Q7LL80      DGGHKTLLIDGDIRRGVLHRRFK-GNRQPGLVDYLLGDAGH--DA---IV-QKTAYPRLS
A0A2V7PFU2      DGGHRTLLVDGDIRRGTLHRRFK-ANRRPGLVDYLRGEAGIGREL---IV-QQTPYPQLA
A0A2V7MFS9      DGGHRTVLVDGDIRRGVLHRRFK-ANRQPGLVDFLNGEVGH--DQ---IV-QPTPYPRLA
A0A2V7T933      DAGHRTLLVDGDVRRGVLHRRFK-ANRQPGLVDFLLGKAGL--DE---IV-QGTEYPRLA
A0A2V7J4D7      DAGYRTLLVDGDVRRGRLHHTLS-AARRPGLTELLEGSAPQ--DA---AV-QATRYKNLS
A0A2V7LN90      DAGSRTLLVDGDIRCGRLHRVLK-LARKPGLTDLLAGDATP--EQ---VL-QGTAYRTLT
A0A2V7LFN9      DAGYRTLLVDGDVRCGRLHRTLK-LPRRPGLTDLLQGRASK--EQ---AV-QLSAYGMLS
A0A2V7MEK4      DAGYRTLLVDGDVRCGRLHRTLK-LPRRPGLTDLLQGRASK--EQ---AV-QLSAYGMLS
A0A2V7P8B1      YGNHRTLLIDADLRRGALHRTLK-LPRQPGLMDLLVGHATP--EQ---VV-HRTAYQSLD
A0A7C2QQS2      QQGMRVVLVDADLRRPAVHEVFG-VPREPGLSNVLVRQATL--DQ---TL-RPAPIEGLR
A0A2V7QN41      DAGFRTLLIDGDVRRGGQHRMLG-LHREPGLVDFLAGDLPF--ET---VV-QATRHPGLS
A0A2V7R603      DAGFRTLLIDGDVRRGGQHRMLG-LHREPGLVDFLAGDLPF--ET---VV-QATRHPNLS
A0A2V7LJS2      YANHRTLLVDADLRRGALHRALQ-LRREPGLTDLLAAAASP--EQ---VV-KATSHPSLD
A0A1Q7GLJ7      YAKQRTLLVDADLRRGALHRLLN-LRRQPGLTDFLIGDVSR--AP---AL-QTTAYPFLD
A0A2V7GRE3      YAKQRTLLVDADLRRGALHRVLN-LRRQPGLTDFLAGDVSR--AP---VV-QTTSHPCLD
A0A2V7EU00      DAGQRTLLIDGDSRRGVLHRLFK-GLRKPGLTDYLAGVVPL--DA---VV-QRTDHPALW
A0A1Q6WE01      EAGRRTLLIDGDVRRGSLHRAVR-ARRQPGLTDFLAGRAPF--EA---TV-QGTPYPDLQ
A0A2V7S9K3      EGGRRTLLIDGDVRRGGLHRALR-AHRRPGLTDFLAGRVPL--EE---TI-VATSYADLQ
A0A1Q7DXB9      YAGLRTIVIDGDIRRGALHRLLR-GSRRPGLTDHLTGRAPL--EK---VL-QPTPYKGLS
A0A1Q7JD32      YAGLRTIVIDGDIRRGALHRLLR-GSRRPGLTDHLTGRAPL--EK---VL-QPTPYKGLS
A0A2V7MVP8      YAGLRTIVIDGDIRRGALHRLLR-ASRRPGLTDHLTGRAPL--EQ---VL-QATPYKDLS
A0A2V7N0A9      DVGCRTLLIDGDVRLGALHRALR-RARRPGLTDALAGRVTA--DQ---TL-QATDHAFLS
A0A1Q7DLS9      DAGYSTLLIDGDIRRGGLHRVLD-AARTPGLTDLLAGTAAV--QQ---VIQQAKSYPSLA
A0A1Q7JK96      DAGYSTLLIDGDIRRGGLHRVLD-AARTPGLTDLLAGTAAV--QQ---VIQQAKSYPSLA
A0A2V7KQV7      QVGYRTLLIDGDVRCGALHRLLK-AARRPGLTDVLANEVTP--DQ---VV-QSTPYAHLS
A0A1Q7JGF6      DVGYRTLLIDGDVRLGVLHRALR-GTRRPGLTDLLASRATV--DQ---VV-QGTPHPLLS
A0A2V7SG67      DVGYRTLLIDGDVRLGVLHRALR-GTRRPGLTDLLASRATV--DQ---VV-QGTPHQLLS
A0A1Q7GIK9      AVGYRTLLIDGDVRLGALHRTLR-AARRPGLTDVLAGHVEY--AA---VL-QSTPHTRLS
                     .:::* * *       .       *: . .                         

