BYKdb

Dataset for cluster tadcd of phylum gemmatimonadetes

[Download (right click)] [Edit] [Sequences] [Repertoires]

91 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2D5ZJF2      ------------------------------------------------------------
A0A0S8H9P3      ------------------------------------------------------------
A0A1E4BBP7      ------------------------------------------------------------
A0A3M2G737      ------------------------------------------------------------
A0A0H4TUX7      ------------------------------------------------------------
A0A1G0LUG0      ------------------------------------------------------------
A0A1Q7E3T7      ------------------------------------------------------------
A0A1G0L906      ------------------------------------------------------------
A0A1G0LCC0      ------------------------------------------------------------
A0A2D5ZJE2      ------------------------------------------------------------
A0A3M2G624      ------------------------------------------------------------
W0RI74          ------------------------------------------------------------
A0A3M2BJA6      ------------------------------------------------------------
A0A3D4VBZ5      ------------------------------------------------------------
C1A5W1          ------------------------------------------------------------
A0A2V7PX99      ------------------------------------------------------------
A0A2V7ERC7      ------------------------------------------------------------
A0A5Q4D6Y4      ------------------------------------------------------------
A0A2V7JTZ5      ------------------------------------------------------------
A0A3D4YTR6      ------------------------------------------------------------
A0A5Q4DA46      ------------------------------------------------------------
A0A2V7F1M1      ------------------------------------------------------------
A0A2V7KXK7      ------------------------------------------------------------
A0A651HKD3      ------------------------------------------------------------
A0A2V7QDU7      ------------------------------------------------------------
A0A2V7ITT6      ------------------------------------------------------------
A0A2V7NJW1      ------------------------------------------------------------
A0A2V7GFB5      ------------------------------------------------------------
A0A2V7RQ86      ------------------------------------------------------------
A0A2V7IWX2      ------------------------------------------------------------
A0A1Q7KE95      ------------------------------------------------------------
A0A1Q7T8X5      ------------------------------------------------------------
A0A2V7FK98      ------------------------------------------------------------
A0A2V7R3Z8      MIGPQSGAQQGEAIDLRHVQVHEHEVECAALQQVEGFLPPAADGYVVAFVAQNRRAALAQ
A0A2V7J3C0      ------------------------------------------------------------
A0A2V7KWV9      ------------------------------------------------------------
A0A1Q6ZHP2      ------------------------------------------------------------
A0A1Q7R6Z6      ------------------------------------------------------------
A0A2V7FYT7      ------------------------------------------------------------
A0A2V7IGR0      ------------------------------------------------------------
A0A2V7MR23      ------------------------------------------------------------
A0A2V7L1V3      ------------------------------------------------------------
A0A1Q7E5D3      ------------------------------------------------------------
A0A2V7ISE2      ------------------------------------------------------------
A0A1Q7J2X5      ------------------------------------------------------------
A0A2V7NPD1      ------------------------------------------------------------
A0A2V7QPD8      ------------------------------------------------------------
A0A2V7Q8M6      ------------------------------------------------------------
A0A2V7QBC3      ------------------------------------------------------------
A0A2V7LMU1      ------------------------------------------------------------
A0A2V7PBY9      ------------------------------------------------------------
A0A3M2BLV5      ------------------------------------------------------------
A0A2V7KS68      ------------------------------------------------------------
A0A2V7N4L3      ------------------------------------------------------------
A0A1Q7AZK2      ------------------------------------------------------------
A0A1Q7TNP7      ------------------------------------------------------------
A0A1Q7KG39      ------------------------------------------------------------
A0A1Q7GX75      ------------------------------------------------------------
A0A1Q7LL80      ------------------------------------------------------------
A0A2V7PFU2      ------------------------------------------------------------
A0A2V7MFS9      ------------------------------------------------------------
A0A2V7T933      ------------------------------------------------------------
A0A2V7J4D7      ------------------------------------------------------------
A0A2V7LN90      ------------------------------------------------------------
A0A2V7LFN9      ------------------------------------------------------------
A0A2V7MEK4      ------------------------------------------------------------
A0A2V7P8B1      ------------------------------------------------------------
A0A2V7R2W8      ------------------------------------------------------------
A0A2V7MS64      ------------------------------------------------------------
A0A2V7Q7N9      ------------------------------------------------------------
A0A2V7IRW6      ------------------------------------------------------------
A0A1Q7DVU6      ------------------------------------------------------------
A0A1Q7JSV2      ------------------------------------------------------------
A0A2V7QN41      ------------------------------------------------------------
A0A2V7R603      ------------------------------------------------------------
A0A2V7LJS2      ------------------------------------------------------------
A0A1Q7GLJ7      ------------------------------------------------------------
A0A2V7GRE3      ------------------------------------------------------------
A0A2V7EU00      ------------------------------------------------------------
A0A1Q6WE01      ------------------------------------------------------------
A0A2V7S9K3      ------------------------------------------------------------
A0A1Q7DXB9      ------------------------------------------------------------
A0A1Q7JD32      ------------------------------------------------------------
A0A2V7MVP8      ------------------------------------------------------------
A0A2V7N0A9      ------------------------------------------------------------
A0A1Q7DLS9      ------------------------------------------------------------
A0A1Q7JK96      ------------------------------------------------------------
A0A2V7KQV7      ------------------------------------------------------------
A0A1Q7JGF6      ------------------------------------------------------------
A0A2V7SG67      ------------------------------------------------------------
A0A1Q7GIK9      ------------------------------------------------------------
                                                                            

A0A2D5ZJF2      ------------------------------------------------------------
A0A0S8H9P3      ------------------------------------------------------------
A0A1E4BBP7      ------------------------------------------------------------
A0A3M2G737      ------------------------------------------------------------
A0A0H4TUX7      ------------------------------------------------------------
A0A1G0LUG0      ------------------------------------------------------------
A0A1Q7E3T7      ------------------------------------------------------------
A0A1G0L906      ------------------------------------------------------------
A0A1G0LCC0      ------------------------------------------------------------
A0A2D5ZJE2      ------------------------------------------------------------
A0A3M2G624      ------------------------------------------------------------
W0RI74          ------------------------------------------------------------
A0A3M2BJA6      ------------------------------------------------------------
A0A3D4VBZ5      ------------------------------------------------------------
C1A5W1          ------------------------------------------------------------
A0A2V7PX99      ------------------------------------------------------------
A0A2V7ERC7      ------------------------------------------------------------
A0A5Q4D6Y4      ------------------------------------------------------------
A0A2V7JTZ5      ------------------------------------------------------------
A0A3D4YTR6      ------------------------------------------------------------
A0A5Q4DA46      ------------------------------------------------------------
A0A2V7F1M1      ------------------------------------------------------------
A0A2V7KXK7      ------------------------------------------------------------
A0A651HKD3      ------------------------------------------------------------
A0A2V7QDU7      ------------------------------------------------------------
A0A2V7ITT6      ------------------------------------------------------------
A0A2V7NJW1      -MLVVHDEHPDVGPRPGLDCEQVRHLLREIRRDARGRLARLRFRPGWRHADDSPGGAGGR
A0A2V7GFB5      ------------------------------------------------------------
A0A2V7RQ86      ------------------------------------------------------------
A0A2V7IWX2      ------------------MFNGVPFLCKRTNRGRALRGAIPLAPMHMTCAPPRPAGRLPE
A0A1Q7KE95      ------------------------------------------------------------
A0A1Q7T8X5      ------------------------------------------------------------
A0A2V7FK98      --------------------------------------MRC-------------------
A0A2V7R3Z8      RVFVIDHQNPHPGLGFRPDGEHGRRLASLDGGGHAVMSKRCRHRGRPRFPVDPPLRRVRA
A0A2V7J3C0      ------------------------------------------------------------
A0A2V7KWV9      ------------------------------------------------------------
A0A1Q6ZHP2      ------------------------------------------------------------
A0A1Q7R6Z6      ------------------------------------------------------------
A0A2V7FYT7      ------------------------------------------------------------
A0A2V7IGR0      ------------------------------------------------------------
A0A2V7MR23      ------------------------------------------------------------
A0A2V7L1V3      ------------------------------------------------------------
A0A1Q7E5D3      ------------------------------------------------------------
A0A2V7ISE2      ------------------------------MDIGFVPARVWPPLTQGSGQSVATSQRPDS
A0A1Q7J2X5      ------------------------------------------------------------
A0A2V7NPD1      ------------------------------------------------------------
A0A2V7QPD8      -MASMADGSRPSTEGLTPSWASGMDIAVVLDFRLTPPYAGFGPTCREVAAARILRITTAK
A0A2V7Q8M6      -----------------------MDIALVLDNGRPHSYAQFGPHCRDPAAWPGLPHGFSN
A0A2V7QBC3      -----------------------------------------------------MPQRRRF
A0A2V7LMU1      -----------------------------------------------------MNSATTD
A0A2V7PBY9      -----------------------------------------------------MKWATNG
A0A3M2BLV5      ------------------------------------------------------------
A0A2V7KS68      ------------------------------------------------------------
A0A2V7N4L3      ------------------------------------------------------------
A0A1Q7AZK2      ------------------------------------------------------------
A0A1Q7TNP7      ------------------------------------------------------------
A0A1Q7KG39      ------------------------------------------------------------
A0A1Q7GX75      ------------------------------------------------------------
A0A1Q7LL80      ------------------------------------------------------------
A0A2V7PFU2      ------------------------------------------------------------
A0A2V7MFS9      ------------------------------------------------------------
A0A2V7T933      ------------------------------------------------------------
A0A2V7J4D7      ------------------------------------------------------------
A0A2V7LN90      ------------------------------------------------------------
A0A2V7LFN9      ------------------------------------------------------------
A0A2V7MEK4      ------------------------------------------------------------
A0A2V7P8B1      ------------------------------------------------------------
A0A2V7R2W8      ------------------------------------------------------------
A0A2V7MS64      ------------------------------------------------------------
A0A2V7Q7N9      ------------------------------------------------------------
A0A2V7IRW6      ------------------------------------------------------------
A0A1Q7DVU6      ------------------------------------------------------------
A0A1Q7JSV2      ------------------------------------------------------------
A0A2V7QN41      ------------------------------------------------------------
A0A2V7R603      ------------------------------------------------------------
A0A2V7LJS2      ------------------------------------------------------------
A0A1Q7GLJ7      ------------------------------------------------------------
A0A2V7GRE3      ------------------------------------------------------------
A0A2V7EU00      ------------------------------------------------------------
A0A1Q6WE01      ------------------------------------------------------------
A0A2V7S9K3      ------------------------------------------------------------
A0A1Q7DXB9      ------------------------------------------------------------
A0A1Q7JD32      ------------------------------------------------------------
A0A2V7MVP8      ------------------------------------------------------------
A0A2V7N0A9      ------------------------------------------------------------
A0A1Q7DLS9      ------------------------------------------------------------
A0A1Q7JK96      ------------------------------------------------------------
A0A2V7KQV7      ------------------------------------------------------------
A0A1Q7JGF6      ------------------------------------------------------------
A0A2V7SG67      ------------------------------------------------------------
A0A1Q7GIK9      ------------------------------------------------------------
                                                                            

A0A2D5ZJF2      ------------------------------------------------------------
A0A0S8H9P3      ------------------------------------------------------------
A0A1E4BBP7      ------------------------------------------------------------
A0A3M2G737      ------------------------------------------------------------
A0A0H4TUX7      ------------------------------------------------------------
A0A1G0LUG0      ------------------------------------------------------------
A0A1Q7E3T7      ------------------------------------------------------------
A0A1G0L906      ------------------------------------------------------------
A0A1G0LCC0      ------------------------------------------------------------
A0A2D5ZJE2      ------------------------------------------------------------
A0A3M2G624      ------------------------------------------------------------
W0RI74          ------------------------------------------------------------
A0A3M2BJA6      ------------------------------------------------------------
A0A3D4VBZ5      ------------------------------------------------------------
C1A5W1          ------------------------------------------------------------
A0A2V7PX99      ------------------------------------------------------------
A0A2V7ERC7      ------------------------------------------------------------
A0A5Q4D6Y4      ------------------------------------------------------------
A0A2V7JTZ5      ------------------------------------------------------------
A0A3D4YTR6      ------------------------------------------------------------
A0A5Q4DA46      ------------------------------------------------------------
A0A2V7F1M1      ------------------------------------------------------------
A0A2V7KXK7      ------------------------------------------------------------
A0A651HKD3      ------------------------------------------------------------
A0A2V7QDU7      ------------------------------------------------------------
A0A2V7ITT6      ------------------------------------------------------------
A0A2V7NJW1      AVCDLPHADAESGPVRPLQLHLSGEAVKGDCCANDTGFPCVPLAQQPLQRARQVTAACVG
A0A2V7GFB5      ------------------------------------------------------------
A0A2V7RQ86      ------------------------------------------------------------
A0A2V7IWX2      PIALQRVAPASRREHAPARAAHVLRICGATCCAYATRRHRHAPRRRCGREAGVRSQRYRP
A0A1Q7KE95      ------------------------------------------------------------
A0A1Q7T8X5      ------------------------------------------------------------
A0A2V7FK98      --------TDLRHGDG--------------------------------VGGVPRGIG-LA
A0A2V7R3Z8      NLSRGRSGTDSPHNDGKILSSARRGGVVARTKVHPAPGCGAPICGMWTVGAPHRAVSDLP
A0A2V7J3C0      ------------------------------------------------------------
A0A2V7KWV9      ------------------------------------------------------------
A0A1Q6ZHP2      ------------------------------------------------------------
A0A1Q7R6Z6      ------------------------------------------------------------
A0A2V7FYT7      ------------------------------------------------------------
A0A2V7IGR0      ------------------------------------------------------------
A0A2V7MR23      ------------------------------------------------------------
A0A2V7L1V3      ------------------------------------------------------------
A0A1Q7E5D3      ------------------------------------------------------------
A0A2V7ISE2      QAIAAPAARRTRAPGWTVAPTCIHRLPHAAPICGMTSPAGGEGVGPCAVSDLLSSRRDAG
A0A1Q7J2X5      ------------------------------------------------------------
A0A2V7NPD1      ------------------------------------------------------------
A0A2V7QPD8      SASLAVAAGTRPAPRCIRLRE---------AVHRFAACGRCGLRAARYRTCH--------
A0A2V7Q8M6      NRS--CGAGRPRSER-TKLHPFFGC-----DCTELRHQLNRSAGRARYRTCHTLSRDETQ
A0A2V7QBC3      AAR--IGQQRPRASRATPFRPHQGASVPPGDCTELRHQSHRSAGSARYRTCHTSSANEPQ
A0A2V7LMU1      RAY--SRRHRPNAPRCIRYGAL--------IALNCGISADG-LRRRTGIGLATCSAHDTT
A0A2V7PBY9      AQE--GQRRYPSRTKVHRRDVH--------PCTQLRHGGGR-LGVARGIGLAVRRWDDTH
A0A3M2BLV5      ------------------------------------------------------------
A0A2V7KS68      ------------------------------------------------------------
A0A2V7N4L3      ------------------------------------------------------------
A0A1Q7AZK2      ------------------------------------------------------------
A0A1Q7TNP7      ------------------------------------------------------------
A0A1Q7KG39      ------------------------------------------------------------
A0A1Q7GX75      ------------------------------------------------------------
A0A1Q7LL80      ------------------------------------------------------------
A0A2V7PFU2      ------------------------------------------------------------
A0A2V7MFS9      ------------------------------------------------------------
A0A2V7T933      ------------------------------------------------------------
A0A2V7J4D7      ------------------------------------------------------------
A0A2V7LN90      ------------------------------------------------------------
A0A2V7LFN9      ------------------------------------------------------------
A0A2V7MEK4      ------------------------------------------------------------
A0A2V7P8B1      ------------------------------------------------------------
A0A2V7R2W8      ------------------------------------------------------------
A0A2V7MS64      ------------------------------------------------------------
A0A2V7Q7N9      -------------------------------------------------------MQARG
A0A2V7IRW6      ------------------------------------------------------------
A0A1Q7DVU6      ------------------------------------------------------------
A0A1Q7JSV2      ------------------------------------------------------------
A0A2V7QN41      ------------------------------------------------------------
A0A2V7R603      ------------------------------------------------------------
A0A2V7LJS2      ------------------------------------------------------------
A0A1Q7GLJ7      ------------------------------------------------------------
A0A2V7GRE3      ------------------------------------------------------------
A0A2V7EU00      ------------------------------------------------------------
A0A1Q6WE01      ------------------------------------------------------------
A0A2V7S9K3      --------------------------------MSLAGTSTCCRRTTAYASSPRRAVRQRP
A0A1Q7DXB9      ------------------------------------------------------------
A0A1Q7JD32      ------------------------------------------------------------
A0A2V7MVP8      ------------------------------------------------------------
A0A2V7N0A9      --------------------------------MQMRPTAFRGRRRRPRWYRACSAALVPN
A0A1Q7DLS9      ------------------------------------------------------------
A0A1Q7JK96      ------------------------------------------------------------
A0A2V7KQV7      ------------------------------------------------------------
A0A1Q7JGF6      ------------------------------------------------------------
A0A2V7SG67      ------------------------------------------------------------
A0A1Q7GIK9      ------------------------------------------------------------
                                                                            

A0A2D5ZJF2      --------------MITTRDRATTRGTPCRTPRTIWCGPSWHPSIRHPRKVIMSRMGSQA
A0A0S8H9P3      ------------------------------------------------------------
A0A1E4BBP7      -----------------------MSANLVPSAANAAAVPRQDGFAPMP------------
A0A3M2G737      -------------------MYFGRMVPSDSAPKLQAPISTSNGAYHSE------------
A0A0H4TUX7      --------------------MNLRSGTWSHSLSFLSSATTWENRLDAV------------
A0A1G0LUG0      ------------------------------------------------------------
A0A1Q7E3T7      ------------------------------------------------------------
A0A1G0L906      ------------------------------------------------------------
A0A1G0LCC0      ------------------------------------------------------------
A0A2D5ZJE2      ------------------------------------------------------------
A0A3M2G624      -------------------------------------------------------MYFGN
W0RI74          --------------------MSANLPPLPAGSDAPLPVPAAEHALQPY-----------D
A0A3M2BJA6      ------------------------------------------------------------
A0A3D4VBZ5      ------------------------MSGQQIQSVTPQAVALEPYQEGTP------------
C1A5W1          ------------------------MSGQQIQSVTPQAVALEPYQEGTP------------
A0A2V7PX99      ------------------------MSNSPSWPVERAGPEVALQPVPDR------------
A0A2V7ERC7      -----------------------MPPLILPPRKSLMSVRLTPSPETPPPFTGAPYGAFPG
A0A5Q4D6Y4      -----------------------MSNLVPRDPIPGHPQGLIGGAAPHG------YADQGG
A0A2V7JTZ5      -------------------------MSVRSLQPDYPLAPHHPGSIPTA------------
A0A3D4YTR6      ---------------------MLLRTRVYPSPSDFAIAPSNAGSPSPA------------
A0A5Q4DA46      ----------------------MSDRSLPSGDPNGSQRDLPAEYYPAP------------
A0A2V7F1M1      ------------MSSQRGAQLMSELLPEPTPLRLTGPPGSLRPSRDGG------------
A0A2V7KXK7      -------------MRDGERHRACVAHPCMEPKEPHEMSGSNGEGTRIPVLRSESSLDTIR
A0A651HKD3      ---------------------MSDRERFDLTPHGGTGVPSEHARQSTP------------
A0A2V7QDU7      ---------------------------------------MSHDVTHSQ------------
A0A2V7ITT6      ---------------------MACRPPPRPSPRSKDPVPSIEPPQPPPDGFPEVWSGSPF
A0A2V7NJW1      SRADCITSRSRRGAGRYQDCGIACRPPPRPSPRSKDPVSSIEPPQPPPDGFPEVWSGSPF
A0A2V7GFB5      --------------------MERQLPERVDPAVLGAPRPWAAEEVATT------------
A0A2V7RQ86      --------------------MERQLPERVDPAVLGAPRPWVAEEVATT------------
A0A2V7IWX2      CSGDPWSRDVESRAIRFALDMAHEGPSLPEPARLDAIAATPRSRAPTR------------
A0A1Q7KE95      --------------------MRIAVSAYPPSNG--TPVPADQLAAPFG------------
A0A1Q7T8X5      --------------------MRIAVSAYPPSNG--TPVPADQLSAPFG------------
A0A2V7FK98      TGRRDAAPTGRSPANTVEVRVPMSTSPLPFHSG--STVPAVAPAAPPP------------
A0A2V7R3Z8      QGRGDAAPPGAAPPTHVEVRFPMSTSPLPLHAG--ATVPAVAPSAAPP------------
A0A2V7J3C0      ------------------------------------------------------------
A0A2V7KWV9      ------------------------MTDLPSAPRSQLPARPALSSIDLA------------
A0A1Q6ZHP2      ----------------------MTISNLPAPLG---PAPMAAPGMPQR------------
A0A1Q7R6Z6      ----------------------MTISNLPAPLG---PAPMAAPGMPQR------------
A0A2V7FYT7      ----------------------MTISNLPAPLG---PAPMAAPGMPQR------------
A0A2V7IGR0      ----------------------MTNSDNHAALARLPPSSDAGAALQPA------------
A0A2V7MR23      ----------------------MTISNLPAA-L--VPPAATPPALPQR------------
A0A2V7L1V3      ----------------------MTMSHLPLPPG--STPPVMVPPSAPP------------
A0A1Q7E5D3      ----------------------MTTSNL-LAPL--APPPAVAPVAPSC------------
A0A2V7ISE2      ARHDAARPARRNRPYRSIGNGSMAFSNLPAAPL--VPPPVVAPGTPHR------------
A0A1Q7J2X5      ----------------------MTLSNLPAAPL--VSPPVVAPGTSHR------------
A0A2V7NPD1      ----------------------MAFSNLPAAPL--VPPPVVAPGTPHR------------
A0A2V7QPD8      -GKTRRRATRRGPANTVEVRFPMSTSPLPLHAG--STVPAVAPAAPLP------------
A0A2V7Q8M6      FSEASPRATPRGTRS-------MSMSHLPLPPG--STAPVMVPPSPPP------------
A0A2V7QBC3      FSEATPSATWRGTRS-------MTMSHLPLPPG--STSPVMVPPSPPP------------
A0A2V7LMU1      LCGATPRATRRGTPS-------MTLSHLPLPPS--SPPPVIVPPSSKS------------
A0A2V7PBY9      RAPLRRALPTRGLPS-------MSISRLPIPHG--APPPAAAPPPAPP------------
A0A3M2BLV5      ----------------------------------------------MD------------
A0A2V7KS68      ---------------MLIRHMMTSRHLPALRSDTASPARAERASVSTR------------
A0A2V7N4L3      ---------------------MTPSPFPLIRNQPTGSVASAAPPPSSA------------
A0A1Q7AZK2      ------------------------------------------------------------
A0A1Q7TNP7      ------------------------------------------------------------
A0A1Q7KG39      ------------------------------------------------------------
A0A1Q7GX75      ------------------------------------------------------------
A0A1Q7LL80      ------------------------------------------------------------
A0A2V7PFU2      ---------------------MNPRPLPAIRSQSA-PVLRRANASAA-------------
A0A2V7MFS9      ---------------------MNPLPLPAVRGQTAAPALRRASPPHT-------------
A0A2V7T933      ---------------------MTPRPLPAIRGQSAPAVLRRGGTSDR-------------
A0A2V7J4D7      ----------------------------MMPGESIARFRSTA------------------
A0A2V7LN90      ----------------------------MTTGDLPVPFEPVRTE---V------------
A0A2V7LFN9      ----------------------------MTTGSLPARLDTPKAEDRNA------------
A0A2V7MEK4      ----------------------------MTTGSLPARLDTPKAADRNA------------
A0A2V7P8B1      ----------------------------------MTRVTEPLPSDSRA------------
A0A2V7R2W8      ---------------------MAGD---SLMPSRST------------------------
A0A2V7MS64      ---------------------MIGELPSP----RPENDPRTTTTVIQP------------
A0A2V7Q7N9      PPLVPTLRCWEPVNQETLRGMTTGDLPVPFEPTRAE----------FV------------
A0A2V7IRW6      ------------MKKSPETDMDTGDLPARLDPVQPERLPSPAGSFDAI------------
A0A1Q7DVU6      ------------MKESPETDMETGDLPAALDPERPERLPSTAAPFDTI------------
A0A1Q7JSV2      --------------------METGDLPAALDPERPERLPSTAAPFDTI------------
A0A2V7QN41      ---------------------------MSRERSRLPEVASVDGTWLRA------------
A0A2V7R603      ------MRRSVASPAAPRYPPCSADLAMSRERSRLPEVASVEGAWMRA------------
A0A2V7LJS2      -------------------------------------MSQPHPNDARA------------
A0A1Q7GLJ7      -------------------------------------MSEQLRSEPPA------------
A0A2V7GRE3      -------------------------------------MVEP--SNRPA------------
A0A2V7EU00      -----------------------------------------MQPYGAP------------
A0A1Q6WE01      ----------------------MTEYLPGVA----ASPLVREAPLPVP------------
A0A2V7S9K3      AVGRGSPRPGAAGGIGLAVGNRVPELLPSGA----APQLTHAVPLVAP------------
A0A1Q7DXB9      ------------------MAHEGPSLPESAR----LEAIAATPRPRAP------------
A0A1Q7JD32      ------------------MAHEGPSLPESAR----LEAIAATPRPRAP------------
A0A2V7MVP8      ------------------MAQDPLLIPESAR----VDEVAPLLERRPA------------
A0A2V7N0A9      AGPEPAPRPSPGKFETHTMPSQLTVPPQEGTPDRRL---GAAAAAAGP------------
A0A1Q7DLS9      --------------MFNDLPELPPSSPETPG----------RATVPAP------------
A0A1Q7JK96      --------------MFNDLPELPPSSPETPG----------RATVPAP------------
A0A2V7KQV7      ------------------MASDATLPPNQPA--------------LVP------------
A0A1Q7JGF6      ------------------MPSDPTADPEQSAPDRRLVLAAATAARLAP------------
A0A2V7SG67      ------------------MPSDPTADPEQSAPDRRLVLAAATAARLAP------------
A0A1Q7GIK9      ---------------------------------------MVTSTLVVP------------
                                                                            

