BYKdb

Dataset for cluster tadcd of phylum gemmatimonadetes

[Download (right click)] [Edit] [Sequences] [Repertoires]

90 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2D5ZJF2      ------------------------------------------------------------
A0A0S8H9P3      ------------------------------------------------------------
A0A1E4BBP7      ------------------------------------------------------------
A0A3M2G737      ------------------------------------------------------------
A0A0H4TUX7      ------------------------------------------------------------
A0A1G0LUG0      ------------------------------------------------------------
A0A1Q7E3T7      ------------------------------------------------------------
A0A1G0L906      ------------------------------------------------------------
A0A1G0LCC0      ------------------------------------------------------------
A0A2D5ZJE2      ------------------------------------------------------------
A0A3M2G624      ------------------------------------------------------------
W0RI74          ------------------------------------------------------------
A0A3M2BJA6      ------------------------------------------------------------
A0A3D4VBZ5      ------------------------------------------------------------
C1A5W1          ------------------------------------------------------------
A0A2V7PX99      ------------------------------------------------------------
A0A2V7ERC7      ------------------------------------------------------------
A0A5Q4D6Y4      ------------------------------------------------------------
A0A2V7JTZ5      ------------------------------------------------------------
A0A3D4YTR6      ------------------------------------------------------------
A0A5Q4DA46      ------------------------------------------------------------
A0A2V7F1M1      ------------------------------------------------------------
A0A2V7KXK7      ------------------------------------------------------------
A0A651HKD3      ------------------------------------------------------------
A0A2V7QDU7      ------------------------------------------------------------
A0A2V7ITT6      ------------------------------------------------------------
A0A2V7NJW1      -----------------------------------------------------MLVVHDE
A0A2V7GFB5      ------------------------------------------------------------
A0A2V7RQ86      ------------------------------------------------------------
A0A2V7IWX2      ------------------------------------------------------------
A0A1Q7KE95      ------------------------------------------------------------
A0A1Q7T8X5      ------------------------------------------------------------
A0A2V7MS64      ------------------------------------------------------------
A0A2V7Q7N9      ------------------------------------------------------------
A0A2V7IRW6      ------------------------------------------------------------
A0A1Q7DVU6      ------------------------------------------------------------
A0A1Q7JSV2      ------------------------------------------------------------
A0A2V7FK98      ------------------------------------------------------------
A0A2V7R3Z8      MIGPQSGAQQGEAIDLRHVQVHEHEVECAALQQVEGFLPPAADGYVVAFVAQNRRAALAQ
A0A2V7J3C0      ------------------------------------------------------------
A0A2V7KWV9      ------------------------------------------------------------
A0A1Q6ZHP2      ------------------------------------------------------------
A0A1Q7R6Z6      ------------------------------------------------------------
A0A2V7FYT7      ------------------------------------------------------------
A0A2V7IGR0      ------------------------------------------------------------
A0A2V7MR23      ------------------------------------------------------------
A0A2V7L1V3      ------------------------------------------------------------
A0A1Q7E5D3      ------------------------------------------------------------
A0A2V7ISE2      ------------------------------------------------------------
A0A1Q7J2X5      ------------------------------------------------------------
A0A2V7NPD1      ------------------------------------------------------------
A0A2V7QPD8      ------------------------------------------------------------
A0A2V7Q8M6      ------------------------------------------------------------
A0A2V7QBC3      ------------------------------------------------------------
A0A2V7LMU1      ------------------------------------------------------------
A0A2V7PBY9      ------------------------------------------------------------
A0A3M2BLV5      ------------------------------------------------------------
A0A2V7KS68      ------------------------------------------------------------
A0A2V7N4L3      ------------------------------------------------------------
A0A1Q7AZK2      ------------------------------------------------------------
A0A1Q7TNP7      ------------------------------------------------------------
A0A1Q7KG39      ------------------------------------------------------------
A0A1Q7GX75      ------------------------------------------------------------
A0A1Q7LL80      ------------------------------------------------------------
A0A2V7PFU2      ------------------------------------------------------------
A0A2V7MFS9      ------------------------------------------------------------
A0A2V7T933      ------------------------------------------------------------
A0A2V7J4D7      ------------------------------------------------------------
A0A2V7LN90      ------------------------------------------------------------
A0A2V7LFN9      ------------------------------------------------------------
A0A2V7MEK4      ------------------------------------------------------------
A0A2V7P8B1      ------------------------------------------------------------
A0A2V7QN41      ------------------------------------------------------------
A0A2V7R603      ------------------------------------------------------------
A0A2V7LJS2      ------------------------------------------------------------
A0A1Q7GLJ7      ------------------------------------------------------------
A0A2V7GRE3      ------------------------------------------------------------
A0A2V7EU00      ------------------------------------------------------------
A0A1Q6WE01      ------------------------------------------------------------
A0A2V7S9K3      ------------------------------------------------------------
A0A1Q7DXB9      ------------------------------------------------------------
A0A1Q7JD32      ------------------------------------------------------------
A0A2V7MVP8      ------------------------------------------------------------
A0A2V7N0A9      ------------------------------------------------------------
A0A1Q7DLS9      ------------------------------------------------------------
A0A1Q7JK96      ------------------------------------------------------------
A0A2V7KQV7      ------------------------------------------------------------
A0A1Q7JGF6      ------------------------------------------------------------
A0A2V7SG67      ------------------------------------------------------------
A0A1Q7GIK9      ------------------------------------------------------------
                                                                            

A0A2D5ZJF2      ------------------------------------------------------------
A0A0S8H9P3      ------------------------------------------------------------
A0A1E4BBP7      ------------------------------------------------------------
A0A3M2G737      ------------------------------------------------------------
A0A0H4TUX7      ------------------------------------------------------------
A0A1G0LUG0      ------------------------------------------------------------
A0A1Q7E3T7      ------------------------------------------------------------
A0A1G0L906      ------------------------------------------------------------
A0A1G0LCC0      ------------------------------------------------------------
A0A2D5ZJE2      ------------------------------------------------------------
A0A3M2G624      ------------------------------------------------------------
W0RI74          ------------------------------------------------------------
A0A3M2BJA6      ------------------------------------------------------------
A0A3D4VBZ5      ------------------------------------------------------------
C1A5W1          ------------------------------------------------------------
A0A2V7PX99      ------------------------------------------------------------
A0A2V7ERC7      ------------------------------------------------------------
A0A5Q4D6Y4      ------------------------------------------------------------
A0A2V7JTZ5      ------------------------------------------------------------
A0A3D4YTR6      ------------------------------------------------------------
A0A5Q4DA46      ------------------------------------------------------------
A0A2V7F1M1      ------------------------------------------------------------
A0A2V7KXK7      ------------------------------------------------------------
A0A651HKD3      ------------------------------------------------------------
A0A2V7QDU7      ------------------------------------------------------------
A0A2V7ITT6      ------------------------------------------------------------
A0A2V7NJW1      HPDVGPRPGLDCEQVRHLLREIRRDARGRLARLRFRPGWRHADDSPGGAGGRAVCDLPHA
A0A2V7GFB5      ------------------------------------------------------------
A0A2V7RQ86      ------------------------------------------------------------
A0A2V7IWX2      ------------------MFNGVPFLCKRTNRGRALRGAIPLAPMHMTCAPPRPAGRLPE
A0A1Q7KE95      ------------------------------------------------------------
A0A1Q7T8X5      ------------------------------------------------------------
A0A2V7MS64      ------------------------------------------------------------
A0A2V7Q7N9      ------------------------------------------------------------
A0A2V7IRW6      ------------------------------------------------------------
A0A1Q7DVU6      ------------------------------------------------------------
A0A1Q7JSV2      ------------------------------------------------------------
A0A2V7FK98      --------------------------------------MRC-------------------
A0A2V7R3Z8      RVFVIDHQNPHPGLGFRPDGEHGRRLASLDGGGHAVMSKRCRHRGRPRFPVDPPLRRVRA
A0A2V7J3C0      ------------------------------------------------------------
A0A2V7KWV9      ------------------------------------------------------------
A0A1Q6ZHP2      ------------------------------------------------------------
A0A1Q7R6Z6      ------------------------------------------------------------
A0A2V7FYT7      ------------------------------------------------------------
A0A2V7IGR0      ------------------------------------------------------------
A0A2V7MR23      ------------------------------------------------------------
A0A2V7L1V3      ------------------------------------------------------------
A0A1Q7E5D3      ------------------------------------------------------------
A0A2V7ISE2      ------------------------------MDIGFVPARVWPPLTQGSGQSVATSQRPDS
A0A1Q7J2X5      ------------------------------------------------------------
A0A2V7NPD1      ------------------------------------------------------------
A0A2V7QPD8      -MASMADGSRPSTEGLTPSWASGMDIAVVLDFRLTPPYAGFGPTCREVAAARILRITTAK
A0A2V7Q8M6      -----------------------MDIALVLDNGRPHSYAQFGPHCRDPAAWPGLPHGFSN
A0A2V7QBC3      -----------------------------------------------------MPQRRRF
A0A2V7LMU1      -----------------------------------------------------MNSATTD
A0A2V7PBY9      -----------------------------------------------------MKWATNG
A0A3M2BLV5      ------------------------------------------------------------
A0A2V7KS68      ------------------------------------------------------------
A0A2V7N4L3      ------------------------------------------------------------
A0A1Q7AZK2      ------------------------------------------------------------
A0A1Q7TNP7      ------------------------------------------------------------
A0A1Q7KG39      ------------------------------------------------------------
A0A1Q7GX75      ------------------------------------------------------------
A0A1Q7LL80      ------------------------------------------------------------
A0A2V7PFU2      ------------------------------------------------------------
A0A2V7MFS9      ------------------------------------------------------------
A0A2V7T933      ------------------------------------------------------------
A0A2V7J4D7      ------------------------------------------------------------
A0A2V7LN90      ------------------------------------------------------------
A0A2V7LFN9      ------------------------------------------------------------
A0A2V7MEK4      ------------------------------------------------------------
A0A2V7P8B1      ------------------------------------------------------------
A0A2V7QN41      ------------------------------------------------------------
A0A2V7R603      ------------------------------------------------------------
A0A2V7LJS2      ------------------------------------------------------------
A0A1Q7GLJ7      ------------------------------------------------------------
A0A2V7GRE3      ------------------------------------------------------------
A0A2V7EU00      ------------------------------------------------------------
A0A1Q6WE01      ------------------------------------------------------------
A0A2V7S9K3      ------------------------------------------------------------
A0A1Q7DXB9      ------------------------------------------------------------
A0A1Q7JD32      ------------------------------------------------------------
A0A2V7MVP8      ------------------------------------------------------------
A0A2V7N0A9      ------------------------------------------------------------
A0A1Q7DLS9      ------------------------------------------------------------
A0A1Q7JK96      ------------------------------------------------------------
A0A2V7KQV7      ------------------------------------------------------------
A0A1Q7JGF6      ------------------------------------------------------------
A0A2V7SG67      ------------------------------------------------------------
A0A1Q7GIK9      ------------------------------------------------------------
                                                                            

A0A2D5ZJF2      ------------------------------------------------------------
A0A0S8H9P3      ------------------------------------------------------------
A0A1E4BBP7      ------------------------------------------------------------
A0A3M2G737      ------------------------------------------------------------
A0A0H4TUX7      ------------------------------------------------------------
A0A1G0LUG0      ------------------------------------------------------------
A0A1Q7E3T7      ------------------------------------------------------------
A0A1G0L906      ------------------------------------------------------------
A0A1G0LCC0      ------------------------------------------------------------
A0A2D5ZJE2      ------------------------------------------------------------
A0A3M2G624      ------------------------------------------------------------
W0RI74          ------------------------------------------------------------
A0A3M2BJA6      ------------------------------------------------------------
A0A3D4VBZ5      ------------------------------------------------------------
C1A5W1          ------------------------------------------------------------
A0A2V7PX99      ------------------------------------------------------------
A0A2V7ERC7      ------------------------------------------------------------
A0A5Q4D6Y4      ------------------------------------------------------------
A0A2V7JTZ5      ------------------------------------------------------------
A0A3D4YTR6      ------------------------------------------------------------
A0A5Q4DA46      ------------------------------------------------------------
A0A2V7F1M1      ------------------------------------------------------------
A0A2V7KXK7      ------------------------------------------------------------
A0A651HKD3      ------------------------------------------------------------
A0A2V7QDU7      ------------------------------------------------------------
A0A2V7ITT6      ------------------------------------------------------------
A0A2V7NJW1      DAESGPVRPLQLHLSGEAVKGDCCANDTGFPCVPLAQQPLQRARQVTAACVGSRADCITS
A0A2V7GFB5      ------------------------------------------------------------
A0A2V7RQ86      ------------------------------------------------------------
A0A2V7IWX2      PIALQRVAPASRREHAPARAAHVLRICGATCCAYATRRHRHAPRRRCGREAGVRSQRYRP
A0A1Q7KE95      ------------------------------------------------------------
A0A1Q7T8X5      ------------------------------------------------------------
A0A2V7MS64      ------------------------------------------------------------
A0A2V7Q7N9      ---------------------------------------------------------MQA
A0A2V7IRW6      ------------------------------------------------------------
A0A1Q7DVU6      ------------------------------------------------------------
A0A1Q7JSV2      ------------------------------------------------------------
A0A2V7FK98      --------TDLRHGDG--------------------------------VGGVPRGIG-LA
A0A2V7R3Z8      NLSRGRSGTDSPHNDGKILSSARRGGVVARTKVHPAPGCGAPICGMWTVGAPHRAVSDLP
A0A2V7J3C0      ------------------------------------------------------------
A0A2V7KWV9      ------------------------------------------------------------
A0A1Q6ZHP2      ------------------------------------------------------------
A0A1Q7R6Z6      ------------------------------------------------------------
A0A2V7FYT7      ------------------------------------------------------------
A0A2V7IGR0      ------------------------------------------------------------
A0A2V7MR23      ------------------------------------------------------------
A0A2V7L1V3      ------------------------------------------------------------
A0A1Q7E5D3      ------------------------------------------------------------
A0A2V7ISE2      QAIAAPAARRTRAPGWTVAPTCIHRLPHAAPICGMTSPAGGEGVGPCAVSDLLSSRRDAG
A0A1Q7J2X5      ------------------------------------------------------------
A0A2V7NPD1      ------------------------------------------------------------
A0A2V7QPD8      SASLAVAAGTRPAPRCIRLRE---------AVHRFAACGRCGLRAARYRTCH--------
A0A2V7Q8M6      NRS--CGAGRPRSER-TKLHPFFGC-----DCTELRHQLNRSAGRARYRTCHTLSRDETQ
A0A2V7QBC3      AAR--IGQQRPRASRATPFRPHQGASVPPGDCTELRHQSHRSAGSARYRTCHTSSANEPQ
A0A2V7LMU1      RAY--SRRHRPNAPRCIRYGAL--------IALNCGISADG-LRRRTGIGLATCSAHDTT
A0A2V7PBY9      AQE--GQRRYPSRTKVHRRDVH--------PCTQLRHGGGR-LGVARGIGLAVRRWDDTH
A0A3M2BLV5      ------------------------------------------------------------
A0A2V7KS68      ------------------------------------------------------------
A0A2V7N4L3      ------------------------------------------------------------
A0A1Q7AZK2      ------------------------------------------------------------
A0A1Q7TNP7      ------------------------------------------------------------
A0A1Q7KG39      ------------------------------------------------------------
A0A1Q7GX75      ------------------------------------------------------------
A0A1Q7LL80      ------------------------------------------------------------
A0A2V7PFU2      ------------------------------------------------------------
A0A2V7MFS9      ------------------------------------------------------------
A0A2V7T933      ------------------------------------------------------------
A0A2V7J4D7      ------------------------------------------------------------
A0A2V7LN90      ------------------------------------------------------------
A0A2V7LFN9      ------------------------------------------------------------
A0A2V7MEK4      ------------------------------------------------------------
A0A2V7P8B1      ------------------------------------------------------------
A0A2V7QN41      ------------------------------------------------------------
A0A2V7R603      ------------------------------------------------------------
A0A2V7LJS2      ------------------------------------------------------------
A0A1Q7GLJ7      ------------------------------------------------------------
A0A2V7GRE3      ------------------------------------------------------------
A0A2V7EU00      ------------------------------------------------------------
A0A1Q6WE01      ------------------------------------------------------------
A0A2V7S9K3      ------------------------------------MSLAGTSTCCRRTTAYASSPRRAV
A0A1Q7DXB9      ------------------------------------------------------------
A0A1Q7JD32      ------------------------------------------------------------
A0A2V7MVP8      ------------------------------------------------------------
A0A2V7N0A9      ------------------------------------MQMRPTAFRGRRRRPRWYRACSAA
A0A1Q7DLS9      ------------------------------------------------------------
A0A1Q7JK96      ------------------------------------------------------------
A0A2V7KQV7      ------------------------------------------------------------
A0A1Q7JGF6      ------------------------------------------------------------
A0A2V7SG67      ------------------------------------------------------------
A0A1Q7GIK9      ------------------------------------------------------------
                                                                            

A0A2D5ZJF2      ------MITTRDRATTRGTPCRTPRTIWCGPSWHPSIRHPRKVIMSRMGSQATGEGNGSQ
A0A0S8H9P3      ------------------------------------------------------------
A0A1E4BBP7      ---------------------------MSANLVPSAANAAAVPRQDGFAPMPQWGGAPSA
A0A3M2G737      ----------------------------------------MYFGRMVPSDSAPKLQAPIS
A0A0H4TUX7      ------------------------MNLRSGTWSHSLSFLSSATTWENRLDAVRRPEGTEA
A0A1G0LUG0      ------------------------------------------------------------
A0A1Q7E3T7      ------------------------------------------------------------
A0A1G0L906      ------------------------------------------------------------
A0A1G0LCC0      ------------------------------------------------------------
A0A2D5ZJE2      ------------------------------------------------------------
A0A3M2G624      -----------------------------------------------MYFGNGKNYPVEV
W0RI74          -----------------------MSANLPPLPAGSDAPLPVPAAEHALQPYDPAAYAPPA
A0A3M2BJA6      -------------------------------------------------------MEKPT
A0A3D4VBZ5      ----------------------------MSGQQIQSVTPQAVALEPYQEGTPPGDWGGGT
C1A5W1          ----------------------------MSGQQIQSVTPQAVALEPYQEGTPPGDWGGGT
A0A2V7PX99      ------------------------MSNSPSWPVERAGPEVALQPVPDRGTAAAHGRA---
A0A2V7ERC7      ---------------MPPLILPPRKSLMSVRLTPSPETPPPFTGAPYGAFPGNTGPSTGP
A0A5Q4D6Y4      ---------------------MSNLVPRDPIPGHPQGLIGGAAPHGYADQGGARGGSWPN
A0A2V7JTZ5      -----------------------------MSVRSLQPDYPLAPHHPGSIPTAEWTPARPR
A0A3D4YTR6      -------------------------MLLRTRVYPSPSDFAIAPSNAGSPSPAPYKGGPQR
A0A5Q4DA46      --------------------MSDRSLPSGDPNGSQRDLPAEYYPAPAPAPAPAGW-----
A0A2V7F1M1      -----------------------MSSQRGAQLMSELLPEPTPLRLTGPPGSLRPSRDGGG
A0A2V7KXK7      -----MRDGERHRACVAHPCMEPKEPHEMSGSNGEGTRIPVLRSESSLDTIRMKSLTTPS
A0A651HKD3      -------------------------MSDRERFDLTPHGGTGVPSEHARQSTPGVHAGDAG
A0A2V7QDU7      -------------------------------------------MSHDVTHSQGLRSPSLD
A0A2V7ITT6      -------------MACRPPPRPSPRSKDPVPSIEPPQPPPDGFPEVWSGSPFRGAQPVPS
A0A2V7NJW1      RSRRGAGRYQDCGIACRPPPRPSPRSKDPVSSIEPPQPPPDGFPEVWSGSPFRGAQPVPS
A0A2V7GFB5      ------------------MERQLPERVDPAVLG--APRPWAAEEV---------------
A0A2V7RQ86      ------------------MERQLPERVDPAVLG--APRPWVAEEV---------------
A0A2V7IWX2      CSGDPWSRDVESRAIRFALDMAHEGPSLPEPARLDAIAATPRSRAPTRYEQLPRL-----
A0A1Q7KE95      --------------------MRIAVSAYPPSNG--TPVPADQLAAPFGAGRGGRLEE---
A0A1Q7T8X5      --------------------MRIAVSAYPPSNG--TPVPADQLSAPFGAGRGGRLEE---
A0A2V7MS64      -----------------------MIGELPSP------RPENDPRTTTTVIQPHGTRPVSI
A0A2V7Q7N9      RGPPLVPTLRCWEPVNQETLRGMTTGDLPVPFE--PTRAE----------FVARNRPPP-
A0A2V7IRW6      --------------MKKSPETDMDTGDLPARLD--PVQPERLPSPAGSFDAIARYAPPAA
A0A1Q7DVU6      --------------MKESPETDMETGDLPAALD--PERPERLPSTAAPFDTIARYAPPAA
A0A1Q7JSV2      ----------------------METGDLPAALD--PERPERLPSTAAPFDTIARYAPPAA
A0A2V7FK98      TGRRDAAPTGRSPANTVEVRVPMSTSPLPFHSG--STVPAVAPAAPPPMGADMGFGQ---
A0A2V7R3Z8      QGRGDAAPPGAAPPTHVEVRFPMSTSPLPLHAG--ATVPAVAPSAAPPMAADLGFSQ---
A0A2V7J3C0      ------------------------------------------------------------
A0A2V7KWV9      ------------------------MTDLPSAPRSQLPARPALSSIDLAA-----------
A0A1Q6ZHP2      ----------------------MTISNLPAPLG---PAPMAAPGMPQRG--ISVFD----
A0A1Q7R6Z6      ----------------------MTISNLPAPLG---PAPMAAPGMPQRG--ISVFD----
A0A2V7FYT7      ----------------------MTISNLPAPLG---PAPMAAPGMPQRG--ISVFD----
A0A2V7IGR0      ----------------------MTNSDNHAALARLPPSSDAGAALQPAA--LSLVEP---
A0A2V7MR23      ----------------------MTISNLPAA-L--VPPAATPPALPQRG--VSPF-----
A0A2V7L1V3      ----------------------MTMSHLPLPPG--STPPVMVPPSAPPA--TTGW-----
A0A1Q7E5D3      ----------------------MTTSNL-LAPL--APPPAVAPVAPSCA--VAES-----
A0A2V7ISE2      ARHDAARPARRNRPYRSIGNGSMAFSNLPAAPL--VPPPVVAPGTPHRG--MTEF-----
A0A1Q7J2X5      ----------------------MTLSNLPAAPL--VSPPVVAPGTSHRG--VTEF-----
A0A2V7NPD1      ----------------------MAFSNLPAAPL--VPPPVVAPGTPHRG--MTEF-----
A0A2V7QPD8      -GKTRRRATRRGPANTVEVRFPMSTSPLPLHAG--STVPAVAPAAPLPTGADMGFGQ---
A0A2V7Q8M6      FSEASPRATPRGTRS-------MSMSHLPLPPG--STAPVMVPPSPPPP--TAGW-----
A0A2V7QBC3      FSEATPSATWRGTRS-------MTMSHLPLPPG--STSPVMVPPSPPPP--TTEW-----
A0A2V7LMU1      LCGATPRATRRGTPS-------MTLSHLPLPPS--SPPPVIVPPSSKSL--STEW-----
A0A2V7PBY9      RAPLRRALPTRGLPS-------MSISRLPIPHG--APPPAAAPPPAPPAVPGTYA-----
A0A3M2BLV5      --------------------------------------------------MDRQPDLRPP
A0A2V7KS68      -------------------MLIRHMMTSRHLPALRSDTASPARAERASVSTRALRPE--A
A0A2V7N4L3      -------------------------MTPSPFPLIRNQPTGSVASAAPPPSSAGLRRGSPE
A0A1Q7AZK2      ------------------------------------------------------------
A0A1Q7TNP7      ------------------------------------------------------------
A0A1Q7KG39      ------------------------------------------------------------
A0A1Q7GX75      -----------------------------------------------------------M
A0A1Q7LL80      -----------------------------------------------------------M
A0A2V7PFU2      -------------------------MNPRPLPAIRSQSA-PVLRRANASAA--------P
A0A2V7MFS9      -------------------------MNPLPLPAVRGQTAAPALRRASPPHT--------P
A0A2V7T933      -------------------------MTPRPLPAIRGQSAPAVLRRGGTSDR--------T
A0A2V7J4D7      --------------------------------MMPGESIARFRSTA----------PTVA
A0A2V7LN90      --------------------------------MTTGDLPVPFEPVRTE---VVARYPPPP
A0A2V7LFN9      --------------------------------MTTGSLPARLDTPKAEDRNAVAR-PAPA
A0A2V7MEK4      --------------------------------MTTGSLPARLDTPKAADRNAVAR-PAPA
A0A2V7P8B1      --------------------------------------MTRVTEPLPSDSRAASGPFAER
A0A2V7QN41      -------------------------------MSRERSRLPEVASVDGTWLRAPAPSTADV
A0A2V7R603      ----------MRRSVASPAAPRYPPCSADLAMSRERSRLPEVASVEGAWMRAPALPAGDV
A0A2V7LJS2      -----------------------------------------MSQPHPNDARAASDSVADR
A0A1Q7GLJ7      -----------------------------------------MSEQLRSEPPAPSRRLADR
A0A2V7GRE3      -----------------------------------------MVEP--SNRPAASSFHGDR
A0A2V7EU00      ---------------------------------------------MQPYGAPA-------
A0A1Q6WE01      --------------------------MTEYLPGVA----ASPLVREAPLPVPARVTTAPD
A0A2V7S9K3      RQRPAVGRGSPRPGAAGGIGLAVGNRVPELLPSGA----APQLTHAVPLVAPAGNGLRLD
A0A1Q7DXB9      ----------------------MAHEGPSLPESAR----LEAIAATPRPRAPTRYDQPP-
A0A1Q7JD32      ----------------------MAHEGPSLPESAR----LEAIAATPRPRAPTRYDQPP-
A0A2V7MVP8      ----------------------MAQDPLLIPESAR----VDEVAPLLERRPARPYAEPP-
A0A2V7N0A9      LVPNAGPEPAPRPSPGKFETHTMPSQLTVPPQEGTPDRRL---GAAAAAAGPVRRSEAA-
A0A1Q7DLS9      ------------------MFNDLPELPPSSPETPG----------RATVPAPARRRSPP-
A0A1Q7JK96      ------------------MFNDLPELPPSSPETPG----------RATVPAPARRRSPP-
A0A2V7KQV7      ----------------------MASDATLPPNQPA--------------LVPFQTGFQA-
A0A1Q7JGF6      ----------------------MPSDPTADPEQSAPDRRLVLAAATAARLAPRRDEAPP-
A0A2V7SG67      ----------------------MPSDPTADPEQSAPDRRLVLAAATAARLAPRRDEAPP-
A0A1Q7GIK9      -------------------------------------------MVTSTLVVPARPKGPSV
                                                                            