A0A2D5ZJF2      VLRCGPLPPNPSEFINSDAFREMLEELAVKYDRVVIDSPPVMAVSDARILAAGCDITLLV
A0A0S8H9P3      LLPAGKRPPNPSELLGSQAMAKLLASWREEYRWVLFDTPPVLAVTDASVLAALVDGAVLV
A0A1E4BBP7      IVPCGKRRRHGPELLASERMTTLIRDLRTQFDAIIVDTAPLGAGIDPFAIGTATGSMVLV
A0A3M2G737      VICSGIIPPNPAEILSSTRMIEFVKEMRDQYDLIIFDTPPILRVADPSIVSTLVDGVILV
A0A0H4TUX7      VLPSGSIPPNPSELLGSAAMHSLISALRRDYHYIIIDTPPTLPVTDASVVASGADAAILV
A0A1G0LUG0      VLPSGPAPPNPSELLGSHAMHALIGELRRSYDYIVMDTPPTLPVTDAAVVASAADGAILV
A0A1Q7E3T7      FIGCGMRRPDSPELLSSPRMSDLFAQLRANFAVIIVDSPPLGAGVDAFALATITGHLVMV
A0A1G0L906      ILTSGSLPPNPSELLGSEAMHRLLEEVRSHYDNIIFDTPPALAVTDAAVLGAGSDAVILI
A0A1G0LCC0      ILTSGSLPPNPSELLGSEAMHRLLEEVRSHYDNIIFDTPPALAVTDAAVLGAGSDAVILI
A0A2D5ZJE2      VITSGSLPPNPSELLGSDAMARFIEEVGREFDQIIVDTPPVMAVTDALLLSALLDGVIII
A0A3M2G624      IICSGTQPPNPSELLSSPELKSLITTLKEHYDMILFDSPPVIPVADSVALSTNVDGVLLV
W0RI74          IIPSGTRHRRAPELLATPRMQQLVASLAAEFDVVIIDTPPLGAGTDAYAIGTACGQLAVV
A0A3M2BJA6      FLPTGTLPPNPAELLGSERMKTLLRHLEEQFDAIILDSAPLTVVTDAAVLGTNAEGVLLV
A0A6M4IRY1      VMPAGARRKRAPELLATPRLQQLINQMSAEYDVVIVDSPPLGAGFDAYALATATGNLALV
A0A3D4VBZ5      IMPAGVRRKRAPELLATPRLTQLISQMAGEYDVVVVDSPPLGAGYDAFALATATGNMALV
C1A5W1          IMPAGVRRKRAPELLATPRLTQLISQMAGEYDVVVVDSPPLGAGYDAFALATATGNMALV
A0A2V7PX99      ILSCGTRMYRSPELLLLPTLRETIARLRTTYQIIIVDSPPLVAGIDPLVLATVTGNLLVV
A0A2V7ERC7      LLPAGTRKNRAPELLVSDRMTALLLAARQEFEVIIIDSPPFIAGVDAYALGAAAGSMLVV
A0A5Q4D6Y4      ILPSGTLPPNPTELLGGARTREVLQVLQENFDMVILDSPPLSGGADSSILGAAVDGVIMV
A0A2V7JTZ5      LIPRGTRGNRAPELLVSELMSALVHAMRLQFDVVIIDSPPLVAGMDAYALGAAAGSMLIV
A0A3D4YTR6      LIPRGTRRNRAPELLVSDLMNSLVHAMRLQFDVVIIDSPPLVAGIDAYALGAAAGSMLIV
A0A5Q4DA46      VIPSGSRLRDGPELLGTDRMIELLDDVRGRFDVILIDSPPLGAAVDPYLLGTLSGSIMLV
A0A2V7F1M1      LLPCGALPRRTSEVLQPHQLRRLLDDLSGHFDVIILDTPPVLVSADAALLAPLADGAILV
A0A2V7KXK7      FLSSGTRMQRAPERLLSQNMRDLMSKLRSMFDVVIVDSPPLGAGADPLVLGTLTENLLLV
A0A651HKD3      VIPRGSGLQNGPELLSTPAMQDLLAHLKEEFDVILVDSCPIGAAADPVILGTLTGSLALV
A0A2V7QDU7      VLPAGSAVNNASQLLWRADLDGLLVRLRAAYDLIVIDSPPMNVVADATLLAPQSDAVIVV
A0A6J4M9S2      VMASGTLPPNPSELVGGPRMANVLKALSAEFDLVVLDTPPLTAAADAAILGKSADGVLVV
A0A2V7ITT6      FISAGTHFRDAPELLGSDAMVELVTRLRGSYGVILVDSPPLASGVDPYTLGMVTGSLLLV
A0A2V7NJW1      FISAGTHFRDAPELLGSDAMVELVTRLRGSYGVILVDSPPLASGVDPYTLGMVTGSLLLV
A0A2V7GFB5      LLPCGVRTSDAPELLGSAKMPELLARLRGDYDTILVDSPPLGAGIDPFVLGTLTGNLLLV
A0A2V7RQ86      LLPCGVRTSDAPELLGSAKMPELLARLRGDYDTILVDSPPLGAGIDPFVLGTLTGNLLLV
A0A2V7IWX2      FIGCGSRMHNSPELLSAATMVDLLAALRSRYDVVLVDTAPLAAGADPYTMASLTTNLLMV
A0A1Q7KE95      FIGAGSRFRDSPELLGSPAMVELLERVRSQYRVVLVDSPPLGSGVDPYTLGTLTGNLLLV
A0A1Q7T8X5      FIGAGSRFRDSPELLGSPAMVELLERVRSQYRVVLVDSPPLGSGVDPYTLGTLTGNLLLV
A0A2V7MS64      FLPSGTRTQIAPVLVSSAPLPRLLAELRPNYDAVIVDSPPLAAGVDALALGTATGAMVLV
A0A2V7Q7N9      FLGSGTRTHAGPTLISSAALPRALAALRPGYDVIIVDSSPLAAGADAFALGTATGSMLLV
A0A2V7IRW6      FIGSGTRTHTGPSLVSSAALPRLLAALRPSYDAIIVDSPPLAAGADAFAIGTATGSMVLV
A0A1Q7DVU6      FIGSGTRTHTGPSLVSSAALPRLLATLRPGYDAIIVDSPPLAAGADAFAIGTATGSMVLV
A0A1Q7JSV2      FIGSGTRTHTGPSLVSSAALPRLLATLRPGYDAIIVDSPPLAAGADAFAIGTATGSMVLV
A0A2V7FK98      LIGCGTRAYNAPELLGSPAMTSLVNGLRGGYDVVLIDSPPLAAGVDPLILSTLTGTLALV
A0A2V7R3Z8      LIGCGTRAYNAPELLGSPAMTSLVNGLRGGYDVVLIDSPPLAAGVDPLILSTLTGTLALV
A0A2V7J3C0      FIAAGSRYRDSPELLGYPAMVELLEHARAHYAVVIVDSSPLGSGVDPYTLGTLTGSLLLV
A0A2V7KWV9      FIGAGSRIRESPELLGSPRMVELLVRLRAMYPVIIVDSPPLGAGVDPYTLGTMTGAMMLV
A0A1Q6ZHP2      LIGCGTRAYNAPELLGSQTMSQLLTTLRPSYDVILVDSPPLSAGVDPLILGTLTGHLVVV
A0A1Q7R6Z6      LIGCGTRAYNAPELLGSQTMSQLLTTLRPSYDVILVDSPPLSAGVDPLILGTLTGHLVVV