A0A2D5ZJF2      TGEGNGSQAAPAGLSPEITPPGLLEILWRRRWIVTLV-TLASIVGAFIYL-MKATPIYTS
A0A0S8H9P3      -----------MGRYERTHLEDYWRVVRRRAWLILLT-ALVALLAATWAA-SRRPRLYRA
A0A1E4BBP7      QWGGAPSAPPPSQGGVGDQLARTLAAIKRYKWLVLAV-IAVGSTAGVTLT-RFVKPKYDV
A0A3M2G737      -----------------NPIHEYFQIIVRGRWIILVVFTLVMAATMIYVLRNKPRLVYST
A0A0H4TUX7      RRPEGTEALRRIVHQREVHLRDLVGVVSRHWRLVALL-TVLVAGGAWYSA-RRQVPRYQS
A0A1G0LUG0      ------------MHQREVHLRDLVAVVTRHWRLVAAV-TAVLVGFSWYNG-RNQVARYQS
A0A1Q7E3T7      ---------------MRVNLRDPLAVVRRHLWLVLGMTAVVGGIVGYRA--YAAVPSYRA
A0A1G0L906      ------------------MHLRDLAQVLFSHWKVVVFLTVLVVFSTSYAS-RKAVPRYQS
A0A1G0LCC0      ------------------MHLRDLAQVLFSHWKVVVFLTALVVFSTSYAS-RKAVPRYQS
A0A2D5ZJE2      ---------MDEHQAHGVTLADYVRIIWSRKWMVGLV-ATAVLAFTIFFT-LRMQPVYES
A0A3M2G624      GKNYPVEVTTSSYLEADFDVRKYVRMLWRRRYIVLLLFVLIFGFSTYRALTQKVTPVYRS
W0RI74          PAAYAPPAAPADEAGGALSVGRFMAAMSRYKWLVAAL-VVLGLGGGFVAT-RFIDPEYEV
A0A3M2BJA6      ---MEKPTFEGGYVDDEISLRDIWNLLRRNQWLIFLC-VLLVTGGAAAYS-YFAVPVYES
A0A3D4VBZ5      PGDWGGGTAEGAPEPKGPSLRRYLAAVNRFKWLVLVF-AILGGAGGYAAT-RFIEPEYEV
C1A5W1          PGDWGGGTAEGAPEPKGPSLRRYLAAVNRFKWLVLVF-AILGGAGGYAAT-RFIEPEYEV
A0A2V7PX99      GTAAAHGRAYEPPTPEPSDWQRMLAAAMRRRWLVILV-TLAGTAAGVIGS-RFLDPRFAA
A0A2V7ERC7      NTGPSTGPAVVLQESEGVQWGRYFDVLKRHALLIVLL-VAVGTVWGLNAA-RQVRPDYET
A0A5Q4D6Y4      ARGGSWPNGQPPPPNDSIELSELLQILRRRIWLILAC-VLVGGALAWGVH-EIREPRYRA
A0A2V7JTZ5      EWTPARPRSEDFEDAEGIPWSRYVDAIRRHVLLIVGL-AAVGSVLGVVAA-RRVRPIYEA
A0A3D4YTR6      PYKGGPQRMDGPSDSEGIPWSRYIDAISRHSLLILAI-ALLGSLVGLYAA-RQVRLSYDA
A0A5Q4DA46      APAPAPAGWGGDEEEQGLDWRRYVAAIVRNKWLVLAG-LVVGLGAGFLVR-QVTSPVYSV
A0A2V7F1M1      -------GRSADSAEIRTDFKQLLMLLRRRIGLVAGI-AALIVFVVALFV-VLERPVYRS
A0A2V7KXK7      MKSLTTPSAPPPPPAEHSDWQRYFNSVMRHKWFVIVV-TLVGTALGIVAT-RFLDPRYTA
A0A651HKD3      GVHAGDAGHGEGEEPGGLDFRKLPSTLLRYKWLVLAS-VVLGALAASASM-ALTPPRYTV
A0A2V7QDU7      GLRSPSLDGAPAGFLPGAGAAELVDILRRRLWSILGC-TVLCVGAAVLYV-VLARPSYRA
A0A2V7ITT6      RGAQPVPSAFRPEHDGVHDWQQYRGAVARYKWVVVLV-STVGTLIGVAAT-RFLRPEYEV
A0A2V7NJW1      RGAQPVPSAFRPENDGVHDWQQYRGAVARYKWVVVLV-STVGTLIGVAAT-RFLRPEYEV
A0A2V7GFB5      S------------PEGALDWRRIAQVVTRFKWLVFGI-TVAGGAAG-FAATKVVRPQYLT
A0A2V7RQ86      S------------PEGALDWRRIAQVVTRFKWLVFGI-TVAGGAAG-FAATKVVRPQYLT
A0A2V7IWX2      YEQLPRL-----LPAAEPDWRRILGAIGRRRWVVLAV-TLLGTAAGVVAAAKFVGPRYLA
A0A1Q7KE95      AGRGGRLEESGAGLVQPTDWRRHGATALRYRWWILGL-AALGTLGG-TAAGRLLPPRYQV
A0A1Q7T8X5      AGRGGRLEESGAGLVQPTDWRRHGATALRYRWWILGL-AALGTLGG-TAAGRLLPPRYQV
A0A2V7FK98      MGADMGFGQGFAQPETGVDWRRVLSAVARFKWLIAVV-TIVGTVGG-LAATRFIKPQYMV
A0A2V7R3Z8      MAADLGFSQGFAQPETGVDWRRVLSAVARFKWLIAVV-TIVGTVGG-LAATRFIKPQYMV
A0A2V7J3C0      --------------------------TRRYRWWVLAL-TGVGILGG-ILAGRLLPPRYQV
A0A2V7KWV9      A-----------DSGGAPDWRRHGTAVWRHRWWILGL-TVLGTIGG-VGASRVLPPRYLV
A0A1Q6ZHP2      G--ISVFD--LDGRESGVDWRRILSALLRFKWLIATT-TLVGTIAG-VGATRFLKPQYSA
A0A1Q7R6Z6      G--ISVFD--LDGRESGVDWRRILSALLRFKWLIATT-TLVGTIAG-VGATRFLKPQYSA
A0A2V7FYT7      G--ISVFD--LDGRESGVDWRRILSALLRFKWLIATT-TLVGTIAG-VGATRFLKPQYSA
A0A2V7IGR0      A--LSLVEPGFSEVEGALDWRRVWSAVVRFKWLILAV-TLLGVAAG-GAATRFLKPQYLV
A0A2V7MR23      G--VSPF--DLDGPEGGLDWRRILSALLRFKWLIATF-TLVGTVAG-VGATRFIKPVYSA
A0A2V7L1V3      A--TTGW--GGPESEGGVDWRRVYSAVMRFKWLICAV-TVLGTVAG-FGLARFVRPQYGA
A0A1Q7E5D3      A--VAES--GFPGLDDGLDWRRVLSALLRFKWLIAAV-TLAGTAAG-VGATRFLTPEYVA
A0A2V7ISE2      G--MTEF--DLAGSDSGLDWRRILSALLRFKWLIAGF-TLVGTVAG-VGATRFLKPEYAA
A0A1Q7J2X5      G--VTEF--DLAGSDSGLDWRRILSALLRFKWLIAGF-TLVGTAAG-FGATRFLKPEYSA
A0A2V7NPD1      G--MTEF--DLAGSDSGLDWRRILSALLRFKWLIAGF-TLVGTVAG-VGATRFLKPEYAA
A0A2V7QPD8      TGADMGFGQGFAAPETGVDWRRVLSAVLRFKWLIAVV-TIVGTVGG-VAATRFIKPQYMV
A0A2V7Q8M6      P--TAGW--GGADSEGGVDWRRVFSAVLRFKWLICAV-TVLGTTAG-FGVARFVRPQYGA
A0A2V7QBC3      P--TTEW--GGADSEGGVDWRRVFSAVLRFKWLICGV-TVLGTTAG-FGVARFVRPQYGA
A0A2V7LMU1      L--STEW--GGAESEGGVDWRRVLSAVLRFKWLICGV-TILGTAAG-FGVARFVRPQYGA
A0A2V7PBY9      AVPGTYA--GFAEPEGGVDWRRVVSAVMRFKWLICGV-TFLGTLAG-FGAARFVKPQYGA
A0A3M2BLV5      RQPDLRPPLDSELLSASPHLSDYIQVVTRRLWLVLLI-FAVTTASAIWAV-SRQKTLWRS
A0A2V7KS68      ALRPE--AAAFPDDEHGPDWRRVGSALLRFKWLVLAA-LLAGLAAAFGAT-KVLRPAYKA
A0A2V7N4L3      GLRRGSPEGPPEGHEAGPDWHRIASALLRFKWVVILA-VLLGLGAAFAAT-RVLRPVYRA
A0A1Q7AZK2      -------------------------MLLRFKWVVILM-LALGLGAGFAAT-RVLRPVYRA
A0A1Q7TNP7      -------------------------MLLRFKWVVILM-LALGLGAGFAAT-RVLRPVYRA
A0A1Q7KG39      -------------------------MLLRFKWVVILM-LALGLGAGFAAT-RVLRPVYRA
A0A1Q7GX75      -------MAGLDDEESGLDWRRIVSALLRFKWLVLLA-VALGLGGGFAAT-RKLPPVYSA
A0A1Q7LL80      -------MAGLDDEESGLDWRRIVSALLRFKWLVLLA-VALGLGGGFAAT-RKLPPVYSA
A0A2V7PFU2      -------PSLPE-AESGPDWRRLASALLRFKWIVLLM-VLLGLGGAVAAT-RLLRPIYRA
A0A2V7MFS9      -------PSLPDGGEPGPDWRRIASALLRFKWLLVLT-LTMGIGAAFAAI-RLLRPVYRA
A0A2V7T933      -------TSLPE-EEAAPDWRRIGSVLLRFKWVVILM-LALGLGAGFAAT-RVLRPVYRA
A0A2V7J4D7      ----PTVAGPFEDPNPPPDWWRYVAAIRRFKWLVLGV-TVGATALGVVGTMF-LRPTYAA
A0A2V7LN90      VARYPPPPLRPDS-EPLAEWRRYLMAARRYRWMVLGV-TLFGTAAGVGLSLL-LPPTYLA
A0A2V7LFN9      VAR-PAPALPPDAGDWLADAQRYLRSVRRHKWLVLSL-TLFATAAGIELSVYALPPNYAA
A0A2V7MEK4      VAR-PAPALPPDAGDWLADAQRYLRSVRRHKWLVLSL-TLFATAAGIELSVYALPPNYAA
A0A2V7P8B1      ASGPFAEREEVEASASTVRLEDLFATVRRHIWLVLGV-AAGVVAAAGGVA-YVTGSVYRA
A0A2V7R2W8      ---APLAVTNEPEQPQQPEWLRYLSAVRRFGWLVVAV-TLAVTGLGVVAA-VLMPPSYVA
A0A2V7MS64      HGTRPVSIASAQEPPPLAQWPRYVSAALRYKWLVVGA-TLVATAAGVGAS-FLLAPEYVA
A0A2V7Q7N9      ARNRPPP--PPPDPEPLAEWQRYLLAARRYRWLVFGV-TLLGTAAGIGLS-LLLPPTYLA
A0A2V7IRW6      ARYAPPAAGAPQDGDVLADLRRYLSAVWRYKWAVTGI-TVLGTAAGVAGK-MLLPPNYVA
A0A1Q7DVU6      ARYAPPAAGAPRDADALAELRRYLSAVWRYKWAVAGV-TVLGTAAGVAGK-MLLAPSYVA
A0A1Q7JSV2      ARYAPPAAGAPRDADALAELRRYLSAVWRYKWAVAGV-TVLGTAAGVAGK-MLLAPSYVA
A0A2V7QN41      PAPSTADVASRTGPPGETDWQHYFGAVRRRKWTVIGV-TLLGTALGLFAS-RLLHPPYSA
A0A2V7R603      PALPAGDVVSRAGAPGETDWQHYIGAVRRRKWTVIAI-TLLGTALGLFAS-RLLHPPYSA
A0A2V7LJS2      ASDSVADRGELDAPVSTVRLDDLFAVLRRHIRLVLGV-TAAAMMAAGYVA-YVTGSVYRA
A0A1Q7GLJ7      PSRRLADRADPEAFVHTVGLEELLSTLRRHVWLVLGV-AAVAVAATGFVA-YTTGPVYRA
A0A2V7GRE3      ASSFHGDR-EPEVSVRTVRLEELLAILRRHVRLVVGV-VVATVTAAGVVA-YVTGPAYRA
A0A2V7EU00      ----------ATPDDAAVDWRRYWAAIVRYRWWVVLC-TALGLVGGFVAA-SVLKPQYRA
A0A1Q6WE01      ARVTTAPDPVASPFEQGVDWRRCWGAVRRHRWWILGC-AVLGTAGGVVGA-RMRPPRYQA
A0A2V7S9K3      AGNGLRLDPLAAAGEPFLDWRRSWAAALRYRWWVVGF-MGLGVLGGLAAS-RFLPPRYLA
A0A1Q7DXB9      TRYDQPP---RLLPAVEPDWRRIFGAIRRRRWVVLGV-TLLGTVAGVVAAAKFVGPRYLA
A0A1Q7JD32      TRYDQPP---RLLPAVEPDWRRIFGAIRRRRWVVLGV-TLLGTVAGVVAAAKFVGPRYLA
A0A2V7MVP8      RPYAEPP---RPLAAGEPDWHRILGAIRRRRWLVLAV-TLLGTAAGVVAAVRFVGPRYLA
A0A2V7N0A9      VRRSEAA-------PLPDDWRRVVAAIGTYRWFVVAV-TAAGTLVGAVAA-HFLKPTYQA
A0A1Q7DLS9      ARRRSPP---MVEAAPDVDWGRYRTAIWRFRWWVLLI-TLLGTAAGVGAS-RIVRPVYVA
A0A1Q7JK96      ARRRSPP---MVEAAPDVDWGRYRTAIWRFRWWVLLI-TLLGTAAGVGAS-RIVRPVYVA
A0A2V7KQV7      FQTGFQA---AAAPAPMSDWARVFAAARRYKMLVATV-TVVGSLAGLVIG-KFLKPVYQA
A0A1Q7JGF6      RRDEAPP---------PEDWRRVVTAIRTYRWLVIAV-TGVGTLAGIIGA-RFLKPTYQA
A0A2V7SG67      RRDEAPP---------PEDWRRVVTAIRTYRWLVIAV-TGVGTLAGIIGA-RFLKPTYQA
A0A1Q7GIK9      ARPKGPSVYPAVVPAGPDDWRRVFAAMRTSRWLILAV-TAVGTLAGIVGS-RFLKPTYEA
                                                 :                       :  

A0A2D5ZJF2      TSRIYVEQSGPKVITEFEGVMTQSKNYLYTQAEIFLS-----------TEVLRPVAEAAE
A0A0S8H9P3      TLTLQVGDPRGRMGQLGDIDVTPNMLWTDPVESEVQQ--------------LTTQAVAQY
A0A1E4BBP7      SASIWIAATPG------------PSGRMGPVSAPGLV-----NSDVAWMELARSFSVLDK
A0A3M2G737      TATIALKNKSGNLNPYPVYRDPAKINNELVILKSRRL-------AETIADSLLKRVYIDP
A0A0H4TUX7      RLTVQVSSPKQVFAQLEGMRVDELALQTDPVLSEALI--------------LTTQQLALE
A0A1G0LUG0      QLTVQISSPRGVFSQLNDRTVDELALQTDPVLSEALV--------------LTTQALALQ
A0A1Q7E3T7      IAVIRLSDPRRALTGGVADGPTGDLA---GSSADPLL---------SQVELLTSRRVGGV
A0A1G0L906      SATVQVSSKKQALTPLEAMRVDEMSMQTDPVLSEALV--------------LSTQALALR
A0A1G0LCC0      SATVQVSSKKQALTPLEAMRVDEMSMQTDPVLSEALV--------------LSTQALALR
A0A2D5ZJE2      QTTLLIEPQDAGALSIFDPT---------GFMKQKIL-------INNECELLRSRSLAQQ
A0A3M2G624      TVYLEVDEKETNIRLLPQFSSVRQQSIYWGSPEGKII------------AEVLSTSVIEE
W0RI74          NATIFSSGSGNEKPS--------------MINPAQLT-----G-NAGWRDLFQSFAIIDP
A0A3M2BJA6      ATTIRIEEERANLPVLDILQELSSGS----------------Q-VETEMEVLRSRTLAED
A0A3D4VBZ5      QATILLEQGTG-------VNNGAGRG---PIQAAELL-----Q-ASGWQDLLRSYAIADP
C1A5W1          QATILLEQGTG-------VNNGAGRG---PIQAAELL-----Q-ASGWQDLLRSYAIADP
A0A2V7PX99      RAVLWIEAAGRA--------PGRDGG---SIVDEALV-----Q-TPSWGELVTSGAVLED
A0A2V7ERC7      QATIWIN-----------GARGQQAG---SIGTQQLL-----E-QTSWVELLRSFAVVDA
A0A5Q4D6Y4      TAVIQIEDPRTQ--------MSERLGSVDPARSGADP-------IRSSLEVLRSRTVLAQ
A0A2V7JTZ5      QATVWISTTPS-------SA--LQTG---PIRQQQLL-----T-TGSWVELLRSFAIVDP
A0A3D4YTR6      DATIWINTTPN-------GTQQTQTG---PIRQPQLL-----T-SVSWVELLRSFAVVDP
A0A5Q4DA46      SSTVLLESTDRG-----------TAGDAAPIRPSQLL-----T-NTGWMDLLRSYIVLDP
A0A2V7F1M1      TATVRLAYPRRALTVGVEDLPAKDQR------SDPLL---------SLIELLRGRGIVGA
A0A2V7KXK7      KAILWVDVA-----------VGRDRG----VQSDQLL-----D-SRGWEELVVSNAVLDT
A0A651HKD3      SALIHTPNGQTGVT---------------AIETGQRQ-----S-SLNWQNLLPSFSVVEP
A0A2V7QDU7      EAAIRMDDRRQ------------------PIPTLDVLALYRGNELSTEIEMLGSRTLAED
A0A2V7ITT6      QATIWIESHDP---------RTEDRG---PIRGDQLL-----Q-ASSWLQLLRSYVVLDH
A0A2V7NJW1      QATIWIESHDP---------RTEDRG---PIRGDQLL-----Q-ASSWLQLLRSYVVLDH
A0A2V7GFB5      QVTVFIDQPDP---------RGNDRGG--PIRSGQVL-----D-PESWIDLLRSYAVLDR
A0A2V7RQ86      QVTVFIDQPDP---------RGNDRGG--PIRSGQVL-----D-PESWIDLLRSYAVLDR
A0A2V7IWX2      RARLWVGAAEPN--------PNALRGTTPPPGAERLL-----G-VAAWVDFVRSDAVLDT
A0A1Q7KE95      QATIWIQSSEPR--------GGTSRG---PIGANQLF-----E-SYAWGELLKSYVVLDE
A0A1Q7T8X5      QATIWIQSSEPR--------GGTSRG---PIGANQLF-----E-SYAWGELLKSYVVLDE
A0A2V7FK98      QATLWIDQPDQR--------GGQDRG---PIRAGQPL-----E-PEAWLDLLKSYRVLDQ
A0A2V7R3Z8      QATLWIDQPDQR--------GGQERG---PIRAGQPL-----E-PEAWLDLLKSYRVLDQ
A0A2V7J3C0      QATIWIQSSEP---------RGTGRG---PIGANQLF-----E-SYAWVDLLKSYVVLDQ
A0A2V7KWV9      QATIWIQSSEAR--------GTPDRG---PIGANQLL-----A-PTAWGDLLKSYVVLDA
A0A1Q6ZHP2      QAKIWIDVEGR---------RGPERGPT-PIRSGQLL-----D-AESWVDLLESYVVLDQ
A0A1Q7R6Z6      QAKIWIDVEGR---------RGPERGPT-PIRSGQLL-----D-AESWVDLLESYVVLDQ
A0A2V7FYT7      QAKIWIDVEGR---------RGPERGPT-PIRSGQLL-----D-AESWVDLLESYVVLDQ
A0A2V7IGR0      QATIWIDQADR---------RGPDRGPT-PIRSGQLL-----E-PEAWVDLLRSYIVLDQ
A0A2V7MR23      QAKIWIDVEGR---------RSPDRSLA-PIRPGQLL-----D-AESWVDLLRSYVVLDQ
A0A2V7L1V3      QATIWIDATERER-----WGQAQDRG---PIRQGQLL-----D-PQSWVDLLKSYVVLDT
A0A1Q7E5D3      QATVWIDGPDR---------RGPDRG---PIRPGQLL-----D-PEAWVELLKSYVVLDE
A0A2V7ISE2      QAKIWIDVEGR---------RGPDRGPA-PIRPSQLL-----D-AESWVDLLKSYVVLDQ
A0A1Q7J2X5      QAKIWIDVEGR---------RGPDRGPA-PIRPGQLL-----D-AESWVDLLKSYVVLDQ
A0A2V7NPD1      QAKIWIDVEGR---------RGPDRGPA-PIRPSQLL-----D-AESWVDLLKSYVVLDQ
A0A2V7QPD8      QATLWIDQPDQR--------GGQERG---PIRSGQAL-----E-PEAWLDLLKSYRVLDQ
A0A2V7Q8M6      QATIWIDATESER-----WGQGQDRG---PIRQGQLL-----D-PQAWVDLLKSYVVLDQ
A0A2V7QBC3      QSTIWIDATESER-----WGQGQDRG---PIRQGQLL-----D-PQAWVDLLKSYVVLDQ
A0A2V7LMU1      QATIWIDATERER-----WGQGQDRG---PIRQGQLL-----D-PQAWVDLLKSYVVLDQ
A0A2V7PBY9      QATIWIDASERER-------RADDRG---PIRQGQLL-----D-AQAWVDLLKSYVVLDQ
A0A3M2BLV5      EMAVQVTDPLERA-----RSLTSPTR---VSGMDIFV-----DPMQSQIEVLQSRSIAER
A0A2V7KS68      QANVWVDVPGRAEG----DRSADNRG---PIRTAALL-----E-ADDWIELLRSYIVLDQ
A0A2V7N4L3      QANVWVDVPDR-RG----ENPSDARG---PIRQGALL-----D-ADAWVELMRSYVVLDQ
A0A1Q7AZK2      QANVWVDVPDR-RG----NGSSDARG---PIRQGALL-----D-ADAWVELLRSYVVLDQ
A0A1Q7TNP7      QANVWVDVPDR-RG----NGSSDARG---PIRQGALL-----D-ADAWVELLRSYVVLDQ
A0A1Q7KG39      QANVWVDVPDR-RG----NGSSDARG---PIRQGALL-----D-ADAWVELLRSYVVLDQ
A0A1Q7GX75      QANVWVDVLDR-RG----EGGAEARG---PIQQRALL-----D-EDAWVELLRSYIVLDQ
A0A1Q7LL80      QANVWVDVLDR-RG----EGGAEARG---PIQQRALL-----D-EDAWVELLRSYIVLDQ
A0A2V7PFU2      QANVWVDVPDR-RG----DPHADTRG---PIRQGALL-----D-ADAWVELLRSYVVMDQ
A0A2V7MFS9      QANVWVDVPDR-RG----EGPSDARG---PIRQGALL-----D-ADAWVELLRSYIVLDQ
A0A2V7T933      QANVWVDVPDR-RG----NGSSDARG---PIRQGALL-----D-ADAWVELLRSYVVLDQ
A0A2V7J4D7      QATLWIQVPARQ------P---REAG---PIWQAQLP-----I-STGWMDLLQSYAVLDD
A0A2V7LN90      RATVWIQVPSAR------ARDIRDRG---PIWQGQLP-----I-TSGWMDLLQTNVVLED
A0A2V7LFN9      RATVWIQVPAHQ------A---RDEG---PIWSGHLP-----I-SSGWIDLIRTNIVLEE
A0A2V7MEK4      RATVWIQVPAHQ------A---RDEG---PIWSGHLP-----I-SSGWIDLIRTNIVLEE
A0A2V7P8B1      VAVIRLSDPRRAFTGGVVEDPALLAD---GRYADPLL-----S-Q---VELLKSRTVAGG
A0A2V7R2W8      QAIVWIRVP---N-----KEP-RNEG---PIWQGQLP-----I-SSGWMELLQSYAVLDY
A0A2V7MS64      RATVWISIS---A-----HPAPRDQG---PIWSGQLP-----I-STGWTDLLRTNVVLEE
A0A2V7Q7N9      RATVWVQVPSGHA-----RDA-RDRG---PIWQGQLP-----I-SSGWMDLLQTNVVLED
A0A2V7IRW6      RATVWIQVP---A-----RPT-RDEG---PIWSGQLP-----I-SSGWTDLLHTNVVLEE
A0A1Q7DVU6      RATVWIQVP---Q-----RPT-RDEG---PIWSGQLP-----I-SSGWTDLLQTNVVLED
A0A1Q7JSV2      RATVWIQVP---Q-----RPT-RDEG---PIWSGQLP-----I-SSGWTDLLQTNVVLED
A0A2V7QN41      TALLWFETKDRAAAA---RDPRTASE------ADELL-----N-PSGWIDLVESNAVLEE
A0A2V7R603      TALLWFETKDRAAAG---RDPRTASE------ADELL-----N-PSGWIDLVESNAVLEE
A0A2V7LJS2      VAVIRLSDPRRAFTGGVVDDPALLAD---GRYADPLL-----S-Q---VELLKSRTVAGG
A0A1Q7GLJ7      VAVIRLSDPRRALTGGVVEDPGPSAD---ERFADPLL-----S-Q---VELLTSGTVAGA
A0A2V7GRE3      VAVIRMSDARRALTGGVVLDPA-RAD---ERFSDPLL-----S-Q---AELLTSRAVAGA
A0A2V7EU00      QATVWIDVAKERQD----A----TRG---PIRQGQLL-----E-ATAWVDLLQSYAVLDD
A0A1Q6WE01      QATIWIQAGEPR-G----P----DRG---PIGANRLL-----D-ASAWVDLLKSYVVLDD
A0A2V7S9K3      QATIWIQTSEPR-A----T----DRG---PIGANQLL-----E-ASAWVDLLKSYVVLDD
A0A1Q7DXB9      RARLWVGAAEPDPN----AIR--GTT---PAPGAERL-----LGVEAWVDFVRSDAVLDT
A0A1Q7JD32      RARLWVGAAEPDPN----AIR--GTT---PAPGAERL-----LGVEAWVDFVRSDAVLDT
A0A2V7MVP8      RARLWVGAAEPDPN----ALR--GTT---PLPGTDRL-----LGVEAWVDFVRSDAVLDT
A0A2V7N0A9      RATVWVEVPNPAAR----ER---DQG---PIETGQLL-----GTATSWLDLLRSHVVLDD
A0A1Q7DLS9      RATIWIEGANEKQP---------GPG---PAGSGDLL-----G-ATGWVDLVRSYVVVAA
A0A1Q7JK96      RATIWIEGANEKQP---------GPG---PAGSGDLL-----G-ATGWVDLVRSYVVVAA
A0A2V7KQV7      QATIWIQSSEQD-H----DRGRADQG---PIQSAQLL-----GTSGGWLDLIRSHVVLND
A0A1Q7JGF6      RATVWLEIPDQSAH----ER---DQG---PFQSGQLL-----GTATGWLDLLRSHVVLDD
A0A2V7SG67      RATVWLEIPDQSAH----ER---DQG---PFQSGQLL-----GTATGWLDLLRSHVVLDD
A0A1Q7GIK9      RATVWLEIPDEASH----AR---ERG---PIESGELF-----PTATGWLDLLRSHVVLDD
                   :                                                        

A0A2D5ZJF2      DAKTRILSSRT-------------RATKGSTTSVAEESVQEVG-QPEQGANGALLQRRQI
A0A0S8H9P3      VADTLQLRARS--------------PDISRDLLLSGVRID--R-EAPSGDYRIRVGSDGS
A0A1E4BBP7      VVSKLALYVYP--------------DVAADTLVVRDLYPS--D-SLQPGPYRLTIQGSSY
A0A3M2G737      ETKNEKLHIIH-------------------------------------------------
A0A0H4TUX7      VVRGLALHLEL------------DDPGLRRGDLFAAVAVD--S-TTPPGAYRLTVQPTSG
A0A1G0LUG0      VVDALQLQVEL------------TDPRLRRDDVIAAIAVD--S-SSTPGRFALVRRGPDG
A0A1Q7E3T7      VVDSMLMLRVR--------------ARNFPTSILAVVQLP--S-DVGGDSLRLEFNRDSL
A0A1G0L906      VVDAIGLRLAM------------DDWRLSRTTFLYDAQVD--T-LARPDSFVLELKGTGY
A0A1G0LCC0      VVDAIGLRLAM------------DDWRLSRTTFLYDAQVD--T-LARPDSFVLELKGTGY
A0A2D5ZJE2      VL----------------------------------------D-----------------
A0A3M2G624      VVQMLDLDKAV--------------HSISPNLSFSMTNIQ--SHNAPLGTYRVHILDNQH
W0RI74          VVQKLSLYIQP--------------AKASDSLLFATFQIDPVKKQFRPGTYTLKTERGRF
A0A3M2BJA6      VVDSLNLQVEI------------IEPRGVSRAVLLDRLVA--E-RWAPEG-EFLIEPGGD
A0A3D4VBZ5      VVIGLGLFVTP--------------AVVADSVLFRTFRVD--QSRLRPGDYKLTIAGERY
C1A5W1          VVIGLGLFVTP--------------AVVADSVLFRTFRVD--QSRLRPGDYKLTIAGERY
A0A2V7PX99      VVRELRLYVTP--------------KSPADAPVFAGFGLG--K-MVRPGRYELVVDRGAR
A0A2V7ERC7      VVHQLKLNVVY--------------KVPGDSLLFRTFQTG--T-TPFYGSYVLQIDRSGR
A0A5Q4D6Y4      IVDEEGLRLIG-------------LHANAAQQALQEVTVE--A-FALDDTLTLEFSSTGL
A0A2V7JTZ5      IVRDLKLNVSY--------------KQPSDSVLFRNFEWT--P-ATRSGAYLLKIDGAGP
A0A3D4YTR6      VVRDLKLNVSY---------------TPADSALYANFVWT--P-ATRSGAYALKIDEHGR
A0A5Q4DA46      VVDNLRLYVTP--------------ADPAHAPLFEDFSVG--N-EVFSASYEIGRDASGG
A0A2V7F1M1      VVDSLALRLQPLGSRFGG-------SSRVVRAALRDVRVS--P-GAQQDTLRLTFGGDRV
A0A2V7KXK7      VVKERRLFIHP--------------ETPQDSAALTTFDIT--D-RVAPGDYRVVVDKAGR
A0A651HKD3      VVRELRLYIEP--------------REPEDAELFEEVELA--G-DVVPGRYRLQVDSSGR
A0A2V7QDU7      VVAALGLQLEI-----------TKPRAVLREEVFASVRVT--R-DAPAATYRLEPADSDG
A0A2V7ITT6      VVRDLRLYVTP--------------ALPADSDLFQSFEVA--A-PFRPGAYRLAVDESGR
A0A2V7NJW1      VVRDLRLYVTP--------------ALPADSDLFQSFEVA--A-PFRPGAYRLAVDESGR
A0A2V7GFB5      VARDLRLFLQL--------------PKGPD-PALRSLNVA--D-QFRPGAYRLTTD-AAR
A0A2V7RQ86      VARDLRLFLQL--------------PKGPD-PALRSLNVA--D-QFRPGAYRLTTD-AAR
A0A2V7IWX2      VVRDVRLYLDP--------------RTPLDGTALLRFGLK--D-QVLPGRYRLEVDRDGA
A0A1Q7KE95      VARERRLYLAP--------------Q-HGWAGAFAGFTVS--D-TYRPGRYRVVVDGTGR
A0A1Q7T8X5      VARERRLYLAP--------------Q-HGWAGAFAGFTVS--D-TYRPGRYRVVVDGTGR
A0A2V7FK98      VVRDQRLFLTP--------------KAREDAPLFETFRVA--E-QYRPGVYRLALDGSAR
A0A2V7R3Z8      VVRDQRLFVTP--------------RAREDAPVFEAFRVA--E-QYRPGVYRLALDGSGK
A0A2V7J3C0      VARDLKLYLTP--------------ERGANG-AFAGFEVG--D-TYRPGRYRIVADRTGR
A0A2V7KWV9      VARERRLYLQA--------------RPR-DLPALAGFAVA--D-QFTPGRYHLTIDHDGQ
A0A1Q6ZHP2      VVRDQRLYVSP--------------NAPADAQAVAKLGVA--D-QFQAGAYRFTVDHSGQ
A0A1Q7R6Z6      VVRDQRLYVSP--------------NAPADAQAVAKLGVA--D-QFQAGAYRFTVDHSGQ
A0A2V7FYT7      VVRDQRLYVSP--------------NAPADAQAVAKLGVA--D-QFQAGAYRFTVDHSGQ
A0A2V7IGR0      VVREQRLFLTV--------------RPLADSVALGTFGVA--D-QYRPGKYRLTVDSTGQ
A0A2V7MR23      VVHDQRLFVGS--------------AARADTQAIDRIRVA--D-QYQPGAYRLSVDRSGQ
A0A2V7L1V3      VVRDQRLFVSP--------------KSRADEDVLASLRVT--G-QYRPGTYRLKVDSDRR
A0A1Q7E5D3      VVREQRLFLGL--------------GSPADAHVFDAFRPA--E-QYRPGAYRLKVDATGQ
A0A2V7ISE2      VVRDERLFVDP--------------SSPADAQALEGLRVA--D-QYRPGAYRFTVDRAGQ
A0A1Q7J2X5      VVRDERLFVAP--------------SSPADAQAVEGLRVA--D-QYRPGAYRFTVDRSGQ
A0A2V7NPD1      VVRDERLFVDP--------------SSPADAQALEGLRVA--D-QYRPGAYRFTVDHAGQ
A0A2V7QPD8      VVRDQRLFLTT--------------KAREDAPLLETFRVA--E-QYRPGAYRLAVDGSGK
A0A2V7Q8M6      VVRDQRLFVSP--------------KSRVDEAVLATLQVT--G-QYRPGVYRLKVDSDRR
A0A2V7QBC3      VVRDQRLFVSP--------------KSRADEGVLATLQVT--G-QYRPGVYRLKVDSDRR
A0A2V7LMU1      VVRDQRLFVSP--------------ESRADEPLVATLQVT--G-QYRPGAYRLKVDSDRR
A0A2V7PBY9      VARDQRMFVSP--------------KSRADARFLTTFQTA--G-QYRPGAYRLSLDADRQ
A0A3M2BLV5      VADELGLRLRR------------RGTNTVRSELFSDAVVT--D-EAEPGWYELRYSADGA
A0A2V7KS68      VVRDLRLYLTV--------------KRPAERAIFSTFNVA--D-DFRPGLYRLRASADGR
A0A2V7N4L3      VVKDQRLYLET--------------KRASDRGNFVAFRVD--D-TFRPGDYRLNISDNGR
A0A1Q7AZK2      VVRDLRLYLKV--------------KRTSDRATFDAFRVN--D-IFRPGDYRLSVSDDGR
A0A1Q7TNP7      VVRDLRLYLKV--------------KRTSDRATFDAFRVN--D-IFRPGDYRLSVSDDGR
A0A1Q7KG39      VVRDLRLYLKV--------------KRTSDRATFDAFRVN--D-IFRPGDYRLSVSDDGR
A0A1Q7GX75      VVRDLRLYLAV--------------KRPADQATFVGFRVN--D-TFRPGQYAFSVSADGR
A0A1Q7LL80      VVRDLRLYLAV--------------KRPADQATFVGFRVN--D-TFRPGQYAFSVSADGR
A0A2V7PFU2      VVRDLRLYLDV--------------KRLGDRPSFAGFSVS--D-DFRPGEYRLNISDNGR
A0A2V7MFS9      VVRDLRLYLEV--------------KRPADRPSFSGFGVA--D-AFRPGAYRLSVSDDSK
A0A2V7T933      VVRDLRLYLKV--------------KRTSDRATFDAFRVN--D-IFRPGDYRLSVSDDGR
A0A2V7J4D7      VVRGQRLYLHA--------------KVPGDSDILATLRIK--D-HVAPGKYRLVVEDTGD
A0A2V7LN90      VVRRHRLYLTP--------------RQPGDTDALATFGIK--P-HVRPALYRLVVDSIGK
A0A2V7LFN9      VARRERLYLV---------------NVSGDSAALTSFAIK--E-RVRPGTYLLAVDTVGT
A0A2V7MEK4      VARRERLYLV---------------NVSGDSAALTSFAIK--E-RVRPGTYLLAVDTVGT
A0A2V7P8B1      VVDSMPM-LRVLLRKASPSLLDRVLRRRFSTSLLGSVAVA--A-DAPADSIELAFDQDGF
A0A2V7R2W8      AVRSRRLYLHP--------------GLPGDSDVLGTLAIK--E-HVLPGEYRLVVDDTAP
A0A2V7MS64      VVRARQLYLTP--------------KEPADSDLFSGFRAA--D-RIRPGRYYLVIDATGH
A0A2V7Q7N9      VVRRQRLYVTA--------------RRPGDSDALATFEIK--D-RVRPGVYRLVVDTAGN
A0A2V7IRW6      VVRQQRLYVAP--------------QEPRDSDALAGFGIK--D-RVRGGTYRLVVNDGGT
A0A1Q7DVU6      VVRQQRLYVTP--------------KEPGDADALTGFGIK--D-RVRGGTYRLVVNDAGT
A0A1Q7JSV2      VVRQQRLYVTP--------------KEPGDADALTGFGIK--D-RVRGGTYRLVVNDAGT
A0A2V7QN41      VVRQRRLYLRP--------------GNPVDSSVLATLRLD--G-TPLPGAYRYSVDREGR
A0A2V7R603      VVRQRRLYLRA--------------RDPADSSGLATLRLD--G-TPVPGAYRYTLDREGR
A0A2V7LJS2      VVDSMPM-LRVVLRKSSPSLLDRVLRRRFSPNLLGVVAVR--P-DAAADSLSLTFERDGF
A0A1Q7GLJ7      VVDSVPM-LRV------------L-TRKFSPSLLGGVAVA--A-DSAAHSFQLTFGRDDF
A0A2V7GRE3      VVDSMPA-LRM------------VTTRDLPLSFLGEVAVP--A-AAGPVSLQIAFGRDSF
A0A2V7EU00      VVRQRRLYLTP--------------GARGDSLAFASFDMG--E-RFRSGNYRLSVDASGK
A0A1Q6WE01      VVRDRQLYLGV--------------VAR-DTRALTGFAVG--D-PVMPGRYRVVLDRSGS
A0A2V7S9K3      VVRELRLYLRV--------------DPR-RSPVFAEFTVS--D-EFRPGQYRLVVDQAGR
A0A1Q7DXB9      VVREVRLYLSP--------------KTPIDGTALLGLRLK--D-QVLPGRYRLEVDRDGQ
A0A1Q7JD32      VVREVRLYLSP--------------KTPIDGTALLGLRLK--D-QVLPGRYRLEVDRDGQ
A0A2V7MVP8      VVRDARLYLFP--------------RTPADSAALVAFGLK--A-RVVPGRYRLEVDRQAR
A0A2V7N0A9      VVRQWRLYLKP--------------QSPADTAALATFAVP--G-DVRPGRYRLQVDATGH
A0A1Q7DLS9      VVNDRQLYLTP--------------ASPSDSAVFAGFSVA--P-RFRPGSYRLEVDQAGR
A0A1Q7JK96      VVNDRQLYLTP--------------ASPSDSAVFAGFSVA--P-RFRPGSYRLEVDQAGR
A0A2V7KQV7      VVREARLYLAP--------------KSRADSAALATLTVF--G-DVRPGTYRLEVDQTGQ
A0A1Q7JGF6      VVRQWRLYLKP--------------QSAADSAALATLTVT--G-DVRPGRYRLQVAAAAN
A0A2V7SG67      VVRQWRLYLKP--------------QSAADSAALATLTVP--G-DVRPGRYRLEVAAAAN
A0A1Q7GIK9      VVRRWRLYLKP--------------KSAADSAALATLTVP--G-DVRPGHYRLVLDRAGK
                                                                            