A0A2D5ZJF2      AAPAGLSPEITPPGLLEILWRRRWIVTLV--TLASIVGAFIYLMKATPIYTSTSRIYVE-
A0A0S8H9P3      ---MGRYERTHLEDYWRVVRRRAWLILLT-ALVALLAATWAA-SRRPRLYRATLTLQVGD
A0A1E4BBP7      PPPSQGGVGDQLARTLAAIKRYKWLVLAV-IAVGSTAG-VTLTRFVKPKYDVSASIWIAA
A0A3M2G737      TSNGAYHSENPIHEYFQIIVRGRWIILVVFTLVMAATMIYVLRNKPRLVYSTTATIALKN
A0A0H4TUX7      LRRIVHQREVHLRDLVGVVSRH-WRLVAL-LTVLVAGGAWYSARRQVPRYQSRLTVQVSS
A0A1G0LUG0      ----MHQREVHLRDLVAVVTRH-WRLVAA-VTAVLVGFSWYNGRNQVARYQSQLTVQISS
A0A1Q7E3T7      -------MRVNLRDPLAVVRRHLWLVLGMTAVVGGIVGYRA--YAAVPSYRAIAVIRLSD
A0A1G0L906      ----------MHLRDLAQVLFSHWKVVVFLTVLVVFSTSYAS-RKAVPRYQSSATVQVSS
A0A1G0LCC0      ----------MHLRDLAQVLFSHWKVVVFLTALVVFSTSYAS-RKAVPRYQSSATVQVSS
A0A2D5ZJE2      -MDEHQAHGVTLADYVRIIWSRKWMVGLV--ATAVLAFTIFFTLRMQPVYESQTTLLIEP
A0A3M2G624      TTSSYLEADFDVRKYVRMLWRRRYIVLLLFVLIFGFSTYRALTQKVTPVYRSTVYLEVDE
W0RI74          APADEAGGALSVGRFMAAMSRYKWLVAAL-VVLGLGGGFVAT-RFIDPEYEVNATIFSSG
A0A3M2BJA6      FEGGYVDDEISLRDIWNLLRRNQWLIFLC-VLLVTGGA-AAYSYFAVPVYESATTIRIEE
A0A3D4VBZ5      AEGAPEPKGPSLRRYLAAVNRFKWLVLVF-AILGGAGG-YAATRFIEPEYEVQATILLEQ
C1A5W1          AEGAPEPKGPSLRRYLAAVNRFKWLVLVF-AILGGAGG-YAATRFIEPEYEVQATILLEQ
A0A2V7PX99      -YEPPTPEPSDWQRMLAAAMRRRWLVILV-TLAGTAAGVIGS-RFLDPRFAARAVLWIEA
A0A2V7ERC7      AVVLQESEGVQWGRYFDVLKRHALLIVLL-VAVGTVWGLNAA-RQVRPDYETQATIWING
A0A5Q4D6Y4      GQPPPPNDSIELSELLQILRRRIWLILAC-VLVGGALA-WGVHEIREPRYRATAVIQIED
A0A2V7JTZ5      SEDFEDAEGIPWSRYVDAIRRHVLLIVGL-AAVGSVLGVVAA-RRVRPIYEAQATVWIST
A0A3D4YTR6      MDGPSDSEGIPWSRYIDAISRHSLLILAI-ALLGSLVGLYAA-RQVRLSYDADATIWINT
A0A5Q4DA46      -GGDEEEQGLDWRRYVAAIVRNKWLVLAG-LVVGLGAGFLVR-QVTSPVYSVSSTVLLES
A0A2V7F1M1      RSADSAEIRTDFKQLLMLLRRRIGLVAGI-AALIVFVVALFV-VLERPVYRSTATVRLAY
A0A2V7KXK7      APPPPPAEHSDWQRYFNSVMRHKWFVIVV-TLVGTALGIVAT-RFLDPRYTAKAILWVDV
A0A651HKD3      HGEGEEPGGLDFRKLPSTLLRYKWLVLAS-VVLGALAA-SASMALTPPRYTVSALIHTPN
A0A2V7QDU7      GAPAGFLPGAGAAELVDILRRRLWSILGC-TVLCVGAAVLYV-VLARPSYRAEAAIRMDD
A0A2V7ITT6      AFRPEHDGVHDWQQYRGAVARYKWVVVLV-STVGTLIG-VAATRFLRPEYEVQATIWIES
A0A2V7NJW1      AFRPENDGVHDWQQYRGAVARYKWVVVLV-STVGTLIG-VAATRFLRPEYEVQATIWIES
A0A2V7GFB5      -ATTSPEGALDWRRIAQVVTRFKWLVFGI-TVAGGAAG-FAATKVVRPQYLTQVTVFIDQ
A0A2V7RQ86      -ATTSPEGALDWRRIAQVVTRFKWLVFGI-TVAGGAAG-FAATKVVRPQYLTQVTVFIDQ
A0A2V7IWX2      ----LPAAEPDWRRILGAIGRRRWVVLAV-TLLGTAAGVVAAAKFVGPRYLARARLWVGA
A0A1Q7KE95      -SGAGLVQPTDWRRHGATALRYRWWILGL-AALGTLGG-TAAGRLLPPRYQVQATIWIQS
A0A1Q7T8X5      -SGAGLVQPTDWRRHGATALRYRWWILGL-AALGTLGG-TAAGRLLPPRYQVQATIWIQS
A0A2V7MS64      ASAQEPPPLAQWPRYVSAALRYKWLVVGA-TLVATAAG-VGASFLLAPEYVARATVWISI
A0A2V7Q7N9      -PPPDPEPLAEWQRYLLAARRYRWLVFGV-TLLGTAAG-IGLSLLLPPTYLARATVWVQV
A0A2V7IRW6      GAPQDGDVLADLRRYLSAVWRYKWAVTGI-TVLGTAAG-VAGKMLLPPNYVARATVWIQV
A0A1Q7DVU6      GAPRDADALAELRRYLSAVWRYKWAVAGV-TVLGTAAG-VAGKMLLAPSYVARATVWIQV
A0A1Q7JSV2      GAPRDADALAELRRYLSAVWRYKWAVAGV-TVLGTAAG-VAGKMLLAPSYVARATVWIQV
A0A2V7FK98      -GFAQPETGVDWRRVLSAVARFKWLIAVV-TIVGTVGG-LAATRFIKPQYMVQATLWIDQ
A0A2V7R3Z8      -GFAQPETGVDWRRVLSAVARFKWLIAVV-TIVGTVGG-LAATRFIKPQYMVQATLWIDQ
A0A2V7J3C0      ------------------TRRYRWWVLAL-TGVGILGG-ILAGRLLPPRYQVQATIWIQS
A0A2V7KWV9      ----DSGGAPDWRRHGTAVWRHRWWILGL-TVLGTIGG-VGASRVLPPRYLVQATIWIQS
A0A1Q6ZHP2      --LDGRESGVDWRRILSALLRFKWLIATT-TLVGTIAG-VGATRFLKPQYSAQAKIWIDV
A0A1Q7R6Z6      --LDGRESGVDWRRILSALLRFKWLIATT-TLVGTIAG-VGATRFLKPQYSAQAKIWIDV
A0A2V7FYT7      --LDGRESGVDWRRILSALLRFKWLIATT-TLVGTIAG-VGATRFLKPQYSAQAKIWIDV
A0A2V7IGR0      -GFSEVEGALDWRRVWSAVVRFKWLILAV-TLLGVAAG-GAATRFLKPQYLVQATIWIDQ
A0A2V7MR23      -DLDGPEGGLDWRRILSALLRFKWLIATF-TLVGTVAG-VGATRFIKPVYSAQAKIWIDV
A0A2V7L1V3      -GGPESEGGVDWRRVYSAVMRFKWLICAV-TVLGTVAG-FGLARFVRPQYGAQATIWIDA
A0A1Q7E5D3      -GFPGLDDGLDWRRVLSALLRFKWLIAAV-TLAGTAAG-VGATRFLTPEYVAQATVWIDG
A0A2V7ISE2      -DLAGSDSGLDWRRILSALLRFKWLIAGF-TLVGTVAG-VGATRFLKPEYAAQAKIWIDV
A0A1Q7J2X5      -DLAGSDSGLDWRRILSALLRFKWLIAGF-TLVGTAAG-FGATRFLKPEYSAQAKIWIDV
A0A2V7NPD1      -DLAGSDSGLDWRRILSALLRFKWLIAGF-TLVGTVAG-VGATRFLKPEYAAQAKIWIDV
A0A2V7QPD8      -GFAAPETGVDWRRVLSAVLRFKWLIAVV-TIVGTVGG-VAATRFIKPQYMVQATLWIDQ
A0A2V7Q8M6      -GGADSEGGVDWRRVFSAVLRFKWLICAV-TVLGTTAG-FGVARFVRPQYGAQATIWIDA
A0A2V7QBC3      -GGADSEGGVDWRRVFSAVLRFKWLICGV-TVLGTTAG-FGVARFVRPQYGAQSTIWIDA
A0A2V7LMU1      -GGAESEGGVDWRRVLSAVLRFKWLICGV-TILGTAAG-FGVARFVRPQYGAQATIWIDA
A0A2V7PBY9      -GFAEPEGGVDWRRVVSAVMRFKWLICGV-TFLGTLAG-FGAARFVKPQYGAQATIWIDA
A0A3M2BLV5      LDSELLSASPHLSDYIQVVTRRLWLVLLI-FAVTTASAIWAV-SRQKTLWRSEMAVQVTD
A0A2V7KS68      AAFPDDEHGPDWRRVGSALLRFKWLVLAA-LLAGLAAAFGAT-KVLRPAYKAQANVWVDV
A0A2V7N4L3      GPPEGHEAGPDWHRIASALLRFKWVVILA-VLLGLGAAFAAT-RVLRPVYRAQANVWVDV
A0A1Q7AZK2      -----------------MLLRFKWVVILM-LALGLGAGFAAT-RVLRPVYRAQANVWVDV
A0A1Q7TNP7      -----------------MLLRFKWVVILM-LALGLGAGFAAT-RVLRPVYRAQANVWVDV
A0A1Q7KG39      -----------------MLLRFKWVVILM-LALGLGAGFAAT-RVLRPVYRAQANVWVDV
A0A1Q7GX75      AGLDDEESGLDWRRIVSALLRFKWLVLLA-VALGLGGGFAAT-RKLPPVYSAQANVWVDV
A0A1Q7LL80      AGLDDEESGLDWRRIVSALLRFKWLVLLA-VALGLGGGFAAT-RKLPPVYSAQANVWVDV
A0A2V7PFU2      SLPE-AESGPDWRRLASALLRFKWIVLLM-VLLGLGGAVAAT-RLLRPIYRAQANVWVDV
A0A2V7MFS9      SLPDGGEPGPDWRRIASALLRFKWLLVLT-LTMGIGAAFAAI-RLLRPVYRAQANVWVDV
A0A2V7T933      SLPE-EEAAPDWRRIGSVLLRFKWVVILM-LALGLGAGFAAT-RVLRPVYRAQANVWVDV
A0A2V7J4D7      GPFEDPNPPPDWWRYVAAIRRFKWLVLGV-TVGATALGVVGTMF-LRPTYAAQATLWIQV
A0A2V7LN90      LRPDS-EPLAEWRRYLMAARRYRWMVLGV-TLFGTAAGVGLSLL-LPPTYLARATVWIQV
A0A2V7LFN9      LPPDAGDWLADAQRYLRSVRRHKWLVLSL-TLFATAAGIELSVYALPPNYAARATVWIQV
A0A2V7MEK4      LPPDAGDWLADAQRYLRSVRRHKWLVLSL-TLFATAAGIELSVYALPPNYAARATVWIQV
A0A2V7P8B1      EEVEASASTVRLEDLFATVRRHIWLVLGV-AAGVVAAAGGVA-YVTGSVYRAVAVIRLSD
A0A2V7QN41      ASRTGPPGETDWQHYFGAVRRRKWTVIGV-TLLGTALGLFAS-RLLHPPYSATALLWFET
A0A2V7R603      VSRAGAPGETDWQHYIGAVRRRKWTVIAI-TLLGTALGLFAS-RLLHPPYSATALLWFET
A0A2V7LJS2      GELDAPVSTVRLDDLFAVLRRHIRLVLGV-TAAAMMAAGYVA-YVTGSVYRAVAVIRLSD
A0A1Q7GLJ7      ADPEAFVHTVGLEELLSTLRRHVWLVLGV-AAVAVAATGFVA-YTTGPVYRAVAVIRLSD
A0A2V7GRE3      -EPEVSVRTVRLEELLAILRRHVRLVVGV-VVATVTAAGVVA-YVTGPAYRAVAVIRMSD
A0A2V7EU00      ---TPDDAAVDWRRYWAAIVRYRWWVVLC-TALGLVGGFVAA-SVLKPQYRAQATVWIDV
A0A1Q6WE01      PVASPFEQGVDWRRCWGAVRRHRWWILGC-AVLGTAGGVVGA-RMRPPRYQAQATIWIQA
A0A2V7S9K3      PLAAAGEPFLDWRRSWAAALRYRWWVVGF-MGLGVLGGLAAS-RFLPPRYLAQATIWIQT
A0A1Q7DXB9      --RLLPAVEPDWRRIFGAIRRRRWVVLGV-TLLGTVAGVVAAAKFVGPRYLARARLWVGA
A0A1Q7JD32      --RLLPAVEPDWRRIFGAIRRRRWVVLGV-TLLGTVAGVVAAAKFVGPRYLARARLWVGA
A0A2V7MVP8      --RPLAAGEPDWHRILGAIRRRRWLVLAV-TLLGTAAGVVAAVRFVGPRYLARARLWVGA
A0A2V7N0A9      ------PLPDDWRRVVAAIGTYRWFVVAV-TAAGTLVGAVAA-HFLKPTYQARATVWVEV
A0A1Q7DLS9      --MVEAAPDVDWGRYRTAIWRFRWWVLLI-TLLGTAAGVGAS-RIVRPVYVARATIWIEG
A0A1Q7JK96      --MVEAAPDVDWGRYRTAIWRFRWWVLLI-TLLGTAAGVGAS-RIVRPVYVARATIWIEG
A0A2V7KQV7      --AAAPAPMSDWARVFAAARRYKMLVATV-TVVGSLAGLVIG-KFLKPVYQAQATIWIQS
A0A1Q7JGF6      --------PEDWRRVVTAIRTYRWLVIAV-TGVGTLAGIIGA-RFLKPTYQARATVWLEI
A0A2V7SG67      --------PEDWRRVVTAIRTYRWLVIAV-TGVGTLAGIIGA-RFLKPTYQARATVWLEI
A0A1Q7GIK9      YPAVVPAGPDDWRRVFAAMRTSRWLILAV-TAVGTLAGIVGS-RFLKPTYEARATVWLEI
                                         :                       :     :    

A0A2D5ZJF2      ---------------QSG--PKVITEFEGVMTQSKNYLYTQ---AEIFLSTEVLRPVAEA
A0A0S8H9P3      PRGRMG---------QLGDIDVTP---------NMLWTDPVESEVQQLTTQAVAQYVADT
A0A1E4BBP7      TPGPSG---------RMG--PVSA---PGLVNSDVAW-------MELARSFSVLDKVVSK
A0A3M2G737      KSGNLNPY------------PVYR----DPAKINNE--------LVILKSRRLAETIADS
A0A0H4TUX7      PKQVFAQL----EGMRVDELALQT----DPVLSE----------ALILTTQQLALEVVRG
A0A1G0LUG0      PRGVFSQL----NDRTVDELALQT----DPVLSE----------ALVLTTQALALQVVDA
A0A1Q7E3T7      PRRALTGGVADGPTGDLA--GSSA----DPLLSQ----------VELLTSRRVGGVVVDS
A0A1G0L906      K--------------KQALTPLEAMRVDEMSMQTDPVLSE----ALVLSTQALALRVVDA
A0A1G0LCC0      K--------------KQALTPLEAMRVDEMSMQTDPVLSE----ALVLSTQALALRVVDA
A0A2D5ZJE2      QDAGALSIFDPTGFMKQKILINNE--------------------CELLRSRSLAQQVL--
A0A3M2G624      KETNIRLL------------PQFS----SVRQQSIYWGSPEGKIIAEVLSTSVIEEVVQM
W0RI74          SGNEKPS-------------MINP----AQLTGNAGW-------RDLFQSFAIIDPVVQK
A0A3M2BJA6      ERANLPVL------------DILQELSSGSQVETE---------MEVLRSRTLAEDVVDS
A0A3D4VBZ5      GTGVNNGA-------GRG--PIQA----AELLQASGW-------QDLLRSYAIADPVVIG
C1A5W1          GTGVNNGA-------GRG--PIQA----AELLQASGW-------QDLLRSYAIADPVVIG
A0A2V7PX99      AGRAPGR--------DGG--SIVD----EALVQTPSW-------GELVTSGAVLEDVVRE
A0A2V7ERC7      ARGQ-----------QAG--SIGT----QQLLEQTSW-------VELLRSFAVVDAVVHQ
A0A5Q4D6Y4      PRTQMSERLGSVDPARSGADPIRS------------S-------LEVLRSRTVLAQIVDE
A0A2V7JTZ5      TPSSA--L-------QTG--PIRQ----QQLLTTGSW-------VELLRSFAIVDPIVRD
A0A3D4YTR6      TPNGTQQT-------QTG--PIRQ----PQLLTSVSW-------VELLRSFAVVDPVVRD
A0A5Q4DA46      TDRGTAGD----AA------PIRP----SQLLTNTGW-------MDLLRSYIVLDPVVDN
A0A2V7F1M1      PRRALTV--------GVEDLPAKD----QRSDPLLSL-------IELLRGRGIVGAVVDS
A0A2V7KXK7      AVGR-----------DRG---VQS----DQLLDSRGW-------EELVVSNAVLDTVVKE
A0A651HKD3      G--------------QTGVTAIET----GQRQSSLNW-------QNLLPSFSVVEPVVRE
A0A2V7QDU7      ---------------RRQPIPTLDVLALYRGNELSTE-------IEMLGSRTLAEDVVAA
A0A2V7ITT6      HDPRTE---------DRG--PIRG----DQLLQASSW-------LQLLRSYVVLDHVVRD
A0A2V7NJW1      HDPRTE---------DRG--PIRG----DQLLQASSW-------LQLLRSYVVLDHVVRD
A0A2V7GFB5      PDP----R----GN-DRG-GPIRS----GQVLDPESW-------IDLLRSYAVLDRVARD
A0A2V7RQ86      PDP----R----GN-DRG-GPIRS----GQVLDPESW-------IDLLRSYAVLDRVARD
A0A2V7IWX2      AEPNPNAL----RG-TTP--PPGA----ERLLGVAAW-------VDFVRSDAVLDTVVRD
A0A1Q7KE95      SEPR---G----GT-SRG--PIGA----NQLFESYAW-------GELLKSYVVLDEVARE
A0A1Q7T8X5      SEPR---G----GT-SRG--PIGA----NQLFESYAW-------GELLKSYVVLDEVARE
A0A2V7MS64      S---AHPA----PR-DQG--PIWS----GQLPISTGW-------TDLLRTNVVLEEVVRA
A0A2V7Q7N9      PSGHARDA-----R-DRG--PIWQ----GQLPISSGW-------MDLLQTNVVLEDVVRR
A0A2V7IRW6      P---ARPT-----R-DEG--PIWS----GQLPISSGW-------TDLLHTNVVLEEVVRQ
A0A1Q7DVU6      P---QRPT-----R-DEG--PIWS----GQLPISSGW-------TDLLQTNVVLEDVVRQ
A0A1Q7JSV2      P---QRPT-----R-DEG--PIWS----GQLPISSGW-------TDLLQTNVVLEDVVRQ
A0A2V7FK98      PDQR---G----GQ-DRG--PIRA----GQPLEPEAW-------LDLLKSYRVLDQVVRD
A0A2V7R3Z8      PDQR---G----GQ-ERG--PIRA----GQPLEPEAW-------LDLLKSYRVLDQVVRD
A0A2V7J3C0      SEP----R----GT-GRG--PIGA----NQLFESYAW-------VDLLKSYVVLDQVARD
A0A2V7KWV9      SEAR---G----TP-DRG--PIGA----NQLLAPTAW-------GDLLKSYVVLDAVARE
A0A1Q6ZHP2      EGR----R----GP-ERGPTPIRS----GQLLDAESW-------VDLLESYVVLDQVVRD
A0A1Q7R6Z6      EGR----R----GP-ERGPTPIRS----GQLLDAESW-------VDLLESYVVLDQVVRD
A0A2V7FYT7      EGR----R----GP-ERGPTPIRS----GQLLDAESW-------VDLLESYVVLDQVVRD
A0A2V7IGR0      ADR----R----GP-DRGPTPIRS----GQLLEPEAW-------VDLLRSYIVLDQVVRE
A0A2V7MR23      EGR----R----SP-DRSLAPIRP----GQLLDAESW-------VDLLRSYVVLDQVVHD
A0A2V7L1V3      TERERWGQ----AQ-DRG--PIRQ----GQLLDPQSW-------VDLLKSYVVLDTVVRD
A0A1Q7E5D3      PDR----R----GP-DRG--PIRP----GQLLDPEAW-------VELLKSYVVLDEVVRE
A0A2V7ISE2      EGR----R----GP-DRGPAPIRP----SQLLDAESW-------VDLLKSYVVLDQVVRD
A0A1Q7J2X5      EGR----R----GP-DRGPAPIRP----GQLLDAESW-------VDLLKSYVVLDQVVRD
A0A2V7NPD1      EGR----R----GP-DRGPAPIRP----SQLLDAESW-------VDLLKSYVVLDQVVRD
A0A2V7QPD8      PDQR---G----GQ-ERG--PIRS----GQALEPEAW-------LDLLKSYRVLDQVVRD
A0A2V7Q8M6      TESERWGQ----GQ-DRG--PIRQ----GQLLDPQAW-------VDLLKSYVVLDQVVRD
A0A2V7QBC3      TESERWGQ----GQ-DRG--PIRQ----GQLLDPQAW-------VDLLKSYVVLDQVVRD
A0A2V7LMU1      TERERWGQ----GQ-DRG--PIRQ----GQLLDPQAW-------VDLLKSYVVLDQVVRD
A0A2V7PBY9      SERER--R----AD-DRG--PIRQ----GQLLDAQAW-------VDLLKSYVVLDQVARD
A0A3M2BLV5      PLERARS--------LTS--PTRVSGMDIFVDPMQSQ-------IEVLQSRSIAERVADE
A0A2V7KS68      PGRAEGDR----SADNRG--PIRT----AALLEADDW-------IELLRSYIVLDQVVRD
A0A2V7N4L3      PDR-RGEN----PSDARG--PIRQ----GALLDADAW-------VELMRSYVVLDQVVKD
A0A1Q7AZK2      PDR-RGNG----SSDARG--PIRQ----GALLDADAW-------VELLRSYVVLDQVVRD
A0A1Q7TNP7      PDR-RGNG----SSDARG--PIRQ----GALLDADAW-------VELLRSYVVLDQVVRD
A0A1Q7KG39      PDR-RGNG----SSDARG--PIRQ----GALLDADAW-------VELLRSYVVLDQVVRD
A0A1Q7GX75      LDR-RGEG----GAEARG--PIQQ----RALLDEDAW-------VELLRSYIVLDQVVRD
A0A1Q7LL80      LDR-RGEG----GAEARG--PIQQ----RALLDEDAW-------VELLRSYIVLDQVVRD
A0A2V7PFU2      PDR-RGDP----HADTRG--PIRQ----GALLDADAW-------VELLRSYVVMDQVVRD
A0A2V7MFS9      PDR-RGEG----PSDARG--PIRQ----GALLDADAW-------VELLRSYIVLDQVVRD
A0A2V7T933      PDR-RGNG----SSDARG--PIRQ----GALLDADAW-------VELLRSYVVLDQVVRD
A0A2V7J4D7      PARQP-------R--EAG--PIWQ----AQLPISTGW-------MDLLQSYAVLDDVVRG
A0A2V7LN90      PSARARDI----R--DRG--PIWQ----GQLPITSGW-------MDLLQTNVVLEDVVRR
A0A2V7LFN9      PAHQA-------R--DEG--PIWS----GHLPISSGW-------IDLIRTNIVLEEVARR
A0A2V7MEK4      PAHQA-------R--DEG--PIWS----GHLPISSGW-------IDLIRTNIVLEEVARR
A0A2V7P8B1      PRRAFTGG----VVEDPA--LLADGRYADPLLSQ----------VELLKSRTVAGGVVDS
A0A2V7QN41      KDRAAAA-------RDPR--TASE---ADELLNPSGW-------IDLVESNAVLEEVVRQ
A0A2V7R603      KDRAAAG-------RDPR--TASE---ADELLNPSGW-------IDLVESNAVLEEVVRQ
A0A2V7LJS2      PRRAFTGG----VVDDPA--LLADGRYADPLLSQ----------VELLKSRTVAGGVVDS
A0A1Q7GLJ7      PRRALTGG----VVEDPG--PSADERFADPLLSQ----------VELLTSGTVAGAVVDS
A0A2V7GRE3      ARRALTGG----VVLDPA---RADERFSDPLLSQ----------AELLTSRAVAGAVVDS
A0A2V7EU00      AKERQDA--------TRG--PIRQ---GQLLE-ATAW-------VDLLQSYAVLDDVVRQ
A0A1Q6WE01      GEPR-GP--------DRG--PIGA---NRLLD-ASAW-------VDLLKSYVVLDDVVRD
A0A2V7S9K3      SEPR-AT--------DRG--PIGA---NQLLE-ASAW-------VDLLKSYVVLDDVVRE
A0A1Q7DXB9      AEPDPNAI----R--GTT--PAPG---AERLLGVEAW-------VDFVRSDAVLDTVVRE
A0A1Q7JD32      AEPDPNAI----R--GTT--PAPG---AERLLGVEAW-------VDFVRSDAVLDTVVRE
A0A2V7MVP8      AEPDPNAL----R--GTT--PLPG---TDRLLGVEAW-------VDFVRSDAVLDTVVRD
A0A2V7N0A9      PNPAARER-------DQG--PIET---GQLLGTATSW-------LDLLRSHVVLDDVVRQ
A0A1Q7DLS9      ANEKQP---------GPG--PAGS---GDLLG-ATGW-------VDLVRSYVVVAAVVND
A0A1Q7JK96      ANEKQP---------GPG--PAGS---GDLLG-ATGW-------VDLVRSYVVVAAVVND
A0A2V7KQV7      SEQD-HDR----GRADQG--PIQS---AQLLGTSGGW-------LDLIRSHVVLNDVVRE
A0A1Q7JGF6      PDQSAHER-------DQG--PFQS---GQLLGTATGW-------LDLLRSHVVLDDVVRQ
A0A2V7SG67      PDQSAHER-------DQG--PFQS---GQLLGTATGW-------LDLLRSHVVLDDVVRQ
A0A1Q7GIK9      PDEASHAR-------ERG--PIES---GELFPTATGW-------LDLLRSHVVLDDVVRR
                                                                    :   :   

A0A2D5ZJF2      A----------------------EDAKTRILSSRTRATKGSTTSVAEESVQEVGQPEQGA
A0A0S8H9P3      L--QLRARS--------------PDISRDLLLSGVRID--R-EAPSGDYRIRVGSDGSV-
A0A1E4BBP7      L--ALYVYP--------------DVAADTLVVRDLYPS--D-SLQPGPYRLTIQGSSYV-
A0A3M2G737      LLKRVYIDP--------------ETKNEKLHIIHRRVE----------------------
A0A0H4TUX7      L--ALHLEL------------DDPGLRRGDLFAAVAVD--S-TTPPGAYRLTVQPTSGF-
A0A1G0LUG0      L--QLQVEL------------TDPRLRRDDVIAAIAVD--S-SSTPGRFALVRRGPDGY-
A0A1Q7E3T7      M--LMLRVR--------------ARNFPTSILAVVQLP--S-DVGGDSLRLEFNRDSLT-
A0A1G0L906      I--GLRLAM------------DDWRLSRTTFLYDAQVD--T-LARPDSFVLELKGTGYQ-
A0A1G0LCC0      I--GLRLAM------------DDWRLSRTTFLYDAQVD--T-LARPDSFVLELKGTGYQ-
A0A2D5ZJE2      ----------------------------------------D-------------------
A0A3M2G624      L--DLDKAV--------------HSISPNLSFSMTNIQ--SHNAPLGTYRVHILDNQHY-
W0RI74          L--SLYIQP--------------AKASDSLLFATFQIDPVKKQFRPGTYTLKTERGRFS-
A0A3M2BJA6      L--NLQVEI------------IEPRGVSRAVLLDRLVA--E-RWAPEG-EFLIEPGGDA-
A0A3D4VBZ5      L--GLFVTP--------------AVVADSVLFRTFRVD--QSRLRPGDYKLTIAGERYVL
C1A5W1          L--GLFVTP--------------AVVADSVLFRTFRVD--QSRLRPGDYKLTIAGERYVL
A0A2V7PX99      L--RLYVTP--------------KSPADAPVFAGFGLG--K-MVRPGRYELVVDRGAR--
A0A2V7ERC7      L--KLNVVY--------------KVPGDSLLFRTFQTG--T-TPFYGSYVLQIDRSGRG-
A0A5Q4D6Y4      E--GLRLIG-------------LHANAAQQALQEVTVE--A-FALDDTLTLEFSSTGLG-
A0A2V7JTZ5      L--KLNVSY--------------KQPSDSVLFRNFEWT--P-ATRSGAYLLKIDGAGPK-
A0A3D4YTR6      L--KLNVSY---------------TPADSALYANFVWT--P-ATRSGAYALKIDEHGRS-
A0A5Q4DA46      L--RLYVTP--------------ADPAHAPLFEDFSVG--N-EVFSASYEIGRDASGGD-
A0A2V7F1M1      L--ALRLQPLGSRFGG-------SSRVVRAALRDVRVS--P-GAQQDTLRLT--------
A0A2V7KXK7      R--RLFIHP--------------ETPQDSAALTTFDIT--D-RVAPGDYRVVVDKAGRA-
A0A651HKD3      L--RLYIEP--------------REPEDAELFEEVELA--G-DVVPGRYRLQVDSSGRT-
A0A2V7QDU7      L--GLQLEI-----------TKPRAVLREEVFASVRVT--R-DAPAATYRLEPADSDG--
A0A2V7ITT6      L--RLYVTP--------------ALPADSDLFQSFEVA--A-PFRPGAYRLAVDESGRA-
A0A2V7NJW1      L--RLYVTP--------------ALPADSDLFQSFEVA--A-PFRPGAYRLAVDESGRA-
A0A2V7GFB5      L--RLFLQL--------------PKGPD-PALRSLNVA--D-QFRPGAYRLTTD-AARA-
A0A2V7RQ86      L--RLFLQL--------------PKGPD-PALRSLNVA--D-QFRPGAYRLTTD-AARA-
A0A2V7IWX2      V--RLYLDP--------------RTPLDGTALLRFGLK--D-QVLPGRYRLEVDRDGAG-
A0A1Q7KE95      R--RLYLAP--------------Q-HGWAGAFAGFTVS--D-TYRPGRYRVVVDGTGRN-
A0A1Q7T8X5      R--RLYLAP--------------Q-HGWAGAFAGFTVS--D-TYRPGRYRVVVDGTGRN-
A0A2V7MS64      R--QLYLTP--------------KEPADSDLFSGFRAA--D-RIRPGRYYLVIDATGHR-
A0A2V7Q7N9      Q--RLYVTA--------------RRPGDSDALATFEIK--D-RVRPGVYRLVVDTAGNT-
A0A2V7IRW6      Q--RLYVAP--------------QEPRDSDALAGFGIK--D-RVRGGTYRLVVNDGGTA-
A0A1Q7DVU6      Q--RLYVTP--------------KEPGDADALTGFGIK--D-RVRGGTYRLVVNDAGTA-
A0A1Q7JSV2      Q--RLYVTP--------------KEPGDADALTGFGIK--D-RVRGGTYRLVVNDAGTA-
A0A2V7FK98      Q--RLFLTP--------------KAREDAPLFETFRVA--E-QYRPGVYRLALDGSART-
A0A2V7R3Z8      Q--RLFVTP--------------RAREDAPVFEAFRVA--E-QYRPGVYRLALDGSGKT-
A0A2V7J3C0      L--KLYLTP--------------ERGANG-AFAGFEVG--D-TYRPGRYRIVADRTGRS-
A0A2V7KWV9      R--RLYLQA--------------RPR-DLPALAGFAVA--D-QFTPGRYHLTIDHDGQT-
A0A1Q6ZHP2      Q--RLYVSP--------------NAPADAQAVAKLGVA--D-QFQAGAYRFTVDHSGQG-
A0A1Q7R6Z6      Q--RLYVSP--------------NAPADAQAVAKLGVA--D-QFQAGAYRFTVDHSGQG-
A0A2V7FYT7      Q--RLYVSP--------------NAPADAQAVAKLGVA--D-QFQAGAYRFTVDHSGQG-
A0A2V7IGR0      Q--RLFLTV--------------RPLADSVALGTFGVA--D-QYRPGKYRLTVDSTGQH-
A0A2V7MR23      Q--RLFVGS--------------AARADTQAIDRIRVA--D-QYQPGAYRLSVDRSGQG-
A0A2V7L1V3      Q--RLFVSP--------------KSRADEDVLASLRVT--G-QYRPGTYRLKVDSDRRS-
A0A1Q7E5D3      Q--RLFLGL--------------GSPADAHVFDAFRPA--E-QYRPGAYRLKVDATGQN-
A0A2V7ISE2      E--RLFVDP--------------SSPADAQALEGLRVA--D-QYRPGAYRFTVDRAGQG-
A0A1Q7J2X5      E--RLFVAP--------------SSPADAQAVEGLRVA--D-QYRPGAYRFTVDRSGQG-
A0A2V7NPD1      E--RLFVDP--------------SSPADAQALEGLRVA--D-QYRPGAYRFTVDHAGQG-
A0A2V7QPD8      Q--RLFLTT--------------KAREDAPLLETFRVA--E-QYRPGAYRLAVDGSGKA-
A0A2V7Q8M6      Q--RLFVSP--------------KSRVDEAVLATLQVT--G-QYRPGVYRLKVDSDRRS-
A0A2V7QBC3      Q--RLFVSP--------------KSRADEGVLATLQVT--G-QYRPGVYRLKVDSDRRS-
A0A2V7LMU1      Q--RLFVSP--------------ESRADEPLVATLQVT--G-QYRPGAYRLKVDSDRRT-
A0A2V7PBY9      Q--RMFVSP--------------KSRADARFLTTFQTA--G-QYRPGAYRLSLDADRQS-
A0A3M2BLV5      L--GLRLRR------------RGTNTVRSELFSDAVVT--D-EAEPGWYELRYSADGAS-
A0A2V7KS68      L--RLYLTV--------------KRPAERAIFSTFNVA--D-DFRPGLYRLRASADGRS-
A0A2V7N4L3      Q--RLYLET--------------KRASDRGNFVAFRVD--D-TFRPGDYRLNISDNGRT-
A0A1Q7AZK2      L--RLYLKV--------------KRTSDRATFDAFRVN--D-IFRPGDYRLSVSDDGRQ-
A0A1Q7TNP7      L--RLYLKV--------------KRTSDRATFDAFRVN--D-IFRPGDYRLSVSDDGRQ-
A0A1Q7KG39      L--RLYLKV--------------KRTSDRATFDAFRVN--D-IFRPGDYRLSVSDDGRQ-
A0A1Q7GX75      L--RLYLAV--------------KRPADQATFVGFRVN--D-TFRPGQYAFSVSADGRE-
A0A1Q7LL80      L--RLYLAV--------------KRPADQATFVGFRVN--D-TFRPGQYAFSVSADGRE-
A0A2V7PFU2      L--RLYLDV--------------KRLGDRPSFAGFSVS--D-DFRPGEYRLNISDNGRQ-
A0A2V7MFS9      L--RLYLEV--------------KRPADRPSFSGFGVA--D-AFRPGAYRLSVSDDSKT-
A0A2V7T933      L--RLYLKV--------------KRTSDRATFDAFRVN--D-IFRPGDYRLSVSDDGRQ-
A0A2V7J4D7      Q--RLYLHA--------------KVPGDSDILATLRIK--D-HVAPGKYRLVVEDTGDAP
A0A2V7LN90      H--RLYLTP--------------RQPGDTDALATFGIK--P-HVRPALYRLVVDSIGKT-
A0A2V7LFN9      E--RLYLV---------------NVSGDSAALTSFAIK--E-RVRPGTYLLAVDTVGTG-
A0A2V7MEK4      E--RLYLV---------------NVSGDSAALTSFAIK--E-RVRPGTYLLAVDTVGTG-
A0A2V7P8B1      M--PM-LRVLLRKASPSLLDRVLRRRFSTSLLGSVAVA--A-DAPADSIELAFDQDGFV-
A0A2V7QN41      R--RLYLRP--------------GNPVDSSVLATLRLD--G-TPLPGAYRYSVDREGRT-
A0A2V7R603      R--RLYLRA--------------RDPADSSGLATLRLD--G-TPVPGAYRYTLDREGRT-
A0A2V7LJS2      M--PM-LRVVLRKSSPSLLDRVLRRRFSPNLLGVVAVR--P-DAAADSLSLTFERDGFL-
A0A1Q7GLJ7      V--PM-LRV------------L-TRKFSPSLLGGVAVA--A-DSAAHSFQLTFGRDDFV-
A0A2V7GRE3      M--PA-LRM------------VTTRDLPLSFLGEVAVP--A-AAGPVSLQIAFGRDSFV-
A0A2V7EU00      R--RLYLTP--------------GARGDSLAFASFDMG--E-RFRSGNYRLSVDASGKN-
A0A1Q6WE01      R--QLYLGV--------------VAR-DTRALTGFAVG--D-PVMPGRYRVVLDRSGST-
A0A2V7S9K3      L--RLYLRV--------------DPR-RSPVFAEFTVS--D-EFRPGQYRLVVDQAGRT-
A0A1Q7DXB9      V--RLYLSP--------------KTPIDGTALLGLRLK--D-QVLPGRYRLEVDRDGQA-
A0A1Q7JD32      V--RLYLSP--------------KTPIDGTALLGLRLK--D-QVLPGRYRLEVDRDGQA-
A0A2V7MVP8      A--RLYLFP--------------RTPADSAALVAFGLK--A-RVVPGRYRLEVDRQARG-
A0A2V7N0A9      W--RLYLKP--------------QSPADTAALATFAVP--G-DVRPGRYRLQVDATGHS-
A0A1Q7DLS9      R--QLYLTP--------------ASPSDSAVFAGFSVA--P-RFRPGSYRLEVDQAGRG-
A0A1Q7JK96      R--QLYLTP--------------ASPSDSAVFAGFSVA--P-RFRPGSYRLEVDQAGRG-
A0A2V7KQV7      A--RLYLAP--------------KSRADSAALATLTVF--G-DVRPGTYRLEVDQTGQH-
A0A1Q7JGF6      W--RLYLKP--------------QSAADSAALATLTVT--G-DVRPGRYRLQVAAAANR-
A0A2V7SG67      W--RLYLKP--------------QSAADSAALATLTVP--G-DVRPGRYRLEVAAAANR-
A0A1Q7GIK9      W--RLYLKP--------------KSAADSAALATLTVP--G-DVRPGHYRLVLDRAGKR-
                                                                            