A0A2V7FYT7      LIGCGTRAYNAPELLGSQTMSQLLTTLRPSYDVILVDSPPLSAGVDPLILGTLTGHLVVV
A0A2V7IGR0      LVSCGTRAHHAPELLGSPAMGQFVAGLRTHYDVILFDNPPLAAGVDPLIVGTLTGNLLLV
A0A2V7MR23      LIGCGTRAYNAPELLGSQTMSQLLTTLRPSYDVILVDSPPLSAGVDPLILGTLTGHLVVV
A0A2V7L1V3      LIACGTRAYNAPELLGSPAMSELVTGMRSGYDVILIDSPPLAAGVDPLILGTLTGTLALV
A0A1Q7E5D3      LVGCGTRAHNAPELLGSEAMSQLIRHARRSYDVVVFDSPPLGAGVDPLILGTLTGSLVLV
A0A2V7ISE2      LIGCGTRAYNAPELLGSQTMSQLVTALRPSYDVILVDSPPLSAGVDPLILGTLTGHLVVV
A0A1Q7J2X5      LIGCGTRAYNAPELLGSQTMSQLVTALRPSYDVILVDSPPLGAGVDPLILGTLTGHLVVV
A0A2V7NPD1      LIGCGTRAYNAPELLGSQTMSQLVTALRPSYDVILVDSPPLGAGVDPLILGTLTGHLVVV
A0A2V7QPD8      LIGCGTRAYNAPELLGSPAMTSLVNGLRGSYDVILIDSPPLAAGVDPLILSTLTGTLTLV
A0A2V7Q8M6      LIACGTRAYNAPELLGSPPMSELVNGMRSGYDVILIDSPPLAAGVDPLILGTLTGTLALV
A0A2V7QBC3      LIACGTRAYNAPELLGSPPMSELVNGMRSGYDVILIDSPPLAAGVDPLILGTLTGTLALV
A0A2V7LMU1      LIACGTRAYNAPEMLASPAMSQLVNGMRSGYDVILIDSPPLGAGVDPLILGTLTGTLALV
A0A2V7PBY9      LIGCGTRAYNAPELLGSPRMSELVTGMRSGYDVILFDSPPLAAGVDPLIVGTLTGTLALV
A0A3M2BLV5      MLPSGPFPPNPSELLNSKAMQRLLEELQGKYSHIIVDSPPVLAVTDAALLGAHTDGVVLV
A0A2V7KS68      LIACGTRTQRAPELLDSDAMVTLLTRLRGEYDVVLIDSPPLTAGVDPFVLGTLTGALVLV
A0A2V7N4L3      LIGCGTRTSRAPEVLGSTAMNDLLTEMRGQYDVIVVDSPPLAAGVDSFVLGTVTGTLLVV
A0A1Q7AZK2      FIGCGTRTQRAPEVLGSPAMTQFIADLRNQYDVILVDSPPLTAGVDPFVLGTVTGALLLV
A0A1Q7TNP7      FIGCGTRTQRAPEVLGSPAMTQFIADLRNQYDVILVDSPPLTAGVDPFVLGTVTGALLLV
A0A1Q7KG39      FIGCGTRTQRAPEVLGSPAMTQFIADLRNQYDVILVDSPPLTAGVDPFVLGTVTGALLLV
A0A1Q7GX75      LIGCGTRTQRAPEVLGSPAMNRLLAELRGRYDVIVVDSPPLAAGVDSFIIGTVTGSLLLV
A0A1Q7LL80      LIGCGTRTQRAPEVLGSPAMNRLLAELRGRYDVIVVDSPPLAAGVDSFIIGTVTGSLLLV
A0A2V7PFU2      FIGCGTRTQRAPEVLGSPAMAQLLAELREQYDVIVVDSPPLTAGVDPFILGTATGSLLLV
A0A2V7MFS9      LIGGGTRTQRAPEVLGSQAMTELIAELRGQYDVILVDSPPLTAGVDPFILGTVTGSLLVV
A0A2V7T933      FIGCGTRTQRAPEVLGSPAMTQFIADLRNQYDVILVDSPPLTAGVDPFVLGTVTGALLLV
A0A2V7J4D7      FISCGLRSHAGPALLSSVAMARLLDALRASYEAIIVDSPPLAAGADGLALATVTGSLVLV
A0A2V7LN90      LLAAGTRTHAGPALIGSAALPRALAALRPGYDVIIVDSSPLAAGADAFALATATGSMLLV
A0A2V7LFN9      FLGCGTRTHDGPALVSSAALPRVLAGLRSSYHAIIIDSSPLAAGADAFALGTGTGTLLLV
A0A2V7MEK4      FLGCGTRTHDGPALVSSAALPRVLAGLRSSYHAIIIDSSPLAAGADAFALGTGTGTLLLV
A0A2V7P8B1      FVASGSRRRDAPELIGSARMTEFMSGLRSRYGVIVVDSPPLGAGVDALLVASLAGSLLMV
A0A7C2QQS2      ILTAGTLPPNPAELLGSPAMDEVLEQLDRSADLVVLDTPPVLAAADAAVLAPRVEGVVLV
A0A2V7QN41      FIGCGARRPSAPELLSSDVMTELIDRVREECGVVLVDSPPLAVGVDPYVLATRTGNVLIV
A0A2V7R603      FIGCGARRPSAPELLSSDVMTDLIDRVREECGVVLVDSPPLAVGVDPYVLATRTGNVLIV
A0A2V7LJS2      FLASGSRRGDAPELLGSARMADFMTKLRSSYGVIVVDTPPLGAGVDAFVLASLAGSLLLV
A0A1Q7GLJ7      FLPSGTRRRDAPELMGSAAMVDLVTSLRSTYDVIVLDTAPLGAGVDALALAKLAGNLLMV
A0A2V7GRE3      FIASGTRRRDAPELLGSAAMTDLVTSLRSTYEVIVVDTAPLGAGVDALVLAKLARNLLMV
A0A2V7EU00      FIGSGSRTPDAPELLGAPPMARLLASVRTSYQVILIDSSPLGAGVDPFLLGTLTGSLLIV
A0A1Q6WE01      FIGAGTRFRDSPELLGSGAMSELLARLRASWSVILVDSPPLGSGVDPYTLGTLTSNMLLV
A0A2V7S9K3      FIGAGTRFRDSPELLGSVAMVELLTCVRSSYGVILLDSPPLGSGVDPYTLATLTGSLLLV
A0A1Q7DXB9      FIGCGSRMHNSPELLSAATMVDLLAALRSRYDVVLVDTAPLAAGADPYTMASLTTNLLMV
A0A1Q7JD32      FIGCGSRMHNSPELLSAATMVDLLAALRSRYDVVLVDTAPLAAGADPYTMASLTTNLLMV
A0A2V7MVP8      FIGCGSRMHNSPELLSATTMVDLLAALRSRYDVVLVDTAPLAAGADPYTMASHTKNLLVV
A0A2V7N0A9      FIGAGSRMHRGPELLCSATVPQLITALRPGYDVILVDSAPLAAGVDPYALGVATGNMLLV
A0A1Q7DLS9      FIACGSRTRSGPELLSSTAMAGFVTSLRSRYAVILIDSPPLAAGVDACALGTMTGSLVLV
A0A1Q7JK96      FIACGSRTRSGPELLSSTAMAGFVTSLRSRYAVILIDSPPLAAGVDACALGTMTGSLVLV
A0A2V7KQV7      FIGGGSRLHRGPELLCSEALPRLITAMRPHYDAILVDSPPLAAGVDASALGAVTGSLLVV
