BYKdb

Dataset for cluster tadcd of phylum firmicutes

[Download (right click)] [Edit] [Sequences] [Repertoires]

283 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


S3FFL2          ------------------------------------------------------------
A0A328M4V1      ------------------------------------------------------------
A0A6A8IF17      ------------------------------------------------------------
A0A143WVN6      ------------------------------------------------------------
W6RXP9          ------------------------------------------------------------
W6S4G8          ------------------------------------------------------------
A0A3D5R4X5      ------------------------------------------------------------
A0A1I4C3N6      ------------------------------------------------------------
A0A3B9CIM7      ------------------------------------------------------------
A0A7R7IBN8      ------------------------------------------------------------
A0A1G9WHW8      ------------------------------------------------------------
A0A1H5VAA0      ------------------------------------------------------------
A0A3R6VK11      ------------------------------------------------------------
A0A3R6QUY7      ------------------------------------------------------------
A0A373K3P9      ------------------------------------------------------------
A0A3R6JRU5      ------------------------------------------------------------
A0A1C5MS04      ------------------------------------------------------------
A0A3C1J150      ------------------------------------------------------------
A0A416CXD7      ------------------------------------------------------------
A0A6N2X662      ------------------------------------------------------------
R6XBL9          ------------------------------------------------------------
A0A355W5Z7      ------------------------------------------------------------
A0A1G6BLB6      ------------------------------------------------------------
A0A1C6G8M0      -----------------------------------------------------------M
A0A416MP73      ------------------------------------------------------------
A0A3E4LL92      ------------------------------------------------------------
A0A415D1L1      ------------------------------------------------------------
A0A396G6S7      ------------------------------------------------------------
A0A3E5A223      ------------------------------------------------------------
R7D5E6          ------------------------------------------------------------
A0A415HQH5      ------------------------------------------------------------
A0A414W2C6      ------------------------------------------------------------
A5ZNE7          ------------------------------------------------------------
A0A395X821      ------------------------------------------------------------
A0A1C5PY68      ------------------------------------------------------------
A0A174CJF8      ------------------------------------------------------------
A0A564SRR2      ------------------------------------------------------------
A0A174R7V0      ------------------------------------------------------------
A0A373MWV2      ------------------------------------------------------------
A0A417CE88      ------------------------------------------------------------
A0A416Y441      ------------------------------------------------------------
A0A357GPJ7      ------------------------------------------------------------
A0A396PAC1      ------------------------------------------------------------
A0A416EYU4      ------------------------------------------------------------
A0A416SCQ2      ------------------------------------------------------------
A0A416TGN7      ------------------------------------------------------------
A0A417SMF6      ------------------------------------------------------------
A0A0H5SF45      ------------------------------------------------------------
A0A1M6JRJ5      ------------------------------------------------------------
A0A1M7Y1S2      ------------------------------------------------------------
A0A7I8DMN1      ------------------------------------------------------------
A0A1Y4MW77      ------------------------------------------------------------
A0A6S6R676      ------------------------------------------------------------
A0A0K8J554      ------------------------------------------------------------
A0A1I0RG99      ------------------------------------------------------------
A0A1I5G322      ------------------------------------------------------------
A0A7C6IYW8      ------------------------------------------------------------
A0A7C6JZF1      ------------------------------------------------------------
A0A3N1XSX6      ------------------------------------------------------------
A0A839K1C1      ------------------------------------------------------------
R6UHV6          ------------------------------------------------------------
A0A3R9Q621      ------------------------------------------------------------
A0A069RC75      ------------------------------------------------------------
A0A174F2W5      ------------------------------------------------------------
A0A174S8E9      ------------------------------------------------------------
A0A416ZL97      ------------------------------------------------------------
A0A174LSK1      ------------------------------------------------------------
A0A373GY92      ------------------------------------------------------------
A0A373NZQ6      ------------------------------------------------------------
A0A417I9B9      ------------------------------------------------------------
A0A417WQF8      ------------------------------------------------------------
A0A8B3CFR3      ------------------------------------------------------------
A0A373RZ83      ------------------------------------------------------------
A0A416U6I1      ------------------------------------------------------------
R7JQZ9          ------------------------------------------------------------
A0A1M5UYN6      ------------------------------------------------------------
A0A176JBT8      ------------------------------------------------------------
A0A1I5HIC6      ------------------------------------------------------------
A0A1Y3TC51      ------------------------------------------------------------
A0A1Y3T1N0      ------------------------------------------------------------
A0A1Y3Y8U8      ------------------------------------------------------------
A0A5B0BQY5      ------------------------------------------------------------
A6CLL4          ------------------------------------------------------------
A0A176U8D6      ------------------------------------------------------------
A0A1Q6KSQ5      ----------------------------------------------------------ML
A0A3D3U8B3      ----------------------------------------------------------ML
A0A3E5FRL7      ------------------------------------------------------------
A0A1Y4QK93      ------------------------------------------------------------
B1C232          ------------------------------------------------------------
A0A401USI6      ------------------------------------------------------------
A0A1V4IQ10      ------------------------------------------------------------
A0A1S8TRD2      ------------------------------------------------------------
G7M1U2          ------------------------------------------------------------
A0A2T6KJ75      ------------------------------------------------------------
A9KN92          ------------------------------------------------------------
A0A352MUJ1      ------------------------------------------------------------
R5YI67          ------------------------------------------------------------
A0A174DL89      ------------------------------------------------------------
A0A1Y0IQP5      ------------------------------------------------------------
A0A4R2R7B1      ------------------------------------------------------------
A0A1M6E8I2      ------------------------------------------------------------
A0A7C6SMH0      ------------------------------------------------------------
A0A7X7XYM7      ------------------------------------------------------------
A0A3B8KKL6      ------------------------------------------------------------
A0A2K9E6R0      ------------------------------------------------------------
A0A2S8RBI0      ------------------------------------------------------------
A0A7X8MFK9      ------------------------------------------------------------
A0A7X9D1M8      ------------------------------------------------------------
A0A0L6JLG6      ------------------------------------------------------------
A0A7X8PYA7      ------------------------------------------------------------
G8LSN0          ------------------------------------------------------------
A0A1Y4N105      ------------------------------------------------------------
A0A1Y4QP75      ------------------------------------------------------------
A0A3D4QRB5      ------------------------------------------------------------
A0A349DEH5      ------------------------------------------------------------
A0A3D4T7B4      ------------------------------------------------------------
A0A350XYC7      ------------------------------------------------------------
R6DNR8          ------------------------------------------------------------
A0A355KUM5      ------------------------------------------------------------
R5YGY6          ------------------------------------------------------------
A0A7G9WCY6      ------------------------------------------------------------
A0A0A5GPA9      ------------------------------------------------------------
A0A271M6M4      ------------------------------------------------------------
A0A1C6G0U3      ------------------------------------------------------------
A0A3D4LLB3      ------------------------------------------------------------
A0A7C7AD93      ------------------------------------------------------------
A0A2V3W8U6      ------------------------------------------------------------
A0A6N3BXA1      ------------------------------------------------------------
A0A351SRI8      ------------------------------------------------------------
A0A1V5LU59      ------------------------------------------------------------
A0A7X8R9W1      ------------------------------------------------------------
A0A1E3BVC3      ------------------------------------------------------------
A0A4Q0I6S0      ------------------------------------------------------------
A3DF66          ------------------------------------------------------------
W4V1T8          ------------------------------------------------------------
A0A1C6ITD7      ------------------------------------------------------------
A0A381IX63      ------------------------------------------------------------
A0A1M6RWV2      ------------------------------------------------------------
A0A841ZT34      ------------------------------------------------------------
A0A1G9IUT4      ------------------------------------------------------------
A0A842GR80      ------------------------------------------------------------
A0A7X0TNH3      ------------------------------------------------------------
A0A842D596      ------------------------------------------------------------
A0A842EQ86      ------------------------------------------------------------
A0A842A220      ------------------------------------------------------------
A0A7X0YM80      ------------------------------------------------------------
A0A842GEL5      ------------------------------------------------------------
A0A841XVD7      ------------------------------------------------------------
A0A7X0XME5      ------------------------------------------------------------
A0A842B6T1      ------------------------------------------------------------
A0A841X7G0      ------------------------------------------------------------
A0A841W3M8      ------------------------------------------------------------
A0A7X0XVI0      ------------------------------------------------------------
A0A7X0Z1K1      ------------------------------------------------------------
A0A143ZUX1      -------------------------------MYEQNTSATPS------------------
A0A7I8D809      -------------------------------MYEQNTSATPS------------------
A0A3R9WAA7      -------------------------MNYNDAAFGEVYTIDLS------------------
A0A1G6BLF1      ------------------------MAEYSSRQGTAPSAIDLG------------------
A0A355G1X5      ---------------------------MNTNVNTTSAPKGLE------------------
A0A1W2CEA6      -------------------------MKNKEKITGLTEEMTGISVRN--------------
A0A355G3J9      ----------------------------------------MR------------------
A0A3D2AD87      ---------------------------------------MQD------------------
A0A143XN92      -----------------------------MQKYRDTNEMELK------------------
R7FFK6          --------------------------------------MKKS------------------
A0A373MPB9      --------------------------------------MKKN------------------
A0A373L519      --------------------------------------MKKN------------------
A0A373W906      --------------------------------------MKKN------------------
A0A373VCW2      --------------------------------------MKKN------------------
W0U604          --------------------------------------MKKN------------------
A0A374B6G0      --------------------------------------MKKN------------------
A0A373VM36      --------------------------------------MKKN------------------
A0A1C5P379      --------------------------------------MKKN------------------
A0A373XXX0      --------------------------------------MKKN------------------
A0A5R9MJM9      --------------------------------------MKKN------------------
A0A356CW82      --------------------------------------MKKN------------------
R6T4X7          --------------------------------------MKKN------------------
A0A374HTV1      --------------------------------------MKKN------------------
A0A374GB66      --------------------------------------MKKN------------------
A0A374ECC6      --------------------------------------MKKN------------------
A0A374BM61      --------------------------------------MKKN------------------
A0A373UGZ4      --------------------------------------MKKN------------------
A0A373SA66      --------------------------------------MKKN------------------
A0A1C5X6X7      --------------------------------------MKKN------------------
A0A1C6JIH3      --------------------------------------MKKN------------------
A0A373PSC3      --------------------------------------MKKN------------------
A0A1K1WYK8      --------------------------------------MKNT------------------
A0A1H6IUB1      --------------------------------------MDNG------------------
A0A1M7L1F9      --------------------------------------MNNS------------------
A0A1C6B4L6      --------------------------------------MENS------------------
A0A1Q6T9P4      --------------------------------------MKNS------------------
A0A315Y4F9      --------------------------------------MNQS------------------
A0A354K620      --------------------------------------MNES------------------
A0A173ZYY6      --------------------------MESSNRNDMPVFMDND------------------
A0A6L8RXB5      --------------------------MESNNRNDMPAFMDTD------------------
A0A173SMI2      --------------------------MESNNRNDMPAFMDTD------------------
A0A845KKD0      --------------------------MESNNRNDMPAFMDTD------------------
A0A6N9JW85      --------------------------MESNNRNDMPAFMDTD------------------
A0A174ASH7      --------------------------MESNNRNDMPAFMDTD------------------
A6BH65          --------------------------MESSNRNDMPVFMDND------------------
R7G0D7          --------------------------MESSNRNDMPVFMDND------------------
R6HZX3          -------------------------MQEHSYEHNTDQKVDLE------------------
R5EFZ0          --------------------------MENTSKSNMQSARLLP------------------
A0A3E5FSY5      MIVIIMIMVIVIMIIKPIDMKVGDIMDEQRLKESMMEDDSIE------------------
A0A1V5S3C0      -------------------------MSGSDYNASVRDEEYGVSF----------------
A0A3C0QME1      ------------------------------------MNDS--------------------
A0A355FYK5      --------------------------------MQEDQRNSVNALLG--------------
A0A357AQU0      ---------------------------------MEQQKDEVE------------------
A0A3C1YJQ7      ---------------------------------MEQQKDEVE------------------
A0A3D0JG38      ---------------------------------MEQQKDEVE------------------
A0A3C0IHX1      -------------------------MGTLNQKNKNKQDDETE------------------
R5V506          -------------------------MGTLNQKNKNKQDDETE------------------
A0A352TIU5      -------------------------MGTLNQKNKNKQDDETE------------------
R5B467          --------------------------------MNEQRQGHTI------------------
A0A1Y3TC98      -------------------------MQDQRNRIDEREDEMEI------------------
A0A1W1Z4C3      -----------------------------------MNKQSGS------------------
A0A239QN83      -----------------------------------MNKQGGS------------------
A0A8A5CVI3      -----------------------------------MNKQGGS------------------
A0A8A5D3H1      -----------------------------------MNKQGGS------------------
A0A1Q6REE0      ----------------------------MEIEKTEQQGRDTF------------------
R5ETF9          ----------------------------MEIEKTEQQGRDTF------------------
A0A0F2P7X6      -------------------------MEHQGLNNGVDRTEENE------------------
A0A359B487      -------------------------MEHQGLNNGVNRTEENE------------------
R6VAT5          -------------------------MEKKFVPENSRSYTPVG------------------
D4LC36          --------------------------------------MKKE------------------
A0A7X3IXX7      ------------------------------------------------------------
A0A1Q6S448      ------------------------------MDENNQGLQWSH------------------
A0A351MYR0      ------------------------------MEEKNRGLQWSH------------------
R6HPC1          ------------------------------MDEKNRGLQWSH------------------
A0A3D4G5Z5      ------------------------------MDEKNRGLQWSH------------------
A0A3D5ES03      ------------------------------MDEKNRGLQWSH------------------
A0A348P5V4      -------------------------MNYNSEPKKDYEEGLSL------------------
A0A356PT74      -------------------------MAYSSSGKTHAEESVNL------------------
A0A3D5LL19      -------------------------MAYSSSGKTHAEESDNL------------------
R5MNF0          -------------------------MAYSSSGKTHVEESDNL------------------
A0A1Q9JSI0      --------------------------MSE--NKNTSINDYEM------------------
A0A3D5TNI1      --------------------------MNRIVKKDTDSDGVEI------------------
A0A358LJD0      --------------------------MSKIVRKDTDSDGVEV------------------
R6I3L7          --------------------------MSKIVRKDTNSDGVEV------------------
A0A3D1HXX0      --------------------------MSKIVRKDTDSDGVEV------------------
A0A3D2QJB8      --------------------------MSKIVRKDTDSDGVEV------------------
R7MQJ4          -----------------------------------MESNYTI------------------
A0A1V5GLC0      -----------------------------------MENTYSI------------------
W7V182          -------------------------------MKNDGKDMLDL------------------
A0A143XPI5      ----------------------------------MKEEYSREPQRS--------------
A0A0M6WXE3      ----------------------------------MENNRENASAQT--------------
A0A348SAK2      --------------------------------MKMENNRENASAQT--------------
A0A1G9H5B9      ---------------------------------------MKKKANQ--------------
A0A1Y4H8L0      -------------------------------------MNKDENFNE--------------
A0A4B9BMD9      ----------------------------------LEKDGVALTIAD--------------
A0A0M6WYQ8      ----------------------------MDEMREKSGKEQQGEIEK--------------
A0A348SAK1      ----------------------------MDEMREKSGKEQQGEIEK--------------
A0A252F281      ------------------------------------MEEKRWSLAS--------------
A0A1Y4QKE6      --------MMKFVIMIMVIVIMIIKTIGMKVGDIMDEQRLKESMLE--------------
B1C231          --------------MTMVIVIMIIKPIDMKVGDIMDEQRLKESMME--------------
A0A7V6WIR4      ------------------------------------------------------------
A0A1Y3TUL5      ----------------------------------MNDEYITIRLSD--------------
A0A1Y4JAX2      ----------------------------------MNDEYITIRLSD--------------
A0A1Y4T590      ----------------------------------MNDEYITIRLSD--------------
A0A1Y3T163      MLFTETGFPRVPDMDMIMETMGKTSGEETKEDKSMEDQRKEIENRE--------------
A0A1Y3YCA2      MLFTETGFPRVPDMDMIMETMGKTSGEETKEDKSMEDQRKEIENRE--------------
A0A7W8H9H2      ------------------------------------MADENRVRTE--------------
A0A1Y4L6N9      --------------------------------------MSELNHAE--------------
A0A173T644      ---------------------------------------MDERLED--------------
A0A1C5TSB8      ---------------------------------------MDERLED--------------
C0CIK6          -------------------------------------MTVDERLED--------------
A0A1Y3WEF6      --------------------------MAEQDRYGGNSQNLSRKIEE--------------
A0A417T0L2      --------------------------MAERDLYSKNNQNLSRRIDE--------------
A0A1H9EPU3      ----------------------------------MSNQTDEKFFQDDIGQTPGKILENAP
A0A354IGV3      ------------------------------------MEKKQSLGSA--------------
A0A417JMV2      ----------------------------------MSSDKRNISVND--------------
A0A415VWX5      ----------------------------------MSSDKRNISVND--------------
A0A173UY96      ----------------------------------MSSDKRNISVND--------------
B0P408          ----------------------------------MSSDKRNISVND--------------
D4MV82          ----------------------------------MSSDKRNISVND--------------
A0A173QTL1      ----------------------------------MSSDKRNISVND--------------
A0A174J359      ----------------------------------MSSDKRNISVND--------------
A0A174A3T7      ----------------------------------MSSDKRNISVND--------------
A0A417UUA3      ----------------------------------MSSDKRNISVND--------------
A0A6N2VB70      ----------------------------------MSSDKRNISVND--------------
A0A1C6EUV9      ----------------------------------MSNEKHNISVND--------------
A0A173Y645      ----------------------------------MSNEKHNISVND--------------
A0A374AVY6      ----------------------------------MSNEKHNISVND--------------
R7BXS4          ----------------------------------MSNEKHNISVND--------------
                                                                            

S3FFL2          -MGVAPKQKGAFAGLPVQQAGDTPIIRQYMRI---ANRWRWVI-------LGIVAASLVA
A0A328M4V1      ----------MTTRQTFSPRDDDVDLRALIGT---LLDNKWLI-------GITTAVFFAL
A0A6A8IF17      ------------------------------MC---LARWKWFV--------LSLAVTIGA
A0A143WVN6      ----------------MEFQIDDIDFRSIVLD---LIKNIWVI-------ILAVLAVRMG
W6RXP9          ----------MEQ----EILEKEISISEIMEA---LQKRWKMI-------ALITLIFSVV
W6S4G8          ----------MEEVKVVEEFSNEISFSQIIFA---LKKRWKII-------FATTIFFTAL
A0A3D5R4X5      ------------MTREERYLEEEIDIRQLFHI---LRKRLGWI-------ISITLAFLII
A0A1I4C3N6      ---------------MFKIFFANLHLEKILWI---IKSKILYI-------IMFALVGGAV
A0A3B9CIM7      ---------------MFKTILSNFHLEKIFWT---LKKKALYI-------FLSTAVLGMV
A0A7R7IBN8      ---------------MFETLLTNFYFDKIIQI---IKNKLKYI-------ILISILFALA
A0A1G9WHW8      ---------------MFKIIVANFHLEKILWI---IKKNLTYM-------VFCGLVAALL
A0A1H5VAA0      ---------------MFKIIVANFHLEKILWI---IKKNLTYM-------VFCGLVAALL
A0A3R6VK11      ---------------MLETILNNFHLEKILWI---LQKRIAYI-------MILGVLGGMA
A0A3R6QUY7      ---------------MLETILNNFHLEKILWI---LQKRIAYI-------MILGVLGGMA
A0A373K3P9      ---------------MLETILNNFHLEKILWI---LQKRIAYI-------MILGVLGGMA
A0A3R6JRU5      ---------------MLETILNNFHLEKILWI---LQKRIAYI-------MILGVLGGMA
A0A1C5MS04      ---------------MLETILNNFHLEKILWI---LQKRIAYI-------MILGVLGGMA
A0A3C1J150      ---------------MLETILNNFHLEKILWI---LQKRIAYI-------MILGVLGGMA
A0A416CXD7      ---------------MLETILNNFHLEKILWI---LQKRIAYI-------MILGVLGGMA
A0A6N2X662      ---------------MLETILNNFHLEKILWI---LQKRIAYI-------MILGVLGGMA
R6XBL9          ---------------MLETILNNFHLEKILWI---LQKRIAYI-------MILGVLGGMA
A0A355W5Z7      ---------------MLETILNNFHLEKILWI---LQKRIAYI-------MILGVLGGMA
A0A1G6BLB6      --------MQFEERNEEPVQLFRFNGYTVGRD---IIKHMKMI-------IMISVAAMLL
A0A1C6G8M0      GGVCDFMENKKAVAV-ENAAEDTIDLLEIFRA---LYRRWVWI-------VFTALVFGIA
A0A416MP73      ------MESKEITAMGASAEEDTIDLMEIFRA---LRKRWYWI-------VLLAIIFGAA
A0A3E4LL92      ---------MSQESYKSQSLDSQIDLRYIFRT---LKKNAVFI-------LMCMCLTGMF
A0A415D1L1      ---------MSQEGYKSQSLDSQIDLRYIFRT---LKKNAVFI-------LMCVCLTGMF
A0A396G6S7      -----------MEERIDNETVQQIDLISMLKD---IGREWLTI-------LLLAIAAALF
A0A3E5A223      -----------MEERIDNETVQQIDLISMLKD---IGREWLTI-------LLLAIAAALF
R7D5E6          -----------MEERIDNETVQQIDLISMLKD---IGREWLTI-------LLLAIAAALF
A0A415HQH5      -----------MEERIDNETVQQIDLISMLKD---IGREWLTI-------LLLAIAAALF
A0A414W2C6      -----------MEERIDNETVQQIDLISMLKD---IGREWLTI-------LLLAIAAALF
A5ZNE7          -----------MEERIDNETVQQIDLISMLKD---IGREWLTI-------LLLAIAAALF
A0A395X821      -----------MEERIDNETVQQIDLISMLKD---IGREWMTI-------LLLAIAAALF
A0A1C5PY68      -----------MEERIDNETVQQIDLISMLKD---IGREWLTI-------LLLAIAAALF
A0A174CJF8      -----------MEERIDNETVQQIDLISMLKD---IGREWLTI-------LLLAIAAALF
A0A564SRR2      -----------MEERIDNETVQQIDLISMLKD---IGREWLTI-------LLLAIAAALF
A0A174R7V0      -----------MEERIDNETVQQIDLISMLKD---IGREWLTI-------LLLAIAAALF
A0A373MWV2      --MRRFQMGEYDRTGNGQNGEADWDLRSILCD---MAKNWWII-------LLIACSAAMI
A0A417CE88      --MRRFQMGEYDRTGNGQNGEADWDLRSILCD---MAKNWWII-------LLIACSAAMI
A0A416Y441      --MRRFQMGEYDRTGNGQNGEADWDLRSILCD---MAKNWWII-------LLIACSAAMI
A0A357GPJ7      --MRRFQMGEYDRTGNGQNGEADWDLRSILCD---MAKNWWII-------LLIACSAAMI
A0A396PAC1      --MRRFQMGEYDRTGNGQNGEADWDLRSILCD---MAKNWWII-------LLIACSAAMI
A0A416EYU4      --MRRFQMGEYDRTGNGQNGEADWDLRSILCD---MAKNWWII-------LLIACSAAMI
A0A416SCQ2      --MRRFQMGEYDRTGNGQNGEADWDLRSILCD---MAKNWWII-------LLIACSAAMI
A0A416TGN7      --MRRFQMGEYDRTGNGQNGEADWDLRSILCD---MAKNWWII-------LLIACSAAMI
A0A417SMF6      --MRRFQMGEYDRTGNGQNGEADWDLRSILCD---MAKNWWII-------LLIACSAAMI
A0A0H5SF45      ---------------------MELSIKDVLGI---IYKRLIFI-------IACTFFCAIM
A0A1M6JRJ5      ---------------------MEFTVTDILHL---LKKRFILI-------AACTLGGLLL
A0A1M7Y1S2      ---------------------MEFTVRDILYL---IKKRFILI-------AACTFAGLLL
A0A7I8DMN1      ---------------------MEFTVRDILHL---IKKRFLLI-------AFCTLAGLLI
A0A1Y4MW77      -------MEEKNIEQDEITIDLTVLFRDFIRG---CIKFWWLI-------LALMVAGGAI
A0A6S6R676      ---------------------MEFSFKEIAAL---MVKRFLLI-------SVCTFSGLFL
A0A0K8J554      ---------------------MELSLKEIIEL---IYKRLKLI-------IIFVLIGAGL
A0A1I0RG99      ---------------------MEFSFKEILEI---LAKRFVFI-------AICTFVGICS
A0A1I5G322      ---------------------MEFTLKEIFEI---FMKRIVFI-------TVCTIGGLCV
A0A7C6IYW8      ---------------------MEFTVKEIIDL---ILKRIIWV-------IIGLSLGLFT
A0A7C6JZF1      ---------------------MEYSLTDVLAI---MIKHFLLI-------VLCTFLGFLS
A0A3N1XSX6      ---------------------MEFTVKEIIKL---ILKRLIWI-------ILCLFAGLLI
A0A839K1C1      ---------------------MEFTVKEMINL---VLKRIIWI-------TISLFAGLLL
R6UHV6          -MNNSQDDLKAQDDLKEQDANYSFDLASTLQD---LTKRWFVI-------LLSGIIAAIG
A0A3R9Q621      ---------------------MEFTLAQVIKL---LYKRMLWI-------VLITALALAA
A0A069RC75      -----------------------MNGKKYIGI---FKRRKWLF-------FMVLAVSVAV
A0A174F2W5      -------MGEYDRTGNGQNGEADWDLRSILCD---MAKNWWII-------LLIACSAAMI
A0A174S8E9      -------MREYDRTGNGQNGEADWDLRSILCD---MAKNWWII-------LLIACSAAMI
A0A416ZL97      -------MGEYDRTGNGQSSKTDWDLRSILCD---IAKNWWVI-------LLIACSVAMI
A0A174LSK1      -------MGEYDRTGNGQSSKTDWDLRSILCD---IAKNWWVI-------LLIACSAAMI
A0A373GY92      -------MGEYDRTGNGQSSKTDWDLRSILCD---IAKNWWVI-------LLIACSAAMI
A0A373NZQ6      -------MGEYDRTGNGQSSKTDWDLRSILCD---IAKNWWVI-------LLIACSAAMI
A0A417I9B9      -------MGEYDRTGNGQSSKTDWDLRSILCD---IAKNWWVI-------LLIACSAAMI
A0A417WQF8      -------MGEYDRTGNGQSSKTDWDLRSILCD---IAKNWWVI-------LLIACSAAMI
A0A8B3CFR3      -------MGEYDRTGNGQSSKTDWDLRSILCD---IAKNWWVI-------LLIACSAAMI
A0A373RZ83      -------MGEYDRTGNGQSSKTDWDLRSILCD---IAKNWWVI-------LLIACSAAMI
A0A416U6I1      -------MGEYDRTGNGQSSKTDWDLRSILCD---IAKNWWVI-------LLIACSAAMI
R7JQZ9          -------MGEYDRTGNGQSSKTDWDLRSILCD---IAKNWWVI-------LLIACSAAMI
A0A1M5UYN6      -----------------MQKDDRLDLRDYLHI---IKKKIMVI-------ITITFLTTLI
A0A176JBT8      -------------------MEKTFEIKDLLNI---LRKNKILI-------TSIPFVCLLI
A0A1I5HIC6      ---------------MPNNNDIEIDIGDLFFL---LLHKMWFI-------LLWGILSAAA
A0A1Y3TC51      -------------MNGERFSLAEISVRGLCMD---LFRNAWMI-------LLAAAAVWLA
A0A1Y3T1N0      -------------MNRELFRLDEISIRGLCLE---LLQSLWMI-------LVIGVSLWLG
A0A1Y3Y8U8      -------------MNRELFRLDEISIRGLCLE---LLQSLWMI-------LVIGVSLWLG
A0A5B0BQY5      -------------------MKRTIDMTDLMQA---VRRRWMIF-------FGIILIATLI
A6CLL4          -------------------MNQSLTLKELFQI---LQNHFWLI-------LSIIFLVTAS
A0A176U8D6      ---MVFMNSDEVMIVNEDEDEVTIDFFGIFHA---IAKRWYIV-------LLAAVACGVA
A0A1Q6KSQ5      GGVCDFMENKKAVAV-ENAAEDTIDLLEIFRA---LYRRWVWI-------VFAALVFGIA
A0A3D3U8B3      GGVCDFMENKKAVAV-ENAAEDTIDLLEIFRA---LYRRWVWI-------VFAALVFGIA
A0A3E5FRL7      -------------MNQDEINLDSINYRGIIRD---LLKNWWII-------VLIVISLYLA
A0A1Y4QK93      -------------MNQDEINLDSINYRGIIRD---LLKNWWVI-------VLIVISLWLA
B1C232          -------------MNQDEINLDSINYRGIIRD---LLKNWWII-------VLIVISLYLA
A0A401USI6      -----------------MREENDIEFNDYLNI---IRKKIVVI-------LFIIICPTLI
A0A1V4IQ10      ------------------MDSETISIEEIFQI---LKKKWKLV-------IILPLITTAI
A0A1S8TRD2      ------------------MDSETTSIEEIFQI---LKKKWKLV-------IILPLITTAI
G7M1U2          ------------------MDSETISIEEIFQI---LKKKWKLV-------IILPLITTAI
A0A2T6KJ75      -------------------MNRTMEIRDFIRL---FKKKKKVI-------LLVTFYITLI
A9KN92          --------------MQNNNNDIEINLGEIFIL---LLHKIWII-------VLSSIVCAVA
A0A352MUJ1      --------------------MEEIDLKELLKL---FWKKKILI-------ILTTLAFLFV
R5YI67          --------------------MEEIDLRDLLKL---FWKRKAII-------LLTTMAFLFI
A0A174DL89      -----------------------MNKFKYFKL---IKEKLSII-------ILITISSIII
A0A1Y0IQP5      ---------------------MEMGLAEMGRV---IRQRVLLI-------VLVTLLAVGL
A0A4R2R7B1      ---------------------MEMGLAEMGRV---LRQRVLLI-------VLVTLLAVGL
A0A1M6E8I2      -------------------MGEEWNLLELVQI---VLKRKWIV-------VATTIFAAIL
A0A7C6SMH0      ---------------MERNSFEEIDVREIFFL---LLRKWYII-------AACFIFVTVS
A0A7X7XYM7      ---------------MERNSFEEIEVREIFFL---LLRKWYVV-------AACFIFVTVS
A0A3B8KKL6      ---------------MERNNFEEIDVREIFFL---LLRKWYVV-------AACFIFVTVS
A0A2K9E6R0      ---------------MERNNFEEIDVREIFFL---LLRKWYVV-------AACFIFVTVS
A0A2S8RBI0      ---------------MERNNFEEIDVREIFFL---LLRKWYVV-------AACFIFVTVS
A0A7X8MFK9      ----------------MEKNFEEIDVLELVYL---LLKKWYLI-------VICLLLATCS
A0A7X9D1M8      ----------------MEKNFEEIDVLELAYL---LLKKWYLM-------AICFILAVTS
A0A0L6JLG6      ---------------MQDKDFVEVDIRELILI---LLRKWYIL-------LICLVVATGA
A0A7X8PYA7      ---------------MGKSDYIEIDLREVFVT---LLKKWYII-------AICFILATSS
G8LSN0          ---------------MGKNDYIEIDIREILIV---LLKRWYLI-------AICFILATGS
A0A1Y4N105      ---------------MMEFRINDIDLRSIIVD---MVRNCWMI-------ILVMLATYFA
A0A1Y4QP75      ---------------MMEFRINDIDLRSIIVD---VIRNCWMI-------ILVMLATYFA
A0A3D4QRB5      --------------------MEELDIRDIIHI---IRKHFWII-------VLTILLFASA
A0A349DEH5      -----------MRSEKKNQKGLEINVLAFFKE---LSKKLWIV-------LIVALIGAII
A0A3D4T7B4      -----------MRSEKKNQKGLEINVLAFFKE---LSKKLWIV-------LIVALIGAII
A0A350XYC7      ---------MKSYSDRKSSKGLEINIVAFFRE---LSKKIWIV-------LIIAVIGAAI
R6DNR8          ---------MKSYSERKSSKGLEINILAFFKE---LSKKLWIV-------AIVAFIGAAI
A0A355KUM5      ---------MKSYSDRKNSKGIEINILAFFKE---LSKKLWIV-------AIIAVIGATI
R5YGY6          ---------MKSYSDRKNSKGIEINILAFFKE---LSKKLWIV-------AIIAVIGATI
A0A7G9WCY6      ----------------MDSQEYEIDLRQIFDI---LFKRLWII-------AAIVLVTTTT
A0A0A5GPA9      -------------------MGQAFGLKEVYQV---IRRRVVLL-------SVVTLLVVII
A0A271M6M4      -------------------MNEAVGLREIFNI---IKKEYLII-------IIITTFMVFL
A0A1C6G0U3      -------------------MKEKLDFIEVLKI---INKRKIIV-------ISILSIFIIV
A0A3D4LLB3      ---------------MYEEEFNDIDLREIFQI---IRKYLALI-------IIITIVFAAA
A0A7C7AD93      ----------------MDQAKAYIEYKDFIKI---LRKRILVI-------ILIVIAILAI
A0A2V3W8U6      -------------------MDQTFQIRDFLQI---FKKRIKFI-------ITVPLLFALL
A0A6N3BXA1      -----------------MKDTMTISLRELFTI---IKRKLWII-------VLVGIIFGLI
A0A351SRI8      --------------------MEEFNILEFLKY---YWNKILIV-------AIVTLLGLIL
A0A1V5LU59      --------MEKGIGRMENNDFVEIDLREIFFT---ILRKWYLI-------AICFILAVGL
A0A7X8R9W1      ---------------MDKNDFINIDIRELLYL---LLKKWYLI-------VLCFVLSTTS
A0A1E3BVC3      ---------------MEKDDILEIDIREMVYL---LLKKWYLI-------VLCFVLAAGS
A0A4Q0I6S0      ---------------MEKDDILEIDIREMVYL---LLKKWYLI-------VLCFVLAAGS
A3DF66          ---------------MEKDDILEIDLREIVYI---LLKKWYLI-------VLCFVLSAGT
W4V1T8          ---------------MEKDDILEIDLREIVYI---LLKKWYFI-------VLCFVLAAGS
A0A1C6ITD7      ----------------------MKNILYYLDI---IKKHLTLI-------IIITLISTIL
A0A381IX63      -------------------MEQKIEIKEYLQL---IRKRMKII-------VAIVIASILI
A0A1M6RWV2      ----------------MEAYEYEIDLRELFEI---ILNKLWLI-------ILIVLITTIT
A0A841ZT34      -------------------MNKTIRLSYLLFL---VKKYWLFI-------GVVMIVAVLA
A0A1G9IUT4      -------------------MEEIINLRQCFQI---IKKNISLI-------IIITCITMFT
A0A842GR80      -------------------MERKISFSSLLQI---FKKYYLLI-------AIAVVVSVIG
A0A7X0TNH3      -------------------MERKISFSSLLQI---FKKYYLLI-------AIAVVVSVIG
A0A842D596      -------------------MEKKISFSSLLQI---FKKYYLLI-------AIAVVVSVIG
A0A842EQ86      -------------------MERKISFSSLLQV---FKKYYLLI-------AIAVVVSVIG
A0A842A220      -------------------MERKISFSSLLQV---FKKYYLLI-------AIAVVVSVIG
A0A7X0YM80      -------------------MERKISFSSLLQV---LKKYYLLI-------AIAVVVSVIG
A0A842GEL5      -------------------MERKISFSSLLQI---FKKYYLLI-------AIAVVVSVIG
A0A841XVD7      -------------------MERKISFSSLLQI---FKKYYLLI-------AIAVFVSVIG
A0A7X0XME5      -------------------MERKISFSSLLQV---FKKYYLLI-------AIAVVVSVIG
A0A842B6T1      -------------------MERKISFSSLLLV---FKKYYLLI-------AIAVVVSVIG
A0A841X7G0      -------------------MERKISFSSLLQI---FKKYYLLI-------AIAVFVSVIG
A0A841W3M8      -------------------MERKISFSSLLQI---FKKYYLLI-------AIAVFVSVIG
A0A7X0XVI0      -------------------MERKISFSSLLQI---FKKYYLLI-------AIAVVVSVIG
A0A7X0Z1K1      -------------------MERKISFSSLLQI---FKKYYLLI-------AIAVVVSVIG
A0A143ZUX1      -----------------------PTTLRYFRQ---LKKSWWIP-------TILLVIFAVA
A0A7I8D809      -----------------------PTTLRYFRQ---LKKSWWIP-------TILLVIFAVA
A0A3R9WAA7      -----------------------GIGRNFLRG---LKKLFWLI-------PLLAVSVAML
A0A1G6BLF1      -----------------------TIVDDVWKG---FWRIWWLL-------LVIISICATL
A0A355G1X5      -----------------------INVLFLLKT---VLKRWWIL-------LITTVLCATI
A0A1W2CEA6      -----------TAPAAEGPAQEYYSGIDWVSVLFRLLEKIHWI-------VLAALIGALI
A0A355G3J9      -----------------------LTLKDIAMT---VWRSIGLI-------IVSSLLGAML
A0A3D2AD87      -----------------------ISIMYLFHL---AWRRIWAI-------VIAACLCAAM
A0A143XN92      -----------------------IDIRTMIKD---VLRYSWLI-------VIMAISFSLI
R7FFK6          -----------------------YTIKDLIFL---FLGHIWWI-------ICAAVVGAAG
A0A373MPB9      -----------------------YTIKDLLVL---LLGKVWYI-------VAASIVCAIL
A0A373L519      -----------------------YTIKDLLVL---LLGKVWYI-------VAAAVVCAVL
A0A373W906      -----------------------YTIKDLLVL---LLGKVWYI-------VAASIVCAIL
A0A373VCW2      -----------------------YTIKDLLVL---LLGKVWYI-------VAASIVCAIL
W0U604          -----------------------YTIKDLLVL---LLGKVWYI-------VAASIVCAIL
A0A374B6G0      -----------------------YTIKDLLVL---LLGKVWYI-------VAASIVCAIL
A0A373VM36      -----------------------YTIKDLLVL---LLGKVWYI-------VAASIVCAIL
A0A1C5P379      -----------------------YTIKDLLVL---LLGKVWYI-------VAASIVCAIL
A0A373XXX0      -----------------------YTIKDLLVL---LLGKVWYI-------VAASIVCAIL
A0A5R9MJM9      -----------------------YTIKDLLVL---LLGKVWYI-------VAASIVCAIL
A0A356CW82      -----------------------YTIKDLLVL---LLGKVWYI-------VAASIVCAIL
R6T4X7          -----------------------YTIKDLLVL---LLGKVWYI-------VAASIVCAIL
A0A374HTV1      -----------------------YTIKDLLVL---LLGKVWYI-------VAASIVCAIL
A0A374GB66      -----------------------YTIKDLLVL---LLGKVWYI-------VAASIVCAIL
A0A374ECC6      -----------------------YTIKDLLVL---LLGKVWYI-------VAASIVCAIL
A0A374BM61      -----------------------YTIKDLLVL---LLGKVWYI-------VAASIVCAIL
A0A373UGZ4      -----------------------YTIKDLLVL---LLGKVWYI-------VAASIVCAIL
A0A373SA66      -----------------------YTIKDLLVL---LLGKVWYI-------VAASVVCAIL
A0A1C5X6X7      -----------------------YTIKDLLVL---LLGKVWYI-------VAASIVCAIL
A0A1C6JIH3      -----------------------YTIKDLLVL---LLGKVWYI-------VAASIVCAIL
A0A373PSC3      -----------------------YTIKDLLVL---LLGKVWYI-------VAASIVCAIL
A0A1K1WYK8      -----------------------YTIKDLLSL---LWNHLMLI-------IAITIIGGIA
A0A1H6IUB1      -----------------------YSIKDIISL---LLSKLWLL-------IIVTIIGGAA
A0A1M7L1F9      -----------------------YSIKDIINL---LLSKLWLL-------ILVTIIGGTA
A0A1C6B4L6      -----------------------YTIKELIGL---FLNKIWII-------IIVTIAGGIL
A0A1Q6T9P4      -----------------------YTIKELIGL---FLNKIWII-------IIVTIAGGIL
A0A315Y4F9      -----------------------YSIKDIIRL---LLSHIWLI-------IVITVLGAGA
A0A354K620      -----------------------YSIKDILRL---LLNHLWII-------IIIAILGGAA
A0A173ZYY6      -----------------------LDPYTLVHD---IVSNWWVI-------ILGAIAGALL
A0A6L8RXB5      -----------------------LDPYTLVHD---IVSNWWVI-------ILGAIAGALL
A0A173SMI2      -----------------------LDPYTLVHD---IVSNWWVI-------ILGAIAGALL
A0A845KKD0      -----------------------LDPYTLVHD---IVSNWWVI-------ILGAIAGALL
A0A6N9JW85      -----------------------LDLYTLVHD---IVSNWWVI-------ILGAIAGALL
A0A174ASH7      -----------------------LDPYTLVHD---IVSNWWVI-------ILGAIAGALL
A6BH65          -----------------------LDPYTLVHD---IVSNWWVI-------ILGAIAGALL
R7G0D7          -----------------------LDPYTLVHD---IVSNWWVI-------ILGAIAGALL
R6HZX3          -----------------------LIFRNFLHV---LKRTWWWV-------TLLAILVGAL
R5EFZ0          -----------------------FDPIVLVQD---VLKRWLVV-------VLAALAVGIG
A0A3E5FSY5      -----------------------IDLSELIHDFLKILKDYWGV-------FLGTIVICTI
A0A1V5S3C0      -----------------------ETILKLIRV---IASKWWVI-------LILVFIFASA
A0A3C0QME1      -----------------------YTIKDIISL---LLSKLWLL-------ILLAVLGGGG
A0A355FYK5      -----------NGLFGNGGSGGGLDLFKLLRA---LLRRAWAI-------VMVGVVFAAA
A0A357AQU0      -----------------------IDLLELFWA---LLRKWWML-------TIAAVLCAAI
A0A3C1YJQ7      -----------------------IDLLELFWA---LLRKWWML-------TIAAVLCAAI
A0A3D0JG38      -----------------------IDLLELFWA---LLRKWWML-------TIAAVLCAAI
A0A3C0IHX1      -----------------------IDLGKLFKA---LMQRLPII-------LLVTLCFSAI
R5V506          -----------------------IDLGKLFKA---LMQRLPII-------LLVTLCFSAI
A0A352TIU5      -----------------------IDLGKLFKA---LVRRLPII-------LLVTLCFSAI
R5B467          -----------------------DLAELLGRFARSLRRLWWLC-------LALIVLCAAA
A0A1Y3TC98      -----------------------DLGLLFAGMWKNIRRFWWLA-------LLLTVAGAAG
A0A1W1Z4C3      -----------------------IDLARLAVY---ILKRIWLV-------IICAAI-GFG
A0A239QN83      -----------------------IDLARLAVY---ILKRIWLV-------ILCAAI-GFG
A0A8A5CVI3      -----------------------IDLARLAVY---ILKRIWLV-------ILCAAI-GFG
A0A8A5D3H1      -----------------------IDLARLAVY---ILKRIWLV-------ILCAAI-GFG
A0A1Q6REE0      -----------------------VLLDDFLHQ---AKRMWLLG-------LALVLICAAG
R5ETF9          -----------------------VLLDDFLHQ---AKRMWLLG-------LALILICAAG
A0A0F2P7X6      -----------------------ISLGEIISA---LFKWWWLV-------VLCTVLAALG
A0A359B487      -----------------------ISLGEIISA---LFKWWWLV-------ILCTVLAALG
R6VAT5          -----------------------EYASKILTG---IKKHWYII-------AVLAGICCVG
D4LC36          -----------------------YTIKDLVYL---MLGRIWWI-------IGAALICGLG
A0A7X3IXX7      -----------------------MTVIDFLRL---TRANLVLL-------LAATLAGLLL
A0A1Q6S448      -----------------------IEPLCILRA---LARQLWML-------LLAALTCSMA
A0A351MYR0      -----------------------IEPYCLLRT---LLRQLWML-------LMAGAACAMA
R6HPC1          -----------------------IEPYCLVRT---LLRQLWML-------LLAAAACAMA
A0A3D4G5Z5      -----------------------IEPYCLVRT---LLRQLWML-------LLAAAACAMA
A0A3D5ES03      -----------------------IEPYCLVRT---LLRQLWML-------LLAAAACAMA
A0A348P5V4      -----------------------DTALMYAKK---LMDKWFVI-------LLSAILCAGV
A0A356PT74      -----------------------DSVVIYLKK---ILQHWKIV-------VISAVVLAVL
A0A3D5LL19      -----------------------DSVVIYLKK---ILQHWKIV-------VISAVVLAVL
R5MNF0          -----------------------DSVVIYLKK---ILQHWKIV-------VISAVVLAVL
A0A1Q9JSI0      -----------------------NIDLYS------ICKDIWKY-------ALVILLLAAS
A0A3D5TNI1      -----------------------NI-MYVFGL---LIRRLWLL-------MLVGLIVGAS
A0A358LJD0      -----------------------NI-MYVFGL---LLRRLWLL-------ILVALVVGAS
R6I3L7          -----------------------NI-MYAFGL---LLRRLWLL-------ILVALVVGAS
A0A3D1HXX0      -----------------------NI-MYAFGL---LLRRLWLL-------ILVALVVGAS
A0A3D2QJB8      -----------------------NI-MYAFGL---LLRRLWLL-------ILVALVVGAS
R7MQJ4          -----------------------KK---LIQL---FLSKIYVI-------IILTIVGGAA
A0A1V5GLC0      -----------------------KD---LINL---FLSKLWLI-------ILLAVIGGAA
W7V182          -----------------------KS---MVAL---LLSKLWII-------ILAAVLGGTA
A0A143XPI5      ----------------EESIDIFYLFNNVWKG---IRQFYWIF-------LIIISISTAA
A0A0M6WXE3      --------------------ETEFEPISLVCD---ILKNWWVI-------LLGALAGAML
A0A348SAK2      --------------------ETEFEPISLVCD---ILKNWWVI-------LFGALAGAML
A0A1G9H5B9      -----------------------IDLVKMLFF---ILKHLWLL-------VLCAELGFGA
A0A1Y4H8L0      -----------------ILQTSRLEPFTLVRD---ILVNWWVI-------LLGALAAAML
A0A4B9BMD9      -----------------------------------------------------IKAKPGT
A0A0M6WYQ8      -------------------IDLIEFLRSFQYG---IKKMWWLV-------LVLALIFGLN
A0A348SAK1      -------------------IDLIEFLRSFQYG---IKKMWWLV-------LVLALIFGLN
A0A252F281      -----------------------INLHTMLRD---VWKNLWMI-------VLVAASAVML
A0A1Y4QKE6      --------------DDNIEIDLSELIHGFLKI---LKDYWGLF-------LGTIVICTIA
B1C231          --------------DDSIEIDLSELIHDFLKI---LKDYWGVF-------LGTIVICTIA
A0A7V6WIR4      -----------------MIFIAFVLSFFILKP---VYEARVLL-----------------
A0A1Y3TUL5      ----------------------------FLHA---LIKNRGLIAATTIAGLAIGVVLSIA
A0A1Y4JAX2      ----------------------------FLHA---LIKNRGLIAATTIAGLAIGVVLSIA
A0A1Y4T590      ----------------------------FLHA---LIKNRGLIAATTIAGLAIGVVLSIA
A0A1Y3T163      --------------DDEMEIDLVLLFGAFWKS---FTRLWWLV-------LILILAGAGG
A0A1Y3YCA2      --------------DDEMEIDLVLLFGAFWKS---FTRLWWLV-------LILILAGAGG
A0A7W8H9H2      --------------AEDDVIDLGALIFAFWRI---FKVFWWII-------PILAVVGAAA
A0A1Y4L6N9      --------------TEEMEIDIVSLIQNFISG---IFRWWWLI-------VLLALIGGSI
A0A173T644      --------------REELEIDLGILLWNFLQG---LARFWWLV-------ILLAALGSAA
A0A1C5TSB8      --------------REELEIDLGILLWNFLQG---LARFWWLV-------ILLAALGSAA
C0CIK6          --------------REELEIDLGILLWNFLQG---LARFWWLV-------ILLAALGSAA
A0A1Y3WEF6      --------------DD--AIDLRTLFWNVIQG---ILKFWWLI-------LLLAAVGAGA
A0A417T0L2      --------------DD--VIDLGALFWNVIQG---ILRFWWLI-------IFLAAVGAGA
A0A1H9EPU3      VTPRKPAIINNNNIAKKTQDEETIDLRQIFGL---LWVNKILI-------ILLGLCVAVI
A0A354IGV3      -------------------FLSSIDVSGALRA---IVRNFWLV-------VLAALTGAMG
A0A417JMV2      -------------------YETNIDLYSILRD---IWKYALVI-------MLLAASMSLL
A0A415VWX5      -------------------YEMNIDLYSILRD---IWKYALVI-------LLLAASMSLL
A0A173UY96      -------------------YEMNIDLYSILRD---IWKYALVI-------LLLAASMSLL
B0P408          -------------------YEMNIDLYSILRD---IWKYALVI-------LLLAASMSLL
D4MV82          -------------------YEMNIDLYSILRD---IWKYALVI-------LLLAASMSLL
A0A173QTL1      -------------------YEMNIDLYSILRD---IWKYAIVI-------LLLAASMSLL
A0A174J359      -------------------YEMNIDLYSILRD---IWKYAILI-------LLLAASMSLL
A0A174A3T7      -------------------YEMNIDLYSILRD---IWKYAIVI-------LLLAASMSLL
A0A417UUA3      -------------------YEMNIDLYSILRD---IWKYAIVI-------LLLAASMSLL
A0A6N2VB70      -------------------YEMNIDLYSILRD---IWKYAIVI-------LLLAASMSLL
A0A1C6EUV9      -------------------YEMNIDLYSILRD---ISKYIVVI-------LLLAASMSLL
A0A173Y645      -------------------YEMNIDLYSILRD---ISKYIVVI-------LLLAASMSLL
A0A374AVY6      -------------------YEMNIDLYSILRD---ISKYIVVI-------LLLAASMSLL
R7BXS4          -------------------YEMNIDLYSILRD---ISKYIVVI-------LLLAASMSLL
                                                                            