A0A2D5ZJF2      NGALLQRRQILEGVADLLAFFAKTFNDTGGSTAVASDESEEEP---DEGKQVVFYDRLKT
A0A0S8H9P3      ----------FIEPGSGAPAVRGQVGEPIEFTAGSLVVRPQ-----IEPGDYRV-----H
A0A1E4BBP7      -LA----RPAQQRGEQDVVVERGAVGDSIG-RAVGFQWQPSAQLL-AGREQVGF-----Y
A0A3M2G737      -----------------------------------------------SNGHVDY-----E
A0A0H4TUX7      ----------EVRDGFGTVVAQGQPGETVVGPGFTLRLVPS-----PEARTVGF-----R
A0A1G0LUG0      ----------EVQDASGAAVGGGAYSQPVTVSGVTLTVQPT-----TSEDVVPF-----R
A0A1Q7E3T7      -VL------------GRSRAIRTSYGTSVELDGMRFTVVAR-----PTVERGTI-----S
A0A1G0L906      ----------LRSVAGGTLVAAGGYDV----PAVGSGFSFRVREYRGDPRSVRI-----S
A0A1G0LCC0      ----------LRSVAGGTLVAAGGYDV----PAVGSGFSFRVREYRGDPRSVRI-----S
A0A2D5ZJE2      -------------------------------RAMREGWTPPPESD---------------
A0A3M2G624      ----------VVYDTANRELGRGISGVPFQHEFFEFTISNIEG---PPQSEFYF-----T
W0RI74          ----------LTDK-VGFTHEVGTVGDSVG-RSAGFAWVPPARLLGTRSREVEF-----T
A0A3M2BJA6      ----------FRITDEETLESLGEVSERLPAALAGVTFTLTEAAR-DYPR-IRV-----R
A0A3D4VBZ5      NLQ------------PGVEVEKGVVGDSIG-RPVGFQWQPVAGQF-GRRTEVVF-----N
C1A5W1          NLQ------------PGVEVEKGVVGDSIG-RPVGFQWQPVAGQF-GRRTEVVF-----N
A0A2V7PX99      -YE-------LLDQ-NGALVERGAVGDSVG-RSVGFSWAPSSSML-LEGRRITF-----N
A0A2V7ERC7      -YT-------LATA-TGRILESGTVGDSVG-RKMGFFWNPDPALL-PPGRLIAF-----S
A0A5Q4D6Y4      -VT-------SARGHASVNVSYGQRATVGG---ISFRVDEHPGV-----DQASF-----E
A0A2V7JTZ5      -YM-------LSTA-KGVFIESGAIGDSIG-RKAGMNWLPDARFL-GRGRAIEF-----G
A0A3D4YTR6      -YV-------LSTA-TGTVLERGAVGDSVG-RKIGMSWLPDRRLL-GANSIFKF-----A
A0A5Q4DA46      -LL-------LFDS-DGNVLERAAPGQPIG-AERGIEWTPPAGAI-EAGQRIAF-----R
A0A2V7F1M1      -FG------------GDRVTAQGLQGEAQS----------PYGTP-LAVGSVQF-----T
A0A2V7KXK7      -FR-------LELE-DGTVVQRGRVGQPVG-ESVGFDWTPTAAML-KPGTTVKF-----G
A0A651HKD3      -LQ-------ILGR-EGELVEEASVTEGIG-ASLGIRLTPRPEHL-RPGRNAEF-----R
A0A2V7QDU7      -FV-------VRNDSSEAVLGRTVPGKPLTFAGVELEVSPHALGL-GP---VAF-----S
A0A2V7ITT6      -FT-------LFTT-AGDSLQHAAVGDSIG-NGLGFRWTARAGAL-LPGRVVDF-----T
A0A2V7NJW1      -FT-------LFTT-AGDSLQHAAVGDSIG-NGLGFRWTARAGAL-LPGRVVDF-----T
A0A2V7GFB5      -YV-------LAKV-DGAVLERGTVGDSIG-RSIGFLWAPPAESL-PPGHTVEF-----R
A0A2V7RQ86      -YV-------LAKV-DGAVLERGTVGDSIG-RSIGFLWAPPAESL-PPGHTVEF-----R
A0A2V7IWX2      -FT-------LFSA-QGGVVQHGERGDSVG-PALGFAWVPGAAVL-TPGRRIEF-----T
A0A1Q7KE95      -FR-------LAGA-GGEGLQEGAIGDSVG-AALGFRWVPTAAVL-PAGSDLTF-----T
A0A1Q7T8X5      -FR-------LAGA-GGEGLQEGAIGDSVG-AALGFRWVPTAAVL-PAGSDLTF-----T
A0A2V7MS64      -FA-------LQDK-HKTELQHGATGEPVG-TALGFLWTPPAEKL-TPGRRVEF-----D
A0A2V7Q7N9      -FT-------LTDT-KHLVRLHGTVADSVG-PALGFAWVPPSGVL-TPGRTMEF-----T
A0A2V7IRW6      -FT-------LEEM-KAGTVQHGVTGDSVG-AALGFAWVPPSAAL-SRGRRVEF-----T
A0A1Q7DVU6      -FT-------LEEK-KAGVLQHGAAGDSVG-APLGFVWVPPAAAL-TRGRTVEF-----T
A0A1Q7JSV2      -FT-------LEEK-KAGVLQHGAAGDSVG-APLGFVWVPPAAAL-TRGRTVEF-----T
A0A2V7FK98      -FT-------LSTD-KGVEVEHGAVGDSIG-ARLGFTWAPPAGTV-PAGRTIEF-----S
A0A2V7R3Z8      -FT-------LSTD-KGVEVEHGAAGDSIG-ARLGFVWAPPAGTV-PAGRTIEF-----S
A0A2V7J3C0      -FS-------LLGA-KGEELQQGAIGDSIG-AALGFRWAPAAAAL-HAGSDLTF-----T
A0A2V7KWV9      -FH-------LQRE-DGTELEQGAVGSPVG-RTLGFIWTPTTAVL-TPGREVRF-----V
A0A1Q6ZHP2      -YT-------LATA-DGVELERGTLGDSVG-SRYGLRWVPDASTV-APGRVVEF-----T
A0A1Q7R6Z6      -YT-------LATA-DGVELERGTLGDSVG-SRYGLRWVPDASTV-APGRVVEF-----T
A0A2V7FYT7      -YT-------LATA-DGVELERGTLGDSVG-SRYGLRWVPDASTV-APGRVVEF-----T
A0A2V7IGR0      -YT-------LADG-EGVALEHGVVGDSVG-ARLGFLWVPTRDAL-GAGRTVRF-----A
A0A2V7MR23      -YT-------LSTA-DGVELERGSFGDSVG-TRYGLRWAPDASTV-PPGHTVEF-----T
A0A2V7L1V3      -YT-------LSTAPENQVVERGTVGDSIG-IKLGFVWAPAAGAL-PADRTIEF-----R
A0A1Q7E5D3      -WT-------LATE-DGIDLERGAVGDSIG-GRVGFHWAPGLGVL-TPGRSVGF-----T
A0A2V7ISE2      -YT-------LATA-DGIELERGTLGDSVG-TRYGLQWAPDAGTV-APGRTVEF-----T
A0A1Q7J2X5      -YT-------LGTA-DGIELERGTLGDSVG-TRYGLQWAPDAGTV-APGRTVEF-----T
A0A2V7NPD1      -YT-------LATA-DGIELERGTLGDSVG-TRYGLQWAPDAGSV-APGRTVEF-----T
A0A2V7QPD8      -FT-------LSTD-KGVEVEHGAVGDSIG-ARLGFTWAPPAGTI-PAGRTIEF-----S
A0A2V7Q8M6      -YA-------LATV-EGQVLERGTVGDSIG-TRLGLAWAPAATTL-PADRAVEF-----A
A0A2V7QBC3      -YA-------LATL-EGQVVERGTVGDSIG-TRLGLAWAPAASTL-PTDRAVEF-----G
A0A2V7LMU1      -YT-------LATV-EGQVVERGTVGDSIG-TRLGLAWAPAASTL-PTDRAVGF-----G
A0A2V7PBY9      -YT-------LATV-EGRVLEQGRVGDSIG-TRLGFAWAPTAATL-PPDRAVEF-----E
A0A3M2BLV5      -----------------AALVHAPTGDTVG--------TADAGEV-LEAPGLRF-----V
A0A2V7KS68      -YT-------LSNKDG-VELERGTVGDSVG-RRLGFLWQPS--SL-PRDHAVEF-----S
A0A2V7N4L3      -YT-------LASAEG-KELERGTVGDSVG-NRLGFRWVPAAGSL-PPGRTIEF-----S
A0A1Q7AZK2      -YT-------LASAEG-VDLERGTVGDSVG-NRLGFRWAPPAGSL-PPGRTVEF-----S
A0A1Q7TNP7      -YT-------LASAEG-VDLERGTVGDSVG-NRLGFRWAPPAGSL-PPGRTVEF-----S
A0A1Q7KG39      -YT-------LASAEG-VDLERGTVGDSVG-NRLGFRWAPPAGSL-PPGRTVEF-----S
A0A1Q7GX75      -YT-------LDGANG-VELERGMVGDSVG-RRLGFQWVPASGRL-APSRTVEF-----S
A0A1Q7LL80      -YT-------LDGANG-VELERGMVGDSVG-RRLGFQWVPASGRL-APSRTVEF-----S
A0A2V7PFU2      -YT-------LTSAAG-LTLERGTVGDSVG-SRFGFRWVPAPGTL-PAGRSVEF-----A
A0A2V7MFS9      -YT-------LAAAEG-VDLERGTVGDSVG-RRLGFRWVPGPESL-SPGRTIEF-----S
A0A2V7T933      -YT-------LASAEG-VDLERGTVGDSVG-NRLGFRWAPPAGSL-PPGRTVEF-----S
A0A2V7J4D7      HFT-------LYNARSKTPVQTGVAGDSVG-PDMGLAWVPPRAVL-AGPREVDF-----T
A0A2V7LN90      -FT-------LSDKKHLV-QLHGTVGDSIG-AELGFAWVPPSGTL-TPGRLVDF-----T
A0A2V7LFN9      -FT-------LTDDAGAV-LDRGAVGDSIG-AALGFAWVPPEGVL-LAGHVVEF-----T
A0A2V7MEK4      -FT-------LTDDAGAV-LDRGAVGDSIG-AALGFAWVPPEGVL-LAGHVVEF-----T
A0A2V7P8B1      -VG---------RPPGRR--------------------RAPYGTV-VEVGGVRF-----A
A0A2V7QN41      -FS---------LQNGGRVVQTDSLATTVG-QGLGFSWSPARGLV-APGHAVDF-----A
A0A2V7R603      -FT---------LQNGGRVVQTDSVGTPAG-QGLGFSWSPPRGLV-A-GHSVDF-----A
A0A2V7LJS2      -V----------GTGPAR-------------------RRAAYGTV-VEVGGVRF-----A
A0A1Q7GLJ7      -VE---------GPAGQQ-------------------RRAAYGRV-VDLGVIRF-----A
A0A2V7GRE3      -VR---------GTSG-Q-------------------WSAPYGSA-VESHDIRF-----A
A0A2V7EU00      -FTLTAVGGVLMAVGG-VVLQRGTPGEAVG-DAIGFRWTPPAAAL-PAGASIAF-----S
A0A1Q6WE01      -FR-------LLGDDG-VELQRGTVGDSIG-QAVGFRWAPAAAVL-PPGSEVTL-----I
A0A2V7S9K3      -FR-------LEGRGG-AELQRGAVGDSVG-QALGFRWAPSATLL-APGTELPF-----V
A0A1Q7DXB9      -FA-------LFS-AE-GVVQRGERGDSVG-PALGFAWVPGAAVL-TPGRRIEF-----T
A0A1Q7JD32      -FA-------LFS-AE-GVVQRGERGDSVG-PALGFAWVPGAAVL-TPGRRIEF-----T
A0A2V7MVP8      -FT-------VVAVGG-GVVQRGAVGDSVG-PALGFAWVPGKTVL-NPGRTIDF-----T
A0A2V7N0A9      -FR-------LLDVDENAVLEQGAVGSNLG-VGLGFAWLPPAASL-RGGARVEF-----T
A0A1Q7DLS9      -FT-------LATHDA-VVLQRGAAGDSVG-GALGFVWLPPAAEL-SPLRRLEF-----V
A0A1Q7JK96      -FT-------LATHDA-VVLQRGAAGDSVG-GALGFVWLPPAAEL-SPLRRLDF-----V
A0A2V7KQV7      -FT-------LRDVAENAVLQQGSVGDSVG-GLLGLAWVPPAGTL-RPRAVIRF-----T
A0A1Q7JGF6      -FR-------LLDVDAKVVLQEGAVGDSVG-AALGFTWVPPAAVL-RPGASVQF-----T
A0A2V7SG67      -FR-------LLDVDAKVVLQEGAVGDSVG-ATLGFTWVPPAAVL-RPGASVQF-----T
A0A1Q7GIK9      -FR-------LLDADEKQVLQEATPGEAIG-AALGLVWVPPAGTV-QPGGRVDF-----T
                                                                            

A0A2D5ZJF2      FQDVDNIQVFLKKELE-------------VKVGKKD----------------DIISVSFD
A0A0S8H9P3      VISQLAAEAVVTGGLA-------------ASTRPET----------------NLIDVTYS
A0A1E4BBP7      VVTPREAAFNLGSQLS-------------VTVGQNS----------------NLMRFQLS
A0A3M2G737      PLNKRSVVRRLQSSAS-------------FSPIPQS----------------DIIQISVK
A0A0H4TUX7      LVRPEEAAAWVSGGLS-------------YNVREGT----------------NAVDISFA
A0A1G0LUG0      ITRREEAAAWVSGGLS-------------YRVREAT----------------NAVDITFT
A0A1Q7E3T7      VVSREEAINGLLGGLR-------------VTLRPHT----------------DIFDVAYV
A0A1G0L906      IMPRIAAGNMVRGGIG-------------FAVPPTT----------------SLVNVTFT
A0A1G0LCC0      IMPRIAAGNMVRGGIG-------------FAVPPTT----------------SLVNVTFT
A0A2D5ZJE2      --PMADWVEALRSRLS-------------VSPLKDA----------------DVITIKMT
A0A3M2G624      LYPLQRAVNSVRAATHAQATTRAAIQDNVAGGGIAGAASAKRSRKDAAIQDAGIVQVDVY
W0RI74          VLTPREASRDVQKRLA-------------ITIKQAS----------------PVIGLTLT
A0A3M2BJA6      VLPFDKAVTKLQKALSV------------SRPNRDA----------------GIVTVRYE
A0A3D4VBZ5      VQTPREASRALIKKLA-------------LSLQDGS----------------SFLFLRMN
C1A5W1          VQTPREASRALIKKLA-------------LSLQDGS----------------SFLFLRMN
A0A2V7PX99      VSSPYEATQGLVKALR-------------LKQDPGG----------------SFLRIELK
A0A2V7ERC7      VTTPRNTSLGLLASMR-------------STLPEDG----------------QFLTISLT
A0A5Q4D6Y4      LLSRDQAIELVGRNLT-------------SQPRPET----------------NVVDVSYT
A0A2V7JTZ5      VTSPRNVSVFLVNAVH-------------ASLPEDG----------------QFLKITLS
A0A3D4YTR6      VSSPRNTSASLVAAVH-------------ATLPEDG----------------QFLKITLT
A0A5Q4DA46      VTRPREVARGLLADLD---------------VRIQG----------------TFMTVGMS
A0A2V7F1M1      IPSPPSVKAGALAVRSREEVIDDVLKSLAVLRRKST----------------DIVDVTYS
A0A2V7KXK7      VSAITDASASLAKSIK-------------TRLDPDG----------------NFLRLQLK
A0A651HKD3      LTSPREAAGGIARSMN-------------IQTNQFI----------------EYISVSLS
A0A2V7QDU7      VVAFDDAVRGLRKALSI------------KRRNREA----------------NIVDVGYR
A0A2V7ITT6      VGTPRSAAEQLARRLR-------------AKTDEAG----------------NFLSVQLT
A0A2V7NJW1      VGTPRSAAEQLARRLR-------------AKTDEAG----------------NFLSVQLT
A0A2V7GFB5      LQTAREAALHLSDALD-------------AHMDYNG----------------NFLKIELR
A0A2V7RQ86      LQTAREAALHLSDALD-------------AHMDYNG----------------NFLKIELR
A0A2V7IWX2      LLTPHDAAELLASQLQ-------------VTTDPEG----------------TFVTVQLT
A0A1Q7KE95      VRPLRDAARQLGNALT-------------VTMDQGG----------------NFLRVGLT
A0A1Q7T8X5      VRPLRDAARQLGNALT-------------VTMDQGG----------------NFLRVGLT
A0A2V7MS64      VDAPYEAARKLGKHLK-------------TSLDLDG----------------NFLRLELA
A0A2V7Q7N9      VTAPYEAAKLLTKRLK-------------ITADADG----------------NFLRLELG
A0A2V7IRW6      VSAPYEAARALGKRLK-------------TSLDLDG----------------NFLRLELG
A0A1Q7DVU6      VSAPYEAARALGKRLK-------------TSLDLDG----------------NFLRLELG
A0A1Q7JSV2      VSAPYEAARALGKRLK-------------TSLDLDG----------------NFLRLELG
A0A2V7FK98      VATVRDSARALSDELE-------------VATDPAG----------------NFLRMHLK
A0A2V7R3Z8      VATVRDSARALSEELE-------------VATDPAG----------------NFLRMHLK
A0A2V7J3C0      VRPLRDAARKLANSLA-------------VTLDPGG----------------NFLRIGLT
A0A2V7KWV9      VSPLRDAAKKLADNLN-------------VTLDLSG----------------NFLRVALT
A0A1Q6ZHP2      LTTLRDAATSLGEGLD-------------ARMDQEG----------------SFLRLELR
A0A1Q7R6Z6      LTTLRDAATSLGEGLD-------------ARMDQEG----------------SFLRLELR
A0A2V7FYT7      LTTLRDAATSLGEGLD-------------ARMDQEG----------------SFLRLELR
A0A2V7IGR0      LATVRDGARHLDEALD-------------VRAAPDG----------------SFLHIELR
A0A2V7MR23      LTTLRDAATSLADALD-------------TWMDIDG----------------NFLRIEMR
A0A2V7L1V3      LATFRDAARSLADSMS-------------AQLDPQG----------------NFLRLELR
A0A1Q7E5D3      VASVRDASRHLAERLD-------------VHMDMNG----------------NFLRVELT
A0A2V7ISE2      LTTLRDAATGLGEALD-------------VRMDMDG----------------NFLRFELR
A0A1Q7J2X5      LTTLRDAATGLGEALD-------------TRMDMDG----------------NFLRVELR
A0A2V7NPD1      LTTLRDAATGLGEALD-------------VRMDMDG----------------NFLRFELR
A0A2V7QPD8      VATVRDSARALSEGLE-------------VNNDPAG----------------TFLRMHLK
A0A2V7Q8M6      LSTLRDAARSLADSLS-------------AQLDEKG----------------NFLRLELR
A0A2V7QBC3      LSTLRDAARSLADSLS-------------AQLDEKG----------------NFLRLELR
A0A2V7LMU1      LSTLRDAARSLADSLS-------------AQLDAEG----------------NFLRLELR
A0A2V7PBY9      LLTLRDAARSLADSLR-------------TELDLEG----------------NFLRIEMR
A0A3M2BLV5      LKRAPEEFRTYLLEVVPSVAQVASEVRLVGTAREQT----------------NIIDIYLT
A0A2V7KS68      LAAPRDAATGLGNALD-------------VHMDING----------------NFLAVELS
A0A2V7N4L3      LMTPRDAALRLGEQLD-------------VRMDLNG----------------NFLALELR
A0A1Q7AZK2      VVPPRDAALRLGEQLD-------------VRMDMNG----------------NFLALELR
A0A1Q7TNP7      VVPPRDAALRLGEQLD-------------VRMDMNG----------------NFLALELR
A0A1Q7KG39      VVPPRDAALRLGEQLD-------------VRMDMNG----------------NFLALELR
A0A1Q7GX75      LVSPRDAALTLGEQLS-------------VRMEMNS----------------NFLALELR
A0A1Q7LL80      LVSPRDAALTLGEQLS-------------VRMEMNS----------------NFLALELR
A0A2V7PFU2      VMPPRDAATRLGEELQ-------------VQMDMNG----------------NFLALELR
A0A2V7MFS9      VVQPRDAALRLGEQLD-------------VRMDLNG----------------NFLALQLQ
A0A2V7T933      VVPPRDAALRLGEQLD-------------VRMDMNG----------------NFLALELR
A0A2V7J4D7      LDPPYEAALGLARNLK-------------VAADLDG----------------NFLRMELG
A0A2V7LN90      VVAPYEAAKLLAKRLK-------------TSADADG----------------NFLRLELG
A0A2V7LFN9      VTTPAEAATRLRRELK-------------VSSDMDG----------------NFLRLELT
A0A2V7MEK4      VTTPAEAATRLRRELK-------------VSSDMDG----------------NFLRLELT
A0A2V7P8B1      VLRRPDAARGLLRVVSRDAAISQLLTELRVRPRVRT----------------DIVDVAYA
A0A2V7QN41      LNTPADAARQLKTTLSVTTDVDPAL----MRAGTDA----------------NFLRIQLT
A0A2V7R603      LSTPADAARQLMKTLNVSTDVDPAL----MRAGTDA----------------NFLRIQIT
A0A2V7LJS2      ILRRPEVRQGVLRVLSRDAAISALLTELRVRPRMRT----------------DIVDVAYS
A0A1Q7GLJ7      VLHRPSAKQGFLQVLDQESAISYLIAKVRVRPRLRT----------------DIVDVAYS
A0A2V7GRE3      VLHRPDAATARLRVLSREAAISGLLARLRVKPRLNT----------------DIVDVTYS
A0A2V7EU00      VVTPRDAAQRLSARLG-------------VRLDENG----------------NFMRLELD
A0A1Q6WE01      VSSVRDAAKRLGDELN-------------VTIDPNG----------------NFLRLSLS
A0A2V7S9K3      VTTLRDAAKHLGEALT-------------VAIDPSG----------------NFLGISLT
A0A1Q7DXB9      LLTPHDAAELLASQLQ-------------VTTDREG----------------TFVTVQLT
A0A1Q7JD32      LLTPHDAAELLASQLQ-------------VTTDREG----------------TFVTVQLT
A0A2V7MVP8      VYTPHDAAELLAGELQ-------------VTTDPGG----------------SFVTVQLT
A0A2V7N0A9      VATTSEAAQKLAEELR-------------VRAAQDG----------------NFIRIERR
A0A1Q7DLS9      VESPHEAASRLAERLR-------------VKTDLEG----------------NFLRVELR
A0A1Q7JK96      VESPHEAASRLAERLR-------------VKTDLEG----------------NFLRVELR
A0A2V7KQV7      MTALSDVALELSQSLR-------------IRATADG----------------YFVRLERR
A0A1Q7JGF6      VATTSEAAQKLSEELR-------------VRAGTDG----------------NFVRIERR
A0A2V7SG67      VATTSEAAQKLSEELR-------------VRAGTDG----------------NFVRIERR
A0A1Q7GIK9      VTTTSEAALQLAEELR-------------IRAAPEG----------------NFVRIARR
                                                                      . .   