A0A1Q7JGF6      FIGAGSRMHRGPELLCSVAMPRLITVMRPSYDVILVDSAPLAAGVDPYALGTATGSMLLV
A0A2V7SG67      FIGAGSRMHRGPELLCSVAMPRLITVMRPSYDVILVDSAPLAAGVDPYALGTATGSMLLV
A0A1Q7GIK9      FLGAGSRMHRGPELLGSAGMPRLLTALRSAYDVILVDSAPLAAGVDPYALGAATGNVLLV
                .:  *      .  :        .         ::.*. *     *   :.       ::

A0A2D5ZJF2      LRAEKSTRKASEQARDGLLAVGGHLLGVVVND----AHHRREGYGYGYYGGYGQYGGYYG
A0A0S8H9P3      VKAGETDRRAGWQAIQQLRRVGARVVGAVLNE--IVLQRGAD---RYYFDYY--YSRSSS
A0A1E4BBP7      LRAGETDRKLAQAKLTVLDRMPIRLVGAILND----IGELPQ---FKYY-YY--LEGYRA
A0A3M2G737      VASGKTPAGGLNFAVETLVKVKANLLGIVLNDFDPKKAYGGYYYGNYYKYYY--YSSYYG
A0A0H4TUX7      LRSGDTQETAAQRALEQLRRVHARIAGAVLNG----VSSRHD----RYYTYY--SYRREP
A0A1G0LUG0      LKSGDTEEVPAQRALEQLRRVHARVAGAVLNG----VNQQKD----QYYTYY--ASRE--
A0A1Q7E3T7      LRPGTTNREVIEAKLDLLHRLPVRVLGAVLND----VQDGPE---YTGYSYY--LEGYEA
A0A1G0L906      LRAGKTEEVAAQRALAQLSRVQARVAGSVLNG----VQKMRD--RYYYYYYY--RKDPRT
A0A1G0LCC0      LRAGKTEEVAAQRALAQLSRVQARVAGSVLNG----VQKMRD--RYYYYYYY--RKDPRT
A0A2D5ZJE2      VEAGETLEQVAKRTKTLVETAARRCLGVVLNN----VDVGGGYGRYGGYHYH--YHYHED
A0A3M2G624      VSAGKTDRHALQRTRDLLHNVNARIMGAVLNN----VRINEIYGYQKHYYYY--DTKKPV
W0RI74          LRSNRTNLKMAKAKLAVLAQLPVTLLGAVLNE----VRTDSG--MYQYYSYD---PDYVL
A0A3M2BJA6      ARANVTERGAIRYSVDQLKHVRAPILGVVLNDIDF-RRDSRYSSSYGRYGYY--YQYYYG
A0A6M4IRY1      LRAGTTDRKMAAAKMATVDTLPVRVMGAVLNG----IKLTGV---YEYYSYY---QDYAA
A0A3D4VBZ5      MRAGVTDRKMAEAKMATVDTLPIRVMGAILNG----IKMTGA---YQYYSYY---QDYAA
C1A5W1          MRAGVTDRKMAEAKMATVDTLPIRVMGAILNG----IKMTGA---YQYYSYY---QDYAA
A0A2V7PX99      LRSEATDLELAAAKLSVADTLPVRTIGAVLNC----VRGHGA---FRYYTYD--LADYAE
A0A2V7ERC7      LRPGVSDRKLAAAKLDIVDRLPIRVLGAVLNG----VPGGGA---YRYYG-----TNYYY
A0A5Q4D6Y4      VRAGETEIEAVRYAARQLHTVGATLLGSVMND-----PDGEA---EKYGAYY--SYGYYG
A0A2V7JTZ5      LRPAVTDRKLASAKLEVLDRLPIRILGAVLNA----VPDGGA---YRYYG-----ADYSY
A0A3D4YTR6      LRPARTDRKLAAAKLDVLDRLPIRILGAVLNA----VPGGGA---YRYYG-----ADYEY
A0A5Q4DA46      FRNGTTNQDVAVSRIEELKRLPVQIVGAVLND----VPAGSA--AYKSYAY---LPGYGV
A0A2V7F1M1      VRAGQTNRSSAERACQYLIAAGAHFLGAVLND------PAGELARYGKY-YY--SYGYPT
A0A2V7KXK7      LRTGQSDINLASTKLEVLNALPVRVIGAVLND----VRSSGV---YRYYMYS--SAEYEL
A0A651HKD3      VRSGTTDSERAEGMLRNLRRFPVRVLGAVVND----VSQGDH---YNYYGY---VPGYGV
A0A2V7QDU7      ARAGRTAPEALNFTLEQLRSVHA-LVWTVLND----ID-------YRRDRVY--GRAYGQ
A0A6J4M9S2      VRAGQTERGAAQHAVGQLNNVGARILGAVLNDPDAKVPRYGG---YYYYDYY----GSEA
A0A2V7ITT6      LRTGATSLELARTKLRVLDRLPIRLLGVVVND----VRPRGV---YRYHSY---LSGYGT
A0A2V7NJW1      LRTGATSLELARTKLRVLDRLPIRLLGVVVND----VRPRGV---YRYHSY---LSGYGT
A0A2V7GFB5      LRTGVSHREVMAAKLEVLRRLPVRLLGAVLND----VPPGAA---YQYYSYY--TPGYEA
A0A2V7RQ86      LRTGVSHREVMAAKLEVLRRLPVRLLGAVLND----VPPGAA---YQYYSYY--TPGYEA
A0A2V7IWX2      LRAGVTDLELAQAKLESFEDLPVRVVGTVLND----VQPKGA---YRYYAYY--VPGYET
A0A1Q7KE95      LRTGTTNLALARTKLTVLDHLPIRLLGVVLND----VRPGGM---YRYYS-Y--LSGYAT
A0A1Q7T8X5      LRTGTTNLALARTKLTVLDHLPIRLLGVVLND----VRPGGM---YRYYS-Y--LSGYAT
A0A2V7MS64      LRTGYSDREMAQNKLQALTHLPIRVLGAVLND----VR-GSR---YKYYSYY--LEGYEA
A0A2V7Q7N9      LRTGVSDRELVQAKLEVLQYLPIRVLGAVLND----VRPGGV---YRYYSYY--LEGYEA
A0A2V7IRW6      LRTGVSDRELAQTKLEVLAHLPIRMLGAVLND----VR-GGL---YRYYSYY--LEGYEV
A0A1Q7DVU6      LRTGVSDRELAQTKLEVLAHLPIRMLGAVLND----VR-GGL---YRYYSYY--LEGYEV
A0A1Q7JSV2      LRTGVSDRELAQTKLEVLAHLPIRMLGAVLND----VR-GGL---YRYYSYY--LEGYEV
A0A2V7FK98      LRTGYSHRDVAAAKLEVLQRLPVRMLGAVLND----VPAGGA---YRYYSYY--LPGYEA
A0A2V7R3Z8      LRTGYSHRDVAAAKLEVLQRLPVRMLGAVLND----VPAGGA---YRYYSYY--LPGYEA