S3FFL2          GLVIT--LLMT-------PQ----YTATAQIEISREGNQVTNFQGVER--------NSNQ
A0A328M4V1      AVIYS--VLAT-------PI----YQSSAIVQVENTVPSLPGLEDLAQ----TLGTSTSQ
A0A6A8IF17      ATAYL--LRTP-------AV----YTRTASVLIKEDSKGKSVSSDLESFSEFGLFQSGTN
A0A143WVN6      ISGYYE-LTYE-------PQ----YTSTATLAV------------TARGSSNGSYSSLTT
W6RXP9          AGVLSF-FVIK-------PT----YEAGTKLFI----------GKEESQNSTYDNNDIQM
W6S4G8          VALITF-FFID-------PV----YEVHTKVFI----------GKDAEVN--YDNNDVQM
A0A3D5R4X5      SALISF-FILT-------PI----YQSSTALMVNKTF--SESEMLNQ-----IQLSDINV
A0A1I4C3N6      GGAYAL-FMGQ-------DL----YRSEITMTA---F--SNPDYANDS-GININVSDVQS
A0A3B9CIM7      AGAYAS-ITST-------SL----YMAQISFYV---Y--SNPDYITDS-SVNIGSSDITQ
A0A7R7IBN8      GGAYGT-YYKS-------ST----YVGQISFYV---Y--SNKDYISDS-SVNINSLDFTQ
A0A1G9WHW8      FGGYAY-ATRS-------SV----YQAKISFYA---Y--SDPDYASDT-SVNITYSEVNQ
A0A1H5VAA0      FGGYAY-ATRS-------SV----YQAKISFYA---Y--SDPDYASDT-SVNITYSEVNQ
A0A3R6VK11      GGAYAY-LTNS-------TL----YRAEVSFYV---Y--SDPDYVYDS-SVNISNSEFTQ
A0A3R6QUY7      GGAYAY-LTNS-------TL----YRAEVSFYV---Y--SDPDYVYDS-SVNISNSEFTQ
A0A373K3P9      GGAYAY-LTNS-------TL----YRAEVSFYV---Y--SDPDYVYDS-SVNISNSEFTQ
A0A3R6JRU5      GGAYAY-LTNS-------TL----YRAEVSFYV---Y--SDPDYVYDS-SVNISNSEFTQ
A0A1C5MS04      GGAYAY-LTNS-------TL----YRAEVSFYV---Y--SDPDYVYDS-SVNISNSEFTQ
A0A3C1J150      GGAYAY-LTNS-------TL----YRAEVSFYV---Y--SDPDYVYDS-SVNISNSEFTQ
A0A416CXD7      GGAYAY-LTNS-------TL----YRAEVSFYV---Y--SDPDYVYDS-SVNISNSEFTQ
A0A6N2X662      GGAYAY-LTNS-------TL----YRAEVSFYV---Y--SDPDYVYDS-SVNISNSEFTQ
R6XBL9          GGAYAY-LTNS-------TL----YRAEVSFYV---Y--SDPDYVYDS-SVNISNSEFTQ
A0A355W5Z7      GGAYAY-LTNS-------TL----YRAEVSFYV---Y--SDPDYVYDS-SVNISNSEFTQ
A0A1G6BLB6      MYAYLA-YTYA-------ET----YTMTTTFTV------------VSASTENDAYTNIQS
A0A1C6G8M0      LGMYGK-FVVK-------DV----FQAEASMCI-------------IDSNKEVSISDLQI
A0A416MP73      LGVYGK-FIVK-------DA----YQAEASMCI-------------IDSNKEVSMSDVQL
A0A3E4LL92      SYVILD-HSLK-------DT----YTVSVNLCV----------IPRDNTSEKLAETNIE-
A0A415D1L1      SYVILD-HSLK-------DT----YTVSVNLCV----------IPRDNTSEKLAETNIE-
A0A396G6S7      ADIWIC-ATYQ-------PE----YRTSTTFVV------------TAKGMNNNIYQNLNS
A0A3E5A223      ADIWIC-ATYQ-------PE----YRTSTTFVV------------TAKGMNNNIYQNLNS
R7D5E6          ADIWIC-ATYQ-------PE----YRTSTTFVV------------TAKGMNNNIYQNLNS
A0A415HQH5      ADIWIC-ATYQ-------PE----YRTSTTFVV------------TAKGMNNNIYQNLNS
A0A414W2C6      ADIWIC-ATYQ-------PE----YRTSTTFVV------------TAKGMNNNIYQNLNS
A5ZNE7          ADIWIC-ATYQ-------PE----YRTSTTFVV------------TAKGMNNNIYQNLNS
A0A395X821      ADIWIC-ATYQ-------PE----YRTSTTFVV------------TAKGMNNNIYQNLNS
A0A1C5PY68      ADIWIC-ATYQ-------PE----YRTSTTFVV------------TAKGMNNNIYQNLNS
A0A174CJF8      ADIWIC-ATYQ-------PE----YRTSTTFVV------------TAKGMNNNIYQNLNS
A0A564SRR2      ADIWIC-ATYQ-------PE----YRTSTTFVV------------TAKGMNNNIYQNLNS
A0A174R7V0      ADIWIC-ATYQ-------PE----YRTSTTFVV------------TAKGMNNNIYQNLNS
A0A373MWV2      TYTVLT-AVHR-------DQ----YTVKTTFAV------------MGRGENANAASSLSS
A0A417CE88      TYTVLT-AVHR-------DQ----YTVKTTFAV------------MGRGENANAASSLSS
A0A416Y441      TYTVLT-AVHR-------DQ----YTVKTTFAV------------MGRGENANAASSLSS
A0A357GPJ7      TYTVLT-AVHR-------DQ----YTVKTTFAV------------MGRGENANAASSLSS
A0A396PAC1      TYTVLT-AVHR-------DQ----YTVKTTFAV------------MGRGENANAASSLSS
A0A416EYU4      TYTVLT-AVHR-------DQ----YTVKTTFAV------------MGRGENANAASSLSS
A0A416SCQ2      TYTVLT-AVHR-------DQ----YTVKTTFAV------------MGRGENANAASSLSS
A0A416TGN7      TYTVLT-AVHR-------DQ----YTVKTTFAV------------MGRGENANAASSLSS
A0A417SMF6      TYTVLT-AVHR-------DQ----YTVKTTFAV------------MGRGENANAASSLSS
A0A0H5SF45      SYVYNK-FIKD-------PV----YTASVQFCV------------NTNDNSSGNINELNY
A0A1M6JRJ5      SFLYTS-YFVD-------KT----YTASTQFYV------------STADSTAANLSELDY
A0A1M7Y1S2      SFLYTR-YFVD-------KT----YTASSQFYV------------STIESTSANLSELDY
A0A7I8DMN1      SFLFTR-YFVD-------RT----YTASTQFYV------------STQNSTSTNLSDLDY
A0A1Y4MW77      MFVTNI-QTYT-------PM----YQASATFTV---T--TNTTTDQNNQSDYNYYYDSST
A0A6S6R676      FLLVSS-FIVQ-------PS----YTASVQLYV----------NPNDKEATTATLSELDY
A0A0K8J554      LFVVNR-FIRR-------PI----YTASVQLYV----------NPNDTTP-AANLNELNY
A0A1I0RG99      FFINSK-YIIK-------PT----YVASVQMYV----------NPNETTY-SADLNELNY
A0A1I5G322      SFLYSK-YIIK-------PT----YIASVQMYV----------NSNDSTS-SADLNELNY
A0A7C6IYW8      LFICSK-FIIN-------PS----YTASVQLYV----------IPNDTET-SVNLNELNY
A0A7C6JZF1      FYLVNR-YVTE-------PS----YTAQVKMYV----------NPNEATG-SGDLNELNY
A0A3N1XSX6      SFIFSR-YIIN-------PS----YTAYVQLYV----------IPDDTEA-SLNLNELNY
A0A839K1C1      SFIFSK-FIIN-------PS----YTTSVKLYV----------IPNDSEA-SLNLNELNY
R6UHV6          CFITAT-QLYS-------PQ----YMTSTTLLV------------QSKNNTESAYNNLTA
A0A3R9Q621      TFAVNK-YLIS-------ES----YTASVQFYV---------NTQDSQ-TQKIDLNELNY
A0A069RC75      SAVMTF-YVSE-------PE----YSSYTTLMV---------NKARGDNENYIDYESYII
A0A174F2W5      TYTVLT-AVHR-------DQ----YTVKTTFAV------------MGRGENANAASSLSS
A0A174S8E9      TYTVLT-AVHR-------DQ----YTVKTTFAV------------MGRGENANAASSLSA
A0A416ZL97      TYTVLT-TVHK-------DR----YTVKTTFAV------------MGRGVDANAASSLSA
A0A174LSK1      TYTVMA-TVHK-------DR----YTVKTTFAV------------MGRGVDANAASSLSA
A0A373GY92      TYTVMA-TVHK-------DR----YTVKTTFAV------------MGRGVDANAASSLSA
A0A373NZQ6      TYTVMA-TVHK-------DR----YTVKTTFAV------------MGRGVDANAASSLSA
A0A417I9B9      TYTVMA-TVHK-------DR----YTVKTTFAV------------MGRGVDANAASSLSA
A0A417WQF8      TYTVMA-TVHK-------DR----YTVKTTFAV------------MGRGVDANAASSLSA
A0A8B3CFR3      TYTVMA-TVHK-------DR----YTVKTTFAV------------MGRGVDANAASSLSA
A0A373RZ83      TYTVMA-TVHK-------DR----YTVKTTFAV------------MGRGVDANAASSLSA
A0A416U6I1      TYTVMA-TVHK-------DR----YTVKTTFAV------------MGRGVDANAASSLSA
R7JQZ9          TYTVMA-TVHK-------DR----YTVKTTFAV------------MGRGVDANAASSLSA
A0A1M5UYN6      GGIYSF-YVLK-------PT----YYSSMSVII--------GKTVSVDGNISMDINDVTM
A0A176JBT8      GFIYTY-FIAS-------PI----YESKTDLLV--------NTTPTANTAEPVSPLEIDA
A0A1I5HIC6      AIFISK-VFIT-------PV----YTSSTKLYI----------INRQN-KDTITSSDLQT
A0A1Y3TC51      ATGWHN-LTYQ-------PE----YTSSATLVV------------TVK-GSSSTYSSLSL
A0A1Y3T1N0      ITGVHT-LIYE-------PA----YTSTATLVV------------TVK-GESSAYSSLSV
A0A1Y3Y8U8      ITGVHT-LIYE-------PV----YTSTATLVV------------TVK-GQTSAYSSLSV
A0A5B0BQY5      GGGIG--YTIP-------RT----YEAKTDLLV---N--SMGKVEGNS---APTMGEIET
A6CLL4          GIILS--LSLP-------KE----YEAKVDLLV---------NYSPENNQGSLSVGEVET
A0A176U8D6      LGVYGR-FVVK-------DA----YESEASMCI------------IDS-NKEVSMSDLQV
A0A1Q6KSQ5      LGMYGK-FVVK-------DV----FQAEASMCI------------IDS-NKEVSISDLQI
A0A3D3U8B3      LGMYGK-FVVK-------DV----FQAEASMCI------------IDS-NKEVSISDLQI
A0A3E5FRL7      ATGIGK-LVYI-------PE----YTVSTTLVV------------NAQ-GTSDTYTSLAM
A0A1Y4QK93      ATGIGK-LVYV-------PE----YTVSTTLVV------------SAK-GTSDTYTSLAM
B1C232          ATGIGK-LVYI-------PE----YTVSTTLVV------------NAQ-GTSDTYTSLAM
A0A401USI6      AGLLSF-YVIK-------PV----YEAKATVIV---------GKDSTD---KITQSEVMM
A0A1V4IQ10      SILYSF-YIVK-------PQ----YEASTKVFV---------GKETGI-EEKYNNNDVEM
A0A1S8TRD2      SIFYSF-YIVK-------PQ----YEACTKVFV---------GKETAD-KEKYDNNDVEM
G7M1U2          SIFYSF-YIVK-------PQ----YEACTKVFV---------GKETAD-KEKYDNNDVEM
A0A2T6KJ75      GG-FSS-FAIP-------PK----FEAKTDVLV-----------NFTT-ANVVSSGEIDA
A9KN92          AGLISK-FVMT-------PV----YTSDTKLYI----------INRQN-KDTITSSDLQT
A0A352MUJ1      GYIYNA-FITT-------PE----YKAATTLLL---------VKSSEG-TSSVTQADVTL
R5YI67          GYVYNA-FVTT-------PQ----YKSATTLIL---------VKAEN---SGTTTNDVTL
A0A174DL89      STIATL-FFIE-------PT----YESKISVII---G--PNQSTSGDY-SSSQSSYDVVM
A0A1Y0IQP5      TGAGSF-LVLE-------PE----YEATTTLLV-----------QSKQAGNVIAYNDLLT
A0A4R2R7B1      AGAGSF-LVLE-------PE----YEATTTLLV-----------QSKQTEKGIAYNDLLT
A0A1M6E8I2      AILVTM-VAIT-------PV----YESNTTLMV---N--SSKTSSLGDIASGFDIGSINL
A0A7C6SMH0      TFLITS-YYLT-------PI----YRSEATLFL---------GKESGN-VGGLSIGDIQL
A0A7X7XYM7      TYLITS-YYLT-------PI----YRSEATLFL---------GKESGN-VGGLSIGDIQL
A0A3B8KKL6      TFLITS-YYLT-------PI----YRSEATLFL---------GKESGN-VGGLSIGDIQL
A0A2K9E6R0      TFLITS-YYLT-------PI----YRSEATLFL---------GKESGN-VGGLSIGDIQL
A0A2S8RBI0      TFLITS-YYLT-------PI----YRSEATLFL---------GKESGN-VGGLSIGDIQL
A0A7X8MFK9      SFVVTR-FYLK-------PI----YKAEATLFL---------GKEPGQ-I-ALSISDIQL
A0A7X9D1M8      AFAVTK-YYLR-------PV----YKAESTLFL---------GKEKDQ-V-TLSITDIQL
A0A0L6JLG6      AYTVTA-FYLK-------PV----YRAETTLFL---------GKEKDK-IGALSLLDLQI
A0A7X8PYA7      AFVVTQ-FYMK-------PV----YKAHTTLFL---------GKESDK-VASLSIADIQI
G8LSN0          SFAITK-FYLK-------PV----YRAQTTLFL---------GKESDK-VASLSIADIQV
A0A1Y4N105      IAGVYR-LTYS-------PH----YTTTATMAV-----------TARG-SQSGTYSSLTT
A0A1Y4QP75      IAGVYR-LTYS-------PQ----YTTTATMAV-----------TARG-SQSGTYSSLTT
A0A3D4QRB5      SGIISV-FFLD-------DV----YASSTTLIV-------SKQNQNSN-VNEIQLSDVNL
A0A349DEH5      GAVVSE-ATKK-------ET----YTSTASFVV----------NTSSD-SEKASSNDIYV
A0A3D4T7B4      GAVVSE-ATKK-------ET----YTSTASFVV----------NTSSD-SEKASSNDIYV
A0A350XYC7      GGVAGE-ATKK-------ET----YTSTVSFVV----------NSATE-NGQASSGEINA
R6DNR8          GGFVGH-ATRQ-------ET----YTSTVSFVV----------NSATE-AGQTSSGEINA
A0A355KUM5      GGVIGE-ATKS-------ET----YTSTVSFVV----------NSATE-NGQVSSGEINA
R5YGY6          GGVIGE-ATKS-------ET----YTSTVSFVV----------NSATE-NGQVSSGEINA
A0A7G9WCY6      SAVVSY-FFLD-------RV----YEASSSLVI----------LAKAD-SGNIQYNDVLL
A0A0A5GPA9      GIAIS--LLLP-------RT----YEGEGALLV-------NFTSVKSD-EDEISSSEIET
A0A271M6M4      GAAIS--YFMP-------PV----YQAKTDLLV-------NFKAEGVE-SKDISTVEIET
A0A1C6G0U3      TAIFNF-YIIE-------PT----YVADTTIIV--------SKSVTNT-NDTISSEELSV
A0A3D4LLB3      GAVVSI-YLIQ-------PV----YESSTTLIV---------REDKDA-EEKISISDVNL
A0A7C7AD93      AVIYRT-QLSK-------PS----YEARVSLII--------GSVINNE-KTQFQIDNVKE
A0A2V3W8U6      AVIVNS-FIIK-------PV----YEARSDLLV--------NNTVPMT-EETLTALDIET
A0A6N3BXA1      TAGVNQ-FLLK-------PV----YEANTTIIT-------NKEVDEEK-VQMSTSDDFTF
A0A351SRI8      SIVYTA-KIQV-------PV----YEAKTSLVL---------VNNMGE-NTTITTTDITI
A0A1V5LU59      SFVVSQ-YYLK-------PI----YKANATLFL---------GKESDK-IASLSFADIQL
A0A7X8R9W1      AYLITQ-YYLK-------PV----YTAETTLFL---------GKERQK-V-DFSFADIQV
A0A1E3BVC3      AFVVTQ-FYIK-------PI----YKAETTLFL---------GKEKDQ-V-SLSFADIQV
A0A4Q0I6S0      AFVVTQ-FYIK-------PI----YKAETTLFL---------GKEKDQ-V-SLSFADIQV
A3DF66          AFVVTQ-FYIK-------PV----YKAETTLFL---------GKEKDQ-V-SLSFSDIQV
W4V1T8          AFVVTQ-FYIK-------PV----YKAETTLFL---------GKEKDQ-V-SLSFADIQV
A0A1C6ITD7      TAITTI-FFIE-------PT----YQANISIII---G--QNQSTVDEG-TSYPGSYDVVM
A0A381IX63      VSIKTF-FFTT-------PI----YEAQTTIII---------NNLLGK-SSQLTKEDISY
A0A1M6RWV2      TSVVSF-FFLD-------KV----YEASTKLVL---------V---KG-GDSDIQYNDVL
A0A841ZT34      GVTITK-FVIT-------PT----YSASSWVVA---------KPPSSE-TSD--ANDIQL
A0A1G9IUT4      SAGLSF-FVID-------PV----YEANTTLIV---------NKVKEV-NTQDITNDDVL
A0A842GR80      TYLFTT-QVIK-------PM----YSASAWAIV---------KIENKA-NSNNSSEDIQR
A0A7X0TNH3      TYLFTT-QVIK-------PM----YSASAWAIV---------KIENKA-NSNNSSEDIQR
A0A842D596      TYLFTT-QVIK-------PM----YSASAWAIV---------KIENKA-NSNNSSEDIQR
A0A842EQ86      TYLFTT-QVIK-------PM----YSASAWAIV---------KIENKA-NSNNSSEDIQR
A0A842A220      TYLFTT-QVIK-------PM----YSASAWAIV---------KIENKA-NSNNSSEDIQR
A0A7X0YM80      TYLFTT-QVIK-------PM----YSASAWAIV---------KIENKA-NSNNSSEDIQR
A0A842GEL5      TYLFTT-QVIK-------PM----YSASAWAIV---------KIENKA-NSNNSSEDIQR
A0A841XVD7      TYLFTT-QVIK-------PM----YSASAWAIV---------KIENKA-NSNNSSEDIQR
A0A7X0XME5      TYLFTT-QVIK-------PM----YSASAWAIV---------KIENKA-NSNNSSEDIQR
A0A842B6T1      TYLFTT-QVIK-------PM----YSASAWAIV---------KIENKA-NSNSSSEDIQR
A0A841X7G0      TYLFTT-QVIK-------PM----YSASAWAIV---------KIENKA-NSNNSSEDIQR
A0A841W3M8      TYLFTT-QVIK-------PM----YSASAWAIV---------KIENKA-NSNNSSEDIQR
A0A7X0XVI0      TYLFTT-QVIK-------PM----YSASAWAIV---------KIENKA-NSNNSSEDIQR
A0A7X0Z1K1      TYLFTT-QVIK-------PM----YSASAWAIV---------KIENKA-NSNNSSEDIQR
A0A143ZUX1      GFLFAQ-LTYK-------PT----YSSIGSFWLQIYS-------TNENDQTKLVMSDIQA
A0A7I8D809      GFLFAQ-LTYK-------PT----YSSIGSFWLQIYS-------TNENDQTKLVMSDIQA
A0A3R9WAA7      VCVYAR-EKYS-------PR----YTAAVTFTVNLDL-----------ASDGSIYEDSMR
A0A1G6BLF1      FYTHVK-MVYE-------PK----YTAEATYLVTAAS----------YYGYTESYYNETT
A0A355G1X5      GWSVSF-MTTD-------PT----YTTNLSFTTYNKA-----------AADVVSSSDINS
A0A1W2CEA6      AWFYVT-RLVT-------PV----YQATSKIYIAGSD-------------TTISLSDLQL
A0A355G3J9      LAGATW-ALIK-------PT----YTATAKLYVYNEH----------STDTYITSSDLAV
A0A3D2AD87      TFAYCK-FVVN-------PK----YKAQSTIYVTNGNINPGETVEEQEETDGVKGTDVSA
A0A143XN92      AYMIID-SSYK-------PK----YTSSTTFIVTGKG------------LNNSIYDNLLT
R7FFK6          TFLVSS-YVIP-------QQ----FQSNISMYVKNSE----KQN--QEQQ-GINNNDLTV
A0A373MPB9      ALFVSK-FVMS-------KQ----YQSHVSMYVKSAD----NQSTGQDKT-NVDLQDIDA
A0A373L519      ALFVSK-FVMS-------KQ----YQSHVSMYVKSAD----NQSTGQDKT-NVDLQDINA
A0A373W906      ALFVSK-FVMS-------KQ----YQSHVSMYVKSAD----NQSTGQDKT-NVDLQDINA
A0A373VCW2      ALFVSK-FVMS-------KQ----YQSHVSMYVKSAD----NQSMGQDKT-NVDLQDIDA
W0U604          ALFVSK-FVMS-------KQ----YQSHVSMYVKSAD----NQSTGQDKT-NVDLQDINA
A0A374B6G0      ALFVSK-FVMS-------KQ----YQSHVSMYVKSAD----NQSTGQDKT-NVDLQDINA
A0A373VM36      ALFVSK-FVMS-------KQ----YQSHVSMYVKSAD----NQSTGQDKT-NVDLQDINA
A0A1C5P379      ALFVSK-FVMS-------KQ----YQSHVSMYVKSAD----NQSTGQDKT-NVDLQDINA
A0A373XXX0      ALFVSK-FVMS-------KQ----YQSHVSMYVKSAD----NQSTGQDKT-NVDLQDINA
A0A5R9MJM9      ALFVSK-FVMS-------KQ----YQSHVSMYVKSAD----NQSTGQDKT-NVDLQDINA
A0A356CW82      ALFVSK-FVMS-------KQ----YQSHVSMYVKSAD----NQSTGQDKT-NVDLQDINA
R6T4X7          ALFVSK-FVMS-------KQ----YQSHVSMYVKSAD----NQSTGQDKT-NVDLQDINA
A0A374HTV1      ALFVSK-FVMS-------KQ----YQSHVSMYVKSAD----NQSTGQDKT-NVDLQDINA
A0A374GB66      ALFVSK-FVMS-------KQ----YQSHVSMYVKSAD----NQSTGQDKT-NVDLQDINA
A0A374ECC6      ALFVSK-FVMS-------KQ----YQSHVSMYVKSAD----NQSTGQDKT-NVDLQDINA
A0A374BM61      ALFVSK-FVMS-------KQ----YQSHVSMYVKSAD----NQSTGQDKT-NVDLQDINA
A0A373UGZ4      ALFVSK-FVMS-------KQ----YQSHVSMYVKSAD----NQSTGQDKT-NVDLQDINA
A0A373SA66      ALFVSK-FVMS-------KQ----YQSHVSMYVKSAD----NQSTGQDKT-NVDLQDINA
A0A1C5X6X7      ALFVSK-FVMS-------KQ----YQSHVSMYVKSAD----NQSTGQDKT-NVDLQDINA
A0A1C6JIH3      ALFVSK-FVMS-------KQ----YQSHVSMYVKSAD----NQSTGQDKT-NVDLQDINA
A0A373PSC3      ALFVSK-FVMS-------KQ----YQSHVSMYVKSAD----NQSTGQDKT-NVDLQDINA
A0A1K1WYK8      AFSFSK-FVLP-------VK----YSSHITMYVQS--------YTGISENAANDVNNISN
A0A1H6IUB1      AFCYSK-FVMP-------LK----YSSHISMYVQS--------YTGITEN-ANQQNNISN
A0A1M7L1F9      AFCYSK-FVMP-------LK----YSSHISMYVQS--------YTGISEN-ANQQNNISN
A0A1C6B4L6      SFGFSK-MFLP-------FE----YSSHVSMYVQS--------YTGISDQ-MADQNNISN
A0A1Q6T9P4      SFGFSK-MFLP-------FE----YSSHVSMYVQS--------YTGISDQ-MADQNNISN
A0A315Y4F9      AFGISK-FLLP-------LQ----YSSHITMYVQS--------YTGITEN-ANSANNISN
A0A354K620      GFSVSR-FLLP-------LK----YSSHITMYVQS--------YTGITEN-ANNVNNISN
A0A173ZYY6      TYVVVS-SRYV-------PE----YTTQATFVVSSRG-------------DANAYSNLSS
A0A6L8RXB5      TYVVVS-SRYV-------PE----YTTQATFVVASRG-------------DANAYSNLSS
A0A173SMI2      TYVVVS-SRYV-------PE----YTTQATFVVASRG-------------DANAYSNLSS
A0A845KKD0      TYVVVS-SRYV-------PE----YTTQATFVVASRG-------------DANAYSNLSS
A0A6N9JW85      TYVVVS-SRYV-------PE----YTTQATFVVASRG-------------DANAYSNLSS
A0A174ASH7      TYVVVS-SRYV-------PE----YTTQATFVVSSRG-------------DANAYSNLSS
A6BH65          TYVVVS-SRYV-------PE----YTTQATFVVSSRG-------------DANAYSNLSS
R7G0D7          TYVVVS-SRYV-------PE----YTTQATFVVSSRG-------------DANAYSNLSS
R6HZX3          RYVQAQ-RSFV-------PQ----YTATASFSVKSGY----VG--TTDLVDSTQYYDNQA
R5EFZ0          TYIYTD-ATYA-------PV----YRTTTTFVV------------TTRGSSTSVYSNLSS
A0A3E5FSY5      AFSTFRYLTYT-------PI----YRCEATFTVATD---------SENTGSYSYYYSQNT
A0A1V5S3C0      GFVFSR-VTYE-------ER----FSSKILFNASNKS----SDI-AGEAAKYTTASDVQA
A0A3C0QME1      AYAYAH-FMMP-------NQ----YQSYTSMYVRNSG--------NILGDLDINISALNA
A0A355FYK5      GYFFAKASYVPIYTVSATIE----FTSTKYIKVADAT--------GKEELVTVV---VPY
A0A357AQU0      GFSYAK-FYLP-------ET----FTSSIRMYVKNLN--------STETVSSVTTSDLNA
A0A3C1YJQ7      GFSYAK-FYLP-------ET----FTSSIRMYVKNLN--------STETVSSVTTSDLNA
A0A3D0JG38      GFSYAK-FYLP-------ET----FTSSIRMYVKNLN--------STETVSSVTTSDLNA
A0A3C0IHX1      GFSYGK-YYLP-------LE----YTSSTYMYVKNGD--------TSEEKTAINQQDLMA
R5V506          GFSYGK-YYLP-------LE----YTSSTYMYVKNGD--------TSEEKTAINQQDLMA
A0A352TIU5      GFSYGK-YYLP-------LE----YTSSTYMYVKNGD--------ASEEKTAINQQDLMA
R5B467          SGGYAR-LSYR-------PQ----YTASMTFLVNAGG----T-------SQSGSAASTAT
A0A1Y3TC98      VTVYQR-VFHQ-------PM----YECSATFTVATG---------NSENGSYSFYYNSST
A0A1W1Z4C3      FMYWRA-SKAI-------DT----YTASGTMFVTNSN----P---NLVNYGYTSTSDISS
A0A239QN83      VMYYRA-SKAP-------DT----YTASGTMFVTNSN----P---NLVNYGYTSTSDISS
A0A8A5CVI3      VMYYRA-SKAP-------DT----YTASGTMFVTNSN----P---NLVNYGYANVTDISS
A0A8A5D3H1      VLYYRA-SKAP-------DT----YTASGTMFVTNSN----P---NLVNYGYTSTSDISS
A0A1Q6REE0      LTFVQR-RAYR-------PV----YEASASFTVRVAN----P---LYASVSSYNEKTAQV
R5ETF9          LTFVQR-RAYR-------PV----YEASASFTVRVAN----P---LYASVSSYNEKTAQV
A0A0F2P7X6      AYFYTI-STYV-------PV----YTASASMVVNSKQ----L---KIVGQEAVLTNDVNL
A0A359B487      AYFYTI-YTYV-------PV----YTASASMVVNSKQ----L---KIVGQEAVLTNDVNL
R6VAT5          FTLYSY-AAYT-------PQ----YTAAATFTVTPKG----D---SL-----SAYTSISS
D4LC36          AFLISD-FAIP-------RK----YQSNVSMYVRNKE----D---QK---QDINNSDLSV
A0A7X3IXX7      AFGVAL-AQPK-------IY----TSSSTGFVTTTGS----S---SL---GDV-LNGDVA
A0A1Q6S448      AWIVLT-CFVT-------QQ----YTSSTTFSVTTRT----S---NL-----Y-YTNITA
A0A351MYR0      AWIVLS-CFVT-------QQ----YTSSTTFAVTARA----S---TL-----Y-YTNITA
R6HPC1          AWIVLS-CFVT-------RQ----YTSSTTFAVTARA----S---TL-----Y-YTNITA
A0A3D4G5Z5      AWIVLS-CFVT-------RQ----YTSSTTFAVTARA----S---TL-----Y-YTNITA
A0A3D5ES03      AWIVLS-CFVT-------RQ----YTSSTTFAVTARA----S---TL-----Y-YTNITA
A0A348P5V4      GFGVAV-ARYT-------EH----YSSQIMFIASNRS--------SAITVAGQSSSDINA
A0A356PT74      GFAVAK-LTYT-------PS----YSSKITFIANNKS--------SALAVSGQTQSDLNA
A0A3D5LL19      GFAVAK-LTYT-------PS----YSSKITFIANNKS--------SALAVSGQTQSDLNA
R5MNF0          GFAVAK-LTYT-------PS----YSSKITFIANNKS--------SALAVSGQTQSDLNA
A0A1Q9JSI0      MSLLAY-VKVG-------RSYHKMYESTSTFIVSGK------------GSNNNVYSNLNT
A0A3D5TNI1      CAGITK-LVEE-------PT----YTSSMTFIVNNKS----EKDLSSSGDNSVSYNDMSA
A0A358LJD0      CAVVTK-AVEE-------PT----YTSSMTFIVNNKS----EKDLSSSGDNSVSYNDMSA
R6I3L7          CAVITK-AVEE-------PT----YTLSMTFIVNNKS----EKDLSSSGENSVSYNDMSA
A0A3D1HXX0      CAVITK-AVEE-------PT----YTSSMTFIVNNKS----EKDLSSSGDNSVSYNDMSA
A0A3D2QJB8      CAVITK-AVEE-------PT----YTLSMTFIVNNKS----EKDLSSSGENSVSYNDMSA
R7MQJ4          AFGFSK-FFMP-------LK----YQSYTSMYVKNNN--------SVTETDGVNLNDLNA
A0A1V5GLC0      GFCYTK-FCMP-------LQ----YSSHMSMYVQCYT--------STSGPTD--YNDISK
W7V182          AFCVSK-FLMP-------LK----YASHISMYIQSYT--------TFNENPDQNFNNINN
A0A143XPI5      GYYYAKE-SYR-------PN----YEAYASFAVDAGV---SSYS--------SSYYNSTT
A0A0M6WXE3      FYVASSM-IYV-------PN----YRTQATFVITSRE---NANA----------YNNLSS
A0A348SAK2      FYVASSM-IYV-------PN----YRTQATFVITSRE---NANA----------YNNLSS
A0A1G9H5B9      FYMYMTR-RMP-------ET----YTATGTMYVSSYN---PEYI----DDEYTRPGDLSS
A0A1Y4H8L0      AATVLSL-RWQ-------PA----YTTSATFAVSSRV---GASS----------YADLNS
A0A4B9BMD9      QFVLSQRTELE-------AI----NALQETFTVSERS---KESG----------MLELTM
A0A0M6WYQ8      SYIKARK-NYT-------PV----YTASATVAVTTID---GSPA----------YQNNAS
A0A348SAK1      SYIKARK-NYT-------PV----YTASATVAVTTID---GSPA----------YQNNAS
A0A252F281      TRVASET-IYK-------PE----YTSSVTMSVTSKS---GSNA----------VADLNT
A0A1Y4QKE6      FSTFRYL-TYT-------PI----YRCEATFTVATDS---ENTG------SYSYYYSQNT
B1C231          FSTFRYL-TYT-------PI----YRCEATFTVATDS---ENTG------SYSYYYSQNT
A0A7V6WIR4      --------RVA-------HP----VQLINSQNIDVQG---LEGT---------VNSLSSL
A0A1Y3TUL5      SYMRGEM---A-------KG----YSITSSIAVTTQD---AGGN-FTTNTSNPDSSDIQL
A0A1Y4JAX2      SYMRGEM---A-------KG----YSITSSIAVTTQD---AGGN-FTTNTSNPDSSDIQL
A0A1Y4T590      SYMRGEM---A-------KG----YSITSSIAVTTQD---AGGN-FTTNTSNPDSSDIQL
A0A1Y3T163      FYAFQNL-SYE-------PL----YASSATFTVATGD---G------ENGTYNFYYNRNT
A0A1Y3YCA2      FYAFQNL-SYE-------PL----YASSATFTVATGD---G------ENGTYNFYYNSNT
A0A7W8H9H2      GYIKNAA-SYY-------PM----YRSTASFTVVTAS---GSSD------GFSFYYDNLT
A0A1Y4L6N9      FYLRASR-FYT-------PM----YRAEAVFTVMTST---QSNS--ENSGSYNFYYDSTT
A0A173T644      YYVKNSQ-FYT-------PM----YQSVASFTVMTGG---NSEN-GQEEGSYNFYYDTTT
A0A1C5TSB8      YYVKNSQ-FYT-------PM----YQSVASFTVMTGG---NSEN-GQEEGSYNFYYDTTT
C0CIK6          YYVKNSQ-FYT-------PM----YQSVASFTVMTGG---NSEN-GQEEGSYNFYYDTTT
A0A1Y3WEF6      FYLRATRLFYT-------PM----YQSSATFTVLTGG---TMDT---ENSTYNFYYDTNT
A0A417T0L2      FYLRATSLFYT-------PM----YQSSATFTVLTGG---STDS---ENSTYNFYYDTTT
A0A1H9EPU3      AFVYSKF-VIT-------PL----YSASTQILVMNEN---SGTGNTTTDGKSVSVSDLQS
A0A354IGV3      AHVVLQT-IYK-------PQ----YTCSATYIVSSKY---STVS----------YSNISA
A0A417JMV2      SYVYVGR-NYH-------KQ----YESTSTFIVSSKG---SNNS---------IYSDLSA
A0A415VWX5      SYVYVGR-NYH-------KQ----YESTSTFIVSSKG---SNNS---------VYSDLSA
A0A173UY96      SYVYVGR-NYH-------KQ----YESTSTFIVSSKG---SNNS---------VYSDLSA
B0P408          SYVYVGR-NYH-------KQ----YESTSTFIVSSKG---SNNS---------VYSDLSA
D4MV82          SYVYVGR-NYH-------KQ----YESTSTFIVSSKG---SNNS---------VYSDLSA
A0A173QTL1      SYVYVGR-SYH-------KQ----YESTSTFIVSSKG---SNNS---------VYSDLSA
A0A174J359      SYVYVGR-NYH-------KQ----YESTSTFIVSSKG---SNNS---------VYSDLSA
A0A174A3T7      SYVYVGR-NYH-------KQ----YESTSTFIVSSKG---SNNS---------VYSDLSA
A0A417UUA3      SYVYVGR-NYH-------KQ----YESTSTFIVSSKG---SNNS---------VYSDLSA
A0A6N2VB70      SYVYVGR-NYH-------KQ----YESTSTFIVSSKG---SNNS---------VYSDLSA
A0A1C6EUV9      AYVYVGR-SYH-------KQ----YESTSTFIVSSKG---SNNS---------VYSDLGT
A0A173Y645      AYVYVGR-SYH-------KQ----YESTSTFIVSSKG---SNNS---------VYSDLST
A0A374AVY6      AYVYVGR-SYH-------KQ----YESTSTFIVSSKG---SNNS---------VYSDLST
R7BXS4          AYVYVGR-SYH-------KQ----YESTSTFIVSSKG---SNNS---------VYSDLST
                                                                            