A0A2D5ZJF2      SPWPDEAELIVYEVVESYRRYQSTTKQTTAGGVLKILEKARKKADGKWNESYEKLILSQK
A0A0S8H9P3      GPDQRLVPRTLNAVAAALRDLGVRRVRQWARGRTRFIRDQLDESGRQLREALQAVQDYKG
A0A1E4BBP7      GSKAGLLATTLNTLAREFVSEAVRLKRENLTVSAEATEEQLQQAAQQLAAAQTALERFKI
A0A3M2G737      STHPEEAKLIANLFAETYYQWNVERSRTELIGTRKFLEKQLEQKRERLYQAEDSLRKYME
A0A0H4TUX7      GTDPTLVPQILNAAAVALRLDGVRRAQEIAARKRTYVAEQLAKADSSYRIKLAELQRFKE
A0A1G0LUG0      STDPLLVPRILNAAGLALQSDGVRRAREVAARRRAYIAEQLAGADAAYKGKLTELQRYKE
A0A1Q7E3T7      ASDPQHAQQVVNRVVEVFRAVNAEEAQRQSRLRREFLETQLRVNDSVLADARRALTAFRR
A0A1G0L906      GTDPSLVPEILNEALIALQNYGVDRVRDVASLRLRYINERVDDARTRYLSALSGVQSYKE
A0A1G0LCC0      GTDPSLVPEILNEALIALQNYGVDRVRDVASLRLRYINERVDDARTRYLSALSGVQSYKE
A0A2D5ZJE2      AGDPDEAAYFANLFAEEYRNQNISQNRGELSGVRQFLEEQLHQVETRLAISEEELRSFKT
A0A3M2G624      WQDPETATQIANALADVIRHRELEDKRLEHTKTREYIERQLNTYTQKLKASEEALQTYKE
W0RI74          GTAQQKPAATMNAMLTQFVDVATELKKREMVASTTTLNTQLDEASKGLQAAEQAFEDYRV
A0A3M2BJA6      SSDTLLVHEVPNRLAASFISRRQRIQKTEASSTVRFLEDQIDTLARQLAAAEERLVAFRE
A0A3D4VBZ5      GPDAQRSAATLNAWVEQFVTVATQYKKQNVVQVAGILEGQREYAAQELASAEAALEGFRV
C1A5W1          GPDAQRSAATLNAWVEQFVTVATQYKKQNVVQVAGILEGQREYAAQELASAEAALEGFRV
A0A2V7PX99      GTDPALTAATVNAVAGRTVTLAAELKRRKYAELAKILGEQAQQAQQALHASDAALASFRV
A0A2V7ERC7      GTNPQRSARTVNVWAEQFVGAAIELKKRHLLEFKKMLGDQLNVAEHELNTSELLLEQFRA
A0A5Q4D6Y4      ATDPDVAQRLANRAVQVFQARTASEARAESQRRRQFLEEQLAVADTTLREAQGYLTAFRS
A0A2V7JTZ5      GADPRRTARTVNAWAEQLVNSSGDLKTRHLFEFKKILGDQLALAEAQLRTSENELEHFRV
A0A3D4YTR6      GSDPRRTARTVNAWAAQLVSSSGDLKKSHLLEFKRILGDQLALAEGQLRSSEDELERFRV
A0A5Q4DA46      GTDPVRTTRVLNGILDRFAIVAEDLKRAKFEELQAILEEQLDYAAQNLQQAEYALEGFKV
A0A2V7F1M1      DPDPLLAQRVANLLVRVFQARDAGSAQEQARSRAEFLAAQLSATDSELSIAQAELSAFRR
A0A2V7KXK7      STSAAGAAATLNAISARIVAVESEMKRRKFEELAGVMDEQHQHAKEALDQADEALRNFRV
A0A651HKD3      GGDPVHAARLLNTVLESFLREATELSRATSDQLSSTLEQQLVTARQTLQEAEGELEAFHR
A0A2V7QDU7      GTDPQLVQAVPNLLATRFIIDRQKTQQTETRSTGAFLRDQTAKLARQLRASEDSLERFRV
A0A2V7ITT6      GNDARHVTAVLNAVVQRYVAVAADLKRDKLTELSKILQQQLQYAEHNLRSAEEVFEDFRV
A0A2V7NJW1      GNDARHVTVVLNAVVQRYVAVAADLKRDKLTELSKILQQQLQYAEHNLRSAEEVFEDFRV
A0A2V7GFB5      GGDPARITRILNAVAERYVEVAAELKRGRLTELTSIIGDQVRTAKQSLDSAEGDLQTFRR
A0A2V7RQ86      GGDPARITRILNAVAERYVEVAAELKRGRLTELTSIIGDQVRTAKQSLDSAEGDLQSFRR
A0A2V7IWX2      GTDPQLTAAIVKGVADRTVAVAADLRRHKVAALADILGEQVRHAQASLTAAELALKSFRV
A0A1Q7KE95      GADPAHTAATVNAVAQRSVAVGAELKRAKLNQLGKLLDEQRQSARENLQRAESALEQLQV
A0A1Q7T8X5      GADPAHTAATVNAVAQRSVAVGAELKRAKLNQLGKLLDEQRQSARENLQRAESALEQLQV
A0A2V7MS64      GDDPVQITDIVNTVGQRFVAAAADLKRQNLTELSRILGDQLDKARTELTSAEQSLKQFRM
A0A2V7Q7N9      GSDPGEVTAVVNMVAERFVSVAADLKKQNLQQLTGILGGQLERARDKLQSAEAELKRFRV
A0A2V7IRW6      GPDAAGITAVVNAVAERFVAAAAELKRQNLTELTRILSGQLERAQANLRDAETALKTFRV
A0A1Q7DVU6      GPDAAGITAVVNAVAERFVAAAADLKRQNLTELTRILNGQLERAQANLRDAETTLKTFRV
A0A1Q7JSV2      GPDAAGITAVVNAVAERFVAAAADLKRQNLTELTRILNGQLERAQANLRDAETTLKTFRV
A0A2V7FK98      GADAARITSTINGIAERFVQVAADLRRQKLTELTKILDQQLAAAHQNLLDAEQALERFQV
A0A2V7R3Z8      GADAVRITSTINAIAERFVLVAADLRRQKLTELTKILDQQLAAAHQNLLDAEKALERFQV
A0A2V7J3C0      AEDATRGAATANAIAQRFVEVGADLKRAKLHQLGTLLDEQLRAARDNLRRTESALEQFQV
A0A2V7KWV9      SPNGTDAAATVNAVADRYVAVATDLKRVKVTELSRLLNEQLQAAEANLHKAERALEDFRV
A0A1Q6ZHP2      GANPVDITAIVNAVAQRYVTVYADLKRQKLIELTKILGEQLQHAQENLHGAEASLQRFRE
A0A1Q7R6Z6      GANPVDITAIVNAVAQRYVTVYADLKRQKLIELTKILGEQLQHAQENLHGAEASLQRFRE
A0A2V7FYT7      GANPVDITAIVNAVAQRYVTVYADLKRQKLIELTKILGEQLQHAQENLHGAEASLQRFRE
A0A2V7IGR0      GAQPARITAIVNAIAQRYVEVAAELKREKVTELTKILDQQVESARQRLRDAEAGLRSFGV
A0A2V7MR23      GPDPVRITTLVNAVAQRYVTVYADLKRQKLIELTKILGEQLQHSQDNLRSAEAALQRFRE
A0A2V7L1V3      GPDAPRITAVVNAVADRYVLVAADLKRKKLTELTKILGEQLQSAEDKLRGAEAALERFRE
A0A1Q7E5D3      GAYPARITAIVNAVVERYVQVAADLKRQKVTELTKILNDQVESARRNLQDAEVALEAFRV
A0A2V7ISE2      GPYPTRITAIVNAVAQRYVQVYADLKRQKVIELTKILGEQVQHSQENLRNAEAALQRFRE
A0A1Q7J2X5      GVYPTRITAIVNAVAQRYVQVYADLKRQKVMELTKILGEQVQHSQENLRNAEAALQRFRE
A0A2V7NPD1      GPYPTRITAIVNAVAQRYVQVYADLKRQKVIELTKILGEQVQHSQENLRNAEAALQRFRE
A0A2V7QPD8      GADAVRITSTINAIAERFVQVAAELRRQKLTELTKILDQQLAAAHQNLQDAEKALERFQV
A0A2V7Q8M6      GPDAPRITAVVNAVAERYVQVASDLKRKKLTELTKILAEQLRSAQGNLRSAEAGFERFRE
A0A2V7QBC3      GPDAPRITAVVNAVAERYVQVASDLKRKKLTELTKILAEQLQSAQGNLRSAEAAFEGFRE
A0A2V7LMU1      GPDAPRITAVVNAVAERYVQVASDLKRKKLSELTKILAEQFQSAQGNLRSAEAALERFRE
A0A2V7PBY9      GPDAAQITAIVNAVAERYVQVAADLKRTKLSELTKILADQLQRAQGTLRSSEAALERFRV
A0A3M2BLV5      HEDPELAPKMLGAAARALSEFGARQVRERAESDLEFAEAQLDSARNNLQRSFQKIREFKE
A0A2V7KS68      GQNPVLIANILNAVTQRYVDVAAQLKREKLTELTKLLENQLNTARSNLDDAESALQHFRT
A0A2V7N4L3      GANPVLISNILNAVSQRYVAVAAQLKREKLTELTKLLEDQLTTAQRNLDEAETALQRFRT
A0A1Q7AZK2      GPNPVLITSILNAVAQRYVEVAAQLNREKLTQLTKILEDQLTTAKRNLDSAETALQGFRT
A0A1Q7TNP7      GPNPVLITSILNAVAQRYVEVAAQLNREKLTQLTKILEDQLTTAKRNLDSAETALQGFRT
A0A1Q7KG39      GPNPVLITTILNAVAQRYVEVAAQLNREKLTQLTKILEDQLTTAKRNLDSAETALQGFRT
A0A1Q7GX75      GSNPVLIANILNAVSQRYVEVAAQLKREKLTELTKILEDQLRTAQGNLDDAETALERFRT
A0A1Q7LL80      GSNPVLIANILNAVSQRYVEVAAQLKREKLTELTKILEDQLRTAQGNLDDAETALERFRT
A0A2V7PFU2      GTNPMLISKILNAVTQRYVEVAAQLKREKLTELTKILEDQLTTAKRNLDEAEDAQRRFRT
A0A2V7MFS9      GTNPVLISSILNAVSQRYVAVAAQLKREKLSELTKILEDQLTTAQRNLDDAEAAQQRFRT
A0A2V7T933      GPNPVLITTILNAVAQRYVEVAAQLNREKLTQLTKILEDQLTTAKRNLDSAETALQGFRT
A0A2V7J4D7      GHDPAQIAATVNAVAERFVAVAAGLKRDNLTELTRILGDQLAQAQANLRQAEASLKSFRV
A0A2V7LN90      GSDPAEVTAIVNLVAERFVAIAADLKKENLQQLTGILSGQLERARDKLQSAEAGLKRFRV
A0A2V7LFN9      GPDAAGVTGTVNAVASRFVAAAADLKRDNLTQLTGILGAQLEQAQARLRSAETALQRFRV
A0A2V7MEK4      GPDAAGVTGTVNAVASRFVAAAADLKRDNLTQLTGILGAQLEQAQARLRSAETALQRFRV
A0A2V7P8B1      APDPSRAQQVVNRVVDVFRAASAEAAQGQSRLRREFLEAQLKVNDSVVADAQAALTALQR
A0A2V7QN41      GSRPAELAATVNAIADRVVVVAADLKRIKLVELGRILDEQRQHALRGLRDAEAAQRDFRI
A0A2V7R603      GSRPAELAATVNAIADRVVVVAADLKRIKLVELGRILDEQRQHALGSLRAAEAAQRDFRI
A0A2V7LJS2      APDPARAQEVVNRVVDVFRAASAEAAQGQSRLRREFLEAQLRVNDSLVADAQDALTAFQR
A0A1Q7GLJ7      APDPARAQEVVNRVVDVFRAASADAAQRQSKLRREFLEAQLKVNDSLLADARQALTEFQR
A0A2V7GRE3      APDPYVAQHVLNRVVDLFKSASAEDAQQQSTRRREFLESQLKVNDSLLADARQAVTAFRQ
A0A2V7EU00      GTDPKSIAATLNAIAQRLVAVAAELKRAKLTELTRILNEQLTTAARNLRDAEGSLESFRV
A0A1Q6WE01      GTDGPTVAATLNAVAQRYVDAALKLKRAKLSELAALLAEQLQSARASLQRAESAYEAFRT
A0A2V7S9K3      DANGTAAAKTVNYVAQRYVLAASGLKRSKLTELARLLDEQLQSARGNLQRAEAALEQFRT
A0A1Q7DXB9      GTDPQLTAAIVKGVADRTVAVAADLRRHKVAALADILGQQVQHAQASLTVAELALKNFRV
A0A1Q7JD32      GTDPQLTAAIVKGVADRTVAVAADLRRHKVAALADILGQQVQHAQASLTVAELALKNFRV
A0A2V7MVP8      GTDPHLTTAILRGVANRTVAVANELRRHKVAALADMLGQQVQHAQTSLTAAELALKDFRI
A0A2V7N0A9      GPDRRVVTGTVNAVAERFVAAAAELKRQRLTQLTAILKDQLDHAQDNLRAAEAALMAFRV
A0A1Q7DLS9      GQDPRKITVIVNAVAQRFVAVAADLKRQQLTELVRILGEQLNHSQVNLSAAESALRDLLS
A0A1Q7JK96      GQDPRKITVIVNAVAQRFVAVAADLKRQQLTELVRILGEQLNHSQVNLSAAESALRDLLS
A0A2V7KQV7      GHDPVLITTTVNAVADRLVAVAADLKRERRTELSSILHEQRDRAKANLSSAELALTQFRV
A0A1Q7JGF6      GPDAAVVTRTVNAVAERFVAAAADLKRQRLTELTAILKDQLDRAETNLRAAERGLTAFRV
A0A2V7SG67      GPDAAVVTRTVNAVAERFVAAAADLKRQRLTELTAILKDQLDRAETNLRAAERGLTAFRV
A0A1Q7GIK9      GPDPDQATGIANAVAERFVAAAADLKRQRLTELTAILQDQLNHAQANLRTAEAALTVFRV
                                                                            

A0A2D5ZJF2      K-----------HPVLSLKDDRGSFLVRGLSTLHEELAAAQSAAIVAKATYEAAEQMQGD
A0A0S8H9P3      R-----------------------------RGLISLTVEESRVMQRVATLQTEIEQLLIE
A0A1E4BBP7      N-----TITLPSEQMAITPGV---------------STTMNPVFQAYFSDRVNYEQVRRD
A0A3M2G737      A-----------------------------SNVMTDDAGATATIEKIAQLEATRSALEID
A0A0H4TUX7      G-----------------------------EQITDLSVEEQSVVQSIQALEQQRQQITVQ
A0A1G0LUG0      G-----------------------------QQITDLSAEELSIVQSIQTLEQERQLLAVQ
A0A1Q7E3T7      H-----------------------------AGRAGSDQQGPTQQAGIDQLQLQRDQLDAD
A0A1G0L906      S-----------------------------ENTTNFTAEEVAIINSIHGFDREKERLQVD
A0A1G0LCC0      S-----------------------------ENTTNFTAEEVAIINSIHGFDREKERLQVD
A0A2D5ZJE2      K-----------------------------SGLVSLSDEVEWLVRQLAEFESAENAAITD
A0A3M2G624      Q-----------------------------NRIYELDAIARDVTYKVFDIEAEISQIQAE
W0RI74          K-----TIAEPSETPTVISSDPKSQN----------MAVGQPIFNAFFTRKTEVDQLKRD
A0A3M2BJA6      E-----------------------------GQVVSIEAEANAQVTELARLQADRNAIDAE
A0A3D4VBZ5      R-----TVTEPSERQTIQPGI---------------EMTNSPVFENYFRDKILADNYRRD
C1A5W1          R-----TVTEPSERQTIQPGI---------------EMTNSPVFENYFRDKILADNYRRD
A0A2V7PX99      R-----TAGVVQRGAPTVSPTM--------------DGKGDPVYSRAFELRLNIEQLRRE
A0A2V7ERC7      S-----TITLPSGGSPLASSG---------------QTAGDPAFTTYFQQKATLDEVRND
A0A5Q4D6Y4      DEQVVST-----------------------------QAQGTEEQLGLINIEMRREELLAD
A0A2V7JTZ5      S-----TITLPSGVAASAGPG---------------VTQGDPVVASYFQQKVALDEIRSE
A0A3D4YTR6      N-----TITLPHG-ATPIGPG---------------AGQVDPVVGNYFQQKAALDEVRSE
A0A5Q4DA46      R-----TISLPSEQGMPVAGGT--------------QQTTNPVFQNFFNLRVEQDEARRD
A0A2V7F1M1      Q-----RMLGSSRDKLAVEQAR------------------------LTALDARLGELEAE
A0A2V7KXK7      RTADRPLVTQAPGGGLTVEGSG-----------------------VVTQLRTDMDQQRRD
A0A651HKD3      A-----NVLSPAQQGA--------------------VDGSSPAMDAYIDLQLGAEELERD
A0A2V7QDU7      V-----------------------------EHIVSLPQQASSGVTQFAELQAQRNALDAE
A0A2V7ITT6      Q-----TITLPADRVTPVAPGV--------------ELTRDPGVAAFFNMKVEREQLRRD
A0A2V7NJW1      Q-----TITLPADRVTPVAPGV--------------ELTRDPGVAAFFNMKVEREQLRRD
A0A2V7GFB5      R-----TITLPPDAVAAGG-----------------DTPRDPVLGDFFEQQVQRQQVARD
A0A2V7RQ86      R-----TITLPPDAVAAGG-----------------DTPRDPVLGDFFEQQVQRQQVARD
A0A2V7IWX2      R-----AAGVLPAGVA--------------------APPPSPAFTNAFELRVAVDQLGRD
A0A1Q7KE95      T-----VGPDLGAAPVPP--------------------GGGPPLGTLLGPKLEQEQLRRD
A0A1Q7T8X5      T-----VGPDLGAAPVPP--------------------GGGPPLGTLLGPKLEQEQLRRD
A0A2V7MS64      S-----AVTEYTEGTASIAPNM--------------QFPHDPVFAGLFDMKVNREELRRD
A0A2V7Q7N9      G-----AVTQYADGSAPVTPNM--------------EFPRDPVFAGLVGMKVNREELRRD
A0A2V7IRW6      S-----AVTEYADGAAPVTPNM--------------QFPRDPVFAGLLDMKVNREQLRRD
A0A1Q7DVU6      S-----AVTEYADGAAPVTPNM--------------QFPRDPVFAGLLDMKVSREQLRRD
A0A1Q7JSV2      S-----AVTEYADGAAPVTPNM--------------QFPRDPVFAGLLDMKVSREQLRRD
A0A2V7FK98      K-----TITLPS-------TAAGGARAAGGVPTASGASADDPAFASFFRMQVDRQQVQQD
A0A2V7R3Z8      K-----TITLPS-------TAVGGSRGA-GVPSA-GASADDPAFASFFRMQVDRQQVQQD
A0A2V7J3C0      G-----TATFTPTVGTAAA-----------------SAGRDAAFGSLFAPRLEEEQLRRD
A0A2V7KWV9      R-----TIMLPAEPVAG-------------------SAARTSPVSEFLTRRVQEDQLRRD
A0A1Q6ZHP2      E-----TITLPGDRPSVGGASVAGAAVGGPGATGA-VAARDPVFGSFFDMQISREQARRD
A0A1Q7R6Z6      E-----TITLPGDRPSVGGASVAGAAVGGPGATGA-VAARDPVFGSFFDMQISREQARRD
A0A2V7FYT7      E-----TITLPGDRPSVGGASVAGAAVGGPGATGA-VAARDPVFGSFFDMQISREQARRD
A0A2V7IGR0      R-----TITLPSGRAAA-------------GVTGT-GADRDPALTSFFDLQIEQQQAHQD
A0A2V7MR23      E-----TITLPGERPVTGGASVAGPVVAGAAPGTGPAGARDPLFGSFFEMQISREEARRD
A0A2V7L1V3      R-----TITLPADRPAPVALGAPGGA--GGGSQGQ-VGEADPKFGTFFTMQFDRERIQQD
A0A1Q7E5D3      R-----TITLPSDRPAPSRAGVAGAT----GAAAG-DVAGDPVFTHFFDTQVEREQVRRD
A0A2V7ISE2      E-----TITLPSDRPAAG-ASVAGAG--VGGAGAA-GGARDPVFGGFFETQLTREEARRD
A0A1Q7J2X5      E-----TITLPSDRAAAG-ASVAGAGGVGAGAGAA-GGTRDPVFGGFFDMQLTREEARRD
A0A2V7NPD1      E-----TITLPSDRPAAG-ASVAGAG--VGGAGAA-GGTRDPVFGGFFETQLTREEARRD
A0A2V7QPD8      S-----VITRPSQVPKAGP-------------------GDDPAFKNFFTMQVDREQARRD
A0A2V7Q8M6      R-----TITLPGDRTPPGALGMAGGA--GGGQGA----ESDPKFGTFFGMQADRDRIQQD
A0A2V7QBC3      R-----TITLPGDRTPPVSLGVPSAA--GGGQGA----ESDPKFGTFFGMQADRDRIQQD
A0A2V7LMU1      R-----TITLPSDRPPPVALGAPGGA--GGGAQGA---ELDPKFGTFFNMQFDRERIQQD
A0A2V7PBY9      R-----TITLPTDRPPPVALGAPGGA--GGGGGSA-NGEASAQFGTFFNMQFDRERLQQD
A0A3M2BLV5      T---------------EAFTNL--------------TAEEQQLVQRRQDALERLQQLDDQ
A0A2V7KS68      R------TITLPSEQA--GPSA--------------TETRDPIRSNYFDMEADRDQLRRD
A0A2V7N4L3      R------TITLPSERSPSAAVS--------------GDTHDP-RAGFFDIQVERDQVRRD
A0A1Q7AZK2      R------TITLPSDQAADRKAA--------------ADTRDPIRTSFFDMAVERDQLRRD
A0A1Q7TNP7      R------TITLPSDQAADRKAA--------------ADTRDPIRTSFFDMAVERDQLRRD
A0A1Q7KG39      R------TITLPSDQAADRKAA--------------ADTRDPIRTSFFDMAVERDQLRRD
A0A1Q7GX75      R------TITLPSDQT----TG--------------VESRDPRRANFFEMQVDRDQLRRD
A0A1Q7LL80      R------TITLPSDQT----TG--------------VESRDPRRANFFEMQVDRDQLRRD
A0A2V7PFU2      R------TITLPSDQQR-PGAA--------------AETRDPIRASFFDMAVERDQLRRD
A0A2V7MFS9      R------TITLPSDQQAGQAAA--------------AGTRDPIRASFFDMQVERDQLRRD
A0A2V7T933      R------TITLPSDQAADRKAA--------------ADTRDPIRTSFFDMAVERDQLRRD
A0A2V7J4D7      G-----AVTTVAAGAGSVTESS--------------QYPRDPMFAGLVDLKVNLDEVRRD
A0A2V7LN90      G-----AVTQYADGAAPVTPNM--------------EFPRDPAFAGLLGMKVNREELRRD
A0A2V7LFN9      T-----AVTEYAEGAAPVTPNM--------------QYPQDPVFAGLLDLKVRRGDLLRD
A0A2V7MEK4      T-----AVTEYAEGAAPVTPNM--------------RYPQDPVFAGLLDLKVRRGDLLRD
A0A2V7P8B1      RARSDGWGQSSGREQTEVPGLE--------------LQRQQLLAERRTDEDLLAAL--QD
A0A2V7QN41      R-----SAGVLRQGAPPVSATL--------------RGGGDPVFERSFDTKLALDSVQRD
A0A2V7R603      H-----SAGVLRQGAPPVSASL--------------RGGGDPVFERSFDTKLALDSVQRD
A0A2V7LJS2      RARSDGSGQTSGREQTELPGLE--------------LQRQQLLAERRTDETLLKAL--QD
A0A1Q7GLJ7      RARPYGSGGSSAREQSELPGLE--------------LERQQLMAERRTDEALLAAL--RD
A0A2V7GRE3      RAGTYGSRDALAREQAGLAGVE--------------LQRQQLEAERRTDESLLAALRDRD
A0A2V7EU00      K-----TITLPSEQSTPVSPGL--------------EATRDPVFRNFFEMRIMREQLRRD
A0A1Q6WE01      R-----TITLPPDPGAAAAAA----------------AGVQSPMSEFFGLRMAYDQMRRD
A0A2V7S9K3      R-----TITLPPDPGATGTAA----------------PPKGSPLGDFFDLQVEQGQLRRD
A0A1Q7DXB9      R-----AAGVLPAGVAAPPP--------------------SPAFTNAFELRVAVDQHGRD
A0A1Q7JD32      R-----AAGVLPAGVAAPPP--------------------SPAFTNAFELRVAVDQHGRD
A0A2V7MVP8      R-----TAGVLPAGVVTPPP--------------------SPAFTNAFELRVTRDQLGHD
A0A2V7N0A9      R-----NAVRPSEGPAQGPDGR--------------RITADPTYAGYMDLQIAASGLARD
A0A1Q7DLS9      K-----TVSFVADGATPVAPGL--------------QFTHDPGFASYFETKVNLEQVRRD
A0A1Q7JK96      K-----TVSFVADGATPVAPGL--------------QFTHDPGFASYFETKVNLEQVRRD
A0A2V7KQV7      R-----NAVRPSEGPAEGPDGR--------------RITADPTFASYVDLQVAIDGLARD
A0A1Q7JGF6      R-----NAVRPSEGPAQGPDGR--------------RITADPTFASYVDLQVALGALAHD
A0A2V7SG67      R-----NAVRPSEGPAQGPDGR--------------RITADPTFASYVDLQVALGALAHD
A0A1Q7GIK9      H-----NAVRPSEGPAQGPDGR--------------RITADPTFASYVDVQVTLDGLTRD
                                                                           :

A0A2D5ZJF2      ----PERLRQLVESQFGRVGTT-PFNQ-------------EKVQLHRDASQ---------
A0A0S8H9P3      ----KSLYTSLV--DRI--GSV-GLRP-------------GDVQQFVVLSTEEVN-----
A0A1E4BBP7      ----REALERIV--EEGRGRGG-KISL-------------EALRSVGSATASNTS-----
A0A3M2G737      ----IQAFAEKIKSYEDKLGSKSNVNVIAEQNDPYITQLQEQIANLEVQRDVTITQNPAL
A0A0H4TUX7      ----IATLREALGQPGD------SIGV-------------GTLNRLAAVQDIGQNTALGF
A0A1G0LUG0      ----LSTLRGSLGDSAT------QIDV-------------GTLNRLSAVQGIAQNNALGF
A0A1Q7E3T7      ----RRMYRSIL--VSLDSGGG-RGNR-------------EALRTAASTPAISAN-----
A0A1G0L906      ----LSTLQGIM-------GPEAQVTL-------------ETLNRLAALTGIANNTAMTF
A0A1G0LCC0      ----LSTLQGIM-------GPEAQVTL-------------ETLNRLAALTGIANNTAMTF
A0A2D5ZJE2      ----QKSLERRLEHLEG------ELER-------------ARAGLVEDLDDAAAS-----
A0A3M2G624      ----RERIKLFREKVTS------GLQP-------------EDYLLISAIPFQDEEGYGYW
W0RI74          ----RESLERLL--GQIKAPGS-TLAP-------------EILLTVPTLANDPGA-----
A0A3M2BJA6      ----RSALQELMDEIDREATTADPAGP-------------SPYRRLLSFPTLLKN-----
A0A3D4VBZ5      ----REALERIL--QSG--RSGTAITR-------------EAVLSVPAVNADPAA-----
C1A5W1          ----REALERIL--QSG--RSGTAITR-------------EAVLSVPAVNADPAA-----
A0A2V7PX99      ----RRVIEKAL--ADQ--PKS-GLPV-------------EALAVLPTVGT--SP-----
A0A2V7ERC7      ----RMAIERIL--SDA--RGG-PINP-------------QAFLVLPSILNN-TP-----
A0A5Q4D6Y4      ----RSMYQSIL--GELGSADP-GEMG-------------ERIQAIVATPEVAAN-----
A0A2V7JTZ5      ----RQALERMV--SEA--KGGPINPQ-------------DFLQLPTILNN--AP-----
A0A3D4YTR6      ----REALERMI--ADA--KGGPIDTQ-------------GFLQLPTILNN--AP-----
A0A5Q4DA46      ----QSALNRAM--ARS--QQEGRLAT-------------EALEVIPSVRE--ST-----
A0A2V7F1M1      ----RSVYESFL--TKFNTSND-SLRL-------------DVARDLSYTPELAAD-----
A0A2V7KXK7      ----RQQILSLA--TRA--QSS-SVPV-------------QLWNSIPSVQN--DP-----
A0A651HKD3      ----RGALLRAL--EAG--GGA-GIRI-------------QALEAIPAVQS--SS-----
A0A2V7QDU7      ----RRALEQLL--SSTASSVAGSTQS-------------TPIAFPTLLRNEVAA-----
A0A2V7ITT6      ----REAIELAL--AQA--ADS-AASW-------------DALSVIGSVQQ--SP-----
A0A2V7NJW1      ----REAIELAL--AQA--ADS-AASW-------------DALSVIGSVQQ--SP-----
A0A2V7GFB5      ----RAALTRVL--AQP--ADS-GLA--------------SALEVIDAVQH--SP-----
A0A2V7RQ86      ----RAALTRVL--AQP--ADS-GLA--------------SALEVIDAVQH--SP-----
A0A2V7IWX2      ----RQAIDRVL--AQQ--PDS-GLSV-------------DALAAIDAVQK--SP-----
A0A1Q7KE95      ----RDAIEQVL--VQM--RDS-GGSP-------------DGLAFIGAVQR--SP-----
A0A1Q7T8X5      ----RDAIEQVL--VQM--RDS-GGSP-------------DGLAFIGAVQR--SP-----
A0A2V7MS64      ----RAAIDRIL--AQG--SDA-DLAV-------------DALTMIGSVQK--ST-----
A0A2V7Q7N9      ----REAIGRIL--ARG--PDS-ALAV-------------DALATIGSVQK--ST-----
A0A2V7IRW6      ----REAIARIL--AQG--RDS-GLAV-------------DALAMIGSVEK--ST-----
A0A1Q7DVU6      ----REAIARIL--AQG--RDS-GLAV-------------DALAMIGSVEK--ST-----
A0A1Q7JSV2      ----REAIARIL--AQG--RDS-GLAV-------------DALAMIGSVEK--ST-----
A0A2V7FK98      ----RDALERVL--KQA--GDS-GVSP-------------EALAIVGSVQQ--NV-----
A0A2V7R3Z8      ----RDALERVLAQAQA--SDS-GVSP-------------EALAIVGSVQQ--NV-----
A0A2V7J3C0      ----RSAIQQVL--ARM--RDS-GGSP-------------EGLAFIGAVQR--TA-----
A0A2V7KWV9      ----QDALAQVL--AQG--PDSLGFS--------------ERLAAIGAVQG--SA-----
A0A1Q6ZHP2      ----RDALDRLL--AQA--GDS-GLSA-------------EALSVVGLVQA--NP-----
A0A1Q7R6Z6      ----RDALDRLL--AQA--GDS-GLSA-------------EALSVVGLVQA--NP-----
A0A2V7FYT7      ----RDALDRLL--AQA--GDS-GLSA-------------EALSVVGLVQA--NP-----
A0A2V7IGR0      ----RKAILQAL--AQA--RDS-GLSA-------------TALEAIGAVQH--NA-----
A0A2V7MR23      ----RDALQRLL--AQQ--GDS-GLSV-------------EALSVVGLVQQ--NP-----
A0A2V7L1V3      ----REALQRLL--QAR--DSA-GLSA-------------DALAVVGSVQG--NP-----
A0A1Q7E5D3      ----RETLERVL--AQA--GDS-GSSA-------------DALSVIGSVQR--HA-----
A0A2V7ISE2      ----REALGRLL--AQA--GDS-GLSP-------------EALSVVGSVQQ--NP-----
A0A1Q7J2X5      ----REALGRLL--AQA--GDS-GLSA-------------EALSVVGSVQQ--NP-----
A0A2V7NPD1      ----REALGRLL--AQA--GDS-GLSA-------------EALSVVGSVQQ--NP-----
A0A2V7QPD8      ----REALERVL--AQA--GDS-GVSP-------------EALAIVGSVQQ--NA-----
A0A2V7Q8M6      ----REALQRLL--APA--SDSSGLSA-------------DALAVVGSVQG--NP-----
A0A2V7QBC3      ----REALQRLL--APT--SDSSGLSA-------------DALAVVGSVQG--NP-----
A0A2V7LMU1      ----REALQRLL--AQV--RDSTGISP-------------DELAVVGSVQA--NP-----
A0A2V7PBY9      ----REALERVL--AQA--GDTAGLSP-------------DALAVVGSVQS--NP-----
A0A3M2BLV5      ----RQALQNLM--VDIQ-AAG-VEGV-------------DIVAFLAALPQGVNP-----
A0A2V7KS68      ----REAIEGLL--PAGG-G---PLPA-------------DALSAIESVQH--AP-----
A0A2V7N4L3      ----REAIDNLL--AQ-G-WDS-GVPT-------------AALSAIGSVQH--AP-----
A0A1Q7AZK2      ----GDAIDRLL--AQGG-GGD-GLPT-------------EALSAIGSVQH--AP-----
A0A1Q7TNP7      ----GAAIDRLL--AQGG-GGD-GLPT-------------EALSAIGSVQH--AP-----
A0A1Q7KG39      ----GDAIDRLL--AQGG-GGD-GLPT-------------EALSAIGSVQH--AP-----
A0A1Q7GX75      ----RDAIDRLL--AEAG-GAS-GLPT-------------AALSAIESVQH--AP-----
A0A1Q7LL80      ----RDAIDRLL--AEAG-GAS-GLPT-------------AALSAIESVQH--AP-----
A0A2V7PFU2      ----RDALERLL--TQAG-----GLQT-------------DALSAIKSAQD--AP-----
A0A2V7MFS9      ----RDALQRLL--TQ-G-GDS-GLPT-------------DALSAIESAQR--AP-----
A0A2V7T933      ----GDAIDRLL--AQGG-GGD-GLPT-------------EALSAIGSVQH--AP-----
A0A2V7J4D7      ----RTAIERLL--APSTDPTV-EVPV-------------DALSMVGSVQR--ST-----
A0A2V7LN90      ----RDAIGRIL--AQR--PDS-GLAV-------------DALATIGAVQK--ST-----
A0A2V7LFN9      ----RAAIKRIL--AQG--PES-GLMV-------------DALATLASVER--ST-----
A0A2V7MEK4      ----RAAIKRIL--AQG--PES-GLMV-------------DALATLASVER--ST-----
A0A2V7P8B1      SSTSRKAIQTAL--STP--G-------------------------VAPNPA--VV-----
A0A2V7QN41      ----RQALQRAL--AQT--GDS-GPPI-------------EALQAIGAVQK--SA-----
A0A2V7R603      ----RQALQRAL--AQT--GDS-GPPI-------------EALQAIGAVQK--SA-----
A0A2V7LJS2      SSTSRRAIQTAL--STP--G-------------------------VAPSPA--VV-----
A0A1Q7GLJ7      SSTSRKAIQTAL--AAP--G-------------------------MGASPA--LS-----
A0A2V7GRE3      SSVSRKALQTAL--ATP--G-------------------------VAASPS--VM-----
A0A2V7EU00      ----REAVLRVL--AQA--PES-GLAV-------------AGLEVIGTVHN--SS-----
A0A1Q6WE01      ----QLAVAHVL--TQA--HDS-AASI-------------DALAAIGAVQQ--SL-----
A0A2V7S9K3      ----QQAITQAL--DQM--RDS-GASV-------------EGLGFIGAVQR--SP-----
A0A1Q7DXB9      ----RQAIDRVL--AQP--PDS-GLSV-------------DALAAIDAVQK--SP-----
A0A1Q7JD32      ----RQAIDRVL--AQP--PDS-GLSV-------------DALAAIDAVQK--SP-----
A0A2V7MVP8      ----RQAIDRFL--AQ---PDS-GLSA-------------DALVVIDAVQK--SP-----
A0A2V7N0A9      ----REAIAQML--VHA--PDS-GIAV-------------DQLAMIGAVQR--SS-----
A0A1Q7DLS9      ----RAAIERLL--AQV--RDS-GLPV-------------DALAAIGAVDR--ST-----
A0A1Q7JK96      ----RAAIERLL--AQV--RDS-GLPV-------------DALAAIGAVDR--ST-----
A0A2V7KQV7      ----REAITQVV--ARA--RDG-SVPV-------------DELSMIGAVQR--SS-----
A0A1Q7JGF6      ----REAIARVV--AHA--ADS-GVAV-------------DQLAMISAVQH--AS-----
A0A2V7SG67      ----REAIARVV--AHA--ADS-GVAV-------------DQLAMISAVQH--AS-----
A0A1Q7GIK9      ----RAAIAQVL--THA--ADS-GVAV-------------DQLAMIGAVQR--SS-----
                                                                            