A0A2D5ZJF2      ------------LEGVADLLAFFAKTFNDTGGSTAVASDESEEEP---DEGKQVVFYDRL
A0A0S8H9P3      V-----------FIEPGSGAPAVRGQVGEPIEFTAGSLVVRPQ-----IEPGDYRV----
A0A1E4BBP7      V--LARPA----QQRGEQDVVVERGAVGDSIG-RAVGFQWQPSAQLL-AGREQVGF----
A0A3M2G737      ---------------------------------RRV------------ESNGHVDY----
A0A0H4TUX7      F-----------EVRDGFGTVVAQGQPGETVVGPGFTLRLVPS-----PEARTVGF----
A0A1G0LUG0      Y-----------EVQDASGAAVGGGAYSQPVTVSGVTLTVQPT-----TSEDVVPF----
A0A1Q7E3T7      T-----------VLGRSRAIRTSYGTSVELDG-MRFTVVARPTVERG-------TI----
A0A1G0L906      Q-----------LRSVAGGTLVAAGGYDVPAVGSGFSFRVREYRGDP----RSVRI----
A0A1G0LCC0      Q-----------LRSVAGGTLVAAGGYDVPAVGSGFSFRVREYRGDP----RSVRI----
A0A2D5ZJE2      ---------------------------------RAMREGWTPPPESD-------------
A0A3M2G624      Y-----------VVYDTANRELGRGISGVPFQHEFFEFTISNIEG---PPQSEFYF----
W0RI74          S-----------LTDK-VGFTHEVGTVGDSVG-RSAGFAWVPPARLLGTRSREVEF----
A0A3M2BJA6      A--FR-------ITDEETLESLGEVSERLPAALAGVTFTLTEAARDY-P---RIRV----
A0A3D4VBZ5      VLNLQ------------PGVEVEKGVVGDSIG-RPVGFQWQPVAGQF-GRRTEVVF----
C1A5W1          VLNLQ------------PGVEVEKGVVGDSIG-RPVGFQWQPVAGQF-GRRTEVVF----
A0A2V7PX99      ---YE-------LLDQ-NGALVERGAVGDSVG-RSVGFSWAPSSSML-LEGRRITF----
A0A2V7ERC7      G--YT-------LATA-TGRILESGTVGDSVG-RKMGFFWNPDPALL-PPGRLIAF----
A0A5Q4D6Y4      G--VT-------SARGHASVNVSYGQRATVGG---ISFRVDEHPGV-----DQASF----
A0A2V7JTZ5      K--YM-------LSTA-KGVFIESGAIGDSIG-RKAGMNWLPDARFL-GRGRAIEF----
A0A3D4YTR6      S--YV-------LSTA-TGTVLERGAVGDSVG-RKIGMSWLPDRRLL-GANSIFKF----
A0A5Q4DA46      D--LL-------LFDS-DGNVLERAAPGQPIG-AERGIEWTPPAGAI-EAGQRIAF----
A0A2V7F1M1      T---------------------AQGLQGEAQS----------PYGTP-LAVGSVQF----
A0A2V7KXK7      A--FR--------LELEDGTVVQRGRVGQPVG-ESVGFDWTPTAAML-KPGTTVKF----
A0A651HKD3      T--LQ-------ILGR-EGELVEEASVTEGIG-ASLGIRLTPRPEHL-RPGRNAEF----
A0A2V7QDU7      ---FV-------VRNDSSEAVLGRTVPGKPLTFAGVELEVSPHALGL-GP---VAF----
A0A2V7ITT6      A--FT-------LFTT-AGDSLQHAAVGDSIG-NGLGFRWTARAGAL-LPGRVVDF----
A0A2V7NJW1      A--FT-------LFTT-AGDSLQHAAVGDSIG-NGLGFRWTARAGAL-LPGRVVDF----
A0A2V7GFB5      A--YV-------LAKV-DGAVLERGTVGDSIG-RSIGFLWAPPAESL-PPGHTVEF----
A0A2V7RQ86      A--YV-------LAKV-DGAVLERGTVGDSIG-RSIGFLWAPPAESL-PPGHTVEF----
A0A2V7IWX2      G--FT-------LFSA-QGGVVQHGERGDSVG-PALGFAWVPGAAVL-TPGRRIEF----
A0A1Q7KE95      N--FR-------LAGA-GGEGLQEGAIGDSVG-AALGFRWVPTAAVL-PAGSDLTF----
A0A1Q7T8X5      N--FR-------LAGA-GGEGLQEGAIGDSVG-AALGFRWVPTAAVL-PAGSDLTF----
A0A2V7FK98      T--FT-------LSTD-KGVEVEHGAVGDSIG-ARLGFTWAPPAGTV-PAGRTIEF----
A0A2V7R3Z8      T--FT-------LSTD-KGVEVEHGAAGDSIG-ARLGFVWAPPAGTV-PAGRTIEF----
A0A2V7J3C0      S--FS-------LLGA-KGEELQQGAIGDSIG-AALGFRWAPAAAAL-HAGSDLTF----
A0A2V7KWV9      T--FH-------LQRE-DGTELEQGAVGSPVG-RTLGFIWTPTTAVL-TPGREVRF----
A0A1Q6ZHP2      G--YT-------LATA-DGVELERGTLGDSVG-SRYGLRWVPDASTV-APGRVVEF----
A0A1Q7R6Z6      G--YT-------LATA-DGVELERGTLGDSVG-SRYGLRWVPDASTV-APGRVVEF----
A0A2V7FYT7      G--YT-------LATA-DGVELERGTLGDSVG-SRYGLRWVPDASTV-APGRVVEF----
A0A2V7IGR0      H--YT-------LADG-EGVALEHGVVGDSVG-ARLGFLWVPTRDAL-GAGRTVRF----
A0A2V7MR23      G--YT-------LSTA-DGVELERGSFGDSVG-TRYGLRWAPDASTV-PPGHTVEF----
A0A2V7L1V3      S--YT-------LSTAPENQVVERGTVGDSIG-IKLGFVWAPAAGAL-PADRTIEF----
A0A1Q7E5D3      N--WT-------LATE-DGIDLERGAVGDSIG-GRVGFHWAPGLGVL-TPGRSVGF----
A0A2V7ISE2      G--YT-------LATA-DGIELERGTLGDSVG-TRYGLQWAPDAGTV-APGRTVEF----
A0A1Q7J2X5      G--YT-------LGTA-DGIELERGTLGDSVG-TRYGLQWAPDAGTV-APGRTVEF----
A0A2V7NPD1      G--YT-------LATA-DGIELERGTLGDSVG-TRYGLQWAPDAGSV-APGRTVEF----
A0A2V7QPD8      A--FT-------LSTD-KGVEVEHGAVGDSIG-ARLGFTWAPPAGTI-PAGRTIEF----
A0A2V7Q8M6      S--YA-------LATV-EGQVLERGTVGDSIG-TRLGLAWAPAATTL-PADRAVEF----
A0A2V7QBC3      S--YA-------LATL-EGQVVERGTVGDSIG-TRLGLAWAPAASTL-PTDRAVEF----
A0A2V7LMU1      T--YT-------LATV-EGQVVERGTVGDSIG-TRLGLAWAPAASTL-PTDRAVGF----
A0A2V7PBY9      S--YT-------LATV-EGRVLEQGRVGDSIG-TRLGFAWAPTAATL-PPDRAVEF----
A0A3M2BLV5      S------------------AALVHAPTGDTVG--------TADAGEV-LEAPGLRF----
A0A2V7KS68      S--YT-------LSNKDG-VELERGTVGDSVG-RRLGFLWQPS--SL-PRDHAVEF----
A0A2V7N4L3      T--YT-------LASAEG-KELERGTVGDSVG-NRLGFRWVPAAGSL-PPGRTIEF----
A0A1Q7AZK2      Q--YT-------LASAEG-VDLERGTVGDSVG-NRLGFRWAPPAGSL-PPGRTVEF----
A0A1Q7TNP7      Q--YT-------LASAEG-VDLERGTVGDSVG-NRLGFRWAPPAGSL-PPGRTVEF----
A0A1Q7KG39      Q--YT-------LASAEG-VDLERGTVGDSVG-NRLGFRWAPPAGSL-PPGRTVEF----
A0A1Q7GX75      E--YT-------LDGANG-VELERGMVGDSVG-RRLGFQWVPASGRL-APSRTVEF----
A0A1Q7LL80      E--YT-------LDGANG-VELERGMVGDSVG-RRLGFQWVPASGRL-APSRTVEF----
A0A2V7PFU2      Q--YT-------LTSAAG-LTLERGTVGDSVG-SRFGFRWVPAPGTL-PAGRSVEF----
A0A2V7MFS9      T--YT-------LAAAEG-VDLERGTVGDSVG-RRLGFRWVPGPESL-SPGRTIEF----
A0A2V7T933      Q--YT-------LASAEG-VDLERGTVGDSVG-NRLGFRWAPPAGSL-PPGRTVEF----
A0A2V7J4D7      APHFT-------LYNARSKTPVQTGVAGDSVG-PDMGLAWVPPRAVL-AGPREVDF----
A0A2V7LN90      T--FT-------LSDKKHLV-QLHGTVGDSIG-AELGFAWVPPSGTL-TPGRLVDF----
A0A2V7LFN9      G--FT-------LTDDAGAV-LDRGAVGDSIG-AALGFAWVPPEGVL-LAGHVVEF----
A0A2V7MEK4      G--FT-------LTDDAGAV-LDRGAVGDSIG-AALGFAWVPPEGVL-LAGHVVEF----
A0A2V7P8B1      V--VG-------RPPGRR----------------------RAPYGTV-VEVGGVRF----
A0A2V7R2W8      R--FA-------LFAVSSLDPVARGGAGDSVA-PDLGLAWVPPAAAL-APGREVTF----
A0A2V7MS64      R--FA-------LQDKHK-TELQHGATGEPVG-TALGFLWTPPAEKL-TPGRRVEF----
A0A2V7Q7N9      T--FT-------LTDTKH-LVRLHGTVADSVG-PALGFAWVPPSGVL-TPGRTMEF----
A0A2V7IRW6      A--FT-------LEEMKA-GTVQHGVTGDSVG-AALGFAWVPPSAAL-SRGRRVEF----
A0A1Q7DVU6      A--FT-------LEEKKA-GVLQHGAAGDSVG-APLGFVWVPPAAAL-TRGRTVEF----
A0A1Q7JSV2      A--FT-------LEEKKA-GVLQHGAAGDSVG-APLGFVWVPPAAAL-TRGRTVEF----
A0A2V7QN41      T--FS-------LQNGGR--VVQTDSLATTVG-QGLGFSWSPARGLV-APGHAVDF----
A0A2V7R603      T--FT-------LQNGGR--VVQTDSVGTPAG-QGLGFSWSPPRGLV-A-GHSVDF----
A0A2V7LJS2      L--V--------GTGPAR---------------------RRAAYGTV-VEVGGVRF----
A0A1Q7GLJ7      V--VE-------GPAGQQ---------------------RRAAYGRV-VDLGVIRF----
A0A2V7GRE3      V--VR-------GTSG-Q---------------------WSAPYGSA-VESHDIRF----
A0A2V7EU00      N--FTLTAVGGVLMAVGG-VVLQRGTPGEAVG-DAIGFRWTPPAAAL-PAGASIAF----
A0A1Q6WE01      T--FR-------LLGDDG-VELQRGTVGDSIG-QAVGFRWAPAAAVL-PPGSEVTL----
A0A2V7S9K3      T--FR-------LEGRGG-AELQRGAVGDSVG-QALGFRWAPSATLL-APGTELPF----
A0A1Q7DXB9      A--FA-------LFS-AE-GVVQRGERGDSVG-PALGFAWVPGAAVL-TPGRRIEF----
A0A1Q7JD32      A--FA-------LFS-AE-GVVQRGERGDSVG-PALGFAWVPGAAVL-TPGRRIEF----
A0A2V7MVP8      G--FT-------VVAVGG-GVVQRGAVGDSVG-PALGFAWVPGKTVL-NPGRTIDF----
A0A2V7N0A9      S--FR-------LLDVDENAVLEQGAVGSNLG-VGLGFAWLPPAASL-RGGARVEF----
A0A1Q7DLS9      G--FT-------LATHDA-VVLQRGAAGDSVG-GALGFVWLPPAAEL-SPLRRLEF----
A0A1Q7JK96      G--FT-------LATHDA-VVLQRGAAGDSVG-GALGFVWLPPAAEL-SPLRRLDF----
A0A2V7KQV7      H--FT-------LRDVAENAVLQQGSVGDSVG-GLLGLAWVPPAGTL-RPRAVIRF----
A0A1Q7JGF6      R--FR-------LLDVDAKVVLQEGAVGDSVG-AALGFTWVPPAAVL-RPGASVQF----
A0A2V7SG67      R--FR-------LLDVDAKVVLQEGAVGDSVG-ATLGFTWVPPAAVL-RPGASVQF----
A0A1Q7GIK9      R--FR-------LLDADEKQVLQEATPGEAIG-AALGLVWVPPAGTV-QPGGRVDF----
                                                                            

A0A2D5ZJF2      KTFQDVDNIQVFLKKELEVKVG-----------------------------KKD------
A0A0S8H9P3      -HVISQLAAEAVVTGGLAASTR-----------------------------PET------
A0A1E4BBP7      -YVVTPREAAFNLGSQLSVTVG-----------------------------QNS------
A0A3M2G737      -EPLNKRSVVRRLQSSASFSPI-----------------------------PQS------
A0A0H4TUX7      -RLVRPEEAAAWVSGGLSYNVR-----------------------------EGT------
A0A1G0LUG0      -RITRREEAAAWVSGGLSYRVR-----------------------------EAT------
A0A1Q7E3T7      -SVVSREEAINGLLGGLRVTLR-----------------------------PHT------
A0A1G0L906      -SIMPRIAAGNMVRGGIGFAVP-----------------------------PTT------
A0A1G0LCC0      -SIMPRIAAGNMVRGGIGFAVP-----------------------------PTT------
A0A2D5ZJE2      ----PMADWVEALRSRLSVSPL-----------------------------KDA------
A0A3M2G624      -TLYPLQRAVNSVRAATHAQATTRAAIQDNVAGGGIAGAASAKRSRKDAAIQDA------
W0RI74          -TVLTPREASRDVQKRLAITIK-----------------------------QAS------
A0A3M2BJA6      -RVLPFDKAVTKLQKALSVSRP-----------------------------NRD------
A0A3D4VBZ5      -NVQTPREASRALIKKLALSLQ-----------------------------DGS------
C1A5W1          -NVQTPREASRALIKKLALSLQ-----------------------------DGS------
A0A2V7PX99      -NVSSPYEATQGLVKALRLKQD-----------------------------PGG------
A0A2V7ERC7      -SVTTPRNTSLGLLASMRSTLP-----------------------------EDG------
A0A5Q4D6Y4      -ELLSRDQAIELVGRNLTSQPR-----------------------------PET------
A0A2V7JTZ5      -GVTSPRNVSVFLVNAVHASLP-----------------------------EDG------
A0A3D4YTR6      -AVSSPRNTSASLVAAVHATLP-----------------------------EDG------
A0A5Q4DA46      -RVTRPREVARGLLADLDVRI-------------------------------QG------
A0A2V7F1M1      -TIPSPPSVKAGALAVRSREEV-----------------------------IDDVLKSLA
A0A2V7KXK7      -GVSAITDASASLAKSIKTRLD-----------------------------PDG------
A0A651HKD3      -RLTSPREAAGGIARSMNIQTN-----------------------------QFI------
A0A2V7QDU7      -SVVAFDDAVRGLRKALSIKRR-----------------------------NRE------
A0A2V7ITT6      -TVGTPRSAAEQLARRLRAKTD-----------------------------EAG------
A0A2V7NJW1      -TVGTPRSAAEQLARRLRAKTD-----------------------------EAG------
A0A2V7GFB5      -RLQTAREAALHLSDALDAHMD-----------------------------YNG------
A0A2V7RQ86      -RLQTAREAALHLSDALDAHMD-----------------------------YNG------
A0A2V7IWX2      -TLLTPHDAAELLASQLQVTTD-----------------------------PEG------
A0A1Q7KE95      -TVRPLRDAARQLGNALTVTMD-----------------------------QGG------
A0A1Q7T8X5      -TVRPLRDAARQLGNALTVTMD-----------------------------QGG------
A0A2V7FK98      -SVATVRDSARALSDELEVATD-----------------------------PAG------
A0A2V7R3Z8      -SVATVRDSARALSEELEVATD-----------------------------PAG------
A0A2V7J3C0      -TVRPLRDAARKLANSLAVTLD-----------------------------PGG------
A0A2V7KWV9      -VVSPLRDAAKKLADNLNVTLD-----------------------------LSG------
A0A1Q6ZHP2      -TLTTLRDAATSLGEGLDARMD-----------------------------QEG------
A0A1Q7R6Z6      -TLTTLRDAATSLGEGLDARMD-----------------------------QEG------
A0A2V7FYT7      -TLTTLRDAATSLGEGLDARMD-----------------------------QEG------
A0A2V7IGR0      -ALATVRDGARHLDEALDVRAA-----------------------------PDG------
A0A2V7MR23      -TLTTLRDAATSLADALDTWMD-----------------------------IDG------
A0A2V7L1V3      -RLATFRDAARSLADSMSAQLD-----------------------------PQG------
A0A1Q7E5D3      -TVASVRDASRHLAERLDVHMD-----------------------------MNG------
A0A2V7ISE2      -TLTTLRDAATGLGEALDVRMD-----------------------------MDG------
A0A1Q7J2X5      -TLTTLRDAATGLGEALDTRMD-----------------------------MDG------
A0A2V7NPD1      -TLTTLRDAATGLGEALDVRMD-----------------------------MDG------
A0A2V7QPD8      -SVATVRDSARALSEGLEVNND-----------------------------PAG------
A0A2V7Q8M6      -ALSTLRDAARSLADSLSAQLD-----------------------------EKG------
A0A2V7QBC3      -GLSTLRDAARSLADSLSAQLD-----------------------------EKG------
A0A2V7LMU1      -GLSTLRDAARSLADSLSAQLD-----------------------------AEG------
A0A2V7PBY9      -ELLTLRDAARSLADSLRTELD-----------------------------LEG------
A0A3M2BLV5      -VLKRAPEEFRTYLLEVVPSVA-----------------------------QVASEVRLV
A0A2V7KS68      -SLAAPRDAATGLGNALDVHMD-----------------------------ING------
A0A2V7N4L3      -SLMTPRDAALRLGEQLDVRMD-----------------------------LNG------
A0A1Q7AZK2      -SVVPPRDAALRLGEQLDVRMD-----------------------------MNG------
A0A1Q7TNP7      -SVVPPRDAALRLGEQLDVRMD-----------------------------MNG------
A0A1Q7KG39      -SVVPPRDAALRLGEQLDVRMD-----------------------------MNG------
A0A1Q7GX75      -SLVSPRDAALTLGEQLSVRME-----------------------------MNS------
A0A1Q7LL80      -SLVSPRDAALTLGEQLSVRME-----------------------------MNS------
A0A2V7PFU2      -AVMPPRDAATRLGEELQVQMD-----------------------------MNG------
A0A2V7MFS9      -SVVQPRDAALRLGEQLDVRMD-----------------------------LNG------
A0A2V7T933      -SVVPPRDAALRLGEQLDVRMD-----------------------------MNG------
A0A2V7J4D7      -TLDPPYEAALGLARNLKVAAD-----------------------------LDG------
A0A2V7LN90      -TVVAPYEAAKLLAKRLKTSAD-----------------------------ADG------
A0A2V7LFN9      -TVTTPAEAATRLRRELKVSSD-----------------------------MDG------
A0A2V7MEK4      -TVTTPAEAATRLRRELKVSSD-----------------------------MDG------
A0A2V7P8B1      -AVLRRPDAARGLLRVVSRDAA-----------------------------ISQLLTELR
A0A2V7R2W8      -TLDAPYEATLKLADQLKVSAD-----------------------------LDG------
A0A2V7MS64      -DVDAPYEAARKLGKHLKTSLD-----------------------------LDG------
A0A2V7Q7N9      -TVTAPYEAAKLLTKRLKITAD-----------------------------ADG------
A0A2V7IRW6      -TVSAPYEAARALGKRLKTSLD-----------------------------LDG------
A0A1Q7DVU6      -TVSAPYEAARALGKRLKTSLD-----------------------------LDG------
A0A1Q7JSV2      -TVSAPYEAARALGKRLKTSLD-----------------------------LDG------
A0A2V7QN41      -ALNTPADAARQLKTTLSVTTD-----------------------------VDPAL----
A0A2V7R603      -ALSTPADAARQLMKTLNVSTD-----------------------------VDPAL----
A0A2V7LJS2      -AILRRPEVRQGVLRVLSRDAA-----------------------------ISALLTELR
A0A1Q7GLJ7      -AVLHRPSAKQGFLQVLDQESA-----------------------------ISYLIAKVR
A0A2V7GRE3      -AVLHRPDAATARLRVLSREAA-----------------------------ISGLLARLR
A0A2V7EU00      -SVVTPRDAAQRLSARLGVRLD-----------------------------ENG------
A0A1Q6WE01      -IVSSVRDAAKRLGDELNVTID-----------------------------PNG------
A0A2V7S9K3      -VVTTLRDAAKHLGEALTVAID-----------------------------PSG------
A0A1Q7DXB9      -TLLTPHDAAELLASQLQVTTD-----------------------------REG------
A0A1Q7JD32      -TLLTPHDAAELLASQLQVTTD-----------------------------REG------
A0A2V7MVP8      -TVYTPHDAAELLAGELQVTTD-----------------------------PGG------
A0A2V7N0A9      -TVATTSEAAQKLAEELRVRAA-----------------------------QDG------
A0A1Q7DLS9      -VVESPHEAASRLAERLRVKTD-----------------------------LEG------
A0A1Q7JK96      -VVESPHEAASRLAERLRVKTD-----------------------------LEG------
A0A2V7KQV7      -TMTALSDVALELSQSLRIRAT-----------------------------ADG------
A0A1Q7JGF6      -TVATTSEAAQKLSEELRVRAG-----------------------------TDG------
A0A2V7SG67      -TVATTSEAAQKLSEELRVRAG-----------------------------TDG------
A0A1Q7GIK9      -TVTTTSEAALQLAEELRIRAA-----------------------------PEG------
                                                                            

A0A2D5ZJF2      -------DIISVSFDSPWPDEAELIVYEVVESYRRYQSTTKQTTAGGVLKILEKARKKAD
A0A0S8H9P3      -------NLIDVTYSGPDQRLVPRTLNAVAAALRDLGVRRVRQWARGRTRFIRDQLDESG
A0A1E4BBP7      -------NLMRFQLSGSKAGLLATTLNTLAREFVSEAVRLKRENLTVSAEATEEQLQQAA
A0A3M2G737      -------DIIQISVKSTHPEEAKLIANLFAETYYQWNVERSRTELIGTRKFLEKQLEQKR
A0A0H4TUX7      -------NAVDISFAGTDPTLVPQILNAAAVALRLDGVRRAQEIAARKRTYVAEQLAKAD
A0A1G0LUG0      -------NAVDITFTSTDPLLVPRILNAAGLALQSDGVRRAREVAARRRAYIAEQLAGAD
A0A1Q7E3T7      -------DIFDVAYVASDPQHAQQVVNRVVEVFRAVNAEEAQRQSRLRREFLETQLRVND
A0A1G0L906      -------SLVNVTFTGTDPSLVPEILNEALIALQNYGVDRVRDVASLRLRYINERVDDAR
A0A1G0LCC0      -------SLVNVTFTGTDPSLVPEILNEALIALQNYGVDRVRDVASLRLRYINERVDDAR
A0A2D5ZJE2      -------DVITIKMTAGDPDEAAYFANLFAEEYRNQNISQNRGELSGVRQFLEEQLHQVE
A0A3M2G624      -------GIVQVDVYWQDPETATQIANALADVIRHRELEDKRLEHTKTREYIERQLNTYT
W0RI74          -------PVIGLTLTGTAQQKPAATMNAMLTQFVDVATELKKREMVASTTTLNTQLDEAS
A0A3M2BJA6      ------AGIVTVRYESSDTLLVHEVPNRLAASFISRRQRIQKTEASSTVRFLEDQIDTLA
A0A3D4VBZ5      -------SFLFLRMNGPDAQRSAATLNAWVEQFVTVATQYKKQNVVQVAGILEGQREYAA
C1A5W1          -------SFLFLRMNGPDAQRSAATLNAWVEQFVTVATQYKKQNVVQVAGILEGQREYAA
A0A2V7PX99      -------SFLRIELKGTDPALTAATVNAVAGRTVTLAAELKRRKYAELAKILGEQAQQAQ
A0A2V7ERC7      -------QFLTISLTGTNPQRSARTVNVWAEQFVGAAIELKKRHLLEFKKMLGDQLNVAE
A0A5Q4D6Y4      -------NVVDVSYTATDPDVAQRLANRAVQVFQARTASEARAESQRRRQFLEEQLAVAD
A0A2V7JTZ5      -------QFLKITLSGADPRRTARTVNAWAEQLVNSSGDLKTRHLFEFKKILGDQLALAE
A0A3D4YTR6      -------QFLKITLTGSDPRRTARTVNAWAAQLVSSSGDLKKSHLLEFKRILGDQLALAE
A0A5Q4DA46      -------TFMTVGMSGTDPVRTTRVLNGILDRFAIVAEDLKRAKFEELQAILEEQLDYAA
A0A2V7F1M1      VLRRKSTDIVDVTYSDPDPLLAQRVANLLVRVFQARDAGSAQEQARSRAEFLAAQLSATD
A0A2V7KXK7      -------NFLRLQLKSTSAAGAAATLNAISARIVAVESEMKRRKFEELAGVMDEQHQHAK
A0A651HKD3      -------EYISVSLSGGDPVHAARLLNTVLESFLREATELSRATSDQLSSTLEQQLVTAR
A0A2V7QDU7      ------ANIVDVGYRGTDPQLVQAVPNLLATRFIIDRQKTQQTETRSTGAFLRDQTAKLA
A0A2V7ITT6      -------NFLSVQLTGNDARHVTAVLNAVVQRYVAVAADLKRDKLTELSKILQQQLQYAE
A0A2V7NJW1      -------NFLSVQLTGNDARHVTVVLNAVVQRYVAVAADLKRDKLTELSKILQQQLQYAE
A0A2V7GFB5      -------NFLKIELRGGDPARITRILNAVAERYVEVAAELKRGRLTELTSIIGDQVRTAK
A0A2V7RQ86      -------NFLKIELRGGDPARITRILNAVAERYVEVAAELKRGRLTELTSIIGDQVRTAK
A0A2V7IWX2      -------TFVTVQLTGTDPQLTAAIVKGVADRTVAVAADLRRHKVAALADILGEQVRHAQ
A0A1Q7KE95      -------NFLRVGLTGADPAHTAATVNAVAQRSVAVGAELKRAKLNQLGKLLDEQRQSAR
A0A1Q7T8X5      -------NFLRVGLTGADPAHTAATVNAVAQRSVAVGAELKRAKLNQLGKLLDEQRQSAR
A0A2V7FK98      -------NFLRMHLKGADAARITSTINGIAERFVQVAADLRRQKLTELTKILDQQLAAAH
A0A2V7R3Z8      -------NFLRMHLKGADAVRITSTINAIAERFVLVAADLRRQKLTELTKILDQQLAAAH
A0A2V7J3C0      -------NFLRIGLTAEDATRGAATANAIAQRFVEVGADLKRAKLHQLGTLLDEQLRAAR
A0A2V7KWV9      -------NFLRVALTSPNGTDAAATVNAVADRYVAVATDLKRVKVTELSRLLNEQLQAAE
A0A1Q6ZHP2      -------SFLRLELRGANPVDITAIVNAVAQRYVTVYADLKRQKLIELTKILGEQLQHAQ
A0A1Q7R6Z6      -------SFLRLELRGANPVDITAIVNAVAQRYVTVYADLKRQKLIELTKILGEQLQHAQ
A0A2V7FYT7      -------SFLRLELRGANPVDITAIVNAVAQRYVTVYADLKRQKLIELTKILGEQLQHAQ
A0A2V7IGR0      -------SFLHIELRGAQPARITAIVNAIAQRYVEVAAELKREKVTELTKILDQQVESAR
A0A2V7MR23      -------NFLRIEMRGPDPVRITTLVNAVAQRYVTVYADLKRQKLIELTKILGEQLQHSQ
A0A2V7L1V3      -------NFLRLELRGPDAPRITAVVNAVADRYVLVAADLKRKKLTELTKILGEQLQSAE
A0A1Q7E5D3      -------NFLRVELTGAYPARITAIVNAVVERYVQVAADLKRQKVTELTKILNDQVESAR
A0A2V7ISE2      -------NFLRFELRGPYPTRITAIVNAVAQRYVQVYADLKRQKVIELTKILGEQVQHSQ
A0A1Q7J2X5      -------NFLRVELRGVYPTRITAIVNAVAQRYVQVYADLKRQKVMELTKILGEQVQHSQ
A0A2V7NPD1      -------NFLRFELRGPYPTRITAIVNAVAQRYVQVYADLKRQKVIELTKILGEQVQHSQ
A0A2V7QPD8      -------TFLRMHLKGADAVRITSTINAIAERFVQVAAELRRQKLTELTKILDQQLAAAH
A0A2V7Q8M6      -------NFLRLELRGPDAPRITAVVNAVAERYVQVASDLKRKKLTELTKILAEQLRSAQ
A0A2V7QBC3      -------NFLRLELRGPDAPRITAVVNAVAERYVQVASDLKRKKLTELTKILAEQLQSAQ
A0A2V7LMU1      -------NFLRLELRGPDAPRITAVVNAVAERYVQVASDLKRKKLSELTKILAEQFQSAQ
A0A2V7PBY9      -------NFLRIEMRGPDAAQITAIVNAVAERYVQVAADLKRTKLSELTKILADQLQRAQ
A0A3M2BLV5      GTAREQTNIIDIYLTHEDPELAPKMLGAAARALSEFGARQVRERAESDLEFAEAQLDSAR
A0A2V7KS68      -------NFLAVELSGQNPVLIANILNAVTQRYVDVAAQLKREKLTELTKLLENQLNTAR
A0A2V7N4L3      -------NFLALELRGANPVLISNILNAVSQRYVAVAAQLKREKLTELTKLLEDQLTTAQ
A0A1Q7AZK2      -------NFLALELRGPNPVLITSILNAVAQRYVEVAAQLNREKLTQLTKILEDQLTTAK
A0A1Q7TNP7      -------NFLALELRGPNPVLITSILNAVAQRYVEVAAQLNREKLTQLTKILEDQLTTAK
A0A1Q7KG39      -------NFLALELRGPNPVLITTILNAVAQRYVEVAAQLNREKLTQLTKILEDQLTTAK
A0A1Q7GX75      -------NFLALELRGSNPVLIANILNAVSQRYVEVAAQLKREKLTELTKILEDQLRTAQ
A0A1Q7LL80      -------NFLALELRGSNPVLIANILNAVSQRYVEVAAQLKREKLTELTKILEDQLRTAQ
A0A2V7PFU2      -------NFLALELRGTNPMLISKILNAVTQRYVEVAAQLKREKLTELTKILEDQLTTAK
A0A2V7MFS9      -------NFLALQLQGTNPVLISSILNAVSQRYVAVAAQLKREKLSELTKILEDQLTTAQ
A0A2V7T933      -------NFLALELRGPNPVLITTILNAVAQRYVEVAAQLNREKLTQLTKILEDQLTTAK
A0A2V7J4D7      -------NFLRMELGGHDPAQIAATVNAVAERFVAVAAGLKRDNLTELTRILGDQLAQAQ
A0A2V7LN90      -------NFLRLELGGSDPAEVTAIVNLVAERFVAIAADLKKENLQQLTGILSGQLERAR
A0A2V7LFN9      -------NFLRLELTGPDAAGVTGTVNAVASRFVAAAADLKRDNLTQLTGILGAQLEQAQ
A0A2V7MEK4      -------NFLRLELTGPDAAGVTGTVNAVASRFVAAAADLKRDNLTQLTGILGAQLEQAQ
A0A2V7P8B1      VRPRVRTDIVDVAYAAPDPSRAQQVVNRVVDVFRAASAEAAQGQSRLRREFLEAQLKVND
A0A2V7R2W8      -------NFLHMQLGGRDPVAIAATVNTVAERFVAVAAGLKRDNLGELTGILGAQLAQGQ
A0A2V7MS64      -------NFLRLELAGDDPVQITDIVNTVGQRFVAAAADLKRQNLTELSRILGDQLDKAR
A0A2V7Q7N9      -------NFLRLELGGSDPGEVTAVVNMVAERFVSVAADLKKQNLQQLTGILGGQLERAR
A0A2V7IRW6      -------NFLRLELGGPDAAGITAVVNAVAERFVAAAAELKRQNLTELTRILSGQLERAQ
A0A1Q7DVU6      -------NFLRLELGGPDAAGITAVVNAVAERFVAAAADLKRQNLTELTRILNGQLERAQ
A0A1Q7JSV2      -------NFLRLELGGPDAAGITAVVNAVAERFVAAAADLKRQNLTELTRILNGQLERAQ
A0A2V7QN41      MRAGTDANFLRIQLTGSRPAELAATVNAIADRVVVVAADLKRIKLVELGRILDEQRQHAL
A0A2V7R603      MRAGTDANFLRIQITGSRPAELAATVNAIADRVVVVAADLKRIKLVELGRILDEQRQHAL
A0A2V7LJS2      VRPRMRTDIVDVAYSAPDPARAQEVVNRVVDVFRAASAEAAQGQSRLRREFLEAQLRVND
A0A1Q7GLJ7      VRPRLRTDIVDVAYSAPDPARAQEVVNRVVDVFRAASADAAQRQSKLRREFLEAQLKVND
A0A2V7GRE3      VKPRLNTDIVDVTYSAPDPYVAQHVLNRVVDLFKSASAEDAQQQSTRRREFLESQLKVND
A0A2V7EU00      -------NFMRLELDGTDPKSIAATLNAIAQRLVAVAAELKRAKLTELTRILNEQLTTAA
A0A1Q6WE01      -------NFLRLSLSGTDGPTVAATLNAVAQRYVDAALKLKRAKLSELAALLAEQLQSAR
A0A2V7S9K3      -------NFLGISLTDANGTAAAKTVNYVAQRYVLAASGLKRSKLTELARLLDEQLQSAR
A0A1Q7DXB9      -------TFVTVQLTGTDPQLTAAIVKGVADRTVAVAADLRRHKVAALADILGQQVQHAQ
A0A1Q7JD32      -------TFVTVQLTGTDPQLTAAIVKGVADRTVAVAADLRRHKVAALADILGQQVQHAQ
A0A2V7MVP8      -------SFVTVQLTGTDPHLTTAILRGVANRTVAVANELRRHKVAALADMLGQQVQHAQ
A0A2V7N0A9      -------NFIRIERRGPDRRVVTGTVNAVAERFVAAAAELKRQRLTQLTAILKDQLDHAQ
A0A1Q7DLS9      -------NFLRVELRGQDPRKITVIVNAVAQRFVAVAADLKRQQLTELVRILGEQLNHSQ
A0A1Q7JK96      -------NFLRVELRGQDPRKITVIVNAVAQRFVAVAADLKRQQLTELVRILGEQLNHSQ
A0A2V7KQV7      -------YFVRLERRGHDPVLITTTVNAVADRLVAVAADLKRERRTELSSILHEQRDRAK
A0A1Q7JGF6      -------NFVRIERRGPDAAVVTRTVNAVAERFVAAAADLKRQRLTELTAILKDQLDRAE
A0A2V7SG67      -------NFVRIERRGPDAAVVTRTVNAVAERFVAAAADLKRQRLTELTAILKDQLDRAE
A0A1Q7GIK9      -------NFVRIARRGPDPDQATGIANAVAERFVAAAADLKRQRLTELTAILQDQLNHAQ
                         . .                                                