A0A2V7J3C0      LRTGTTNLALARTKLAVLDHLPIRLLGAVLND----VRSDDL---YRHYS-Y--LSGYAT
A0A2V7KWV9      LRTGATNLDLARTKVAMLENLPIRVLGAVLND----VRLGQM---YGEYYGY--MAGYGT
A0A1Q6ZHP2      LRTGFSHRDMASAKLEVLQRLPVRLLGAILNA----VPAGEA---YRYYSYY--LPGYEA
A0A1Q7R6Z6      LRTGFSHRDMASAKLEVLQRLPVRLLGAILNA----VPAGEA---YRYYSYY--LPGYEA
A0A2V7FYT7      LRTGFSHRDMASAKLEVLQRLPVRLLGAILNA----VPAGEA---YRYYSYY--LPGYEA
A0A2V7IGR0      LRTGQSDREMTAAKLEVLQRLPVRLLGAVLND----VPAGAT---YRYYSYY--LPGYEA
A0A2V7MR23      LRTGFSHRDVASAKLEVLQRLPVRLLGAILNA----VPAGDA---YRYYSYY--LPGYEA
A0A2V7L1V3      LRTGYSHRDVAAAKLEMLQRLPVRMLGAILND----VPAGGA---YRYYSYY--LPGYEA
A0A1Q7E5D3      LRTGYSDRDVAAAKLEMLQRLPIRLLGAILND----VPAGAA---YRYYSYY--LPGYEA
A0A2V7ISE2      LRTGYSHRDVAAAKLEVLQRLPVRLLGAILNA----VPAGAA---YRYYSYY--LPGYEA
A0A1Q7J2X5      LRTGYSHRDVAAAKLEVLQRLPVRLLGAILNA----VPAGAA---YRYYSYY--LPGYEA
A0A2V7NPD1      LRTGYSHRDVAAAKLEVLQRLPVRLLGAILNA----VPAGAA---YRYYSYY--LPGYEA
A0A2V7QPD8      LRTGYSHRDVAAAKLEVLQRLPVRMLGAVLND----VPAGGA---YRYYSYY--LPGYEA
A0A2V7Q8M6      LRTGYSHRDVAAAKLEMLHRLPVRLLGAILND----VPAGGA---YRYYSYY--LPGYEA
A0A2V7QBC3      LRTGYSHRDVAAAKLETLQRLPVRLLGAILND----VPAGGA---YRYYSYY--LPGYEA
A0A2V7LMU1      LRTGYSHRDVATAKLEMLQRLPVRLLGAIMND----VPAGGA---YRSYSYY--LPGYEA
A0A2V7PBY9      LRTGYSHRDVAAAKLEVLQRLPIRLLGAILND----VPAGGA---YRYYSYY--LPGYEA
A0A3M2BLV5      LRSGETEQRAAERAVEQLRRVGVRVFGAVLNE----VSTSNA--EESYYLQY--YYGYHP
A0A2V7KS68      LRTGHSNRNITGAKLDMLQRLPVRLLGAVLND----VPRGGAYGYYAYYSYY--LPGYEA
A0A2V7N4L3      LRTGHSHRDITGAKLEMLDRLPIRLLGAVLND----VPRGAAYGYYAYYSYY--LPGYEA
A0A1Q7AZK2      LRTGHSHRDITGAKLEVLDRLPIRLLGAVLND----VPHGAAYGYYSYYSYY--LPGYEA
A0A1Q7TNP7      LRTGHSHRDITGAKLEVLDRLPIRLLGAVLND----VPHGAAYGYYSYYSYY--LPGYEA
A0A1Q7KG39      LRTGHSHRDITGAKLEVLDRLPIRLLGAVLND----VPHGAAYGYYSYYSYY--LPGYEA
A0A1Q7GX75      LRTGHSHRDITGAKLEVLDRLPIRLLGAVLND----VPRGAAYGYYAYYSYY--LPGYEA
A0A1Q7LL80      LRTGHSHRDITGAKLEVLDRLPIRLLGAVLND----VPRGAAYGYYAYYSYY--LPGYEA
A0A2V7PFU2      LRTGHSHRDVTGAKLEMLDRLPIRLLGAVLND----IPREAAYGYYAYYSYY--LPGYEA
A0A2V7MFS9      LRTGHSHREIAGAKLEVLERLPIRLLGAVLND----VPRGAAYGYYAYYSYY--LPGYEA
A0A2V7T933      LRTGHSHRDITGAKLEVLDRLPIRLLGAVLND----VPHGAAYGYYSYYSYY--LPGYEA
A0A2V7J4D7      LRTGVSDRELTETKLGALHHLPVRVLGAVLND----VRPGGA---YRYYSYY--LEGYEV
A0A2V7LN90      LRTGVSDRELAQAKLEVLQYLPIRVLGAVLND----VRLGGV---YRYYSYY--LEGYEA
A0A2V7LFN9      LRTGVSDGGLALAKLEVMSRLPIRVLGAVLND----VRGGSL---YRDYSYY--LEGYET
A0A2V7MEK4      LRTGVSDGGLALAKLEVMSRLPIRVLGAVLND----VRGGSL---YRDYSYY--LEGYET
A0A2V7P8B1      LRLGRTDRELAEAKLELLRAQPIRVLGAVLND----VREGSE---YHAYSYY--LDGYEL
A0A7C2QQS2      ARAGRVNREAVLRAFRQLQSVNARILGTVLNDPDAEVPRYVS---SEAYAYY--YQYY--
A0A2V7QN41      LRAGVSDLDLAAAKLDVLDTLPVRVLGAVLND----VRPYGA---YRYYTYD--AAAYAE
A0A2V7R603      LRAGVSDLDLAAAKLDVLDTLPVRVLGAVLND----VRPYGA---YRYYTYD--AAAYAE
A0A2V7LJS2      LRLGRTDRELAEAKIDLLRQSSTRVLGVVLND----VREGSE---YRAYSYY--MDGYEF
A0A1Q7GLJ7      LRLGRTDRELAEAKLEILRRLPLRLLGAVLND----VRDESE---YRAYAYY--MDGYAL
A0A2V7GRE3      LRLGRTDRVLAEAKLEILRRLPLRLLGAVLND----VRDESE---YRAYAYY--MDGYAL
A0A2V7EU00      LRSGTTDRELAQANLDGLLRLPIRVLGAVLND----IEPRGA---YRYYSY---LSGYAA
A0A1Q6WE01      LRTDATDLSLARTKLSVLDQLPIRLLGVVVND----VRPGGV---YRYYSY---FAGYGT
A0A2V7S9K3      LRTGATNLDLARTKLGMLDHLPIRLLGVVVND----VQPGGA---YRYYSY---LSGYAT
A0A1Q7DXB9      LRAGVTDLELAQAKLESFEDLPVRVVGTVLND----VQPKGA---YRYYAYY--VPGYET
A0A1Q7JD32      LRAGVTDLELAQAKLESFEDLPVRVVGTVLND----VQPKGA---YRYYAYY--VPGYET