A0A2D5ZJF2      --LQLELADLQRQVTSDHPAVESL---------ESKIARIKGELEALDRTTGEAYLELAR
A0A0S8H9P3      RTVQFYYDQLLELLEERSSQLGPL----GKDPSHPVIMALDQRISETQDQLVAAAENAAV
A0A1E4BBP7      --LQAEIAN----LNQARGQLVNL--QKTYTDEYRMVKDLKQQIEVMESQSIPTLVASSL
A0A3M2G737      AGQEAYIEK----MAEINAQIEAL--RSKLQQRTEEYRKSILKDENLTASDILELRTSIF
A0A0H4TUX7      Q-IQNLLT-----LYDQRRTLTAG--ALGLRERNPQVDALSERIRQ-GYQALRGAVSAAL
A0A1G0LUG0      Q-IQSLLT-----QYEERRKLTAG--ALGLRERSPQISALDDRIQQ-GHQALRTAVGAAL
A0A1Q7E3T7      AVVAPLFTQ----LVQYENTRDSLTARSTTHPDVPRLNQLLVATEGKLLRAVQSALKGLI
A0A1G0L906      Q-IQNLLK-----LHDDRRTLVAG--SLGLRESNPQVQAIDQRITQ-AAAALREAANATV
A0A1G0LCC0      Q-IQNLLK-----LHDDRRTLVAG--SLGLRESNPQVQAIDQRITQ-AAAALREAANATV
A0A2D5ZJE2      P-LVIQLREQLVALQIEHTSLLVR----GASEDSPQIIDLESKVKQAKTRLAAETQKIVD
A0A3M2G624      DVLSQLTSQ----LMELEIQLPLK--LEEMTENHPDIIALKNQIQQVRLRLQQQVDARLT
W0RI74          AGVKQTVDE----LTHATVDLRVK--LQTLTDSNPLVVDARRNIAELHDRVLPQRLTDYI
A0A3M2BJA6      QSTSELLRS----LTEVENQRSVL--LQRRTMADDDVQQFTQRIRELEAQ-LRTVATTYL
A0A3D4VBZ5      ENLRRALEE----RAARELELRRL--RETYTDEYQRVKDAQAALVALRDTVVPRSLDAYL
C1A5W1          ENLRRALEE----RAARELELRRL--RETYTDEYQRVKDAQAALVALRDTVVPRSLDAYL
A0A2V7PX99      E-LNTALQE----INQKEADLRAL--RTRYTDASAPVQQARSDLDALEQRTVPALARKLA
A0A2V7ERC7      Q-LRTAIEE----LSSRQAALRTE--QQYLTNANPRIKQLGEAIRVLEIETIPRIAQSVL
A0A5Q4D6Y4      P-VVSSLHAQLMELETERQALTSG--PWGLSQTNPDVARIDQQIATTGGR-LESAVRSHM
A0A2V7JTZ5      Q-LRSAIEE----LSLRQATLRTE--QQFLTDANPRIRQLAEAVRVLERETIPQITVAVL
A0A3D4YTR6      Q-LRSAIEE----LSLRKATLRTE--QQFLTDANPRIKQLAEAVRVLETETIPQITQAVL
A0A5Q4DA46      D-LVRALSL----ASEKRAEVRAL--SLRYHEDWPEVQALRRDIVELEQQTIPALVGTLQ
A0A2V7F1M1      P-VVSRISQQVLVYRTRLDSLTTG--PLPAAPTNPDVLGLKALIRSTQEELVRAV-RAHL
A0A2V7KXK7      V-MKGALDE----LGLKQAQLRQL--RLQYTDSAAPVRQLQSDLTTLEHQQIPSLARILA
A0A651HKD3      E-LMGALEQ----VAEARAERRAL--LQRYTEEYPSVAELDAQLRTLEGQVVPSLAREIL
A0A2V7QDU7      S-LLSALAQ----TEDRRSEL-----LSRRSPQDADVQVLTRRIEDL-RAQLRGIAATYL
A0A2V7ITT6      G-LMQALKE----LTDKQAEQRAL--GYRYTADFSRVGYVREQVDTLERKTIPGLARALI
A0A2V7NJW1      G-LMQALKE----LTDKQAEQRAL--GYRYTADFSRVGYVREQVDTLERKTIPGLARALI
A0A2V7GFB5      E-LKGALQE----LTTKQADLRNL--RYHYTEAYPPLARKAAEVATLERQTIPTLVRSLI
A0A2V7RQ86      E-LKGALQE----LTTKQADLRNL--RYHYTEAYPPLARKAAEVATLERQTIPTLVRSLI
A0A2V7IWX2      E-LTQALKE----LTDKQAELRAL--RYTYTDQHFPVQQLADAVATLDRRTIPGMLRALR
A0A1Q7KE95      D-VSQALRE----LTTKQAERRAL--ASKYTDDHPAVQRLIGEIELLERGTVPTLAQSLI
A0A1Q7T8X5      D-VSQALRE----LTTKQAERRAL--ASKYTDDHPAVQRLIGEIELLERGTVPTLAQSLI
A0A2V7MS64      E-LAQALRD----LTSKQAELRAI--RSRYTDASPAVQRIALDVKTLQRQTIPSLATQLA
A0A2V7Q7N9      E-LSQALHD----LTTKQAELRAL--RTRYADANPAVRRVAVEVQDLERRTIPDLAASLT
A0A2V7IRW6      E-LSQALRD----LTGKVAELRAL--RGRYTDANVAVRRVSDEVAVLEQQTIPALATKLT
A0A1Q7DVU6      A-LIQALRD----LTGKVAELRAL--RGRYTDANVAVRRVSDEVAVLEQQTIPALATKLT
A0A1Q7JSV2      A-LIQALRD----LTGKVAELRAL--RGRYTDANVAVRRVSDEVAVLEQQTIPALATKLT
A0A2V7FK98      Q-LKQALDE----LTTKQAELRAL--RYKYSDEYPLVQRRLSEVATLERQTIPTLARQLM
A0A2V7R3Z8      Q-LKQALDE----LTTKQAELRAL--RYKYNDAYPLVQRRLSEVATLQRQTIPTLARQLM
A0A2V7J3C0      D-VSQALRD----LTVKQADERAL--RARYTPEHHAVQQLRAEIAALEQRTIPALAESLS
A0A2V7KWV9      D-LTRALTE----LTTKRAERRAL--LYRYTDDHPAVQRVTTDLEQLEHQTIPGLIRGLV
A0A1Q6ZHP2      E-LTQALTE----LMTKQAELRAL--RYKYSDAYPPVQRLLGEIATLQRQTIPTLARQLA
A0A1Q7R6Z6      E-LTQALTE----LMTKQAELRAL--RYKYSDAYPPVQRLLGEIATLQRQTIPTLARQLA
A0A2V7FYT7      E-LTQALTE----LMTKQAELRAL--RYKYSDAYPPVQRLLGEIATLQRQTIPTLARQLA
A0A2V7IGR0      D-LAQALKE----LVTKQADLRVL--RYQYTDAYPRVQRLTAEIATLQRQTIPALAQALA
A0A2V7MR23      E-LSQALTE----LNNKQAELRSL--RYKYTDEYMPVQRLLGEIRTLQRQTIPTLARTLA
A0A2V7L1V3      D-LAAALTE----LTSKRANLRAL--RYRYSDQYPPVQRLVGEIGTLERQTIPALARVLL
A0A1Q7E5D3      E-LSQALKE----LTAKQAELRAL--RYRYSDAYPPVQRLLAEIATLKRQAIPVLARALV
A0A2V7ISE2      E-LSEALKE----LTDKQALLRTY--RYKYSDEYPPVQRLLGEIATLQRQTIPTLARALA
A0A1Q7J2X5      E-LSEALKE----LTDKQAQLRAY--RYKYSDEYPPVQRLLGEIATLQRQTIPGLARALA
A0A2V7NPD1      E-LSEALKE----LTDKQAQLRAY--RYKYSDEYPPVQRLLGEIATLQRQTIPTLARALA
A0A2V7QPD8      D-LKQALAE----LTTKQAELRAL--RYKYSDQYPLVQRRLSDVATLERQTIPTLARRLL
A0A2V7Q8M6      D-LAAALTE----LTSKRASLRAL--RYRYSDQYPPVQRLVAEIATLEHQTIPALARGLM
A0A2V7QBC3      D-LAAALTE----LTSKRASLRAL--RYRYSDQYPPVQRLVAEIATLERQTIPALARGLM
A0A2V7LMU1      D-LAAALTE----LTSKRANLRAL--QYRYSDQYPPVQHLTGEIATLERQTIPALARGLL
A0A2V7PBY9      D-LVGALGE----LTSKRASLRAL--RYKYSDQYPPVQRLIEEITTLQRQTIPTLARGLL
A0A3M2BLV5      Q-ITAIAED----IRDKQDEIQRLLTEERVTPDHPRVQAIRTQLARDEGSLRDAVDRHLQ
A0A2V7KS68      E-LANALKE----LGDKRAELRTL--RYHYSDAYPPLQRLAGQVAQLEQQTIPTLARGLA
A0A2V7N4L3      E-LSSALKE----LGDKEAEVRTY--RYHYSDAYPPLQRLLAQVGELQQRTIPSLARALS
A0A1Q7AZK2      E-LSNALKE----LSDKQAQLRTY--RYHYSEAYPPVQRLAREISELQQRTIPTLARALS
A0A1Q7TNP7      E-LSNALKE----LSDKQAQLRTY--RYHYSEAYPPVQRLAREISELQQRTIPTLARALS
A0A1Q7KG39      E-LSNALKE----LSDKQAQLRTY--RYHYSEAYPPVQRLAREISELQQRTIPTLARALS
A0A1Q7GX75      E-LSNALKE----LSDKEAQLRAL--RYHYSDAYPPVQRLAAEIAELQQRTIPTLARALS
A0A1Q7LL80      E-LSNALKE----LSDKEAQLRAL--RYHYSDAYPPVQRLAAEIAELQQRTIPTLARALS
A0A2V7PFU2      E-LSNALKE----LSDKQAQARTY--RYHYSEAYPPLQHLAAEITELQERTIPTLARALA
A0A2V7MFS9      E-LSNALKE----LSDKQAQLRAY--RYHYSEAYPPLQRLVSEIAQLQQRTIPTLARTLA
A0A2V7T933      E-LSNALKE----LSDKQAQLRTY--RYHYSEAYPPVQRLAREISELQQRTIPTLARALS
A0A2V7J4D7      E-LVQGLRD----LTSKQAELRAL--RAHYTDANPPVRRLASEVDELAHRTVPALAASLV
A0A2V7LN90      E-LSQALHD----LTVKQAELRAL--RTRYADANPAVRRVAAEVAELERRAIPGLATSLT
A0A2V7LFN9      E-LSQALRD----LTAKQAVLRAL--RVRYTAEAPAVRRVAAEAATLERQTIPQLATGLA
A0A2V7MEK4      E-LSQALRD----LTAKQAVLRAL--RVRYTAEAPAVRRVAAEAATLERQTIPQLATGLA
A0A2V7P8B1      Q-LNTQLLH----YEMARDSLVSL--SPTHPDLR--------RLSLLIPPTEAKLLRAVQ
A0A2V7QN41      E-LSLALQE----VTQRQATLRAL--RYRYTDASDPVQRVRGEVRTLLQTTIPTLARGLD
A0A2V7R603      E-LSLALQE----VTQRQATLRAL--RYRYTDASDPVQRVRGEVRTLLQTTIPTLARLLD
A0A2V7LJS2      Q-LNTQLFQ----YEIARDSLASL--SPSHPDLP--------RLNLLISSTEAKLLRAVQ
A0A1Q7GLJ7      Q-LSAQLFQ----YEMARDSLASR--SARHPDLP--------RLNLLVSSTEAKLLRAVQ
A0A2V7GRE3      Q-LSTQLYQ----YERARDSLASR--STSHPDLP--------RLNQLVSSTEADLLHAVQ
A0A2V7EU00      D-LVEALKE----LTAKQAELRAL--RYRYTDEHPPVKRLQASIETLERHTIPALAGALL
A0A1Q6WE01      D-LKQALSE----LTTKRAELRAL--RYRYTEDHPAVRRLTTDIDVLQRQAIPGLARALH
A0A2V7S9K3      E-LSDALRE----VTTKRAELRAL--RYRYTDDHPTVRRLAAEIDVLEHQTIPVLVRTLL
A0A1Q7DXB9      E-LTQALKE----LTDKQAELRAL--RYTYTDQHFPVQQLADAVATLERRTIPGMLRALR
A0A1Q7JD32      E-LTQALKE----LTDKQAELRAL--RYTYTDQHFPVQQLADAVATLERRTIPGMLRALR
A0A2V7MVP8      E-LMQALKE----LTDKQAELRAL--RYTYTDQNFPVQQLADAVATLEHRTIPALLRAVR
A0A2V7N0A9      E-LIAALKE----LTDRQAELRAL--RFRYADTHPPVRRLAAQVDTLARRVIPGLGRALI
A0A1Q7DLS9      E-LVAALRE----LTAKRAELRAL--QQRYTEEHGTVRRLAGEVQALEGRTIPALARVLV
A0A1Q7JK96      E-LVAALRE----LTAKRAELRAL--QQRYTEEHGTVRRLAGEVQALEGRTIPALARVLV
A0A2V7KQV7      A-LAAALKD----LADRQAELRVL--RFRYADTHPPVRRLAQQVDTLARYVIPELGGALV
A0A1Q7JGF6      E-LTAALKE----LSDRQAELRVM--RFRYADTHPPVRRLAQQVDTLARRVIPELGRAVV
A0A2V7SG67      E-LTAALKE----LSDRQAELRVM--RFRYADTHPPVRRLAQQVDTLARRVIPELGRAVV
A0A1Q7GIK9      E-LTAALKE----LTDRQADLRAL--RFRYADTHPPVRRLALQVDTLAQRVIPGLARTLM
                                                                            

A0A2D5ZJF2      QQWLVA-----------------------RERETELDQRYRTQLVEAQELGA-------K
A0A0S8H9P3      AL---------------------------DTRIGALTGRLSNLQAELRQLPA-------V
A0A1E4BBP7      QEL--------------------------RSREAEMKRRIDGASQELKQIPA-------R
A0A3M2G737      AAQ--------------------MEMQTLKTKKEILDSTIADYERKIKTLPQ-------K
A0A0H4TUX7      ESL--------------------------ESRTEALDQRVASARARLRTFPG-------K
A0A1G0LUG0      ESI--------------------------EARRQALDLRVQELRGTLGTFPG-------K
A0A1Q7E3T7      ASL--------------------------DVRIATLDDLRVRRVANVEQRSS-------T
A0A1G0L906      RGI--------------------------QANIASLDQNVANLRQRLGTYPG-------K
A0A1G0LCC0      RGI--------------------------QANIASLDQNVANLRQRLGTYPG-------K
A0A2D5ZJE2      RDLLPGDPLLYSQGLVEKVLELRTELETARSRAAELNRFVADYATKLHSLPD-------K
A0A3M2G624      M-L--------------------------DSREESLRLQLLPYQQQLETFPL-------K
W0RI74          ATL--------------------------RTRESQYGQELQTATHELQGIPE-------R
A0A3M2BJA6      QGL--------------------------TNQVQSYDQTLEQFAAQLEVIPQ-------K
A0A3D4VBZ5      GEL--------------------------RLREQTLNSTIEQSSKDLKGIPS-------R
C1A5W1          GEL--------------------------RLREQTLNSTIEQSSKDLKGIPS-------R
A0A2V7PX99      ADL--------------------------SAREAALTPQVDSAFGYMRTVPP-------L
A0A2V7ERC7      ESL--------------------------RSRENQLTGRIDTQERVLRQIPS-------R
A0A5Q4D6Y4      QNL--------------------------DARLAAMTDLRARTAAQIAGRPQ-------A
A0A2V7JTZ5      NSL--------------------------KAREPELDTRISVGSQELRGIPA-------R
A0A3D4YTR6      NSL--------------------------KAREPELGARIDVGSQELRAIPA-------R
A0A5Q4DA46      SEM--------------------------QARESEIERFVGRASSELQQIPP-------R
A0A2V7F1M1      TSI--------------------------GAQSQALAALRSRTGASFQRLPA-------T
A0A2V7KXK7      GTL--------------------------GEVVATTKPRADTAIGQLRAAPS-------I
A0A651HKD3      EDL--------------------------EARLGEVTSRLQTRSAELGAIPT-------R
A0A2V7QDU7      QGL--------------------------SNQVVAIDLTLAKSNAQLQTIPA-------K
A0A2V7ITT6      REL--------------------------AMRESVGDARIRLASQDLRQIPP-------R
A0A2V7NJW1      REL--------------------------AIRESVGDARIRLASQDLRQIPP-------R
A0A2V7GFB5      DEL--------------------------GTRMAELDRRIGSASQELRRIPA-------R
A0A2V7RQ86      DEL--------------------------GTRMAELDRRIGSASQELRRIPA-------R
A0A2V7IWX2      NNL--------------------------AARERDLGQRVDSTVRYLSNIPP-------L
A0A1Q7KE95      DEL--------------------------TARERVLAPQVAAADRDLRRIPQ-------R
A0A1Q7T8X5      DEL--------------------------TARERVLAPQVAAADRDLRRIPQ-------R
A0A2V7MS64      SEL--------------------------GLRETELAQRINAASTGLRRIPP-------L
A0A2V7Q7N9      REM--------------------------QFREVELAQRVDSAASNLRRIPP-------L
A0A2V7IRW6      QEM--------------------------AVQEAGLAQRVDSAAGGLRRIPP-------L
A0A1Q7DVU6      QEM--------------------------AVQERVLAQRVDSAAGGLRRIPP-------L
A0A1Q7JSV2      QEM--------------------------AVQERVLAQRVDSAAGGLRRIPP-------L
A0A2V7FK98      AEL--------------------------SGREAELGRRVTADARSIQAVPP-------R
A0A2V7R3Z8      AEL--------------------------SGRDAELGRRVAADTRSIQLVPP-------R
A0A2V7J3C0      AEL--------------------------LARERVLAPQIAAGEHELRGIPQ-------R
A0A2V7KWV9      AEL--------------------------ATQRRALASQLETGGRELQGIPQ-------R
A0A1Q6ZHP2      GQL--------------------------AAKETELGRRVDADSRTLKQIPA-------R
A0A1Q7R6Z6      GQL--------------------------AAKETELGRRVDADSRTLKQIPA-------R
A0A2V7FYT7      GQL--------------------------AAKETELGRRVDADSRTLKQIPA-------R
A0A2V7IGR0      GEL--------------------------AAREAELGRRVETGSQNLRQIPP-------R
A0A2V7MR23      GQL--------------------------AAKEAELGRRTDADSRTLRQIPA-------R
A0A2V7L1V3      DQL--------------------------AAREAELGRRLGADSRSLQQIRA-------R
A0A1Q7E5D3      GEL--------------------------ASRETELGRRVDADSRTLRQIPP-------R
A0A2V7ISE2      GQL--------------------------AGKEAELGRRVDADSRSLRQIPA-------R
A0A1Q7J2X5      GQL--------------------------AGKESELGRRVDADSRSLRQIPG-------R
A0A2V7NPD1      GQL--------------------------AGKEAELGRRVDADSRSLRQIPG-------R
A0A2V7QPD8      AEL--------------------------SGREAELGRRVAEDTRSIQAVPP-------R
A0A2V7Q8M6      DQL--------------------------AARETELGRRLGTDSRSLRQIPA-------R
A0A2V7QBC3      DQL--------------------------AAREMELGRRLGADSRSLRQIPA-------R
A0A2V7LMU1      DQL--------------------------TARDAELGRRLGADSKSLRQIPA-------R
A0A2V7PBY9      AQL--------------------------TAREADLGRRLGTDSRTLRDIPA-------R
A0A3M2BLV5      -GI--------------------------DREMAEVRTELDRIQEAQRRFPQ-----LQN
A0A2V7KS68      AQL--------------------------AARESEIGRQVDAASTDLRQIPA-------R
A0A2V7N4L3      SQL--------------------------AARATELGRQVDAASPGLRQIPG-------R
A0A1Q7AZK2      AQL--------------------------ATRESELGRQVGAASRDLRQIPA-------R
A0A1Q7TNP7      AQL--------------------------ATRESELGRQVGAASRDLRQIPA-------R
A0A1Q7KG39      AQL--------------------------ATRESELGRQVGAASRDLRQIPA-------R
A0A1Q7GX75      VQL--------------------------AARESELGRHVDAASSDLRQIPA-------R
A0A1Q7LL80      VQL--------------------------AARESELGRHVDAASSDLRQIPA-------R
A0A2V7PFU2      SQL--------------------------ADRESELERQVNSASNDLRQIPG-------R
A0A2V7MFS9      SQL--------------------------ASRESELGRQVDAASHDLRQIPG-------R
A0A2V7T933      AQL--------------------------ATRESELGRQVGAASRDLRQIPA-------R
A0A2V7J4D7      AEL--------------------------RVRESELVQRVDAASSSIQKIPP-------L
A0A2V7LN90      REM--------------------------AFREAELAQRVDSAATDLRRIPP-------L
A0A2V7LFN9      REL--------------------------ERRAAELGQRADSVARDLRRIPP-------L
A0A2V7MEK4      REL--------------------------ERRAAELGQRADSVARDLRRIPP-------L
A0A2V7P8B1      AGV--------------------------QGAIASLDGRIAA----INDLRARRAGNLQH
A0A2V7QN41      ADL--------------------------AAREEALSRRADAAFGYLHDLPP-------L
A0A2V7R603      ADL--------------------------AAREEALSHRADAAFGYLHDLPP-------L
A0A2V7LJS2      AGV--------------------------QGAIASLDGRIAA----INDLRARRAGNLQH
A0A1Q7GLJ7      AGV--------------------------QGSIASLDGRIAA----IDDLRAHWAGGLQQ
A0A2V7GRE3      GGV--------------------------QSAIASLEGRITA----MNDLRARQQQLSTS
A0A2V7EU00      EEV--------------------------GTRERVLDSLVQSGGRELQQIPL-------R
A0A1Q6WE01      AEL--------------------------GARAQTLATEISAGGRELQAIPQ-------R
A0A2V7S9K3      TEL--------------------------GTRQRLLASEVAAGGRALQAIPQ-------R
A0A1Q7DXB9      NNL--------------------------AAREHDLGQRVDSTVRYLSNIPP-------L
A0A1Q7JD32      NNL--------------------------AAREHDLGQRVDSTVRYLSNIPP-------L
A0A2V7MVP8      DNL--------------------------AVRERDLGQRVDSTVRYLSNIPP-------L
A0A2V7N0A9      AGL--------------------------AARERELRQRADSITGVLRRAPP-------A
A0A1Q7DLS9      SEL--------------------------AARDAELTQRVRAASAELRQIPS-------L
A0A1Q7JK96      SEL--------------------------AARDAELTQRVRAASAELRQIPS-------L
A0A2V7KQV7      AAL--------------------------AAREHELQQRIDSIARALRGAPP-------V
A0A1Q7JGF6      AGL--------------------------AAREHELQQRIDSISRDLRSAPP-------V
A0A2V7SG67      AGL--------------------------AAREHELQQRIDSISRDLRSAPP-------V
A0A1Q7GIK9      DGL--------------------------AARARELASRRDSIARDLQSAPP-------V
                                                                            