S3FFL2          VDQE---FYQTQYGLLRS---RSLSERVATQ------------------------LRLVD
A0A328M4V1      AVTE---IA-----LLTS---RTVVGGAIDN------------------------LKLEI
A0A6A8IF17      VNNE---LI-----TFRS---PSLMTEVVKR------------------------LRLDM
A0A143WVN6      AM-N---MADVFSEVFQS---DALKKMIEAD------------------------IGE--
W6RXP9          YQ-K---LLKTYAEMIKN---DELIEKAIRE------------------------VNT--
W6S4G8          YQ-K---LLLTYAQILKT---EDLIGTALNN------------------------VDS--
A0A3D5R4X5      NI-R---LAETYSEIIKS---RRVASRVIDE------------------------MNL--
A0A1I4C3N6      AQ-Q---LITSYSSVLTS---SIFLNDVLEA------------------------SGLQD
A0A3B9CIM7      AK-N---LITSYMQILKS---RTFLEKVKEE------------------------TGL--
A0A7R7IBN8      AK-N---LVSSYMQILRS---NTFLERVQKE------------------------LGI--
A0A1G9WHW8      AK-N---LISSYTQILKS---NTFLEALKEE------------------------TGL--
A0A1H5VAA0      AK-N---LISSYTQILKS---NTFLEALKEE------------------------TGL--
A0A3R6VK11      AK-N---LVQSYILILKS---NTILQKVLEE------------------------AGL--
A0A3R6QUY7      AK-N---LVQSYILILKS---NTILQKVLEE------------------------AGL--
A0A373K3P9      AK-N---LVQSYILILKS---NTILQKVLEE------------------------AGL--
A0A3R6JRU5      AK-N---LVQSYILILKS---NTILQKVLEE------------------------AGL--
A0A1C5MS04      AK-N---LVQSYILILKS---NTILQKVLEE------------------------AGL--
A0A3C1J150      AK-N---LVQSYILILKS---NTILQKVLEE------------------------AGL--
A0A416CXD7      AK-N---LVQSYILILKS---NTILQKVLEE------------------------AGL--
A0A6N2X662      AK-N---LVQSYILILKS---NTILQKVLEE------------------------AGL--
R6XBL9          AK-N---LVQSYILILKS---NTILQKVLEE------------------------AGL--
A0A355W5Z7      AK-N---LVQSYILILKS---NTILQKVLEE------------------------AGL--
A0A1G6BLB6      AS-T---TATSFQTILSN---SVVQEAVAKA------------------------AGM--
A0A1C6G8M0      GS-A---LTNDYEGIIKS---RVVLTKVISN------------------------LNL--
A0A416MP73      GS-A---LTGDYEGIIKS---RVVLNKVIEN------------------------LKL--
A0A3E4LL92      ---N---ALERSVNVLNS---DTMRDQIVKA------------------------SGG--
A0A415D1L1      ---N---ALERSVNVLNS---DTMRDQIMKA------------------------SGS--
A0A396G6S7      TK-E---LAGQFTEILGS---NVLKKKVAQD------------------------LGV--
A0A3E5A223      TK-E---LAGQFTEILGS---NVLKKKVAQD------------------------LGV--
R7D5E6          TK-E---LAGQFTEILGS---NVLKKKVAQD------------------------LGV--
A0A415HQH5      TK-E---LAGQFTEILGS---NVLKKKVAQD------------------------LGV--
A0A414W2C6      TK-E---LAGQFTEILGS---NVLKKKVAQD------------------------LGV--
A5ZNE7          TK-E---LAGQFTEILGS---NVLKKKVAQD------------------------LGV--
A0A395X821      TK-E---LASQFTEILGS---NVLKKKVAQD------------------------LGM--
A0A1C5PY68      TK-E---LASQFTEILGS---NVLKKKVAQD------------------------LGM--
A0A174CJF8      TK-E---LASQFTEILGS---NVLKKKVAQD------------------------LGM--
A0A564SRR2      TK-E---LASQFTEILGS---NVLKKKVAQD------------------------LGM--
A0A174R7V0      TK-E---LASQFTEILGS---NVLKKKVAQD------------------------LGM--
A0A373MWV2      TY-E---MTQKFQAILEN---NILKKKVMEE------------------------LGC--
A0A417CE88      TY-E---MTQKFQAILEN---NILKKKVMEE------------------------LGC--
A0A416Y441      TY-E---MTQKFQAILEN---NILKKKVMEE------------------------LGC--
A0A357GPJ7      TY-E---MTQKFQAILEN---NILKKKVMEE------------------------LGC--
A0A396PAC1      TY-E---MTQKFQAILEN---NILKKKVMEE------------------------LGC--
A0A416EYU4      TY-E---MTQKFQAILEN---NILKKKVMEE------------------------LGC--
A0A416SCQ2      TY-E---MTQKFQAILEN---NILKKKVMEE------------------------LGC--
A0A416TGN7      TY-E---MTQKFQAILEN---NILKKKVMEE------------------------LGC--
A0A417SMF6      TY-E---MTQKFQAILEN---NILKKKVMEE------------------------LGC--
A0A0H5SF45      AQ-K---VVSTYVNLLRT---NTFYRQVLEA------------------------TGL--
A0A1M6JRJ5      AQ-K---IAETYINFLNT---RQFYAQVLEL------------------------SRL--
A0A1M7Y1S2      AQ-K---IAETYINFLNT---RQFYSQVLEL------------------------SGL--
A0A7I8DMN1      AQ-K---IAETYINFLNT---RQFYTEVLKM------------------------SGL--
A0A1Y4MW77      AE-Q---LSLTFPYILSS---QILNDAIEAD------------------------LGV--
A0A6S6R676      AQ-K---VVTTYINFLKT---KVFYKQVADR------------------------SRL--
A0A0K8J554      AQ-K---VVATYVNLLRT---QKFYKKVLEE------------------------TGL--
A0A1I0RG99      AQ-K---VVTTYINFLQT---KVFYKQVIDE------------------------SKL--
A0A1I5G322      AQ-K---VVTTYISFLQT---KKFYEQVIEE------------------------SNL--
A0A7C6IYW8      AQ-K---VVTTYINFLNT---NVFYQKIQDD------------------------TNL--
A0A7C6JZF1      AQ-K---VITTYINFLKT---NRFYQEVAEG------------------------SGL--
A0A3N1XSX6      AQ-K---VVTTYINFLNT---NVFYHDIQEE------------------------SNL--
A0A839K1C1      AQ-K---VVTTYINFLNT---NVFYEKIQDD------------------------TML--
R6UHV6          TN-K---MAGVFKNILDS---SQLQNSAARQ------------------------LGY--
A0A3R9Q621      AQ-K---VVNTYINFLKT---KVFYNMLIEE------------------------TRL--
A0A069RC75      SQ-K---LVDTYAVVAKS---ETVMERTIKN------------------------LNL--
A0A174F2W5      TY-E---MTQKFQAILEN---NILKKKVMEE------------------------LGC--
A0A174S8E9      TY-E---MTQKFQAILEN---NILKKKVMEE------------------------LGC--
A0A416ZL97      TY-E---MAQKFEAILEN---TILKKKVMEE------------------------LSL--
A0A174LSK1      TY-E---MAQKFEAILEN---TILKKKVMEE------------------------LSL--
A0A373GY92      TY-E---MAQKFEAILEN---TILKKKVMEE------------------------LSL--
A0A373NZQ6      TY-E---MAQKFEAILEN---TILKKKVMEE------------------------LSL--
A0A417I9B9      TY-E---MAQKFEAILEN---TILKKKVMEE------------------------LSL--
A0A417WQF8      TY-E---MAQKFEAILEN---TILKKKVMEE------------------------LSL--
A0A8B3CFR3      TY-E---MAQKFEAILEN---TILKKKVMEE------------------------LSL--
A0A373RZ83      TY-E---MAQKFEAILEN---TILKKKVMEE------------------------LSL--
A0A416U6I1      TY-E---MAQKFEAILEN---TILKKKVMEE------------------------LSL--
R7JQZ9          TY-E---MAQKFEAILEN---TILKKKVMEE------------------------LSL--
A0A1M5UYN6      YV-K---ALETYIQIAKS---EDVAEGARGI------------------------LGD--
A0A176JBT8      SL-K---LIETYQYILKS---QRMADLVIKD------------------------LDG--
A0A1I5HIC6      GS-Q---LTQDYKILVLS---RPVTEQVLSK------------------------LNL--
A0A1Y3TC51      TT-Q---MADVFGQVFQS---DALAEKIAEE------------------------TG---
A0A1Y3T1N0      TS-Q---MADVFGEVFQS---SALRSRIIED------------------------VG---
A0A1Y3Y8U8      TS-Q---MADVFGEVFQS---SALRSRIIED------------------------VG---
A0A5B0BQY5      NL-R---LIETYTDIFTS---NRLVSEVKIV------------------------LGD--
A6CLL4          NL-R---LISTYKYILKS---PRVLEIVAER------------------------TEE--
A0A176U8D6      GS-A---LTNDYEGIIKS---RVVLTKAIAN------------------------LKL--
A0A1Q6KSQ5      GS-A---LTNDYEGIIKS---RVVLTKVISN------------------------LNL--
A0A3D3U8B3      GS-A---LTNDYEGIIKS---RVVLTKVISN------------------------LNL--
A0A3E5FRL7      AN-E---MADIIKEVFQS---DVLLELVENE------------------------IG---
A0A1Y4QK93      AS-E---MADIIKEVFQS---DVLLELVENE------------------------IG---
B1C232          AN-E---MADIIKEVFQS---DVLLELVENE------------------------IG---
A0A401USI6      YQ-D---LIKTYSEIGKS---RVVAENAIKN------------------------LKS--
A0A1V4IQ10      YQ-K---LLKTYSELIKT---NTLVSRALNR------------------------YDL--
A0A1S8TRD2      YQ-K---LLKTYSELAKT---NTLVSKALKE------------------------HNI--
G7M1U2          YQ-K---LLKTYSELAKT---NTLVSKALKE------------------------HNI--
A0A2T6KJ75      NL-R---LIETYKYLMKS---NRILTKVNGS------------------------LDE--
A9KN92          GS-Q---LTQDFKVMVLS---RPVTEQVISK------------------------LNL--
A0A352MUJ1      NQ-K---LVYTYTELVKS---DTVLNEVANR------------------------IQL--
R5YI67          NQ-K---LVYTYSELVKS---DSVLNEVISR------------------------VQL--
A0A174DL89      YQ-K---MVKTYSELLTS---KIVLQDVIEN------------------------TGL--
A0A1Y0IQP5      DQ-K---LVTTYGEIFQS---RMIAEAVIDR------------------------LSL--
A0A4R2R7B1      DQ-K---LVTTYGEIFQS---RMIAEAVIER------------------------LGL--
A0A1M6E8I2      SQ-K---LVVTYSEIVKS---RIVLEAVIDK------------------------IEL--
A0A7C6SMH0      NN-Q---LIADYRELLKS---RTVAERVGEK------------------------LNV--
A0A7X7XYM7      NN-Q---LIADYRELLKS---RTVAERVGEK------------------------LNV--
A0A3B8KKL6      NN-Q---LIADYRELLKS---RTVAERVGEK------------------------LNV--
A0A2K9E6R0      NN-Q---LIADYRELLKS---RTVAERVGEK------------------------LNV--
A0A2S8RBI0      NN-Q---LIADYRELLKS---RTVAERVGEK------------------------LNV--
A0A7X8MFK9      NN-Q---LVVDYRQILKS---RRVAKIINEK------------------------LGV--
A0A7X9D1M8      NN-Q---LVGDYRQILKS---RRVAEIINEK------------------------LGV--
A0A0L6JLG6      NS-Q---LVVDYREILKS---RLVAEKIQSQ------------------------LGV--
A0A7X8PYA7      NN-Q---LVNDYRELLKS---NLVADSIEKK------------------------LGV--
G8LSN0          NN-Q---LVSDYRELLKS---NLVAESIEKK------------------------LGV--
A0A1Y4N105      AM-N---MAEVFSEVFQS---DTLKEKIEAD------------------------LEV--
A0A1Y4QP75      AM-N---MAEVFSEVFQS---DTLKEKIKAD------------------------LEV--
A0A3D4QRB5      SR-N---LVDTYSVIIKS---NRVLENVVSD------------------------LGL--
A0A349DEH5      QI-N---MAGTFRYILSS---RVMKNAIVEK------------------------CTP--
A0A3D4T7B4      QI-N---MAGTFRYILSS---RVMKNAIVEK------------------------CTP--
A0A350XYC7      QI-N---MAGTFNYILSS---PRMKEAIVEK------------------------CSE--
R6DNR8          QI-N---MAGTFSYILSS---RALKEAIVEK------------------------CPE--
A0A355KUM5      QI-N---MAGTFSYILSS---RALKEAIVEK------------------------CPE--
R5YGY6          QI-N---MAGTFSYILSS---RALKEAIVEK------------------------CPE--
A0A7G9WCY6      NQ-R---LVKTYSEIAKS---RSVSTEVIRK------------------------LGL--
A0A0A5GPA9      NL-R---LIETYKSILIS---PRIMDKVKAQ------------------------YGS--
A0A271M6M4      NL-R---LIETYKYILNS---TRIMEKVAEK------------------------TGS--
A0A1C6G0U3      TK-N---LAITYANIIKS---RAVLEKVINS------------------------MNL--
A0A3D4LLB3      SK-S---LVYTYAEMVKS---HTVLDNTAKT------------------------LKI--
A0A7C7AD93      TK-E---YMQTYIMILKT---NVVAERTIER------------------------LGL--
A0A2V3W8U6      NL-R---LIETYHFIIQS---DRIIDLVVEE------------------------LDE--
A0A6N3BXA1      SQ-R---MAITYSKIITS---DTVLNQVIDN------------------------LNL--
A0A351SRI8      NK-N---LVSTYREIIQS---KLILNKTIEN------------------------LNL--
A0A1V5LU59      NN-Q---LVSDYRELLKS---DLVAESVKEK------------------------LGV--
A0A7X8R9W1      NN-Q---LVADYRELLMS---RTVAEEIEKK------------------------LGV--
A0A1E3BVC3      NN-Q---LVVDYREILQS---RRVAEIINQK------------------------FGV--
A0A4Q0I6S0      NN-Q---LVVDYREILQS---RRVAEIINQK------------------------FGV--
A3DF66          NN-Q---LVVDYREILQS---RRVAEIINQK------------------------FGV--
W4V1T8          NN-Q---LVVDYREILQS---RRVAETINQK------------------------FGV--
A0A1C6ITD7      YQ-K---MVKTYSEMITS---RVVLEDVIEN------------------------TGL--
A0A381IX63      SQ-L---LGETYKPIVKS---RKVAEEIKKN------------------------LNL--
A0A1M6RWV2      LNQR---LVKTYSEIASS---RTIAEEVINN------------------------LKL--
A0A841ZT34      LN--------TYKNIVTS---DVVLDDVKKK------------------------LEI--
A0A1G9IUT4      ANQK---LALTYGEIIKS---RTVLDKVIKN------------------------LNI--
A0A842GR80      LN--------TYKTIATS---TVVLENVKKE------------------------LHL--
A0A7X0TNH3      LN--------TYKTIATS---TVVLENVKKE------------------------LHL--
A0A842D596      LN--------TYKTIATS---TVVLENVKKE------------------------LHL--
A0A842EQ86      LN--------TYKTIATS---TVVLENVKKE------------------------LHL--
A0A842A220      LN--------TYKTIATS---TVVLENVKKE------------------------LHL--
A0A7X0YM80      LN--------TYKTIATS---TVVLENVKKE------------------------LHL--
A0A842GEL5      LN--------TYKTIATS---TVVLENVKKE------------------------LHL--
A0A841XVD7      LN--------TYKTIATS---TVVLENVKKE------------------------LHL--
A0A7X0XME5      LN--------TYKTIATS---TVVLENVKKE------------------------LHL--
A0A842B6T1      LN--------TYKTIATS---TVVLENVKKE------------------------LHL--
A0A841X7G0      LN--------TYKTIATS---TVVLENVKKE------------------------LHL--
A0A841W3M8      LN--------TYKTIATS---TVVLENVKKE------------------------LHL--
A0A7X0XVI0      LN--------TYKTIATS---TVVLENVKKE------------------------LHL--
A0A7X0Z1K1      LN--------TYKTIATS---TVVLENVKKE------------------------LHL--
A0A143ZUX1      AT-G---LAQTYQYFLTG---ADTIDYVLEESGLD--------------------LNP--
A0A7I8D809      AT-G---LAQTYQYFLTG---ADTIDYVLEESGLD--------------------LNP--
A0A3R9WAA7      AS-Q---LSATFPYIVTS---SILKNIIAEE------------------------LGI--
A0A1G6BLF1      AS-G---LATSLEYVLNS---TVMQKTVAEA------------------------LDM--
A0A355G1X5      SI-M---MTNTFKYILEG---RPMRETVAKSCSFN--------------------ISA--
A0A1W2CEA6      GS-T---LATDYQEVFKI---WHVHEMVDERLDLD--------------------YSY--
A0A355G3J9      SK-S---LVDTYLIIIKS---DPVLDKVQKDLAAKYPS-----------------LTA--
A0A3D2AD87      SV-S---LSFTVVDILKQ---PDIYREMVNTIEKYND------------------KNY--
A0A143XN92      AQ-D---MTNRFKNIIDS---NILKEKIAEV------------------------LSM--
R7FFK6          SK-S---LVSTYIVILNN---DVVMDEVGNQLAKEYTEEELSRYFTLKN-GK---VTD--
A0A373MPB9      SK-S---LVQTYIVILTD---DPVMNEVSDKLLEMYTPEQLAPYFTVTS-GR---VSN--
A0A373L519      SK-S---LVQTYIVILTD---DPVMNEVSDKLLEMYTPEQLAPYFTVTS-GR---VSN--
A0A373W906      SK-S---LVQTYIVILTD---DPVMNEVSDKLLEMYTPEQLAPYFTVTS-GR---VSN--
A0A373VCW2      SK-S---LVQTYIVILTD---DPVMNEVSDKLLEMYTPEQLAPYFTVTS-GR---VSN--
W0U604          SK-S---LVQTYIVILTD---DPVMNEVSDKLLEMYTPEQLAPYFTVTS-GR---VSN--
A0A374B6G0      SK-S---LVQTYIVILTD---DPVMNEVSDKLLEMYTPEQLAPYFTVTS-GR---VSN--
A0A373VM36      SK-S---LVQTYIVILTD---DPVMNEVSDKLLEMYTPEQLAPYFTVTS-GR---VSN--
A0A1C5P379      SK-S---LVQTYIVILTD---DPVMNEVSDKLLEMYTPEQLAPYFTVTS-GR---VSN--
A0A373XXX0      SK-S---LVQTYIVILTD---DPVMNEVSDKLLEMYTPEQLAPYFTVTS-GR---VSN--
A0A5R9MJM9      SK-S---LVQTYIVILTD---DPVMNEVSDKLLEMYTPEQLAPYFTVTS-GR---VSN--
A0A356CW82      SK-S---LVQTYIVILTD---DPVMNEVSDKLLEMYTPEQLAPYFTVTS-GR---VSN--
R6T4X7          SK-S---LVQTYIVILTD---DPVMNEVSDKLLEMYTPEQLAPYFTVTS-GR---VSN--
A0A374HTV1      SK-S---LVQTYIVILTD---DPVMNEVSDKLLEMYTPEQLAPYFTVTS-GR---VSN--
A0A374GB66      SK-S---LVQTYIVILTD---DPVMNEVSDKLLEMYTPEQLAPYFTVTS-GR---VSN--
A0A374ECC6      SK-S---LVQTYIVILTD---DPVMNEVSDKLLEMYTPEQLAPYFTVTS-GR---VSN--
A0A374BM61      SK-S---LVQTYIVILTD---DPVMNEVSDKLLEMYTPEQLAPYFTVTS-GR---VSN--
A0A373UGZ4      SK-S---LVQTYIVILTD---DPVMNEVSDKLLEMYTPEQLAPYFTVTS-GR---VSN--
A0A373SA66      SK-S---LVQTYIVILTD---DPVMNEVSDKLLEMYTPEQLAPYFTVTS-GR---VSN--
A0A1C5X6X7      SK-S---LVQTYIVILTD---DPVMNEVSDKLLEMYTPEQLAPYFTVTS-GR---VSN--
A0A1C6JIH3      SK-S---LVQTYIVILTD---DPVMNEVSDKLLEMYTPEQLAPYFTVTS-GR---VSN--
A0A373PSC3      SK-S---LVQTYIVILTD---DPVMNEVSDKLLEMYTPEQLAPYFTVTS-GR---VSN--
A0A1K1WYK8      SK-Q---LVNTYMEVLKD---DEVMNAVSAKLLEQYDEQDLRRVFSFDEDNK---IDP--
A0A1H6IUB1      SK-Q---LVNTYMEVLKD---DAVMNAVGDKLLTQFDADTLSKNFGMSD-GK---IAP--
A0A1M7L1F9      SK-Q---LVNTYMEVLKD---DAVMNSVGELLKKQFDEDTLIKNFGMSE-GR---ISP--
A0A1C6B4L6      SK-Q---LVNTYMEVLKD---DAVMAAIGELLLEQFDEVILSENFTFNMSGE---IET--
A0A1Q6T9P4      SK-Q---LVNTYMEVLKD---DAVMAAIGELLLEQFDEVILSENFTFNMSGE---IET--
A0A315Y4F9      SK-Q---LVNTYMEVLKD---DAVMNAVAEKLSKQFEENVLSQNFTINDSGK---ITP--
A0A354K620      SK-Q---LVNTYMEVLKD---DAVMNAVAEKLAKQFEKNVLSQNFSLSESGK---IAP--
A0A173ZYY6      AN-T---MAKTFEKILKS---NIMEKKICEK------------------------LKV--
A0A6L8RXB5      AN-T---MAKTFEKILKS---NIMEKKICEK------------------------LKV--
A0A173SMI2      AN-T---MAKTFEKILKS---NIMEKKICEK------------------------LKV--
A0A845KKD0      AN-T---MAKTFEKILKS---NIMEKKICEK------------------------LKV--
A0A6N9JW85      AN-T---MAKTFEKILKS---NIMEKKICEK------------------------LKV--
A0A174ASH7      AN-T---MAKTFEKILKS---NIMEKKICEK------------------------LKV--
A6BH65          AN-T---MAKTFEKILKS---NIMEKKICEK------------------------LKV--
R7G0D7          AN-T---MAKTFEKILKS---NIMEKKICEK------------------------LKV--
R6HZX3          AE-Q---VVSSFPYIICS---EAMQERICLA------------------------LNT--
R5EFZ0          TS-N---LAGLFTELLNS---SIMRKTILQE------------------------TDI--
A0A3E5FSY5      AD-Q---LSKTFPYILDS---SYFRSILLDE------------------------LGV--
A0A1V5S3C0      SV-T---FATSFKFILTE---TDYIYSLVKQAVKAQSGQE---------------YSI--
A0A3C0QME1      SR-S---LLDTYTVVLKS---NYVMGEVAERLEMEYTTDELAGVFAM-NDGK---ISL--
A0A355FYK5      EN-N---DINRYSTLMKS---DAMIYALADKLNNDYNVV---------------------
A0A357AQU0      SK-S---LVMTYIVILKD---PVVVGEVAETLAENHERDYLNRYFALDENGC---PTT--
A0A3C1YJQ7      SK-S---LVMTYIVILKD---PVVVGEVAETLAENHERDYLNRYFALDENGC---PTT--
A0A3D0JG38      SK-S---LVMTYIVILKD---PVVVGEVAETLAENHERDYLNRYFALDENGC---PTT--
A0A3C0IHX1      SK-S---LVETYIVILKN---DTVVKQVGMSLVSKFGVSEISKCFTV-KNGV---IST--
R5V506          SK-S---LVETYIVILKN---DTVVKQVGMSLVSKFGVSEISKCFTV-KNGV---IST--
A0A352TIU5      SK-S---LVETYIVILKN---DTVVKQVGMSLVSKFGVSEISKCFTV-KNGV---IST--
R5B467          AA-Q---MAKTFPYILTS---GLLDSAVRADTGLA-------------------------
A0A1Y3TC98      AD-Q---MSLTFPYILES---NFFQSALMEE------------------------LGT--
A0A1W1Z4C3      AV-Q---LVNIYSEVVKS---ETVMQKVLEYAIEPAGENGNENDLLLSQKYPG--LST--
A0A239QN83      AV-Q---LVNIYSEVVKS---ETVMQRVLEYAIEPAGENGNEEDILLSQKYPG--LTT--
A0A8A5CVI3      AV-Q---LVNIYSEVVKS---ETVMQRVLEYAIEPAGENGNEEDVLLSQKYPG--LST--
A0A8A5D3H1      AV-Q---LVNIYSEVVKS---ETVMQRVLEYAIEPAGENGNEEDILLSQKYPG--LST--
A0A1Q6REE0      -------MADTFPSILTS---GLLQRRVMEELGID--------------------EV---
R5ETF9          -------MADTFPSILTS---GLLQRRVMDELGID--------------------EV---
A0A0F2P7X6      SA-K---LVNTYTAVLTS---NRVMELVAGELDLP--------------------AS---
A0A359B487      SA-K---LVNTYTAVLTS---NRVMELVAGELDLP--------------------AA---
R6VAT5          NA-STQQLEKTFPYIITS---APLTRVVAEDLGLS--------------------DVP--
D4LC36          SK-S---LVSTYIVILNN---DAVMEQVGEQLLKQ--------------------HTP--
A0A7X3IXX7      AQ-N---KANAYIPVISS---RSVAEKIAQDPALG--------------------LTA--
A0A1Q6S448      AA-D---VAASYSQLLQS---RVLRQTMEQNLGMP--------------------LN---
A0A351MYR0      AA-D---MASSYTQLLQS---RVLRQTMEQDLGMP--------------------LD---
R6HPC1          AA-D---MAASYSQLLQS---RVLRQTMEQNLGMS--------------------LD---
A0A3D4G5Z5      AA-D---MAASYSQLLQS---RVLRQTMEQNLGMS--------------------LD---
A0A3D5ES03      AA-D---MAASYSQLLQS---RVLRQTMEQNLGMS--------------------LD---
A0A348P5V4      SV-S---LAESFKYVFTT---TELATKVANSCGYANPDGSP--------------ITA--
A0A356PT74      SA-T---LAESFKYVFTT---TELSKRVADNSGFKD-------------------ISV--
A0A3D5LL19      SA-T---LAESFKYVFTT---TELSKRVADNSGFKD-------------------ISV--
R5MNF0          SA-T---LAESFKYVFTT---TELSKRVADNSGFKD-------------------ISV--
A0A1Q9JSI0      TA-Q---MATKFSEILNS---SILQKKVAKEMN------------------------M--
A0A3D5TNI1      SA-Y---MANTFVHLMTG---RTMCNAIAAECKTYP-------------------KTA--
A0A358LJD0      SA-Y---MANTFVHLMTG---RTMCNAIASECKSYP-------------------KTA--
R6I3L7          SA-Y---MANTFVHLMTG---RTMCNAIAAECKSYP-------------------KTA--
A0A3D1HXX0      SA-Y---MANTFVHLMTG---RTMCNAIAAECKSYP-------------------KTA--
A0A3D2QJB8      SA-Y---MANTFVHLMTG---RTMCNAIAAECKSYP-------------------KTA--
R7MQJ4          SK-S---LVSTYIAVMQD---DAVMEKVGSELLAEFDKDKLSKCFSIKDENGEESISA--
A0A1V5GLC0      SK-Q---LINTYIEVLKD---DAVMNAVGGKLMNEFDEAVLAETFGSYQNR----ISP--
W7V182          SK-Q---LINTYMEVMKD---DAVMNAVAEELRGSFENDVLEQNFSVVNGR----ITP--
A0A143XPI5      IK-Q---LSATFPYILTS---GALRQIVMND------------------------LGL--
A0A0M6WXE3      AN-S---MAETFQKILES---TIMKKTICEK------------------------LDM--
A0A348SAK2      AN-S---MAETFQKILES---TIMKKTICEK------------------------LDM--
A0A1G9H5B9      AS-Q---LIKTLLVVVKR---DSVMSKVADR------------------------VSE--
A0A1Y4H8L0      AS-E---MAGTFQKILQS---SALNKILCEE------------------------LEV--
A0A4B9BMD9      TG-D---DPQLITRILNSIANNYLQQNIARQ------------------------AAQ--
A0A0M6WYQ8      AQ-Q---MADVFPYILTS---GVLKDVVAKD------------------------MKL--
A0A348SAK1      AQ-Q---MADVFPYILTS---GVLKDVVAKD------------------------MKL--
A0A252F281      TR-Q---MASAFQGVLES---DLLHETVAAA------------------------MGE--
A0A1Y4QKE6      AD-Q---LSKTFPYILDS---SYFRSILLEE------------------------LGV--
B1C231          AD-Q---LSKTFPYILDS---SYFRSILLDE------------------------LGV--
A0A7V6WIR4      PK-M---TMQTHVSQIQS---EAMMDRVANK------------------------LDF--
A0A1Y3TUL5      AE-D---MVDAVIYVLKS---DRTLKAAIQN------------------------IK---
A0A1Y4JAX2      AE-D---MVDAVIYVLKS---DRTLKAAIQN------------------------IK---
A0A1Y4T590      AE-D---MVDAVIYVLKS---DRTLKAAIQN------------------------IE---
A0A1Y3T163      AD-Q---MSRTFPYILDS---SFFRSALLER------------------------LGT--
A0A1Y3YCA2      AD-Q---MSRTFPYILDS---SFFRSALLER------------------------LGT--
A0A7W8H9H2      AG-Q---LAATFPYILSS---SLLSDAIKED------------------------LGV--
A0A1Y4L6N9      AG-Q---LAKTFPYILSS---NLLNEAIKED------------------------LGI--
A0A173T644      AG-Q---LAKTFPYILGS---SLLTDAIKED------------------------LGV--
A0A1C5TSB8      AG-Q---LAKTFPYILGS---SLLTDAIKED------------------------LGV--
C0CIK6          AG-Q---LAKTFPYILGS---SLLTDAIKED------------------------LGV--
A0A1Y3WEF6      VG-Q---LAKTFPYILSS---SLLTEAIEED------------------------LGV--
A0A417T0L2      AG-Q---LAKTFPYILSS---TLLTEAIEED------------------------LGV--
A0A1H9EPU3      ST-F---LVKDYTYMITS---KPVMKSVIDE------------------------YGL--
A0A354IGV3      TS-D---TASLFSKLLDS---QVLRKHAAEA------------------------IGV--
A0A417JMV2      TS-E---MATKFSEILNS---SILQKKVAKE------------------------MDM--
A0A415VWX5      TS-E---MATKFSEILNS---SILQKKVAKE------------------------MDM--
A0A173UY96      TS-E---MATKFSEILNS---SILQKKVAKE------------------------MDM--
B0P408          TS-E---MATKFSEILNS---SILQKKVAKE------------------------MDM--
D4MV82          TS-E---MATKFSEILNS---SILQKKVAKE------------------------MDM--
A0A173QTL1      TS-E---MATKFSEILNS---SILQKKVAKE------------------------MDM--
A0A174J359      TS-E---MATKFSEILNS---SILQKKVAKE------------------------MDM--
A0A174A3T7      TS-E---MATKFSEILNS---SILQKKVAKE------------------------MDM--
A0A417UUA3      TS-E---MATKFSEILNS---SILQKKVAKE------------------------MDM--
A0A6N2VB70      TS-E---MATKFSEILNS---SILQKKVAKE------------------------MDM--
A0A1C6EUV9      TT-E---MATKFSEILNS---SILQKKVAKE------------------------MNM--
A0A173Y645      TT-E---MATKFSEILNS---SILQKKVAKE------------------------MNM--
A0A374AVY6      TT-E---MATKFSEILNS---SILQKKVAKE------------------------MNM--
R7BXS4          TT-E---MATKFSEILNS---SILQKKVAKE------------------------MNM--
                                                                            