A0A2V7MVP8      LRAGVTDLELAQAKLESFDDMPVRVVGSVLND----VRPKGA---YRYYAYY--VPGYET
A0A2V7N0A9      VRPDVTDRAIAEAKVEVLQRLPVRLLGAVLND----VRPGLA---YNHYSYS--LAGYEM
A0A1Q7DLS9      LRTGVSDRELVEAKLDVLERLPIRILGAVLND----VRPGGA---YRSYAYS--LSGYDL
A0A1Q7JK96      LRTGVSDRELVEAKLDVLERLPIRILGAVLND----VRPGGA---YRSYAYS--LSGYDL
A0A2V7KQV7      LRTGVTDRMIAEAKVELLRTLPIRMLGVVLND----VRPGVA---YSYYAYS--LEGYSV
A0A1Q7JGF6      LRTGVTDRTLAEAKVEVLHRLPIRVLGAVLND----VRPGAA---YTYYSYS--LAGSEV
A0A2V7SG67      LRTGVTDRTLAEAKVEVLHRLPIRVLGAVLND----VRPGAA---YTYYSYS--LAGSEV
A0A1Q7GIK9      LRTGVTDRSLAEAKVEVLHRLPLRVLGAILND----VRPGSA---YSYYSYS--LEGYEV
                                            ::*                             

A0A2D5ZJF2      RDRAEGRREGGRGSSGTEKGSSTG------------------------------------
A0A0S8H9P3      ------------------------------------------------------------
A0A1E4BBP7      LEGAEEGNAALLGSGSGGNGRG--------------------------------------
A0A3M2G737      SDRDKKKQRSIKLKS---------------------------------------------
A0A0H4TUX7      ARRGLLTAGSPRAGGCSPFGRSSAIPSENQ------------------------------
A0A1G0LUG0      ---------APRRSRTSLFTR---------------------------------------
A0A1Q7E3T7      TAEGVREHHTVLRSSG--------------------------------------------
A0A1G0L906      TRGLLSALREQIAHLF--------------------------------------------
A0A1G0LCC0      TRGLLSALREQIAHLF--------------------------------------------
A0A2D5ZJE2      ADNKTNSRATSIWRAARGVAIVATFFAIAAAMWHQRRPTLAEADTVESRMVPNTEDGRIA
A0A3M2G624      KV----------------------------------------------------------
W0RI74          PEETPALSAGGGGGTSVAVREG--------------------------------------
A0A3M2BJA6      DNGKKKK-----------------------------------------------------
A0A6M4IRY1      QDEEPVARISDGSARSDKPLPAKIS-----------------------------------
A0A3D4VBZ5      EDEQPERLSAGSGSSRPVALSGGVSDA---------------------------------
C1A5W1          EDEQPERLSAGSGSSRPVALSGGVSDA---------------------------------
A0A2V7PX99      PDPAVAATRRDGWRHILGGRSS--------------------------------------
A0A2V7ERC7      GDTRAKEHVGNLATPKGLLLNA--------------------------------------
A0A5Q4D6Y4      STE---------------------------------------------------------
A0A2V7JTZ5      KDEVLKEPIADIATPKGLLVRS--------------------------------------
A0A3D4YTR6      KGDSSTEPIADLATPQGLVLRA--------------------------------------
A0A5Q4DA46      ADEEPETREAPEGRRLVARAEA--------------------------------------
A0A2V7F1M1      PSD---------------------------------------------------------
A0A2V7KXK7      VDDEGQTREALPSILGGRT-----------------------------------------
A0A651HKD3      DEVEQLHLVAGATQARGAVGSGGR------------------------------------
A0A2V7QDU7      RASYLETE----------------------------------------------------
A0A6J4M9S2      ------------------------------------------------------------
A0A2V7ITT6      ADEAEYAMGPPRVRGVL-------------------------------------------
A0A2V7NJW1      ADEAEYAMGPPRVRGVL-------------------------------------------
A0A2V7GFB5      TDE----------KPARLTPSVG-------------------------------------
A0A2V7RQ86      TDE----------KPARLTPSVG-------------------------------------
A0A2V7IWX2      KEE----ADLGPEKPVLGVPSV--------------------------------------
A0A1Q7KE95      TNEREGYAVAGRQARGVL------------------------------------------
A0A1Q7T8X5      TNEREGYAVAGRQARGVL------------------------------------------
A0A2V7MS64      RDE--QPASRLMRAPE--------------------------------------------
A0A2V7Q7N9      KDEPAEAAGQVLQAPEQVLPAPE-------------------------------------