A0A2D5ZJF2      ATELAKLESEVSKTEKMLDILDDRIKEVDVTEKADVLNINILEYAEVEDEPSKP--EKAR
A0A0S8H9P3      ESELTRLQNEVEIHSDMYKYLLSRYQESQIAEAEISPYVEVLDPA-SWARPVSG--GRRI
A0A1E4BBP7      TVEEMRLNRELQIAQTMYVDLQQRAMSARLSERNALPDVSILDTAVAPRFPSSD--TTLS
A0A3M2G737      SIDYARLVRQRSSAEKLYLLVEQHYNEASIAEQSEFGNVEIIESAETPTKPINP-PKPLR
A0A0H4TUX7      ESRIAQLQLEASILNDTYRYLLTEYESARLTEATIGPYINLLDPA-SPAFRVGT--TLRQ
A0A1G0LUG0      QSRIAQLQLETSIHNDTYRYLLGQLEAARLQENTIAPYINLLDPA-SPAFRIGR--TPWQ
A0A1Q7E3T7      DAEEARLEERVENGRKIADELRIEYQRARIAEAVEVGHVEIVDLAVPPTAPLGI--GFAE
A0A1G0L906      ETRFAQLALDIELQNGIYKYLLSELESARISAATISPYIQIVETATVAARIGVG---TRQ
A0A1G0LCC0      ETRFAQLALDIELQNGIYKYLLSELESARISAATISPYIQIVETATVAARIGVG---TRQ
A0A2D5ZJE2      ELALARKTREYTVNENTYLMMKEKYEEVRISEAGEIGNVRIIDAALPFLDPVRP--NRRM
A0A3M2G624      EVELARLEREFRLNEEIYSLLTRQHEQTRLAEAAIVNDIQVLDYASIPTAPIGGGPNRQK
W0RI74          TIQTGVLARERDVRAEIYTKLRTASAQAQLAQQSAVPDVKILDTAITPLAPSSN--TAPT
A0A3M2BJA6      QVQLARLEREEKVLSELFTLLQTRLKEAQIAQAVEDASIRVVDPAILPSEPIKP--KTVL
A0A3D4VBZ5      TIEEQRLKRQVEVAARVYESLNMKAAEAKLAEASTIPDVSILDAAVPPLSPTRN--TAPM
C1A5W1          TIEEQRLKRQVEVAARVYESLNMKAAEAKLAEASTIPDVSILDAAVPPLSPTRN--TAPM
A0A2V7PX99      ALEEDQLKRAVAGAEAFSATVNQRYEAARLGLISSSPDVRLLDSAVQPGKPSLD--LGPL
A0A2V7ERC7      SIEEMRLVRRVSASETMYNSLKARYEEVSLAEAQTTPDLSILDYAIPPVHPTSN--GARR
A0A5Q4D6Y4      LAEEERLLQDVASIRRTMEQLQDEFYRARMAEAVEEGPVQIVDLAPTPHTSEQA--GLPL
A0A2V7JTZ5      ATEEARLVRQVAATENLYNSLKARYEEVSLAEVQTAPDLSVLDTAVAPTLPTSN--DAPR
A0A3D4YTR6      ATEEMRLARRVVASESLYNTLKARYEELSIAEAQTTPDLAVLDTAVGPNFPTSN--DAPR
A0A5Q4DA46      VVEEARLTREYQSAENLFRDLQGRFENARLGAVSTVPDVRILVRAQVPEFPSSD--PRNQ
A0A2V7F1M1      EAEGGRLERLVEDLRSTGDRIRQDYKNARMAEAISAGDARVIDWAPLPYKAAGI--PPWA
A0A2V7KXK7      ALEGSRLEREQRLAEEQFNNVDGEYQKAKLGLISALPDVRVLDPAQEPRRPAAD--FGPL
A0A651HKD3      SIREASLRREVGRAETLYEDVSQRYESARLASISADPNVRVVDWAEPPTHPESD--RSTL
A0A2V7QDU7      EIRLAQLERNVSGLAQIYTQLESRLKESEIAAAAEDPSVRLVDAALLPREPVSP--RRAF
A0A2V7ITT6      AIQEGRLRREVAVAENLFTTLQQRYEEARLAEASSIPDVRVLDVATPPLVPVRN--TAPG
A0A2V7NJW1      AIQEGRLRREVAVAENLFTTLQQRYEEARLAEASSIPDVRVLDVATPPLVPVRN--TAPG
A0A2V7GFB5      SVEEARLRRSVTIADNLYTSLQQNYEAAKLAEASSIPDIRIFDKAVVPLQPVKN--TAPR
A0A2V7RQ86      SVEEARLRRSVTIADNLYTSLQQNYEAAKLAEASSIPDIRIFDKAVVPLQPVKN--TAPR
A0A2V7IWX2      LFEQTRLEREVQVAGQLYASLQQRYDEARVAEASALPDVRILDAPVQPYQPIGS--VAPF
A0A1Q7KE95      AIEEARRRRDVDLATNLYTSVQQRYDEARLAEASSVADVRILDAAVPPQESLGN--STLR
A0A1Q7T8X5      AIEEARRRRDVDLATNLYTSVQQRYDEARLAEASSVADVRILDAAVPPQESLGN--STLR
A0A2V7MS64      AVEEERLVREVTLRDQAVSNLTARYQEARLAEVSAIPDVRLIDPAVQPEDPAAS--WTKI
A0A2V7Q7N9      AVEETRLEREVTRGEQAVASLQTLYDEARLAEVSAIPDVRLVDPAVQPEEPTEN--WRPV
A0A2V7IRW6      AVEETQLQRSVTLAEQVVTNLQQRYEEARLAEVSAIPDVRLIDPAIEPQQPAAS--WAVL
A0A1Q7DVU6      AVAETQLQRDVTLAEQVVTNLQRRYEEARLAEVSAIPDVRLIDPAIEPQQPAAS--WSVL
A0A1Q7JSV2      AVAETQLQRDVTLAEQVVTNLQRRYEEARLAEVSAIPDVRLIDPAIEPQQPAAS--WSVL
A0A2V7FK98      AIDEARLQRQVTLAENLFTSLQKNYDEARLAEESAVPDARILDHAVVPQDPVRN--TAPR
A0A2V7R3Z8      AIDEARLQRQVTLAENLFTNLQKNYDEARLAEESAVPDARILDHAVVPQDPVRN--TAPR
A0A2V7J3C0      AIDEARLRRDLELATNLFTGVQQRYDEARLAEASSIADVRILDVAVPPQEPLKD--TASR
A0A2V7KWV9      AIEDARLRRDVSIAENLFTSVQQRYSEARLAEASSIADVRVLDAAVAPETPVKN--TAAR
A0A1Q6ZHP2      AIEEARLRRDAALAENLYLSLQGKYDEARLAEASTLSDVRVLDSAVVPRRPVKN--TRRR
A0A1Q7R6Z6      AIEEARLRRDAALAENLYLSLQGKYDEARLAEASTLSDVRVLDSAVVPRRPVKN--TRRR
A0A2V7FYT7      AIEEARLRRDAALAENLYLSLQGKYDEARLAEASTLSDVRVLDSAVVPRRPVKN--TRRR
A0A2V7IGR0      AIDEARLRRDMTLAENLYATLQQRYEEARLAEASTIPDVRILDSAVSPQRPVKN--TAPR
A0A2V7MR23      AIEEARLRRDAGLAENLYTGLQAKYDEARLAEVSSLSDVRVLDSAVVPRRPVKN--TAPR
A0A2V7L1V3      AIEEARLRRTKTMSENLYTMLKERYEEARLAEASTIPDVRILDAAVVSREPVSA--MGGR
A0A1Q7E5D3      LIEEARLRRADTLAANLYTTLQQRYEEARLAQASTVPDVRILDSAVVPQRPVKN--RAPR
A0A2V7ISE2      TIEEARLRRDASLAENLYTSLQQKYDEARLAEASTLADVRVLDSAVVPRRPVKN--TAPR
A0A1Q7J2X5      TIEEARLRRDASLAENLYTSLQQKYDEARLAEASTLADVRVLDSAVVPRRPVKN--TAPR
A0A2V7NPD1      TIEEARLRRDASLAENLYTSLQQKYDEARLAEASTLADVRVLDSAVVPRRPVKN--TAPR
A0A2V7QPD8      AIDEARLQRQVTLAENLFTSLQKNYDEARLAEESAVPDARILDHAVVPQDPVRN--TAPR
A0A2V7Q8M6      AIEEARLRRTLSMAEDLYTLLQKRYEEARLAEASTIPDVRILDAAVVSREPVSS--AGGR
A0A2V7QBC3      AIEEARLRRTLSMAEDLYTLLQKRYEEARLAEASTIPDVRILDAAVVSREPVSS--AGGR
A0A2V7LMU1      AVEEARLRRSVTMAENIYTMLQQRYEEARLAEASTIPDVRILDAAVVSRQPVRD--LAGR
A0A2V7PBY9      AIEEARLRRDVSLSENLFTMLQQRYEEARLAEASTIPDVRILDAAVVSRRPVQD--LAGR
A0A3M2BLV5      RYDELDLQRSIDREMVLYLQ-SQLYQAQILAQGAGDGFIDVVDPPGAPIE-VTP--RGKI
A0A2V7KS68      TIEEVRLRRNADLKEQTYTSLQQRFDQARLAAESTVPDVRVLDPAVVPQRPVKN--TTPR
A0A2V7N4L3      TIEEARLTRNAQLKEQTYTQLQQRFDQARLAAEATVPDVRILDPAIVPQRPFKN--TAPR
A0A1Q7AZK2      DIEDVRLNRNAQLKEQTYTALQQRFDQARLAAEATLPDVRILDPAVVPQRPVKN--TAPR
A0A1Q7TNP7      DIEDVRLNRNAQLKEQTYTALQQRFDQARLAAEATLPDVRILDPAVVPQRPVKN--TAPR
A0A1Q7KG39      DIEDVRLNRNAQLKEQTYTALQQRFDQARLAAEATLPDVRILDPAVVPQRPVKN--TAPR
A0A1Q7GX75      TIEEARLNRNVQLKEQTYTALQQRFDQARLAAEATVPDVRILDSAIVPQRPVKN--TASR
A0A1Q7LL80      TIEEARLNRNVQLKEQTYTALQQRFDQARLAAEATVPDVRILDSAIVPQRPVKN--TASR
A0A2V7PFU2      AIEEVRLNRNVELKEQTYTQLQQRYDQARLSAEATVPDVRVLDPAVVPQRPVKN--TAPR
A0A2V7MFS9      AIEEVRLNRNAQLKEQTYTALQQRYDQARLAAEATVPDVRILDPAIVPQRPIKN--TAPR
A0A2V7T933      DIEDVRLNRNAQLKEQTYTALQQRFDQARLAAEATLPDVRILDPAVVPQRPVKN--TAPR
A0A2V7J4D7      AVEESRLQRGVTLAEQTVTNLQARYEEARLAEISAIADVRLLDRAVEPQVPVGH--MRAI
A0A2V7LN90      AVEETRLEREVTRGEQAVASLQTLYEEARLAEVSAIPDVRLVDPAVQPEEPAEN--WRPL
A0A2V7LFN9      AVEETRLQRDVTQSAQTVANLQQHYEEARLAEASSIPDVRFVDPALEPQEPTEN--WAPV
A0A2V7MEK4      AVEETRLQRDVTQSAQTVANLQQHYEEARLAEASSIPDVRFVDPALEPQEPTEN--WAPV
A0A2V7P8B1      DADEARLTERLDNARKVADALRTEYQKAGIAEAVTVGQVEIVDHATLPTKPAGI--GLVE
A0A2V7QN41      ALEEARLQRDVAIAEQLFTTVQQSYNQTQLAAVSTLPDVRILDRATAPDRPDRD--LTPL
A0A2V7R603      ALEEARLQRDVAIAEQLFTTVQQSYNQTQLAAVSTLPDVRILDRATAPDRPDRN--LTPL
A0A2V7LJS2      VAQEARLTERVENARKVADELRTEYQKAGIAEAVTVGQVEIVDHATLPMKPAGI--GLAE
A0A1Q7GLJ7      DAEEARLKERVDNARKVADELRVEYQKAGIAEAITVGQVEIVDHAALPAKPAGI--GLPE
A0A2V7GRE3      EEEEARLTERVDNAQKVADELRVEYQKAKIAEAVTVGQVEIVDHAALPAKPAGI--GLPE
A0A2V7EU00      AVEEARLRREVTIAENLYTTLQQRYEEARLAEASTIPDVRVLDAAVVPHQPIKN--TAPR
A0A1Q6WE01      SIEEGRLRRDVSIAENLYASVQQRYNEARLGEASTVADVQVLDAAVSPQEAAKN--TASR
A0A2V7S9K3      AVEEARLRRDVAIAENLYSSVQQRYDEARLAEASTVADVRILDAAVAPQDPVKD--MTRR
A0A1Q7DXB9      LFEQTRLEREVQVAGQLYASLQQHYDEARVAEASALPDVRILDAPVQPYQPIGS--VAPF
A0A1Q7JD32      LFEQTRLEREVQVAGQLYASLQQHYDEARVAEASALPDVRILDAPVQPYQPIGS--VAPF
A0A2V7MVP8      LFEQTRLEREVQVAGQLYASLQQHHDEARVAEASAVPDVRILDAPDQPYRPLGS--LAPF
A0A2V7N0A9      ALEEVRLARDQANAEQLFSDLQHRYQEARLAEVSTLPDVRILERAVQPTRPATN--TAPL
A0A1Q7DLS9      AIEDARLRREVANAERLFTSIQQRYDEARLAEVSTIPEVSVLDAAVEPEEPLLD--PTPF
A0A1Q7JK96      AIEDARLRREVANAERLFTSIQQRYDEARLAEVSTIPEVSVLDAAVEPEEPLLD--PTPF
A0A2V7KQV7      ALEEIRLARDQANATELFSNLEQRYNEARLAEVSTLPDVRILERASRPARPVVN--ATPL
A0A1Q7JGF6      ALEEVRLARDQANAEQLFSNLQQRYQEARLAEVSTLPDVRILEPAVRPTRPVSD--TAPL
A0A2V7SG67      ALEEVRLARDQANAEQLFSNLQQRYQEARLAEVSTLPDVRILEPAVRPTRPVSD--TAPL
A0A1Q7GIK9      ALTEIRLARDQTNAEQLFSNLQQRYQEARLAEVSTLPDVRILERAVRPTRPASR--TAPL
                                             :          ..  .               

A0A2D5ZJF2      IMGAALVAGLILGAGLALLVDWKDHRFRSADEITAIL-GVPVLGVVPSMSRKASRPDHGQ
A0A0S8H9P3      NIIFGGLLGLLLGLGAAFFLEYLDRSLKSTSDVETSL-GVPVLGWIPKITGDGQRRISLV
A0A1E4BBP7      IILVAIAASIGLGLALAILLDRLDKRFRYPEQATHEL-GLDIVGAIPTYRNPTSAAARLE
A0A3M2G737      TVFLGGFLGLGLGLGIVFVREFFNTQIRTPEDIKKR--GYTLLSVIPSMSLDNANRKKRK
A0A0H4TUX7      KIVLGMLVGLLLGLGGAFFLEYLDQTIKNAGDVERVI-GVPVLGLIPHDPALRRSGNGKP
A0A1G0LUG0      TAMLGLLVGLLLGFGAAFLLEYLDQTIKSAADVERAL-GVPVLGQIPDDQRLARGNSHRG
A0A1Q7E3T7      RLALGLLFGLVLGGGSAWLTEHLRSSIARPNEIV-EL-GLPLLGAVPRCQDGRNGSSVKA
A0A1G0L906      KVTIGLLVGLFLGIVAAFFLEYLDQTIKTAADVERAL-EIPVLGLIPLDPRGPHDGPQRN
A0A1G0LCC0      KVTIGLLVGLFLGIVAAFFLEYLDQTIKTAADVERAL-EIPVLGLIPLDPRGPHDGPQRN
A0A2D5ZJE2      NALLGLVVGLGLALSLAFFFEYLDTSLRTIDEVEQKL-DTVVLGAVAALEEAAEAEDESA
A0A3M2G624      AILLGALLGIGVGLGVAFLLEFLDNTIRETDEIERHI-QLPVYGMIPQIESIKNGRRTHK
W0RI74          FIGGGLFAGLVIGIGLAFLLDLLDNRFRYPEQARVDL-GLEVLGVVPVVDQSGRQSP---
A0A3M2BJA6      NIALGLILGMMLGVGLAFTREHMDDTVHTREDLVEATGGAPIMGMIPRIRQRGLRPSKTS
A0A3D4VBZ5      IILGAVGAALALGLLLAIVLDQLDKRFRYPEQATDDL-GLFVLGVVPVIGGKGRRNA---
C1A5W1          IILGAVGAALALGLLLAIVLDQLDKRFRYPEQATDDL-GLFVLGVVPVIGGKGRRNA---
A0A2V7PX99      LIALSFLTSLGLGMVGAVVLDRADPRVRTPEQVTRGM-RLPILAALPHVSLRQAPGASLR
A0A2V7ERC7      LLILAVLASIALACAIALIRDRFDRLFRYPKEATHEL-GLIIAGTVPRFKPNRRGDFQLL
A0A5Q4D6Y4      MLVLGLMLGAMVGSGGAFLLEMLNTKVRRREDMEDAM-QVTTMGIIPRLSSGGRKRL---
A0A2V7JTZ5      LLLLAVVASMGLAVGIALIRDRLDRRFRYPEQATREL-GLSVAGTVPKFKANHRGEFQIA
A0A3D4YTR6      LLLLAVAASIGLAFGIALILDRLDPRFRYPEQATHDL-GLSITGTVPRIKANGRGDIKLE
A0A5Q4DA46      FGLMAILAGLALGLVGAIVRDRMDPVLRRPDQVSGDL-GLPILATIPHVRSRNGRLR---
A0A2V7F1M1      KLGLGLLLGLLLGCGAAGLAESGNSLLMRPEELERAL-NVRDLGVIPPLLETSASRPLRR
A0A2V7KXK7      LILLAAMASFGLAVMGVTLRDKMDPKVRYPEQITGRM-QLPILGAVPHVSWRLGANG---
A0A651HKD3      MAMVVFFGFMGGGLVGALVLDRADRRVRSPADVEWQL-GVQVLGAIPHLRTRGGRVQ---
A0A2V7QDU7      SIVLALLGGLTLGLGAALTREHLDRAVHTRHDLLAVT-GRPVLGIIPHADGEMWSARLAR
A0A2V7ITT6      VILGAFLGSMALGLVGVVRRDRADPRVRCPEQVTHDI-GLPILGVLPHVKVRGAGPE--D
A0A2V7NJW1      VILGAFLGSMALGLVGVVRRDRADPRVRCPEQVTHDI-GLPILGVLPHVKVRGAGPE--D
A0A2V7GFB5      LLLLGFLGGLGLALAGVVLLDRFDPRVRYPEQVSHDL-GLPILGAVPHLKARTG------
A0A2V7RQ86      LLLLGFLGGLGLALAGVVLLDRFDPRVRYPEQVSHDL-GLPILGAVPHLKARTG------
A0A2V7IWX2      LVIMAFLASAGLGVLGAVVIDTLDPRFRDPGHVTQGL-GLRILGALPHLS----------
A0A1Q7KE95      FIVLGLAAGLGLGLVGAVVGDRLDPRMRYPEQVTRQM-GLPILGVLPHVKDRG-------
A0A1Q7T8X5      FIVLGLAAGLGLGLVGAVVGDRLDPRMRYPEQVTRQM-GLPILGVLPHVKDRG-------
A0A2V7MS64      LIALALLGGLSAGIAGAVVLDQNDKRVQYPEEVTGAL-GLTILGAVPHLERNG-------
A0A2V7Q7N9      LIALAFLASLGAGVAGAAVLDHTDRSVRYPQQVTGAM-GLPILGAVPHLNRNG-------
A0A2V7IRW6      LVVLAFLGSLGAGVAGAVVRDRTDRRVHYPEHVTGTM-GLAILGAVPHLERGR-------
A0A1Q7DVU6      LVALAFLGSLGAGVAGAVLRDRTDRHVHYPEHVTGTM-GLAILGAVPHLERGR-------
A0A1Q7JSV2      LVALAFLGSLGAGVAGAVLRDRTDRHVHYPEHVTGTM-GLAILGAVPHLERGR-------
A0A2V7FK98      VVFLGFAASLALGLCGAVVLDRIDPKVRYPDQVSRGL-GIPILGAVPHLRNLPRGGR--G
A0A2V7R3Z8      VIFLGFAASLALGLCGAVVLDRIDPKVRYPDQVSRGL-GIPILGAVPHLRNLPRGGR--G
A0A2V7J3C0      LLVLGFIAGLGLGLVGAVVADRVDPRMRYPDQVTRQM-GLPILGVLPHVKDRA-------
A0A2V7KWV9      LLILGLFAGLGLGVVGAVVVDRFDPRVRYPAQVTTDM-GLRILGALPHVKKRA-------
A0A1Q6ZHP2      VILLAFFGSFAMAVVGAVLIDRVDPRVRYPDQVSREM-GLTILGAVPHIRAGARPER--S
A0A1Q7R6Z6      VILLAFFGSFAMAVVGAVLIDRVDPRVRYPDQVSREM-GLTILGAVPHIRAGARPER--S
A0A2V7FYT7      VILLAFFGSFAMAVVGAVLIDRVDPRVRYPDQVSREM-GLTILGAVPHIRAGARPER--S
A0A2V7IGR0      IVLFALFASLGLAVAGAVLLDRVDPRVRYPEQVSRGM-GLTILGAVPHLRKSEAQRQ--G
A0A2V7MR23      VILLAFFGSFALAVLGAVLIDRIDPRVRYPDQVSREM-GLTILGAVPHIRPGARP-E--R
A0A2V7L1V3      LILLGFCGSFGLAVVGAVLLDRVDPRVRYPDQVSREM-GLAILGAVPHLRTLPHAGR--H
A0A1Q7E5D3      VILLAFFASFGLAVMGAVFIDRVDPRVRYYDQVSREM-GLTILGAVPHLRPRAGLGR--S
A0A2V7ISE2      VILMAFFGSFALAVMGAVLIDRIDPRVRYPDQVSREM-GLTILGAVPHVRPGARPTP--R
A0A1Q7J2X5      VILMAFVGSFALAVMGAVLIDRIDPRVRYPDQVSREM-GLTILGAVPHVRPGARPTP--R
A0A2V7NPD1      VILMAFFGSFALAVMGAVLIDRIDPRVRYPDQVSREM-GLTILGAVPHVRLGARPTP--R
A0A2V7QPD8      VVFLGFAASLALGLCGAVVLDRIDPKLRYPDQVSRGL-GIPILGAVPHLRNLPRGGR--G
A0A2V7Q8M6      MILLGFCGSFGLAVVGAVLLDRIDPRVRYPDQVSREM-GLAILGAVPHLRTLPHAGR--H
A0A2V7QBC3      LILLGFCGSFGLAVVGAVLLDRIDPRVRYPDQVSREM-GLAILGAVPHLRTLPHAGR--H
A0A2V7LMU1      MILLGFCGSFGLAVVGAVLLDRIDPRVRYPDQVSREM-GLTILGAVPHLRTLPH-GR--H
A0A2V7PBY9      LIVMGFCGSFGLAVVGAVLLDRIDPRVRYPDQVSREM-GLAILGAVPHMRTLAH-GR---
A0A3M2BLV5      NLMLGALLGLILGVGAAFFLEYLDRTVRTSADVETLL-GIPVLGIIPRLRKVDEEDD--R
A0A2V7KS68      LLLLGLIAGLGLGMVGAVVLDRVDPKVRYPEQVSREL-GLPILGVLPHLR----------
A0A2V7N4L3      LLLMGLIAGLGLGIVAALVLDRADPRVRYPQQVSRDL-GLPILGAVPHLR----------
A0A1Q7AZK2      LLFMGLLGGLGLGVLGAILLDRADPRVRYPEHVSRDL-GLPIIGAVPHLR----------
A0A1Q7TNP7      LLFMGLLGGLGLGVLGAILLDRADPRVRYPEHVSRDL-GLPIIGAVPHLR----------
A0A1Q7KG39      LLFMGLLGGLGLGVLGAILLDRADPRVRYPEHVSRDL-GLPIIGAVPHLR----------
A0A1Q7GX75      ILLMGLLAGLGLGIVGAVLLDRIDPSVRYPQQVSRDL-GLPILGALPHLR----------
A0A1Q7LL80      ILLMGLLAGLGLGIVGAVLLDRIDPSVRYPQQVSRDL-GLPILGALPHLR----------
A0A2V7PFU2      LLLMGLVAGLGLGVLGAIVLDRADPRVRYPEQVSRDL-GVPILGAVPHLR----------
A0A2V7MFS9      LLLMGLLAGLGLGVVGAILLDRVDPKVRYPEQVSREL-GLSILGAVPHLR----------
A0A2V7T933      LLFMGLLGGLGLGVLGAILLDRADPRVRYPEHVSRDL-GLPIIGAVPHLR----------
A0A2V7J4D7      LIFLAFWGGLGVGVAGAVLLDRTDRKVHYPEHVTRAM-GLSILGAVPHVDWRNGNRD--A
A0A2V7LN90      LIALAFLASLGAGVTGAAVLDHTDGRVHYPQQVTGAM-GLPILGAVPHLARNGGTRK--P
A0A2V7LFN9      LVLFTLITGLGAGVGSAVALDHRDRRVHDPEDITRTM-GLTILGVVPHLERKRRAKQ--P
A0A2V7MEK4      LVLFTLITGLGAGVGSAVALDHRDRRVHDPEDITRTM-GLTILGVVPHLERKRRAKQ--P
A0A2V7P8B1      QLVLGLLVGLMLGAAGAFVADRMASAIARRVQVEH-L-GLSVLGVVPR--WGRLGNK--K
A0A2V7QN41      LVCASFVVSLGLAVFGVVMLDELDHKVRYPEHVTHQM-RLSILGAVPRFDWRQLGNG--K
A0A2V7R603      LACASFVLSLGLAVFGVVMLDGLDHKVRYPEHVTHQM-RLSILGAVPRFDWRHLGNG--K
A0A2V7LJS2      QLALGLLVGLILGAGGAFVAERVGSSIARRVEVEH-L-GLSVLGIVPR--WGRETDK--K
A0A1Q7GLJ7      QIALGLLVGLMLGSAGAFLAERLGSTIAQRVQVER-L-GMSVFGVITH--WDRDARE--K
A0A2V7GRE3      QIALGLLLGLMLGSGGAFLAERLGSTIAQRVQVEQ-L-GMSVIGVITH--LDRDGAE--T
A0A2V7EU00      LILVGLFGGLGLSLLGAVMMDRLDRHFRYPQQVTREM-GLAILGAVPRIKRGGNGVD--P
A0A1Q6WE01      LVAFGFVVGLSLGMVAAVVVDRLDPRVHHPDQVTEQM-GLSIIGVLPHVRDRRAGPD--D
A0A2V7S9K3      LIVLGLVAGFGLALVGAVVADRLDPRVRYPDQVTNQM-GLPILGVLPHVRNRAAGPD--D
A0A1Q7DXB9      LVIMAFLASGGLGVLGAVLIDTLDPRFRDPGHVTQGL-GLRILGALPHLSRAGNGEG--T
A0A1Q7JD32      LVIMAFLASGGLGVLGAVLIDTLDPRFRDPGHVTQGL-GLRILGALPHLSRAGNGEG--T
A0A2V7MVP8      VLIMSFLASAGLGVLGAVVVDSLDPRFRDPGHVTRDL-GLRILGALPHLSRAKNGEA--T
A0A2V7N0A9      LVVVACLTSFGAGVLGAALRDRADPKVRSPEEVTRTM-GLLILGAVPHVHRGKDMGD--D
A0A1Q7DLS9      LVLVSFLGSLGLAALGAVVLERADRKVRYPDQVTRTM-GLPILGAVPHVSWHDGANG--D
A0A1Q7JK96      LVLVSFLGSLGLAALGAVVLERADRKVRYPDQVTRTM-GLPILGAVPHVSWHDGANG--D
A0A2V7KQV7      VLLLALVVSLGTGVGGAALLDRADPKIRDPEQVTRAM-GLSILGAVPHVHRNGNGNG--N
A0A1Q7JGF6      VIIVACIMSLGAGVLGAVLLERADPKVRYPDEVTRAI-GLPILGAVPHVQRGNGKRR--A
A0A2V7SG67      VIIVACIMSLGAGVLGAVLLERADPKVRYPDEVTRAI-GLPILGAVPHVQRGNGKRR--A
A0A1Q7GIK9      LIIAAFLTSFGAGVAGAVVRERADPKVRYPDQVTSAM-GLPILGAVPHVRQTAPSRR--P
                            .   .   :     .                . :.             

A0A2D5ZJF2      QVSRAS--------------------------SSMIAEAYRTIRTAVYFGAP---NGEAR
A0A0S8H9P3      AAHDP---------------------------EGVAAEAYRVLRTNIAFSTA---RERPL
A0A1E4BBP7      E-------------------------------ASQLIESFRTIALSVRSAFE---GLGPV
A0A3M2G737      SKSVAENPQLLTFANP----------------RSTVAESYRQLRTYVQFSK----TDTPV
A0A0H4TUX7      PITIVAREGM----------------------DQPAAEAFRALRTNVTFVG----AEKPL
A0A1G0LUG0      TVGIITQLPH----------------------DEPSAEAFRALRTNVTFVG----AERPL
A0A1Q7E3T7      --------------------------------VGAVIEAFRGLRLNLAYAYG---AAGPV
A0A1G0L906      GRRRASISLISHAAPD-----------------DPTSEAYRALRTNVTFVSA---EQHAL
A0A1G0LCC0      GRRRASISLISHAAPD-----------------DPTSEAYRALRTNVTFVSA---EQHAL
A0A2D5ZJE2      RLVTLHEP------------------------QSPMAEAYRTIRTNVGFAA----VGAPL
A0A3M2G624      AKARFETLVTHLAPKS------------------IPSEAFRSLRTNIQFFDL---SRQSE
W0RI74          --------------EQ----------------IAQIVEAFRSLRMNVRYAAG-AGSQRSV
A0A3M2BJA6      AAANGASHLGERLVAGRDP-------------RNPVSEAYRSLRTNITFSNP---DRPPK
A0A3D4VBZ5      --------------DQ----------------AAQVVESFRTIRMNVRYAAD---PTRPL
C1A5W1          --------------DQ----------------AAQVVESFRTIRMNVRYAAD---PTRPL
A0A2V7PX99      --------------------------------SAEVIEALRGLRVRVLHSQG---VEGPL
A0A2V7ERC7      T-------------------------------LSQAVESFRTLHLAVRYDFP---GGGPI
A0A5Q4D6Y4      ----------KHAAASSNGARGGRELVTLHESRSSEAEAFRTLRTNLLYAQH----HKPL
A0A2V7JTZ5      M-------------------------------MSQAVESFRTLRLALRYDFP---TDAPI
A0A3D4YTR6      L-------------------------------MSQTVEAFRTIRLALRYDFP---DGLPI
A0A5Q4DA46      -------------PED----------------HEQVVEAFRSLRLALAYGRR---GAGPL
A0A2V7F1M1      LPIPLFISASRRPEAASRGEQATWEVVADSAPLSSAAEAFRLLYSGLLFGWG----EGQR
A0A2V7KXK7      --------------DG----------------PAQVIEALRGLRLRVLHAHA---GEGPL
A0A651HKD3      -------------PAD----------------HEHAIEAFRSIRTGILFAHG---SAGPL
A0A2V7QDU7      GKGPGRARRRPIGAGS----------------RAELAEAFVRLATNVSFAGP---NGPPQ
A0A2V7ITT6      E--------------H----------------VAQVIEAMRSVRLSLSQTHG---GGGPM
A0A2V7NJW1      E--------------H----------------VAQVIEAMRSVRLSLSQTHG---GGGPM
A0A2V7GFB5      ---------GQLTREQ----------------RVQLVEAMRGVCLGVSYTYG---AAGPV
A0A2V7RQ86      ---------GQLTREQ----------------RVQLVEAMRGVCLGVSYTYG---AAGPV
A0A2V7IWX2      ---------RAGNGEG----------------TAQAIEAMRTVRVKLQHASN---GGNPL
A0A1Q7KE95      ---------AGPNDEH----------------VIHVIEAMRSVRLSLIHFYG---GNGPV
A0A1Q7T8X5      ---------AGPNDEH----------------VIHVIEAMRSVRLSLIHFYG---GNGPV
A0A2V7MS64      ---------NGRAKAG----------------ALEAVEALRAIRLNLLHAHG---A-GPT
A0A2V7Q7N9      ---------GRRKPDG----------------VMQVVEAVRGIRLNVLHAHG---T-GPI
A0A2V7IRW6      ---------NGKKAGA----------------VLQVVEAVRGIRLNVLHAHG---A-GPA
A0A1Q7DVU6      ---------NGKKSGA----------------VLQVVEAVRGIRLNVLHAHG---A-GPA
A0A1Q7JSV2      ---------NGKKSGA----------------VLQVVEAVRGIRLNVLHAHG---A-GPA
A0A2V7FK98      N--------GARVPDD----------------VNEVVEALRGVCLNLVYAHG---GRAPL
A0A2V7R3Z8      G--------GARVPDD----------------VNEVVEALRGVCLNLVYAHG---GRAPL
A0A2V7J3C0      ---------AGPDDEE----------------VAQVIEAMRSVRLSLMHFYG---GNGPV
A0A2V7KWV9      ---------GASDDES----------------GPLVIETMRGVRLSLIHAYG---TAGPL
A0A1Q6ZHP2      G-------RRVRPPED----------------VAVVVEALRGVCLNLVYTHG---AVAPL
A0A1Q7R6Z6      G-------RRVRPPED----------------VAVVVEALRGVCLNLVYTHG---AVAPL
A0A2V7FYT7      G-------RRVRPPED----------------VAVVVEALRGVCLNLVYTHG---AVAPL
A0A2V7IGR0      T-------GPL--SEN----------------VAEVLEALRGVCLNLEHAYG---TAGPL
A0A2V7MR23      S------GRRVRPPED----------------VAVVVEALRGVCLNLVYTHG---AVAPL
A0A2V7L1V3      G--------RARVPED----------------VNQVVEALRGVCLNLVYAHG---GRAPL
A0A1Q7E5D3      G------G--AHPPED----------------IAVVVEALRGACLNLVYAHG---AEGPL
A0A2V7ISE2      N------GRRVRPPED----------------VAVVVEALRGVCLNLVYTHG---AASPM
A0A1Q7J2X5      N------GRRVRPPED----------------VAVVVEALRGVCLNLVYTHG---AESPM
A0A2V7NPD1      N------GRRVRPPED----------------VAVVVEALRGVCLNLVYTHG---AASPM
A0A2V7QPD8      G--------GARVPDD----------------VNEVVEALRGVCLNLVYAHG---GRAPL
A0A2V7Q8M6      G--------KGRVPED----------------VNQVVEALRGVCLNLVYAHG---GRAPL
A0A2V7QBC3      G--------KGRVPED----------------VNQVVEALRGVCLNLVYAHG---GRAPL
A0A2V7LMU1      G--------RGRVPED----------------VNQVVEALRAVCLNLVYAHG---GRAPL
A0A2V7PBY9      G--------RGRIPED----------------VNQVVEALRGVCLNLVYAHG---GRAPL
A0A3M2BLV5      R----AGLPLIVALDP----------------LDPAAEAYRNLRMNLMFMST---EDEPI
A0A2V7KS68      -------------TKE----------------PAEVVEALRGLRLNVIHEYGTAEAAQPL
A0A2V7N4L3      -------------AKE----------------PAEVIEALRGIRLSVLHEHG---PG-PL
A0A1Q7AZK2      -------------AKE----------------PAEVVEALRGVRLSLVHEYG---PG-PL
A0A1Q7TNP7      -------------AKE----------------PAEVVEALRGVRLSLVHEYG---PG-PL
A0A1Q7KG39      -------------AKE----------------PAEVVEALRGVRLSLVHEYG---PG-PL
A0A1Q7GX75      -------------AKE----------------PAEVVEALRGVRLNLLHEYG---PG-PV
A0A1Q7LL80      -------------AKE----------------PAEVVEALRGVRLNLLHEYG---PG-PV
A0A2V7PFU2      -------------AKE----------------PVEVIEALRGLRLNVLNEYG---AETPV
A0A2V7MFS9      -------------AKD----------------PVEVVEALRGVRLNLMNEHG---PG-PL
A0A2V7T933      -------------AKE----------------PAEVVEALRGVRLSLVHEYG---PG-PL
A0A2V7J4D7      ---------------A----------------ATQVIESLRGVRLNVVHRHG---TAGPV
A0A2V7LN90      D--------------G----------------VMQVVEAVRGIRLNVQHAHG---T-GPV
A0A2V7LFN9      E--------------D----------------GLPVLEAMRGICLNVLHSHG---V-GPV
A0A2V7MEK4      E--------------D----------------GLPVLEAMRGICLNVLHSHG---V-GPV
A0A2V7P8B1      G------------PKS----------------AEATVEAFRGIRLNVLNAHG---ATGPV
A0A2V7QN41      T------------AEA----------------AAPVVEALRGLRLRLSHA-G---GSGPL
A0A2V7R603      T------------AEA----------------AAPVVEALRGLRLRLSHA-G---GSGPL
A0A2V7LJS2      G------------PGS----------------ADAAVEAFRGIRLNVLNAHG---AAGPA
A0A1Q7GLJ7      G------------VKN----------------PDAVVEAFRGLRLTLVNEYG---APGPI
A0A2V7GRE3      G------------MKS----------------PDAVVEAFRGLRLSLVNEYG---APGPL
A0A2V7EU00      E--------------E----------------ARQVIEALRTVRLNLTHAYG---SAGPL
A0A1Q6WE01      Q--------------Q----------------VAHAIEAMRSIRLSLTHAHG---AAGPM
A0A2V7S9K3      E--------------H----------------VAHAIEAMRSVRLSVSHAYG---AAGPM
A0A1Q7DXB9      A---------------------------------QAIEAMRTVRVKLQHASN---GGNPL
A0A1Q7JD32      A---------------------------------QAIEAMRTVRVKLQHASN---GGNPL
A0A2V7MVP8      T---------------------------------QAIEAMRTVRVKLQHACN---GGSPL
A0A2V7N0A9      G--------------------------------VKAVEALRGIRLNVQYAYG---AAGPL
A0A1Q7DLS9      G-------------------------------VSRVIEALRGIRLNVLHAYG---TAGPL
A0A1Q7JK96      G-------------------------------VSRVIEALRGIRLNVLHAYG---TAGPL
A0A2V7KQV7      GNGRAH------AETD----------------DTGALEALRGIRLNVQHAYG---AAGPL
A0A1Q7JGF6      G-----------GEDD----------------IAKAVEALRGIRLNLQHAYG---AAGPL
A0A2V7SG67      G-----------GEDD----------------IAKAVEALRGIRLNLQHAYG---AAGPL
A0A1Q7GIK9      AEVRATWRAPEVDAED----------------GAKAVEALRGIRLNVHHASG---AVGPL
                                                     *:       :             