S3FFL2          D---------------------------PGFFEMFGVGREDQGPFAL------------V
A0A328M4V1      ESEPERFPVIGNFMARRYTPPVPGAVAPP----FAGLSSYDWGGSSLDIYQLDVPRSLLD
A0A6A8IF17      N----------YFVRGKFHRQVAYGLTLPVDVTINDLPENESAGFTLEIQP--------D
A0A143WVN6      ------------------------------------------------------------
W6RXP9          T-----------------------------------------------------------
W6S4G8          D-----------------------------------------------------------
A0A3D5R4X5      D-----------------------------------------------------------
A0A1I4C3N6      Q-----------------------------------------------------------
A0A3B9CIM7      G-----------------------------------------------------------
A0A7R7IBN8      S-----------------------------------------------------------
A0A1G9WHW8      N-----------------------------------------------------------
A0A1H5VAA0      N-----------------------------------------------------------
A0A3R6VK11      D-----------------------------------------------------------
A0A3R6QUY7      D-----------------------------------------------------------
A0A373K3P9      D-----------------------------------------------------------
A0A3R6JRU5      D-----------------------------------------------------------
A0A1C5MS04      D-----------------------------------------------------------
A0A3C1J150      D-----------------------------------------------------------
A0A416CXD7      D-----------------------------------------------------------
A0A6N2X662      D-----------------------------------------------------------
R6XBL9          D-----------------------------------------------------------
A0A355W5Z7      D-----------------------------------------------------------
A0A1G6BLB6      ------------------------------------------------------------
A0A1C6G8M0      D-----------------------------------------------------------
A0A416MP73      D-----------------------------------------------------------
A0A3E4LL92      ------------------------------------------------------------
A0A415D1L1      ------------------------------------------------------------
A0A396G6S7      ------------------------------------------------------------
A0A3E5A223      ------------------------------------------------------------
R7D5E6          ------------------------------------------------------------
A0A415HQH5      ------------------------------------------------------------
A0A414W2C6      ------------------------------------------------------------
A5ZNE7          ------------------------------------------------------------
A0A395X821      ------------------------------------------------------------
A0A1C5PY68      ------------------------------------------------------------
A0A174CJF8      ------------------------------------------------------------
A0A564SRR2      ------------------------------------------------------------
A0A174R7V0      ------------------------------------------------------------
A0A373MWV2      ------------------------------------------------------------
A0A417CE88      ------------------------------------------------------------
A0A416Y441      ------------------------------------------------------------
A0A357GPJ7      ------------------------------------------------------------
A0A396PAC1      ------------------------------------------------------------
A0A416EYU4      ------------------------------------------------------------
A0A416SCQ2      ------------------------------------------------------------
A0A416TGN7      ------------------------------------------------------------
A0A417SMF6      ------------------------------------------------------------
A0A0H5SF45      N-----------------------------------------------------------
A0A1M6JRJ5      P-----------------------------------------------------------
A0A1M7Y1S2      P-----------------------------------------------------------
A0A7I8DMN1      P-----------------------------------------------------------
A0A1Y4MW77      ------------------------------------------------------------
A0A6S6R676      E-----------------------------------------------------------
A0A0K8J554      N-----------------------------------------------------------
A0A1I0RG99      N-----------------------------------------------------------
A0A1I5G322      R-----------------------------------------------------------
A0A7C6IYW8      D-----------------------------------------------------------
A0A7C6JZF1      S-----------------------------------------------------------
A0A3N1XSX6      N-----------------------------------------------------------
A0A839K1C1      G-----------------------------------------------------------
R6UHV6          ------------------------------------------------------------
A0A3R9Q621      P-----------------------------------------------------------
A0A069RC75      R-----------------------------------------------------------
A0A174F2W5      ------------------------------------------------------------
A0A174S8E9      ------------------------------------------------------------
A0A416ZL97      ------------------------------------------------------------
A0A174LSK1      ------------------------------------------------------------
A0A373GY92      ------------------------------------------------------------
A0A373NZQ6      ------------------------------------------------------------
A0A417I9B9      ------------------------------------------------------------
A0A417WQF8      ------------------------------------------------------------
A0A8B3CFR3      ------------------------------------------------------------
A0A373RZ83      ------------------------------------------------------------
A0A416U6I1      ------------------------------------------------------------
R7JQZ9          ------------------------------------------------------------
A0A1M5UYN6      R-----------------------------------------------------------
A0A176JBT8      L-----------------------------------------------------------
A0A1I5HIC6      D-----------------------------------------------------------
A0A1Y3TC51      ------------------------------------------------------------
A0A1Y3T1N0      ------------------------------------------------------------
A0A1Y3Y8U8      ------------------------------------------------------------
A0A5B0BQY5      S-----------------------------------------------------------
A6CLL4          N-----------------------------------------------------------
A0A176U8D6      D-----------------------------------------------------------
A0A1Q6KSQ5      N-----------------------------------------------------------
A0A3D3U8B3      N-----------------------------------------------------------
A0A3E5FRL7      ------------------------------------------------------------
A0A1Y4QK93      ------------------------------------------------------------
B1C232          ------------------------------------------------------------
A0A401USI6      G-----------------------------------------------------------
A0A1V4IQ10      D-----------------------------------------------------------
A0A1S8TRD2      D-----------------------------------------------------------
G7M1U2          D-----------------------------------------------------------
A0A2T6KJ75      T-----------------------------------------------------------
A9KN92          N-----------------------------------------------------------
A0A352MUJ1      N-----------------------------------------------------------
R5YI67          D-----------------------------------------------------------
A0A174DL89      D-----------------------------------------------------------
A0A1Y0IQP5      N-----------------------------------------------------------
A0A4R2R7B1      D-----------------------------------------------------------
A0A1M6E8I2      D-----------------------------------------------------------
A0A7C6SMH0      ------------------------------------------------------------
A0A7X7XYM7      ------------------------------------------------------------
A0A3B8KKL6      ------------------------------------------------------------
A0A2K9E6R0      ------------------------------------------------------------
A0A2S8RBI0      ------------------------------------------------------------
A0A7X8MFK9      ------------------------------------------------------------
A0A7X9D1M8      ------------------------------------------------------------
A0A0L6JLG6      ------------------------------------------------------------
A0A7X8PYA7      ------------------------------------------------------------
G8LSN0          ------------------------------------------------------------
A0A1Y4N105      D-----------------------------------------------------------
A0A1Y4QP75      D-----------------------------------------------------------
A0A3D4QRB5      N-----------------------------------------------------------
A0A349DEH5      K-----------------------------------------------------------
A0A3D4T7B4      K-----------------------------------------------------------
A0A350XYC7      K-----------------------------------------------------------
R6DNR8          K-----------------------------------------------------------
A0A355KUM5      K-----------------------------------------------------------
R5YGY6          K-----------------------------------------------------------
A0A7G9WCY6      N-----------------------------------------------------------
A0A0A5GPA9      D-----------------------------------------------------------
A0A271M6M4      K-----------------------------------------------------------
A0A1C6G0U3      E-----------------------------------------------------------
A0A3D4LLB3      D-----------------------------------------------------------
A0A7C7AD93      N-----------------------------------------------------------
A0A2V3W8U6      P-----------------------------------------------------------
A0A6N3BXA1      K-----------------------------------------------------------
A0A351SRI8      D-----------------------------------------------------------
A0A1V5LU59      ------------------------------------------------------------
A0A7X8R9W1      ------------------------------------------------------------
A0A1E3BVC3      ------------------------------------------------------------
A0A4Q0I6S0      ------------------------------------------------------------
A3DF66          ------------------------------------------------------------
W4V1T8          ------------------------------------------------------------
A0A1C6ITD7      D-----------------------------------------------------------
A0A381IX63      E-----------------------------------------------------------
A0A1M6RWV2      N-----------------------------------------------------------
A0A841ZT34      P-----------------------------------------------------------
A0A1G9IUT4      D-----------------------------------------------------------
A0A842GR80      E-----------------------------------------------------------
A0A7X0TNH3      E-----------------------------------------------------------
A0A842D596      E-----------------------------------------------------------
A0A842EQ86      E-----------------------------------------------------------
A0A842A220      E-----------------------------------------------------------
A0A7X0YM80      E-----------------------------------------------------------
A0A842GEL5      E-----------------------------------------------------------
A0A841XVD7      E-----------------------------------------------------------
A0A7X0XME5      E-----------------------------------------------------------
A0A842B6T1      E-----------------------------------------------------------
A0A841X7G0      E-----------------------------------------------------------
A0A841W3M8      E-----------------------------------------------------------
A0A7X0XVI0      E-----------------------------------------------------------
A0A7X0Z1K1      E-----------------------------------------------------------
A0A143ZUX1      S-----------------------------------------------------------
A0A7I8D809      S-----------------------------------------------------------
A0A3R9WAA7      N-----------------------------------------------------------
A0A1G6BLF1      E-----------------------------------------------------------
A0A355G1X5      D-----------------------------------------------------------
A0A1W2CEA6      S-----------------------------------------------------------
A0A355G3J9      K-----------------------------------------------------------
A0A3D2AD87      R-----------------------------------------------------------
A0A143XN92      D-----------------------------------------------------------
R7FFK6          T-----------------------------------------------------------
A0A373MPB9      D-----------------------------------------------------------
A0A373L519      D-----------------------------------------------------------
A0A373W906      D-----------------------------------------------------------
A0A373VCW2      D-----------------------------------------------------------
W0U604          D-----------------------------------------------------------
A0A374B6G0      D-----------------------------------------------------------
A0A373VM36      D-----------------------------------------------------------
A0A1C5P379      D-----------------------------------------------------------
A0A373XXX0      D-----------------------------------------------------------
A0A5R9MJM9      D-----------------------------------------------------------
A0A356CW82      D-----------------------------------------------------------
R6T4X7          D-----------------------------------------------------------
A0A374HTV1      D-----------------------------------------------------------
A0A374GB66      D-----------------------------------------------------------
A0A374ECC6      D-----------------------------------------------------------
A0A374BM61      D-----------------------------------------------------------
A0A373UGZ4      D-----------------------------------------------------------
A0A373SA66      D-----------------------------------------------------------
A0A1C5X6X7      D-----------------------------------------------------------
A0A1C6JIH3      D-----------------------------------------------------------
A0A373PSC3      D-----------------------------------------------------------
A0A1K1WYK8      A-----------------------------------------------------------
A0A1H6IUB1      A-----------------------------------------------------------
A0A1M7L1F9      S-----------------------------------------------------------
A0A1C6B4L6      E-----------------------------------------------------------
A0A1Q6T9P4      E-----------------------------------------------------------
A0A315Y4F9      A-----------------------------------------------------------
A0A354K620      A-----------------------------------------------------------
A0A173ZYY6      E-----------------------------------------------------------
A0A6L8RXB5      E-----------------------------------------------------------
A0A173SMI2      E-----------------------------------------------------------
A0A845KKD0      E-----------------------------------------------------------
A0A6N9JW85      E-----------------------------------------------------------
A0A174ASH7      E-----------------------------------------------------------
A6BH65          E-----------------------------------------------------------
R7G0D7          E-----------------------------------------------------------
R6HZX3          S-----------------------------------------------------------
R5EFZ0          S-----------------------------------------------------------
A0A3E5FSY5      N-----------------------------------------------------------
A0A1V5S3C0      S-----------------------------------------------------------
A0A3C0QME1      S-----------------------------------------------------------
A0A355FYK5      ------------------------------------------------------------
A0A357AQU0      G-----------------------------------------------------------
A0A3C1YJQ7      G-----------------------------------------------------------
A0A3D0JG38      G-----------------------------------------------------------
A0A3C0IHX1      S-----------------------------------------------------------
R5V506          S-----------------------------------------------------------
A0A352TIU5      S-----------------------------------------------------------
R5B467          ------------------------------------------------------------
A0A1Y3TC98      D-----------------------------------------------------------
A0A1W1Z4C3      D-----------------------------------------------------------
A0A239QN83      D-----------------------------------------------------------
A0A8A5CVI3      S-----------------------------------------------------------
A0A8A5D3H1      S-----------------------------------------------------------
A0A1Q6REE0      ------------------------------------------------------------
R5ETF9          ------------------------------------------------------------
A0A0F2P7X6      ------------------------------------------------------------
A0A359B487      ------------------------------------------------------------
R6VAT5          ------------------------------------------------------------
D4LC36          E-----------------------------------------------------------
A0A7X3IXX7      D-----------------------------------------------------------
A0A1Q6S448      ------------------------------------------------------------
A0A351MYR0      ------------------------------------------------------------
R6HPC1          ------------------------------------------------------------
A0A3D4G5Z5      ------------------------------------------------------------
A0A3D5ES03      ------------------------------------------------------------
A0A348P5V4      S-----------------------------------------------------------
A0A356PT74      A-----------------------------------------------------------
A0A3D5LL19      S-----------------------------------------------------------
R5MNF0          L-----------------------------------------------------------
A0A1Q9JSI0      D-----------------------------------------------------------
A0A3D5TNI1      D-----------------------------------------------------------
A0A358LJD0      D-----------------------------------------------------------
R6I3L7          D-----------------------------------------------------------
A0A3D1HXX0      D-----------------------------------------------------------
A0A3D2QJB8      D-----------------------------------------------------------
R7MQJ4          A-----------------------------------------------------------
A0A1V5GLC0      S-----------------------------------------------------------
W7V182          A-----------------------------------------------------------
A0A143XPI5      E-----------------------------------------------------------
A0A0M6WXE3      D-----------------------------------------------------------
A0A348SAK2      D-----------------------------------------------------------
A0A1G9H5B9      T-----------------------------------------------------------
A0A1Y4H8L0      D-----------------------------------------------------------
A0A4B9BMD9      D-----------------------------------------------------------
A0A0M6WYQ8      D-----------------------------------------------------------
A0A348SAK1      D-----------------------------------------------------------
A0A252F281      T-----------------------------------------------------------
A0A1Y4QKE6      N-----------------------------------------------------------
B1C231          N-----------------------------------------------------------
A0A7V6WIR4      H-----------------------------------------------------------
A0A1Y3TUL5      ------------------------------------------------------------
A0A1Y4JAX2      ------------------------------------------------------------
A0A1Y4T590      ------------------------------------------------------------
A0A1Y3T163      D-----------------------------------------------------------
A0A1Y3YCA2      D-----------------------------------------------------------
A0A7W8H9H2      D-----------------------------------------------------------
A0A1Y4L6N9      S-----------------------------------------------------------
A0A173T644      D-----------------------------------------------------------
A0A1C5TSB8      D-----------------------------------------------------------
C0CIK6          D-----------------------------------------------------------
A0A1Y3WEF6      D-----------------------------------------------------------
A0A417T0L2      D-----------------------------------------------------------
A0A1H9EPU3      D-----------------------------------------------------------
A0A354IGV3      E-----------------------------------------------------------
A0A417JMV2      D-----------------------------------------------------------
A0A415VWX5      D-----------------------------------------------------------
A0A173UY96      D-----------------------------------------------------------
B0P408          D-----------------------------------------------------------
D4MV82          D-----------------------------------------------------------
A0A173QTL1      D-----------------------------------------------------------
A0A174J359      D-----------------------------------------------------------
A0A174A3T7      D-----------------------------------------------------------
A0A417UUA3      D-----------------------------------------------------------
A0A6N2VB70      D-----------------------------------------------------------
A0A1C6EUV9      D-----------------------------------------------------------
A0A173Y645      D-----------------------------------------------------------
A0A374AVY6      D-----------------------------------------------------------
R7BXS4          D-----------------------------------------------------------
                                                                            

S3FFL2          NNRYT------------------------------------------------------A
A0A328M4V1      QQLYL-DAGQNGTYTLSDDDDGVLLT------GRVGDKVTAKGITIQVKSMLANPGTRFD
A0A6A8IF17      GTLYLSDFIRNGTDLEEKDVKGSLLDSITTPLGKIIIHTTPNYVKGEAYTLYVGKSSLYN
A0A143WVN6      ------------------------------------------------------------
W6RXP9          ------------------------------------------------------------
W6S4G8          ------------------------------------------------------------
A0A3D5R4X5      ------------------------------------------------------------
A0A1I4C3N6      ------------------------------------------------------------
A0A3B9CIM7      ------------------------------------------------------------
A0A7R7IBN8      ------------------------------------------------------------
A0A1G9WHW8      ------------------------------------------------------------
A0A1H5VAA0      ------------------------------------------------------------
A0A3R6VK11      ------------------------------------------------------------
A0A3R6QUY7      ------------------------------------------------------------
A0A373K3P9      ------------------------------------------------------------
A0A3R6JRU5      ------------------------------------------------------------
A0A1C5MS04      ------------------------------------------------------------
A0A3C1J150      ------------------------------------------------------------
A0A416CXD7      ------------------------------------------------------------
A0A6N2X662      ------------------------------------------------------------
R6XBL9          ------------------------------------------------------------
A0A355W5Z7      ------------------------------------------------------------
A0A1G6BLB6      ------------------------------------------------------------
A0A1C6G8M0      ------------------------------------------------------------
A0A416MP73      ------------------------------------------------------------
A0A3E4LL92      ------------------------------------------------------------
A0A415D1L1      ------------------------------------------------------------
A0A396G6S7      ------------------------------------------------------------
A0A3E5A223      ------------------------------------------------------------
R7D5E6          ------------------------------------------------------------
A0A415HQH5      ------------------------------------------------------------
A0A414W2C6      ------------------------------------------------------------
A5ZNE7          ------------------------------------------------------------
A0A395X821      ------------------------------------------------------------
A0A1C5PY68      ------------------------------------------------------------
A0A174CJF8      ------------------------------------------------------------
A0A564SRR2      ------------------------------------------------------------
A0A174R7V0      ------------------------------------------------------------
A0A373MWV2      ------------------------------------------------------------
A0A417CE88      ------------------------------------------------------------
A0A416Y441      ------------------------------------------------------------
A0A357GPJ7      ------------------------------------------------------------
A0A396PAC1      ------------------------------------------------------------
A0A416EYU4      ------------------------------------------------------------
A0A416SCQ2      ------------------------------------------------------------
A0A416TGN7      ------------------------------------------------------------
A0A417SMF6      ------------------------------------------------------------
A0A0H5SF45      ------------------------------------------------------------
A0A1M6JRJ5      ------------------------------------------------------------
A0A1M7Y1S2      ------------------------------------------------------------
A0A7I8DMN1      ------------------------------------------------------------
A0A1Y4MW77      ------------------------------------------------------------
A0A6S6R676      ------------------------------------------------------------
A0A0K8J554      ------------------------------------------------------------
A0A1I0RG99      ------------------------------------------------------------
A0A1I5G322      ------------------------------------------------------------
A0A7C6IYW8      ------------------------------------------------------------
A0A7C6JZF1      ------------------------------------------------------------
A0A3N1XSX6      ------------------------------------------------------------
A0A839K1C1      ------------------------------------------------------------
R6UHV6          ------------------------------------------------------------
A0A3R9Q621      ------------------------------------------------------------
A0A069RC75      ------------------------------------------------------------
A0A174F2W5      ------------------------------------------------------------
A0A174S8E9      ------------------------------------------------------------
A0A416ZL97      ------------------------------------------------------------
A0A174LSK1      ------------------------------------------------------------
A0A373GY92      ------------------------------------------------------------
A0A373NZQ6      ------------------------------------------------------------
A0A417I9B9      ------------------------------------------------------------
A0A417WQF8      ------------------------------------------------------------
A0A8B3CFR3      ------------------------------------------------------------
A0A373RZ83      ------------------------------------------------------------
A0A416U6I1      ------------------------------------------------------------
R7JQZ9          ------------------------------------------------------------
A0A1M5UYN6      ------------------------------------------------------------
A0A176JBT8      ------------------------------------------------------------
A0A1I5HIC6      ------------------------------------------------------------
A0A1Y3TC51      ------------------------------------------------------------
A0A1Y3T1N0      ------------------------------------------------------------
A0A1Y3Y8U8      ------------------------------------------------------------
A0A5B0BQY5      ------------------------------------------------------------
A6CLL4          ------------------------------------------------------------
A0A176U8D6      ------------------------------------------------------------
A0A1Q6KSQ5      ------------------------------------------------------------
A0A3D3U8B3      ------------------------------------------------------------
A0A3E5FRL7      ------------------------------------------------------------
A0A1Y4QK93      ------------------------------------------------------------
B1C232          ------------------------------------------------------------
A0A401USI6      ------------------------------------------------------------
A0A1V4IQ10      ------------------------------------------------------------
A0A1S8TRD2      ------------------------------------------------------------
G7M1U2          ------------------------------------------------------------
A0A2T6KJ75      ------------------------------------------------------------
A9KN92          ------------------------------------------------------------
A0A352MUJ1      ------------------------------------------------------------
R5YI67          ------------------------------------------------------------
A0A174DL89      ------------------------------------------------------------
A0A1Y0IQP5      ------------------------------------------------------------
A0A4R2R7B1      ------------------------------------------------------------
A0A1M6E8I2      ------------------------------------------------------------
A0A7C6SMH0      ------------------------------------------------------------
A0A7X7XYM7      ------------------------------------------------------------
A0A3B8KKL6      ------------------------------------------------------------
A0A2K9E6R0      ------------------------------------------------------------
A0A2S8RBI0      ------------------------------------------------------------
A0A7X8MFK9      ------------------------------------------------------------
A0A7X9D1M8      ------------------------------------------------------------
A0A0L6JLG6      ------------------------------------------------------------
A0A7X8PYA7      ------------------------------------------------------------
G8LSN0          ------------------------------------------------------------
A0A1Y4N105      ------------------------------------------------------------
A0A1Y4QP75      ------------------------------------------------------------
A0A3D4QRB5      ------------------------------------------------------------
A0A349DEH5      ------------------------------------------------------------
A0A3D4T7B4      ------------------------------------------------------------
A0A350XYC7      ------------------------------------------------------------
R6DNR8          ------------------------------------------------------------
A0A355KUM5      ------------------------------------------------------------
R5YGY6          ------------------------------------------------------------
A0A7G9WCY6      ------------------------------------------------------------
A0A0A5GPA9      ------------------------------------------------------------
A0A271M6M4      ------------------------------------------------------------
A0A1C6G0U3      ------------------------------------------------------------
A0A3D4LLB3      ------------------------------------------------------------
A0A7C7AD93      ------------------------------------------------------------
A0A2V3W8U6      ------------------------------------------------------------
A0A6N3BXA1      ------------------------------------------------------------
A0A351SRI8      ------------------------------------------------------------
A0A1V5LU59      ------------------------------------------------------------
A0A7X8R9W1      ------------------------------------------------------------
A0A1E3BVC3      ------------------------------------------------------------
A0A4Q0I6S0      ------------------------------------------------------------
A3DF66          ------------------------------------------------------------
W4V1T8          ------------------------------------------------------------
A0A1C6ITD7      ------------------------------------------------------------
A0A381IX63      ------------------------------------------------------------
A0A1M6RWV2      ------------------------------------------------------------
A0A841ZT34      ------------------------------------------------------------
A0A1G9IUT4      ------------------------------------------------------------
A0A842GR80      ------------------------------------------------------------
A0A7X0TNH3      ------------------------------------------------------------
A0A842D596      ------------------------------------------------------------
A0A842EQ86      ------------------------------------------------------------
A0A842A220      ------------------------------------------------------------
A0A7X0YM80      ------------------------------------------------------------
A0A842GEL5      ------------------------------------------------------------
A0A841XVD7      ------------------------------------------------------------
A0A7X0XME5      ------------------------------------------------------------
A0A842B6T1      ------------------------------------------------------------
A0A841X7G0      ------------------------------------------------------------
A0A841W3M8      ------------------------------------------------------------
A0A7X0XVI0      ------------------------------------------------------------
A0A7X0Z1K1      ------------------------------------------------------------
A0A143ZUX1      ------------------------------------------------------------
A0A7I8D809      ------------------------------------------------------------
A0A3R9WAA7      ------------------------------------------------------------
A0A1G6BLF1      ------------------------------------------------------------
A0A355G1X5      ------------------------------------------------------------
A0A1W2CEA6      ------------------------------------------------------------
A0A355G3J9      ------------------------------------------------------------
A0A3D2AD87      ------------------------------------------------------------
A0A143XN92      ------------------------------------------------------------
R7FFK6          ------------------------------------------------------------
A0A373MPB9      ------------------------------------------------------------
A0A373L519      ------------------------------------------------------------
A0A373W906      ------------------------------------------------------------
A0A373VCW2      ------------------------------------------------------------
W0U604          ------------------------------------------------------------
A0A374B6G0      ------------------------------------------------------------
A0A373VM36      ------------------------------------------------------------
A0A1C5P379      ------------------------------------------------------------
A0A373XXX0      ------------------------------------------------------------
A0A5R9MJM9      ------------------------------------------------------------
A0A356CW82      ------------------------------------------------------------
R6T4X7          ------------------------------------------------------------
A0A374HTV1      ------------------------------------------------------------
A0A374GB66      ------------------------------------------------------------
A0A374ECC6      ------------------------------------------------------------
A0A374BM61      ------------------------------------------------------------
A0A373UGZ4      ------------------------------------------------------------
A0A373SA66      ------------------------------------------------------------
A0A1C5X6X7      ------------------------------------------------------------
A0A1C6JIH3      ------------------------------------------------------------
A0A373PSC3      ------------------------------------------------------------
A0A1K1WYK8      ------------------------------------------------------------
A0A1H6IUB1      ------------------------------------------------------------
A0A1M7L1F9      ------------------------------------------------------------
A0A1C6B4L6      ------------------------------------------------------------
A0A1Q6T9P4      ------------------------------------------------------------
A0A315Y4F9      ------------------------------------------------------------
A0A354K620      ------------------------------------------------------------
A0A173ZYY6      ------------------------------------------------------------
A0A6L8RXB5      ------------------------------------------------------------
A0A173SMI2      ------------------------------------------------------------
A0A845KKD0      ------------------------------------------------------------
A0A6N9JW85      ------------------------------------------------------------
A0A174ASH7      ------------------------------------------------------------
A6BH65          ------------------------------------------------------------
R7G0D7          ------------------------------------------------------------
R6HZX3          ------------------------------------------------------------
R5EFZ0          ------------------------------------------------------------
A0A3E5FSY5      ------------------------------------------------------------
A0A1V5S3C0      ------------------------------------------------------------
A0A3C0QME1      ------------------------------------------------------------
A0A355FYK5      ------------------------------------------------------------
A0A357AQU0      ------------------------------------------------------------
A0A3C1YJQ7      ------------------------------------------------------------
A0A3D0JG38      ------------------------------------------------------------
A0A3C0IHX1      ------------------------------------------------------------
R5V506          ------------------------------------------------------------
A0A352TIU5      ------------------------------------------------------------
R5B467          ------------------------------------------------------------
A0A1Y3TC98      ------------------------------------------------------------
A0A1W1Z4C3      ------------------------------------------------------------
A0A239QN83      ------------------------------------------------------------
A0A8A5CVI3      ------------------------------------------------------------
A0A8A5D3H1      ------------------------------------------------------------
A0A1Q6REE0      ------------------------------------------------------------
R5ETF9          ------------------------------------------------------------
A0A0F2P7X6      ------------------------------------------------------------
A0A359B487      ------------------------------------------------------------
R6VAT5          ------------------------------------------------------------
D4LC36          ------------------------------------------------------------
A0A7X3IXX7      ------------------------------------------------------------
A0A1Q6S448      ------------------------------------------------------------
A0A351MYR0      ------------------------------------------------------------
R6HPC1          ------------------------------------------------------------
A0A3D4G5Z5      ------------------------------------------------------------
A0A3D5ES03      ------------------------------------------------------------
A0A348P5V4      ------------------------------------------------------------
A0A356PT74      ------------------------------------------------------------
A0A3D5LL19      ------------------------------------------------------------
R5MNF0          ------------------------------------------------------------
A0A1Q9JSI0      ------------------------------------------------------------
A0A3D5TNI1      ------------------------------------------------------------
A0A358LJD0      ------------------------------------------------------------
R6I3L7          ------------------------------------------------------------
A0A3D1HXX0      ------------------------------------------------------------
A0A3D2QJB8      ------------------------------------------------------------
R7MQJ4          ------------------------------------------------------------
A0A1V5GLC0      ------------------------------------------------------------
W7V182          ------------------------------------------------------------
A0A143XPI5      ------------------------------------------------------------
A0A0M6WXE3      ------------------------------------------------------------
A0A348SAK2      ------------------------------------------------------------
A0A1G9H5B9      ------------------------------------------------------------
A0A1Y4H8L0      ------------------------------------------------------------
A0A4B9BMD9      ------------------------------------------------------------
A0A0M6WYQ8      ------------------------------------------------------------
A0A348SAK1      ------------------------------------------------------------
A0A252F281      ------------------------------------------------------------
A0A1Y4QKE6      ------------------------------------------------------------
B1C231          ------------------------------------------------------------
A0A7V6WIR4      ------------------------------------------------------------
A0A1Y3TUL5      ------------------------------------------------------------
A0A1Y4JAX2      ------------------------------------------------------------
A0A1Y4T590      ------------------------------------------------------------
A0A1Y3T163      ------------------------------------------------------------
A0A1Y3YCA2      ------------------------------------------------------------
A0A7W8H9H2      ------------------------------------------------------------
A0A1Y4L6N9      ------------------------------------------------------------
A0A173T644      ------------------------------------------------------------
A0A1C5TSB8      ------------------------------------------------------------
C0CIK6          ------------------------------------------------------------
A0A1Y3WEF6      ------------------------------------------------------------
A0A417T0L2      ------------------------------------------------------------
A0A1H9EPU3      ------------------------------------------------------------
A0A354IGV3      ------------------------------------------------------------
A0A417JMV2      ------------------------------------------------------------
A0A415VWX5      ------------------------------------------------------------
A0A173UY96      ------------------------------------------------------------
B0P408          ------------------------------------------------------------
D4MV82          ------------------------------------------------------------
A0A173QTL1      ------------------------------------------------------------
A0A174J359      ------------------------------------------------------------
A0A174A3T7      ------------------------------------------------------------
A0A417UUA3      ------------------------------------------------------------
A0A6N2VB70      ------------------------------------------------------------
A0A1C6EUV9      ------------------------------------------------------------
A0A173Y645      ------------------------------------------------------------
A0A374AVY6      ------------------------------------------------------------
R7BXS4          ------------------------------------------------------------
                                                                            