A0A2D5ZJF2      GKWNESYEKL-----------ILSQKKHPVLSLKDDRGSFLVRGLSTLHEELAAAQSAAI
A0A0S8H9P3      RQLREALQAVQDYKGR-----------------------------RGLISLTVEESRVMQ
A0A1E4BBP7      QQLAAAQTALERFKIN-----TITLPSEQMAITPGV---------------STTMNPVFQ
A0A3M2G737      ERLYQAEDSLRKYMEA-----------------------------SNVMTDDAGATATIE
A0A0H4TUX7      SSYRIKLAELQRFKEG-----------------------------EQITDLSVEEQSVVQ
A0A1G0LUG0      AAYKGKLTELQRYKEG-----------------------------QQITDLSAEELSIVQ
A0A1Q7E3T7      SVLADARRALTAFRRH-----------------------------AGRAGSDQQGPTQQA
A0A1G0L906      TRYLSALSGVQSYKES-----------------------------ENTTNFTAEEVAIIN
A0A1G0LCC0      TRYLSALSGVQSYKES-----------------------------ENTTNFTAEEVAIIN
A0A2D5ZJE2      TRLAISEEELRSFKTK-----------------------------SGLVSLSDEVEWLVR
A0A3M2G624      QKLKASEEALQTYKEQ-----------------------------NRIYELDAIARDVTY
W0RI74          KGLQAAEQAFEDYRVK-----TIAEPSETPTVISSDPKSQN----------MAVGQPIFN
A0A3M2BJA6      RQLAAAEERLVAFREE-----------------------------GQVVSIEAEANAQVT
A0A3D4VBZ5      QELASAEAALEGFRVR-----TVTEPSERQTIQPGI---------------EMTNSPVFE
C1A5W1          QELASAEAALEGFRVR-----TVTEPSERQTIQPGI---------------EMTNSPVFE
A0A2V7PX99      QALHASDAALASFRVR-----TAGVVQRGAPTVSPTM--------------DGKGDPVYS
A0A2V7ERC7      HELNTSELLLEQFRAS-----TITLPSGGSPLASSG---------------QTAGDPAFT
A0A5Q4D6Y4      TTLREAQGYLTAFRSD-----EQVVST------------------------QAQGTEEQL
A0A2V7JTZ5      AQLRTSENELEHFRVS-----TITLPSGVAASAGPG---------------VTQGDPVVA
A0A3D4YTR6      GQLRSSEDELERFRVN-----TITLPHG-ATPIGPG---------------AGQVDPVVG
A0A5Q4DA46      QNLQQAEYALEGFKVR-----TISLPSEQGMPVAGGT--------------QQTTNPVFQ
A0A2V7F1M1      SELSIAQAELSAFRRQ-----RMLGSSRDKLAVEQAR-----------------------
A0A2V7KXK7      EALDQADEALRNFRVR-----TADRPLVTQAPG------------------GGLTVEGSG
A0A651HKD3      QTLQEAEGELEAFHRA-----NVLSPAQQGA--------------------VDGSSPAMD
A0A2V7QDU7      RQLRASEDSLERFRVV---EHIVSLPQQASSGV--------------------------T
A0A2V7ITT6      HNLRSAEEVFEDFRVQ-----TITLPADRVTPVAPGV--------------ELTRDPGVA
A0A2V7NJW1      HNLRSAEEVFEDFRVQ-----TITLPADRVTPVAPGV--------------ELTRDPGVA
A0A2V7GFB5      QSLDSAEGDLQTFRRR-----TITLPPDAVAAGG-----------------DTPRDPVLG
A0A2V7RQ86      QSLDSAEGDLQSFRRR-----TITLPPDAVAAGG-----------------DTPRDPVLG
A0A2V7IWX2      ASLTAAELALKSFRVR-----AA--------------------GVLPAGVAAPPPSPAFT
A0A1Q7KE95      ENLQRAESALEQLQVT-----VGPDLGAAPVPP--------------------GGGPPLG
A0A1Q7T8X5      ENLQRAESALEQLQVT-----VGPDLGAAPVPP--------------------GGGPPLG
A0A2V7FK98      QNLLDAEQALERFQVK-----TITLPS-------TAAGGARAAGGVPTASGASADDPAFA
A0A2V7R3Z8      QNLLDAEKALERFQVK-----TITLPS-------TAVGGSRGA-GVPSA-GASADDPAFA
A0A2V7J3C0      DNLRRTESALEQFQVG-----TATFTPTVGTAAA-----------------SAGRDAAFG
A0A2V7KWV9      ANLHKAERALEDFRVR-----TIMLPAEPVAG-------------------SAARTSPVS
A0A1Q6ZHP2      ENLHGAEASLQRFREE-----TITLPGDRPSVGGASVAGAAVGGPGATGA-VAARDPVFG
A0A1Q7R6Z6      ENLHGAEASLQRFREE-----TITLPGDRPSVGGASVAGAAVGGPGATGA-VAARDPVFG
A0A2V7FYT7      ENLHGAEASLQRFREE-----TITLPGDRPSVGGASVAGAAVGGPGATGA-VAARDPVFG
A0A2V7IGR0      QRLRDAEAGLRSFGVR-----TITLPSGRAAA-------------GVTGT-GADRDPALT
A0A2V7MR23      DNLRSAEAALQRFREE-----TITLPGERPVTGGASVAGPVVAGAAPGTGPAGARDPLFG
A0A2V7L1V3      DKLRGAEAALERFRER-----TITLPADRPAPVALGAPGGA--GGGSQGQ-VGEADPKFG
A0A1Q7E5D3      RNLQDAEVALEAFRVR-----TITLPSDRPAPSRAGVAGAT----GAAAG-DVAGDPVFT
A0A2V7ISE2      ENLRNAEAALQRFREE-----TITLPSDRPAAG-ASVAGAG--VGGAGAA-GGARDPVFG
A0A1Q7J2X5      ENLRNAEAALQRFREE-----TITLPSDRAAAG-ASVAGAGGVGAGAGAA-GGTRDPVFG
A0A2V7NPD1      ENLRNAEAALQRFREE-----TITLPSDRPAAG-ASVAGAG--VGGAGAA-GGTRDPVFG
A0A2V7QPD8      QNLQDAEKALERFQVS-----VITRPSQVPKAGP-------------------GDDPAFK
A0A2V7Q8M6      GNLRSAEAGFERFRER-----TITLPGDRTPPGALGMAGGA--GGGQGA----ESDPKFG
A0A2V7QBC3      GNLRSAEAAFEGFRER-----TITLPGDRTPPVSLGVPSAA--GGGQGA----ESDPKFG
A0A2V7LMU1      GNLRSAEAALERFRER-----TITLPSDRPPPVALGAPGGA--GGGAQGA---ELDPKFG
A0A2V7PBY9      GTLRSSEAALERFRVR-----TITLPTDRPPPVALGAPGGA--GGGGGSA-NGEASAQFG
A0A3M2BLV5      NNLQRSFQKIREFKET---------------EAFTNL--------------TAEEQQLVQ
A0A2V7KS68      SNLDDAESALQHFRTR-----TITLPSEQA--GPSAT--------------E-TRDPIRS
A0A2V7N4L3      RNLDEAETALQRFRTR-----TITLPSERSPSAAVSG--------------D-THDP-RA
A0A1Q7AZK2      RNLDSAETALQGFRTR-----TITLPSDQAADRKAAA--------------D-TRDPIRT
A0A1Q7TNP7      RNLDSAETALQGFRTR-----TITLPSDQAADRKAAA--------------D-TRDPIRT
A0A1Q7KG39      RNLDSAETALQGFRTR-----TITLPSDQAADRKAAA--------------D-TRDPIRT
A0A1Q7GX75      GNLDDAETALERFRTR-----TITLPSDQT----TGV--------------E-SRDPRRA
A0A1Q7LL80      GNLDDAETALERFRTR-----TITLPSDQT----TGV--------------E-SRDPRRA
A0A2V7PFU2      RNLDEAEDAQRRFRTR-----TITLPSDQQR-PGAAA--------------E-TRDPIRA
A0A2V7MFS9      RNLDDAEAAQQRFRTR-----TITLPSDQQAGQAAAA--------------G-TRDPIRA
A0A2V7T933      RNLDSAETALQGFRTR-----TITLPSDQAADRKAAA--------------D-TRDPIRT
A0A2V7J4D7      ANLRQAEASLKSFRVG-----AVTTVAAGAGSVTESS--------------QYPRDPMFA
A0A2V7LN90      DKLQSAEAGLKRFRVG-----AVTQYADGAAPVTPNM--------------EFPRDPAFA
A0A2V7LFN9      ARLRSAETALQRFRVT-----AVTEYAEGAAPVTPNM--------------QYPQDPVFA
A0A2V7MEK4      ARLRSAETALQRFRVT-----AVTEYAEGAAPVTPNM--------------RYPQDPVFA
A0A2V7P8B1      SVVADAQAALTALQRRARSDGWGQSSGREQTEVPGLE--------------LQRQQLLAE
A0A2V7R2W8      AALRSAEDALRAFRVG-----AVTTLAEGAGSVAQNT--------------QYQRDPLFA
A0A2V7MS64      TELTSAEQSLKQFRMS-----AVTEYTEGTASIAPNM--------------QFPHDPVFA
A0A2V7Q7N9      DKLQSAEAELKRFRVG-----AVTQYADGSAPVTPNM--------------EFPRDPVFA
A0A2V7IRW6      ANLRDAETALKTFRVS-----AVTEYADGAAPVTPNM--------------QFPRDPVFA
A0A1Q7DVU6      ANLRDAETTLKTFRVS-----AVTEYADGAAPVTPNM--------------QFPRDPVFA
A0A1Q7JSV2      ANLRDAETTLKTFRVS-----AVTEYADGAAPVTPNM--------------QFPRDPVFA
A0A2V7QN41      RGLRDAEAAQRDFRIR-----SAGVLRQGAPPVSATL--------------RGGGDPVFE
A0A2V7R603      GSLRAAEAAQRDFRIH-----SAGVLRQGAPPVSASL--------------RGGGDPVFE
A0A2V7LJS2      SLVADAQDALTAFQRRARSDGSGQTSGREQTELPGLE--------------LQRQQLLAE
A0A1Q7GLJ7      SLLADARQALTEFQRRARPYGSGGSSAREQSELPGLE--------------LERQQLMAE
A0A2V7GRE3      SLLADARQAVTAFRQRAGTYGSRDALAREQAGLAGVE--------------LQRQQLEAE
A0A2V7EU00      RNLRDAEGSLESFRVK-----TITLPSEQSTPVSPGL--------------EATRDPVFR
A0A1Q6WE01      ASLQRAESAYEAFRTR-----TITLPPDPGAAAAAA----------------AGVQSPMS
A0A2V7S9K3      GNLQRAEAALEQFRTR-----TITLPPDPGATGTAA----------------PPKGSPLG
A0A1Q7DXB9      ASLTVAELALKNFRVR-----AAGVLPAGVAAPPP--------------------SPAFT
A0A1Q7JD32      ASLTVAELALKNFRVR-----AAGVLPAGVAAPPP--------------------SPAFT
A0A2V7MVP8      TSLTAAELALKDFRIR-----TAGVLPAGVVTPPP--------------------SPAFT
A0A2V7N0A9      DNLRAAEAALMAFRVR-----NAVRPSEGPAQGPDGR--------------RITADPTYA
A0A1Q7DLS9      VNLSAAESALRDLLSK-----TVSFVADGATPVAPGL--------------QFTHDPGFA
A0A1Q7JK96      VNLSAAESALRDLLSK-----TVSFVADGATPVAPGL--------------QFTHDPGFA
A0A2V7KQV7      ANLSSAELALTQFRVR-----NAVRPSEGPAEGPDGR--------------RITADPTFA
A0A1Q7JGF6      TNLRAAERGLTAFRVR-----NAVRPSEGPAQGPDGR--------------RITADPTFA
A0A2V7SG67      TNLRAAERGLTAFRVR-----NAVRPSEGPAQGPDGR--------------RITADPTFA
A0A1Q7GIK9      ANLRTAEAALTVFRVH-----NAVRPSEGPAQGPDGR--------------RITADPTFA
                                                                            

A0A2D5ZJF2      VAKATYEAAEQMQGD----PERLRQLV---------------ESQFGRVGTTPF--NQE-
A0A0S8H9P3      RVATLQTEIEQLLIEKSLYTSLVDRIG--SVGLRPGD-----VQQFVVLSTEEVNRTVQ-
A0A1E4BBP7      AYFSDRVNYEQVRRD----REALERIV--EEG--RGRGGKISLEALRSVGSATAS-NTS-
A0A3M2G737      KIAQLEATRSALEID----IQAFAEKIKSYED------KLGSKSNVNVIAEQNDPYITQ-
A0A0H4TUX7      SIQALEQQRQQITVQ----IATLREAL--GQP--GDSIGVGTLNRLAAVQDIGQ--NTA-
A0A1G0LUG0      SIQTLEQERQLLAVQ----LSTLRGSL--GDS--ATQIDVGTLNRLSAVQGIAQ--NNA-
A0A1Q7E3T7      GIDQLQLQRDQLDADRRMYRSILVSLD--SGGGRGNREALRTAASTPAISANAV--VAP-
A0A1G0L906      SIHGFDREKERLQVD----LSTLQGIMGPEAQVTLET-----LNRLAALTGIAN--NTA-
A0A1G0LCC0      SIHGFDREKERLQVD----LSTLQGIMGPEAQVTLET-----LNRLAALTGIAN--NTA-
A0A2D5ZJE2      QLAEFESAENAAITD----QKSLERRLEHLEGELERA-RAGLVEDLDDAAASPL--VIQ-
A0A3M2G624      KVFDIEAEISQIQAE----RERIKLFREKVTS------GLQ-PEDYLLISAIPF--QDEE
W0RI74          AFFTRKTEVDQLKRD----RESLERLLGQIKA--PGS-TLAPEILLTVPTLANDPGAAG-
A0A3M2BJA6      ELARLQADRNAIDAERSALQELMDEID--REATTADPAGPSPYRRLLSFPTLLK--NQS-
A0A3D4VBZ5      NYFRDKILADNYRRD----REALERIL--QSG--RSGTAITREAVLSVPAVNADPAAEN-
C1A5W1          NYFRDKILADNYRRD----REALERIL--QSG--RSGTAITREAVLSVPAVNADPAAEN-
A0A2V7PX99      RAFELRLNIEQLRRE----RRVIEKAL--ADQ--PKS-GLP-VEALAVLPTVGT--SPE-
A0A2V7ERC7      TYFQQKATLDEVRND----RMAIERILSDARG------GPINPQAFLVLPSILNN-TPQ-
A0A5Q4D6Y4      GLINIEMRREELLAD----RSMYQSILGELGSADPGEMGERIQAIVATPEVAANPVVSS-
A0A2V7JTZ5      SYFQQKVALDEIRSE----RQALERMVSEAKGGPINP-----QDFLQLPTILNN--APQ-
A0A3D4YTR6      NYFQQKAALDEVRSE----REALERMIADAKGGPIDT-----QGFLQLPTILNN--APQ-
A0A5Q4DA46      NFFNLRVEQDEARRD----QSALNRAM--ARS--QQEGRLA-TEALEVIPSVRE--STD-
A0A2V7F1M1      -LTALDARLGELEAE----RSVYESFLTKFNTS-NDSLRLDVARDLSYTPELAA--DPV-
A0A2V7KXK7      VVTQLRTDMDQQRRD----RQQILSLA--TRA--QSS-SVP-VQLWNSIPSVQN--DPV-
A0A651HKD3      AYIDLQLGAEELERD----RGALLRAL--EAG--GGA-GIR-IQALEAIPAVQS--SSE-
A0A2V7QDU7      QFAELQAQRNALDAE----RRALEQLL--SSTASSVA-GSTQSTPIAFPTLLRNEVAAS-
A0A2V7ITT6      AFFNMKVEREQLRRD----REAIELAL--AQA--ADS-AAS-WDALSVIGSVQQ--SPG-
A0A2V7NJW1      AFFNMKVEREQLRRD----REAIELAL--AQA--ADS-AAS-WDALSVIGSVQQ--SPG-
A0A2V7GFB5      DFFEQQVQRQQVARD----RAALTRVL--AQP--ADS-GLA--SALEVIDAVQH--SPE-
A0A2V7RQ86      DFFEQQVQRQQVARD----RAALTRVL--AQP--ADS-GLA--SALEVIDAVQH--SPE-
A0A2V7IWX2      NAFELRVAVDQLGRD----RQAIDRVL--AQQ--PDS-GLS-VDALAAIDAVQK--SPE-
A0A1Q7KE95      TLLGPKLEQEQLRRD----RDAIEQVL--VQM--RDS-GGS-PDGLAFIGAVQR--SPD-
A0A1Q7T8X5      TLLGPKLEQEQLRRD----RDAIEQVL--VQM--RDS-GGS-PDGLAFIGAVQR--SPD-
A0A2V7FK98      SFFRMQVDRQQVQQD----RDALERVL--KQA--GDS-GVS-PEALAIVGSVQQ--NVQ-
A0A2V7R3Z8      SFFRMQVDRQQVQQD----RDALERVLAQAQA--SDS-GVS-PEALAIVGSVQQ--NVQ-
A0A2V7J3C0      SLFAPRLEEEQLRRD----RSAIQQVL--ARM--RDS-GGS-PEGLAFIGAVQR--TAD-
A0A2V7KWV9      EFLTRRVQEDQLRRD----QDALAQVL--AQG--PDSLGFS--ERLAAIGAVQG--SAD-
A0A1Q6ZHP2      SFFDMQISREQARRD----RDALDRLL--AQA--GDS-GLS-AEALSVVGLVQA--NPE-
A0A1Q7R6Z6      SFFDMQISREQARRD----RDALDRLL--AQA--GDS-GLS-AEALSVVGLVQA--NPE-
A0A2V7FYT7      SFFDMQISREQARRD----RDALDRLL--AQA--GDS-GLS-AEALSVVGLVQA--NPE-
A0A2V7IGR0      SFFDLQIEQQQAHQD----RKAILQAL--AQA--RDS-GLS-ATALEAIGAVQH--NAD-
A0A2V7MR23      SFFEMQISREEARRD----RDALQRLL--AQQ--GDS-GLS-VEALSVVGLVQQ--NPE-
A0A2V7L1V3      TFFTMQFDRERIQQD----REALQRLL--QAR--DSA-GLS-ADALAVVGSVQG--NPD-
A0A1Q7E5D3      HFFDTQVEREQVRRD----RETLERVL--AQA--GDS-GSS-ADALSVIGSVQR--HAE-
A0A2V7ISE2      GFFETQLTREEARRD----REALGRLL--AQA--GDS-GLS-PEALSVVGSVQQ--NPE-
A0A1Q7J2X5      GFFDMQLTREEARRD----REALGRLL--AQA--GDS-GLS-AEALSVVGSVQQ--NPE-
A0A2V7NPD1      GFFETQLTREEARRD----REALGRLL--AQA--GDS-GLS-AEALSVVGSVQQ--NPE-
A0A2V7QPD8      NFFTMQVDREQARRD----REALERVL--AQA--GDS-GVS-PEALAIVGSVQQ--NAD-
A0A2V7Q8M6      TFFGMQADRDRIQQD----REALQRLL--APA--SDSSGLS-ADALAVVGSVQG--NPD-
A0A2V7QBC3      TFFGMQADRDRIQQD----REALQRLL--APT--SDSSGLS-ADALAVVGSVQG--NPD-
A0A2V7LMU1      TFFNMQFDRERIQQD----REALQRLL--AQV--RDSTGIS-PDELAVVGSVQA--NPD-
A0A2V7PBY9      TFFNMQFDRERLQQD----REALERVL--AQA--GDTAGLS-PDALAVVGSVQS--NPD-
A0A3M2BLV5      RRQDALERLQQLDDQ----RQALQNLM--VDI--QAA-GVEGVDIVAFLAALPQGVNPQ-
A0A2V7KS68      NYFDMEADRDQLRRD----REAIEGLL--PAGG-G---PLP-ADALSAIESVQH--APE-
A0A2V7N4L3      GFFDIQVERDQVRRD----REAIDNLL--AQ-G-WDS-GVP-TAALSAIGSVQH--APE-
A0A1Q7AZK2      SFFDMAVERDQLRRD----GDAIDRLL--AQGG-GGD-GLP-TEALSAIGSVQH--APE-
A0A1Q7TNP7      SFFDMAVERDQLRRD----GAAIDRLL--AQGG-GGD-GLP-TEALSAIGSVQH--APE-
A0A1Q7KG39      SFFDMAVERDQLRRD----GDAIDRLL--AQGG-GGD-GLP-TEALSAIGSVQH--APE-
A0A1Q7GX75      NFFEMQVDRDQLRRD----RDAIDRLL--AEAG-GAS-GLP-TAALSAIESVQH--APE-
A0A1Q7LL80      NFFEMQVDRDQLRRD----RDAIDRLL--AEAG-GAS-GLP-TAALSAIESVQH--APE-
A0A2V7PFU2      SFFDMAVERDQLRRD----RDALERLL--TQAG-----GLQ-TDALSAIKSAQD--APE-
A0A2V7MFS9      SFFDMQVERDQLRRD----RDALQRLL--TQ-G-GDS-GLP-TDALSAIESAQR--APE-
A0A2V7T933      SFFDMAVERDQLRRD----GDAIDRLL--AQGG-GGD-GLP-TEALSAIGSVQH--APE-
A0A2V7J4D7      GLVDLKVNLDEVRRD----RTAIERLL--APSTDPTV-EVP-VDALSMVGSVQR--STE-
A0A2V7LN90      GLLGMKVNREELRRD----RDAIGRIL--AQR--PDS-GLA-VDALATIGAVQK--STE-
A0A2V7LFN9      GLLDLKVRRGDLLRD----RAAIKRIL--AQG--PES-GLM-VDALATLASVER--STE-
A0A2V7MEK4      GLLDLKVRRGDLLRD----RAAIKRIL--AQG--PES-GLM-VDALATLASVER--STE-
A0A2V7P8B1      RRTDEDLLAAL--QDSSTSRKAIQTAL--STP--G-------------VAPNPA--VVQ-
A0A2V7R2W8      GLVEMKVSLDEVRRD----RAAIDRLL--RQG--IDS-GVS-VDALAMVGAVQR--STE-
A0A2V7MS64      GLFDMKVNREELRRD----RAAIDRIL--AQG--SDA-DLA-VDALTMIGSVQK--STE-
A0A2V7Q7N9      GLVGMKVNREELRRD----REAIGRIL--ARG--PDS-ALA-VDALATIGSVQK--STE-
A0A2V7IRW6      GLLDMKVNREQLRRD----REAIARIL--AQG--RDS-GLA-VDALAMIGSVEK--STE-
A0A1Q7DVU6      GLLDMKVSREQLRRD----REAIARIL--AQG--RDS-GLA-VDALAMIGSVEK--STA-
A0A1Q7JSV2      GLLDMKVSREQLRRD----REAIARIL--AQG--RDS-GLA-VDALAMIGSVEK--STA-
A0A2V7QN41      RSFDTKLALDSVQRD----RQALQRAL--AQT--GDS-GPP-IEALQAIGAVQK--SAE-
A0A2V7R603      RSFDTKLALDSVQRD----RQALQRAL--AQT--GDS-GPP-IEALQAIGAVQK--SAE-
A0A2V7LJS2      RRTDETLLKAL--QDSSTSRRAIQTAL--STP--G-------------VAPSPA--VVQ-
A0A1Q7GLJ7      RRTDEALLAAL--RDSSTSRKAIQTAL--AAP--G-------------MGASPA--LSQ-
A0A2V7GRE3      RRTDESLLAALRDRDSSVSRKALQTAL--ATP--G-------------VAASPS--VMQ-
A0A2V7EU00      NFFEMRIMREQLRRD----REAVLRVL--AQA--PES-GLA-VAGLEVIGTVHN--SSD-
A0A1Q6WE01      EFFGLRMAYDQMRRD----QLAVAHVL--TQA--HDS-AAS-IDALAAIGAVQQ--SLD-
A0A2V7S9K3      DFFDLQVEQGQLRRD----QQAITQAL--DQM--RDS-GAS-VEGLGFIGAVQR--SPE-
A0A1Q7DXB9      NAFELRVAVDQHGRD----RQAIDRVL--AQP--PDS-GLS-VDALAAIDAVQK--SPE-
A0A1Q7JD32      NAFELRVAVDQHGRD----RQAIDRVL--AQP--PDS-GLS-VDALAAIDAVQK--SPE-
A0A2V7MVP8      NAFELRVTRDQLGHD----RQAIDRFL--AQ---PDS-GLS-ADALVVIDAVQK--SPE-
A0A2V7N0A9      GYMDLQIAASGLARD----REAIAQML--VHA--PDS-GIA-VDQLAMIGAVQR--SSE-
A0A1Q7DLS9      SYFETKVNLEQVRRD----RAAIERLL--AQV--RDS-GLP-VDALAAIGAVDR--STE-
A0A1Q7JK96      SYFETKVNLEQVRRD----RAAIERLL--AQV--RDS-GLP-VDALAAIGAVDR--STE-
A0A2V7KQV7      SYVDLQVAIDGLARD----REAITQVV--ARA--RDG-SVP-VDELSMIGAVQR--SSA-
A0A1Q7JGF6      SYVDLQVALGALAHD----REAIARVV--AHA--ADS-GVA-VDQLAMISAVQH--ASE-
A0A2V7SG67      SYVDLQVALGALAHD----REAIARVV--AHA--ADS-GVA-VDQLAMISAVQH--ASE-
A0A1Q7GIK9      SYVDVQVTLDGLTRD----RAAIAQVL--THA--ADS-GVA-VDQLAMIGAVQR--SSE-
                              :                                             