A0A2V7IRW6      KEEP-EPAWQLVRAPE--------------------------------------------
A0A1Q7DVU6      KEEP-EPAWQLVRAPE--------------------------------------------
A0A1Q7JSV2      KEEP-EPAWQLVRAPE--------------------------------------------
A0A2V7FK98      MDE----NSGSPRVPV--------------------------------------------
A0A2V7R3Z8      MDE----NSGSPRVPV--------------------------------------------
A0A2V7J3C0      VDEQEGYAIAGRKAHGVL------------------------------------------
A0A2V7KWV9      TTEDGGTRIARRRLQGAL------------------------------------------
A0A1Q6ZHP2      VDEEAERASGGKGQPFVI------------------------------------------
A0A1Q7R6Z6      VDEEAERASGGKGQPFVI------------------------------------------
A0A2V7FYT7      VDEEAERASGGKGQPFVI------------------------------------------
A0A2V7IGR0      VDEEAQ------AQPLVT------------------------------------------
A0A2V7MR23      VDEEAEQASGGKGQPFVI------------------------------------------
A0A2V7L1V3      ADE----NSGSRRVPV--------------------------------------------
A0A1Q7E5D3      VD-EGERNSGPKVRSLVI------------------------------------------
A0A2V7ISE2      VDEEAERTSGGNKQPFVI------------------------------------------
A0A1Q7J2X5      VDEEAERTSGGNKQPFVI------------------------------------------
A0A2V7NPD1      VDEEAERTSGGNKQPFVI------------------------------------------
A0A2V7QPD8      MDE----NSGTPRVPV--------------------------------------------
A0A2V7Q8M6      ADE----NSGSR------------------------------------------------
A0A2V7QBC3      ADE----NSGSRRVPV--------------------------------------------
A0A2V7LMU1      MDE----ERGSGRVPV--------------------------------------------
A0A2V7PBY9      ADE----EAGSRRVPV--------------------------------------------
A0A3M2BLV5      REETGWQRLRSGLSRARFW-----------------------------------------
A0A2V7KS68      VEERD-GARQTGPVVVTE------------------------------------------
A0A2V7N4L3      VDESKHGRRTPAPTVV--------------------------------------------
A0A1Q7AZK2      VDEGD--RQASGARVV--------------------------------------------
A0A1Q7TNP7      VDEGD--RQASGARVV--------------------------------------------
A0A1Q7KG39      VDEGD--RQASGARVV--------------------------------------------
A0A1Q7GX75      VEESS--GQASAPRVV--------------------------------------------
A0A1Q7LL80      VEESS--GQASAPRVV--------------------------------------------
A0A2V7PFU2      VDEGA--GRTSGPRVV--------------------------------------------
A0A2V7MFS9      VDEGD-GRRTSGPQVV--------------------------------------------
A0A2V7T933      VDEGD--RQASGARVV--------------------------------------------
A0A2V7J4D7      HDEPAAADVHVLRGPER-------------------------------------------
A0A2V7LN90      TDEPAGAEGEVLRGPE--------------------------------------------
A0A2V7LFN9      QDEPDEARGQVLRAPEYP------------------------------------------
A0A2V7MEK4      QDEPDEARGQVLRAPEYP------------------------------------------
A0A2V7P8B1      GDEPLFEPLV-SRPRGTTPVAGR-------------------------------------
A0A7C2QQS2      ---------------------GRH------------------------------------
A0A2V7QN41      ANGAASQRRG----GSAGVLWGQS------------------------------------
A0A2V7R603      GNGAIGQRRP----GSAGVLWGRS------------------------------------
A0A2V7LJS2      TGEPLFQPLGDATKRGRPPVTARQ------------------------------------
A0A1Q7GLJ7      TNEPPFRPLG-G-KQGASSHAAG-------------------------------------
A0A2V7GRE3      TNEPLFRPLA-GNKQGVGSRPAR-------------------------------------
A0A2V7EU00      EDEPTAPPQQWAVARRLPGASSPDA-----------------------------------