S3FFL2          AGRSERLRIAGDILRSHIEISP----------------ARLSRLVDLYFTSPDAS---FS
A0A328M4V1      VTRHGRLALITSLQQALVATEQ----------------GKDSGIIELDYRNADPV---LA
A0A6A8IF17      A--------VNSCSSNLSVSLN----------------SEKASVIDLSFKDNSTQ---RA
A0A143WVN6      -----------SNIQGTINSSI----------------ISQTNLITLTVTSDTPA---HA
W6RXP9          --------MTAEEILDSLTVNP----------------LTDTQILEIKLQGKKPK---EI
W6S4G8          --------MTMEEVMKDITVEP----------------ITDTQILQIKLTGKNKD---DL
A0A3D5R4X5      --------ISYEGLRNITEVSL----------------VRDTEFINIKVQNPNPE---QA
A0A1I4C3N6      --------YSVLALQRRISARQ----------------ITNTSMFVIYVVDPNPM---NA
A0A3B9CIM7      --------YSTDYLKSQISASA----------------IENTAAFVVRVVDQNPV---NA
A0A7R7IBN8      --------YSVDYLRSNISAVS----------------IEDTAVFSVNVYNPNPE---DA
A0A1G9WHW8      --------YSTSTFKNIISTSA----------------VEDTAVFYVYVVDSNPL---NA
A0A1H5VAA0      --------YSTSTFKNIISTSA----------------VEDTAVFYVYVVDSNPL---NA
A0A3R6VK11      --------YGTEALSGRIGTSV----------------VENTAVFYVYTYDSDPY---RA
A0A3R6QUY7      --------YGTEALSGRIGTSV----------------VENTAVFYVYTYDSDPY---RA
A0A373K3P9      --------YGTEALSGRIGTSV----------------VENTAVFYVYTYDSDPY---RA
A0A3R6JRU5      --------YGTEALSGRIGTSV----------------VENTAVFYVYTYDSDPY---RA
A0A1C5MS04      --------YGTEALSGRIGTSV----------------VENTAVFYVYTYDSDPY---RA
A0A3C1J150      --------YGTEALSGRIGTSV----------------VENTAVFYVYTYDSDPY---RA
A0A416CXD7      --------YGTEALSGRIGTSV----------------VENTAVFYVYTYDSDPY---RA
A0A6N2X662      --------YGTEALSGRIGTSV----------------VENTAVFYVYTYDSDPY---RA
R6XBL9          --------YGTEALSGRIGTSV----------------VENTAVFYVYTYDSDPY---RA
A0A355W5Z7      --------YGTEALSGRIGTSV----------------VENTAVFYVYTYDSDPY---RA
A0A1G6BLB6      -----------DSIPGTVTTSL----------------VENTNLMTLSVTESSPK---MT
A0A1C6G8M0      --------IAYKSLYNAVSVDN----------------PEATRIIRIRVVSGNKE---EA
A0A416MP73      --------LTYKQLYNIVSVEN----------------PDSTRILKIYVTAGTVR---EA
A0A3E4LL92      -----------SRVQGNLSASV----------------VTDTNIIRMSASGTNAE---SA
A0A415D1L1      -----------SRVKGNLSASV----------------VADTNIIKMSASGTNAE---SA
A0A396G6S7      -----------NSLEVETSVDL----------------VPETNLITLSVKAGTAA---ES
A0A3E5A223      -----------NSLEVETSVDL----------------VPETNLITLSVKAGTAA---ES
R7D5E6          -----------NSLEVETSVDL----------------VPETNLITLSVKAGTAA---ES
A0A415HQH5      -----------NSLEVETSVDL----------------VSETNLITLSVKAGTAA---ES
A0A414W2C6      -----------NSLEVETSVDL----------------VPETNLITFSVKAGTAA---ES
A5ZNE7          -----------NSLEVETSVDL----------------VPETNLITLSVKAGTAA---ES
A0A395X821      -----------NNLNVETSVDL----------------VPETNLITLSVKAGTAA---ES
A0A1C5PY68      -----------NNLNVKTSVDL----------------VPETNLITLSVKAGTAA---ES
A0A174CJF8      -----------NNLNVKTSVDL----------------VPETNLITFSVKAGTAA---ES
A0A564SRR2      -----------NNLNVKTSVDL----------------VPETNLITFSVKAGTAA---ES
A0A174R7V0      -----------NNLNVKTSVDL----------------VPETNLITFSVKAETAA---ES
A0A373MWV2      -----------SSFPADMSASI----------------VPESNLMELSVTADSPE---TA
A0A417CE88      -----------SSFPADMSASI----------------VPESNLMELSVTADSPE---TA
A0A416Y441      -----------SSFPADMSASI----------------VPESNLMELSVTADSPE---TA
A0A357GPJ7      -----------SSFPADMSASI----------------VPESNLMELSVTADSPE---TA
A0A396PAC1      -----------SSFPADMSASI----------------VPESNLMELSVTADSPE---TA
A0A416EYU4      -----------SSFPADMSASI----------------VPESNLMELSVTADSPE---TA
A0A416SCQ2      -----------SSFPADMSASI----------------VPESNLMELSVTADSPE---TA
A0A416TGN7      -----------SSFPADMSASI----------------VPESNLMELSVTADSPE---TA
A0A417SMF6      -----------SSFPADMSASI----------------VPESNLMELSVTADSPE---TA
A0A0H5SF45      --------YSVQQLKAMTQISS----------------VNDTEIFQITLSSNSAD---DA
A0A1M6JRJ5      --------YSMPDLKKMTEIKT----------------VQNTEIFSITLTSKNPD---DS
A0A1M7Y1S2      --------YSVTDLRNMTEIKA----------------IQNTEIFSITLTSNNPN---DS
A0A7I8DMN1      --------YSMSELRSMTEIKT----------------VRNTEIFSITVNTKSPE---DS
A0A1Y4MW77      -----------EAINGSISASI----------------IPNSNMITMTVISSDPD---DA
A0A6S6R676      --------YTPEEIRNMTNIYA----------------VNNTEIFQVSVTSHSPD---DS
A0A0K8J554      --------YSESQLKNMTNIQS----------------VGDTEIFKISVNSHSAS---DS
A0A1I0RG99      --------YTPMQLKAMTHIKA----------------INNTEIFEISVTTTNPN---DA
A0A1I5G322      --------LSREQLKNMTNIES----------------INNTEIFEISVSSMNPN---HS
A0A7C6IYW8      --------YSINQLRNMTSVKS----------------VNNTEIFQISVTSPSAK---DS
A0A7C6JZF1      --------YTADELKRMTTIQS----------------VDNTEIFEISVTSNDPM---DS
A0A3N1XSX6      --------YSINELKHMTTIKT----------------INNTEIFQISVTSSSAR---DS
A0A839K1C1      --------YSIGQLKNMTTVKS----------------INNTEIFQISVTSFSAD---DS
R6UHV6          -----------TSFPGNLSCSV----------------IEETNILSFTVTSDSPI---KS
A0A3R9Q621      --------YTVDMLKDCIRITV----------------VSNTEIFQVSVTTNSAS---DS
A0A069RC75      --------VSPQKLLKKVKIDQ----------------VDETEVLKISASSTDPA---LA
A0A174F2W5      -----------SSFPADMSASI----------------VPESNLMELSVTADSPE---TA
A0A174S8E9      -----------SSFPADMSASI----------------VPESNLMELSVTADSPE---TA
A0A416ZL97      -----------SSFPAKMNASI----------------VPESNLMELSVTADSPE---MA
A0A174LSK1      -----------SSFPAKMNASI----------------VPESNLMELSVTADSPE---MA
A0A373GY92      -----------SSFPAKMNASI----------------VPESNLMELSVTADSPE---MA
A0A373NZQ6      -----------SSFPAKMNASI----------------VPESNLMELSVTADSPE---MA
A0A417I9B9      -----------SSFPAKMNASI----------------VPESNLMELSVTADSPE---MA
A0A417WQF8      -----------SSFPAKMNASI----------------VPESNLMELSVTADSPE---MA
A0A8B3CFR3      -----------SSFPAKMNASI----------------VPESNLMELSVTADSPE---MA
A0A373RZ83      -----------SSFPAKMNDSI----------------VPESNLMELSVTADSPE---MA
A0A416U6I1      -----------SSFPAKMNDSI----------------VPESNLMELSVTADSPE---MA
R7JQZ9          -----------SSFPAKMNDSI----------------VPESNLMELSVTADSPE---MA
A0A1M5UYN6      --------YSSGQLMGMLSVGA----------------QSNTQIMNITVQAGNEE---EA
A0A176JBT8      --------LTEDEFLDNVKAES----------------NGNSQIISIIVENKNPD---DA
A0A1I5HIC6      --------MTHEELVSNITVKV----------------PENTRILEISVQNPNPE---TA
A0A1Y3TC51      -----------EEIAGKISCTP----------------IQETNLLVLSVTCRHPR---DA
A0A1Y3T1N0      -----------EEITGDITCTP----------------ITDTNLLTLSVSSPDPR---QA
A0A1Y3Y8U8      -----------EEIAGDITCTP----------------ITDTNLLTLSVSSPDPR---QA
A0A5B0BQY5      --------YAKPEVAKKVKLET----------------GNGSQIITITARDSTPE---KA
A6CLL4          --------DNVQCLNEQISVTS----------------SSDSQIISITATALNPN---QA
A0A176U8D6      --------IEYKDLYNAVSIEN----------------PDGTRIIKINVVSQDQK---EA
A0A1Q6KSQ5      --------IAYKSLYNAVSVDN----------------PEATRIIRIRVVSGNKE---EA
A0A3D3U8B3      --------IAYKSLYNAVSVDN----------------PEATRIIRIRVVSGNKE---EA
A0A3E5FRL7      -----------KTNQGTITCNQ----------------IQETNLLVLNVTSKDPQ---NA
A0A1Y4QK93      -----------KTNQGTITCNQ----------------IQETNLLVLNVTSKDPQ---NA
B1C232          -----------KTNQGTITCNQ----------------IQETNLLVLNVTSKDPQ---NA
A0A401USI6      --------IVVKEFMLDLSITP----------------KIGTQIIEISYKSKNPE---IA
A0A1V4IQ10      --------SQSSAVLSSLTTVP----------------MANTQILEIKYKNLNKS---LA
A0A1S8TRD2      --------LQSSAVLNTLTTIP----------------TANTQILEIRYINLNKS---LA
G7M1U2          --------LQSSAVLNALTTIP----------------TANTQILEIRYINLNKS---LA
A0A2T6KJ75      --------YKKGEISQKVEIQS----------------SINSQILTILAEEKTPE---KA
A9KN92          --------MTHDELVSNINVKV----------------PENTRILEITVQNQDPL---LA
A0A352MUJ1      --------RSVGQLRKNVTIES----------------VKNTEILKISVLDSNKD---DA
R5YI67          --------KTTAQLRKNVTIES----------------VKNTEIIKISVQDSNKD---EA
A0A174DL89      --------LNLESLESMIKIKT----------------TTESEFINITVEGKVPE---VT
A0A1Y0IQP5      --------STEQELLEKIRVTT----------------SGESLLTSVTVTDHDPK---QA
A0A4R2R7B1      --------LTEQELLENVRVRS----------------SSESLLTAVTVTDHDPK---QA
A0A1M6E8I2      --------MTYNELLEDITSSP----------------VGSTEILKISVKNTDPA---MA
A0A7C6SMH0      ---------SPGKLLSNVDVRT----------------VKDSRIFKISYEDSNPA---LA
A0A7X7XYM7      ---------SPGKLLSNVDVRT----------------VKDSRIFKISYEDSNPT---LA
A0A3B8KKL6      ---------SPSKLLSNVDVRT----------------VKDSRIFKISYEDSNPT---LA
A0A2K9E6R0      ---------SPSKLLSNVDVRT----------------VKDSRIFKISYEDSNPT---LA
A0A2S8RBI0      ---------SPSKLLSNVDVRT----------------VKDSRIFKISYEDSNPT---LA
A0A7X8MFK9      ---------DVKVFQGKVGVTT----------------VKDSRIFSISYEDTDPE---LA
A0A7X9D1M8      ---------EIREFRGKVGVTT----------------VKDSRIFSISYENTDPI---LA
A0A0L6JLG6      ---------EAKAFQNNVDVMT----------------IKDSRIFKISYEDYDPK---LA
A0A7X8PYA7      ---------NAGRFKRNVNVQT----------------VKDSRIFSISYEDTDPQ---LA
G8LSN0          ---------SAAKFKRSVNVQT----------------VKDSRIFSISYEDTDPK---LA
A0A1Y4N105      ------------NLDYQISASV----------------ISETNLMTLTVTSNTPK---MT
A0A1Y4QP75      ------------NLDYQISASV----------------ISETNLMTLTVTSNTPK---MT
A0A3D4QRB5      --------ISVNELKSKINVSA----------------EGNTEILRITVEDLIPE---QA
A0A349DEH5      --------VDFGTVDRSISVSV----------------VSSTNIIVMSVTTGNPQ---TS
A0A3D4T7B4      --------VDFGTVDRSISVSV----------------VSSTNIIVMSVTTGNPQ---TS
A0A350XYC7      --------VTYGLVDRSISVRV----------------VTSTNVIVMSVTTDNPK---TS
R6DNR8          --------LNYSTVDKSISVSV----------------VSSTNVIVMSVTTGDPK---IA
A0A355KUM5      --------VNFGTVDKSISVNV----------------VSSTNVIVMSVTTGDPK---IS
R5YGY6          --------VNFGTVDKSISVNV----------------VSSTNVIVMSVTTGDPK---IS
A0A7G9WCY6      --------MSHGEFAGKVQVNS----------------VRDTEVIEIRVQDTDPQ---RA
A0A0A5GPA9      --------LEMEELVQRFTIGT----------------NAESQIITVQAVGPSKE---AA
A0A271M6M4      --------EKPEQLAKKIEVIS----------------NSDSQVITLKVEASSQK---QA
A0A1C6G0U3      --------NSYEEVYSSINVQS----------------IEDTQIIKISVQNKSPE---IA
A0A3D4LLB3      -----------KLDDKSITVSP----------------VKDTQIIKVAVQNTDPV---LA
A0A7C7AD93      --------MSVKEFKKHIQAEH----------------TSGTQFMEIKVRWDSPD---MA
A0A2V3W8U6      --------FTNNELQKKLRVET----------------NDNSQIISLYVKENDLD---TA
A0A6N3BXA1      --------MKAKKLAKYIDVEN----------------IQDTQIIKISVRNGNPK---TA
A0A351SRI8      --------ISYEELKKNVKVGN----------------VEDTEIILIYVYNEDAR---LS
A0A1V5LU59      ---------DIKKFKSNVNVQT----------------VKDTRIFSISYEDTDPE---LA
A0A7X8R9W1      ---------PVNVFQGNVSVKT----------------VKDSRIFSISYADTDKE---RA
A0A1E3BVC3      ---------GISEFQNNVNVKT----------------VKDSRLFSISYEDTDPK---RA
A0A4Q0I6S0      ---------GISEFQNNVNVKT----------------VKDSRLFSISYEDTDPK---RA
A3DF66          ---------GIQEFQKNVNVKT----------------VKDSRLFSISYEDTDPK---RA
W4V1T8          ---------GIREFQNNVTVKT----------------VKDSRLFSISYEDTDPK---RA
A0A1C6ITD7      --------LNLADLESMIKIRT----------------TTESEFISISIEGKIAK---DT
A0A381IX63      --------EDYHAISNSIDI-N----------------SVNGPVMNITVKNADPK---VA
A0A1M6RWV2      --------MSYGEFSNKVRVNS----------------VRDTEVIEIKVQDTNPQ---LA
A0A841ZT34      ---------DAMDISKQINISN----------------DSNSRALEISAKDNDAA---RA
A0A1G9IUT4      --------TDVKKLSNDIRVTT----------------LTDTQIINVSVREDNPK---LA
A0A842GR80      ---------NRQNLQDQIKVLN----------------DNSSQALQITAEDSDNK---EA
A0A7X0TNH3      ---------NRQNLQDQIKVLN----------------DNSSQALQITVEDSDNK---EA
A0A842D596      ---------NRQNLQDQIKVVN----------------DNSSQALQITAEDSDNK---EA
A0A842EQ86      ---------NRQNLQDQIKVLN----------------DNSSQALQITVEDSDNK---EA
A0A842A220      ---------NRQNLQDQIKVLN----------------DNSSQALQITTEDSDNK---EA
A0A7X0YM80      ---------NRQNLQDQIKVLN----------------DNSSQALQITAEDSDNK---EA
A0A842GEL5      ---------NRQNLQDQIKVLN----------------DNSSQALQITAEDSDNK---EA
A0A841XVD7      ---------NRQNLQDQIKVLN----------------DNSSQALQITAEDSDNK---EA
A0A7X0XME5      ---------NRQNLQDQIKVLN----------------DNSSQALQITAEDSDNK---EA
A0A842B6T1      ---------NRQNLQDQIKVLN----------------DNSSQALQITAEDSDNK---EA
A0A841X7G0      ---------NRQNLQDQIKVLN----------------DNSSQALQITAEDSDNK---EA
A0A841W3M8      ---------NRQNLQDQIKVLN----------------DNSSQALQITAEDSDNK---EA
A0A7X0XVI0      ---------NRQNLQDQIKVLN----------------DNSSQALQITAEDSDNK---EA
A0A7X0Z1K1      ---------NRQNLQDQIKVLN----------------DNSSQALQITAEDSDNK---EA
A0A143ZUX1      --------Q----VKKMVSISQ-----------------ATGSVLELKVTASDPE---TA
A0A7I8D809      --------Q----VKKMVSISQ-----------------ATGSVLELKVTASDPE---TA
A0A3R9WAA7      --------E----LSEQITADN----------------VKDTNLFTIRVSSDNPT---RA
A0A1G6BLF1      --------S----VPGTIAVAV----------------VEETNMITIKATADSAQ---MA
A0A355G1X5      --------Q----LRHYVSVNT----------------QADTNIIIVSVTTESPD---KS
A0A1W2CEA6      --------Q----LEKMVSVSN----------------PSGSHLLYIYVKSSVPE---EA
A0A355G3J9      --------Q----ILAMLSGSA----------------INETEAFYISAEHTNRQ---LA
A0A3D2AD87      --------L----LKNKISVSRSE--------------EERSMLIYISATSTDKN---EA
A0A143XN92      --------S----FDAEAEAEI----------------VPETNLMVLRVTADTSK---KA
R7FFK6          --------S----LKACFSMTA----------------VDETEVLKITTTTQNAE---LS
A0A373MPB9      --------D----LRNAYSMIA----------------VNQTEVLQITATTTNAK---LS
A0A373L519      --------G----LRNAYSMTA----------------VNQTEVLQITATTTNAK---LS
A0A373W906      --------G----LRNAYSMTA----------------VNQTEVLQITATTTNAK---LS
A0A373VCW2      --------D----LRNAYSMIA----------------VNQTEVLQITATTTNAK---LS
W0U604          --------D----LRNAYSMIA----------------VNQTEVLQITATTTNAK---LS
A0A374B6G0      --------G----LRNAYSMTA----------------VNQTEVLQITATTTNAK---LS
A0A373VM36      --------G----LRNAYSMTA----------------VNQTEVLQITATTTNAK---LS
A0A1C5P379      --------G----LRNAYSMTA----------------VNQTEVLQITATTTNAK---LS
A0A373XXX0      --------G----LRNAYSMTA----------------VNQTEVLQITATTTNAK---LS
A0A5R9MJM9      --------G----LRNAYSMTA----------------VNQTEVLQITATTTNAK---LS
A0A356CW82      --------G----LRNAYSMTA----------------VNQTEVLQITATTTNAK---LS
R6T4X7          --------G----LRNAYSMTA----------------VNQTEVLQITATTTNAK---LS
A0A374HTV1      --------G----LRNAYSMTA----------------VNQTEVLQITATTTNAK---LS
A0A374GB66      --------G----LRNAYSMTA----------------VNQTEVLQITATTTNAK---LS
A0A374ECC6      --------G----LRNAYSMTA----------------VNQTEVLQITATTTNAK---LS
A0A374BM61      --------G----LRNAYSMTA----------------VNQTEVLQITATTTNAK---LS
A0A373UGZ4      --------G----LRNAYSMTA----------------VNQTEVLQITATTTNAK---LS
A0A373SA66      --------G----LRNAYSMTA----------------VNQTEVLQITATTTNAK---LS
A0A1C5X6X7      --------G----LRNAYSMTA----------------VNQTEVLQITATTTNAK---LS
A0A1C6JIH3      --------G----LRNAYSMTA----------------VNQTEVLQITATTTNAK---LS
A0A373PSC3      --------G----LRNAYSMTA----------------VNQTEVLQITATTTNAK---LS
A0A1K1WYK8      --------S----IRSCLTISS----------------VTDTSAVTITATTVNPN---LA
A0A1H6IUB1      --------S----IRNCLSISS----------------VTDTSAVKIVSTTKNAE---VA
A0A1M7L1F9      --------A----IRDCYSISS----------------VTDTSAVKIVATTKNAE---VA
A0A1C6B4L6      --------S----LRKCIELST----------------VTDTSAVKVIATAKNPE---IA
A0A1Q6T9P4      --------S----LRKCIELST----------------VTDTSAVKVIATAKNPE---IA
A0A315Y4F9      --------S----IRSCLAISS----------------VTDTSAVKVNATAKNAE---VA
A0A354K620      --------S----IRSCLAISS----------------VTDTSAVKVTATAENAE---VA
A0A173ZYY6      --------E----LDADIHAKV----------------LEGTNMLVLSVTADTPK---DS
A0A6L8RXB5      --------E----LDADIHAKV----------------LEGTNMLVLSVTADTPK---DS
A0A173SMI2      --------E----LDADIHAKV----------------LEGTNMLVLSVTADTPK---DS
A0A845KKD0      --------E----LDADIHAKV----------------LEGTNMLVLSVTADTPK---DS
A0A6N9JW85      --------E----LDADIHAKV----------------LEGTNMLVLSVTADTPK---DS
A0A174ASH7      --------E----LDADIHAKV----------------LEGTNMLVLSVTADTPK---ES
A6BH65          --------E----LDADIHAKV----------------LEGTNMLVLSVTADTPK---ES
R7G0D7          --------E----LDADIHAKV----------------LEGTNMLVLSVTADTPK---ES
R6HZX3          --------W----INGTVTASS----------------IGETNIFTLTVTSTNPQ---DA
R5EFZ0          --------S----FDGTIDTAV----------------VPNTNLITMTVTDSDPR---MA
A0A3E5FSY5      --------S----LNGTLSAST----------------VSESNIVTMGVESNSPQ---DA
A0A1V5S3C0      --------Q----LKSCVSANV----------------VTDTTMISVSVSTHDPD---MS
A0A3C0QME1      --------S----LRNKITMSS----------------VDETEVMKITANTTNPE---IS
A0A355FYK5      --------E----LRNAVVLGE----------------TGVSGIFSLTVTNIYPE---FC
A0A357AQU0      --------S----ILNYVSMGS----------------VDNTEVLKVSATTPDAK---LS
A0A3C1YJQ7      --------S----ILNYVSMGS----------------VDNTEVLKVSATTPDAK---LS
A0A3D0JG38      --------S----ILNYVSMGA----------------VDNTEVLKVSATTPNAK---LS
A0A3C0IHX1      --------E----LKDAISMSA----------------DGDTEVLKISAQTKDPH---VS
R5V506          --------E----LKDAISMSA----------------DGDTEVLKISAQTKDPH---VS
A0A352TIU5      --------E----LKDAISMSA----------------DGDTEVLKISAQTKDPH---VS
R5B467          -------------TLPAISATS----------------EEGTNLCTLSVTGSDAQ---QC
A0A1Y3TC98      --------T----LNGEISSET----------------ITDSNVVTMRVESPDPE---DA
A0A1W1Z4C3      --------F----IRNVISMNS----------------VHETPMVRVSCTTPYPE---LS
A0A239QN83      --------D----IRKVISMNS----------------IHETPMVQVSCTTTDPK---LS
A0A8A5CVI3      --------F----IRYAISMKS----------------VHETPMVQVSCTTIDPN---LS
A0A8A5D3H1      --------F----IRNVIKMNS----------------VHETPMVQVSCTTTNAQ---LS
A0A1Q6REE0      ---------------PAMSVSA----------------TAHSSILTLKVRDTDPQ---RA
R5ETF9          ---------------PDMSVSA----------------TAHSSILTLKVRDTDPQ---RA
A0A0F2P7X6      --------A----ISPYVSVAP----------------VRDTEVLRIFVSNPDPL---LA
A0A359B487      --------A----ISPYVSVAP----------------VRDTEVLRIFVSNPDPL---LA
R6VAT5          ---------------GTLTATA----------------VEDTNLFTITVTSSNYE---TA
D4LC36          --------E----LSGNFTIKNGKITNESLKSAFTMAAVNNTEVLKITATTKNAA---LS
A0A7X3IXX7      --------E----VAGHLTASV----------------VPNSALIKVDATADDPE---KS
A0A1Q6S448      ---------------GTVSAQQ----------------LGETNLIRVTVTADTPR---QA
A0A351MYR0      ---------------GTVTAQQ----------------LGETNLIRVTVTADTPR---QA
R6HPC1          ---------------GTVSAQQ----------------LGETNLIRVTVTADTPR---QA
A0A3D4G5Z5      ---------------GTVSAQQ----------------LGETNLIRVTVTADTPR---QA
A0A3D5ES03      ---------------GTVSAQQ----------------LGETNLIRVTVTADTPR---QA
A0A348P5V4      --------Q----IKRYVSVQS----------------IEETQIIYLTVTTTNPD---VS
A0A356PT74      --------D----IKSWVSVEA----------------VEDTAIINLTVTTPNAD---VS
A0A3D5LL19      --------D----IKSWVSVEA----------------VEDTAIINLTVTTPNAD---VS
R5MNF0          --------D----IKNWVSVEA----------------VEDTAIINLTVTTPNAD---VS
A0A1Q9JSI0      --------Y----FPGTASSEV----------------INETNLLVLKVQADSPE---LA
A0A3D5TNI1      --------E----VEEMIAASR----------------KTDSSIIDMTVTAGSPE---EA
A0A358LJD0      --------Q----VSKMIAASR----------------KTDSSIIDMTVTASSPE---EA
R6I3L7          --------Q----VAKMIAVSR----------------KTDSSIIDMTVTASSPE---EA
A0A3D1HXX0      --------Q----VAKMIAASR----------------KTDSSIIDMTVTASSPE---EA
A0A3D2QJB8      --------Q----VAKMIAASR----------------KTDSSIIDMTVTASSPE---EA
R7MQJ4          --------S----IRNCLTMAA----------------VGDTEVMKITAETADPE---VS
A0A1V5GLC0      --------S----IRNCMRITS----------------VTDTSVLTVSATTRSPE---VA
W7V182          --------S----LRSCISISS----------------VTDTSALKLSAVTKNPE---VS
A0A143XPI5      --------E----MNVNITASA----------------VEETNLFRIETSGRDPE---LV
A0A0M6WXE3      --------K----LDADISANV----------------VKGTNMLTLSVTAHSPK---DS
A0A348SAK2      --------K----LDADISANV----------------VKGTNMLTLSVTAHSPK---DS
A0A1G9H5B9      --------H-----PGIDAGMV--------SSSLSMESVSETGVVAVKSTTLEAQ---LS
A0A1Y4H8L0      --------S----IDAAITSNV----------------IPNTNLLELSVSSSSPR---EA
A0A4B9BMD9      --------SQSLEFLQRQLPEV--------RSELD---QAEEKLNVYRQQRDSVDLNLEA
A0A0M6WYQ8      --------S----VPGSISVKA----------------EEGTNMLTISVSGTNAE---LS
A0A348SAK1      --------S----VPGSISVKA----------------EEGTNMLTISVSGTNAE---LS
A0A252F281      --------S----LPAQLESSI----------------IEGTNLLTISATADNAR---TA
A0A1Y4QKE6      --------S----LNGTLSAST----------------VSESNIVTMSVESNSPQ---DA
B1C231          --------S----LNGTLSAST----------------VSESNIVTMGVESNSPQ---DA
A0A7V6WIR4      --------EMG--LHGKPLSQL--------YGVAV---IKDTNLLLLTARHNNPG---LA
A0A1Y3TUL5      -------------LVGIVETDI--------YKNLYLTRYKETQIIEMDLTWRSAE---EG
A0A1Y4JAX2      -------------LVGIAETDI--------YKNLYLTRYKETQIIEMDLTWRSAE---EG
A0A1Y4T590      -------------LVGIAETDI--------YKNLLLTRYKETQIIEMDLTWRSAE---EG
A0A1Y3T163      --------T----LNGTITSET----------------VENSNMVTMRVESPDPE---DA
A0A1Y3YCA2      --------T----LNGTITSET----------------VENSNMVTMRVESPDPE---DA
A0A7W8H9H2      --------V----VNGSISAQV----------------VSDSNLITMSVTSSSPS---DA
A0A1Y4L6N9      --------S----INGSITASV----------------VPDSNLITMSVVSMNAS---EA
A0A173T644      --------S----INGSISAQA----------------VSDSNLITMTVTSSDPQ---DA
A0A1C5TSB8      --------S----INGSISAQA----------------VSDSNLITMTVTSSDPQ---DA
C0CIK6          --------S----INGSISAQA----------------VSDSNLITMTVTSSDPQ---DA
A0A1Y3WEF6      --------A----VNGRISAQA----------------VSDSNMITMTVTSNSPE---DA
A0A417T0L2      --------A----VNGSISAQA----------------VSNSNMITMTVTSNSAE---DA
A0A1H9EPU3      --------LTYSGLASKVSVTS----------------PTDTRILTITVTDPDPV---MS
A0A354IGV3      --------N----LPAQIKTEV----------------AKDTNVLTLTSTADTAY---DA
A0A417JMV2      --------Y----FPGSASAEV----------------VNETNLLVLKVQADSPE---MA
A0A415VWX5      --------Y----FPGSASAEV----------------VNETNLLVLKVQADSPE---MA
A0A173UY96      --------Y----FPGSASAEV----------------VNETNLLVLKVQADSPE---MA
B0P408          --------Y----FPGSASAEV----------------VNETNLLVLKVQADSPE---MA
D4MV82          --------Y----FPGSASAEV----------------VNETNLLVLKVQADSPE---MA
A0A173QTL1      --------Y----FPGSASAEV----------------VNETNLLVLKVQADSPE---MA
A0A174J359      --------Y----FPGSASAEV----------------VNETNLLVLKVQADSPE---MA
A0A174A3T7      --------Y----FPGSASAEV----------------VNETNLLVLKVQADSPE---MA
A0A417UUA3      --------Y----FPGSASAEV----------------VNETNLLVLKVQADSPE---MA
A0A6N2VB70      --------Y----FPGSASAEV----------------VNETNLLVLKVQADSPE---MA
A0A1C6EUV9      --------Y----FPGTASAEV----------------VNETNLLVLKVQADSPE---MA
A0A173Y645      --------Y----FPGTASAEV----------------VNETNLLVLKVQADSPE---MA
A0A374AVY6      --------Y----FPGTASAEV----------------VNETNLLVLKVQADSPE---MA
R7BXS4          --------Y----FPGTASAEV----------------VNETNLLVLKVQADSPE---MA
                                                                            