A0A2D5ZJF2      -------KVQLHRDASQLQ------------------------LELADL--QRQVTSDHP
A0A0S8H9P3      -----FYYDQLLELLEERS------------------------SQLGPL----GKDPSHP
A0A1E4BBP7      -------LQAEIANLNQAR------------------------GQLVNL--QKTYTDEYR
A0A3M2G737      -------LQEQIANLEVQRDVTITQNPALAGQEAYIEKMAEINAQIEAL--RSKLQQRTE
A0A0H4TUX7      -------LGFQIQNLLTLY------------------------DQRRTL------TAGAL
A0A1G0LUG0      -------LGFQIQSLLTQY------------------------EERRKL------TAGAL
A0A1Q7E3T7      -------LFTQLVQYENTR------------------------DSLTAR------STTHP
A0A1G0L906      -------MTFQIQNLLKLH------------------------DDRRTL------VAGSL
A0A1G0LCC0      -------MTFQIQNLLKLH------------------------DDRRTL------VAGSL
A0A2D5ZJE2      -------LREQLVALQIEH------------------------TSLLVR----GASEDSP
A0A3M2G624      GYGYWDVLSQLTSQLMELE------------------------IQLPLK--LEEMTENHP
W0RI74          -------VKQTVDELTHAT------------------------VDLRVK--LQTLTDSNP
A0A3M2BJA6      -------TSELLRSLTEVE------------------------NQRSVL--LQRRTMADD
A0A3D4VBZ5      -------LRRALEERAARE------------------------LELRRL--RETYTDEYQ
C1A5W1          -------LRRALEERAARE------------------------LELRRL--RETYTDEYQ
A0A2V7PX99      -------LNTALQEINQKE------------------------ADLRAL--RTRYTDASA
A0A2V7ERC7      -------LRTAIEELSSRQ------------------------AALRTE--QQYLTNANP
A0A5Q4D6Y4      -------LHAQLMELETER------------------------QALTSG--PWGLSQTNP
A0A2V7JTZ5      -------LRSAIEELSLRQ------------------------ATLRTE--QQFLTDANP
A0A3D4YTR6      -------LRSAIEELSLRK------------------------ATLRTE--QQFLTDANP
A0A5Q4DA46      -------LVRALSLASEKR------------------------AEVRAL--SLRYHEDWP
A0A2V7F1M1      -------VSRISQQVLVYR------------------------TRLDSL---TTGPLPAA
A0A2V7KXK7      -------MKGALDELGLKQ------------------------AQLRQL--RLQYTDSAA
A0A651HKD3      -------LMGALEQVAEAR------------------------AERRAL--LQRYTEEYP
A0A2V7QDU7      -------LLSALAQTEDRR------------------------SEL-----LSRRSPQDA
A0A2V7ITT6      -------LMQALKELTDKQ------------------------AEQRAL--GYRYTADFS
A0A2V7NJW1      -------LMQALKELTDKQ------------------------AEQRAL--GYRYTADFS
A0A2V7GFB5      -------LKGALQELTTKQ------------------------ADLRNL--RYHYTEAYP
A0A2V7RQ86      -------LKGALQELTTKQ------------------------ADLRNL--RYHYTEAYP
A0A2V7IWX2      -------LTQALKELTDKQ------------------------AELRAL--RYTYTDQHF
A0A1Q7KE95      -------VSQALRELTTKQ------------------------AERRAL--ASKYTDDHP
A0A1Q7T8X5      -------VSQALRELTTKQ------------------------AERRAL--ASKYTDDHP
A0A2V7FK98      -------LKQALDELTTKQ------------------------AELRAL--RYKYSDEYP
A0A2V7R3Z8      -------LKQALDELTTKQ------------------------AELRAL--RYKYNDAYP
A0A2V7J3C0      -------VSQALRDLTVKQ------------------------ADERAL--RARYTPEHH
A0A2V7KWV9      -------LTRALTELTTKR------------------------AERRAL--LYRYTDDHP
A0A1Q6ZHP2      -------LTQALTELMTKQ------------------------AELRAL--RYKYSDAYP
A0A1Q7R6Z6      -------LTQALTELMTKQ------------------------AELRAL--RYKYSDAYP
A0A2V7FYT7      -------LTQALTELMTKQ------------------------AELRAL--RYKYSDAYP
A0A2V7IGR0      -------LAQALKELVTKQ------------------------ADLRVL--RYQYTDAYP
A0A2V7MR23      -------LSQALTELNNKQ------------------------AELRSL--RYKYTDEYM
A0A2V7L1V3      -------LAAALTELTSKR------------------------ANLRAL--RYRYSDQYP
A0A1Q7E5D3      -------LSQALKELTAKQ------------------------AELRAL--RYRYSDAYP
A0A2V7ISE2      -------LSEALKELTDKQ------------------------ALLRTY--RYKYSDEYP
A0A1Q7J2X5      -------LSEALKELTDKQ------------------------AQLRAY--RYKYSDEYP
A0A2V7NPD1      -------LSEALKELTDKQ------------------------AQLRAY--RYKYSDEYP
A0A2V7QPD8      -------LKQALAELTTKQ------------------------AELRAL--RYKYSDQYP
A0A2V7Q8M6      -------LAAALTELTSKR------------------------ASLRAL--RYRYSDQYP
A0A2V7QBC3      -------LAAALTELTSKR------------------------ASLRAL--RYRYSDQYP
A0A2V7LMU1      -------LAAALTELTSKR------------------------ANLRAL--QYRYSDQYP
A0A2V7PBY9      -------LVGALGELTSKR------------------------ASLRAL--RYKYSDQYP
A0A3M2BLV5      -------ITAIAEDIRDKQ------------------------DEIQRLLTEERVTPDHP
A0A2V7KS68      -------LANALKELGDKR------------------------AELRTL--RYHYSDAYP
A0A2V7N4L3      -------LSSALKELGDKE------------------------AEVRTY--RYHYSDAYP
A0A1Q7AZK2      -------LSNALKELSDKQ------------------------AQLRTY--RYHYSEAYP
A0A1Q7TNP7      -------LSNALKELSDKQ------------------------AQLRTY--RYHYSEAYP
A0A1Q7KG39      -------LSNALKELSDKQ------------------------AQLRTY--RYHYSEAYP
A0A1Q7GX75      -------LSNALKELSDKE------------------------AQLRAL--RYHYSDAYP
A0A1Q7LL80      -------LSNALKELSDKE------------------------AQLRAL--RYHYSDAYP
A0A2V7PFU2      -------LSNALKELSDKQ------------------------AQARTY--RYHYSEAYP
A0A2V7MFS9      -------LSNALKELSDKQ------------------------AQLRAY--RYHYSEAYP
A0A2V7T933      -------LSNALKELSDKQ------------------------AQLRTY--RYHYSEAYP
A0A2V7J4D7      -------LVQGLRDLTSKQ------------------------AELRAL--RAHYTDANP
A0A2V7LN90      -------LSQALHDLTVKQ------------------------AELRAL--RTRYADANP
A0A2V7LFN9      -------LSQALRDLTAKQ------------------------AVLRAL--RVRYTAEAP
A0A2V7MEK4      -------LSQALRDLTAKQ------------------------AVLRAL--RVRYTAEAP
A0A2V7P8B1      -------LNTQLLHYEMAR------------------------DSLVSL--SPTHPDLR-
A0A2V7R2W8      -------LVQALRDLTAKQ------------------------AELRAL--RGHYTDDNP
A0A2V7MS64      -------LAQALRDLTSKQ------------------------AELRAI--RSRYTDASP
A0A2V7Q7N9      -------LSQALHDLTTKQ------------------------AELRAL--RTRYADANP
A0A2V7IRW6      -------LSQALRDLTGKV------------------------AELRAL--RGRYTDANV
A0A1Q7DVU6      -------LIQALRDLTGKV------------------------AELRAL--RGRYTDANV
A0A1Q7JSV2      -------LIQALRDLTGKV------------------------AELRAL--RGRYTDANV
A0A2V7QN41      -------LSLALQEVTQRQ------------------------ATLRAL--RYRYTDASD
A0A2V7R603      -------LSLALQEVTQRQ------------------------ATLRAL--RYRYTDASD
A0A2V7LJS2      -------LNTQLFQYEIAR------------------------DSLASL--SPSHPDLP-
A0A1Q7GLJ7      -------LSAQLFQYEMAR------------------------DSLASR--SARHPDLP-
A0A2V7GRE3      -------LSTQLYQYERAR------------------------DSLASR--STSHPDLP-
A0A2V7EU00      -------LVEALKELTAKQ------------------------AELRAL--RYRYTDEHP
A0A1Q6WE01      -------LKQALSELTTKR------------------------AELRAL--RYRYTEDHP
A0A2V7S9K3      -------LSDALREVTTKR------------------------AELRAL--RYRYTDDHP
A0A1Q7DXB9      -------LTQALKELTDKQ------------------------AELRAL--RYTYTDQHF
A0A1Q7JD32      -------LTQALKELTDKQ------------------------AELRAL--RYTYTDQHF
A0A2V7MVP8      -------LMQALKELTDKQ------------------------AELRAL--RYTYTDQNF
A0A2V7N0A9      -------LIAALKELTDRQ------------------------AELRAL--RFRYADTHP
A0A1Q7DLS9      -------LVAALRELTAKR------------------------AELRAL--QQRYTEEHG
A0A1Q7JK96      -------LVAALRELTAKR------------------------AELRAL--QQRYTEEHG
A0A2V7KQV7      -------LAAALKDLADRQ------------------------AELRVL--RFRYADTHP
A0A1Q7JGF6      -------LTAALKELSDRQ------------------------AELRVM--RFRYADTHP
A0A2V7SG67      -------LTAALKELSDRQ------------------------AELRVM--RFRYADTHP
A0A1Q7GIK9      -------LTAALKELTDRQ------------------------ADLRAL--RFRYADTHP
                                                                            

A0A2D5ZJF2      AVESLESKIARIKGELEALDRTTGEAYLE-----------------------LARQQWLV
A0A0S8H9P3      VIM-------ALDQRISETQDQLVAAAEN------------------------AAVAL--
A0A1E4BBP7      MVK-------DLKQQIEVMESQSIPTLVA-----------------------SSLQEL--
A0A3M2G737      EYR-------KSILKDENLTASDILELRT--------------------SIFAAQMEMQT
A0A0H4TUX7      GLR-------ERNPQVDALSERIRQGYQA--------------------LRGAVSAALES
A0A1G0LUG0      GLR-------ERSPQISALDDRIQQGHQA--------------------LRTAVGAALES
A0A1Q7E3T7      DVP-------RLNQLLVATEGKLLRAVQS-----------------------ALKGLIAS
A0A1G0L906      GLR-------ESNPQVQAIDQRITQAAAA-----------------LREAANATVRGI--
A0A1G0LCC0      GLR-------ESNPQVQAIDQRITQAAAA-----------------LREAANATVRGI--
A0A2D5ZJE2      QII-------DLESKVKQAKTRLAAETQKIVDRDLLPGDPLLYSQGLVEKVLELRTELET
A0A3M2G624      DII-------ALKNQIQQVRLR----LQQ-----------------------QVDARLTM
W0RI74          LVV-------DARRNIAELHDRVLPQRLT-----------------------DYIATL--
A0A3M2BJA6      DVQ-------QFTQRIRELEAQ-LRTVAT-----------------------TYLQGL--
A0A3D4VBZ5      RVK-------DAQAALVALRDTVVPRSLD-----------------------AYLGEL--
C1A5W1          RVK-------DAQAALVALRDTVVPRSLD-----------------------AYLGEL--
A0A2V7PX99      PVQ-------QARSDLDALEQRTVPALAR-----------------------KLAADL--
A0A2V7ERC7      RIK-------QLGEAIRVLEIETIPRIAQ-----------------------SVLESL--
A0A5Q4D6Y4      DVA-------RIDQQIATTGGR-LESAVR-----------------------SHMQNL--
A0A2V7JTZ5      RIR-------QLAEAVRVLERETIPQITV-----------------------AVLNSL--
A0A3D4YTR6      RIK-------QLAEAVRVLETETIPQITQ-----------------------AVLNSL--
A0A5Q4DA46      EVQ-------ALRRDIVELEQQTIPALVG-----------------------TLQSEM--
A0A2V7F1M1      PTN-------PDVLGLKALIRSTQEELVR-----------------------AVRAHLTS
A0A2V7KXK7      PVR-------QLQSDLTTLEHQQIPSLAR-----------------------ILAGTL--
A0A651HKD3      SVA-------ELDAQLRTLEGQVVPSLAR-----------------------EILEDL--
A0A2V7QDU7      DVQ-------VLTRRIEDL-RAQLRGIAA-----------------------TYLQGL--
A0A2V7ITT6      RVG-------YVREQVDTLERKTIPGLAR-----------------------ALIREL--
A0A2V7NJW1      RVG-------YVREQVDTLERKTIPGLAR-----------------------ALIREL--
A0A2V7GFB5      PLA-------RKAAEVATLERQTIPTLVR-----------------------SLIDEL--
A0A2V7RQ86      PLA-------RKAAEVATLERQTIPTLVR-----------------------SLIDEL--
A0A2V7IWX2      PVQ-------QLADAVATLDRRTIPGMLR-----------------------ALRNNL--
A0A1Q7KE95      AVQ-------RLIGEIELLERGTVPTLAQ-----------------------SLIDEL--
A0A1Q7T8X5      AVQ-------RLIGEIELLERGTVPTLAQ-----------------------SLIDEL--
A0A2V7FK98      LVQ-------RRLSEVATLERQTIPTLAR-----------------------QLMAEL--
A0A2V7R3Z8      LVQ-------RRLSEVATLQRQTIPTLAR-----------------------QLMAEL--
A0A2V7J3C0      AVQ-------QLRAEIAALEQRTIPALAE-----------------------SLSAEL--
A0A2V7KWV9      AVQ-------RVTTDLEQLEHQTIPGLIR-----------------------GLVAEL--
A0A1Q6ZHP2      PVQ-------RLLGEIATLQRQTIPTLAR-----------------------QLAGQL--
A0A1Q7R6Z6      PVQ-------RLLGEIATLQRQTIPTLAR-----------------------QLAGQL--
A0A2V7FYT7      PVQ-------RLLGEIATLQRQTIPTLAR-----------------------QLAGQL--
A0A2V7IGR0      RVQ-------RLTAEIATLQRQTIPALAQ-----------------------ALAGEL--
A0A2V7MR23      PVQ-------RLLGEIRTLQRQTIPTLAR-----------------------TLAGQL--
A0A2V7L1V3      PVQ-------RLVGEIGTLERQTIPALAR-----------------------VLLDQL--
A0A1Q7E5D3      PVQ-------RLLAEIATLKRQAIPVLAR-----------------------ALVGEL--
A0A2V7ISE2      PVQ-------RLLGEIATLQRQTIPTLAR-----------------------ALAGQL--
A0A1Q7J2X5      PVQ-------RLLGEIATLQRQTIPGLAR-----------------------ALAGQL--
A0A2V7NPD1      PVQ-------RLLGEIATLQRQTIPTLAR-----------------------ALAGQL--
A0A2V7QPD8      LVQ-------RRLSDVATLERQTIPTLAR-----------------------RLLAEL--
A0A2V7Q8M6      PVQ-------RLVAEIATLEHQTIPALAR-----------------------GLMDQL--
A0A2V7QBC3      PVQ-------RLVAEIATLERQTIPALAR-----------------------GLMDQL--
A0A2V7LMU1      PVQ-------HLTGEIATLERQTIPALAR-----------------------GLLDQL--
A0A2V7PBY9      PVQ-------RLIEEITTLQRQTIPTLAR-----------------------GLLAQL--
A0A3M2BLV5      RVQ-------AIRTQLARDEGSLRDAVDR-----------------------HL-QGI--
A0A2V7KS68      PLQ-------RLAGQVAQLEQQTIPTLAR-----------------------GLAAQL--
A0A2V7N4L3      PLQ-------RLLAQVGELQQRTIPSLAR-----------------------ALSSQL--
A0A1Q7AZK2      PVQ-------RLAREISELQQRTIPTLAR-----------------------ALSAQL--
A0A1Q7TNP7      PVQ-------RLAREISELQQRTIPTLAR-----------------------ALSAQL--
A0A1Q7KG39      PVQ-------RLAREISELQQRTIPTLAR-----------------------ALSAQL--
A0A1Q7GX75      PVQ-------RLAAEIAELQQRTIPTLAR-----------------------ALSVQL--
A0A1Q7LL80      PVQ-------RLAAEIAELQQRTIPTLAR-----------------------ALSVQL--
A0A2V7PFU2      PLQ-------HLAAEITELQERTIPTLAR-----------------------ALASQL--
A0A2V7MFS9      PLQ-------RLVSEIAQLQQRTIPTLAR-----------------------TLASQL--
A0A2V7T933      PVQ-------RLAREISELQQRTIPTLAR-----------------------ALSAQL--
A0A2V7J4D7      PVR-------RLASEVDELAHRTVPALAA-----------------------SLVAEL--
A0A2V7LN90      AVR-------RVAAEVAELERRAIPGLAT-----------------------SLTREM--
A0A2V7LFN9      AVR-------RVAAEAATLERQTIPQLAT-----------------------GLAREL--
A0A2V7MEK4      AVR-------RVAAEAATLERQTIPQLAT-----------------------GLAREL--
A0A2V7P8B1      --------------RLSLLIPPTEAKLLR-----------------------AVQAGV--
A0A2V7R2W8      PVR-------RAAAEAEALGRRTIPALAS-----------------------SLAAEL--
A0A2V7MS64      AVQ-------RIALDVKTLQRQTIPSLAT-----------------------QLASEL--
A0A2V7Q7N9      AVR-------RVAVEVQDLERRTIPDLAA-----------------------SLTREM--
A0A2V7IRW6      AVR-------RVSDEVAVLEQQTIPALAT-----------------------KLTQEM--
A0A1Q7DVU6      AVR-------RVSDEVAVLEQQTIPALAT-----------------------KLTQEM--
A0A1Q7JSV2      AVR-------RVSDEVAVLEQQTIPALAT-----------------------KLTQEM--
A0A2V7QN41      PVQ-------RVRGEVRTLLQTTIPTLAR-----------------------GLDADL--
A0A2V7R603      PVQ-------RVRGEVRTLLQTTIPTLAR-----------------------LLDADL--
A0A2V7LJS2      --------------RLNLLISSTEAKLLR-----------------------AVQAGV--
A0A1Q7GLJ7      --------------RLNLLVSSTEAKLLR-----------------------AVQAGV--
A0A2V7GRE3      --------------RLNQLVSSTEADLLH-----------------------AVQGGV--
A0A2V7EU00      PVK-------RLQASIETLERHTIPALAG-----------------------ALLEEV--
A0A1Q6WE01      AVR-------RLTTDIDVLQRQAIPGLAR-----------------------ALHAEL--
A0A2V7S9K3      TVR-------RLAAEIDVLEHQTIPVLVR-----------------------TLLTEL--
A0A1Q7DXB9      PVQ-------QLADAVATLERRTIPGMLR-----------------------ALRNNL--
A0A1Q7JD32      PVQ-------QLADAVATLERRTIPGMLR-----------------------ALRNNL--
A0A2V7MVP8      PVQ-------QLADAVATLEHRTIPALLR-----------------------AVRDNL--
A0A2V7N0A9      PVR-------RLAAQVDTLARRVIPGLGR-----------------------ALIAGL--
A0A1Q7DLS9      TVR-------RLAGEVQALEGRTIPALAR-----------------------VLVSEL--
A0A1Q7JK96      TVR-------RLAGEVQALEGRTIPALAR-----------------------VLVSEL--
A0A2V7KQV7      PVR-------RLAQQVDTLARYVIPELGG-----------------------ALVAAL--
A0A1Q7JGF6      PVR-------RLAQQVDTLARRVIPELGR-----------------------AVVAGL--
A0A2V7SG67      PVR-------RLAQQVDTLARRVIPELGR-----------------------AVVAGL--
A0A1Q7GIK9      PVR-------RLALQVDTLAQRVIPGLAR-----------------------TLMDGL--
                                                                            

A0A2D5ZJF2      ARERETELDQRYRTQLVEAQELGA-------KATELAKLESEVSKTEKMLDILDDRIKEV
A0A0S8H9P3      -DTRIGALTGRLSNLQAELRQLPA-------VESELTRLQNEVEIHSDMYKYLLSRYQES
A0A1E4BBP7      -RSREAEMKRRIDGASQELKQIPA-------RTVEEMRLNRELQIAQTMYVDLQQRAMSA
A0A3M2G737      LKTKKEILDSTIADYERKIKTLPQ-------KSIDYARLVRQRSSAEKLYLLVEQHYNEA
A0A0H4TUX7      LESRTEALDQRVASARARLRTFPG-------KESRIAQLQLEASILNDTYRYLLTEYESA
A0A1G0LUG0      IEARRQALDLRVQELRGTLGTFPG-------KQSRIAQLQLETSIHNDTYRYLLGQLEAA
A0A1Q7E3T7      LDVRIATLDDLRVRRVANVEQRSS-------TDAEEARLEERVENGRKIADELRIEYQRA
A0A1G0L906      -QANIASLDQNVANLRQRLGTYPG-------KETRFAQLALDIELQNGIYKYLLSELESA
A0A1G0LCC0      -QANIASLDQNVANLRQRLGTYPG-------KETRFAQLALDIELQNGIYKYLLSELESA
A0A2D5ZJE2      ARSRAAELNRFVADYATKLHSLPD-------KELALARKTREYTVNENTYLMMKEKYEEV
A0A3M2G624      LDSREESLRLQLLPYQQQLETFPL-------KEVELARLEREFRLNEEIYSLLTRQHEQT
W0RI74          -RTRESQYGQELQTATHELQGIPE-------RTIQTGVLARERDVRAEIYTKLRTASAQA
A0A3M2BJA6      -TNQVQSYDQTLEQFAAQLEVIPQ-------KQVQLARLEREEKVLSELFTLLQTRLKEA
A0A3D4VBZ5      -RLREQTLNSTIEQSSKDLKGIPS-------RTIEEQRLKRQVEVAARVYESLNMKAAEA
C1A5W1          -RLREQTLNSTIEQSSKDLKGIPS-------RTIEEQRLKRQVEVAARVYESLNMKAAEA
A0A2V7PX99      -SAREAALTPQVDSAFGYMRTVPP-------LALEEDQLKRAVAGAEAFSATVNQRYEAA
A0A2V7ERC7      -RSRENQLTGRIDTQERVLRQIPS-------RSIEEMRLVRRVSASETMYNSLKARYEEV
A0A5Q4D6Y4      -DARLAAMTDLRARTAAQIAGRPQ-------ALAEEERLLQDVASIRRTMEQLQDEFYRA
A0A2V7JTZ5      -KAREPELDTRISVGSQELRGIPA-------RATEEARLVRQVAATENLYNSLKARYEEV
A0A3D4YTR6      -KAREPELGARIDVGSQELRAIPA-------RATEEMRLARRVVASESLYNTLKARYEEL
A0A5Q4DA46      -QARESEIERFVGRASSELQQIPP-------RVVEEARLTREYQSAENLFRDLQGRFENA
A0A2V7F1M1      IGAQSQALAALRSRTGASFQRLPA-------TEAEGGRLERLVEDLRSTGDRIRQDYKNA
A0A2V7KXK7      -GEVVATTKPRADTAIGQLRAAPS-------IALEGSRLEREQRLAEEQFNNVDGEYQKA
A0A651HKD3      -EARLGEVTSRLQTRSAELGAIPT-------RSIREASLRREVGRAETLYEDVSQRYESA
A0A2V7QDU7      -SNQVVAIDLTLAKSNAQLQTIPA-------KEIRLAQLERNVSGLAQIYTQLESRLKES
A0A2V7ITT6      -AMRESVGDARIRLASQDLRQIPP-------RAIQEGRLRREVAVAENLFTTLQQRYEEA
A0A2V7NJW1      -AIRESVGDARIRLASQDLRQIPP-------RAIQEGRLRREVAVAENLFTTLQQRYEEA
A0A2V7GFB5      -GTRMAELDRRIGSASQELRRIPA-------RSVEEARLRRSVTIADNLYTSLQQNYEAA
A0A2V7RQ86      -GTRMAELDRRIGSASQELRRIPA-------RSVEEARLRRSVTIADNLYTSLQQNYEAA
A0A2V7IWX2      -AARERDLGQRVDSTVRYLSNIPP-------LLFEQTRLEREVQVAGQLYASLQQRYDEA
A0A1Q7KE95      -TARERVLAPQVAAADRDLRRIPQ-------RAIEEARRRRDVDLATNLYTSVQQRYDEA
A0A1Q7T8X5      -TARERVLAPQVAAADRDLRRIPQ-------RAIEEARRRRDVDLATNLYTSVQQRYDEA
A0A2V7FK98      -SGREAELGRRVTADARSIQAVPP-------RAIDEARLQRQVTLAENLFTSLQKNYDEA
A0A2V7R3Z8      -SGRDAELGRRVAADTRSIQLVPP-------RAIDEARLQRQVTLAENLFTNLQKNYDEA
A0A2V7J3C0      -LARERVLAPQIAAGEHELRGIPQ-------RAIDEARLRRDLELATNLFTGVQQRYDEA
A0A2V7KWV9      -ATQRRALASQLETGGRELQGIPQ-------RAIEDARLRRDVSIAENLFTSVQQRYSEA
A0A1Q6ZHP2      -AAKETELGRRVDADSRTLKQIPA-------RAIEEARLRRDAALAENLYLSLQGKYDEA
A0A1Q7R6Z6      -AAKETELGRRVDADSRTLKQIPA-------RAIEEARLRRDAALAENLYLSLQGKYDEA
A0A2V7FYT7      -AAKETELGRRVDADSRTLKQIPA-------RAIEEARLRRDAALAENLYLSLQGKYDEA
A0A2V7IGR0      -AAREAELGRRVETGSQNLRQIPP-------RAIDEARLRRDMTLAENLYATLQQRYEEA
A0A2V7MR23      -AAKEAELGRRTDADSRTLRQIPA-------RAIEEARLRRDAGLAENLYTGLQAKYDEA
A0A2V7L1V3      -AAREAELGRRLGADSRSLQQIRA-------RAIEEARLRRTKTMSENLYTMLKERYEEA
A0A1Q7E5D3      -ASRETELGRRVDADSRTLRQIPP-------RLIEEARLRRADTLAANLYTTLQQRYEEA
A0A2V7ISE2      -AGKEAELGRRVDADSRSLRQIPA-------RTIEEARLRRDASLAENLYTSLQQKYDEA
A0A1Q7J2X5      -AGKESELGRRVDADSRSLRQIPG-------RTIEEARLRRDASLAENLYTSLQQKYDEA
A0A2V7NPD1      -AGKEAELGRRVDADSRSLRQIPG-------RTIEEARLRRDASLAENLYTSLQQKYDEA
A0A2V7QPD8      -SGREAELGRRVAEDTRSIQAVPP-------RAIDEARLQRQVTLAENLFTSLQKNYDEA
A0A2V7Q8M6      -AARETELGRRLGTDSRSLRQIPA-------RAIEEARLRRTLSMAEDLYTLLQKRYEEA
A0A2V7QBC3      -AAREMELGRRLGADSRSLRQIPA-------RAIEEARLRRTLSMAEDLYTLLQKRYEEA
A0A2V7LMU1      -TARDAELGRRLGADSKSLRQIPA-------RAVEEARLRRSVTMAENIYTMLQQRYEEA
A0A2V7PBY9      -TAREADLGRRLGTDSRTLRDIPA-------RAIEEARLRRDVSLSENLFTMLQQRYEEA
A0A3M2BLV5      -DREMAEVRTELDRIQEAQRRFPQ-----LQNRYDELDLQRSIDREMVLYLQ-SQLYQAQ
A0A2V7KS68      -AARESEIGRQVDAASTDLRQIPA-------RTIEEVRLRRNADLKEQTYTSLQQRFDQA
A0A2V7N4L3      -AARATELGRQVDAASPGLRQIPG-------RTIEEARLTRNAQLKEQTYTQLQQRFDQA
A0A1Q7AZK2      -ATRESELGRQVGAASRDLRQIPA-------RDIEDVRLNRNAQLKEQTYTALQQRFDQA
A0A1Q7TNP7      -ATRESELGRQVGAASRDLRQIPA-------RDIEDVRLNRNAQLKEQTYTALQQRFDQA
A0A1Q7KG39      -ATRESELGRQVGAASRDLRQIPA-------RDIEDVRLNRNAQLKEQTYTALQQRFDQA
A0A1Q7GX75      -AARESELGRHVDAASSDLRQIPA-------RTIEEARLNRNVQLKEQTYTALQQRFDQA
A0A1Q7LL80      -AARESELGRHVDAASSDLRQIPA-------RTIEEARLNRNVQLKEQTYTALQQRFDQA
A0A2V7PFU2      -ADRESELERQVNSASNDLRQIPG-------RAIEEVRLNRNVELKEQTYTQLQQRYDQA
A0A2V7MFS9      -ASRESELGRQVDAASHDLRQIPG-------RAIEEVRLNRNAQLKEQTYTALQQRYDQA
A0A2V7T933      -ATRESELGRQVGAASRDLRQIPA-------RDIEDVRLNRNAQLKEQTYTALQQRFDQA
A0A2V7J4D7      -RVRESELVQRVDAASSSIQKIPP-------LAVEESRLQRGVTLAEQTVTNLQARYEEA
A0A2V7LN90      -AFREAELAQRVDSAATDLRRIPP-------LAVEETRLEREVTRGEQAVASLQTLYEEA
A0A2V7LFN9      -ERRAAELGQRADSVARDLRRIPP-------LAVEETRLQRDVTQSAQTVANLQQHYEEA
A0A2V7MEK4      -ERRAAELGQRADSVARDLRRIPP-------LAVEETRLQRDVTQSAQTVANLQQHYEEA
A0A2V7P8B1      -QGAIASLDGRIAA----INDLRARRAGNLQHDADEARLTERLDNARKVADALRTEYQKA
A0A2V7R2W8      -RVRETELAERVATASTGLQQVPP-------LAVEEARLQRNVTLAEQAVTNLQQRYEEA
A0A2V7MS64      -GLRETELAQRINAASTGLRRIPP-------LAVEEERLVREVTLRDQAVSNLTARYQEA
A0A2V7Q7N9      -QFREVELAQRVDSAASNLRRIPP-------LAVEETRLEREVTRGEQAVASLQTLYDEA
A0A2V7IRW6      -AVQEAGLAQRVDSAAGGLRRIPP-------LAVEETQLQRSVTLAEQVVTNLQQRYEEA
A0A1Q7DVU6      -AVQERVLAQRVDSAAGGLRRIPP-------LAVAETQLQRDVTLAEQVVTNLQRRYEEA
A0A1Q7JSV2      -AVQERVLAQRVDSAAGGLRRIPP-------LAVAETQLQRDVTLAEQVVTNLQRRYEEA
A0A2V7QN41      -AAREEALSRRADAAFGYLHDLPP-------LALEEARLQRDVAIAEQLFTTVQQSYNQT
A0A2V7R603      -AAREEALSHRADAAFGYLHDLPP-------LALEEARLQRDVAIAEQLFTTVQQSYNQT
A0A2V7LJS2      -QGAIASLDGRIAA----INDLRARRAGNLQHVAQEARLTERVENARKVADELRTEYQKA
A0A1Q7GLJ7      -QGSIASLDGRIAA----IDDLRAHWAGGLQQDAEEARLKERVDNARKVADELRVEYQKA
A0A2V7GRE3      -QSAIASLEGRITA----MNDLRARQQQLSTSEEEEARLTERVDNAQKVADELRVEYQKA
A0A2V7EU00      -GTRERVLDSLVQSGGRELQQIPL-------RAVEEARLRREVTIAENLYTTLQQRYEEA
A0A1Q6WE01      -GARAQTLATEISAGGRELQAIPQ-------RSIEEGRLRRDVSIAENLYASVQQRYNEA
A0A2V7S9K3      -GTRQRLLASEVAAGGRALQAIPQ-------RAVEEARLRRDVAIAENLYSSVQQRYDEA
A0A1Q7DXB9      -AAREHDLGQRVDSTVRYLSNIPP-------LLFEQTRLEREVQVAGQLYASLQQHYDEA
A0A1Q7JD32      -AAREHDLGQRVDSTVRYLSNIPP-------LLFEQTRLEREVQVAGQLYASLQQHYDEA
A0A2V7MVP8      -AVRERDLGQRVDSTVRYLSNIPP-------LLFEQTRLEREVQVAGQLYASLQQHHDEA
A0A2V7N0A9      -AARERELRQRADSITGVLRRAPP-------AALEEVRLARDQANAEQLFSDLQHRYQEA
A0A1Q7DLS9      -AARDAELTQRVRAASAELRQIPS-------LAIEDARLRREVANAERLFTSIQQRYDEA
A0A1Q7JK96      -AARDAELTQRVRAASAELRQIPS-------LAIEDARLRREVANAERLFTSIQQRYDEA
A0A2V7KQV7      -AAREHELQQRIDSIARALRGAPP-------VALEEIRLARDQANATELFSNLEQRYNEA
A0A1Q7JGF6      -AAREHELQQRIDSISRDLRSAPP-------VALEEVRLARDQANAEQLFSNLQQRYQEA
A0A2V7SG67      -AAREHELQQRIDSISRDLRSAPP-------VALEEVRLARDQANAEQLFSNLQQRYQEA
A0A1Q7GIK9      -AARARELASRRDSIARDLQSAPP-------VALTEIRLARDQTNAEQLFSNLQQRYQEA
                                                                            