A0A1Q6WE01      RDEGVA-----IATHRVRGVL---------------------------------------
A0A2V7S9K3      ADEGTA-----SAAHRLRGVL---------------------------------------
A0A1Q7DXB9      KEEADLGPEKPVLGVPSV------------------------------------------
A0A1Q7JD32      KEEADLGPEKPVLGVPSV------------------------------------------
A0A2V7MVP8      KEEADLGPEKPVLGVPGD------------------------------------------
A0A2V7N0A9      QEEDSGREAGPILLPDSP------------------------------------------
A0A1Q7DLS9      HDEEEPPKR---ILRSVE------------------------------------------
A0A1Q7JK96      HDEEEPPKR---ILRSVE------------------------------------------
A0A2V7KQV7      REEDPDGRAGT-LLPRRS------------------------------------------
A0A1Q7JGF6      QEEDPGGVTSEILLPDRS------------------------------------------
A0A2V7SG67      QEEDPGGVTSEILLPDRS------------------------------------------
A0A1Q7GIK9      RDEDPEGKAGKMLLPDPA------------------------------------------
                                                                            

A0A2D5ZJF2      ---------
A0A0S8H9P3      ---------
A0A1E4BBP7      ---------
A0A3M2G737      ---------
A0A0H4TUX7      ---------
A0A1G0LUG0      ---------
A0A1Q7E3T7      ---------
A0A1G0L906      ---------
A0A1G0LCC0      ---------
A0A2D5ZJE2      GLEEGVVGR
A0A3M2G624      ---------
W0RI74          ---------
A0A3M2BJA6      ---------
A0A6M4IRY1      ---------
A0A3D4VBZ5      ---------
C1A5W1          ---------
A0A2V7PX99      ---------
A0A2V7ERC7      ---------
A0A5Q4D6Y4      ---------
A0A2V7JTZ5      ---------
A0A3D4YTR6      ---------
A0A5Q4DA46      ---------
A0A2V7F1M1      ---------
A0A2V7KXK7      ---------
A0A651HKD3      ---------
A0A2V7QDU7      ---------
A0A6J4M9S2      ---------
A0A2V7ITT6      ---------
A0A2V7NJW1      ---------
A0A2V7GFB5      ---------
A0A2V7RQ86      ---------
A0A2V7IWX2      ---------
A0A1Q7KE95      ---------
A0A1Q7T8X5      ---------
A0A2V7MS64      ---------
A0A2V7Q7N9      ---------
A0A2V7IRW6      ---------
A0A1Q7DVU6      ---------
A0A1Q7JSV2      ---------
A0A2V7FK98      ---------
A0A2V7R3Z8      ---------
A0A2V7J3C0      ---------
A0A2V7KWV9      ---------
A0A1Q6ZHP2      ---------
A0A1Q7R6Z6      ---------
A0A2V7FYT7      ---------
A0A2V7IGR0      ---------
A0A2V7MR23      ---------
A0A2V7L1V3      ---------
A0A1Q7E5D3      ---------
A0A2V7ISE2      ---------
A0A1Q7J2X5      ---------
A0A2V7NPD1      ---------
A0A2V7QPD8      ---------
A0A2V7Q8M6      ---------
A0A2V7QBC3      ---------
A0A2V7LMU1      ---------
A0A2V7PBY9      ---------
A0A3M2BLV5      ---------
A0A2V7KS68      ---------
A0A2V7N4L3      ---------
A0A1Q7AZK2      ---------
A0A1Q7TNP7      ---------
A0A1Q7KG39      ---------
A0A1Q7GX75      ---------
A0A1Q7LL80      ---------
A0A2V7PFU2      ---------
A0A2V7MFS9      ---------
A0A2V7T933      ---------
A0A2V7J4D7      ---------
A0A2V7LN90      ---------
A0A2V7LFN9      ---------
A0A2V7MEK4      ---------
A0A2V7P8B1      ---------
A0A7C2QQS2      ---------
A0A2V7QN41      ---------
A0A2V7R603      ---------
A0A2V7LJS2      ---------
A0A1Q7GLJ7      ---------
A0A2V7GRE3      ---------
A0A2V7EU00      ---------
A0A1Q6WE01      ---------
A0A2V7S9K3      ---------
A0A1Q7DXB9      ---------
A0A1Q7JD32      ---------
A0A2V7MVP8      ---------
A0A2V7N0A9      ---------
A0A1Q7DLS9      ---------
A0A1Q7JK96      ---------
A0A2V7KQV7      ---------
A0A1Q7JGF6      ---------
A0A2V7SG67      ---------
A0A1Q7GIK9      ---------
                         

© 1998-2021Legal notice