A0A2D5ZJF2      -TILVTSPSPGDGKSTTASNLAIAMAQAGQRTLLMDSDFRKPVQHVIFE-MDDKQGLSSV
A0A0S8H9P3      SSLAFTSPGPDEGKSTSVANLAAVLADRGDRTLLVDADLRRGTLHEDFD-LLRSPGLSDL
A0A1E4BBP7      -QLAVSSPGPGDGKSFVSANLASALADSGYRTVIVDGDIRRGTLHDIFAPCAQAPGLVDY
A0A3M2G737      KTIMVSSANPSEGKTTTASNMAVAFATMGKKVLLIDCDMRKPQLHNRFS-LDREPGLSNI
A0A0H4TUX7      QFMSVTSPGPGEGKSTTAVNLAVALAQGGQRTLLIDGDLRRPLIHRAFA-LVQEPGLTDV
A0A1G0LUG0      QLISVTSPGPGEGKSTTAANLAVALAQSGQRTLLVDADLRRPQVHRAFS-LVQEPGLTDV
A0A1Q7E3T7      -LLVLSSPRSREGKSFIAANLALAFAQANYRTLLIDGDTRRGALHKVLA-VARKPGLTDF
A0A1G0L906      QLICVTSPGPGEGKSTTAANLAITLAQQGARTLLVDADLRRPVVHRAFN-LVQEHGLTDI
A0A1G0LCC0      QLICVTSPGPGEGKSTTAANLAITLAQQGARTLLVDADLRRPVVHRAFN-LVQEHGLTDI
A0A2D5ZJE2      RSIAITSSGPQEGKSTTASNLAITIAQSGKRTLLLDADLRRPVLHKLFS-LKRQKGVTDH
A0A3M2G624      -AILITSAVSEEGKSTTCANLAITTAQVGRKTLLIDGDLRKPVIHHLFE-APSEPGLTDV
W0RI74          -VFGITSPGPGDGKSLVASNLALSFAEGGWRTVLIDADTRRGQLNATFD-TPAVPGLVEY
A0A3M2BJA6      -TIVFTSPLPQDGKSTSAANLAITLAQQGTRVLLVDADLRRGVLNNVFD-LPREPGLSDV
A0A3D4VBZ5      -TMTITSPGPNDGKSLISSNLALSFAESGLRTLLIDGDIRRGELAKTFK-IHSRPGLVEY
C1A5W1          -TMTITSPGPNDGKSLISSNLALSFAESGLRTLLIDGDIRRGELAKTFK-IHSRPGLVEY
A0A2V7PX99      -LLTVTSPSVGDGKSFLSVNLALSFAYAGYRTLLIDGDVRRGTQHRVVD-AASEPGLTDV
A0A2V7ERC7      -SLSVASPGPGDGKSLVSSNLAIAFASAGYRTLLIDGDVRCGTQHSTFS-VSPTPGLVDY
A0A5Q4D6Y4      RAVVVASANPGEGKTTTAANLAITYAQQGLSVVLVDCDLRKPRVGELFG-MERRPGMTEL
A0A2V7JTZ5      -VVGVSSPAAGDGKSLVSSNLALAFASAGSRTLLIDGDVRCGGLHNTFE-IPVTPGLVDY
A0A3D4YTR6      -VLGVTSPARGDGKSLVASNLGLAFASAGSRTLLIDGDVRCGGLHNTFG-IPVTPGLVDY
A0A5Q4DA46      -VLTISSPGVGDGKSFTTSNLALACAELGHRTLVIDGDVRRGTLHTLFN-LSRRPGLTDF
A0A2V7F1M1      -TILVTSAAPQEGKTVIAANLAVTFAREGVRVLLVDCDLRRPRLHRVFG-VAPAPGLIEL
A0A2V7KXK7      -TLTITSPGIGDGKSFVSLNLALSFADAGYRTLLVDGDTRRGVQHKALK-TPSTPGLTDV
A0A651HKD3      -VITVTSPDAGDGKSFTVSNLALCFAELGRRTVIVDGDVRRGIQHKLLD-VERKPGLTDC
A0A2V7QDU7      -VVTVTSALRGEGKTTSAVNLALASAN-GRRVLLIDADLRCGTIHALFR-LSRTPGLAEV
A0A2V7ITT6      -LVTVSSPGIGDGKSFVSANLALAYSGAGQRTLLIDGDVRRGSLHRAML-TQRTPGLTDV
A0A2V7NJW1      -LVTVSSPGIGDGKSFVSANLALAYSGAGQRTLLIDGDVRRGSLHRAML-TQRTPGLTDV
A0A2V7GFB5      -VVAVSSPGPGDGKSFITANLAVTFADAGRRTLLVDGDLRRGAQHRLFG-ADRRPGLTDV
A0A2V7RQ86      -VVAVSSPGPGDGKSFITANLAVTFADAGRRTLLVDGDLRRGAQHRLFG-ADRRPGLTDV
A0A2V7IWX2      -LLTVTSPGVGEGKSLVSANLALAFAYAGLRTVVIDGDIRRGALHRLLR-GSRRPGLTDH
A0A1Q7KE95      -VVTVTSPGIGDGKSFLSANLALACAEAGQPTLLIDGDARRGGLHRALR-RPRKPGLTDC
A0A1Q7T8X5      -VVTVTSPGIGDGKSFLSANLALACAEAGQPTLLIDGDARRGGLHRALR-RPRKPGLTDC
A0A2V7MS64      -VVTVTSPGHSDGKSFVASNVAVAFADAGFRTLLIDGDVRKGVLHRTLK-APRLPGLVDV
A0A2V7Q7N9      -VVTVTSPGRSDGKSFLASNLALAFADAGSRTLLVDGDIRCGRLHRVLQ-LARKPGLTDL
A0A2V7IRW6      -VLTVTSPGRSDGKSFVASNLALAFADAGYRTLLVDGDVRCGTLHRALK-LARKPGLVDV
A0A1Q7DVU6      -VLTVTSPGRSDGKSFLASNLALAFADAGYRTLLVDGDVRCGTLHRALK-LARKPGLVDV
A0A1Q7JSV2      -VLTVTSPGRSDGKSFLASNLALAFADAGYRTLLVDGDVRCGTLHRALK-LARKPGLVDV
A0A2V7FK98      -LVTITSPGAGDGKSFISANLAHTFADGGHRTLLIDADIRRGVLHRRLS-VRRRPGLSDF
A0A2V7R3Z8      -LVTITSPGAGDGKSFISANLAHTFADGGHRTLLIDADIRRGVLHRRLS-VRRRPGLSDF
A0A2V7J3C0      -VVTVTSPGAGDGKSFVSANLALACAESGKATLLIDGDSRRGGLHRILH-RPRKLGLTDH
A0A2V7KWV9      -VVTITSPAPGDGKSFVSANLALACAQAGQRTLLIDGDTRRGALHRVLG-GVRRPGLTDF
A0A1Q6ZHP2      -VVTITSPGAGDGKSFLAANLGHTFAEAGHRTLLIDGDLRRGVLHRRLG-ARRRPGVSDF
A0A1Q7R6Z6      -VVTITSPGAGDGKSFLAANLGHTFAEAGHRTLLIDGDLRRGVLHRRLG-ARRRPGVSDF
A0A2V7FYT7      -VVTITSPGAGDGKSFLAANLGHTFAEAGHRTLLIDGDLRRGVLHRRLG-ARRRPGVSDF
A0A2V7IGR0      -IAAVTSPGPGEGKSFIAANLAYTFAESGHRVLLVDADIRRGVLHRRLG-RPRRPGLCDF
A0A2V7MR23      -VVTITSPGAGDGKSFLAANLGHTFAEAGHRTLLIDGDLRRGVLHRRLG-ARRRPGVSDF
A0A2V7L1V3      -LVTVTSPGAGDGKSFLAANLGHTFADGGHRTLLIDADIRRGVLHRRLS-ARRRPGLSDF
A0A1Q7E5D3      -LVTITSPGAGDGKSFLAANLARTFVEGGHRTLLVDGDNRRGVLHRRLA-ARRRPGLTDL
A0A2V7ISE2      -LVTITSPGAGDGKSFLAANLGHTFAEAGHRTLLIDGDIRRGVLHRRLG-ARRRPGLTDF
A0A1Q7J2X5      -LVTITSPGAGDGKSFLAANLGHTFAEAGHRTLLIDGDLRRGVLHRRLG-ARRRPGLTDF
A0A2V7NPD1      -LVTVTSPGAGDGKSFLAANLGHTFAEAGHRTLLIDGDLRRGVLHRRLG-ARRRPGLTDF
A0A2V7QPD8      -LVTITSPGAGDGKSFISANLAHTFADGGHRTLLIDADIRRGVLHRRLS-VRRRPGLSDF
A0A2V7Q8M6      -LVTVTSPGAGDGKSFLAANLAHTFADGGHRTLLIDADIRRGVLHRRLS-ARRRPGLSDF
A0A2V7QBC3      -LVTVTSPGAGDGKSFLAANLAHTFADGGHRTLLIDADIRRGVLHRRLS-ARRRPGLSDF
A0A2V7LMU1      -LVTITSPGAGDGKSFLAANLAHTFADGGHRTLLIDADIRRGVLHRRLS-AHRRPGLSDL
A0A2V7PBY9      -LVTVTSPGAGDGKSFIAANLAHTFADGGHRTLLIDADIRRGVLHRRLS-ARRRPGLSDF
A0A3M2BLV5      RTILFSSPGPHEGKSTTAVNFAVMLAQQGQRVLLIDADLRRPSLHRAMD-LLREPGLTNL
A0A2V7KS68      -IFTVTSPGPGDGKTFLSSNLALAFAEGGHRTVLVDADIRRGLLHRRLK-ANRQPGLADY
A0A2V7N4L3      -VVTITSPEQGDGKSFMSANLAMSFADAGHKTLLVDGDIRRGVLHRRFK-LSRQPGLVDF
A0A1Q7AZK2      -LVTVTSPGPGDGKSFLSANLALTFADAGHRTLLVDGDVRRGVLHRRFK-ANRQPGLVDF
A0A1Q7TNP7      -LVTVTSPGPGDGKSFLSANLALTFADAGHRTLLVDGDVRRGVLHRRFK-ANRQPGLVDF
A0A1Q7KG39      -LVTVTSPGPGDGKSFLSANLALTFADAGHRTLLVDGDVRRGVLHRRFK-ANRQPGLVDF
A0A1Q7GX75      -VLTISSPGSGDGKSFLSANLGLTFADGGHKTLLIDGDIRRGVLHRRFK-GNRQPGLVDY
A0A1Q7LL80      -VLTISSPGSGDGKSFLSANLGLTFADGGHKTLLIDGDIRRGVLHRRFK-GNRQPGLVDY
A0A2V7PFU2      -LFTVTSPGPGDGKSFLSANLALAFADGGHRTLLVDGDIRRGTLHRRFK-ANRRPGLVDY
A0A2V7MFS9      -LVTVTSPGPGDGKSFLSANLALAFADGGHRTVLVDGDIRRGVLHRRFK-ANRQPGLVDF
A0A2V7T933      -LVTVTSPGPGDGKSFLSANLALTFADAGHRTLLVDGDVRRGVLHRRFK-ANRQPGLVDF
A0A2V7J4D7      -RLTVTSPGKSDGKSFVASNLALAFADAGYRTLLVDGDVRRGRLHHTLS-AARRPGLTEL
A0A2V7LN90      -VVTVTSAGRSDGKSFLASNLALAFADAGSRTLLVDGDIRCGRLHRVLK-LARKPGLTDL
A0A2V7LFN9      -IVTVTSPGRADGKSFVASNLAVAFADAGYRTLLVDGDVRCGRLHRTLK-LPRRPGLTDL
A0A2V7MEK4      -IVTVTSPGRADGKSFVASNLAVAFADAGYRTLLVDGDVRCGRLHRTLK-LPRRPGLTDL
A0A2V7P8B1      -VVGVTSPGSGDGKSFVSSNLALAFAYGNHRTLLIDADLRRGALHRTLK-LPRQPGLMDL
A0A2V7QN41      -LVTVTSPGVGEGKSFLSCNLALAFADAGFRTLLIDGDVRRGGQHRMLG-LHREPGLVDF
A0A2V7R603      -LVTVTSPGVGEGKSFLSCNLALAFADAGFRTLLIDGDVRRGGQHRMLG-LHREPGLVDF
A0A2V7LJS2      -VVAVTSPGSGDGKSFVSSNLALAFAYANHRTLLVDADLRRGALHRALQ-LRREPGLTDL
A0A1Q7GLJ7      -VVTVTSPGSGDGKSFVSSNLALAFAYAKQRTLLVDADLRRGALHRLLN-LRRQPGLTDF
A0A2V7GRE3      -VITVTSPGSGDGKSFVSSNLSLAFAYAKQRTLLVDADLRRGALHRVLN-LRRQPGLTDF
A0A2V7EU00      -LVTITSPGPGDGKSFVSGNLARAFADAGQRTLLIDGDSRRGVLHRLFK-GLRKPGLTDY
A0A1Q6WE01      -LVTISSPGVGDGKSFVSANLALAFAEAGRRTLLIDGDVRRGSLHRAVR-ARRQPGLTDF
A0A2V7S9K3      -VLTVSSPGAGDGKSFVAANLALAFAEGGRRTLLIDGDVRRGGLHRALR-AHRRPGLTDF
A0A1Q7DXB9      -LLTVTSPGVGEGKSLVSANLALAFAYAGLRTIVIDGDIRRGALHRLLR-GSRRPGLTDH
A0A1Q7JD32      -LLTVTSPGVGEGKSLVSANLALAFAYAGLRTIVIDGDIRRGALHRLLR-GSRRPGLTDH
A0A2V7MVP8      -LLTVTSPGVGEGKSLVSANLALAFAYAGLRTIVIDGDIRRGALHRLLR-ASRRPGLTDH
A0A2V7N0A9      -VLTVSSPGRGEGKSFVTSNLAQAFADVGCRTLLIDGDVRLGALHRALR-RARRPGLTDA
A0A1Q7DLS9      -LVTVTSPGRSDGKSFLTSNLAVAFVDAGYSTLLIDGDIRRGGLHRVLD-AARTPGLTDL
A0A1Q7JK96      -LVTVTSPGRSDGKSFLTSNLAVAFVDAGYSTLLIDGDIRRGGLHRVLD-AARTPGLTDL
A0A2V7KQV7      -LITVTSPGRGDGKSFVTCNLALAFAQVGYRTLLIDGDVRCGALHRLLK-AARRPGLTDV
A0A1Q7JGF6      -LITVSSPGRGEGKSFVTSNLAQAFADVGYRTLLIDGDVRLGVLHRALR-GTRRPGLTDL
A0A2V7SG67      -LITVSSPGRGEGKSFVTSNLAQAFADVGYRTLLIDGDVRLGVLHRALR-GTRRPGLTDL
A0A1Q7GIK9      -LATITSPGRGEGKSFVSANLAYAFSAVGYRTLLIDGDVRLGALHRTLR-AARRPGLTDV
                    .:*.   :**:    *..         .:::* * *       .       *: . 

A0A2D5ZJF2      LSGQATL--DE---VL-RPSEVAGLDVLRCGPLPPNPSEFINSDAFREMLEELAVKYDRV
A0A0S8H9P3      LVGELDP--RE---AI-RPAVRPALDLLPAGKRPPNPSELLGSQAMAKLLASWREEYRWV
A0A1E4BBP7      LAGEATL--DE---VLRPTQQHINLSIVPCGKRRRHGPELLASERMTTLIRDLRTQFDAI
A0A3M2G737      FFYTAAV--EK---IC-HKTSVDNLDVICSGIIPPNPAEILSSTRMIEFVKEMRDQYDLI
A0A0H4TUX7      LVGRATA--RE---AV-RPDAAPGLDVLPSGSIPPNPSELLGSAAMHSLISALRRDYHYI
A0A1G0LUG0      LIGRVPA--RE---AI-RPEVQPQLDVLPSGPAPPNPSELLGSHAMHALIGELRRSYDYI
A0A1Q7E3T7      LGGDVSW--GE---II-QVTRHGTLHFIGCGMRRPDSPELLSSPRMSDLFAQLRANFAVI
A0A1G0L906      LVGTATL--RE---TV-RPNLIPKLDILTSGSLPPNPSELLGSEAMHRLLEEVRSHYDNI
A0A1G0LCC0      LVGTATL--RE---TV-RPNLIPKLDILTSGSLPPNPSELLGSEAMHRLLEEVRSHYDNI
A0A2D5ZJE2      LAGNATL--EE---VI-QKTEIEGLHVITSGSLPPNPSELLGSDAMARFIEEVGREFDQI
A0A3M2G624      LLGRYTW--QE---VI-HSTSVPGLDIICSGTQPPNPSELLSSPELKSLITTLKEHYDMI
W0RI74          LEGTSLF--GE---VC-YPTRHDNLTIIPSGTRHRRAPELLATPRMQQLVASLAAEFDVV
A0A3M2BJA6      ITGQAKL--SEALRVV-DLGESGRMHFLPTGTLPPNPAELLGSERMKTLLRHLEEQFDAI
A0A3D4VBZ5      LEGSALL--AE---VLNPIASHANLTIMPAGVRRKRAPELLATPRLTQLISQMAGEYDVV
C1A5W1          LEGSALL--AE---VLNPIASHANLTIMPAGVRRKRAPELLATPRLTQLISQMAGEYDVV
A0A2V7PX99      LAGQAAA--EA---AV-QQTGYPNLSILSCGTRMYRSPELLLLPTLRETIARLRTTYQII
A0A2V7ERC7      LRSATGV--EG---AI-RTTSFSNLFLLPAGTRKNRAPELLVSDRMTALLLAARQEFEVI
A0A5Q4D6Y4      VLGQATL--EE---CARPFVPAENLFILPSGTLPPNPTELLGGARTREVLQVLQENFDMV
A0A2V7JTZ5      LNGHAAV--DS---IV-RSTTSENLFLIPRGTRGNRAPELLVSELMSALVHAMRLQFDVV
A0A3D4YTR6      LHGLASV--ES---IV-RSTASKNLFLIPRGTRRNRAPELLVSDLMNSLVHAMRLQFDVV
A0A5Q4DA46      LAGEAEL--EA---VV-QSTEHDTMWVIPSGSRLRDGPELLGTDRMIELLDDVRGRFDVI
A0A2V7F1M1      LKADRATLADSPGGPLRRPTKIAGLWLLPCGALPRRTSEVLQPHQLRRLLDDLSGHFDVI
A0A2V7KXK7      VAGRVAL--DA---AL-RLTSYPGLTFLSSGTRMQRAPERLLSQNMRDLMSKLRSMFDVV
A0A651HKD3      LSGQATL--EE---VL-SPAEHPLLSVIPRGSGLQNGPELLSTPAMQDLLAHLKEEFDVI
A0A2V7QDU7      LAGWMPLENAV---RRMDTGDGTHVDVLPAGSAVNNASQLLWRADLDGLLVRLRAAYDLI
A0A2V7ITT6      LAKRAPL--ER---VT-QATSYTALEFISAGTHFRDAPELLGSDAMVELVTRLRGSYGVI
A0A2V7NJW1      LAKRAPL--ER---VT-QATSYTALEFISAGTHFRDAPELLGSDAMVELVTRLRGSYGVI
A0A2V7GFB5      LRGDVPL--EA---GL-RPTGYDALTLLPCGVRTSDAPELLGSAKMPELLARLRGDYDTI
A0A2V7RQ86      LRGDVPL--EA---GL-RPTGYDALTLLPCGVRTSDAPELLGSAKMPELLARLRGDYDTI
A0A2V7IWX2      LTGRAPL--EK---VL-QTTPYKCLSFIGCGSRMHNSPELLSAATMVDLLAALRSRYDVV
A0A1Q7KE95      LAGAAPL--EG---VT-QTTMYPCLDFIGAGSRFRDSPELLGSPAMVELLERVRSQYRVV
A0A1Q7T8X5      LAGAAPL--EG---VT-QTTMYPCLDFIGAGSRFRDSPELLGSPAMVELLERVRSQYRVV
A0A2V7MS64      LMGKVPV--AQ---AI-QSTTYRTLSFLPSGTRTQIAPVLVSSAPLPRLLAELRPNYDAV
A0A2V7Q7N9      LGGEAAE--EQ---VL-QATAYRTLTFLGSGTRTHAGPTLISSAALPRALAALRPGYDVI
A0A2V7IRW6      LGGKAST--EL---VV-QATSYRALSFIGSGTRTHTGPSLVSSAALPRLLAALRPSYDAI
A0A1Q7DVU6      LGGKAST--EL---VV-QATSYRALSFIGSGTRTHTGPSLVSSAALPRLLATLRPGYDAI
A0A1Q7JSV2      LGGKAST--EL---VV-QATSYRALSFIGSGTRTHTGPSLVSSAALPRLLATLRPGYDAI
A0A2V7FK98      LRGEAQL--DA---IV-QATQFPALSLIGCGTRAYNAPELLGSPAMTSLVNGLRGGYDVV
A0A2V7R3Z8      LRGEAQL--DA---IV-QATQFPALSLIGCGTRAYNAPELLGSPAMTSLVNGLRGGYDVV
A0A2V7J3C0      LAGAASL--EA---VT-QSTPFAALDFIAAGSRYRDSPELLGYPAMVELLEHARAHYAVV
A0A2V7KWV9      LAGNVSF--EA---LI-QTPNFGSLQFIGAGSRIRESPELLGSPRMVELLVRLRAMYPVI
A0A1Q6ZHP2      LRGEVPI--EA---IV-QTTPYPSFSLIGCGTRAYNAPELLGSQTMSQLLTTLRPSYDVI
A0A1Q7R6Z6      LRGEVPI--EA---IV-QTTPYPSFSLIGCGTRAYNAPELLGSQTMSQLLTTLRPSYDVI
A0A2V7FYT7      LRGEVPI--EA---IV-QTTPYPSFSLIGCGTRAYNAPELLGSQTMSQLLTTLRPSYDVI
A0A2V7IGR0      LRSEAPL--EA---IV-QSTTHPSLALVSCGTRAHHAPELLGSPAMGQFVAGLRTHYDVI
A0A2V7MR23      LRGEVPL--EA---IV-QATPYPSFSLIGCGTRAYNAPELLGSQTMSQLLTTLRPSYDVI
A0A2V7L1V3      LRGETPL--DA---VV-QATPYPSLSLIACGTRAYNAPELLGSPAMSELVTGMRSGYDVI
A0A1Q7E5D3      LRGDVTF--EA---IA-QPTPYPGCTLVGCGTRAHNAPELLGSEAMSQLIRHARRSYDVV
A0A2V7ISE2      LRGEVPL--EA---IV-QATPYPSFSLIGCGTRAYNAPELLGSQTMSQLVTALRPSYDVI
A0A1Q7J2X5      LRGEVPL--EA---IV-QATPYPSFSLIGCGTRAYNAPELLGSQTMSQLVTALRPSYDVI
A0A2V7NPD1      LRGEVPL--EA---IV-QATPYPSFSLIGCGTRAYNAPELLGSQTMSQLVTALRPSYDVI
A0A2V7QPD8      LRGEAQL--DA---IV-QATQFQALSLIGCGTRAYNAPELLGSPAMTSLVNGLRGSYDVI
A0A2V7Q8M6      LRGETPL--DA---IV-QATPYPSLSLIACGTRAYNAPELLGSPPMSELVNGMRSGYDVI
A0A2V7QBC3      LRGETPL--DA---IV-QATPYPSLSLIACGTRAYNAPELLGSPPMSELVNGMRSGYDVI
A0A2V7LMU1      LRGETPL--DA---IV-QATPYPSLSLIACGTRAYNAPEMLASPAMSQLVNGMRSGYDVI
A0A2V7PBY9      LRGEAPL--DA---VV-QATPYPALSLIGCGTRAYNAPELLGSPRMSELVTGMRSGYDVI
A0A3M2BLV5      LVGDAEA--RE---AI-RPNVLPNLDMLPSGPFPPNPSELLNSKAMQRLLEELQGKYSHI
A0A2V7KS68      LLGETTA--DE---IV-QQTAYPRLSLIACGTRTQRAPELLDSDAMVTLLTRLRGEYDVV
A0A2V7N4L3      LLDEIGK--DQ---IV-QKTAYPHLALIGCGTRTSRAPEVLGSTAMNDLLTEMRGQYDVI
A0A1Q7AZK2      LLGKAGL--DE---IV-QGTEYPRLAFIGCGTRTQRAPEVLGSPAMTQFIADLRNQYDVI
A0A1Q7TNP7      LLGKAGL--DE---IV-QGTEYPRLAFIGCGTRTQRAPEVLGSPAMTQFIADLRNQYDVI
A0A1Q7KG39      LLGKAGL--DE---IV-QGTEYPRLAFIGCGTRTQRAPEVLGSPAMTQFIADLRNQYDVI
A0A1Q7GX75      LLGDAGH--DA---IV-QKTAYPRLSLIGCGTRTQRAPEVLGSPAMNRLLAELRGRYDVI
A0A1Q7LL80      LLGDAGH--DA---IV-QKTAYPRLSLIGCGTRTQRAPEVLGSPAMNRLLAELRGRYDVI
A0A2V7PFU2      LRGEAGIGREL---IV-QQTPYPQLAFIGCGTRTQRAPEVLGSPAMAQLLAELREQYDVI
A0A2V7MFS9      LNGEVGH--DQ---IV-QPTPYPRLALIGGGTRTQRAPEVLGSQAMTELIAELRGQYDVI
A0A2V7T933      LLGKAGL--DE---IV-QGTEYPRLAFIGCGTRTQRAPEVLGSPAMTQFIADLRNQYDVI
A0A2V7J4D7      LEGSAPQ--DA---AV-QATRYKNLSFISCGLRSHAGPALLSSVAMARLLDALRASYEAI
A0A2V7LN90      LAGDATP--EQ---VL-QGTAYRTLTLLAAGTRTHAGPALIGSAALPRALAALRPGYDVI
A0A2V7LFN9      LQGRASK--EQ---AV-QLSAYGMLSFLGCGTRTHDGPALVSSAALPRVLAGLRSSYHAI
A0A2V7MEK4      LQGRASK--EQ---AV-QLSAYGMLSFLGCGTRTHDGPALVSSAALPRVLAGLRSSYHAI
A0A2V7P8B1      LVGHATP--EQ---VV-HRTAYQSLDFVASGSRRRDAPELIGSARMTEFMSGLRSRYGVI
A0A2V7QN41      LAGDLPF--ET---VV-QATRHPGLSFIGCGARRPSAPELLSSDVMTELIDRVREECGVV
A0A2V7R603      LAGDLPF--ET---VV-QATRHPNLSFIGCGARRPSAPELLSSDVMTDLIDRVREECGVV
A0A2V7LJS2      LAAAASP--EQ---VV-KATSHPSLDFLASGSRRGDAPELLGSARMADFMTKLRSSYGVI
A0A1Q7GLJ7      LIGDVSR--AP---AL-QTTAYPFLDFLPSGTRRRDAPELMGSAAMVDLVTSLRSTYDVI
A0A2V7GRE3      LAGDVSR--AP---VV-QTTSHPCLDFIASGTRRRDAPELLGSAAMTDLVTSLRSTYEVI
A0A2V7EU00      LAGVVPL--DA---VV-QRTDHPALWFIGSGSRTPDAPELLGAPPMARLLASVRTSYQVI
A0A1Q6WE01      LAGRAPF--EA---TV-QGTPYPDLQFIGAGTRFRDSPELLGSGAMSELLARLRASWSVI
A0A2V7S9K3      LAGRVPL--EE---TI-VATSYADLQFIGAGTRFRDSPELLGSVAMVELLTCVRSSYGVI
A0A1Q7DXB9      LTGRAPL--EK---VL-QPTPYKGLSFIGCGSRMHNSPELLSAATMVDLLAALRSRYDVV
A0A1Q7JD32      LTGRAPL--EK---VL-QPTPYKGLSFIGCGSRMHNSPELLSAATMVDLLAALRSRYDVV
A0A2V7MVP8      LTGRAPL--EQ---VL-QATPYKDLSFIGCGSRMHNSPELLSATTMVDLLAALRSRYDVV
A0A2V7N0A9      LAGRVTA--DQ---TL-QATDHAFLSFIGAGSRMHRGPELLCSATVPQLITALRPGYDVI
A0A1Q7DLS9      LAGTAAV--QQ---VIQQAKSYPSLAFIACGSRTRSGPELLSSTAMAGFVTSLRSRYAVI
A0A1Q7JK96      LAGTAAV--QQ---VIQQAKSYPSLAFIACGSRTRSGPELLSSTAMAGFVTSLRSRYAVI
A0A2V7KQV7      LANEVTP--DQ---VV-QSTPYAHLSFIGGGSRLHRGPELLCSEALPRLITAMRPHYDAI
A0A1Q7JGF6      LASRATV--DQ---VV-QGTPHPLLSFIGAGSRMHRGPELLCSVAMPRLITVMRPSYDVI
A0A2V7SG67      LASRATV--DQ---VV-QGTPHQLLSFIGAGSRMHRGPELLCSVAMPRLITVMRPSYDVI
A0A1Q7GIK9      LAGHVEY--AA---VL-QSTPHTRLSFLGAGSRMHRGPELLGSAGMPRLLTALRSAYDVI
                .                         .:  *      .  :        .         :