S3FFL2          ARVVNAWADAYIQTNLERKSQATSYGRNLLQRQLAQAKERLDESQRQLVNYASQQQIINL
A0A328M4V1      TQLVDQISALYVRQNVDRNSAEAANSLAFVKQQLPKVRLELEQATQAMNAFQTRAHSVDI
A0A6A8IF17      EDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKSEHLLPDV
A0A143WVN6      YQMIQSALDNYSSVS-----DYL-------------------------------------
W6RXP9          AEILNGINNEFIFQA-----NEL-------------------------------------
W6S4G8          AVVLESITEEFIKES-----KEI-------------------------------------
A0A3D5R4X5      RDIANKLAEVFQEEV-----VEI-------------------------------------
A0A1I4C3N6      QLIANTIGEIAPTRL-----VGL-------------------------------------
A0A3B9CIM7      MNIANAIGELAPNEI-----IRI-------------------------------------
A0A7R7IBN8      MNIANAIGELAPNEI-----IRI-------------------------------------
A0A1G9WHW8      QKIANAIGELAPDMI-----VTL-------------------------------------
A0A1H5VAA0      QKIANAIGELAPDMI-----VTL-------------------------------------
A0A3R6VK11      MELANAIGRVAPKEI-----GRI-------------------------------------
A0A3R6QUY7      MELANAIGRVAPKEI-----GRI-------------------------------------
A0A373K3P9      LELANAIGRVAPKEI-----GRI-------------------------------------
A0A3R6JRU5      LELANAIGRVAPKEI-----GRI-------------------------------------
A0A1C5MS04      MELANAIGRVAPKEI-----GRI-------------------------------------
A0A3C1J150      MELANAIGRVAPKEI-----SRI-------------------------------------
A0A416CXD7      MELANAIGRVAPKEI-----GRI-------------------------------------
A0A6N2X662      MELANAIGRVAPKEI-----GRI-------------------------------------
R6XBL9          MELANAIGRVAPKEI-----GRI-------------------------------------
A0A355W5Z7      MELANAIGRVAPKEI-----GRI-------------------------------------
A0A1G6BLB6      YAVMNAILDNYSSVS-----DKV-------------------------------------
A0A1C6G8M0      VDIANEILSVSIEEI-----PHV-------------------------------------
A0A416MP73      VNIANEILSVSVDEI-----PHV-------------------------------------
A0A3E4LL92      YKLLKGALKQYPELS-----DYF-------------------------------------
A0A415D1L1      YKLLKGALQQYPELS-----DYF-------------------------------------
A0A396G6S7      YRILQSVMENYNTVS-----DYA-------------------------------------
A0A3E5A223      YRILQSVMENYNTVS-----DYA-------------------------------------
R7D5E6          YRILQSVMENYNTVS-----DYA-------------------------------------
A0A415HQH5      YRILQSVMENYNTVS-----DYA-------------------------------------
A0A414W2C6      YRILQSVMENYNTVS-----DYA-------------------------------------
A5ZNE7          YRILQSVMENYNTVS-----DYA-------------------------------------
A0A395X821      YRVLQSVMENYNTVS-----DYA-------------------------------------
A0A1C5PY68      YRVLQSVMENYNTVS-----DYA-------------------------------------
A0A174CJF8      YRVLQSVMENYNTVS-----DYA-------------------------------------
A0A564SRR2      YRVLQSVMENYNTVS-----DYA-------------------------------------
A0A174R7V0      YRVLQSVMENYNTVS-----DYA-------------------------------------
A0A373MWV2      FRVLRSVLKNYTTIS-----DYI-------------------------------------
A0A417CE88      FRVLRSVLKNYTTIS-----DYI-------------------------------------
A0A416Y441      FRVLRSVLKNYTTIS-----DYI-------------------------------------
A0A357GPJ7      FRVLRSVLKNYTTIS-----DYI-------------------------------------
A0A396PAC1      FRVLRSVLKNYTTIS-----DYI-------------------------------------
A0A416EYU4      FRVLRSVLKNYTTIS-----DYI-------------------------------------
A0A416SCQ2      FRVLRSVLKNYTTIS-----DYI-------------------------------------
A0A416TGN7      FRVLRSVLKNYTTIS-----DYI-------------------------------------
A0A417SMF6      FRVLRSVLKNYTTIS-----DYI-------------------------------------
A0A0H5SF45      YTLVEAMQKIAPQLI-----ANI-------------------------------------
A0A1M6JRJ5      YRLVKSMETIAPKLI-----EKI-------------------------------------
A0A1M7Y1S2      YRLVKSMEMIVPKLI-----EKI-------------------------------------
A0A7I8DMN1      YELVKNMEILAPKLI-----EDI-------------------------------------
A0A1Y4MW77      KEILESTIRVYPSVA-----RFV-------------------------------------
A0A6S6R676      YQLVRVMQEVAPRLI-----KSI-------------------------------------
A0A0K8J554      YELVKAMEYIAPQII-----SEV-------------------------------------
A0A1I0RG99      YKLVDAMKKIAPVLI-----KSI-------------------------------------
A0A1I5G322      FLLVKSMEKIAPELI-----KSI-------------------------------------
A0A7C6IYW8      YSLAESMERIAPQLI-----KTI-------------------------------------
A0A7C6JZF1      YLLAGTMQEITPGFI-----KNI-------------------------------------
A0A3N1XSX6      YTLVETMQRIAPQLI-----KSI-------------------------------------
A0A839K1C1      YTLAESMERIAPELI-----QTI-------------------------------------
R6UHV6          YRLLKAVLECYPQFT-----KNV-------------------------------------
A0A3R9Q621      FELAKAIQNIAPDFI-----KSI-------------------------------------
A0A069RC75      AAIANEIAQVFKEEI-----FRI-------------------------------------
A0A174F2W5      FRVLRSVLKNYTTIS-----DYI-------------------------------------
A0A174S8E9      FRVLRSVLKNYTTIS-----DYI-------------------------------------
A0A416ZL97      FRILKSVLNNYTSIS-----DYI-------------------------------------
A0A174LSK1      FRILKSVLNNYTSIS-----DYI-------------------------------------
A0A373GY92      FRILKSVLNNYTSIS-----DYI-------------------------------------
A0A373NZQ6      FRILKSVLNNYTSIS-----DYI-------------------------------------
A0A417I9B9      FRILKSVLNNYTSIS-----DYI-------------------------------------
A0A417WQF8      FRILKSVLNNYTSIS-----DYI-------------------------------------
A0A8B3CFR3      FRILKSVLNNYTSIS-----DYI-------------------------------------
A0A373RZ83      FRILKSVLNNYTSIS-----DYI-------------------------------------
A0A416U6I1      FRILKSVLNNYTSIS-----DYI-------------------------------------
R7JQZ9          FRILKSVLNNYTSIS-----DYI-------------------------------------
A0A1M5UYN6      KEIVLAITQSFKENA-----EKL-------------------------------------
A0A176JBT8      ALIANKTAVIFQSEI-----KKL-------------------------------------
A0A1I5HIC6      KQLADSIAEESAERM-----VSI-------------------------------------
A0A1Y3TC51      YLFINAALEHYGEVA-----GDV-------------------------------------
A0A1Y3T1N0      YLFINSALENYEQVA-----QDV-------------------------------------
A0A1Y3Y8U8      YLFINSALENYEQVA-----QDV-------------------------------------
A0A5B0BQY5      ANLANTYALTFQEEI-----RTL-------------------------------------
A6CLL4          VDIVNNTAETFKEET-----YNL-------------------------------------
A0A176U8D6      VDIANEILQISIEEI-----PNV-------------------------------------
A0A1Q6KSQ5      VDIANEILSVSIEEI-----PHV-------------------------------------
A0A3D3U8B3      VDIANEILSVSIEEI-----PHV-------------------------------------
A0A3E5FRL7      YQFMNSALKHYDEVS-----DYV-------------------------------------
A0A1Y4QK93      YQFMNSALKHYNEVS-----DYV-------------------------------------
B1C232          YQFMNSALKHYDEVS-----DYV-------------------------------------
A0A401USI6      AEGANALSQAFIEES-----QNL-------------------------------------
A0A1V4IQ10      KDTVSAITNEFIKET-----QEL-------------------------------------
A0A1S8TRD2      KDTVSAITDEFIKET-----QEL-------------------------------------
G7M1U2          KDTVSAITDEFIKET-----QEL-------------------------------------
A0A2T6KJ75      AALANTLATTFQEEI-----KTL-------------------------------------
A9KN92          KQLADSIAEVASERM-----VSV-------------------------------------
A0A352MUJ1      ATIANSIAEVFSEQV-----KEY-------------------------------------
R5YI67          PIIANSIAEVFSEQI-----KEI-------------------------------------
A0A174DL89      TLVANQLTLSLKNIS-----SEI-------------------------------------
A0A1Y0IQP5      VAIANAMAAVFMENL-----SRI-------------------------------------
A0A4R2R7B1      VTIANAMAAVFMENL-----GRI-------------------------------------
A0A1M6E8I2      SEIANTIADVFIKEV-----MRI-------------------------------------
A0A7C6SMH0      KEVVNELSNEIQELA-----ADI-------------------------------------
A0A7X7XYM7      RDVVNELSNEIQELA-----ADI-------------------------------------
A0A3B8KKL6      RDVVNELSNEIQELA-----ADI-------------------------------------
A0A2K9E6R0      RDVVNELSNEIQELA-----ADI-------------------------------------
A0A2S8RBI0      RDVVNELSNEIQELA-----ADI-------------------------------------
A0A7X8MFK9      ANVVNELAEVIQKMA-----SEI-------------------------------------
A0A7X9D1M8      ADVVNELAAVIQEMA-----SDI-------------------------------------
A0A0L6JLG6      AKVVNELGTIIMQLA-----SDI-------------------------------------
A0A7X8PYA7      ADVVNELALVIKQMA-----SDI-------------------------------------
G8LSN0          ADVVNELALVIKQLA-----SDV-------------------------------------
A0A1Y4N105      YQIMQSALDNYTSVS-----DYL-------------------------------------
A0A1Y4QP75      YQIMQSALDNYTSVS-----DYL-------------------------------------
A0A3D4QRB5      RDIADSTAEVFISEV-----NKL-------------------------------------
A0A349DEH5      YAIAQTACEVYGDIV-----AEK-------------------------------------
A0A3D4T7B4      YAIAQTACEVYGDIV-----AEK-------------------------------------
A0A350XYC7      YAIANTVVDVYGDIV-----SEI-------------------------------------
R6DNR8          YAIASTVVDVYGDIV-----SER-------------------------------------
A0A355KUM5      YAIASTVVDVYGDIV-----TER-------------------------------------
R5YGY6          YAIASTVVDVYGDIV-----TER-------------------------------------
A0A7G9WCY6      ARIADELSSVFMSKI-----VNF-------------------------------------
A0A0A5GPA9      SELVNVTLDTFQQEV-----ESL-------------------------------------
A0A271M6M4      VKLANSTAEIFKTEI-----KSL-------------------------------------
A0A1C6G0U3      RDIANSIPEIFKEEV-----KRL-------------------------------------
A0A3D4LLB3      RDIADALVEEFTLEI-----QRI-------------------------------------
A0A7C7AD93      FSVLENITEIFSEEA-----IRI-------------------------------------
A0A2V3W8U6      VEIANLFATKSKEEI-----SQL-------------------------------------
A0A6N3BXA1      AKICNEIPIVFEKEV-----KRI-------------------------------------
A0A351SRI8      RKIANEIASVFESEI-----VGI-------------------------------------
A0A1V5LU59      ANVVNELSVVIKQMA-----TDI-------------------------------------
A0A7X8R9W1      ADVANELATIIQHLA-----KEI-------------------------------------
A0A1E3BVC3      ADVVNELASVIQKMA-----DEI-------------------------------------
A0A4Q0I6S0      ADVVNELASVIQKMA-----DEI-------------------------------------
A3DF66          ADIVNELATVIQKMA-----DEI-------------------------------------
W4V1T8          ADVVNELASVIQKMA-----DEI-------------------------------------
A0A1C6ITD7      ATIANQLVLSLKNIS-----SEL-------------------------------------
A0A381IX63      REIANEVPVVFGGEL-----ENI-------------------------------------
A0A1M6RWV2      ARIANELSEVFIDRI-----HEF-------------------------------------
A0A841ZT34      VELVNQTAQSLKKEV-----KKI-------------------------------------
A0A1G9IUT4      NNIANEIASVFTSEL-----SRI-------------------------------------
A0A842GR80      VAIANSTAESLKKEV-----KHI-------------------------------------
A0A7X0TNH3      VAIANSTAESLKKEV-----KHI-------------------------------------
A0A842D596      VAIANSTAESLKKEV-----KHI-------------------------------------
A0A842EQ86      VAIANSTAESLKKEV-----KHI-------------------------------------
A0A842A220      VAIANSTAESLKKEV-----KHI-------------------------------------
A0A7X0YM80      VAIANSTAESLKKEV-----KHI-------------------------------------
A0A842GEL5      VVIANSTAESLKKEV-----KHI-------------------------------------
A0A841XVD7      VAIANSTAESLKKEV-----KHI-------------------------------------
A0A7X0XME5      VAIANSTAESLKKEV-----KHI-------------------------------------
A0A842B6T1      VAIANSTVESLKKEV-----KHI-------------------------------------
A0A841X7G0      VAIANSTAESLKKEV-----KHI-------------------------------------
A0A841W3M8      VAIANSTAESLKKEV-----KHI-------------------------------------
A0A7X0XVI0      VAIANSTVESLKKEV-----KHI-------------------------------------
A0A7X0Z1K1      VAIANSTAESLKKEV-----KHI-------------------------------------
A0A143ZUX1      YRLAVAYMGAIDIVVNPKDDSSG-------------------------------------
A0A7I8D809      YRLAVAYMGAIDIVVNPKDDSSG-------------------------------------
A0A3R9WAA7      YEVLQSVIKNYPKVA-----ETV-------------------------------------
A0A1G6BLF1      YNILQAVIESYPIVA-----ESV-------------------------------------
A0A355G1X5      YEIASGIASHYQDIV-----DYA-------------------------------------
A0A1W2CEA6      KLLADTYAEVVQDYI-----ANK-------------------------------------
A0A355G3J9      TDVLTDIVKVAPQEI-----IRV-------------------------------------
A0A3D2AD87      IDLANDFAALCQTFI-----PNN-------------------------------------
A0A143XN92      FQILRAIMENYTVVS-----DYV-------------------------------------
R7FFK6          ASLCNIMADVAPQFL-----IRV-------------------------------------
A0A373MPB9      SDLCNIMADVAPSFL-----IRV-------------------------------------
A0A373L519      SDLCNIMADVAPSFL-----IRV-------------------------------------
A0A373W906      SDLCNIMADVAPSFL-----IRV-------------------------------------
A0A373VCW2      SDLCNIMADVAPSFL-----IRV-------------------------------------
W0U604          SDLCNIMADVAPSFL-----IRV-------------------------------------
A0A374B6G0      SDLCNIMADVAPSFL-----IRV-------------------------------------
A0A373VM36      SDLCNIMADVAPSFL-----IRV-------------------------------------
A0A1C5P379      SDLCNIMADVAPSFL-----IRV-------------------------------------
A0A373XXX0      SDLCNIMADVAPSFL-----IRV-------------------------------------
A0A5R9MJM9      SDLCNIMADVAPSFL-----IRV-------------------------------------
A0A356CW82      SDLCNIMADVAPSFL-----IRV-------------------------------------
R6T4X7          SDLCNIMADVAPSFL-----IRV-------------------------------------
A0A374HTV1      SDLCNIMADVAPSFL-----IRV-------------------------------------
A0A374GB66      SDLCNIMADVAPSFL-----IRV-------------------------------------
A0A374ECC6      SDLCNIMADVAPSFL-----IRV-------------------------------------
A0A374BM61      SDLCNIMADVAPSFL-----IRV-------------------------------------
A0A373UGZ4      SDLCNIMADVAPSFL-----IRV-------------------------------------
A0A373SA66      SDLCNIMADVAPSFL-----IRV-------------------------------------
A0A1C5X6X7      SDLCNIMADVAPSFL-----IRV-------------------------------------
A0A1C6JIH3      SDLCNIMADVAPSFL-----IRV-------------------------------------
A0A373PSC3      SDLCNIMADVAPSFL-----IRV-------------------------------------
A0A1K1WYK8      ADICNDITQVAPKYV-----EEA-------------------------------------
A0A1H6IUB1      AALCNDLTEVAPSYV-----EEA-------------------------------------
A0A1M7L1F9      AALCNDLTEVAPDYV-----EEA-------------------------------------
A0A1C6B4L6      ASICNNLTSIAPEYV-----AKA-------------------------------------
A0A1Q6T9P4      ASICNNLTSIAPEYV-----AKA-------------------------------------
A0A315Y4F9      AAICNDLTQVAPQYV-----EEA-------------------------------------
A0A354K620      AAICNDLTQVAPKYV-----EEA-------------------------------------
A0A173ZYY6      IDIIRTVMDNYSSVS-----LYT-------------------------------------
A0A6L8RXB5      IDIIRTVMDNYSSVS-----LYT-------------------------------------
A0A173SMI2      IDIIRTVMDNYSSVS-----LYT-------------------------------------
A0A845KKD0      IDIIRTVMDNYSSVS-----LYT-------------------------------------
A0A6N9JW85      IDIIRTVMDNYSSVS-----LYT-------------------------------------
A0A174ASH7      IDIIRTVMDNYSSVS-----LYT-------------------------------------
A6BH65          IDIIRTVMDNYSSVS-----LYT-------------------------------------
R7G0D7          IDIIRTVMDNYSSVS-----LYT-------------------------------------
R6HZX3          YDILNAVIQNYPQVA-----SFV-------------------------------------
R5EFZ0          FLAAQAIIEHHESLT-----YQV-------------------------------------
A0A3E5FSY5      MSILTSAIEIYPDVA-----RFV-------------------------------------
A0A1V5S3C0      YQIAKALTSVYSQVM-----EGS-------------------------------------
A0A3C0QME1      AAICNQIAESAEECL-----TRI-------------------------------------
A0A355FYK5      SRTMDAVLDVFPDYM-----RTS-------------------------------------
A0A357AQU0      AEISNIFAEVAPDYL-----IRI-------------------------------------
A0A3C1YJQ7      AEISNIFAEVAPDYL-----IRI-------------------------------------
A0A3D0JG38      AEISNIFAEVAPDYL-----IRI-------------------------------------
A0A3C0IHX1      AEICDIYAEVAPTFL-----IRI-------------------------------------
R5V506          AEICDIYAEVAPTFL-----IRI-------------------------------------
A0A352TIU5      AEICDIYAEVAPTFL-----IRI-------------------------------------
R5B467          YDVLQSVIVHYPDVA-----ELV-------------------------------------
A0A1Y3TC98      RAILEAALAIYPETA-----RFV-------------------------------------
A0A1W1Z4C3      ADICNSVLQVAPTAI-----KDV-------------------------------------
A0A239QN83      ADICNSVLQVAPTAI-----KDV-------------------------------------
A0A8A5CVI3      ADICNSVLQVAPGAI-----KDV-------------------------------------
A0A8A5D3H1      ADICNSVLQVAPAAI-----KDV-------------------------------------
A0A1Q6REE0      YDVMSAVIACYPEVA-----EFV-------------------------------------
R5ETF9          YDVMSAVIACYPEVA-----EFV-------------------------------------
A0A0F2P7X6      AKICNSIMHVAPTAI-----SST-------------------------------------
A0A359B487      AKICNSIMHVAPTAI-----SST-------------------------------------
R6VAT5          YNVLKSVINNYPSVA-----EYV-------------------------------------
D4LC36          AELCNIMADVAPEVL-----IRV-------------------------------------
A0A7X3IXX7      AALANSALQATAEVV-----QDL-------------------------------------
A0A1Q6S448      LVLLQAVSDNYGSLS-----AHV-------------------------------------
A0A351MYR0      LVLLKAVSDNYGSLS-----AHV-------------------------------------
R6HPC1          LVLLKAVSDNYGTLS-----AHV-------------------------------------
A0A3D4G5Z5      LVLLKAVSDNYGTLS-----AHV-------------------------------------
A0A3D5ES03      LVLLKAVSDNYGTLS-----AHV-------------------------------------
A0A348P5V4      YGIAQAYVDNYNEAI-----ATA-------------------------------------
A0A356PT74      YGIANAYVNNYESAI-----NAA-------------------------------------
A0A3D5LL19      YGIANAYVNNYESAI-----NAA-------------------------------------
R5MNF0          YGIANAYVNNYESAI-----NAA-------------------------------------
A0A1Q9JSI0      FRLNKAIMNNYSVVS-----DEL-------------------------------------
A0A3D5TNI1      YELAQAVKDTYKDVV-----QVY-------------------------------------
A0A358LJD0      YELAQAVKDTYKDVV-----QVY-------------------------------------
R6I3L7          YELAQAVKDTYKDVV-----RVY-------------------------------------
A0A3D1HXX0      YELAQAVKDTYKDVV-----QVY-------------------------------------
A0A3D2QJB8      YELAQAVKDTYKDVV-----QVY-------------------------------------
R7MQJ4          AALCNIISNVTPDFL-----IRV-------------------------------------
A0A1V5GLC0      AAICNDVAEVAPKFL-----DDA-------------------------------------
W7V182          AAICNDIAKVAPDYL-----HDA-------------------------------------
A0A143XPI5      YEVLESVIKNYPEVA-----EYI-------------------------------------
A0A0M6WXE3      IDIIKTVMDNYTSIS-----YYT-------------------------------------
A0A348SAK2      IDIIKTVMDNYTSIS-----YYT-------------------------------------
A0A1G9H5B9      ADIANAVMEIAPEEI-----VRV-------------------------------------
A0A1Y4H8L0      FDTIHAVMDNYAQVS-----YFS-------------------------------------
A0A4B9BMD9      KAVLEQIVNVDNQLN-----ELT-------------------------------------
A0A0M6WYQ8      YKTLKSVIKNYPEVA-----QFV-------------------------------------
A0A348SAK1      YKTLKSVIKNYPEVA-----QFV-------------------------------------
A0A252F281      FLTVKAVMENYNTVS-----DQV-------------------------------------
A0A1Y4QKE6      MSILTSAIEVYPDAA-----RFV-------------------------------------
B1C231          MSILTSAIEIYPDVA-----RFV-------------------------------------
A0A7V6WIR4      RDLVNTLGQEYIQFI-----SEMSQEQMEQTILFLEQQYKQIENKLNEAIEKWNAFQNMD
A0A1Y3TUL5      VEILNAINEVAPEIL-----IET-------------------------------------
A0A1Y4JAX2      VEILNAINEVAPEIL-----IET-------------------------------------
A0A1Y4T590      VEILNAINEVAPEIL-----IET-------------------------------------
A0A1Y3T163      REILDTALEIYPETA-----RFV-------------------------------------
A0A1Y3YCA2      RKILDTALEIYPETA-----RFV-------------------------------------
A0A7W8H9H2      KAILESVIRVYPSVS-----RFV-------------------------------------
A0A1Y4L6N9      KTILESAIRVYPNIS-----RFV-------------------------------------
A0A173T644      KAILESAIKVYPEVS-----RFV-------------------------------------
A0A1C5TSB8      KAILESAIKVYPEVS-----RFV-------------------------------------
C0CIK6          KAILESAIKVYPEVS-----RFV-------------------------------------
A0A1Y3WEF6      RAILESTIKVYPDVV-----RFV-------------------------------------
A0A417T0L2      KAILESAIKVYPDVA-----RFV-------------------------------------
A0A1H9EPU3      KNLADSIRDAAIKHI-----QGI-------------------------------------
A0A354IGV3      FICLKAVTENYNLIS-----DNV-------------------------------------
A0A417JMV2      FRLNKAIMNNYSVVT-----DQL-------------------------------------
A0A415VWX5      FRLNKAIMNNYSVVT-----DQL-------------------------------------
A0A173UY96      FRLNKAIMNNYSVVT-----DQL-------------------------------------
B0P408          FRLNKAIMNNYSVVT-----DQL-------------------------------------
D4MV82          FRLNKAIMNNYSVVT-----DQL-------------------------------------
A0A173QTL1      FRLNKAIMNNYSVVT-----DQL-------------------------------------
A0A174J359      FRLNKAIMNNYSVVT-----DQL-------------------------------------
A0A174A3T7      FRLNKAIMNNYSVVT-----DQL-------------------------------------
A0A417UUA3      FRLNKAIMNNYSVVT-----DQL-------------------------------------
A0A6N2VB70      FRLNKAIMNNYSVVT-----DQL-------------------------------------
A0A1C6EUV9      FRLNKAIMNNYSVVT-----NQL-------------------------------------
A0A173Y645      FSLNKAIMNNYSVVT-----NRL-------------------------------------
A0A374AVY6      FSLNKAIMNNYSVVT-----NQL-------------------------------------
R7BXS4          FSLNKAIMNNYSVVT-----NQL-------------------------------------
                                                                            

S3FFL2          PAPSSGASGTTTSERSIVADNLATLNAALTQATADRIQAEARYQQAGRAGASTEALRNSA
A0A328M4V1      SMQT-----------KALLDQIVAIDASLQQ-----LRMQM------------SDMQRHF
A0A6A8IF17      QAAS-----------SMYMAQSSQTNAQILA-----LNNQLYMTRYIRNYLANDANRTQL
A0A143WVN6      ------------------------------------------------------------
W6RXP9          ------------------------------------------------------------
W6S4G8          ------------------------------------------------------------
A0A3D5R4X5      ------------------------------------------------------------
A0A1I4C3N6      ------------------------------------------------------------
A0A3B9CIM7      ------------------------------------------------------------
A0A7R7IBN8      ------------------------------------------------------------
A0A1G9WHW8      ------------------------------------------------------------
A0A1H5VAA0      ------------------------------------------------------------
A0A3R6VK11      ------------------------------------------------------------
A0A3R6QUY7      ------------------------------------------------------------
A0A373K3P9      ------------------------------------------------------------
A0A3R6JRU5      ------------------------------------------------------------
A0A1C5MS04      ------------------------------------------------------------
A0A3C1J150      ------------------------------------------------------------
A0A416CXD7      ------------------------------------------------------------
A0A6N2X662      ------------------------------------------------------------
R6XBL9          ------------------------------------------------------------
A0A355W5Z7      ------------------------------------------------------------
A0A1G6BLB6      ------------------------------------------------------------
A0A1C6G8M0      ------------------------------------------------------------
A0A416MP73      ------------------------------------------------------------
A0A3E4LL92      ------------------------------------------------------------
A0A415D1L1      ------------------------------------------------------------
A0A396G6S7      ------------------------------------------------------------
A0A3E5A223      ------------------------------------------------------------
R7D5E6          ------------------------------------------------------------
A0A415HQH5      ------------------------------------------------------------
A0A414W2C6      ------------------------------------------------------------
A5ZNE7          ------------------------------------------------------------
A0A395X821      ------------------------------------------------------------
A0A1C5PY68      ------------------------------------------------------------
A0A174CJF8      ------------------------------------------------------------
A0A564SRR2      ------------------------------------------------------------
A0A174R7V0      ------------------------------------------------------------
A0A373MWV2      ------------------------------------------------------------
A0A417CE88      ------------------------------------------------------------
A0A416Y441      ------------------------------------------------------------
A0A357GPJ7      ------------------------------------------------------------
A0A396PAC1      ------------------------------------------------------------
A0A416EYU4      ------------------------------------------------------------
A0A416SCQ2      ------------------------------------------------------------
A0A416TGN7      ------------------------------------------------------------
A0A417SMF6      ------------------------------------------------------------
A0A0H5SF45      ------------------------------------------------------------
A0A1M6JRJ5      ------------------------------------------------------------
A0A1M7Y1S2      ------------------------------------------------------------
A0A7I8DMN1      ------------------------------------------------------------
A0A1Y4MW77      ------------------------------------------------------------
A0A6S6R676      ------------------------------------------------------------
A0A0K8J554      ------------------------------------------------------------
A0A1I0RG99      ------------------------------------------------------------
A0A1I5G322      ------------------------------------------------------------
A0A7C6IYW8      ------------------------------------------------------------
A0A7C6JZF1      ------------------------------------------------------------
A0A3N1XSX6      ------------------------------------------------------------
A0A839K1C1      ------------------------------------------------------------
R6UHV6          ------------------------------------------------------------
A0A3R9Q621      ------------------------------------------------------------
A0A069RC75      ------------------------------------------------------------
A0A174F2W5      ------------------------------------------------------------
A0A174S8E9      ------------------------------------------------------------
A0A416ZL97      ------------------------------------------------------------
A0A174LSK1      ------------------------------------------------------------
A0A373GY92      ------------------------------------------------------------
A0A373NZQ6      ------------------------------------------------------------
A0A417I9B9      ------------------------------------------------------------
A0A417WQF8      ------------------------------------------------------------
A0A8B3CFR3      ------------------------------------------------------------
A0A373RZ83      ------------------------------------------------------------
A0A416U6I1      ------------------------------------------------------------
R7JQZ9          ------------------------------------------------------------
A0A1M5UYN6      ------------------------------------------------------------
A0A176JBT8      ------------------------------------------------------------
A0A1I5HIC6      ------------------------------------------------------------
A0A1Y3TC51      ------------------------------------------------------------
A0A1Y3T1N0      ------------------------------------------------------------
A0A1Y3Y8U8      ------------------------------------------------------------
A0A5B0BQY5      ------------------------------------------------------------
A6CLL4          ------------------------------------------------------------
A0A176U8D6      ------------------------------------------------------------
A0A1Q6KSQ5      ------------------------------------------------------------
A0A3D3U8B3      ------------------------------------------------------------
A0A3E5FRL7      ------------------------------------------------------------
A0A1Y4QK93      ------------------------------------------------------------
B1C232          ------------------------------------------------------------
A0A401USI6      ------------------------------------------------------------
A0A1V4IQ10      ------------------------------------------------------------
A0A1S8TRD2      ------------------------------------------------------------
G7M1U2          ------------------------------------------------------------
A0A2T6KJ75      ------------------------------------------------------------
A9KN92          ------------------------------------------------------------
A0A352MUJ1      ------------------------------------------------------------
R5YI67          ------------------------------------------------------------
A0A174DL89      ------------------------------------------------------------
A0A1Y0IQP5      ------------------------------------------------------------
A0A4R2R7B1      ------------------------------------------------------------
A0A1M6E8I2      ------------------------------------------------------------
A0A7C6SMH0      ------------------------------------------------------------
A0A7X7XYM7      ------------------------------------------------------------
A0A3B8KKL6      ------------------------------------------------------------
A0A2K9E6R0      ------------------------------------------------------------
A0A2S8RBI0      ------------------------------------------------------------
A0A7X8MFK9      ------------------------------------------------------------
A0A7X9D1M8      ------------------------------------------------------------
A0A0L6JLG6      ------------------------------------------------------------
A0A7X8PYA7      ------------------------------------------------------------
G8LSN0          ------------------------------------------------------------
A0A1Y4N105      ------------------------------------------------------------
A0A1Y4QP75      ------------------------------------------------------------
A0A3D4QRB5      ------------------------------------------------------------
A0A349DEH5      ------------------------------------------------------------
A0A3D4T7B4      ------------------------------------------------------------
A0A350XYC7      ------------------------------------------------------------
R6DNR8          ------------------------------------------------------------
A0A355KUM5      ------------------------------------------------------------
R5YGY6          ------------------------------------------------------------
A0A7G9WCY6      ------------------------------------------------------------
A0A0A5GPA9      ------------------------------------------------------------
A0A271M6M4      ------------------------------------------------------------
A0A1C6G0U3      ------------------------------------------------------------
A0A3D4LLB3      ------------------------------------------------------------
A0A7C7AD93      ------------------------------------------------------------
A0A2V3W8U6      ------------------------------------------------------------
A0A6N3BXA1      ------------------------------------------------------------
A0A351SRI8      ------------------------------------------------------------
A0A1V5LU59      ------------------------------------------------------------
A0A7X8R9W1      ------------------------------------------------------------
A0A1E3BVC3      ------------------------------------------------------------
A0A4Q0I6S0      ------------------------------------------------------------
A3DF66          ------------------------------------------------------------
W4V1T8          ------------------------------------------------------------
A0A1C6ITD7      ------------------------------------------------------------
A0A381IX63      ------------------------------------------------------------
A0A1M6RWV2      ------------------------------------------------------------
A0A841ZT34      ------------------------------------------------------------
A0A1G9IUT4      ------------------------------------------------------------
A0A842GR80      ------------------------------------------------------------
A0A7X0TNH3      ------------------------------------------------------------
A0A842D596      ------------------------------------------------------------
A0A842EQ86      ------------------------------------------------------------
A0A842A220      ------------------------------------------------------------
A0A7X0YM80      ------------------------------------------------------------
A0A842GEL5      ------------------------------------------------------------
A0A841XVD7      ------------------------------------------------------------
A0A7X0XME5      ------------------------------------------------------------
A0A842B6T1      ------------------------------------------------------------
A0A841X7G0      ------------------------------------------------------------
A0A841W3M8      ------------------------------------------------------------
A0A7X0XVI0      ------------------------------------------------------------
A0A7X0Z1K1      ------------------------------------------------------------
A0A143ZUX1      ------------------------------------------------------------
A0A7I8D809      ------------------------------------------------------------
A0A3R9WAA7      ------------------------------------------------------------
A0A1G6BLF1      ------------------------------------------------------------
A0A355G1X5      ------------------------------------------------------------
A0A1W2CEA6      ------------------------------------------------------------
A0A355G3J9      ------------------------------------------------------------
A0A3D2AD87      ------------------------------------------------------------
A0A143XN92      ------------------------------------------------------------
R7FFK6          ------------------------------------------------------------
A0A373MPB9      ------------------------------------------------------------
A0A373L519      ------------------------------------------------------------
A0A373W906      ------------------------------------------------------------
A0A373VCW2      ------------------------------------------------------------
W0U604          ------------------------------------------------------------
A0A374B6G0      ------------------------------------------------------------
A0A373VM36      ------------------------------------------------------------
A0A1C5P379      ------------------------------------------------------------
A0A373XXX0      ------------------------------------------------------------
A0A5R9MJM9      ------------------------------------------------------------
A0A356CW82      ------------------------------------------------------------
R6T4X7          ------------------------------------------------------------
A0A374HTV1      ------------------------------------------------------------
A0A374GB66      ------------------------------------------------------------
A0A374ECC6      ------------------------------------------------------------
A0A374BM61      ------------------------------------------------------------
A0A373UGZ4      ------------------------------------------------------------
A0A373SA66      ------------------------------------------------------------
A0A1C5X6X7      ------------------------------------------------------------
A0A1C6JIH3      ------------------------------------------------------------
A0A373PSC3      ------------------------------------------------------------
A0A1K1WYK8      ------------------------------------------------------------
A0A1H6IUB1      ------------------------------------------------------------
A0A1M7L1F9      ------------------------------------------------------------
A0A1C6B4L6      ------------------------------------------------------------
A0A1Q6T9P4      ------------------------------------------------------------
A0A315Y4F9      ------------------------------------------------------------
A0A354K620      ------------------------------------------------------------
A0A173ZYY6      ------------------------------------------------------------
A0A6L8RXB5      ------------------------------------------------------------
A0A173SMI2      ------------------------------------------------------------
A0A845KKD0      ------------------------------------------------------------
A0A6N9JW85      ------------------------------------------------------------
A0A174ASH7      ------------------------------------------------------------
A6BH65          ------------------------------------------------------------
R7G0D7          ------------------------------------------------------------
R6HZX3          ------------------------------------------------------------
R5EFZ0          ------------------------------------------------------------
A0A3E5FSY5      ------------------------------------------------------------
A0A1V5S3C0      ------------------------------------------------------------
A0A3C0QME1      ------------------------------------------------------------
A0A355FYK5      ------------------------------------------------------------
A0A357AQU0      ------------------------------------------------------------
A0A3C1YJQ7      ------------------------------------------------------------
A0A3D0JG38      ------------------------------------------------------------
A0A3C0IHX1      ------------------------------------------------------------
R5V506          ------------------------------------------------------------
A0A352TIU5      ------------------------------------------------------------
R5B467          ------------------------------------------------------------
A0A1Y3TC98      ------------------------------------------------------------
A0A1W1Z4C3      ------------------------------------------------------------
A0A239QN83      ------------------------------------------------------------
A0A8A5CVI3      ------------------------------------------------------------
A0A8A5D3H1      ------------------------------------------------------------
A0A1Q6REE0      ------------------------------------------------------------
R5ETF9          ------------------------------------------------------------
A0A0F2P7X6      ------------------------------------------------------------
A0A359B487      ------------------------------------------------------------
R6VAT5          ------------------------------------------------------------
D4LC36          ------------------------------------------------------------
A0A7X3IXX7      ------------------------------------------------------------
A0A1Q6S448      ------------------------------------------------------------
A0A351MYR0      ------------------------------------------------------------
R6HPC1          ------------------------------------------------------------
A0A3D4G5Z5      ------------------------------------------------------------
A0A3D5ES03      ------------------------------------------------------------
A0A348P5V4      ------------------------------------------------------------
A0A356PT74      ------------------------------------------------------------
A0A3D5LL19      ------------------------------------------------------------
R5MNF0          ------------------------------------------------------------
A0A1Q9JSI0      ------------------------------------------------------------
A0A3D5TNI1      ------------------------------------------------------------
A0A358LJD0      ------------------------------------------------------------
R6I3L7          ------------------------------------------------------------
A0A3D1HXX0      ------------------------------------------------------------
A0A3D2QJB8      ------------------------------------------------------------
R7MQJ4          ------------------------------------------------------------
A0A1V5GLC0      ------------------------------------------------------------
W7V182          ------------------------------------------------------------
A0A143XPI5      ------------------------------------------------------------
A0A0M6WXE3      ------------------------------------------------------------
A0A348SAK2      ------------------------------------------------------------
A0A1G9H5B9      ------------------------------------------------------------
A0A1Y4H8L0      ------------------------------------------------------------
A0A4B9BMD9      ------------------------------------------------------------
A0A0M6WYQ8      ------------------------------------------------------------
A0A348SAK1      ------------------------------------------------------------
A0A252F281      ------------------------------------------------------------
A0A1Y4QKE6      ------------------------------------------------------------
B1C231          ------------------------------------------------------------
A0A7V6WIR4      ESYLTFQEQGEKLHWETQISHLRQTMELLAE-----------------------------
A0A1Y3TUL5      ------------------------------------------------------------
A0A1Y4JAX2      ------------------------------------------------------------
A0A1Y4T590      ------------------------------------------------------------
A0A1Y3T163      ------------------------------------------------------------
A0A1Y3YCA2      ------------------------------------------------------------
A0A7W8H9H2      ------------------------------------------------------------
A0A1Y4L6N9      ------------------------------------------------------------
A0A173T644      ------------------------------------------------------------
A0A1C5TSB8      ------------------------------------------------------------
C0CIK6          ------------------------------------------------------------
A0A1Y3WEF6      ------------------------------------------------------------
A0A417T0L2      ------------------------------------------------------------
A0A1H9EPU3      ------------------------------------------------------------
A0A354IGV3      ------------------------------------------------------------
A0A417JMV2      ------------------------------------------------------------
A0A415VWX5      ------------------------------------------------------------
A0A173UY96      ------------------------------------------------------------
B0P408          ------------------------------------------------------------
D4MV82          ------------------------------------------------------------
A0A173QTL1      ------------------------------------------------------------
A0A174J359      ------------------------------------------------------------
A0A174A3T7      ------------------------------------------------------------
A0A417UUA3      ------------------------------------------------------------
A0A6N2VB70      ------------------------------------------------------------
A0A1C6EUV9      ------------------------------------------------------------
A0A173Y645      ------------------------------------------------------------
A0A374AVY6      ------------------------------------------------------------
R7BXS4          ------------------------------------------------------------
                                                                            

