BYKdb

Dataset for cluster orphancd of phylum fusobacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

14 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A369XZZ5      ------MAERNIFFKKGQNNQMAELFRILRTNIYFMGKKK-NRVVVVTSTIPGEGKSTVA
A0A842IYV3      --MKKEESQRRLFFKGDKEDQVAESFRLLRTNIHFMDEKT-NRVVIVTSTIPKEGKSSVA
A0A7X1HM01      -------MSQDLFFDN--NIQLSESLRVIRTNLFFLNNKDFGRIILVTSSVPKEGKSVLA
A0A1T4LVC1      ---MELKSKRRVFFKEKANHEISESLRVIRTNLHFLDEKERGRTILVTSSTPREGKSFIA
A0A7X1HR52      ---MENRTKRQLFFKDADNHEMNEALRVIRTNLHFLNEKESERTVLVTSTTPKEGKSTIA
A0A349GTC6      -----------MFFNKEQDSHLAESLRILRTNLHFMEEKK-NRIVIFTSTIPKEGKSTVS
A0A369XZK7      -MDKQISSERKMFFKGDQDSHLAESLRVLRTNIHFMEEKE-NRIVVFTSTIPREGKSTIA
A0A7X1HJ52      --------MSQNLFFNDDNIQLSESLRVIRTNLFFLNNKEAGRVILITSSVPKEGKSLLA
A0A7X1HNF5      ----MEKSKRQLFFKDSENHEMNEALRVIRTNLHFLNEKEEDRIVLVTSTTPKEGKSTIA
U7VC77          MEEMMDRSKRQIFFKDANNHEMNEALRVIRTNLHFLNEKEVARTVLVTSTAPKEGKSTIA
A0A7G9GVB4      --------MHKIFFVDEDNIEVTEALRTLRTNLSFLDDKEKGRTILFSSSIPAEGKSFVA
A0A377GZU7      ------MSKRKIFFIQEDNMEVTEAFRTVRTNLAFQNEKDIGRKIMITSSIPGEGKSTLA
A0A414PP78      ------MSKRKIFFIQEDNMEATEAFRTVRTNLAFQNDKEIGRKIMVTSSIPGEGKSTLA
A0A6N7VPP3      ------MSKRKIFFIQEDNMEATEAFRTVRTNLAFQNDKEIGRKIMVTSSIPGEGKSTLA
                            :*    :    * :* :***: *  .*   * ::.:*: * **** ::

A0A369XZZ5      SNYAMSVAIGKEKVLLIDCDIRKPRAHSSFGIQINHGMGEVLSGEKKIDEVILKGVEKNL
A0A842IYV3      SNYAMSEAIAGKKVLIVDCDIRRPRAHTSFGIQVTKGLADVLAGNAKIEDVILKDVENNL
A0A7X1HM01      VNYAHSIAITDKKVLLIDCDLRNPRLDEAFNLKFNFGLESLLFNDLDIEKIIIKNISKNL
A0A1T4LVC1      ANYAMSIAITGKKVLLIDCDIRRPRAHESFGKKVEKGLESILLGEKNSRDVILKEVEKNL
A0A7X1HR52      SNYAMSIAITGKKVLLIDCDIRRPRAHESFGVSFNSGLESVLSGECQVDDVILKNIEENL
A0A349GTC6      ANYAMSVAMSGEKVLIVDCDIRRPRAHSSFGIEVNKGLGEILLEKESLEDVILKDIEPNL
A0A369XZK7      ANYAMSVAISGEKVLLVDCDIRRPRAHSSFGIEITHGMGSVLLGDKKIEDVILKDIEENL
A0A7X1HJ52      INYAYSIAITGKKVLLIDCDLRCPRLNEAFNLNFNHGLESLLANNLEHEKIVIKNISKNL
A0A7X1HNF5      SNYAMSIAITGKKVLLVDCDIRRPRAHESFGVNFKMGLESVLTGKTVINDVILKDVEKNL
U7VC77          SNYAMSIAITGKKVLLVDCDIRRPRAHESFGVSFDKGLESVLAGECEVENVILKDVEKNL
A0A7G9GVB4      ANYAASIAIADKKVLLIDCDIRRPRAHESFGIKVQKGLESVLTNNTPVDEVIIKDIMPNL
A0A377GZU7      GNYGASLAIAGKKVLLIDCDIRRPRAHESFGIKVERGLEAVLTENADPKSVILKDIIPNF
A0A414PP78      GNYGASLAIAGKKVLLIDCDIRRPRAHESFGIKVERGLESVLTENVNPKDVIIKDLIPNF
A0A6N7VPP3      GNYGASLAIAGKKVLLIDCDIRRLRAHESFGIKVERGLESVLTENVNPKDVIIKDLIPNF
                 **. * *:  :***::***:*  *   :*. ..  *:  :*  .    .:::* :  *:

A0A369XZZ5      DILPSKHMDQNVSELFLGDRMRNILEKLRKKYDLIVLDTPPLMVVTDALILSQYGDGVLY
A0A842IYV3      DLLPAKHFQGNVTEMFLSKNLSKQLDTLRALYDLIILDTAPLTVATDAVLLAEHGDGVIY
A0A7X1HM01      DFIPSKVVASNPTELFLNDKFLTLLNKIKNDYNTIIIDTPPLTVASDAAILSKVSDGVIY
A0A1T4LVC1      DVLPTKYIKSNVTELFLGDRMKRVIEELRDEYNTIVLDTPPLVVASDGAILSKYCDGVVF
A0A7X1HR52      DILPTRNVAHNVTELFLGDKMKTLLDRLKKEYNTIVLDTPPLIVASDAAILSKHCDGVVY
A0A349GTC6      DILPSTHLNHNVTELFLGNRMKNLLLELRKRYDLIVLDTPPLVISTDAVILSEYSDGVVY
A0A369XZK7      DILPSKHLSQNVTELFLGNKMKDLLKALRGKYDLIVLDTPPLVVATDAVILSEYADGVVY
A0A7X1HJ52      DFIPSKTVTSNPTELFLNDKFLTLLNTVKNNYNTIIIDTPPLTIASDAAILSKLSDGVVY
A0A7X1HNF5      DILPTRYMAHNVTELFLGDKMKTLLEGLKGEYNTIVLDTPPLIVASDAAILSKHCDGVVY
U7VC77          DILPTRNVAHNVTELFLGDKMKALLKDLKGEYNTVVLDTPPLIIASDAAILSKHCDGVVY
A0A7G9GVB4      DLLPTKHMKNNVTELFVRDRMKTILEEIKNDYDVVVLDTPPIAVASDAVILSKNVDGVVI
A0A377GZU7      DLLPTKHMKYNVTELFIGDKMKEVIAELENEYNTIILDMPPLAVASDAAILSKYVDGVVV
A0A414PP78      DLLPTKHMRYNVTELFIGDKMKEVISSLENEYNTIILDMPPLAVASDAAILSKYVDGVVV
A0A6N7VPP3      DLLPTKHMRYNVTELFIGDKMKEVISSLENEYNTIILDMPPLAVASDAAILSKYVDGVVV
                *.:*:  .  * :*:*: ..:   :  :   *: :::* .*: : :*. :*::  ***: 

A0A369XZZ5      VCGYDMVTKQEMNQAKKMLDSAGVTLYGVIVNRINKDGYSHGNYGYYNYKYKDYQDYFNG
A0A842IYV3      VVGYDMVTKKELEHAKKLLHRAKANLYGVVMNKVDKTGYSYGNYGYYNYNYRYYNDYITE
A0A7X1HM01      VVAYDEVNAEDLKFGKELLRNAKANIYGFVVNKAEKNIGSYG------RNYSYYGDSSKN
A0A1T4LVC1      VVSYDQVSKSELEFSKKMLDNAGANLYGFVVNRVEKNGFSYGNYCYYNNNYTYYKDYYLD
A0A7X1HR52      VVAYDQVAKRELEFGKTMLNNAKANMYGFVVNKVDKNGLSYGNYGYYNNNYSYYKDYYTE
A0A349GTC6      VCGYDMVSKKQLVQSRKILDRAKANIYGVVVNKIDKDGYSYGNYGYYNYNYKYYDEYSKG
A0A369XZK7      VCGYDMVSKKELLQSKDMLDRAGANIYGIVVNKIDKRGYSYGNYGYYNNNYSYYEEYIKG
A0A7X1HJ52      VVAYDEVSAEDLKFGKELLKNAKANIYGFVVNKAEK------NIGNYGRKYPY--DYESS
A0A7X1HNF5      VVAYDQVAKRELEFGKTMLENAKANLYGFVVNRVDKNGLSYGNYGYYNNNYSYYKDYYTE
U7VC77          VVAYDQVAKRELEFGKTMLNNAKANIYGFVVNKVDKNGLSYGNYGYYNNNYSYYKDYYTE
A0A7G9GVB4      VIGYDQVAKRELEFTKEMFTNAGANLYGFVVNGVDKSGLSYGNYGYYNNYYTYYEDYYMD
A0A377GZU7      VVAYDQVAKRELEFTKEMLSNAGANIYGFVVTKVDKGGLSYGNYGYYNNYYSYYQEYYSD
A0A414PP78      VVAYDQVAKRELEFTKEMLSNAGANIYGFVVTKVDKGGLSYGNYGYYNNYYSYYQEYYSD
A0A6N7VPP3      VVAYDQVAKRELEFTKEMLSNAGANIYGFVVTKVDKGGLSYGNYGYYNNYYSYYQEYYSD
                * .** *   ::   . ::  * ..:**.::.  :*              *    :    

A0A369XZZ5      DKQ--------------------------------------
A0A842IYV3      E----------------------------------------
A0A7X1HM01      SKKS------------------KFSLNFIKKFFGGGE----
A0A1T4LVC1      EERGQSR--S-KPKSKMEKYMEKLKKAYRRELSGNQKGKKY
A0A7X1HR52      EGEALAR--AYKPQKGFKGFIEKLKRDYKRQLSGDQKGKRW
A0A349GTC6      EK---------------------------------------
A0A369XZK7      DK---------------------------------------
A0A7X1HJ52      KDSKKSI----------------FSLNFIKTFFGGRE----
A0A7X1HNF5      EGENLSR--TYVPKKGFKGFVEKLKRDYKRQLSGDQKGKRW
U7VC77          EGEALAR--AYKPQKGFKGFIEKLKRDYKRQLSGDQKGKRW
A0A7G9GVB4      DDNHKVRKKVKTPKNKIKRFIYNIKSAYIKHFSGDIRKRR-
A0A377GZU7      SDGNRKKHIVKKPKSKFGRFMHAVKEQYKRQFSGDLKGKK-
A0A414PP78      SNGNRKKHTVKKPKSKFGKFIHDIKEQYKRQFSGDLKGKK-
A0A6N7VPP3      SNGNRKKHTVKKPKSKFGKFIHDIKEQYKRQFSGDLKGKK-
                .                                        

© 1998-2022Legal notice