A0A2D5ZJF2      DVTEKADVLNINILEYAEVEDEPSKP--EKARIMGAALVAGLILGAGLALLVDWKDHRFR
A0A0S8H9P3      QIAEAEISPYVEVLDPA-SWARPVSG--GRRINIIFGGLLGLLLGLGAAFFLEYLDRSLK
A0A1E4BBP7      RLSERNALPDVSILDTAVAPRFPSSD--TTLSIILVAIAASIGLGLALAILLDRLDKRFR
A0A3M2G737      SIAEQSEFGNVEIIESAETPTKPINP-PKPLRTVFLGGFLGLGLGLGIVFVREFFNTQIR
A0A0H4TUX7      RLTEATIGPYINLLDPA-SPAFRVGT--TLRQKIVLGMLVGLLLGLGGAFFLEYLDQTIK
A0A1G0LUG0      RLQENTIAPYINLLDPA-SPAFRIGR--TPWQTAMLGLLVGLLLGFGAAFLLEYLDQTIK
A0A1Q7E3T7      RIAEAVEVGHVEIVDLAVPPTAPLGI--GFAERLALGLLFGLVLGGGSAWLTEHLRSSIA
A0A1G0L906      RISAATISPYIQIVETATVAARIGVG---TRQKVTIGLLVGLFLGIVAAFFLEYLDQTIK
A0A1G0LCC0      RISAATISPYIQIVETATVAARIGVG---TRQKVTIGLLVGLFLGIVAAFFLEYLDQTIK
A0A2D5ZJE2      RISEAGEIGNVRIIDAALPFLDPVRP--NRRMNALLGLVVGLGLALSLAFFFEYLDTSLR
A0A3M2G624      RLAEAAIVNDIQVLDYASIPTAPIGGGPNRQKAILLGALLGIGVGLGVAFLLEFLDNTIR
W0RI74          QLAQQSAVPDVKILDTAITPLAPSSN--TAPTFIGGGLFAGLVIGIGLAFLLDLLDNRFR
A0A3M2BJA6      QIAQAVEDASIRVVDPAILPSEPIKP--KTVLNIALGLILGMMLGVGLAFTREHMDDTVH
A0A3D4VBZ5      KLAEASTIPDVSILDAAVPPLSPTRN--TAPMIILGAVGAALALGLLLAIVLDQLDKRFR
C1A5W1          KLAEASTIPDVSILDAAVPPLSPTRN--TAPMIILGAVGAALALGLLLAIVLDQLDKRFR
A0A2V7PX99      RLGLISSSPDVRLLDSAVQPGKPSLD--LGPLLIALSFLTSLGLGMVGAVVLDRADPRVR
A0A2V7ERC7      SLAEAQTTPDLSILDYAIPPVHPTSN--GARRLLILAVLASIALACAIALIRDRFDRLFR
A0A5Q4D6Y4      RMAEAVEEGPVQIVDLAPTPHTSEQA--GLPLMLVLGLMLGAMVGSGGAFLLEMLNTKVR
A0A2V7JTZ5      SLAEVQTAPDLSVLDTAVAPTLPTSN--DAPRLLLLAVVASMGLAVGIALIRDRLDRRFR
A0A3D4YTR6      SIAEAQTTPDLAVLDTAVGPNFPTSN--DAPRLLLLAVAASIGLAFGIALILDRLDPRFR
A0A5Q4DA46      RLGAVSTVPDVRILVRAQVPEFPSSD--PRNQFGLMAILAGLALGLVGAIVRDRMDPVLR
A0A2V7F1M1      RMAEAISAGDARVIDWAPLPYKAAGI--PPWAKLGLGLLLGLLLGCGAAGLAESGNSLLM
A0A2V7KXK7      KLGLISALPDVRVLDPAQEPRRPAAD--FGPLLILLAAMASFGLAVMGVTLRDKMDPKVR
A0A651HKD3      RLASISADPNVRVVDWAEPPTHPESD--RSTLMAMVVFFGFMGGGLVGALVLDRADRRVR
A0A2V7QDU7      EIAAAAEDPSVRLVDAALLPREPVSP--RRAFSIVLALLGGLTLGLGAALTREHLDRAVH
A0A2V7ITT6      RLAEASSIPDVRVLDVATPPLVPVRN--TAPGVILGAFLGSMALGLVGVVRRDRADPRVR
A0A2V7NJW1      RLAEASSIPDVRVLDVATPPLVPVRN--TAPGVILGAFLGSMALGLVGVVRRDRADPRVR
A0A2V7GFB5      KLAEASSIPDIRIFDKAVVPLQPVKN--TAPRLLLLGFLGGLGLALAGVVLLDRFDPRVR
A0A2V7RQ86      KLAEASSIPDIRIFDKAVVPLQPVKN--TAPRLLLLGFLGGLGLALAGVVLLDRFDPRVR
A0A2V7IWX2      RVAEASALPDVRILDAPVQPYQPIGS--VAPFLVIMAFLASAGLGVLGAVVIDTLDPRFR
A0A1Q7KE95      RLAEASSVADVRILDAAVPPQESLGN--STLRFIVLGLAAGLGLGLVGAVVGDRLDPRMR
A0A1Q7T8X5      RLAEASSVADVRILDAAVPPQESLGN--STLRFIVLGLAAGLGLGLVGAVVGDRLDPRMR
A0A2V7FK98      RLAEESAVPDARILDHAVVPQDPVRN--TAPRVVFLGFAASLALGLCGAVVLDRIDPKVR
A0A2V7R3Z8      RLAEESAVPDARILDHAVVPQDPVRN--TAPRVIFLGFAASLALGLCGAVVLDRIDPKVR
A0A2V7J3C0      RLAEASSIADVRILDVAVPPQEPLKD--TASRLLVLGFIAGLGLGLVGAVVADRVDPRMR
A0A2V7KWV9      RLAEASSIADVRVLDAAVAPETPVKN--TAARLLILGLFAGLGLGVVGAVVVDRFDPRVR
A0A1Q6ZHP2      RLAEASTLSDVRVLDSAVVPRRPVKN--TRRRVILLAFFGSFAMAVVGAVLIDRVDPRVR
A0A1Q7R6Z6      RLAEASTLSDVRVLDSAVVPRRPVKN--TRRRVILLAFFGSFAMAVVGAVLIDRVDPRVR
A0A2V7FYT7      RLAEASTLSDVRVLDSAVVPRRPVKN--TRRRVILLAFFGSFAMAVVGAVLIDRVDPRVR
A0A2V7IGR0      RLAEASTIPDVRILDSAVSPQRPVKN--TAPRIVLFALFASLGLAVAGAVLLDRVDPRVR
A0A2V7MR23      RLAEVSSLSDVRVLDSAVVPRRPVKN--TAPRVILLAFFGSFALAVLGAVLIDRIDPRVR
A0A2V7L1V3      RLAEASTIPDVRILDAAVVSREPVSA--MGGRLILLGFCGSFGLAVVGAVLLDRVDPRVR
A0A1Q7E5D3      RLAQASTVPDVRILDSAVVPQRPVKN--RAPRVILLAFFASFGLAVMGAVFIDRVDPRVR
A0A2V7ISE2      RLAEASTLADVRVLDSAVVPRRPVKN--TAPRVILMAFFGSFALAVMGAVLIDRIDPRVR
A0A1Q7J2X5      RLAEASTLADVRVLDSAVVPRRPVKN--TAPRVILMAFVGSFALAVMGAVLIDRIDPRVR
A0A2V7NPD1      RLAEASTLADVRVLDSAVVPRRPVKN--TAPRVILMAFFGSFALAVMGAVLIDRIDPRVR
A0A2V7QPD8      RLAEESAVPDARILDHAVVPQDPVRN--TAPRVVFLGFAASLALGLCGAVVLDRIDPKLR
A0A2V7Q8M6      RLAEASTIPDVRILDAAVVSREPVSS--AGGRMILLGFCGSFGLAVVGAVLLDRIDPRVR
A0A2V7QBC3      RLAEASTIPDVRILDAAVVSREPVSS--AGGRLILLGFCGSFGLAVVGAVLLDRIDPRVR
A0A2V7LMU1      RLAEASTIPDVRILDAAVVSRQPVRD--LAGRMILLGFCGSFGLAVVGAVLLDRIDPRVR
A0A2V7PBY9      RLAEASTIPDVRILDAAVVSRRPVQD--LAGRLIVMGFCGSFGLAVVGAVLLDRIDPRVR
A0A3M2BLV5      ILAQGAGDGFIDVVDPPGAPIE-VTP--RGKINLMLGALLGLILGVGAAFFLEYLDRTVR
A0A2V7KS68      RLAAESTVPDVRVLDPAVVPQRPVKN--TTPRLLLLGLIAGLGLGMVGAVVLDRVDPKVR
A0A2V7N4L3      RLAAEATVPDVRILDPAIVPQRPFKN--TAPRLLLMGLIAGLGLGIVAALVLDRADPRVR
A0A1Q7AZK2      RLAAEATLPDVRILDPAVVPQRPVKN--TAPRLLFMGLLGGLGLGVLGAILLDRADPRVR
A0A1Q7TNP7      RLAAEATLPDVRILDPAVVPQRPVKN--TAPRLLFMGLLGGLGLGVLGAILLDRADPRVR
A0A1Q7KG39      RLAAEATLPDVRILDPAVVPQRPVKN--TAPRLLFMGLLGGLGLGVLGAILLDRADPRVR
A0A1Q7GX75      RLAAEATVPDVRILDSAIVPQRPVKN--TASRILLMGLLAGLGLGIVGAVLLDRIDPSVR
A0A1Q7LL80      RLAAEATVPDVRILDSAIVPQRPVKN--TASRILLMGLLAGLGLGIVGAVLLDRIDPSVR
A0A2V7PFU2      RLSAEATVPDVRVLDPAVVPQRPVKN--TAPRLLLMGLVAGLGLGVLGAIVLDRADPRVR
A0A2V7MFS9      RLAAEATVPDVRILDPAIVPQRPIKN--TAPRLLLMGLLAGLGLGVVGAILLDRVDPKVR
A0A2V7T933      RLAAEATLPDVRILDPAVVPQRPVKN--TAPRLLFMGLLGGLGLGVLGAILLDRADPRVR
A0A2V7J4D7      RLAEISAIADVRLLDRAVEPQVPVGH--MRAILIFLAFWGGLGVGVAGAVLLDRTDRKVH
A0A2V7LN90      RLAEVSAIPDVRLVDPAVQPEEPAEN--WRPLLIALAFLASLGAGVTGAAVLDHTDGRVH
A0A2V7LFN9      RLAEASSIPDVRFVDPALEPQEPTEN--WAPVLVLFTLITGLGAGVGSAVALDHRDRRVH
A0A2V7MEK4      RLAEASSIPDVRFVDPALEPQEPTEN--WAPVLVLFTLITGLGAGVGSAVALDHRDRRVH
A0A2V7P8B1      GIAEAVTVGQVEIVDHATLPTKPAGI--GLVEQLVLGLLVGLMLGAAGAFVADRMASAIA
A0A2V7R2W8      RLAEVSSIPDVRLLDRAIAPHRPVGH--IGAILIALAMVGGLGLGMTGAVVLDSTDRRVR
A0A2V7MS64      RLAEVSAIPDVRLIDPAVQPEDPAAS--WTKILIALALLGGLSAGIAGAVVLDQNDKRVQ
A0A2V7Q7N9      RLAEVSAIPDVRLVDPAVQPEEPTEN--WRPVLIALAFLASLGAGVAGAAVLDHTDRSVR
A0A2V7IRW6      RLAEVSAIPDVRLIDPAIEPQQPAAS--WAVLLVVLAFLGSLGAGVAGAVVRDRTDRRVH
A0A1Q7DVU6      RLAEVSAIPDVRLIDPAIEPQQPAAS--WSVLLVALAFLGSLGAGVAGAVLRDRTDRHVH
A0A1Q7JSV2      RLAEVSAIPDVRLIDPAIEPQQPAAS--WSVLLVALAFLGSLGAGVAGAVLRDRTDRHVH
A0A2V7QN41      QLAAVSTLPDVRILDRATAPDRPDRD--LTPLLVCASFVVSLGLAVFGVVMLDELDHKVR
A0A2V7R603      QLAAVSTLPDVRILDRATAPDRPDRN--LTPLLACASFVLSLGLAVFGVVMLDGLDHKVR
A0A2V7LJS2      GIAEAVTVGQVEIVDHATLPMKPAGI--GLAEQLALGLLVGLILGAGGAFVAERVGSSIA
A0A1Q7GLJ7      GIAEAITVGQVEIVDHAALPAKPAGI--GLPEQIALGLLVGLMLGSAGAFLAERLGSTIA
A0A2V7GRE3      KIAEAVTVGQVEIVDHAALPAKPAGI--GLPEQIALGLLLGLMLGSGGAFLAERLGSTIA
A0A2V7EU00      RLAEASTIPDVRVLDAAVVPHQPIKN--TAPRLILVGLFGGLGLSLLGAVMMDRLDRHFR
A0A1Q6WE01      RLGEASTVADVQVLDAAVSPQEAAKN--TASRLVAFGFVVGLSLGMVAAVVVDRLDPRVH
A0A2V7S9K3      RLAEASTVADVRILDAAVAPQDPVKD--MTRRLIVLGLVAGFGLALVGAVVADRLDPRVR
A0A1Q7DXB9      RVAEASALPDVRILDAPVQPYQPIGS--VAPFLVIMAFLASGGLGVLGAVLIDTLDPRFR
A0A1Q7JD32      RVAEASALPDVRILDAPVQPYQPIGS--VAPFLVIMAFLASGGLGVLGAVLIDTLDPRFR
A0A2V7MVP8      RVAEASAVPDVRILDAPDQPYRPLGS--LAPFVLIMSFLASAGLGVLGAVVVDSLDPRFR
A0A2V7N0A9      RLAEVSTLPDVRILERAVQPTRPATN--TAPLLVVVACLTSFGAGVLGAALRDRADPKVR
A0A1Q7DLS9      RLAEVSTIPEVSVLDAAVEPEEPLLD--PTPFLVLVSFLGSLGLAALGAVVLERADRKVR
A0A1Q7JK96      RLAEVSTIPEVSVLDAAVEPEEPLLD--PTPFLVLVSFLGSLGLAALGAVVLERADRKVR
A0A2V7KQV7      RLAEVSTLPDVRILERASRPARPVVN--ATPLVLLLALVVSLGTGVGGAALLDRADPKIR
A0A1Q7JGF6      RLAEVSTLPDVRILEPAVRPTRPVSD--TAPLVIIVACIMSLGAGVLGAVLLERADPKVR
A0A2V7SG67      RLAEVSTLPDVRILEPAVRPTRPVSD--TAPLVIIVACIMSLGAGVLGAVLLERADPKVR
A0A1Q7GIK9      RLAEVSTLPDVRILERAVRPTRPASR--TAPLLIIAAFLTSFGAGVAGAVVRERADPKVR
                 :          ..  .                           .   .   :     . 

A0A2D5ZJF2      SADEITAIL-GVPVLGVVP------------------S--MSRKASRPDHGQQVSRA---
A0A0S8H9P3      STSDVETSL-GVPVLGWIP------------------K--ITGDGQRRISLVAAHD----
A0A1E4BBP7      YPEQATHEL-GLDIVGAIP------------------T--YRNPTSAAARLE--------
A0A3M2G737      TPEDIKKR--GYTLLSVIP------------------SMSLDNANRKKRKSKSVAENPQL
A0A0H4TUX7      NAGDVERVI-GVPVLGLIP------------------HDPALRRSGNGKPPITIVAREG-
A0A1G0LUG0      SAADVERAL-GVPVLGQIP------------------DDQRLARGNSHRGTVGIITQLP-
A0A1Q7E3T7      RPNEIV-EL-GLPLLGAVP------------------R--CQDGRNGSSVK---------
A0A1G0L906      TAADVERAL-EIPVLGLIP-------------------LDPRGPHDGPQRNGRRRASISL
A0A1G0LCC0      TAADVERAL-EIPVLGLIP-------------------LDPRGPHDGPQRNGRRRASISL
A0A2D5ZJE2      TIDEVEQKL-DTVVLGAVA------------------A--LEEAAEAEDESARLVTLHE-
A0A3M2G624      ETDEIERHI-QLPVYGMIP------------------Q--IESIKNGRRTHKAKARFETL
W0RI74          YPEQARVDL-GLEVLGVVP---------------------VVDQSGRQSPE---------
A0A3M2BJA6      TREDLVEATGGAPIMGMIPRIR---------------QRGLRPSKTSAAANGASHLGERL
A0A3D4VBZ5      YPEQATDDL-GLFVLGVVP---------------------VIGGKGRRNAD---------
C1A5W1          YPEQATDDL-GLFVLGVVP---------------------VIGGKGRRNAD---------
A0A2V7PX99      TPEQVTRGM-RLPILAALP------------------HVSLRQAPGASL-----------
A0A2V7ERC7      YPKEATHEL-GLIIAGTVP------------------R--FKPNRRGDFQLL--------
A0A5Q4D6Y4      RREDMEDAM-QVTTMGIIPRLSSGGRKRLK-------H--AAASSNGARGGRELVTLHE-
A0A2V7JTZ5      YPEQATREL-GLSVAGTVP------------------K--FKANHRGEFQIA--------
A0A3D4YTR6      YPEQATHDL-GLSITGTVP------------------R--IKANGRGDIKLE--------
A0A5Q4DA46      RPDQVSGDL-GLPILATIP------------------H--VRSRNGRLRPE---------
A0A2V7F1M1      RPEELERAL-NVRDLGVIPPLLETSASRPLRRLPIPLF--ISASRRPEAASRGEQATWEV
A0A2V7KXK7      YPEQITGRM-QLPILGAVP------------------HVSWRLGANGD------------
A0A651HKD3      SPADVEWQL-GVQVLGAIP------------------H--LRTRGGRVQPA---------
A0A2V7QDU7      TRHDLLAVT-GRPVLGIIP------------------HADGEMWSARLARGKGPGRARRR
A0A2V7ITT6      CPEQVTHDI-GLPILGVLP------------------H--VKVRGAGPEDE---------
A0A2V7NJW1      CPEQVTHDI-GLPILGVLP------------------H--VKVRGAGPEDE---------
A0A2V7GFB5      YPEQVSHDL-GLPILGAVP------------------H--LKARTG-------GQLTRE-
A0A2V7RQ86      YPEQVSHDL-GLPILGAVP------------------H--LKARTG-------GQLTRE-
A0A2V7IWX2      DPGHVTQGL-GLRILGALP------------------H--LS-----------RAGNGE-
A0A1Q7KE95      YPEQVTRQM-GLPILGVLP------------------H--VKDRG--------AGPNDE-
A0A1Q7T8X5      YPEQVTRQM-GLPILGVLP------------------H--VKDRG--------AGPNDE-
A0A2V7FK98      YPDQVSRGL-GIPILGAVP------------------H--LRNLPRGGRGN--GARVPD-
A0A2V7R3Z8      YPDQVSRGL-GIPILGAVP------------------H--LRNLPRGGRGG--GARVPD-
A0A2V7J3C0      YPDQVTRQM-GLPILGVLP------------------H--VKDRA--------AGPDDE-
A0A2V7KWV9      YPAQVTTDM-GLRILGALP------------------H--VKKRA--------GASDDE-
A0A1Q6ZHP2      YPDQVSREM-GLTILGAVP------------------H--IRAGARPERSG-RRVRPPE-
A0A1Q7R6Z6      YPDQVSREM-GLTILGAVP------------------H--IRAGARPERSG-RRVRPPE-
A0A2V7FYT7      YPDQVSREM-GLTILGAVP------------------H--IRAGARPERSG-RRVRPPE-
A0A2V7IGR0      YPEQVSRGM-GLTILGAVP------------------H--LRKSEAQRQGT-GPL--SE-
A0A2V7MR23      YPDQVSREM-GLTILGAVP------------------H--IRPGARP-ERSGRRVRPPE-
A0A2V7L1V3      YPDQVSREM-GLAILGAVP------------------H--LRTLPHAGRHG--RARVPE-
A0A1Q7E5D3      YYDQVSREM-GLTILGAVP------------------H--LRPRAGLGRSGG--AHPPE-
A0A2V7ISE2      YPDQVSREM-GLTILGAVP------------------H--VRPGARPTPRNGRRVRPPE-
A0A1Q7J2X5      YPDQVSREM-GLTILGAVP------------------H--VRPGARPTPRNGRRVRPPE-
A0A2V7NPD1      YPDQVSREM-GLTILGAVP------------------H--VRLGARPTPRNGRRVRPPE-
A0A2V7QPD8      YPDQVSRGL-GIPILGAVP------------------H--LRNLPRGGRGG--GARVPD-
A0A2V7Q8M6      YPDQVSREM-GLAILGAVP------------------H--LRTLPHAGRHG--KGRVPE-
A0A2V7QBC3      YPDQVSREM-GLAILGAVP------------------H--LRTLPHAGRHG--KGRVPE-
A0A2V7LMU1      YPDQVSREM-GLTILGAVP------------------H--LRTLPH-GRHG--RGRVPE-
A0A2V7PBY9      YPDQVSREM-GLAILGAVP------------------H--MRTLAH-GR-G--RGRIPE-
A0A3M2BLV5      TSADVETLL-GIPVLGIIP------------------R--LRKVDEEDDRRAGLPLIVAL
A0A2V7KS68      YPEQVSREL-GLPILGVLP------------------H--LRTK----------------
A0A2V7N4L3      YPQQVSRDL-GLPILGAVP------------------H--LRAK----------------
A0A1Q7AZK2      YPEHVSRDL-GLPIIGAVP------------------H--LRAK----------------
A0A1Q7TNP7      YPEHVSRDL-GLPIIGAVP------------------H--LRAK----------------
A0A1Q7KG39      YPEHVSRDL-GLPIIGAVP------------------H--LRAK----------------
A0A1Q7GX75      YPQQVSRDL-GLPILGALP------------------H--LRAK----------------
A0A1Q7LL80      YPQQVSRDL-GLPILGALP------------------H--LRAK----------------
A0A2V7PFU2      YPEQVSRDL-GVPILGAVP------------------H--LRAK----------------
A0A2V7MFS9      YPEQVSREL-GLSILGAVP------------------H--LRAK----------------
A0A2V7T933      YPEHVSRDL-GLPIIGAVP------------------H--LRAK----------------
A0A2V7J4D7      YPEHVTRAM-GLSILGAVP------------------H--VDWRNGNRDA----------
A0A2V7LN90      YPQQVTGAM-GLPILGAVP------------------H--LARNGGTRKPD---------
A0A2V7LFN9      DPEDITRTM-GLTILGVVP------------------H--LERKRRAKQPE---------
A0A2V7MEK4      DPEDITRTM-GLTILGVVP------------------H--LERKRRAKQPE---------
A0A2V7P8B1      RRVQVEH-L-GLSVLGVVP------------------R--WGRLGNKKGPK---------
A0A2V7R2W8      HPDDVTRAM-GLAILGAVP------------------H--VDW-RNGKRDA---------
A0A2V7MS64      YPEEVTGAL-GLTILGAVP------------------H--LERNGNGRAKA---------
A0A2V7Q7N9      YPQQVTGAM-GLPILGAVP------------------H--LNRNGGRRKPD---------
A0A2V7IRW6      YPEHVTGTM-GLAILGAVP------------------H--LERGRNGKKAG---------
A0A1Q7DVU6      YPEHVTGTM-GLAILGAVP------------------H--LERGRNGKKSG---------
A0A1Q7JSV2      YPEHVTGTM-GLAILGAVP------------------H--LERGRNGKKSG---------
A0A2V7QN41      YPEHVTHQM-RLSILGAVP------------------RFDWRQLGNGKTAE---------
A0A2V7R603      YPEHVTHQM-RLSILGAVP------------------RFDWRHLGNGKTAE---------
A0A2V7LJS2      RRVEVEH-L-GLSVLGIVP------------------R--WGRETDKKGPG---------
A0A1Q7GLJ7      QRVQVER-L-GMSVFGVIT------------------H--WDRDAREKGVK---------
A0A2V7GRE3      QRVQVEQ-L-GMSVIGVIT------------------H--LDRDGAETGMK---------
A0A2V7EU00      YPQQVTREM-GLAILGAVP------------------R--IKRGGNGVDPE---------
A0A1Q6WE01      HPDQVTEQM-GLSIIGVLP------------------H--VRDRRAGPDDQ---------
A0A2V7S9K3      YPDQVTNQM-GLPILGVLP------------------H--VRNRAAGPDDE---------
A0A1Q7DXB9      DPGHVTQGL-GLRILGALP------------------H--LSRAGNGEGTA---------
A0A1Q7JD32      DPGHVTQGL-GLRILGALP------------------H--LSRAGNGEGTA---------
A0A2V7MVP8      DPGHVTRDL-GLRILGALP------------------H--LSRAKNGEATT---------
A0A2V7N0A9      SPEEVTRTM-GLLILGAVP------------------H--VHRGKDMGDDG---------
A0A1Q7DLS9      YPDQVTRTM-GLPILGAVP------------------H--VSWHDGANGDG---------
A0A1Q7JK96      YPDQVTRTM-GLPILGAVP------------------H--VSWHDGANGDG---------
A0A2V7KQV7      DPEQVTRAM-GLSILGAVP------------------H--VHRNGNGNGNGNGRAH----
A0A1Q7JGF6      YPDEVTRAI-GLPILGAVP------------------H--VQRGNGKRRAG---------
A0A2V7SG67      YPDEVTRAI-GLPILGAVP------------------H--VQRGNGKRRAG---------
A0A1Q7GIK9      YPDQVTSAM-GLPILGAVP------------------H--VRQTAPSRRPAEVRATWRAP
                               . :.                                         