S3FFL2          ISALRQQRA----ELAANYQKLMVQFEPEYPAARALSAQIAQLDRSIAREESRVSGSQLA
A0A328M4V1      TPAHPSYKA---------------------------------------------------
A0A6A8IF17      LPANSGIESANIESQIAEYNKQLLQRNSLVANSSTENPLVVDMDQALASMRGAIIRSIDN
A0A143WVN6      ------------------------------------------------------------
W6RXP9          ------------------------------------------------------------
W6S4G8          ------------------------------------------------------------
A0A3D5R4X5      ------------------------------------------------------------
A0A1I4C3N6      ------------------------------------------------------------
A0A3B9CIM7      ------------------------------------------------------------
A0A7R7IBN8      ------------------------------------------------------------
A0A1G9WHW8      ------------------------------------------------------------
A0A1H5VAA0      ------------------------------------------------------------
A0A3R6VK11      ------------------------------------------------------------
A0A3R6QUY7      ------------------------------------------------------------
A0A373K3P9      ------------------------------------------------------------
A0A3R6JRU5      ------------------------------------------------------------
A0A1C5MS04      ------------------------------------------------------------
A0A3C1J150      ------------------------------------------------------------
A0A416CXD7      ------------------------------------------------------------
A0A6N2X662      ------------------------------------------------------------
R6XBL9          ------------------------------------------------------------
A0A355W5Z7      ------------------------------------------------------------
A0A1G6BLB6      ------------------------------------------------------------
A0A1C6G8M0      ------------------------------------------------------------
A0A416MP73      ------------------------------------------------------------
A0A3E4LL92      ------------------------------------------------------------
A0A415D1L1      ------------------------------------------------------------
A0A396G6S7      ------------------------------------------------------------
A0A3E5A223      ------------------------------------------------------------
R7D5E6          ------------------------------------------------------------
A0A415HQH5      ------------------------------------------------------------
A0A414W2C6      ------------------------------------------------------------
A5ZNE7          ------------------------------------------------------------
A0A395X821      ------------------------------------------------------------
A0A1C5PY68      ------------------------------------------------------------
A0A174CJF8      ------------------------------------------------------------
A0A564SRR2      ------------------------------------------------------------
A0A174R7V0      ------------------------------------------------------------
A0A373MWV2      ------------------------------------------------------------
A0A417CE88      ------------------------------------------------------------
A0A416Y441      ------------------------------------------------------------
A0A357GPJ7      ------------------------------------------------------------
A0A396PAC1      ------------------------------------------------------------
A0A416EYU4      ------------------------------------------------------------
A0A416SCQ2      ------------------------------------------------------------
A0A416TGN7      ------------------------------------------------------------
A0A417SMF6      ------------------------------------------------------------
A0A0H5SF45      ------------------------------------------------------------
A0A1M6JRJ5      ------------------------------------------------------------
A0A1M7Y1S2      ------------------------------------------------------------
A0A7I8DMN1      ------------------------------------------------------------
A0A1Y4MW77      ------------------------------------------------------------
A0A6S6R676      ------------------------------------------------------------
A0A0K8J554      ------------------------------------------------------------
A0A1I0RG99      ------------------------------------------------------------
A0A1I5G322      ------------------------------------------------------------
A0A7C6IYW8      ------------------------------------------------------------
A0A7C6JZF1      ------------------------------------------------------------
A0A3N1XSX6      ------------------------------------------------------------
A0A839K1C1      ------------------------------------------------------------
R6UHV6          ------------------------------------------------------------
A0A3R9Q621      ------------------------------------------------------------
A0A069RC75      ------------------------------------------------------------
A0A174F2W5      ------------------------------------------------------------
A0A174S8E9      ------------------------------------------------------------
A0A416ZL97      ------------------------------------------------------------
A0A174LSK1      ------------------------------------------------------------
A0A373GY92      ------------------------------------------------------------
A0A373NZQ6      ------------------------------------------------------------
A0A417I9B9      ------------------------------------------------------------
A0A417WQF8      ------------------------------------------------------------
A0A8B3CFR3      ------------------------------------------------------------
A0A373RZ83      ------------------------------------------------------------
A0A416U6I1      ------------------------------------------------------------
R7JQZ9          ------------------------------------------------------------
A0A1M5UYN6      ------------------------------------------------------------
A0A176JBT8      ------------------------------------------------------------
A0A1I5HIC6      ------------------------------------------------------------
A0A1Y3TC51      ------------------------------------------------------------
A0A1Y3T1N0      ------------------------------------------------------------
A0A1Y3Y8U8      ------------------------------------------------------------
A0A5B0BQY5      ------------------------------------------------------------
A6CLL4          ------------------------------------------------------------
A0A176U8D6      ------------------------------------------------------------
A0A1Q6KSQ5      ------------------------------------------------------------
A0A3D3U8B3      ------------------------------------------------------------
A0A3E5FRL7      ------------------------------------------------------------
A0A1Y4QK93      ------------------------------------------------------------
B1C232          ------------------------------------------------------------
A0A401USI6      ------------------------------------------------------------
A0A1V4IQ10      ------------------------------------------------------------
A0A1S8TRD2      ------------------------------------------------------------
G7M1U2          ------------------------------------------------------------
A0A2T6KJ75      ------------------------------------------------------------
A9KN92          ------------------------------------------------------------
A0A352MUJ1      ------------------------------------------------------------
R5YI67          ------------------------------------------------------------
A0A174DL89      ------------------------------------------------------------
A0A1Y0IQP5      ------------------------------------------------------------
A0A4R2R7B1      ------------------------------------------------------------
A0A1M6E8I2      ------------------------------------------------------------
A0A7C6SMH0      ------------------------------------------------------------
A0A7X7XYM7      ------------------------------------------------------------
A0A3B8KKL6      ------------------------------------------------------------
A0A2K9E6R0      ------------------------------------------------------------
A0A2S8RBI0      ------------------------------------------------------------
A0A7X8MFK9      ------------------------------------------------------------
A0A7X9D1M8      ------------------------------------------------------------
A0A0L6JLG6      ------------------------------------------------------------
A0A7X8PYA7      ------------------------------------------------------------
G8LSN0          ------------------------------------------------------------
A0A1Y4N105      ------------------------------------------------------------
A0A1Y4QP75      ------------------------------------------------------------
A0A3D4QRB5      ------------------------------------------------------------
A0A349DEH5      ------------------------------------------------------------
A0A3D4T7B4      ------------------------------------------------------------
A0A350XYC7      ------------------------------------------------------------
R6DNR8          ------------------------------------------------------------
A0A355KUM5      ------------------------------------------------------------
R5YGY6          ------------------------------------------------------------
A0A7G9WCY6      ------------------------------------------------------------
A0A0A5GPA9      ------------------------------------------------------------
A0A271M6M4      ------------------------------------------------------------
A0A1C6G0U3      ------------------------------------------------------------
A0A3D4LLB3      ------------------------------------------------------------
A0A7C7AD93      ------------------------------------------------------------
A0A2V3W8U6      ------------------------------------------------------------
A0A6N3BXA1      ------------------------------------------------------------
A0A351SRI8      ------------------------------------------------------------
A0A1V5LU59      ------------------------------------------------------------
A0A7X8R9W1      ------------------------------------------------------------
A0A1E3BVC3      ------------------------------------------------------------
A0A4Q0I6S0      ------------------------------------------------------------
A3DF66          ------------------------------------------------------------
W4V1T8          ------------------------------------------------------------
A0A1C6ITD7      ------------------------------------------------------------
A0A381IX63      ------------------------------------------------------------
A0A1M6RWV2      ------------------------------------------------------------
A0A841ZT34      ------------------------------------------------------------
A0A1G9IUT4      ------------------------------------------------------------
A0A842GR80      ------------------------------------------------------------
A0A7X0TNH3      ------------------------------------------------------------
A0A842D596      ------------------------------------------------------------
A0A842EQ86      ------------------------------------------------------------
A0A842A220      ------------------------------------------------------------
A0A7X0YM80      ------------------------------------------------------------
A0A842GEL5      ------------------------------------------------------------
A0A841XVD7      ------------------------------------------------------------
A0A7X0XME5      ------------------------------------------------------------
A0A842B6T1      ------------------------------------------------------------
A0A841X7G0      ------------------------------------------------------------
A0A841W3M8      ------------------------------------------------------------
A0A7X0XVI0      ------------------------------------------------------------
A0A7X0Z1K1      ------------------------------------------------------------
A0A143ZUX1      ------------------------------------------------------------
A0A7I8D809      ------------------------------------------------------------
A0A3R9WAA7      ------------------------------------------------------------
A0A1G6BLF1      ------------------------------------------------------------
A0A355G1X5      ------------------------------------------------------------
A0A1W2CEA6      ------------------------------------------------------------
A0A355G3J9      ------------------------------------------------------------
A0A3D2AD87      ------------------------------------------------------------
A0A143XN92      ------------------------------------------------------------
R7FFK6          ------------------------------------------------------------
A0A373MPB9      ------------------------------------------------------------
A0A373L519      ------------------------------------------------------------
A0A373W906      ------------------------------------------------------------
A0A373VCW2      ------------------------------------------------------------
W0U604          ------------------------------------------------------------
A0A374B6G0      ------------------------------------------------------------
A0A373VM36      ------------------------------------------------------------
A0A1C5P379      ------------------------------------------------------------
A0A373XXX0      ------------------------------------------------------------
A0A5R9MJM9      ------------------------------------------------------------
A0A356CW82      ------------------------------------------------------------
R6T4X7          ------------------------------------------------------------
A0A374HTV1      ------------------------------------------------------------
A0A374GB66      ------------------------------------------------------------
A0A374ECC6      ------------------------------------------------------------
A0A374BM61      ------------------------------------------------------------
A0A373UGZ4      ------------------------------------------------------------
A0A373SA66      ------------------------------------------------------------
A0A1C5X6X7      ------------------------------------------------------------
A0A1C6JIH3      ------------------------------------------------------------
A0A373PSC3      ------------------------------------------------------------
A0A1K1WYK8      ------------------------------------------------------------
A0A1H6IUB1      ------------------------------------------------------------
A0A1M7L1F9      ------------------------------------------------------------
A0A1C6B4L6      ------------------------------------------------------------
A0A1Q6T9P4      ------------------------------------------------------------
A0A315Y4F9      ------------------------------------------------------------
A0A354K620      ------------------------------------------------------------
A0A173ZYY6      ------------------------------------------------------------
A0A6L8RXB5      ------------------------------------------------------------
A0A173SMI2      ------------------------------------------------------------
A0A845KKD0      ------------------------------------------------------------
A0A6N9JW85      ------------------------------------------------------------
A0A174ASH7      ------------------------------------------------------------
A6BH65          ------------------------------------------------------------
R7G0D7          ------------------------------------------------------------
R6HZX3          ------------------------------------------------------------
R5EFZ0          ------------------------------------------------------------
A0A3E5FSY5      ------------------------------------------------------------
A0A1V5S3C0      ------------------------------------------------------------
A0A3C0QME1      ------------------------------------------------------------
A0A355FYK5      ------------------------------------------------------------
A0A357AQU0      ------------------------------------------------------------
A0A3C1YJQ7      ------------------------------------------------------------
A0A3D0JG38      ------------------------------------------------------------
A0A3C0IHX1      ------------------------------------------------------------
R5V506          ------------------------------------------------------------
A0A352TIU5      ------------------------------------------------------------
R5B467          ------------------------------------------------------------
A0A1Y3TC98      ------------------------------------------------------------
A0A1W1Z4C3      ------------------------------------------------------------
A0A239QN83      ------------------------------------------------------------
A0A8A5CVI3      ------------------------------------------------------------
A0A8A5D3H1      ------------------------------------------------------------
A0A1Q6REE0      ------------------------------------------------------------
R5ETF9          ------------------------------------------------------------
A0A0F2P7X6      ------------------------------------------------------------
A0A359B487      ------------------------------------------------------------
R6VAT5          ------------------------------------------------------------
D4LC36          ------------------------------------------------------------
A0A7X3IXX7      ------------------------------------------------------------
A0A1Q6S448      ------------------------------------------------------------
A0A351MYR0      ------------------------------------------------------------
R6HPC1          ------------------------------------------------------------
A0A3D4G5Z5      ------------------------------------------------------------
A0A3D5ES03      ------------------------------------------------------------
A0A348P5V4      ------------------------------------------------------------
A0A356PT74      ------------------------------------------------------------
A0A3D5LL19      ------------------------------------------------------------
R5MNF0          ------------------------------------------------------------
A0A1Q9JSI0      ------------------------------------------------------------
A0A3D5TNI1      ------------------------------------------------------------
A0A358LJD0      ------------------------------------------------------------
R6I3L7          ------------------------------------------------------------
A0A3D1HXX0      ------------------------------------------------------------
A0A3D2QJB8      ------------------------------------------------------------
R7MQJ4          ------------------------------------------------------------
A0A1V5GLC0      ------------------------------------------------------------
W7V182          ------------------------------------------------------------
A0A143XPI5      ------------------------------------------------------------
A0A0M6WXE3      ------------------------------------------------------------
A0A348SAK2      ------------------------------------------------------------
A0A1G9H5B9      ------------------------------------------------------------
A0A1Y4H8L0      ------------------------------------------------------------
A0A4B9BMD9      ------------------------------------------------------------
A0A0M6WYQ8      ------------------------------------------------------------
A0A348SAK1      ------------------------------------------------------------
A0A252F281      ------------------------------------------------------------
A0A1Y4QKE6      ------------------------------------------------------------
B1C231          ------------------------------------------------------------
A0A7V6WIR4      ------------------------------------------------------------
A0A1Y3TUL5      ------------------------------------------------------------
A0A1Y4JAX2      ------------------------------------------------------------
A0A1Y4T590      ------------------------------------------------------------
A0A1Y3T163      ------------------------------------------------------------
A0A1Y3YCA2      ------------------------------------------------------------
A0A7W8H9H2      ------------------------------------------------------------
A0A1Y4L6N9      ------------------------------------------------------------
A0A173T644      ------------------------------------------------------------
A0A1C5TSB8      ------------------------------------------------------------
C0CIK6          ------------------------------------------------------------
A0A1Y3WEF6      ------------------------------------------------------------
A0A417T0L2      ------------------------------------------------------------
A0A1H9EPU3      ------------------------------------------------------------
A0A354IGV3      ------------------------------------------------------------
A0A417JMV2      ------------------------------------------------------------
A0A415VWX5      ------------------------------------------------------------
A0A173UY96      ------------------------------------------------------------
B0P408          ------------------------------------------------------------
D4MV82          ------------------------------------------------------------
A0A173QTL1      ------------------------------------------------------------
A0A174J359      ------------------------------------------------------------
A0A174A3T7      ------------------------------------------------------------
A0A417UUA3      ------------------------------------------------------------
A0A6N2VB70      ------------------------------------------------------------
A0A1C6EUV9      ------------------------------------------------------------
A0A173Y645      ------------------------------------------------------------
A0A374AVY6      ------------------------------------------------------------
R7BXS4          ------------------------------------------------------------
                                                                            

S3FFL2          DYREAQERERALKAQVDALKSSYLDLRRRSIQYNIYQQEVDTNRALYDGLLQRFKEIGVA
A0A328M4V1      ----LQSQIGQMEGQKAALQKQVGQLPDIQQQMLRLARDVQVSNTTYTSLLNQAQQLNIA
A0A6A8IF17      QIVTLNSQIKSLRQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELS
A0A143WVN6      ------------------------------------------------------------
W6RXP9          ------------------------------------------------------------
W6S4G8          ------------------------------------------------------------
A0A3D5R4X5      ------------------------------------------------------------
A0A1I4C3N6      ------------------------------------------------------------
A0A3B9CIM7      ------------------------------------------------------------
A0A7R7IBN8      ------------------------------------------------------------
A0A1G9WHW8      ------------------------------------------------------------
A0A1H5VAA0      ------------------------------------------------------------
A0A3R6VK11      ------------------------------------------------------------
A0A3R6QUY7      ------------------------------------------------------------
A0A373K3P9      ------------------------------------------------------------
A0A3R6JRU5      ------------------------------------------------------------
A0A1C5MS04      ------------------------------------------------------------
A0A3C1J150      ------------------------------------------------------------
A0A416CXD7      ------------------------------------------------------------
A0A6N2X662      ------------------------------------------------------------
R6XBL9          ------------------------------------------------------------
A0A355W5Z7      ------------------------------------------------------------
A0A1G6BLB6      ------------------------------------------------------------
A0A1C6G8M0      ------------------------------------------------------------
A0A416MP73      ------------------------------------------------------------
A0A3E4LL92      ------------------------------------------------------------
A0A415D1L1      ------------------------------------------------------------
A0A396G6S7      ------------------------------------------------------------
A0A3E5A223      ------------------------------------------------------------
R7D5E6          ------------------------------------------------------------
A0A415HQH5      ------------------------------------------------------------
A0A414W2C6      ------------------------------------------------------------
A5ZNE7          ------------------------------------------------------------
A0A395X821      ------------------------------------------------------------
A0A1C5PY68      ------------------------------------------------------------
A0A174CJF8      ------------------------------------------------------------
A0A564SRR2      ------------------------------------------------------------
A0A174R7V0      ------------------------------------------------------------
A0A373MWV2      ------------------------------------------------------------
A0A417CE88      ------------------------------------------------------------
A0A416Y441      ------------------------------------------------------------
A0A357GPJ7      ------------------------------------------------------------
A0A396PAC1      ------------------------------------------------------------
A0A416EYU4      ------------------------------------------------------------
A0A416SCQ2      ------------------------------------------------------------
A0A416TGN7      ------------------------------------------------------------
A0A417SMF6      ------------------------------------------------------------
A0A0H5SF45      ------------------------------------------------------------
A0A1M6JRJ5      ------------------------------------------------------------
A0A1M7Y1S2      ------------------------------------------------------------
A0A7I8DMN1      ------------------------------------------------------------
A0A1Y4MW77      ------------------------------------------------------------
A0A6S6R676      ------------------------------------------------------------
A0A0K8J554      ------------------------------------------------------------
A0A1I0RG99      ------------------------------------------------------------
A0A1I5G322      ------------------------------------------------------------
A0A7C6IYW8      ------------------------------------------------------------
A0A7C6JZF1      ------------------------------------------------------------
A0A3N1XSX6      ------------------------------------------------------------
A0A839K1C1      ------------------------------------------------------------
R6UHV6          ------------------------------------------------------------
A0A3R9Q621      ------------------------------------------------------------
A0A069RC75      ------------------------------------------------------------
A0A174F2W5      ------------------------------------------------------------
A0A174S8E9      ------------------------------------------------------------
A0A416ZL97      ------------------------------------------------------------
A0A174LSK1      ------------------------------------------------------------
A0A373GY92      ------------------------------------------------------------
A0A373NZQ6      ------------------------------------------------------------
A0A417I9B9      ------------------------------------------------------------
A0A417WQF8      ------------------------------------------------------------
A0A8B3CFR3      ------------------------------------------------------------
A0A373RZ83      ------------------------------------------------------------
A0A416U6I1      ------------------------------------------------------------
R7JQZ9          ------------------------------------------------------------
A0A1M5UYN6      ------------------------------------------------------------
A0A176JBT8      ------------------------------------------------------------
A0A1I5HIC6      ------------------------------------------------------------
A0A1Y3TC51      ------------------------------------------------------------
A0A1Y3T1N0      ------------------------------------------------------------
A0A1Y3Y8U8      ------------------------------------------------------------
A0A5B0BQY5      ------------------------------------------------------------
A6CLL4          ------------------------------------------------------------
A0A176U8D6      ------------------------------------------------------------
A0A1Q6KSQ5      ------------------------------------------------------------
A0A3D3U8B3      ------------------------------------------------------------
A0A3E5FRL7      ------------------------------------------------------------
A0A1Y4QK93      ------------------------------------------------------------
B1C232          ------------------------------------------------------------
A0A401USI6      ------------------------------------------------------------
A0A1V4IQ10      ------------------------------------------------------------
A0A1S8TRD2      ------------------------------------------------------------
G7M1U2          ------------------------------------------------------------
A0A2T6KJ75      ------------------------------------------------------------
A9KN92          ------------------------------------------------------------
A0A352MUJ1      ------------------------------------------------------------
R5YI67          ------------------------------------------------------------
A0A174DL89      ------------------------------------------------------------
A0A1Y0IQP5      ------------------------------------------------------------
A0A4R2R7B1      ------------------------------------------------------------
A0A1M6E8I2      ------------------------------------------------------------
A0A7C6SMH0      ------------------------------------------------------------
A0A7X7XYM7      ------------------------------------------------------------
A0A3B8KKL6      ------------------------------------------------------------
A0A2K9E6R0      ------------------------------------------------------------
A0A2S8RBI0      ------------------------------------------------------------
A0A7X8MFK9      ------------------------------------------------------------
A0A7X9D1M8      ------------------------------------------------------------
A0A0L6JLG6      ------------------------------------------------------------
A0A7X8PYA7      ------------------------------------------------------------
G8LSN0          ------------------------------------------------------------
A0A1Y4N105      ------------------------------------------------------------
A0A1Y4QP75      ------------------------------------------------------------
A0A3D4QRB5      ------------------------------------------------------------
A0A349DEH5      ------------------------------------------------------------
A0A3D4T7B4      ------------------------------------------------------------
A0A350XYC7      ------------------------------------------------------------
R6DNR8          ------------------------------------------------------------
A0A355KUM5      ------------------------------------------------------------
R5YGY6          ------------------------------------------------------------
A0A7G9WCY6      ------------------------------------------------------------
A0A0A5GPA9      ------------------------------------------------------------
A0A271M6M4      ------------------------------------------------------------
A0A1C6G0U3      ------------------------------------------------------------
A0A3D4LLB3      ------------------------------------------------------------
A0A7C7AD93      ------------------------------------------------------------
A0A2V3W8U6      ------------------------------------------------------------
A0A6N3BXA1      ------------------------------------------------------------
A0A351SRI8      ------------------------------------------------------------
A0A1V5LU59      ------------------------------------------------------------
A0A7X8R9W1      ------------------------------------------------------------
A0A1E3BVC3      ------------------------------------------------------------
A0A4Q0I6S0      ------------------------------------------------------------
A3DF66          ------------------------------------------------------------
W4V1T8          ------------------------------------------------------------
A0A1C6ITD7      ------------------------------------------------------------
A0A381IX63      ------------------------------------------------------------
A0A1M6RWV2      ------------------------------------------------------------
A0A841ZT34      ------------------------------------------------------------
A0A1G9IUT4      ------------------------------------------------------------
A0A842GR80      ------------------------------------------------------------
A0A7X0TNH3      ------------------------------------------------------------
A0A842D596      ------------------------------------------------------------
A0A842EQ86      ------------------------------------------------------------
A0A842A220      ------------------------------------------------------------
A0A7X0YM80      ------------------------------------------------------------
A0A842GEL5      ------------------------------------------------------------
A0A841XVD7      ------------------------------------------------------------
A0A7X0XME5      ------------------------------------------------------------
A0A842B6T1      ------------------------------------------------------------
A0A841X7G0      ------------------------------------------------------------
A0A841W3M8      ------------------------------------------------------------
A0A7X0XVI0      ------------------------------------------------------------
A0A7X0Z1K1      ------------------------------------------------------------
A0A143ZUX1      ------------------------------------------------------------
A0A7I8D809      ------------------------------------------------------------
A0A3R9WAA7      ------------------------------------------------------------
A0A1G6BLF1      ------------------------------------------------------------
A0A355G1X5      ------------------------------------------------------------
A0A1W2CEA6      ------------------------------------------------------------
A0A355G3J9      ------------------------------------------------------------
A0A3D2AD87      ------------------------------------------------------------
A0A143XN92      ------------------------------------------------------------
R7FFK6          ------------------------------------------------------------
A0A373MPB9      ------------------------------------------------------------
A0A373L519      ------------------------------------------------------------
A0A373W906      ------------------------------------------------------------
A0A373VCW2      ------------------------------------------------------------
W0U604          ------------------------------------------------------------
A0A374B6G0      ------------------------------------------------------------
A0A373VM36      ------------------------------------------------------------
A0A1C5P379      ------------------------------------------------------------
A0A373XXX0      ------------------------------------------------------------
A0A5R9MJM9      ------------------------------------------------------------
A0A356CW82      ------------------------------------------------------------
R6T4X7          ------------------------------------------------------------
A0A374HTV1      ------------------------------------------------------------
A0A374GB66      ------------------------------------------------------------
A0A374ECC6      ------------------------------------------------------------
A0A374BM61      ------------------------------------------------------------
A0A373UGZ4      ------------------------------------------------------------
A0A373SA66      ------------------------------------------------------------
A0A1C5X6X7      ------------------------------------------------------------
A0A1C6JIH3      ------------------------------------------------------------
A0A373PSC3      ------------------------------------------------------------
A0A1K1WYK8      ------------------------------------------------------------
A0A1H6IUB1      ------------------------------------------------------------
A0A1M7L1F9      ------------------------------------------------------------
A0A1C6B4L6      ------------------------------------------------------------
A0A1Q6T9P4      ------------------------------------------------------------
A0A315Y4F9      ------------------------------------------------------------
A0A354K620      ------------------------------------------------------------
A0A173ZYY6      ------------------------------------------------------------
A0A6L8RXB5      ------------------------------------------------------------
A0A173SMI2      ------------------------------------------------------------
A0A845KKD0      ------------------------------------------------------------
A0A6N9JW85      ------------------------------------------------------------
A0A174ASH7      ------------------------------------------------------------
A6BH65          ------------------------------------------------------------
R7G0D7          ------------------------------------------------------------
R6HZX3          ------------------------------------------------------------
R5EFZ0          ------------------------------------------------------------
A0A3E5FSY5      ------------------------------------------------------------
A0A1V5S3C0      ------------------------------------------------------------
A0A3C0QME1      ------------------------------------------------------------
A0A355FYK5      ------------------------------------------------------------
A0A357AQU0      ------------------------------------------------------------
A0A3C1YJQ7      ------------------------------------------------------------
A0A3D0JG38      ------------------------------------------------------------
A0A3C0IHX1      ------------------------------------------------------------
R5V506          ------------------------------------------------------------
A0A352TIU5      ------------------------------------------------------------
R5B467          ------------------------------------------------------------
A0A1Y3TC98      ------------------------------------------------------------
A0A1W1Z4C3      ------------------------------------------------------------
A0A239QN83      ------------------------------------------------------------
A0A8A5CVI3      ------------------------------------------------------------
A0A8A5D3H1      ------------------------------------------------------------
A0A1Q6REE0      ------------------------------------------------------------
R5ETF9          ------------------------------------------------------------
A0A0F2P7X6      ------------------------------------------------------------
A0A359B487      ------------------------------------------------------------
R6VAT5          ------------------------------------------------------------
D4LC36          ------------------------------------------------------------
A0A7X3IXX7      ------------------------------------------------------------
A0A1Q6S448      ------------------------------------------------------------
A0A351MYR0      ------------------------------------------------------------
R6HPC1          ------------------------------------------------------------
A0A3D4G5Z5      ------------------------------------------------------------
A0A3D5ES03      ------------------------------------------------------------
A0A348P5V4      ------------------------------------------------------------
A0A356PT74      ------------------------------------------------------------
A0A3D5LL19      ------------------------------------------------------------
R5MNF0          ------------------------------------------------------------
A0A1Q9JSI0      ------------------------------------------------------------
A0A3D5TNI1      ------------------------------------------------------------
A0A358LJD0      ------------------------------------------------------------
R6I3L7          ------------------------------------------------------------
A0A3D1HXX0      ------------------------------------------------------------
A0A3D2QJB8      ------------------------------------------------------------
R7MQJ4          ------------------------------------------------------------
A0A1V5GLC0      ------------------------------------------------------------
W7V182          ------------------------------------------------------------
A0A143XPI5      ------------------------------------------------------------
A0A0M6WXE3      ------------------------------------------------------------
A0A348SAK2      ------------------------------------------------------------
A0A1G9H5B9      ------------------------------------------------------------
A0A1Y4H8L0      ------------------------------------------------------------
A0A4B9BMD9      ------------------------------------------------------------
A0A0M6WYQ8      ------------------------------------------------------------
A0A348SAK1      ------------------------------------------------------------
A0A252F281      ------------------------------------------------------------
A0A1Y4QKE6      ------------------------------------------------------------
B1C231          ------------------------------------------------------------
A0A7V6WIR4      --------------------------------------------------GTAETRIKGG
A0A1Y3TUL5      ------------------------------------------------------------
A0A1Y4JAX2      ------------------------------------------------------------
A0A1Y4T590      ------------------------------------------------------------
A0A1Y3T163      ------------------------------------------------------------
A0A1Y3YCA2      ------------------------------------------------------------
A0A7W8H9H2      ------------------------------------------------------------
A0A1Y4L6N9      ------------------------------------------------------------
A0A173T644      ------------------------------------------------------------
A0A1C5TSB8      ------------------------------------------------------------
C0CIK6          ------------------------------------------------------------
A0A1Y3WEF6      ------------------------------------------------------------
A0A417T0L2      ------------------------------------------------------------
A0A1H9EPU3      ------------------------------------------------------------
A0A354IGV3      ------------------------------------------------------------
A0A417JMV2      ------------------------------------------------------------
A0A415VWX5      ------------------------------------------------------------
A0A173UY96      ------------------------------------------------------------
B0P408          ------------------------------------------------------------
D4MV82          ------------------------------------------------------------
A0A173QTL1      ------------------------------------------------------------
A0A174J359      ------------------------------------------------------------
A0A174A3T7      ------------------------------------------------------------
A0A417UUA3      ------------------------------------------------------------
A0A6N2VB70      ------------------------------------------------------------
A0A1C6EUV9      ------------------------------------------------------------
A0A173Y645      ------------------------------------------------------------
A0A374AVY6      ------------------------------------------------------------
R7BXS4          ------------------------------------------------------------
                                                                            