A0A2D5ZJF2      VIDSPPVMAVSDARILAAGCDITLLVLRAEKSTRKASEQARDGLLAVGGHLLGVVVNDAH
A0A0S8H9P3      LFDTPPVLAVTDASVLAALVDGAVLVVKAGETDRRAGWQAIQQLRRVGARVVGAVLNEI-
A0A1E4BBP7      IVDTAPLGAGIDPFAIGTATGSMVLVLRAGETDRKLAQAKLTVLDRMPIRLVGAILNDI-
A0A3M2G737      IFDTPPILRVADPSIVSTLVDGVILVVASGKTPAGGLNFAVETLVKVKANLLGIVLNDFD
A0A0H4TUX7      IIDTPPTLPVTDASVVASGADAAILVLRSGDTQETAAQRALEQLRRVHARIAGAVLNGV-
A0A1G0LUG0      VMDTPPTLPVTDAAVVASAADGAILVLKSGDTEEVPAQRALEQLRRVHARVAGAVLNGV-
A0A1Q7E3T7      IVDSPPLGAGVDAFALATITGHLVMVLRPGTTNREVIEAKLDLLHRLPVRVLGAVLNDV-
A0A1G0L906      IFDTPPALAVTDAAVLGAGSDAVILILRAGKTEEVAAQRALAQLSRVQARVAGSVLNGVQ
A0A1G0LCC0      IFDTPPALAVTDAAVLGAGSDAVILILRAGKTEEVAAQRALAQLSRVQARVAGSVLNGVQ
A0A2D5ZJE2      IVDTPPVMAVTDALLLSALLDGVIIIVEAGETLEQVAKRTKTLVETAARRCLGVVLNNV-
A0A3M2G624      LFDSPPVIPVADSVALSTNVDGVLLVVSAGKTDRHALQRTRDLLHNVNARIMGAVLNNV-
W0RI74          IIDTPPLGAGTDAYAIGTACGQLAVVLRSNRTNLKMAKAKLAVLAQLPVTLLGAVLNEV-
A0A3M2BJA6      ILDSAPLTVVTDAAVLGTNAEGVLLVARANVTERGAIRYSVDQLKHVRAPILGVVLNDID
A0A3D4VBZ5      VVDSPPLGAGYDAFALATATGNMALVMRAGVTDRKMAEAKMATVDTLPIRVMGAILNGI-
C1A5W1          VVDSPPLGAGYDAFALATATGNMALVMRAGVTDRKMAEAKMATVDTLPIRVMGAILNGI-
A0A2V7PX99      IVDSPPLVAGIDPLVLATVTGNLLVVLRSEATDLELAAAKLSVADTLPVRTIGAVLNCV-
A0A2V7ERC7      IIDSPPFIAGVDAYALGAAAGSMLVVLRPGVSDRKLAAAKLDIVDRLPIRVLGAVLNGV-
A0A5Q4D6Y4      ILDSPPLSGGADSSILGAAVDGVIMVVRAGETEIEAVRYAARQLHTVGATLLGSVMND--
A0A2V7JTZ5      IIDSPPLVAGMDAYALGAAAGSMLIVLRPAVTDRKLASAKLEVLDRLPIRILGAVLNAV-
A0A3D4YTR6      IIDSPPLVAGIDAYALGAAAGSMLIVLRPARTDRKLAAAKLDVLDRLPIRILGAVLNAV-
A0A5Q4DA46      LIDSPPLGAAVDPYLLGTLSGSIMLVFRNGTTNQDVAVSRIEELKRLPVQIVGAVLNDV-
A0A2V7F1M1      ILDTPPVLVSADAALLAPLADGAILVVRAGQTNRSSAERACQYLIAAGAHFLGAVLNDP-
A0A2V7KXK7      IVDSPPLGAGADPLVLGTLTENLLLVLRTGQSDINLASTKLEVLNALPVRVIGAVLNDV-
A0A651HKD3      LVDSCPIGAAADPVILGTLTGSLALVVRSGTTDSERAEGMLRNLRRFPVRVLGAVVNDV-
A0A2V7QDU7      VIDSPPMNVVADATLLAPQSDAVIVVARAGRTAPEALNFTLEQLRSVHA-LVWTVLNDI-
A0A2V7ITT6      LVDSPPLASGVDPYTLGMVTGSLLLVLRTGATSLELARTKLRVLDRLPIRLLGVVVNDV-
A0A2V7NJW1      LVDSPPLASGVDPYTLGMVTGSLLLVLRTGATSLELARTKLRVLDRLPIRLLGVVVNDV-
A0A2V7GFB5      LVDSPPLGAGIDPFVLGTLTGNLLLVLRTGVSHREVMAAKLEVLRRLPVRLLGAVLNDV-
A0A2V7RQ86      LVDSPPLGAGIDPFVLGTLTGNLLLVLRTGVSHREVMAAKLEVLRRLPVRLLGAVLNDV-
A0A2V7IWX2      LVDTAPLAAGADPYTMASLTTNLLMVLRAGVTDLELAQAKLESFEDLPVRVVGTVLNDV-
A0A1Q7KE95      LVDSPPLGSGVDPYTLGTLTGNLLLVLRTGTTNLALARTKLTVLDHLPIRLLGVVLNDV-
A0A1Q7T8X5      LVDSPPLGSGVDPYTLGTLTGNLLLVLRTGTTNLALARTKLTVLDHLPIRLLGVVLNDV-
A0A2V7MS64      IVDSPPLAAGVDALALGTATGAMVLVLRTGYSDREMAQNKLQALTHLPIRVLGAVLNDV-
A0A2V7Q7N9      IVDSSPLAAGADAFALGTATGSMLLVLRTGVSDRELVQAKLEVLQYLPIRVLGAVLNDV-
A0A2V7IRW6      IVDSPPLAAGADAFAIGTATGSMVLVLRTGVSDRELAQTKLEVLAHLPIRMLGAVLNDV-
A0A1Q7DVU6      IVDSPPLAAGADAFAIGTATGSMVLVLRTGVSDRELAQTKLEVLAHLPIRMLGAVLNDV-
A0A1Q7JSV2      IVDSPPLAAGADAFAIGTATGSMVLVLRTGVSDRELAQTKLEVLAHLPIRMLGAVLNDV-
A0A2V7FK98      LIDSPPLAAGVDPLILSTLTGTLALVLRTGYSHRDVAAAKLEVLQRLPVRMLGAVLNDV-
A0A2V7R3Z8      LIDSPPLAAGVDPLILSTLTGTLALVLRTGYSHRDVAAAKLEVLQRLPVRMLGAVLNDV-
A0A2V7J3C0      IVDSSPLGSGVDPYTLGTLTGSLLLVLRTGTTNLALARTKLAVLDHLPIRLLGAVLNDV-
A0A2V7KWV9      IVDSPPLGAGVDPYTLGTMTGAMMLVLRTGATNLDLARTKVAMLENLPIRVLGAVLNDV-
A0A1Q6ZHP2      LVDSPPLSAGVDPLILGTLTGHLVVVLRTGFSHRDMASAKLEVLQRLPVRLLGAILNAV-
A0A1Q7R6Z6      LVDSPPLSAGVDPLILGTLTGHLVVVLRTGFSHRDMASAKLEVLQRLPVRLLGAILNAV-
A0A2V7FYT7      LVDSPPLSAGVDPLILGTLTGHLVVVLRTGFSHRDMASAKLEVLQRLPVRLLGAILNAV-
A0A2V7IGR0      LFDNPPLAAGVDPLIVGTLTGNLLLVLRTGQSDREMTAAKLEVLQRLPVRLLGAVLNDV-
A0A2V7MR23      LVDSPPLSAGVDPLILGTLTGHLVVVLRTGFSHRDVASAKLEVLQRLPVRLLGAILNAV-
A0A2V7L1V3      LIDSPPLAAGVDPLILGTLTGTLALVLRTGYSHRDVAAAKLEMLQRLPVRMLGAILNDV-
A0A1Q7E5D3      VFDSPPLGAGVDPLILGTLTGSLVLVLRTGYSDRDVAAAKLEMLQRLPIRLLGAILNDV-
A0A2V7ISE2      LVDSPPLSAGVDPLILGTLTGHLVVVLRTGYSHRDVAAAKLEVLQRLPVRLLGAILNAV-
A0A1Q7J2X5      LVDSPPLGAGVDPLILGTLTGHLVVVLRTGYSHRDVAAAKLEVLQRLPVRLLGAILNAV-
A0A2V7NPD1      LVDSPPLGAGVDPLILGTLTGHLVVVLRTGYSHRDVAAAKLEVLQRLPVRLLGAILNAV-
A0A2V7QPD8      LIDSPPLAAGVDPLILSTLTGTLTLVLRTGYSHRDVAAAKLEVLQRLPVRMLGAVLNDV-
A0A2V7Q8M6      LIDSPPLAAGVDPLILGTLTGTLALVLRTGYSHRDVAAAKLEMLHRLPVRLLGAILNDV-
A0A2V7QBC3      LIDSPPLAAGVDPLILGTLTGTLALVLRTGYSHRDVAAAKLETLQRLPVRLLGAILNDV-
A0A2V7LMU1      LIDSPPLGAGVDPLILGTLTGTLALVLRTGYSHRDVATAKLEMLQRLPVRLLGAIMNDV-
A0A2V7PBY9      LFDSPPLAAGVDPLIVGTLTGTLALVLRTGYSHRDVAAAKLEVLQRLPIRLLGAILNDV-
A0A3M2BLV5      IVDSPPVLAVTDAALLGAHTDGVVLVLRSGETEQRAAERAVEQLRRVGVRVFGAVLNEV-
A0A2V7KS68      LIDSPPLTAGVDPFVLGTLTGALVLVLRTGHSNRNITGAKLDMLQRLPVRLLGAVLNDV-
A0A2V7N4L3      VVDSPPLAAGVDSFVLGTVTGTLLVVLRTGHSHRDITGAKLEMLDRLPIRLLGAVLNDV-
A0A1Q7AZK2      LVDSPPLTAGVDPFVLGTVTGALLLVLRTGHSHRDITGAKLEVLDRLPIRLLGAVLNDV-
A0A1Q7TNP7      LVDSPPLTAGVDPFVLGTVTGALLLVLRTGHSHRDITGAKLEVLDRLPIRLLGAVLNDV-
A0A1Q7KG39      LVDSPPLTAGVDPFVLGTVTGALLLVLRTGHSHRDITGAKLEVLDRLPIRLLGAVLNDV-
A0A1Q7GX75      VVDSPPLAAGVDSFIIGTVTGSLLLVLRTGHSHRDITGAKLEVLDRLPIRLLGAVLNDV-
A0A1Q7LL80      VVDSPPLAAGVDSFIIGTVTGSLLLVLRTGHSHRDITGAKLEVLDRLPIRLLGAVLNDV-
A0A2V7PFU2      VVDSPPLTAGVDPFILGTATGSLLLVLRTGHSHRDVTGAKLEMLDRLPIRLLGAVLNDI-
A0A2V7MFS9      LVDSPPLTAGVDPFILGTVTGSLLVVLRTGHSHREIAGAKLEVLERLPIRLLGAVLNDV-
A0A2V7T933      LVDSPPLTAGVDPFVLGTVTGALLLVLRTGHSHRDITGAKLEVLDRLPIRLLGAVLNDV-
A0A2V7J4D7      IVDSPPLAAGADGLALATVTGSLVLVLRTGVSDRELTETKLGALHHLPVRVLGAVLNDV-
A0A2V7LN90      IVDSSPLAAGADAFALATATGSMLLVLRTGVSDRELAQAKLEVLQYLPIRVLGAVLNDV-
A0A2V7LFN9      IIDSSPLAAGADAFALGTGTGTLLLVLRTGVSDGGLALAKLEVMSRLPIRVLGAVLNDV-
A0A2V7MEK4      IIDSSPLAAGADAFALGTGTGTLLLVLRTGVSDGGLALAKLEVMSRLPIRVLGAVLNDV-
A0A2V7P8B1      VVDSPPLGAGVDALLVASLAGSLLMVLRLGRTDRELAEAKLELLRAQPIRVLGAVLNDV-
A0A2V7QN41      LVDSPPLAVGVDPYVLATRTGNVLIVLRAGVSDLDLAAAKLDVLDTLPVRVLGAVLNDV-
A0A2V7R603      LVDSPPLAVGVDPYVLATRTGNVLIVLRAGVSDLDLAAAKLDVLDTLPVRVLGAVLNDV-
A0A2V7LJS2      VVDTPPLGAGVDAFVLASLAGSLLLVLRLGRTDRELAEAKIDLLRQSSTRVLGVVLNDV-
A0A1Q7GLJ7      VLDTAPLGAGVDALALAKLAGNLLMVLRLGRTDRELAEAKLEILRRLPLRLLGAVLNDV-
A0A2V7GRE3      VVDTAPLGAGVDALVLAKLARNLLMVLRLGRTDRVLAEAKLEILRRLPLRLLGAVLNDV-
A0A2V7EU00      LIDSSPLGAGVDPFLLGTLTGSLLIVLRSGTTDRELAQANLDGLLRLPIRVLGAVLNDI-
A0A1Q6WE01      LVDSPPLGSGVDPYTLGTLTSNMLLVLRTDATDLSLARTKLSVLDQLPIRLLGVVVNDV-
A0A2V7S9K3      LLDSPPLGSGVDPYTLATLTGSLLLVLRTGATNLDLARTKLGMLDHLPIRLLGVVVNDV-
A0A1Q7DXB9      LVDTAPLAAGADPYTMASLTTNLLMVLRAGVTDLELAQAKLESFEDLPVRVVGTVLNDV-
A0A1Q7JD32      LVDTAPLAAGADPYTMASLTTNLLMVLRAGVTDLELAQAKLESFEDLPVRVVGTVLNDV-
A0A2V7MVP8      LVDTAPLAAGADPYTMASHTKNLLVVLRAGVTDLELAQAKLESFDDMPVRVVGSVLNDV-
A0A2V7N0A9      LVDSAPLAAGVDPYALGVATGNMLLVVRPDVTDRAIAEAKVEVLQRLPVRLLGAVLNDV-
A0A1Q7DLS9      LIDSPPLAAGVDACALGTMTGSLVLVLRTGVSDRELVEAKLDVLERLPIRILGAVLNDV-
A0A1Q7JK96      LIDSPPLAAGVDACALGTMTGSLVLVLRTGVSDRELVEAKLDVLERLPIRILGAVLNDV-
A0A2V7KQV7      LVDSPPLAAGVDASALGAVTGSLLVVLRTGVTDRMIAEAKVELLRTLPIRMLGVVLNDV-
A0A1Q7JGF6      LVDSAPLAAGVDPYALGTATGSMLLVLRTGVTDRTLAEAKVEVLHRLPIRVLGAVLNDV-
A0A2V7SG67      LVDSAPLAAGVDPYALGTATGSMLLVLRTGVTDRTLAEAKVEVLHRLPIRVLGAVLNDV-
A0A1Q7GIK9      LVDSAPLAAGVDPYALGAATGNVLLVLRTGVTDRSLAEAKVEVLHRLPLRVLGAILNDV-
                :.*. *     *   :.       ::     :                      ::*   

A0A2D5ZJF2      HRREGYG---YGYYGGYGQYGGYYGRDRAEGRREGGRGSSGTEKGSSTG-----------
A0A0S8H9P3      VLQRGAD---RYYFDYY--YSRSSS-----------------------------------
A0A1E4BBP7      -----GELPQFKYY-YY--LEGYRALEGAEEGNAALLGSGSGGNGRG-------------
A0A3M2G737      PKKAYGGYYYGNYYKYY--YYSSYYGSDRDKKKQRSIKLKS-------------------
A0A0H4TUX7      --SSRHD----RYYTYY--SYRREPARRGLLTAGSPRAGGCSPFGRSSAIPSENQ-----
A0A1G0LUG0      --NQQKD----QYYTYY--ASRE-----------APRRSRTSLFTR--------------
A0A1Q7E3T7      --QDGPE---YTGYSYY--LEGYEATAEGVREHHTVLRSSG-------------------
A0A1G0L906      KMRDR-----YYYYYYY--RKDPRTTRGLLSALREQIAHLF-------------------
A0A1G0LCC0      KMRDR-----YYYYYYY--RKDPRTTRGLLSALREQIAHLF-------------------
A0A2D5ZJE2      --DVGGGYGRYGGYHYH--YHYHEDADNKTNSRATSIWRAARGVAIVATFFAIAAAMWHQ
A0A3M2G624      --RINEIYGYQKHYYYY--DTKKPVKV---------------------------------
W0RI74          --RTDSG--MYQYYSYD---PDYVLPEETPALSAGGGGGTSVAVREG-------------
A0A3M2BJA6      FRRDSRYSSSYGRYGYY--YQYYYGDNGKKKK----------------------------
A0A3D4VBZ5      --KMTGA---YQYYSYY---QDYAAEDEQPERLSAGSGSSRPVALSGGVSDA--------
C1A5W1          --KMTGA---YQYYSYY---QDYAAEDEQPERLSAGSGSSRPVALSGGVSDA--------
A0A2V7PX99      --RGHGA---FRYYTYD--LADYAEPDPAVAATRRDGWRHILGGRSS-------------
A0A2V7ERC7      --PGGGA---YRYYG-----TNYYYGDTRAKEHVGNLATPKGLLLNA-------------
A0A5Q4D6Y4      --PDGEA---EKYGAYY--SYGYYGSTE--------------------------------
A0A2V7JTZ5      --PDGGA---YRYYG-----ADYSYKDEVLKEPIADIATPKGLLVRS-------------
A0A3D4YTR6      --PGGGA---YRYYG-----ADYEYKGDSSTEPIADLATPQGLVLRA-------------
A0A5Q4DA46      --PAGSA--AYKSYAY---LPGYGVADEEPETREAPEGRRLVARAEA-------------
A0A2V7F1M1      --AGELARYGKYYYSY-----GYPTPSD--------------------------------
A0A2V7KXK7      --RSSGV---YRYYMYS--SAEYELVDDEGQTREALPSILGGRT----------------
A0A651HKD3      --SQGDH---YNYYGY---VPGYGVDEVEQLHLVAGATQARGAVGSGGR-----------
A0A2V7QDU7      --D-------YRRDRVY--GRAYGQRASYLETE---------------------------
A0A2V7ITT6      --RPRGV---YRYHSY---LSGYGTADEAEYAMGPPRVRGVL------------------
A0A2V7NJW1      --RPRGV---YRYHSY---LSGYGTADEAEYAMGPPRVRGVL------------------
A0A2V7GFB5      --PPGAA---YQYYSYY--TPGYEATDE----------KPARLTPSVG------------
A0A2V7RQ86      --PPGAA---YQYYSYY--TPGYEATDE----------KPARLTPSVG------------
A0A2V7IWX2      --QPKGA---YRYYAYY--VPGYETKEE----ADLGPEKPVLGVPSV-------------
A0A1Q7KE95      --RPGGM---YRYYS-Y--LSGYATTNEREGYAVAGRQARGVL-----------------
A0A1Q7T8X5      --RPGGM---YRYYS-Y--LSGYATTNEREGYAVAGRQARGVL-----------------
A0A2V7MS64      --R-GSR---YKYYSYY--LEGYEARDE--QPASRLMRAPE-------------------
A0A2V7Q7N9      --RPGGV---YRYYSYY--LEGYEAKDEPAEAAGQVLQAPEQVLPAPE------------
A0A2V7IRW6      --R-GGL---YRYYSYY--LEGYEVKEEP-EPAWQLVRAPE-------------------
A0A1Q7DVU6      --R-GGL---YRYYSYY--LEGYEVKEEP-EPAWQLVRAPE-------------------
A0A1Q7JSV2      --R-GGL---YRYYSYY--LEGYEVKEEP-EPAWQLVRAPE-------------------
A0A2V7FK98      --PAGGA---YRYYSYY--LPGYEAMDE----NSGSPRVPV-------------------
A0A2V7R3Z8      --PAGGA---YRYYSYY--LPGYEAMDE----NSGSPRVPV-------------------
A0A2V7J3C0      --RSDDL---YRHYS-Y--LSGYATVDEQEGYAIAGRKAHGVL-----------------
A0A2V7KWV9      --RLGQM---YGEYYGY--MAGYGTTTEDGGTRIARRRLQGAL-----------------
A0A1Q6ZHP2      --PAGEA---YRYYSYY--LPGYEAVDEEAERASGGKGQPFVI-----------------
A0A1Q7R6Z6      --PAGEA---YRYYSYY--LPGYEAVDEEAERASGGKGQPFVI-----------------
A0A2V7FYT7      --PAGEA---YRYYSYY--LPGYEAVDEEAERASGGKGQPFVI-----------------
A0A2V7IGR0      --PAGAT---YRYYSYY--LPGYEAVDEEAQ------AQPLVT-----------------
A0A2V7MR23      --PAGDA---YRYYSYY--LPGYEAVDEEAEQASGGKGQPFVI-----------------
A0A2V7L1V3      --PAGGA---YRYYSYY--LPGYEAADE----NSGSRRVPV-------------------
A0A1Q7E5D3      --PAGAA---YRYYSYY--LPGYEAVD-EGERNSGPKVRSLVI-----------------
A0A2V7ISE2      --PAGAA---YRYYSYY--LPGYEAVDEEAERTSGGNKQPFVI-----------------
A0A1Q7J2X5      --PAGAA---YRYYSYY--LPGYEAVDEEAERTSGGNKQPFVI-----------------
A0A2V7NPD1      --PAGAA---YRYYSYY--LPGYEAVDEEAERTSGGNKQPFVI-----------------
A0A2V7QPD8      --PAGGA---YRYYSYY--LPGYEAMDE----NSGTPRVPV-------------------
A0A2V7Q8M6      --PAGGA---YRYYSYY--LPGYEAADE----NSGSR-----------------------
A0A2V7QBC3      --PAGGA---YRYYSYY--LPGYEAADE----NSGSRRVPV-------------------
A0A2V7LMU1      --PAGGA---YRSYSYY--LPGYEAMDE----ERGSGRVPV-------------------
A0A2V7PBY9      --PAGGA---YRYYSYY--LPGYEAADE----EAGSRRVPV-------------------
A0A3M2BLV5      --STSNA--EESYYLQY--YYGYHPREETGWQRLRSGLSRARFW----------------
A0A2V7KS68      --PRGGAYGYYAYYSYY--LPGYEAVEERD-GARQTGPVVVTE-----------------
A0A2V7N4L3      --PRGAAYGYYAYYSYY--LPGYEAVDESKHGRRTPAPTVV-------------------
A0A1Q7AZK2      --PHGAAYGYYSYYSYY--LPGYEAVDEGD--RQASGARVV-------------------
A0A1Q7TNP7      --PHGAAYGYYSYYSYY--LPGYEAVDEGD--RQASGARVV-------------------
A0A1Q7KG39      --PHGAAYGYYSYYSYY--LPGYEAVDEGD--RQASGARVV-------------------
A0A1Q7GX75      --PRGAAYGYYAYYSYY--LPGYEAVEESS--GQASAPRVV-------------------
A0A1Q7LL80      --PRGAAYGYYAYYSYY--LPGYEAVEESS--GQASAPRVV-------------------
A0A2V7PFU2      --PREAAYGYYAYYSYY--LPGYEAVDEGA--GRTSGPRVV-------------------
A0A2V7MFS9      --PRGAAYGYYAYYSYY--LPGYEAVDEGD-GRRTSGPQVV-------------------
A0A2V7T933      --PHGAAYGYYSYYSYY--LPGYEAVDEGD--RQASGARVV-------------------
A0A2V7J4D7      --RPGGA---YRYYSYY--LEGYEVHDEPAAADVHVLRGPER------------------
A0A2V7LN90      --RLGGV---YRYYSYY--LEGYEATDEPAGAEGEVLRGPE-------------------
A0A2V7LFN9      --RGGSL---YRDYSYY--LEGYETQDEPDEARGQVLRAPEYP-----------------
A0A2V7MEK4      --RGGSL---YRDYSYY--LEGYETQDEPDEARGQVLRAPEYP-----------------
A0A2V7P8B1      --REGSE---YHAYSYY--LDGYELGDEPLFEPLV-SRPRGTTPVAGR------------
A0A2V7QN41      --RPYGA---YRYYTYD--AAAYAEANGAASQRRG----GSAGVLWGQS-----------
A0A2V7R603      --RPYGA---YRYYTYD--AAAYAEGNGAIGQRRP----GSAGVLWGRS-----------
A0A2V7LJS2      --REGSE---YRAYSYY--MDGYEFTGEPLFQPLGDATKRGRPPVTARQ-----------
A0A1Q7GLJ7      --RDESE---YRAYAYY--MDGYALTNEPPFRPLG-G-KQGASSHAAG------------
A0A2V7GRE3      --RDESE---YRAYAYY--MDGYALTNEPLFRPLA-GNKQGVGSRPAR------------
A0A2V7EU00      --EPRGA---YRYYSY---LSGYAAEDEPTAPPQQWAVARRLPGASSPDA----------
A0A1Q6WE01      --RPGGV---YRYYSY---FAGYGTRDEGVA-----IATHRVRGVL--------------
A0A2V7S9K3      --QPGGA---YRYYSY---LSGYATADEGTA-----SAAHRLRGVL--------------
A0A1Q7DXB9      --QPKGA---YRYYAYY--VPGYETKEEADLGPEKPVLGVPSV-----------------
A0A1Q7JD32      --QPKGA---YRYYAYY--VPGYETKEEADLGPEKPVLGVPSV-----------------
A0A2V7MVP8      --RPKGA---YRYYAYY--VPGYETKEEADLGPEKPVLGVPGD-----------------
A0A2V7N0A9      --RPGLA---YNHYSYS--LAGYEMQEEDSGREAGPILLPDSP-----------------
A0A1Q7DLS9      --RPGGA---YRSYAYS--LSGYDLHDEEEPPKR---ILRSVE-----------------
A0A1Q7JK96      --RPGGA---YRSYAYS--LSGYDLHDEEEPPKR---ILRSVE-----------------
A0A2V7KQV7      --RPGVA---YSYYAYS--LEGYSVREEDPDGRAGT-LLPRRS-----------------
A0A1Q7JGF6      --RPGAA---YTYYSYS--LAGSEVQEEDPGGVTSEILLPDRS-----------------
A0A2V7SG67      --RPGAA---YTYYSYS--LAGSEVQEEDPGGVTSEILLPDRS-----------------
A0A1Q7GIK9      --RPGSA---YSYYSYS--LEGYEVRDEDPEGKAGKMLLPDPA-----------------
                                                                            

A0A2D5ZJF2      ----------------------------------
A0A0S8H9P3      ----------------------------------
A0A1E4BBP7      ----------------------------------
A0A3M2G737      ----------------------------------
A0A0H4TUX7      ----------------------------------
A0A1G0LUG0      ----------------------------------
A0A1Q7E3T7      ----------------------------------
A0A1G0L906      ----------------------------------
A0A1G0LCC0      ----------------------------------
A0A2D5ZJE2      RRPTLAEADTVESRMVPNTEDGRIAGLEEGVVGR
A0A3M2G624      ----------------------------------
W0RI74          ----------------------------------
A0A3M2BJA6      ----------------------------------
A0A3D4VBZ5      ----------------------------------
C1A5W1          ----------------------------------
A0A2V7PX99      ----------------------------------
A0A2V7ERC7      ----------------------------------
A0A5Q4D6Y4      ----------------------------------
A0A2V7JTZ5      ----------------------------------
A0A3D4YTR6      ----------------------------------
A0A5Q4DA46      ----------------------------------
A0A2V7F1M1      ----------------------------------
A0A2V7KXK7      ----------------------------------
A0A651HKD3      ----------------------------------
A0A2V7QDU7      ----------------------------------
A0A2V7ITT6      ----------------------------------
A0A2V7NJW1      ----------------------------------
A0A2V7GFB5      ----------------------------------
A0A2V7RQ86      ----------------------------------
A0A2V7IWX2      ----------------------------------
A0A1Q7KE95      ----------------------------------
A0A1Q7T8X5      ----------------------------------
A0A2V7MS64      ----------------------------------
A0A2V7Q7N9      ----------------------------------
A0A2V7IRW6      ----------------------------------
A0A1Q7DVU6      ----------------------------------
A0A1Q7JSV2      ----------------------------------
A0A2V7FK98      ----------------------------------
A0A2V7R3Z8      ----------------------------------
A0A2V7J3C0      ----------------------------------
A0A2V7KWV9      ----------------------------------
A0A1Q6ZHP2      ----------------------------------
A0A1Q7R6Z6      ----------------------------------
A0A2V7FYT7      ----------------------------------
A0A2V7IGR0      ----------------------------------
A0A2V7MR23      ----------------------------------
A0A2V7L1V3      ----------------------------------
A0A1Q7E5D3      ----------------------------------
A0A2V7ISE2      ----------------------------------
A0A1Q7J2X5      ----------------------------------
A0A2V7NPD1      ----------------------------------
A0A2V7QPD8      ----------------------------------
A0A2V7Q8M6      ----------------------------------
A0A2V7QBC3      ----------------------------------
A0A2V7LMU1      ----------------------------------
A0A2V7PBY9      ----------------------------------
A0A3M2BLV5      ----------------------------------
A0A2V7KS68      ----------------------------------
A0A2V7N4L3      ----------------------------------
A0A1Q7AZK2      ----------------------------------
A0A1Q7TNP7      ----------------------------------
A0A1Q7KG39      ----------------------------------
A0A1Q7GX75      ----------------------------------
A0A1Q7LL80      ----------------------------------
A0A2V7PFU2      ----------------------------------
A0A2V7MFS9      ----------------------------------
A0A2V7T933      ----------------------------------
A0A2V7J4D7      ----------------------------------
A0A2V7LN90      ----------------------------------
A0A2V7LFN9      ----------------------------------
A0A2V7MEK4      ----------------------------------
A0A2V7P8B1      ----------------------------------
A0A2V7QN41      ----------------------------------
A0A2V7R603      ----------------------------------
A0A2V7LJS2      ----------------------------------
A0A1Q7GLJ7      ----------------------------------
A0A2V7GRE3      ----------------------------------
A0A2V7EU00      ----------------------------------
A0A1Q6WE01      ----------------------------------
A0A2V7S9K3      ----------------------------------
A0A1Q7DXB9      ----------------------------------
A0A1Q7JD32      ----------------------------------
A0A2V7MVP8      ----------------------------------
A0A2V7N0A9      ----------------------------------
A0A1Q7DLS9      ----------------------------------
A0A1Q7JK96      ----------------------------------
A0A2V7KQV7      ----------------------------------
A0A1Q7JGF6      ----------------------------------
A0A2V7SG67      ----------------------------------
A0A1Q7GIK9      ----------------------------------
                                                  

© 1998-2021Legal notice