A0A2D5ZJF2      -----SSSMIAEAYRTIRTAVYFGAP---NGEAR-TILVTSPSPGDGKSTTASNLAIAMA
A0A0S8H9P3      -----PEGVAAEAYRVLRTNIAFSTA---RERPLSSLAFTSPGPDEGKSTSVANLAAVLA
A0A1E4BBP7      -----EASQLIESFRTIALSVRSAFE---GLGPV-QLAVSSPGPGDGKSFVSANLASALA
A0A3M2G737      LTFANPRSTVAESYRQLRTYVQFSKT----DTPVKTIMVSSANPSEGKTTTASNMAVAFA
A0A0H4TUX7      -----MDQPAAEAFRALRTNVTFVGA----EKPLQFMSVTSPGPGEGKSTTAVNLAVALA
A0A1G0LUG0      -----HDEPSAEAFRALRTNVTFVGA----ERPLQLISVTSPGPGEGKSTTAANLAVALA
A0A1Q7E3T7      -----AVGAVIEAFRGLRLNLAYAYG---AAGPV-LLVLSSPRSREGKSFIAANLALAFA
A0A1G0L906      ISHAAPDDPTSEAYRALRTNVTFVSA---EQHALQLICVTSPGPGEGKSTTAANLAITLA
A0A1G0LCC0      ISHAAPDDPTSEAYRALRTNVTFVSA---EQHALQLICVTSPGPGEGKSTTAANLAITLA
A0A2D5ZJE2      -----PQSPMAEAYRTIRTNVGFAA----VGAPLRSIAITSSGPQEGKSTTASNLAITIA
A0A3M2G624      VTHLAPKSIPSEAFRSLRTNIQFFDL---SRQSE-AILITSAVSEEGKSTTCANLAITTA
W0RI74          -----QIAQIVEAFRSLRMNVRYAAG-AGSQRSV-VFGITSPGPGDGKSLVASNLALSFA
A0A3M2BJA6      VAGRDPRNPVSEAYRSLRTNITFSNP---DRPPK-TIVFTSPLPQDGKSTSAANLAITLA
A0A3D4VBZ5      -----QAAQVVESFRTIRMNVRYAAD---PTRPL-TMTITSPGPNDGKSLISSNLALSFA
C1A5W1          -----QAAQVVESFRTIRMNVRYAAD---PTRPL-TMTITSPGPNDGKSLISSNLALSFA
A0A2V7PX99      -----RSAEVIEALRGLRVRVLHSQG---VEGPL-LLTVTSPSVGDGKSFLSVNLALSFA
A0A2V7ERC7      -----TLSQAVESFRTLHLAVRYDFP---GGGPI-SLSVASPGPGDGKSLVSSNLAIAFA
A0A5Q4D6Y4      -----SRSSEAEAFRTLRTNLLYAQH----HKPLRAVVVASANPGEGKTTTAANLAITYA
A0A2V7JTZ5      -----MMSQAVESFRTLRLALRYDFP---TDAPI-VVGVSSPAAGDGKSLVSSNLALAFA
A0A3D4YTR6      -----LMSQTVEAFRTIRLALRYDFP---DGLPI-VLGVTSPARGDGKSLVASNLGLAFA
A0A5Q4DA46      -----DHEQVVEAFRSLRLALAYGRR---GAGPL-VLTISSPGVGDGKSFTTSNLALACA
A0A2V7F1M1      VADSAPLSSAAEAFRLLYSGLLFGWG----EGQR-TILVTSAAPQEGKTVIAANLAVTFA
A0A2V7KXK7      -----GPAQVIEALRGLRLRVLHAHA---GEGPL-TLTITSPGIGDGKSFVSLNLALSFA
A0A651HKD3      -----DHEHAIEAFRSIRTGILFAHG---SAGPL-VITVTSPDAGDGKSFTVSNLALCFA
A0A2V7QDU7      PIGAGSRAELAEAFVRLATNVSFAGP---NGPPQ-VVTVTSALRGEGKTTSAVNLALASA
A0A2V7ITT6      -----HVAQVIEAMRSVRLSLSQTHG---GGGPM-LVTVSSPGIGDGKSFVSANLALAYS
A0A2V7NJW1      -----HVAQVIEAMRSVRLSLSQTHG---GGGPM-LVTVSSPGIGDGKSFVSANLALAYS
A0A2V7GFB5      -----QRVQLVEAMRGVCLGVSYTYG---AAGPV-VVAVSSPGPGDGKSFITANLAVTFA
A0A2V7RQ86      -----QRVQLVEAMRGVCLGVSYTYG---AAGPV-VVAVSSPGPGDGKSFITANLAVTFA
A0A2V7IWX2      -----GTAQAIEAMRTVRVKLQHASN---GGNPL-LLTVTSPGVGEGKSLVSANLALAFA
A0A1Q7KE95      -----HVIHVIEAMRSVRLSLIHFYG---GNGPV-VVTVTSPGIGDGKSFLSANLALACA
A0A1Q7T8X5      -----HVIHVIEAMRSVRLSLIHFYG---GNGPV-VVTVTSPGIGDGKSFLSANLALACA
A0A2V7FK98      -----DVNEVVEALRGVCLNLVYAHG---GRAPL-LVTITSPGAGDGKSFISANLAHTFA
A0A2V7R3Z8      -----DVNEVVEALRGVCLNLVYAHG---GRAPL-LVTITSPGAGDGKSFISANLAHTFA
A0A2V7J3C0      -----EVAQVIEAMRSVRLSLMHFYG---GNGPV-VVTVTSPGAGDGKSFVSANLALACA
A0A2V7KWV9      -----SGPLVIETMRGVRLSLIHAYG---TAGPL-VVTITSPAPGDGKSFVSANLALACA
A0A1Q6ZHP2      -----DVAVVVEALRGVCLNLVYTHG---AVAPL-VVTITSPGAGDGKSFLAANLGHTFA
A0A1Q7R6Z6      -----DVAVVVEALRGVCLNLVYTHG---AVAPL-VVTITSPGAGDGKSFLAANLGHTFA
A0A2V7FYT7      -----DVAVVVEALRGVCLNLVYTHG---AVAPL-VVTITSPGAGDGKSFLAANLGHTFA
A0A2V7IGR0      -----NVAEVLEALRGVCLNLEHAYG---TAGPL-IAAVTSPGPGEGKSFIAANLAYTFA
A0A2V7MR23      -----DVAVVVEALRGVCLNLVYTHG---AVAPL-VVTITSPGAGDGKSFLAANLGHTFA
A0A2V7L1V3      -----DVNQVVEALRGVCLNLVYAHG---GRAPL-LVTVTSPGAGDGKSFLAANLGHTFA
A0A1Q7E5D3      -----DIAVVVEALRGACLNLVYAHG---AEGPL-LVTITSPGAGDGKSFLAANLARTFV
A0A2V7ISE2      -----DVAVVVEALRGVCLNLVYTHG---AASPM-LVTITSPGAGDGKSFLAANLGHTFA
A0A1Q7J2X5      -----DVAVVVEALRGVCLNLVYTHG---AESPM-LVTITSPGAGDGKSFLAANLGHTFA
A0A2V7NPD1      -----DVAVVVEALRGVCLNLVYTHG---AASPM-LVTVTSPGAGDGKSFLAANLGHTFA
A0A2V7QPD8      -----DVNEVVEALRGVCLNLVYAHG---GRAPL-LVTITSPGAGDGKSFISANLAHTFA
A0A2V7Q8M6      -----DVNQVVEALRGVCLNLVYAHG---GRAPL-LVTVTSPGAGDGKSFLAANLAHTFA
A0A2V7QBC3      -----DVNQVVEALRGVCLNLVYAHG---GRAPL-LVTVTSPGAGDGKSFLAANLAHTFA
A0A2V7LMU1      -----DVNQVVEALRAVCLNLVYAHG---GRAPL-LVTITSPGAGDGKSFLAANLAHTFA
A0A2V7PBY9      -----DVNQVVEALRGVCLNLVYAHG---GRAPL-LVTVTSPGAGDGKSFIAANLAHTFA
A0A3M2BLV5      D----PLDPAAEAYRNLRMNLMFMST---EDEPIRTILFSSPGPHEGKSTTAVNFAVMLA
A0A2V7KS68      -----EPAEVVEALRGLRLNVIHEYGTAEAAQPL-IFTVTSPGPGDGKTFLSSNLALAFA
A0A2V7N4L3      -----EPAEVIEALRGIRLSVLHEHG---PG-PL-VVTITSPEQGDGKSFMSANLAMSFA
A0A1Q7AZK2      -----EPAEVVEALRGVRLSLVHEYG---PG-PL-LVTVTSPGPGDGKSFLSANLALTFA
A0A1Q7TNP7      -----EPAEVVEALRGVRLSLVHEYG---PG-PL-LVTVTSPGPGDGKSFLSANLALTFA
A0A1Q7KG39      -----EPAEVVEALRGVRLSLVHEYG---PG-PL-LVTVTSPGPGDGKSFLSANLALTFA
A0A1Q7GX75      -----EPAEVVEALRGVRLNLLHEYG---PG-PV-VLTISSPGSGDGKSFLSANLGLTFA
A0A1Q7LL80      -----EPAEVVEALRGVRLNLLHEYG---PG-PV-VLTISSPGSGDGKSFLSANLGLTFA
A0A2V7PFU2      -----EPVEVIEALRGLRLNVLNEYG---AETPV-LFTVTSPGPGDGKSFLSANLALAFA
A0A2V7MFS9      -----DPVEVVEALRGVRLNLMNEHG---PG-PL-LVTVTSPGPGDGKSFLSANLALAFA
A0A2V7T933      -----EPAEVVEALRGVRLSLVHEYG---PG-PL-LVTVTSPGPGDGKSFLSANLALTFA
A0A2V7J4D7      -----AATQVIESLRGVRLNVVHRHG---TAGPV-RLTVTSPGKSDGKSFVASNLALAFA
A0A2V7LN90      -----GVMQVVEAVRGIRLNVQHAHG---T-GPV-VVTVTSAGRSDGKSFLASNLALAFA
A0A2V7LFN9      -----DGLPVLEAMRGICLNVLHSHG---V-GPV-IVTVTSPGRADGKSFVASNLAVAFA
A0A2V7MEK4      -----DGLPVLEAMRGICLNVLHSHG---V-GPV-IVTVTSPGRADGKSFVASNLAVAFA
A0A2V7P8B1      -----SAEATVEAFRGIRLNVLNAHG---ATGPV-VVGVTSPGSGDGKSFVSSNLALAFA
A0A2V7R2W8      -----AVAQVIEALRGIRLNVVHRHG---SAGPV-RLTITSPGKSDGKSFVASNLALAFA
A0A2V7MS64      -----GALEAVEALRAIRLNLLHAHG----AGPT-VVTVTSPGHSDGKSFVASNVAVAFA
A0A2V7Q7N9      -----GVMQVVEAVRGIRLNVLHAHG----TGPI-VVTVTSPGRSDGKSFLASNLALAFA
A0A2V7IRW6      -----AVLQVVEAVRGIRLNVLHAHG----AGPA-VLTVTSPGRSDGKSFVASNLALAFA
A0A1Q7DVU6      -----AVLQVVEAVRGIRLNVLHAHG----AGPA-VLTVTSPGRSDGKSFLASNLALAFA
A0A1Q7JSV2      -----AVLQVVEAVRGIRLNVLHAHG----AGPA-VLTVTSPGRSDGKSFLASNLALAFA
A0A2V7QN41      -----AAAPVVEALRGLRLRLSHA-G---GSGPL-LVTVTSPGVGEGKSFLSCNLALAFA
A0A2V7R603      -----AAAPVVEALRGLRLRLSHA-G---GSGPL-LVTVTSPGVGEGKSFLSCNLALAFA
A0A2V7LJS2      -----SADAAVEAFRGIRLNVLNAHG---AAGPA-VVAVTSPGSGDGKSFVSSNLALAFA
A0A1Q7GLJ7      -----NPDAVVEAFRGLRLTLVNEYG---APGPI-VVTVTSPGSGDGKSFVSSNLALAFA
A0A2V7GRE3      -----SPDAVVEAFRGLRLSLVNEYG---APGPL-VITVTSPGSGDGKSFVSSNLSLAFA
A0A2V7EU00      -----EARQVIEALRTVRLNLTHAYG---SAGPL-LVTITSPGPGDGKSFVSGNLARAFA
A0A1Q6WE01      -----QVAHAIEAMRSIRLSLTHAHG---AAGPM-LVTISSPGVGDGKSFVSANLALAFA
A0A2V7S9K3      -----HVAHAIEAMRSVRLSVSHAYG---AAGPM-VLTVSSPGAGDGKSFVAANLALAFA
A0A1Q7DXB9      --------QAIEAMRTVRVKLQHASN---GGNPL-LLTVTSPGVGEGKSLVSANLALAFA
A0A1Q7JD32      --------QAIEAMRTVRVKLQHASN---GGNPL-LLTVTSPGVGEGKSLVSANLALAFA
A0A2V7MVP8      --------QAIEAMRTVRVKLQHACN---GGSPL-LLTVTSPGVGEGKSLVSANLALAFA
A0A2V7N0A9      -------VKAVEALRGIRLNVQYAYG---AAGPL-VLTVSSPGRGEGKSFVTSNLAQAFA
A0A1Q7DLS9      ------VSRVIEALRGIRLNVLHAYG---TAGPL-LVTVTSPGRSDGKSFLTSNLAVAFV
A0A1Q7JK96      ------VSRVIEALRGIRLNVLHAYG---TAGPL-LVTVTSPGRSDGKSFLTSNLAVAFV
A0A2V7KQV7      --AETDDTGALEALRGIRLNVQHAYG---AAGPL-LITVTSPGRGDGKSFVTCNLALAFA
A0A1Q7JGF6      --GEDDIAKAVEALRGIRLNLQHAYG---AAGPL-LITVSSPGRGEGKSFVTSNLAQAFA
A0A2V7SG67      --GEDDIAKAVEALRGIRLNLQHAYG---AAGPL-LITVSSPGRGEGKSFVTSNLAQAFA
A0A1Q7GIK9      EVDAEDGAKAVEALRGIRLNVHHASG---AVGPL-LATITSPGRGEGKSFVSANLAYAFS
                           *:       :                 .:*.   :**:    *..    

A0A2D5ZJF2      QAGQRTLLMDSDFRKPVQHVIFE-MDDKQGLSSVLSGQATL--DE---VL-RPSEVAGLD
A0A0S8H9P3      DRGDRTLLVDADLRRGTLHEDFD-LLRSPGLSDLLVGELDP--RE---AI-RPAVRPALD
A0A1E4BBP7      DSGYRTVIVDGDIRRGTLHDIFAPCAQAPGLVDYLAGEATL--DE---VLRPTQQHINLS
A0A3M2G737      TMGKKVLLIDCDMRKPQLHNRFS-LDREPGLSNIFFYTAAV--EK---IC-HKTSVDNLD
A0A0H4TUX7      QGGQRTLLIDGDLRRPLIHRAFA-LVQEPGLTDVLVGRATA--RE---AV-RPDAAPGLD
A0A1G0LUG0      QSGQRTLLVDADLRRPQVHRAFS-LVQEPGLTDVLIGRVPA--RE---AI-RPEVQPQLD
A0A1Q7E3T7      QANYRTLLIDGDTRRGALHKVLA-VARKPGLTDFLGGDVSW--GE---II-QVTRHGTLH
A0A1G0L906      QQGARTLLVDADLRRPVVHRAFN-LVQEHGLTDILVGTATL--RE---TV-RPNLIPKLD
A0A1G0LCC0      QQGARTLLVDADLRRPVVHRAFN-LVQEHGLTDILVGTATL--RE---TV-RPNLIPKLD
A0A2D5ZJE2      QSGKRTLLLDADLRRPVLHKLFS-LKRQKGVTDHLAGNATL--EE---VI-QKTEIEGLH
A0A3M2G624      QVGRKTLLIDGDLRKPVIHHLFE-APSEPGLTDVLLGRYTW--QE---VI-HSTSVPGLD
W0RI74          EGGWRTVLIDADTRRGQLNATFD-TPAVPGLVEYLEGTSLF--GE---VC-YPTRHDNLT
A0A3M2BJA6      QQGTRVLLVDADLRRGVLNNVFD-LPREPGLSDVITGQAKL--SEALRVV-DLGESGRMH
A0A3D4VBZ5      ESGLRTLLIDGDIRRGELAKTFK-IHSRPGLVEYLEGSALL--AE---VLNPIASHANLT
C1A5W1          ESGLRTLLIDGDIRRGELAKTFK-IHSRPGLVEYLEGSALL--AE---VLNPIASHANLT
A0A2V7PX99      YAGYRTLLIDGDVRRGTQHRVVD-AASEPGLTDVLAGQAAA--EA---AV-QQTGYPNLS
A0A2V7ERC7      SAGYRTLLIDGDVRCGTQHSTFS-VSPTPGLVDYLRSATGV--EG---AI-RTTSFSNLF
A0A5Q4D6Y4      QQGLSVVLVDCDLRKPRVGELFG-MERRPGMTELVLGQATL--EE---CARPFVPAENLF
A0A2V7JTZ5      SAGSRTLLIDGDVRCGGLHNTFE-IPVTPGLVDYLNGHAAV--DS---IV-RSTTSENLF
A0A3D4YTR6      SAGSRTLLIDGDVRCGGLHNTFG-IPVTPGLVDYLHGLASV--ES---IV-RSTASKNLF
A0A5Q4DA46      ELGHRTLVIDGDVRRGTLHTLFN-LSRRPGLTDFLAGEAEL--EA---VV-QSTEHDTMW
A0A2V7F1M1      REGVRVLLVDCDLRRPRLHRVFG-VAPAPGLIELLKADRATLADSPGGPLRRPTKIAGLW
A0A2V7KXK7      DAGYRTLLVDGDTRRGVQHKALK-TPSTPGLTDVVAGRVAL--DA---AL-RLTSYPGLT
A0A651HKD3      ELGRRTVIVDGDVRRGIQHKLLD-VERKPGLTDCLSGQATL--EE---VL-SPAEHPLLS
A0A2V7QDU7      N-GRRVLLIDADLRCGTIHALFR-LSRTPGLAEVLAGWMPLENAV---RRMDTGDGTHVD
A0A2V7ITT6      GAGQRTLLIDGDVRRGSLHRAML-TQRTPGLTDVLAKRAPL--ER---VT-QATSYTALE
A0A2V7NJW1      GAGQRTLLIDGDVRRGSLHRAML-TQRTPGLTDVLAKRAPL--ER---VT-QATSYTALE
A0A2V7GFB5      DAGRRTLLVDGDLRRGAQHRLFG-ADRRPGLTDVLRGDVPL--EA---GL-RPTGYDALT
A0A2V7RQ86      DAGRRTLLVDGDLRRGAQHRLFG-ADRRPGLTDVLRGDVPL--EA---GL-RPTGYDALT
A0A2V7IWX2      YAGLRTVVIDGDIRRGALHRLLR-GSRRPGLTDHLTGRAPL--EK---VL-QTTPYKCLS
A0A1Q7KE95      EAGQPTLLIDGDARRGGLHRALR-RPRKPGLTDCLAGAAPL--EG---VT-QTTMYPCLD
A0A1Q7T8X5      EAGQPTLLIDGDARRGGLHRALR-RPRKPGLTDCLAGAAPL--EG---VT-QTTMYPCLD
A0A2V7FK98      DGGHRTLLIDADIRRGVLHRRLS-VRRRPGLSDFLRGEAQL--DA---IV-QATQFPALS
A0A2V7R3Z8      DGGHRTLLIDADIRRGVLHRRLS-VRRRPGLSDFLRGEAQL--DA---IV-QATQFPALS
A0A2V7J3C0      ESGKATLLIDGDSRRGGLHRILH-RPRKLGLTDHLAGAASL--EA---VT-QSTPFAALD
A0A2V7KWV9      QAGQRTLLIDGDTRRGALHRVLG-GVRRPGLTDFLAGNVSF--EA---LI-QTPNFGSLQ
A0A1Q6ZHP2      EAGHRTLLIDGDLRRGVLHRRLG-ARRRPGVSDFLRGEVPI--EA---IV-QTTPYPSFS
A0A1Q7R6Z6      EAGHRTLLIDGDLRRGVLHRRLG-ARRRPGVSDFLRGEVPI--EA---IV-QTTPYPSFS
A0A2V7FYT7      EAGHRTLLIDGDLRRGVLHRRLG-ARRRPGVSDFLRGEVPI--EA---IV-QTTPYPSFS
A0A2V7IGR0      ESGHRVLLVDADIRRGVLHRRLG-RPRRPGLCDFLRSEAPL--EA---IV-QSTTHPSLA
A0A2V7MR23      EAGHRTLLIDGDLRRGVLHRRLG-ARRRPGVSDFLRGEVPL--EA---IV-QATPYPSFS
A0A2V7L1V3      DGGHRTLLIDADIRRGVLHRRLS-ARRRPGLSDFLRGETPL--DA---VV-QATPYPSLS
A0A1Q7E5D3      EGGHRTLLVDGDNRRGVLHRRLA-ARRRPGLTDLLRGDVTF--EA---IA-QPTPYPGCT
A0A2V7ISE2      EAGHRTLLIDGDIRRGVLHRRLG-ARRRPGLTDFLRGEVPL--EA---IV-QATPYPSFS
A0A1Q7J2X5      EAGHRTLLIDGDLRRGVLHRRLG-ARRRPGLTDFLRGEVPL--EA---IV-QATPYPSFS
A0A2V7NPD1      EAGHRTLLIDGDLRRGVLHRRLG-ARRRPGLTDFLRGEVPL--EA---IV-QATPYPSFS
A0A2V7QPD8      DGGHRTLLIDADIRRGVLHRRLS-VRRRPGLSDFLRGEAQL--DA---IV-QATQFQALS
A0A2V7Q8M6      DGGHRTLLIDADIRRGVLHRRLS-ARRRPGLSDFLRGETPL--DA---IV-QATPYPSLS
A0A2V7QBC3      DGGHRTLLIDADIRRGVLHRRLS-ARRRPGLSDFLRGETPL--DA---IV-QATPYPSLS
A0A2V7LMU1      DGGHRTLLIDADIRRGVLHRRLS-AHRRPGLSDLLRGETPL--DA---IV-QATPYPSLS
A0A2V7PBY9      DGGHRTLLIDADIRRGVLHRRLS-ARRRPGLSDFLRGEAPL--DA---VV-QATPYPALS
A0A3M2BLV5      QQGQRVLLIDADLRRPSLHRAMD-LLREPGLTNLLVGDAEA--RE---AI-RPNVLPNLD
A0A2V7KS68      EGGHRTVLVDADIRRGLLHRRLK-ANRQPGLADYLLGETTA--DE---IV-QQTAYPRLS
A0A2V7N4L3      DAGHKTLLVDGDIRRGVLHRRFK-LSRQPGLVDFLLDEIGK--DQ---IV-QKTAYPHLA
A0A1Q7AZK2      DAGHRTLLVDGDVRRGVLHRRFK-ANRQPGLVDFLLGKAGL--DE---IV-QGTEYPRLA
A0A1Q7TNP7      DAGHRTLLVDGDVRRGVLHRRFK-ANRQPGLVDFLLGKAGL--DE---IV-QGTEYPRLA
A0A1Q7KG39      DAGHRTLLVDGDVRRGVLHRRFK-ANRQPGLVDFLLGKAGL--DE---IV-QGTEYPRLA
A0A1Q7GX75      DGGHKTLLIDGDIRRGVLHRRFK-GNRQPGLVDYLLGDAGH--DA---IV-QKTAYPRLS
A0A1Q7LL80      DGGHKTLLIDGDIRRGVLHRRFK-GNRQPGLVDYLLGDAGH--DA---IV-QKTAYPRLS
A0A2V7PFU2      DGGHRTLLVDGDIRRGTLHRRFK-ANRRPGLVDYLRGEAGIGREL---IV-QQTPYPQLA
A0A2V7MFS9      DGGHRTVLVDGDIRRGVLHRRFK-ANRQPGLVDFLNGEVGH--DQ---IV-QPTPYPRLA
A0A2V7T933      DAGHRTLLVDGDVRRGVLHRRFK-ANRQPGLVDFLLGKAGL--DE---IV-QGTEYPRLA
A0A2V7J4D7      DAGYRTLLVDGDVRRGRLHHTLS-AARRPGLTELLEGSAPQ--DA---AV-QATRYKNLS
A0A2V7LN90      DAGSRTLLVDGDIRCGRLHRVLK-LARKPGLTDLLAGDATP--EQ---VL-QGTAYRTLT
A0A2V7LFN9      DAGYRTLLVDGDVRCGRLHRTLK-LPRRPGLTDLLQGRASK--EQ---AV-QLSAYGMLS
A0A2V7MEK4      DAGYRTLLVDGDVRCGRLHRTLK-LPRRPGLTDLLQGRASK--EQ---AV-QLSAYGMLS
A0A2V7P8B1      YGNHRTLLIDADLRRGALHRTLK-LPRQPGLMDLLVGHATP--EQ---VV-HRTAYQSLD
A0A2V7R2W8      DTGLRTLLVDGDVRRGRLHRTLG-AARRPGLTDLLEGSVGW--DQ---VV-QATPYKNLS
A0A2V7MS64      DAGFRTLLIDGDVRKGVLHRTLK-APRLPGLVDVLMGKVPV--AQ---AI-QSTTYRTLS
A0A2V7Q7N9      DAGSRTLLVDGDIRCGRLHRVLQ-LARKPGLTDLLGGEAAE--EQ---VL-QATAYRTLT
A0A2V7IRW6      DAGYRTLLVDGDVRCGTLHRALK-LARKPGLVDVLGGKAST--EL---VV-QATSYRALS
A0A1Q7DVU6      DAGYRTLLVDGDVRCGTLHRALK-LARKPGLVDVLGGKAST--EL---VV-QATSYRALS
A0A1Q7JSV2      DAGYRTLLVDGDVRCGTLHRALK-LARKPGLVDVLGGKAST--EL---VV-QATSYRALS
A0A2V7QN41      DAGFRTLLIDGDVRRGGQHRMLG-LHREPGLVDFLAGDLPF--ET---VV-QATRHPGLS
A0A2V7R603      DAGFRTLLIDGDVRRGGQHRMLG-LHREPGLVDFLAGDLPF--ET---VV-QATRHPNLS
A0A2V7LJS2      YANHRTLLVDADLRRGALHRALQ-LRREPGLTDLLAAAASP--EQ---VV-KATSHPSLD
A0A1Q7GLJ7      YAKQRTLLVDADLRRGALHRLLN-LRRQPGLTDFLIGDVSR--AP---AL-QTTAYPFLD
A0A2V7GRE3      YAKQRTLLVDADLRRGALHRVLN-LRRQPGLTDFLAGDVSR--AP---VV-QTTSHPCLD
A0A2V7EU00      DAGQRTLLIDGDSRRGVLHRLFK-GLRKPGLTDYLAGVVPL--DA---VV-QRTDHPALW
A0A1Q6WE01      EAGRRTLLIDGDVRRGSLHRAVR-ARRQPGLTDFLAGRAPF--EA---TV-QGTPYPDLQ
A0A2V7S9K3      EGGRRTLLIDGDVRRGGLHRALR-AHRRPGLTDFLAGRVPL--EE---TI-VATSYADLQ
A0A1Q7DXB9      YAGLRTIVIDGDIRRGALHRLLR-GSRRPGLTDHLTGRAPL--EK---VL-QPTPYKGLS
A0A1Q7JD32      YAGLRTIVIDGDIRRGALHRLLR-GSRRPGLTDHLTGRAPL--EK---VL-QPTPYKGLS
A0A2V7MVP8      YAGLRTIVIDGDIRRGALHRLLR-ASRRPGLTDHLTGRAPL--EQ---VL-QATPYKDLS
A0A2V7N0A9      DVGCRTLLIDGDVRLGALHRALR-RARRPGLTDALAGRVTA--DQ---TL-QATDHAFLS
A0A1Q7DLS9      DAGYSTLLIDGDIRRGGLHRVLD-AARTPGLTDLLAGTAAV--QQ---VIQQAKSYPSLA
A0A1Q7JK96      DAGYSTLLIDGDIRRGGLHRVLD-AARTPGLTDLLAGTAAV--QQ---VIQQAKSYPSLA
A0A2V7KQV7      QVGYRTLLIDGDVRCGALHRLLK-AARRPGLTDVLANEVTP--DQ---VV-QSTPYAHLS
A0A1Q7JGF6      DVGYRTLLIDGDVRLGVLHRALR-GTRRPGLTDLLASRATV--DQ---VV-QGTPHPLLS
A0A2V7SG67      DVGYRTLLIDGDVRLGVLHRALR-GTRRPGLTDLLASRATV--DQ---VV-QGTPHQLLS
A0A1Q7GIK9      AVGYRTLLIDGDVRLGALHRTLR-AARRPGLTDVLAGHVEY--AA---VL-QSTPHTRLS
                     .:::* * *       .       *: . .                         

A0A2D5ZJF2      VLRCGPLPPNPSEFINSDAFREMLEELAVKYDRVVIDSPPVMAVSDARILAAGCDITLLV
A0A0S8H9P3      LLPAGKRPPNPSELLGSQAMAKLLASWREEYRWVLFDTPPVLAVTDASVLAALVDGAVLV
A0A1E4BBP7      IVPCGKRRRHGPELLASERMTTLIRDLRTQFDAIIVDTAPLGAGIDPFAIGTATGSMVLV
A0A3M2G737      VICSGIIPPNPAEILSSTRMIEFVKEMRDQYDLIIFDTPPILRVADPSIVSTLVDGVILV
A0A0H4TUX7      VLPSGSIPPNPSELLGSAAMHSLISALRRDYHYIIIDTPPTLPVTDASVVASGADAAILV
A0A1G0LUG0      VLPSGPAPPNPSELLGSHAMHALIGELRRSYDYIVMDTPPTLPVTDAAVVASAADGAILV
A0A1Q7E3T7      FIGCGMRRPDSPELLSSPRMSDLFAQLRANFAVIIVDSPPLGAGVDAFALATITGHLVMV
A0A1G0L906      ILTSGSLPPNPSELLGSEAMHRLLEEVRSHYDNIIFDTPPALAVTDAAVLGAGSDAVILI
A0A1G0LCC0      ILTSGSLPPNPSELLGSEAMHRLLEEVRSHYDNIIFDTPPALAVTDAAVLGAGSDAVILI
A0A2D5ZJE2      VITSGSLPPNPSELLGSDAMARFIEEVGREFDQIIVDTPPVMAVTDALLLSALLDGVIII
A0A3M2G624      IICSGTQPPNPSELLSSPELKSLITTLKEHYDMILFDSPPVIPVADSVALSTNVDGVLLV
W0RI74          IIPSGTRHRRAPELLATPRMQQLVASLAAEFDVVIIDTPPLGAGTDAYAIGTACGQLAVV
A0A3M2BJA6      FLPTGTLPPNPAELLGSERMKTLLRHLEEQFDAIILDSAPLTVVTDAAVLGTNAEGVLLV
A0A3D4VBZ5      IMPAGVRRKRAPELLATPRLTQLISQMAGEYDVVVVDSPPLGAGYDAFALATATGNMALV
C1A5W1          IMPAGVRRKRAPELLATPRLTQLISQMAGEYDVVVVDSPPLGAGYDAFALATATGNMALV
A0A2V7PX99      ILSCGTRMYRSPELLLLPTLRETIARLRTTYQIIIVDSPPLVAGIDPLVLATVTGNLLVV
A0A2V7ERC7      LLPAGTRKNRAPELLVSDRMTALLLAARQEFEVIIIDSPPFIAGVDAYALGAAAGSMLVV
A0A5Q4D6Y4      ILPSGTLPPNPTELLGGARTREVLQVLQENFDMVILDSPPLSGGADSSILGAAVDGVIMV
A0A2V7JTZ5      LIPRGTRGNRAPELLVSELMSALVHAMRLQFDVVIIDSPPLVAGMDAYALGAAAGSMLIV
A0A3D4YTR6      LIPRGTRRNRAPELLVSDLMNSLVHAMRLQFDVVIIDSPPLVAGIDAYALGAAAGSMLIV
A0A5Q4DA46      VIPSGSRLRDGPELLGTDRMIELLDDVRGRFDVILIDSPPLGAAVDPYLLGTLSGSIMLV
A0A2V7F1M1      LLPCGALPRRTSEVLQPHQLRRLLDDLSGHFDVIILDTPPVLVSADAALLAPLADGAILV
A0A2V7KXK7      FLSSGTRMQRAPERLLSQNMRDLMSKLRSMFDVVIVDSPPLGAGADPLVLGTLTENLLLV
A0A651HKD3      VIPRGSGLQNGPELLSTPAMQDLLAHLKEEFDVILVDSCPIGAAADPVILGTLTGSLALV
A0A2V7QDU7      VLPAGSAVNNASQLLWRADLDGLLVRLRAAYDLIVIDSPPMNVVADATLLAPQSDAVIVV
A0A2V7ITT6      FISAGTHFRDAPELLGSDAMVELVTRLRGSYGVILVDSPPLASGVDPYTLGMVTGSLLLV
A0A2V7NJW1      FISAGTHFRDAPELLGSDAMVELVTRLRGSYGVILVDSPPLASGVDPYTLGMVTGSLLLV
A0A2V7GFB5      LLPCGVRTSDAPELLGSAKMPELLARLRGDYDTILVDSPPLGAGIDPFVLGTLTGNLLLV
A0A2V7RQ86      LLPCGVRTSDAPELLGSAKMPELLARLRGDYDTILVDSPPLGAGIDPFVLGTLTGNLLLV
A0A2V7IWX2      FIGCGSRMHNSPELLSAATMVDLLAALRSRYDVVLVDTAPLAAGADPYTMASLTTNLLMV
A0A1Q7KE95      FIGAGSRFRDSPELLGSPAMVELLERVRSQYRVVLVDSPPLGSGVDPYTLGTLTGNLLLV
A0A1Q7T8X5      FIGAGSRFRDSPELLGSPAMVELLERVRSQYRVVLVDSPPLGSGVDPYTLGTLTGNLLLV
A0A2V7FK98      LIGCGTRAYNAPELLGSPAMTSLVNGLRGGYDVVLIDSPPLAAGVDPLILSTLTGTLALV
A0A2V7R3Z8      LIGCGTRAYNAPELLGSPAMTSLVNGLRGGYDVVLIDSPPLAAGVDPLILSTLTGTLALV
A0A2V7J3C0      FIAAGSRYRDSPELLGYPAMVELLEHARAHYAVVIVDSSPLGSGVDPYTLGTLTGSLLLV
A0A2V7KWV9      FIGAGSRIRESPELLGSPRMVELLVRLRAMYPVIIVDSPPLGAGVDPYTLGTMTGAMMLV
A0A1Q6ZHP2      LIGCGTRAYNAPELLGSQTMSQLLTTLRPSYDVILVDSPPLSAGVDPLILGTLTGHLVVV
A0A1Q7R6Z6      LIGCGTRAYNAPELLGSQTMSQLLTTLRPSYDVILVDSPPLSAGVDPLILGTLTGHLVVV
A0A2V7FYT7      LIGCGTRAYNAPELLGSQTMSQLLTTLRPSYDVILVDSPPLSAGVDPLILGTLTGHLVVV
A0A2V7IGR0      LVSCGTRAHHAPELLGSPAMGQFVAGLRTHYDVILFDNPPLAAGVDPLIVGTLTGNLLLV
A0A2V7MR23      LIGCGTRAYNAPELLGSQTMSQLLTTLRPSYDVILVDSPPLSAGVDPLILGTLTGHLVVV
A0A2V7L1V3      LIACGTRAYNAPELLGSPAMSELVTGMRSGYDVILIDSPPLAAGVDPLILGTLTGTLALV
A0A1Q7E5D3      LVGCGTRAHNAPELLGSEAMSQLIRHARRSYDVVVFDSPPLGAGVDPLILGTLTGSLVLV
A0A2V7ISE2      LIGCGTRAYNAPELLGSQTMSQLVTALRPSYDVILVDSPPLSAGVDPLILGTLTGHLVVV
A0A1Q7J2X5      LIGCGTRAYNAPELLGSQTMSQLVTALRPSYDVILVDSPPLGAGVDPLILGTLTGHLVVV
A0A2V7NPD1      LIGCGTRAYNAPELLGSQTMSQLVTALRPSYDVILVDSPPLGAGVDPLILGTLTGHLVVV
A0A2V7QPD8      LIGCGTRAYNAPELLGSPAMTSLVNGLRGSYDVILIDSPPLAAGVDPLILSTLTGTLTLV
A0A2V7Q8M6      LIACGTRAYNAPELLGSPPMSELVNGMRSGYDVILIDSPPLAAGVDPLILGTLTGTLALV
A0A2V7QBC3      LIACGTRAYNAPELLGSPPMSELVNGMRSGYDVILIDSPPLAAGVDPLILGTLTGTLALV
A0A2V7LMU1      LIACGTRAYNAPEMLASPAMSQLVNGMRSGYDVILIDSPPLGAGVDPLILGTLTGTLALV
A0A2V7PBY9      LIGCGTRAYNAPELLGSPRMSELVTGMRSGYDVILFDSPPLAAGVDPLIVGTLTGTLALV
A0A3M2BLV5      MLPSGPFPPNPSELLNSKAMQRLLEELQGKYSHIIVDSPPVLAVTDAALLGAHTDGVVLV
A0A2V7KS68      LIACGTRTQRAPELLDSDAMVTLLTRLRGEYDVVLIDSPPLTAGVDPFVLGTLTGALVLV
A0A2V7N4L3      LIGCGTRTSRAPEVLGSTAMNDLLTEMRGQYDVIVVDSPPLAAGVDSFVLGTVTGTLLVV
A0A1Q7AZK2      FIGCGTRTQRAPEVLGSPAMTQFIADLRNQYDVILVDSPPLTAGVDPFVLGTVTGALLLV
A0A1Q7TNP7      FIGCGTRTQRAPEVLGSPAMTQFIADLRNQYDVILVDSPPLTAGVDPFVLGTVTGALLLV
A0A1Q7KG39      FIGCGTRTQRAPEVLGSPAMTQFIADLRNQYDVILVDSPPLTAGVDPFVLGTVTGALLLV
A0A1Q7GX75      LIGCGTRTQRAPEVLGSPAMNRLLAELRGRYDVIVVDSPPLAAGVDSFIIGTVTGSLLLV
A0A1Q7LL80      LIGCGTRTQRAPEVLGSPAMNRLLAELRGRYDVIVVDSPPLAAGVDSFIIGTVTGSLLLV
A0A2V7PFU2      FIGCGTRTQRAPEVLGSPAMAQLLAELREQYDVIVVDSPPLTAGVDPFILGTATGSLLLV
A0A2V7MFS9      LIGGGTRTQRAPEVLGSQAMTELIAELRGQYDVILVDSPPLTAGVDPFILGTVTGSLLVV
A0A2V7T933      FIGCGTRTQRAPEVLGSPAMTQFIADLRNQYDVILVDSPPLTAGVDPFVLGTVTGALLLV
A0A2V7J4D7      FISCGLRSHAGPALLSSVAMARLLDALRASYEAIIVDSPPLAAGADGLALATVTGSLVLV
A0A2V7LN90      LLAAGTRTHAGPALIGSAALPRALAALRPGYDVIIVDSSPLAAGADAFALATATGSMLLV
A0A2V7LFN9      FLGCGTRTHDGPALVSSAALPRVLAGLRSSYHAIIIDSSPLAAGADAFALGTGTGTLLLV
A0A2V7MEK4      FLGCGTRTHDGPALVSSAALPRVLAGLRSSYHAIIIDSSPLAAGADAFALGTGTGTLLLV
A0A2V7P8B1      FVASGSRRRDAPELIGSARMTEFMSGLRSRYGVIVVDSPPLGAGVDALLVASLAGSLLMV
A0A2V7R2W8      FISCGLRSQAGPALLSSATMARLLDGVRTSYDAVVVDSPPLAAGADGLALATVTGSLVLV
A0A2V7MS64      FLPSGTRTQIAPVLVSSAPLPRLLAELRPNYDAVIVDSPPLAAGVDALALGTATGAMVLV
A0A2V7Q7N9      FLGSGTRTHAGPTLISSAALPRALAALRPGYDVIIVDSSPLAAGADAFALGTATGSMLLV
A0A2V7IRW6      FIGSGTRTHTGPSLVSSAALPRLLAALRPSYDAIIVDSPPLAAGADAFAIGTATGSMVLV
A0A1Q7DVU6      FIGSGTRTHTGPSLVSSAALPRLLATLRPGYDAIIVDSPPLAAGADAFAIGTATGSMVLV
A0A1Q7JSV2      FIGSGTRTHTGPSLVSSAALPRLLATLRPGYDAIIVDSPPLAAGADAFAIGTATGSMVLV
A0A2V7QN41      FIGCGARRPSAPELLSSDVMTELIDRVREECGVVLVDSPPLAVGVDPYVLATRTGNVLIV
A0A2V7R603      FIGCGARRPSAPELLSSDVMTDLIDRVREECGVVLVDSPPLAVGVDPYVLATRTGNVLIV
A0A2V7LJS2      FLASGSRRGDAPELLGSARMADFMTKLRSSYGVIVVDTPPLGAGVDAFVLASLAGSLLLV
A0A1Q7GLJ7      FLPSGTRRRDAPELMGSAAMVDLVTSLRSTYDVIVLDTAPLGAGVDALALAKLAGNLLMV
A0A2V7GRE3      FIASGTRRRDAPELLGSAAMTDLVTSLRSTYEVIVVDTAPLGAGVDALVLAKLARNLLMV
A0A2V7EU00      FIGSGSRTPDAPELLGAPPMARLLASVRTSYQVILIDSSPLGAGVDPFLLGTLTGSLLIV
A0A1Q6WE01      FIGAGTRFRDSPELLGSGAMSELLARLRASWSVILVDSPPLGSGVDPYTLGTLTSNMLLV
A0A2V7S9K3      FIGAGTRFRDSPELLGSVAMVELLTCVRSSYGVILLDSPPLGSGVDPYTLATLTGSLLLV
A0A1Q7DXB9      FIGCGSRMHNSPELLSAATMVDLLAALRSRYDVVLVDTAPLAAGADPYTMASLTTNLLMV
A0A1Q7JD32      FIGCGSRMHNSPELLSAATMVDLLAALRSRYDVVLVDTAPLAAGADPYTMASLTTNLLMV
A0A2V7MVP8      FIGCGSRMHNSPELLSATTMVDLLAALRSRYDVVLVDTAPLAAGADPYTMASHTKNLLVV
A0A2V7N0A9      FIGAGSRMHRGPELLCSATVPQLITALRPGYDVILVDSAPLAAGVDPYALGVATGNMLLV
A0A1Q7DLS9      FIACGSRTRSGPELLSSTAMAGFVTSLRSRYAVILIDSPPLAAGVDACALGTMTGSLVLV
A0A1Q7JK96      FIACGSRTRSGPELLSSTAMAGFVTSLRSRYAVILIDSPPLAAGVDACALGTMTGSLVLV
A0A2V7KQV7      FIGGGSRLHRGPELLCSEALPRLITAMRPHYDAILVDSPPLAAGVDASALGAVTGSLLVV
A0A1Q7JGF6      FIGAGSRMHRGPELLCSVAMPRLITVMRPSYDVILVDSAPLAAGVDPYALGTATGSMLLV
A0A2V7SG67      FIGAGSRMHRGPELLCSVAMPRLITVMRPSYDVILVDSAPLAAGVDPYALGTATGSMLLV
A0A1Q7GIK9      FLGAGSRMHRGPELLGSAGMPRLLTALRSAYDVILVDSAPLAAGVDPYALGAATGNVLLV
                .:  *      .  :        .         ::.*. *     *   :.       ::

A0A2D5ZJF2      LRAEKSTRKASEQARDGLLAVGGHLLGVVVNDAHHRREGYG---YGYYGGYGQYGGYYGR
A0A0S8H9P3      VKAGETDRRAGWQAIQQLRRVGARVVGAVLNEI-VLQRGAD---RYYFDYY--YSRSSS-
A0A1E4BBP7      LRAGETDRKLAQAKLTVLDRMPIRLVGAILNDI------GELPQFKYY-YY--LEGYRAL
A0A3M2G737      VASGKTPAGGLNFAVETLVKVKANLLGIVLNDFDPKKAYGGYYYGNYYKYY--YYSSYYG
A0A0H4TUX7      LRSGDTQETAAQRALEQLRRVHARIAGAVLNGV---SSRHD----RYYTYY--SYRREPA
A0A1G0LUG0      LKSGDTEEVPAQRALEQLRRVHARVAGAVLNGV---NQQKD----QYYTYY--ASRE---
A0A1Q7E3T7      LRPGTTNREVIEAKLDLLHRLPVRVLGAVLNDV---QDGPE---YTGYSYY--LEGYEAT
A0A1G0L906      LRAGKTEEVAAQRALAQLSRVQARVAGSVLNGVQKMRDR-----YYYYYYY--RKDPRTT
A0A1G0LCC0      LRAGKTEEVAAQRALAQLSRVQARVAGSVLNGVQKMRDR-----YYYYYYY--RKDPRTT
A0A2D5ZJE2      VEAGETLEQVAKRTKTLVETAARRCLGVVLNNV---DVGGGYGRYGGYHYH--YHYHEDA
A0A3M2G624      VSAGKTDRHALQRTRDLLHNVNARIMGAVLNNV---RINEIYGYQKHYYYY--DTKKPVK
W0RI74          LRSNRTNLKMAKAKLAVLAQLPVTLLGAVLNEV---RTDSG--MYQYYSYD---PDYVLP
A0A3M2BJA6      ARANVTERGAIRYSVDQLKHVRAPILGVVLNDIDFRRDSRYSSSYGRYGYY--YQYYYGD
A0A3D4VBZ5      MRAGVTDRKMAEAKMATVDTLPIRVMGAILNGI---KMTGA---YQYYSYY---QDYAAE
C1A5W1          MRAGVTDRKMAEAKMATVDTLPIRVMGAILNGI---KMTGA---YQYYSYY---QDYAAE
A0A2V7PX99      LRSEATDLELAAAKLSVADTLPVRTIGAVLNCV---RGHGA---FRYYTYD--LADYAEP
A0A2V7ERC7      LRPGVSDRKLAAAKLDIVDRLPIRVLGAVLNGV---PGGGA---YRYYG-----TNYYYG
A0A5Q4D6Y4      VRAGETEIEAVRYAARQLHTVGATLLGSVMND----PDGEA---EKYGAYY--SYGYYGS
A0A2V7JTZ5      LRPAVTDRKLASAKLEVLDRLPIRILGAVLNAV---PDGGA---YRYYG-----ADYSYK
A0A3D4YTR6      LRPARTDRKLAAAKLDVLDRLPIRILGAVLNAV---PGGGA---YRYYG-----ADYEYK
A0A5Q4DA46      FRNGTTNQDVAVSRIEELKRLPVQIVGAVLNDV---PAGSA--AYKSYAY---LPGYGVA
A0A2V7F1M1      VRAGQTNRSSAERACQYLIAAGAHFLGAVLNDP---AGELARYGKYYYSY-----GYPTP
A0A2V7KXK7      LRTGQSDINLASTKLEVLNALPVRVIGAVLNDV---RSSGV---YRYYMYS--SAEYELV
A0A651HKD3      VRSGTTDSERAEGMLRNLRRFPVRVLGAVVNDV---SQGDH---YNYYGY---VPGYGVD
A0A2V7QDU7      ARAGRTAPEALNFTLEQLRSVHA-LVWTVLNDI---D-------YRRDRVY--GRAYGQR
A0A2V7ITT6      LRTGATSLELARTKLRVLDRLPIRLLGVVVNDV---RPRGV---YRYHSY---LSGYGTA
A0A2V7NJW1      LRTGATSLELARTKLRVLDRLPIRLLGVVVNDV---RPRGV---YRYHSY---LSGYGTA
A0A2V7GFB5      LRTGVSHREVMAAKLEVLRRLPVRLLGAVLNDV---PPGAA---YQYYSYY--TPGYEAT
A0A2V7RQ86      LRTGVSHREVMAAKLEVLRRLPVRLLGAVLNDV---PPGAA---YQYYSYY--TPGYEAT
A0A2V7IWX2      LRAGVTDLELAQAKLESFEDLPVRVVGTVLNDV---QPKGA---YRYYAYY--VPGYETK
A0A1Q7KE95      LRTGTTNLALARTKLTVLDHLPIRLLGVVLNDV---RPGGM---YRYYS-Y--LSGYATT
A0A1Q7T8X5      LRTGTTNLALARTKLTVLDHLPIRLLGVVLNDV---RPGGM---YRYYS-Y--LSGYATT
A0A2V7FK98      LRTGYSHRDVAAAKLEVLQRLPVRMLGAVLNDV---PAGGA---YRYYSYY--LPGYEAM
A0A2V7R3Z8      LRTGYSHRDVAAAKLEVLQRLPVRMLGAVLNDV---PAGGA---YRYYSYY--LPGYEAM
A0A2V7J3C0      LRTGTTNLALARTKLAVLDHLPIRLLGAVLNDV---RSDDL---YRHYS-Y--LSGYATV
A0A2V7KWV9      LRTGATNLDLARTKVAMLENLPIRVLGAVLNDV---RLGQM---YGEYYGY--MAGYGTT
A0A1Q6ZHP2      LRTGFSHRDMASAKLEVLQRLPVRLLGAILNAV---PAGEA---YRYYSYY--LPGYEAV
A0A1Q7R6Z6      LRTGFSHRDMASAKLEVLQRLPVRLLGAILNAV---PAGEA---YRYYSYY--LPGYEAV
A0A2V7FYT7      LRTGFSHRDMASAKLEVLQRLPVRLLGAILNAV---PAGEA---YRYYSYY--LPGYEAV
A0A2V7IGR0      LRTGQSDREMTAAKLEVLQRLPVRLLGAVLNDV---PAGAT---YRYYSYY--LPGYEAV
A0A2V7MR23      LRTGFSHRDVASAKLEVLQRLPVRLLGAILNAV---PAGDA---YRYYSYY--LPGYEAV
A0A2V7L1V3      LRTGYSHRDVAAAKLEMLQRLPVRMLGAILNDV---PAGGA---YRYYSYY--LPGYEAA
A0A1Q7E5D3      LRTGYSDRDVAAAKLEMLQRLPIRLLGAILNDV---PAGAA---YRYYSYY--LPGYEAV
A0A2V7ISE2      LRTGYSHRDVAAAKLEVLQRLPVRLLGAILNAV---PAGAA---YRYYSYY--LPGYEAV
A0A1Q7J2X5      LRTGYSHRDVAAAKLEVLQRLPVRLLGAILNAV---PAGAA---YRYYSYY--LPGYEAV
A0A2V7NPD1      LRTGYSHRDVAAAKLEVLQRLPVRLLGAILNAV---PAGAA---YRYYSYY--LPGYEAV
A0A2V7QPD8      LRTGYSHRDVAAAKLEVLQRLPVRMLGAVLNDV---PAGGA---YRYYSYY--LPGYEAM
A0A2V7Q8M6      LRTGYSHRDVAAAKLEMLHRLPVRLLGAILNDV---PAGGA---YRYYSYY--LPGYEAA
A0A2V7QBC3      LRTGYSHRDVAAAKLETLQRLPVRLLGAILNDV---PAGGA---YRYYSYY--LPGYEAA
A0A2V7LMU1      LRTGYSHRDVATAKLEMLQRLPVRLLGAIMNDV---PAGGA---YRSYSYY--LPGYEAM
A0A2V7PBY9      LRTGYSHRDVAAAKLEVLQRLPIRLLGAILNDV---PAGGA---YRYYSYY--LPGYEAA
A0A3M2BLV5      LRSGETEQRAAERAVEQLRRVGVRVFGAVLNEV---STSNA--EESYYLQY--YYGYHPR
A0A2V7KS68      LRTGHSNRNITGAKLDMLQRLPVRLLGAVLNDV---PRGGAYGYYAYYSYY--LPGYEAV
A0A2V7N4L3      LRTGHSHRDITGAKLEMLDRLPIRLLGAVLNDV---PRGAAYGYYAYYSYY--LPGYEAV
A0A1Q7AZK2      LRTGHSHRDITGAKLEVLDRLPIRLLGAVLNDV---PHGAAYGYYSYYSYY--LPGYEAV
A0A1Q7TNP7      LRTGHSHRDITGAKLEVLDRLPIRLLGAVLNDV---PHGAAYGYYSYYSYY--LPGYEAV
A0A1Q7KG39      LRTGHSHRDITGAKLEVLDRLPIRLLGAVLNDV---PHGAAYGYYSYYSYY--LPGYEAV
A0A1Q7GX75      LRTGHSHRDITGAKLEVLDRLPIRLLGAVLNDV---PRGAAYGYYAYYSYY--LPGYEAV
A0A1Q7LL80      LRTGHSHRDITGAKLEVLDRLPIRLLGAVLNDV---PRGAAYGYYAYYSYY--LPGYEAV
A0A2V7PFU2      LRTGHSHRDVTGAKLEMLDRLPIRLLGAVLNDI---PREAAYGYYAYYSYY--LPGYEAV
A0A2V7MFS9      LRTGHSHREIAGAKLEVLERLPIRLLGAVLNDV---PRGAAYGYYAYYSYY--LPGYEAV
A0A2V7T933      LRTGHSHRDITGAKLEVLDRLPIRLLGAVLNDV---PHGAAYGYYSYYSYY--LPGYEAV
A0A2V7J4D7      LRTGVSDRELTETKLGALHHLPVRVLGAVLNDV---RPGGA---YRYYSYY--LEGYEVH
A0A2V7LN90      LRTGVSDRELAQAKLEVLQYLPIRVLGAVLNDV---RLGGV---YRYYSYY--LEGYEAT
A0A2V7LFN9      LRTGVSDGGLALAKLEVMSRLPIRVLGAVLNDV---RGGSL---YRDYSYY--LEGYETQ
A0A2V7MEK4      LRTGVSDGGLALAKLEVMSRLPIRVLGAVLNDV---RGGSL---YRDYSYY--LEGYETQ
A0A2V7P8B1      LRLGRTDRELAEAKLELLRAQPIRVLGAVLNDV---REGSE---YHAYSYY--LDGYELG
A0A2V7R2W8      LRAGVSDRELTETKLGVLTHLPVRVLGAVLNDV---RPGGA---YRYYSYY--LEGYEAH
A0A2V7MS64      LRTGYSDREMAQNKLQALTHLPIRVLGAVLNDV---R-GSR---YKYYSYY--LEGYEAR
A0A2V7Q7N9      LRTGVSDRELVQAKLEVLQYLPIRVLGAVLNDV---RPGGV---YRYYSYY--LEGYEAK
A0A2V7IRW6      LRTGVSDRELAQTKLEVLAHLPIRMLGAVLNDV---R-GGL---YRYYSYY--LEGYEVK
A0A1Q7DVU6      LRTGVSDRELAQTKLEVLAHLPIRMLGAVLNDV---R-GGL---YRYYSYY--LEGYEVK
A0A1Q7JSV2      LRTGVSDRELAQTKLEVLAHLPIRMLGAVLNDV---R-GGL---YRYYSYY--LEGYEVK
A0A2V7QN41      LRAGVSDLDLAAAKLDVLDTLPVRVLGAVLNDV---RPYGA---YRYYTYD--AAAYAEA
A0A2V7R603      LRAGVSDLDLAAAKLDVLDTLPVRVLGAVLNDV---RPYGA---YRYYTYD--AAAYAEG
A0A2V7LJS2      LRLGRTDRELAEAKIDLLRQSSTRVLGVVLNDV---REGSE---YRAYSYY--MDGYEFT
A0A1Q7GLJ7      LRLGRTDRELAEAKLEILRRLPLRLLGAVLNDV---RDESE---YRAYAYY--MDGYALT
A0A2V7GRE3      LRLGRTDRVLAEAKLEILRRLPLRLLGAVLNDV---RDESE---YRAYAYY--MDGYALT
A0A2V7EU00      LRSGTTDRELAQANLDGLLRLPIRVLGAVLNDI---EPRGA---YRYYSY---LSGYAAE
A0A1Q6WE01      LRTDATDLSLARTKLSVLDQLPIRLLGVVVNDV---RPGGV---YRYYSY---FAGYGTR
A0A2V7S9K3      LRTGATNLDLARTKLGMLDHLPIRLLGVVVNDV---QPGGA---YRYYSY---LSGYATA
A0A1Q7DXB9      LRAGVTDLELAQAKLESFEDLPVRVVGTVLNDV---QPKGA---YRYYAYY--VPGYETK
A0A1Q7JD32      LRAGVTDLELAQAKLESFEDLPVRVVGTVLNDV---QPKGA---YRYYAYY--VPGYETK
A0A2V7MVP8      LRAGVTDLELAQAKLESFDDMPVRVVGSVLNDV---RPKGA---YRYYAYY--VPGYETK
A0A2V7N0A9      VRPDVTDRAIAEAKVEVLQRLPVRLLGAVLNDV---RPGLA---YNHYSYS--LAGYEMQ
A0A1Q7DLS9      LRTGVSDRELVEAKLDVLERLPIRILGAVLNDV---RPGGA---YRSYAYS--LSGYDLH
A0A1Q7JK96      LRTGVSDRELVEAKLDVLERLPIRILGAVLNDV---RPGGA---YRSYAYS--LSGYDLH
A0A2V7KQV7      LRTGVTDRMIAEAKVELLRTLPIRMLGVVLNDV---RPGVA---YSYYAYS--LEGYSVR
A0A1Q7JGF6      LRTGVTDRTLAEAKVEVLHRLPIRVLGAVLNDV---RPGAA---YTYYSYS--LAGSEVQ
A0A2V7SG67      LRTGVTDRTLAEAKVEVLHRLPIRVLGAVLNDV---RPGAA---YTYYSYS--LAGSEVQ
A0A1Q7GIK9      LRTGVTDRSLAEAKVEVLHRLPLRVLGAILNDV---RPGSA---YSYYSYS--LEGYEVR
                     :                      ::*                             

A0A2D5ZJF2      DRAEGRREGGRGSSGTEKGSSTG-------------------------------------
A0A0S8H9P3      ------------------------------------------------------------
A0A1E4BBP7      EGAEEGNAALLGSGSGGNGRG---------------------------------------
A0A3M2G737      SDRDKKKQRSIKLKS---------------------------------------------
A0A0H4TUX7      RRGLLTAGSPRAGGCSPFGRSSAIPSENQ-------------------------------
A0A1G0LUG0      --------APRRSRTSLFTR----------------------------------------
A0A1Q7E3T7      AEGVREHHTVLRSSG---------------------------------------------
A0A1G0L906      RGLLSALREQIAHLF---------------------------------------------
A0A1G0LCC0      RGLLSALREQIAHLF---------------------------------------------
A0A2D5ZJE2      DNKTNSRATSIWRAARGVAIVATFFAIAAAMWHQRRPTLAEADTVESRMVPNTEDGRIAG
A0A3M2G624      V-----------------------------------------------------------
W0RI74          EETPALSAGGGGGTSVAVREG---------------------------------------
A0A3M2BJA6      NGKKKK------------------------------------------------------
A0A3D4VBZ5      DEQPERLSAGSGSSRPVALSGGVSDA----------------------------------
C1A5W1          DEQPERLSAGSGSSRPVALSGGVSDA----------------------------------
A0A2V7PX99      DPAVAATRRDGWRHILGGRSS---------------------------------------
A0A2V7ERC7      DTRAKEHVGNLATPKGLLLNA---------------------------------------
A0A5Q4D6Y4      TE----------------------------------------------------------
A0A2V7JTZ5      DEVLKEPIADIATPKGLLVRS---------------------------------------
A0A3D4YTR6      GDSSTEPIADLATPQGLVLRA---------------------------------------
A0A5Q4DA46      DEEPETREAPEGRRLVARAEA---------------------------------------
A0A2V7F1M1      SD----------------------------------------------------------
A0A2V7KXK7      DDEGQTREALPSILGGRT------------------------------------------
A0A651HKD3      EVEQLHLVAGATQARGAVGSGGR-------------------------------------
A0A2V7QDU7      ASYLETE-----------------------------------------------------
A0A2V7ITT6      DEAEYAMGPPRVRGVL--------------------------------------------
A0A2V7NJW1      DEAEYAMGPPRVRGVL--------------------------------------------
A0A2V7GFB5      DEKPARLTPSVG------------------------------------------------
A0A2V7RQ86      DEKPARLTPSVG------------------------------------------------
A0A2V7IWX2      EE----ADLGPEKPVLGVPSV---------------------------------------
A0A1Q7KE95      NEREGYAVAGRQARGVL-------------------------------------------
A0A1Q7T8X5      NEREGYAVAGRQARGVL-------------------------------------------
A0A2V7FK98      DE----NSGSPRVPV---------------------------------------------
A0A2V7R3Z8      DE----NSGSPRVPV---------------------------------------------
A0A2V7J3C0      DEQEGYAIAGRKAHGVL-------------------------------------------
A0A2V7KWV9      TEDGGTRIARRRLQGAL-------------------------------------------
A0A1Q6ZHP2      DEEAERASGGKGQPFVI-------------------------------------------
A0A1Q7R6Z6      DEEAERASGGKGQPFVI-------------------------------------------
A0A2V7FYT7      DEEAERASGGKGQPFVI-------------------------------------------
A0A2V7IGR0      DEEAQ------AQPLVT-------------------------------------------
A0A2V7MR23      DEEAEQASGGKGQPFVI-------------------------------------------
A0A2V7L1V3      DE----NSGSRRVPV---------------------------------------------
A0A1Q7E5D3      D-EGERNSGPKVRSLVI-------------------------------------------
A0A2V7ISE2      DEEAERTSGGNKQPFVI-------------------------------------------
A0A1Q7J2X5      DEEAERTSGGNKQPFVI-------------------------------------------
A0A2V7NPD1      DEEAERTSGGNKQPFVI-------------------------------------------
A0A2V7QPD8      DE----NSGTPRVPV---------------------------------------------
A0A2V7Q8M6      DE----NSGSR-------------------------------------------------
A0A2V7QBC3      DE----NSGSRRVPV---------------------------------------------
A0A2V7LMU1      DE----ERGSGRVPV---------------------------------------------
A0A2V7PBY9      DE----EAGSRRVPV---------------------------------------------
A0A3M2BLV5      EETGWQRLRSGLSRARFW------------------------------------------
A0A2V7KS68      EERD-GARQTGPVVVTE-------------------------------------------
A0A2V7N4L3      DESKHGRRTPAPTVV---------------------------------------------
A0A1Q7AZK2      DEGD--RQASGARVV---------------------------------------------
A0A1Q7TNP7      DEGD--RQASGARVV---------------------------------------------
A0A1Q7KG39      DEGD--RQASGARVV---------------------------------------------
A0A1Q7GX75      EESS--GQASAPRVV---------------------------------------------
A0A1Q7LL80      EESS--GQASAPRVV---------------------------------------------
A0A2V7PFU2      DEGA--GRTSGPRVV---------------------------------------------
A0A2V7MFS9      DEGD-GRRTSGPQVV---------------------------------------------
A0A2V7T933      DEGD--RQASGARVV---------------------------------------------
A0A2V7J4D7      DEPAAADVHVLRGPER--------------------------------------------
A0A2V7LN90      DEPAGAEGEVLRGPE---------------------------------------------
A0A2V7LFN9      DEPDEARGQVLRAPEYP-------------------------------------------
A0A2V7MEK4      DEPDEARGQVLRAPEYP-------------------------------------------
A0A2V7P8B1      DEPLFEPLV-SRPRGTTPVAGR--------------------------------------
A0A2V7R2W8      DEPDAAQAR-VLRGPVEEPVTR--------------------------------------
A0A2V7MS64      DE--QPASR-LMRAPE--------------------------------------------
A0A2V7Q7N9      DEPAEAAGQ-VLQAPEQVLPAPE-------------------------------------
A0A2V7IRW6      EEP-EPAWQ-LVRAPE--------------------------------------------
A0A1Q7DVU6      EEP-EPAWQ-LVRAPE--------------------------------------------
A0A1Q7JSV2      EEP-EPAWQ-LVRAPE--------------------------------------------
A0A2V7QN41      NGAASQRRG----GSAGVLWGQS-------------------------------------
A0A2V7R603      NGAIGQRRP----GSAGVLWGRS-------------------------------------
A0A2V7LJS2      GEPLFQPLGDATKRGRPPVTARQ-------------------------------------
A0A1Q7GLJ7      NEPPFRPLG-G-KQGASSHAAG--------------------------------------
A0A2V7GRE3      NEPLFRPLA-GNKQGVGSRPAR--------------------------------------
A0A2V7EU00      DEPTAPPQQWAVARRLPGASSPDA------------------------------------
A0A1Q6WE01      DEGVA-----IATHRVRGVL----------------------------------------
A0A2V7S9K3      DEGTA-----SAAHRLRGVL----------------------------------------
A0A1Q7DXB9      EEADLGPEKPVLGVPSV-------------------------------------------
A0A1Q7JD32      EEADLGPEKPVLGVPSV-------------------------------------------
A0A2V7MVP8      EEADLGPEKPVLGVPGD-------------------------------------------
A0A2V7N0A9      EEDSGREAGPILLPDSP-------------------------------------------
A0A1Q7DLS9      DEEEPPKR---ILRSVE-------------------------------------------
A0A1Q7JK96      DEEEPPKR---ILRSVE-------------------------------------------
A0A2V7KQV7      EEDPDGRAGT-LLPRRS-------------------------------------------
A0A1Q7JGF6      EEDPGGVTSEILLPDRS-------------------------------------------
A0A2V7SG67      EEDPGGVTSEILLPDRS-------------------------------------------
A0A1Q7GIK9      DEDPEGKAGKMLLPDPA-------------------------------------------
                                                                            

A0A2D5ZJF2      --------
A0A0S8H9P3      --------
A0A1E4BBP7      --------
A0A3M2G737      --------
A0A0H4TUX7      --------
A0A1G0LUG0      --------
A0A1Q7E3T7      --------
A0A1G0L906      --------
A0A1G0LCC0      --------
A0A2D5ZJE2      LEEGVVGR
A0A3M2G624      --------
W0RI74          --------
A0A3M2BJA6      --------
A0A3D4VBZ5      --------
C1A5W1          --------
A0A2V7PX99      --------
A0A2V7ERC7      --------
A0A5Q4D6Y4      --------
A0A2V7JTZ5      --------
A0A3D4YTR6      --------
A0A5Q4DA46      --------
A0A2V7F1M1      --------
A0A2V7KXK7      --------
A0A651HKD3      --------
A0A2V7QDU7      --------
A0A2V7ITT6      --------
A0A2V7NJW1      --------
A0A2V7GFB5      --------
A0A2V7RQ86      --------
A0A2V7IWX2      --------
A0A1Q7KE95      --------
A0A1Q7T8X5      --------
A0A2V7FK98      --------
A0A2V7R3Z8      --------
A0A2V7J3C0      --------
A0A2V7KWV9      --------
A0A1Q6ZHP2      --------
A0A1Q7R6Z6      --------
A0A2V7FYT7      --------
A0A2V7IGR0      --------
A0A2V7MR23      --------
A0A2V7L1V3      --------
A0A1Q7E5D3      --------
A0A2V7ISE2      --------
A0A1Q7J2X5      --------
A0A2V7NPD1      --------
A0A2V7QPD8      --------
A0A2V7Q8M6      --------
A0A2V7QBC3      --------
A0A2V7LMU1      --------
A0A2V7PBY9      --------
A0A3M2BLV5      --------
A0A2V7KS68      --------
A0A2V7N4L3      --------
A0A1Q7AZK2      --------
A0A1Q7TNP7      --------
A0A1Q7KG39      --------
A0A1Q7GX75      --------
A0A1Q7LL80      --------
A0A2V7PFU2      --------
A0A2V7MFS9      --------
A0A2V7T933      --------
A0A2V7J4D7      --------
A0A2V7LN90      --------
A0A2V7LFN9      --------
A0A2V7MEK4      --------
A0A2V7P8B1      --------
A0A2V7R2W8      --------
A0A2V7MS64      --------
A0A2V7Q7N9      --------
A0A2V7IRW6      --------
A0A1Q7DVU6      --------
A0A1Q7JSV2      --------
A0A2V7QN41      --------
A0A2V7R603      --------
A0A2V7LJS2      --------
A0A1Q7GLJ7      --------
A0A2V7GRE3      --------
A0A2V7EU00      --------
A0A1Q6WE01      --------
A0A2V7S9K3      --------
A0A1Q7DXB9      --------
A0A1Q7JD32      --------
A0A2V7MVP8      --------
A0A2V7N0A9      --------
A0A1Q7DLS9      --------
A0A1Q7JK96      --------
A0A2V7KQV7      --------
A0A1Q7JGF6      --------
A0A2V7SG67      --------
A0A1Q7GIK9      --------
                        

© 1998-2020Legal notice