S3FFL2          GGVGINNIAVVD-AADV------PQ-----------------------------------
A0A328M4V1      RAGTVGNVRVIDRAATD------TA-----------------------------------
A0A6A8IF17      QAFTAYNTRIVT-PPHG------SM-----------------------------------
A0A143WVN6      --FSNASLQMVR-EPNV------PY-----------------------------------
W6RXP9          --VPNGNVKVIR-EVRV-PKD--PV-----------------------------------
W6S4G8          --VPNGNVKIIR-HVKE-AEA--PI-----------------------------------
A0A3D5R4X5      --MNVDNVKILD-KAVT------PT-----------------------------------
A0A1I4C3N6      --VKSGGLQVLD-EAKL------PT-----------------------------------
A0A3B9CIM7      --VKSGGIEVLD-EAEL------PT-----------------------------------
A0A7R7IBN8      --VKSGGIEVLD-KAEL------PT-----------------------------------
A0A1G9WHW8      --VKAGGVQVLD-SAEL------PT-----------------------------------
A0A1H5VAA0      --VKAGGVQVLD-SAEL------PT-----------------------------------
A0A3R6VK11      --VKSGGIEVID-YATL------PE-----------------------------------
A0A3R6QUY7      --VKSGGIEVID-YATL------PE-----------------------------------
A0A373K3P9      --VKSGGIEVID-YATL------PE-----------------------------------
A0A3R6JRU5      --VKSGGIEVID-YATL------PE-----------------------------------
A0A1C5MS04      --VKSGGIEVID-YATL------PE-----------------------------------
A0A3C1J150      --VKSGGIEVID-YATL------PE-----------------------------------
A0A416CXD7      --VKSGGIEVID-YATL------PE-----------------------------------
A0A6N2X662      --VKSGGIEVID-YATL------PE-----------------------------------
R6XBL9          --VKSGGIEVID-YATL------PE-----------------------------------
A0A355W5Z7      --VKSGGIEVID-YATL------PE-----------------------------------
A0A1G6BLB6      --LGSVIMTILD-QSDI------PT-----------------------------------
A0A1C6G8M0      --LGSNTPTVLD-KADEFFAE--NT-----------------------------------
A0A416MP73      --LGSSKPTILD-KADDLFAE--NT-----------------------------------
A0A3E4LL92      --ESGYVLQPLS-SISA-NNVQRTE-----------------------------------
A0A415D1L1      --ESGYVLQPLS-SISA-NNVQKTE-----------------------------------
A0A396G6S7      --IKNVIIETIQ-QPSV-AMA--PI-----------------------------------
A0A3E5A223      --IKNVIIETIQ-QPSV-AMA--PI-----------------------------------
R7D5E6          --IKNVIIETIQ-QPSV-AMA--PI-----------------------------------
A0A415HQH5      --IKNVIIETIQ-QPSV-AMA--PI-----------------------------------
A0A414W2C6      --IKNVIIETIQ-QPSV-AMA--PI-----------------------------------
A5ZNE7          --IKNVIIETIQ-QPSV-AMA--PI-----------------------------------
A0A395X821      --IKNVIIETIQ-QPSV-AMA--PI-----------------------------------
A0A1C5PY68      --IKNVIIETIQ-QPSV-AMA--PI-----------------------------------
A0A174CJF8      --IKNVIIETIQ-QPSV-AMA--PI-----------------------------------
A0A564SRR2      --IKNVIIETIQ-QPSV-AMA--PI-----------------------------------
A0A174R7V0      --IKNVIIETIQ-QPSV-AMA--PI-----------------------------------
A0A373MWV2      --IPNVVLETLQ-QPQV-SDNPSNR-----------------------------------
A0A417CE88      --IPNVVLETLQ-QPQV-SGNPSNR-----------------------------------
A0A416Y441      --IPNVVLETLQ-QPQV-SGNPSNR-----------------------------------
A0A357GPJ7      --IPNVVLETLQ-QPQV-SDNPSNR-----------------------------------
A0A396PAC1      --IPNVVLETLQ-QPQV-SDNPSNR-----------------------------------
A0A416EYU4      --IPNVVLETLQ-QPQV-SDNPSNR-----------------------------------
A0A416SCQ2      --IPNVVLETLQ-QPQV-SDNPSNR-----------------------------------
A0A416TGN7      --IPNVVLETLQ-QPQV-SGNPSNR-----------------------------------
A0A417SMF6      --IPNVVLETLQ-QPQV-SGNPSNR-----------------------------------
A0A0H5SF45      --KENSKISVVD-PVVY-PAG--PS-----------------------------------
A0A1M6JRJ5      --KSDAVINVVD-PVVY-QPS--PS-----------------------------------
A0A1M7Y1S2      --KTNSMIYVVD-PVVC-PTS--PS-----------------------------------
A0A7I8DMN1      --KSDAVISVVD-PVIY-QGA--PT-----------------------------------
A0A1Y4MW77      --IGMTKFNMIE-NPSV-SNV--PY-----------------------------------
A0A6S6R676      --KDTAEISVVD-PVVL-PTS--PS-----------------------------------
A0A0K8J554      --KNNAKITVID-PVVF-PTG--PS-----------------------------------
A0A1I0RG99      --KETSQITVVD-PPTL-PTS--PS-----------------------------------
A0A1I5G322      --KDTAQISIVD-PPAL-PTS--PS-----------------------------------
A0A7C6IYW8      --KPSAKISVVD-PVDF-PTK--PS-----------------------------------
A0A7C6JZF1      --KDSSEISIVD-PVVL-PES--PS-----------------------------------
A0A3N1XSX6      --KPSAQISVVD-PVSV-PTK--PS-----------------------------------
A0A839K1C1      --KPSAKISVVD-PVIF-PKV--PS-----------------------------------
R6UHV6          --VSSIVLQTLE-EPVV-PTE--PT-----------------------------------
A0A3R9Q621      --KNTTEISVVD-PVVM-PRQ--PS-----------------------------------
A0A069RC75      --MNDENVRVID-YAKI-PAV--PS-----------------------------------
A0A174F2W5      --IPNVVLETLQ-QPQV-SGNPSNR-----------------------------------
A0A174S8E9      --IPNVVLETLQ-QPQV-SGNPSNR-----------------------------------
A0A416ZL97      --IPNVVLETLQ-QPQV-SGVPSNQ-----------------------------------
A0A174LSK1      --IPNVVLETLQ-QPQV-SGVPSNQ-----------------------------------
A0A373GY92      --IPNVVLETLQ-QPQV-SGVPSNQ-----------------------------------
A0A373NZQ6      --IPNVVLETLQ-QPQV-SGVPSNQ-----------------------------------
A0A417I9B9      --IPNVVLETLQ-QPQV-SGVPSNQ-----------------------------------
A0A417WQF8      --IPNVVLETLQ-QPQV-SGVPSNQ-----------------------------------
A0A8B3CFR3      --IPNVVLETLQ-QPQV-SGVPSNQ-----------------------------------
A0A373RZ83      --IPNVVLETLQ-QPQV-SGVPSNQ-----------------------------------
A0A416U6I1      --IPNVVLETLQ-QPQV-SGVPSNQ-----------------------------------
R7JQZ9          --IPNVVLETLQ-QPQV-SGVPSNQ-----------------------------------
A0A1M5UYN6      --IPNGNIKIFQ-NPRSFQDSVNKI-----------------------------------
A0A176JBT8      --MKIENVNILT-IATP-YSS--TS-----------------------------------
A0A1I5HIC6      --LEMEKVNIVE-EGDI-PSF--PT-----------------------------------
A0A1Y3TC51      --FSNASLRTVQ-EPEV-PSA--PS-----------------------------------
A0A1Y3T1N0      --FSNASLQILQ-EPQV-PSS--PS-----------------------------------
A0A1Y3Y8U8      --FSNASLQILQ-EPQV-PSS--PS-----------------------------------
A0A5B0BQY5      --MNLDNITILK-EVIV-GTDTKMI-----------------------------------
A6CLL4          --MQIDNIQILS-YAQE-QDSTTPV-----------------------------------
A0A176U8D6      --LGSSVPTVLD-KAELSFTE--NT-----------------------------------
A0A1Q6KSQ5      --LGSNTPTVLD-KADEFFAE--NT-----------------------------------
A0A3D3U8B3      --LGSNTPTVLD-KADEFFAE--NT-----------------------------------
A0A3E5FRL7      --FTNATLQVLQ-EPSI-PIT--PS-----------------------------------
A0A1Y4QK93      --FTNATLQVLQ-EPSI-PTT--PS-----------------------------------
B1C232          --FTNATLQVLQ-EPSI-PTT--PS-----------------------------------
A0A401USI6      --LPSGIAKIMD-KALI-PEL--PI-----------------------------------
A0A1V4IQ10      --IPNGIVKVIE-DVVI-SET--LT-----------------------------------
A0A1S8TRD2      --IPDSTVKVIE-DVVI-SET--LT-----------------------------------
G7M1U2          --IPDSTVKVIE-DVVI-SET--LT-----------------------------------
A0A2T6KJ75      --MNLENVHILS-QATV-NEDTKSV-----------------------------------
A9KN92          --LEMEKVNIVE-EGNI-PTI--PT-----------------------------------
A0A352MUJ1      --YHMENIRVVD-KAVA------PS-----------------------------------
R5YI67          --YNMENIRVVD-KAVA------PS-----------------------------------
A0A174DL89      --RGVDNVILVD-SASI-PEK--PT-----------------------------------
A0A1Y0IQP5      --MQVDNISILD-TAKLTSDVQQPV-----------------------------------
A0A4R2R7B1      --MQVDNVSILD-TAKLTSDVLEPV-----------------------------------
A0A1M6E8I2      --LKVDNVEIID-EAIP-IDH--PV-----------------------------------
A0A7C6SMH0      --IEVKNVMVVD-EASA-PVS--PV-----------------------------------
A0A7X7XYM7      --IEVKNVMVVD-EASI-PRS--PV-----------------------------------
A0A3B8KKL6      --IEVKNVMVVD-EANM-PNS--PV-----------------------------------
A0A2K9E6R0      --IEVKNVMVVD-EANM-PNS--PV-----------------------------------
A0A2S8RBI0      --IEVKNVMVVD-EANM-PNS--PV-----------------------------------
A0A7X8MFK9      --IEVKNVNIVD-TAEI-PDA--PI-----------------------------------
A0A7X9D1M8      --IEVKNIKVID-TAVV-PIN--PI-----------------------------------
A0A0L6JLG6      --IEVKNVKVID-TAKD-PKD--PV-----------------------------------
A0A7X8PYA7      --IQVKNVKVID-TAKT-PTF--PV-----------------------------------
G8LSN0          --IQVKNVSIID-VAKV-PER--PV-----------------------------------
A0A1Y4N105      --FSNASLQMVQ-DASV-PMS--AS-----------------------------------
A0A1Y4QP75      --FSNASLQMVQ-DASV-PMS--AS-----------------------------------
A0A3D4QRB5      --LNMENVQVID-TARV-SQI--PI-----------------------------------
A0A349DEH5      --YPYAQLNLLD-TPVL-STY--PN-----------------------------------
A0A3D4T7B4      --YPYAQLNLLD-TPVL-STY--PN-----------------------------------
A0A350XYC7      --YSNAKLTLCD-RPVL-STA--PN-----------------------------------
R6DNR8          --YPNAKLTLCD-KPVL-STA--PN-----------------------------------
A0A355KUM5      --YPNAKLTLCD-TPVL-PTY--PN-----------------------------------
R5YGY6          --YPNAKLTLCD-TPVL-PTY--PN-----------------------------------
A0A7G9WCY6      --LNIDNIQILD-RASV-PTS--PV-----------------------------------
A0A0A5GPA9      --MNLNNVQILT-RSNP-DAHETPI-----------------------------------
A0A271M6M4      --MKIDNVDILT-GAKI-VNKGRPV-----------------------------------
A0A1C6G0U3      --TNTNKVEIID-KAIV-NEK--PI-----------------------------------
A0A3D4LLB3      --TKTNNVAVVD-YARL-PLA--PV-----------------------------------
A0A7C7AD93      --YPSYSIKTLE-MVG-------PY-----------------------------------
A0A2V3W8U6      --MNLENVNILT-EAKV-EKHKTPI-----------------------------------
A0A6N3BXA1      --TKASGVEVID-KATV-PTK--HI-----------------------------------
A0A351SRI8      --FNIENISIID-EATV-GEE--PY-----------------------------------
A0A1V5LU59      --IQVKNVKVID-IAKV-PET--PI-----------------------------------
A0A7X8R9W1      --IEVNNVQVID-TAKV-PSK--PV-----------------------------------
A0A1E3BVC3      --IQVKNIKVID-TAKI-PEN--PI-----------------------------------
A0A4Q0I6S0      --IQVKNIKVID-TAKI-PEN--PI-----------------------------------
A3DF66          --IQVKNIKVID-TAKI-PEN--PI-----------------------------------
W4V1T8          --IQVKNIKVID-TAKI-PEN--PI-----------------------------------
A0A1C6ITD7      --RGVDNVIMVD-TASI-PEK--PS-----------------------------------
A0A381IX63      --SKVDGGQVID-EALL-PTQ--PI-----------------------------------
A0A1M6RWV2      --IKMENVRILD-YAVV-PSN--PI-----------------------------------
A0A841ZT34      --WDMDSIQIIS-LSNM-NKIQDPV-----------------------------------
A0A1G9IUT4      --MKTNNVEIID-KSTI-PDK--PV-----------------------------------
A0A842GR80      --WGEDNIQIIS-PAQL-KDSQTPI-----------------------------------
A0A7X0TNH3      --WGEDNIQIIS-PAQL-KDSQTPI-----------------------------------
A0A842D596      --WGEDNIQIIS-PAQL-KDSQTPI-----------------------------------
A0A842EQ86      --WGEDNIQIIS-PAQL-KDSQTPI-----------------------------------
A0A842A220      --WGEDNIQIIS-PAQL-KDSQTPI-----------------------------------
A0A7X0YM80      --WGEDNIQIIS-PAQL-KDSQTPI-----------------------------------
A0A842GEL5      --WGEDNIQIIS-PAQL-KDSQTPI-----------------------------------
A0A841XVD7      --WGEDNIQIIS-PAQL-KDSQTPI-----------------------------------
A0A7X0XME5      --WGEDNIQIIS-PAQL-KDSQTPI-----------------------------------
A0A842B6T1      --WGEDNIQIIS-PAQL-KDSQTPI-----------------------------------
A0A841X7G0      --WGEDNIQIIS-PAQL-KDSQTPI-----------------------------------
A0A841W3M8      --WGEDNIQIIS-PAQL-KDSQTPI-----------------------------------
A0A7X0XVI0      --WGEDNIQIIS-PAQL-KDSQTPI-----------------------------------
A0A7X0Z1K1      --WGEDNIQIIS-PAQL-KDSQTPI-----------------------------------
A0A143ZUX1      --SGTAFVNSVQ-KIQ-------PR-----------------------------------
A0A7I8D809      --SGTAFVNSVQ-KIQ-------PR-----------------------------------
A0A3R9WAA7      --VGTTHLNMIE-ESGI------PA-----------------------------------
A0A1G6BLF1      --IGSTTLEVMS-ESGV------PT-----------------------------------
A0A355G1X5      --YPNATLQIYE-KPFK------PT-----------------------------------
A0A1W2CEA6      --MELRKPQILE-KART------PI-----------------------------------
A0A355G3J9      --VKAASVEIIE-EPKL------PT-----------------------------------
A0A3D2AD87      --VDKNIRVSTT-NADS------TS-----------------------------------
A0A143XN92      --VSNVILEVLE-EPQI------PM-----------------------------------
R7FFK6          --VGAGSVEKIG-DAKI------YD-----------------------------------
A0A373MPB9      --IGAGSVEKIG-DAEV------YN-----------------------------------
A0A373L519      --IGAGSVEKIG-DAEV------YN-----------------------------------
A0A373W906      --IGAGSVEKIG-DAEV------YN-----------------------------------
A0A373VCW2      --IGAGSVEKIG-DAEV------YN-----------------------------------
W0U604          --IGAGSVEKIG-DAEV------YN-----------------------------------
A0A374B6G0      --IGAGSVEKIG-DAEV------YN-----------------------------------
A0A373VM36      --IGAGSVEKIG-DAEV------YN-----------------------------------
A0A1C5P379      --IGAGSVEKIG-DAEV------YN-----------------------------------
A0A373XXX0      --IGAGSVEKIG-DAEV------YN-----------------------------------
A0A5R9MJM9      --IGAGSVEKIG-DAEV------YN-----------------------------------
A0A356CW82      --IGAGSVEKIG-DAEV------YN-----------------------------------
R6T4X7          --IGAGSVEKIG-DAEV------YN-----------------------------------
A0A374HTV1      --IGAGSVEKIG-DAEV------YN-----------------------------------
A0A374GB66      --IGAGSVEKIG-DAEV------YN-----------------------------------
A0A374ECC6      --IGAGSVEKIG-DAEV------YN-----------------------------------
A0A374BM61      --IGAGSVEKIG-DAEV------YN-----------------------------------
A0A373UGZ4      --IGAGSVEKIG-DAEV------YN-----------------------------------
A0A373SA66      --IGAGSVEKIG-DAEV------YN-----------------------------------
A0A1C5X6X7      --IGAGSVEKIG-DAEV------YN-----------------------------------
A0A1C6JIH3      --IGAGSVEKIG-DAEV------YN-----------------------------------
A0A373PSC3      --IGAGSVEKIG-DAEV------YN-----------------------------------
A0A1K1WYK8      --VGVGSINTIG-KAKV------YK-----------------------------------
A0A1H6IUB1      --VGVGSINTID-RAKV------YN-----------------------------------
A0A1M7L1F9      --VGVGSINTID-VAKV------YN-----------------------------------
A0A1C6B4L6      --VGVGSINTID-KAKV------YE-----------------------------------
A0A1Q6T9P4      --VGVGSINTID-KAKV------YE-----------------------------------
A0A315Y4F9      --VGVGSINTID-TAKV------YN-----------------------------------
A0A354K620      --VGVGSINTID-TAKV------YK-----------------------------------
A0A173ZYY6      --VGSAVMDVLE-EPKV------PY-----------------------------------
A0A6L8RXB5      --VGSAVMDVLE-EPKV------PY-----------------------------------
A0A173SMI2      --VGSAVMDVLE-EPKV------PY-----------------------------------
A0A845KKD0      --VGSAVMDVLE-EPKV------PY-----------------------------------
A0A6N9JW85      --VGSAVMDVLE-EPKI------PY-----------------------------------
A0A174ASH7      --VGSAVMDVLE-EPKI------PY-----------------------------------
A6BH65          --VGSAVMDVLE-EPKI------PY-----------------------------------
R7G0D7          --VGSAVMDVLE-EPKI------PY-----------------------------------
R6HZX3          --IGGTQLSMIE-EPQV------PT-----------------------------------
R5EFZ0          --IDDIGLEVLQ-YPAV------PT-----------------------------------
A0A3E5FSY5      --LGQIQFHMIN-NPQL------PT-----------------------------------
A0A1V5S3C0      --FPNAKYTVVN-DATE------PN-----------------------------------
A0A3C0QME1      --VGAGSVEVID-VAES------VY-----------------------------------
A0A355FYK5      --ASTINVRLIN-YPSS------PA-----------------------------------
A0A357AQU0      --VGAGSVEIIG-AAVP------AT-----------------------------------
A0A3C1YJQ7      --VGAGSVEIIG-AAVP------AT-----------------------------------
A0A3D0JG38      --VGAGSVEIIG-AAVP------AT-----------------------------------
A0A3C0IHX1      --IGAGSVEVIG-DAEI------PQ-----------------------------------
R5V506          --IGAGSVEVIG-DAEI------PQ-----------------------------------
A0A352TIU5      --IGAGSVEVIG-DAEV------PQ-----------------------------------
R5B467          --VGPTELVMMD-QTGV------PT-----------------------------------
A0A1Y3TC98      --LGDIQFNMLD-GPET-------------------------------------------
A0A1W1Z4C3      --VAAGEAKAQD-YATI------PM-----------------------------------
A0A239QN83      --VTAGEAKAQD-YAVV------PL-----------------------------------
A0A8A5CVI3      --VSAGEAKAQD-YATV------PM-----------------------------------
A0A8A5D3H1      --VAAGEAKAQD-YASV------PM-----------------------------------
A0A1Q6REE0      --VGSTVLVLLD-ESGM-------------------------------------------
R5ETF9          --VGSTVLVLLD-ESGM-------------------------------------------
A0A0F2P7X6      --VEVGSINVLD-NAKV------PE-----------------------------------
A0A359B487      --VEVGSINVLD-NAKV------PE-----------------------------------
R6VAT5          --VGATDLVLVV-PPSA------SS-----------------------------------
D4LC36          --VGAGSVEKIG-DAKI------YE-----------------------------------
A0A7X3IXX7      --EG-------N-SSPV-------------------------------------------
A0A1Q6S448      --SSSAVLTQLN-APSL-------------------------------------------
A0A351MYR0      --SSTAVLSQLN-SPSL-------------------------------------------
R6HPC1          --SSTAVLSQLN-APTL-------------------------------------------
A0A3D4G5Z5      --SSTAVLSQLN-APTL-------------------------------------------
A0A3D5ES03      --SSTAVLSQLN-APTL-------------------------------------------
A0A348P5V4      --FPNTALTVID-PPLK------AE-----------------------------------
A0A356PT74      --FPSTTLTVID-PPLL------AS-----------------------------------
A0A3D5LL19      --FPSTTLTVID-PPLL------AS-----------------------------------
R5MNF0          --FPSTTLTVID-PPLL------AS-----------------------------------
A0A1Q9JSI0      --MGNVVLDVLQ-NPTV------PS-----------------------------------
A0A3D5TNI1      --SGGSI-HLCD-MPEL------PT-----------------------------------
A0A358LJD0      --SGGSI-HLCD-EPEL------PT-----------------------------------
R6I3L7          --SGGSI-HLCD-EPEL------PT-----------------------------------
A0A3D1HXX0      --SGGSI-HLCD-EPEL------PT-----------------------------------
A0A3D2QJB8      --SGGSI-HLCD-EPEL------PT-----------------------------------
R7MQJ4          --VGAGSVEAIG-TAKV------NN-----------------------------------
A0A1V5GLC0      --IGVGQINYID-TAKV------YP-----------------------------------
W7V182          --VGVGQINTIG-TAEV------YN-----------------------------------
A0A143XPI5      --IGSTKLVIVD-DSGV------PK-----------------------------------
A0A0M6WXE3      --VGTTVLDVLE-DPKI------PY-----------------------------------
A0A348SAK2      --VGTTVLDVLE-DPKI------PY-----------------------------------
A0A1G9H5B9      --VGVGNVDIMD-YAVV------PV-----------------------------------
A0A1Y4H8L0      --LGNAVLEPLD-EPEI------PL-----------------------------------
A0A4B9BMD9      --FREAEISQLY-KKDH------PTYRALLEKRQTLEQERKRLNKRVSAMPSTQQEVLRL
A0A0M6WYQ8      --LGNTTLKILD-ETGV------PD-----------------------------------
A0A348SAK1      --LGNTTLKILD-ETGV------PD-----------------------------------
A0A252F281      --LSGAVFTVVR-EPQI------AR-----------------------------------
A0A1Y4QKE6      --LGQIQFHMIN-NPQL------PT-----------------------------------
B1C231          --LGQIQFHMIN-NPQL------PT-----------------------------------
A0A7V6WIR4      IDFGQASILIVS-AAVT------PV-----------------------------------
A0A1Y3TUL5      --LKIGSVSVIN-EPKA------TY-----------------------------------
A0A1Y4JAX2      --LKIGSVSVIN-EPKA------TY-----------------------------------
A0A1Y4T590      --LKIGSVSVIN-EPKA------TY-----------------------------------
A0A1Y3T163      --LGDIQFNYLN-EPET------PT-----------------------------------
A0A1Y3YCA2      --LGDIQFNYLN-EPET------PT-----------------------------------
A0A7W8H9H2      --IGATRFNMIE-EPEE------PT-----------------------------------
A0A1Y4L6N9      --IGNTKFNMID-VPTE------PT-----------------------------------
A0A173T644      --IGETKFNMID-VPTA------PK-----------------------------------
A0A1C5TSB8      --IGETKFNMID-VPTA------PK-----------------------------------
C0CIK6          --IGETKFNMID-VPTA------PK-----------------------------------
A0A1Y3WEF6      --IGDTRFSMID-EPTT------PT-----------------------------------
A0A417T0L2      --IGDTKFNMID-EPST------PT-----------------------------------
A0A1H9EPU3      --IGVDTVKAID-GDIG------AV-----------------------------------
A0A354IGV3      --FSSIVLTVID-GPYI------PT-----------------------------------
A0A417JMV2      --IGNVVLDVLQ-KPTV------PS-----------------------------------
A0A415VWX5      --IGNVVLDVLQ-KPTV------PS-----------------------------------
A0A173UY96      --IGNVVLDVLQ-KPTV------PS-----------------------------------
B0P408          --IGNVVLDVLQ-KPTV------PS-----------------------------------
D4MV82          --IGNVVLDVLQ-KPTV------PS-----------------------------------
A0A173QTL1      --IGNVVLDVLQ-KPTV------PS-----------------------------------
A0A174J359      --IGNVVLDVLQ-KPTV------PS-----------------------------------
A0A174A3T7      --IGNVVLDVLQ-KPTV------PS-----------------------------------
A0A417UUA3      --IGNVVLDVLQ-KPTV------PS-----------------------------------
A0A6N2VB70      --IGNVVLDVLQ-KPTV------PS-----------------------------------
A0A1C6EUV9      --IGTVVLDVLQ-NPTV------PS-----------------------------------
A0A173Y645      --IGTVVLDVLQ-NPTV------PS-----------------------------------
A0A374AVY6      --IGTVVLDVLQ-NPTV------PS-----------------------------------
R7BXS4          --IGTVVLDVLQ-NPTV------PS-----------------------------------
                                                                            

S3FFL2          ---------------------------------------KPSRPRLL-------------
A0A328M4V1      ---------------------------------------KPVWPRKL-------------
A0A6A8IF17      ---------------------------------------LPTSPVHK-------------
A0A143WVN6      ---------------------------------------GPSNYVNY-------------
W6RXP9          ---------------------------------------APNKVMNI-------------
W6S4G8          ---------------------------------------SPNKKMNI-------------
A0A3D5R4X5      ---------------------------------------SPIKPNKM-------------
A0A1I4C3N6      ---------------------------------------EPYESTST-------------
A0A3B9CIM7      ---------------------------------------VPYQSTSV-------------
A0A7R7IBN8      ---------------------------------------VPYQSTSV-------------
A0A1G9WHW8      ---------------------------------------SPYQQTNV-------------
A0A1H5VAA0      ---------------------------------------SPYQQTNV-------------
A0A3R6VK11      ---------------------------------------APYSSTSL-------------
A0A3R6QUY7      ---------------------------------------APYSSTSL-------------
A0A373K3P9      ---------------------------------------APYSSTSL-------------
A0A3R6JRU5      ---------------------------------------APYSSTSL-------------
A0A1C5MS04      ---------------------------------------APYSSTSL-------------
A0A3C1J150      ---------------------------------------APYSSTSL-------------
A0A416CXD7      ---------------------------------------APYSSTSL-------------
A0A6N2X662      ---------------------------------------APYSSTSL-------------
R6XBL9          ---------------------------------------APYSSTSL-------------
A0A355W5Z7      ---------------------------------------APYSSTSL-------------
A0A1G6BLB6      ---------------------------------------QPDAAFAP-------------
A0A1C6G8M0      ---------------------------------------RRSVVSYI-------------
A0A416MP73      ---------------------------------------RRSVLSYA-------------
A0A3E4LL92      ---------------------------------------KATVKYSA-------------
A0A415D1L1      ---------------------------------------KATLRYSL-------------
A0A396G6S7      ---------------------------------------NPLDEKRT-------------
A0A3E5A223      ---------------------------------------NPLDEKRT-------------
R7D5E6          ---------------------------------------NPLDEKRT-------------
A0A415HQH5      ---------------------------------------NPLDEKRT-------------
A0A414W2C6      ---------------------------------------NPLDEKRT-------------
A5ZNE7          ---------------------------------------NPLDEKRT-------------
A0A395X821      ---------------------------------------NPLDEKRT-------------
A0A1C5PY68      ---------------------------------------NPLDEKRT-------------
A0A174CJF8      ---------------------------------------NPLDEKRT-------------
A0A564SRR2      ---------------------------------------NPLDEKRT-------------
A0A174R7V0      ---------------------------------------NPLDEKRT-------------
A0A373MWV2      ---------------------------------------IPTEKYAA-------------
A0A417CE88      ---------------------------------------IPTEKYAA-------------
A0A416Y441      ---------------------------------------IPTEKYAA-------------
A0A357GPJ7      ---------------------------------------IPTEKYAA-------------
A0A396PAC1      ---------------------------------------IPTEKYAA-------------
A0A416EYU4      ---------------------------------------IPTEKYAA-------------
A0A416SCQ2      ---------------------------------------IPTEKYAA-------------
A0A416TGN7      ---------------------------------------IPTEKYAA-------------
A0A417SMF6      ---------------------------------------IPTEKYAA-------------
A0A0H5SF45      ---------------------------------------GPNIYLNT-------------
A0A1M6JRJ5      ---------------------------------------GPNTILNT-------------
A0A1M7Y1S2      ---------------------------------------GPNILLNT-------------
A0A7I8DMN1      ---------------------------------------GPNILLNT-------------
A0A1Y4MW77      ---------------------------------------NQLNYFNT-------------
A0A6S6R676      ---------------------------------------EPNILLNA-------------
A0A0K8J554      ---------------------------------------GPNILLNT-------------
A0A1I0RG99      ---------------------------------------SPNILKNT-------------
A0A1I5G322      ---------------------------------------SPNIFKNT-------------
A0A7C6IYW8      ---------------------------------------GPNIIKNT-------------
A0A7C6JZF1      ---------------------------------------GPNILLNT-------------
A0A3N1XSX6      ---------------------------------------SPNILKNT-------------
A0A839K1C1      ---------------------------------------GPNILRNT-------------
R6UHV6          ---------------------------------------NPSNALKL-------------
A0A3R9Q621      ---------------------------------------GPHVLLNT-------------
A0A069RC75      ---------------------------------------KPDKILNM-------------
A0A174F2W5      ---------------------------------------IPTEKYAA-------------
A0A174S8E9      ---------------------------------------IPTEKYAA-------------
A0A416ZL97      ---------------------------------------IPTKKYAA-------------
A0A174LSK1      ---------------------------------------IPTKKYAA-------------
A0A373GY92      ---------------------------------------IPTKKYAA-------------
A0A373NZQ6      ---------------------------------------IPTKKYAA-------------
A0A417I9B9      ---------------------------------------IPTKKYAA-------------
A0A417WQF8      ---------------------------------------IPTKKYAA-------------
A0A8B3CFR3      ---------------------------------------IPTKKYAA-------------
A0A373RZ83      ---------------------------------------IPTKKYAA-------------
A0A416U6I1      ---------------------------------------IPTKKYAA-------------
R7JQZ9          ---------------------------------------IPTKKYAA-------------
A0A1M5UYN6      ---------------------------------------KIIL-----------------
A0A176JBT8      ---------------------------------------KPILLFNL-------------
A0A1I5HIC6      ---------------------------------------SPSIIKNA-------------
A0A1Y3TC51      ---------------------------------------NTSAAMRY-------------
A0A1Y3T1N0      ---------------------------------------NTSWIMAR-------------
A0A1Y3Y8U8      ---------------------------------------NTSWIMAR-------------
A0A5B0BQY5      ---------------------------------------KPFTFYYL-------------
A6CLL4          ---------------------------------------KPSLILSA-------------
A0A176U8D6      ---------------------------------------RHSILFYS-------------
A0A1Q6KSQ5      ---------------------------------------RRSVVSYI-------------
A0A3D3U8B3      ---------------------------------------RRSVVSYI-------------
A0A3E5FRL7      ---------------------------------------NSSKLINY-------------
A0A1Y4QK93      ---------------------------------------NSSRLINY-------------
B1C232          ---------------------------------------NSSRLINY-------------
A0A401USI6      ---------------------------------------TPKKKFNI-------------
A0A1V4IQ10      ---------------------------------------SSKKKMYV-------------
A0A1S8TRD2      ---------------------------------------SSKKRMYV-------------
G7M1U2          ---------------------------------------SSKKRMYV-------------
A0A2T6KJ75      ---------------------------------------KPITALFF-------------
A9KN92          ---------------------------------------SPHIMKNT-------------
A0A352MUJ1      ---------------------------------------SPSNINPV-------------
R5YI67          ---------------------------------------APSNINPV-------------
A0A174DL89      ---------------------------------------KPNIIINI-------------
A0A1Y0IQP5      ---------------------------------------RPKPFLNM-------------
A0A4R2R7B1      ---------------------------------------RPKPYLNM-------------
A0A1M6E8I2      ---------------------------------------NINLKFNG-------------
A0A7C6SMH0      ---------------------------------------KPNKKTNV-------------
A0A7X7XYM7      ---------------------------------------KPNKRTNV-------------
A0A3B8KKL6      ---------------------------------------KPNKKMNV-------------
A0A2K9E6R0      ---------------------------------------KPNKKMNV-------------
A0A2S8RBI0      ---------------------------------------KPNKKMNV-------------
A0A7X8MFK9      ---------------------------------------SPSIKKNV-------------
A0A7X9D1M8      ---------------------------------------SPSVKKNV-------------
A0A0L6JLG6      ---------------------------------------KPNKKMNV-------------
A0A7X8PYA7      ---------------------------------------SPSKKKNV-------------
G8LSN0          ---------------------------------------GPSAKKNV-------------
A0A1Y4N105      ---------------------------------------NPLNYSRI-------------
A0A1Y4QP75      ---------------------------------------NPLNYSRI-------------
A0A3D4QRB5      ---------------------------------------RPTTVRNC-------------
A0A349DEH5      ---------------------------------------STKSAVSL-------------
A0A3D4T7B4      ---------------------------------------STKSAVSL-------------
A0A350XYC7      ---------------------------------------SNRSVFSL-------------
R6DNR8          ---------------------------------------SNRSVVSL-------------
A0A355KUM5      ---------------------------------------SNRSVVSL-------------
R5YGY6          ---------------------------------------SNRSVVSL-------------
A0A7G9WCY6      ---------------------------------------KPRPALNV-------------
A0A0A5GPA9      ---------------------------------------KPNLLMNT-------------
A0A271M6M4      ---------------------------------------KPDPVIYM-------------
A0A1C6G0U3      ---------------------------------------KPRKLINI-------------
A0A3D4LLB3      ---------------------------------------KPDIIMNT-------------
A0A7C7AD93      ---------------------------------------QYEVLSDS-------------
A0A2V3W8U6      ---------------------------------------SPKLFFNT-------------
A0A6N3BXA1      ---------------------------------------RPRKTVNT-------------
A0A351SRI8      ---------------------------------------NVHVLKQI-------------
A0A1V5LU59      ---------------------------------------SPNKKKNV-------------
A0A7X8R9W1      ---------------------------------------KPNKRMNV-------------
A0A1E3BVC3      ---------------------------------------KPNKKMNV-------------
A0A4Q0I6S0      ---------------------------------------KPNKKMNV-------------
A3DF66          ---------------------------------------KPNKKMNI-------------
W4V1T8          ---------------------------------------KPNKKMNV-------------
A0A1C6ITD7      ---------------------------------------KPNIILNI-------------
A0A381IX63      ---------------------------------------SPNKFRNL-------------
A0A1M6RWV2      ---------------------------------------KPRPMLNI-------------
A0A841ZT34      ---------------------------------------SPNLKTNL-------------
A0A1G9IUT4      ---------------------------------------KPNKIMNT-------------
A0A842GR80      ---------------------------------------SPNLKVNL-------------
A0A7X0TNH3      ---------------------------------------SPNLKVNL-------------
A0A842D596      ---------------------------------------SPNLKVNL-------------
A0A842EQ86      ---------------------------------------SPNLKVNL-------------
A0A842A220      ---------------------------------------SPNLKVNL-------------
A0A7X0YM80      ---------------------------------------SPNLKVNL-------------
A0A842GEL5      ---------------------------------------SPNLKVNL-------------
A0A841XVD7      ---------------------------------------SPNLKVNL-------------
A0A7X0XME5      ---------------------------------------SPNLKVNL-------------
A0A842B6T1      ---------------------------------------SPNLKVNL-------------
A0A841X7G0      ---------------------------------------SPNLKVNL-------------
A0A841W3M8      ---------------------------------------SPNLKVNL-------------
A0A7X0XVI0      ---------------------------------------SPNLKVNL-------------
A0A7X0Z1K1      ---------------------------------------SPNLKVNL-------------
A0A143ZUX1      ---------------------------------------MPQGPNTDYKKI---------
A0A7I8D809      ---------------------------------------MPQGPNTDYKKI---------
A0A3R9WAA7      ---------------------------------------FPSNPVDYR------------
A0A1G6BLF1      ---------------------------------------APSNEDWSH------------
A0A355G1X5      ---------------------------------------AHDPQLSLM------------
A0A1W2CEA6      ---------------------------------------KPIYPNVN-------------
A0A355G3J9      ---------------------------------------EDESEWPIV------------
A0A3D2AD87      ---------------------------------------VVYPRTV--------------
A0A143XN92      ---------------------------------------AASNANQAE------------
R7FFK6          ---------------------------------------TPVSPNVT-------------
A0A373MPB9      ---------------------------------------TPVSPNTT-------------
A0A373L519      ---------------------------------------TPVSPNTT-------------
A0A373W906      ---------------------------------------TPVSPNTT-------------
A0A373VCW2      ---------------------------------------TPVSPNTT-------------
W0U604          ---------------------------------------TPVSPNTT-------------
A0A374B6G0      ---------------------------------------SPVSPNTT-------------
A0A373VM36      ---------------------------------------TPVSPNTT-------------
A0A1C5P379      ---------------------------------------TPVSPNTT-------------
A0A373XXX0      ---------------------------------------TPVSPNTT-------------
A0A5R9MJM9      ---------------------------------------TPVSPNTT-------------
A0A356CW82      ---------------------------------------TPVSPNTT-------------
R6T4X7          ---------------------------------------TPVSPNTT-------------
A0A374HTV1      ---------------------------------------TPVSPNTT-------------
A0A374GB66      ---------------------------------------TPVSPNTT-------------
A0A374ECC6      ---------------------------------------TPVSPNTT-------------
A0A374BM61      ---------------------------------------TPVSPNTT-------------
A0A373UGZ4      ---------------------------------------TPVSPNTT-------------
A0A373SA66      ---------------------------------------TPVSPNTT-------------
A0A1C5X6X7      ---------------------------------------TPVSPNTT-------------
A0A1C6JIH3      ---------------------------------------TPVSPNTT-------------
A0A373PSC3      ---------------------------------------TPVSPNTT-------------
A0A1K1WYK8      ---------------------------------------KPVAPNNT-------------
A0A1H6IUB1      ---------------------------------------SPVAPNMK-------------
A0A1M7L1F9      ---------------------------------------NPVAPNMK-------------
A0A1C6B4L6      ---------------------------------------TPVAPNVI-------------
A0A1Q6T9P4      ---------------------------------------TPVAPNVI-------------
A0A315Y4F9      ---------------------------------------TPVAPNIM-------------
A0A354K620      ---------------------------------------HPVAPNTM-------------
A0A173ZYY6      ---------------------------------------TPDNPLDAG------------
A0A6L8RXB5      ---------------------------------------TPDNPLDAG------------
A0A173SMI2      ---------------------------------------TPDNPLDAG------------
A0A845KKD0      ---------------------------------------TPDNPLDAG------------
A0A6N9JW85      ---------------------------------------TPDNPLDAG------------
A0A174ASH7      ---------------------------------------TPDNPLDAG------------
A6BH65          ---------------------------------------TPDNPLDAG------------
R7G0D7          ---------------------------------------TPDNPLDAG------------
R6HZX3          ---------------------------------------VPVNTFRGS------------
R5EFZ0          ---------------------------------------SPTNQNFAF------------
A0A3E5FSY5      ---------------------------------------DPYNKLTFTNTV---------
A0A1V5S3C0      ---------------------------------------SPDADYSGF------------
A0A3C0QME1      ---------------------------------------KPVSPNKP-------------
A0A355FYK5      ---------------------------------------ISNSDNSV-------------
A0A357AQU0      ---------------------------------------VKSGPSVS-------------
A0A3C1YJQ7      ---------------------------------------VKSGPSVS-------------
A0A3D0JG38      ---------------------------------------VKSGPSVS-------------
A0A3C0IHX1      ---------------------------------------SPSAPDVK-------------
R5V506          ---------------------------------------SPSAPDVK-------------
A0A352TIU5      ---------------------------------------SPSAPDVK-------------
R5B467          ---------------------------------------QPSNPFSWRHSL---------
A0A1Y3TC98      ----------------------------------------PAAPFNQMSVR---------
A0A1W1Z4C3      ---------------------------------------FANGRNDM-------------
A0A239QN83      ---------------------------------------LANGRADM-------------
A0A8A5CVI3      ---------------------------------------FANGRNDK-------------
A0A8A5D3H1      ---------------------------------------FANGRNDR-------------
A0A1Q6REE0      ----------------------------------------PTAPVAEFNYR---------
R5ETF9          ----------------------------------------PTAPVAEFNYR---------
A0A0F2P7X6      ---------------------------------------FPNAPATFRNVG---------
A0A359B487      ---------------------------------------FPNAPATFRNVG---------
R6VAT5          ---------------------------------------TPINPISYREKA---------
D4LC36          ---------------------------------------AAVSPSVTKNTA---------
A0A7X3IXX7      ----------------------------------------RVVPLEDAQVPGGPSSPNTK
A0A1Q6S448      ----------------------------------------SVSAARSYNVP--------R
A0A351MYR0      ----------------------------------------SVAPSRSYNVP--------R
R6HPC1          ----------------------------------------SVAPSRSYNVP--------K
A0A3D4G5Z5      ----------------------------------------SVAPSRSYNVP--------K
A0A3D5ES03      ----------------------------------------SVAPSRSYNVP--------K
A0A348P5V4      ---------------------------------------APN---GDNTKL---------
A0A356PT74      ---------------------------------------APN---RDASAR---------
A0A3D5LL19      ---------------------------------------APN---RDASAR---------
R5MNF0          ---------------------------------------APN---RDASAR---------
A0A1Q9JSI0      ---------------------------------------GPVNKFQPTALM---------
A0A3D5TNI1      ---------------------------------------EPD---KSVGIT---------
A0A358LJD0      ---------------------------------------KPD---KSVGTV---------
R6I3L7          ---------------------------------------KPD---KSVGTV---------
A0A3D1HXX0      ---------------------------------------KPD---KSVGTV---------
A0A3D2QJB8      ---------------------------------------KPD---KSVGTV---------
R7MQJ4          ---------------------------------------NPV----SPNFL---------
A0A1V5GLC0      ---------------------------------------NPV----GPNIK---------
W7V182          ---------------------------------------SPV----APNVK---------
A0A143XPI5      ---------------------------------------EPSNQPNLK------------
A0A0M6WXE3      ---------------------------------------APVNPPQNG------------
A0A348SAK2      ---------------------------------------APVNPPQNG------------
A0A1G9H5B9      ---------------------------------------LPNEKKAVF------------
A0A1Y4H8L0      ---------------------------------------YPSNPLNTS------------
A0A4B9BMD9      SRDVEAGRAVYLQLLNRQQELSISKSSAIGNVRIIDPAVTQPQPVKPK------------
A0A0M6WYQ8      ---------------------------------------DTTNQGVIS------------
A0A348SAK1      ---------------------------------------DTTKQGVIS------------
A0A252F281      ---------------------------------------APSNAMSLR------------
A0A1Y4QKE6      ---------------------------------------SPYNKLTFT------------
B1C231          ---------------------------------------DPYNKLTFT------------
A0A7V6WIR4      ---------------------------------------KPA---KPN------------
A0A1Y3TUL5      ---------------------------------------RIGGNVNAS------------
A0A1Y4JAX2      ---------------------------------------RIGGNVNAS------------
A0A1Y4T590      ---------------------------------------RIGGNVNAS------------
A0A1Y3T163      ---------------------------------------EPFNHIGLR------------
A0A1Y3YCA2      ---------------------------------------EPFNHIGLR------------
A0A7W8H9H2      ---------------------------------------QPYNTPDYT------------
A0A1Y4L6N9      ---------------------------------------EPFNKPNYV------------
A0A173T644      ---------------------------------------EPYNQPNFV------------
A0A1C5TSB8      ---------------------------------------EPYNQPNFV------------
C0CIK6          ---------------------------------------EPYNQPNFV------------
A0A1Y3WEF6      ---------------------------------------EPYNRPSYL------------
A0A417T0L2      ---------------------------------------EPYNRPSYR------------
A0A1H9EPU3      ---------------------------------------TPTSPSSPN------------
A0A354IGV3      ---------------------------------------QPSNQIDSR------------
A0A417JMV2      ---------------------------------------GPVNKFQPT------------
A0A415VWX5      ---------------------------------------GPVNKFQPT------------
A0A173UY96      ---------------------------------------GPVNKFQPT------------
B0P408          ---------------------------------------GPVNKFQPT------------
D4MV82          ---------------------------------------GPVNKFQPT------------
A0A173QTL1      ---------------------------------------GPVNKFQPT------------
A0A174J359      ---------------------------------------GPVNKFQPT------------
A0A174A3T7      ---------------------------------------GPVNKFQPT------------
A0A417UUA3      ---------------------------------------GPVNKFQPT------------
A0A6N2VB70      ---------------------------------------GPVNKFQPT------------
A0A1C6EUV9      ---------------------------------------GPVNEFQPA------------
A0A173Y645      ---------------------------------------GPVNEFQPA------------
A0A374AVY6      ---------------------------------------GPVNEFQPA------------
R7BXS4          ---------------------------------------GPVNEFQPA------------
                                                                            

S3FFL2          LNLAIAL--FVGLGLGVLVAFAL-EQMDEAIADPSEVERQFGLPLL--------------
A0A328M4V1      LLVFGAT--VFGGLLAVGFVFLR-QLLNRGVEDPAAIER-LGLPVY--------------
A0A6A8IF17      NIFMVAF--ALGLLIPIVIIFMR-ENMNTRVRGRKDLEN-LTIPFI--------------
A0A143WVN6      LRIQRMA--TLAAGGLTAAVIVLVSILRPTVKRKSSARRQLDGRIL--------------
W6RXP9          A---IAF--LLGLMVGVGLTFLL-EYLDNTFKTKESVEGALNIPVM--------------
W6S4G8          I---LGF--LIGLVSGMAIVFLI-EYMNNTYKSKEEVERNLKLPVL--------------
A0A3D5R4X5      MNIAIAG--VLGLMLSVGLVFLIE-FLDKTIKTPEDIERYLNLSII--------------
A0A1I4C3N6      ILFALIG--AVGFGVMSAVGFLFFGLQDTRIRRKYEVEDMFNIPII--------------
A0A3B9CIM7      LKYAVLG--AAAGFLLAAAWFLLRSMLDTTVRRKYEIEDLFTIPIL--------------
A0A7R7IBN8      TKLILIG--ALGGLVLAFVLFLSFGLLDTTIQKRKDIEDIFKIPIL--------------
A0A1G9WHW8      PFTAILG--FFFGAILAFIFFILKGLLNTTIRKKYEIEDMFTIPIL--------------
A0A1H5VAA0      PFTAILG--FFFGAILAFIFFILKGLLNTTIRKKYEIEDMFTIPIL--------------
A0A3R6VK11      VKYALVG--FAGCFGASFVLFLLAGLMDTTIRRRYELKLAFRIPVL--------------
A0A3R6QUY7      VKYALVG--FVGCFGASFVLFLLAGLMDTTIRRRYELKLAFRIPVL--------------
A0A373K3P9      VKYALVG--FAGCFGASFVLFLLAGLMDTTIRRRYELKLAFRIPVL--------------
A0A3R6JRU5      VKYALVG--FAGCFGASFVLFLLAGLMDTTIRRRYELKLAFRIPVL--------------
A0A1C5MS04      VKYALVG--FAGCFGASFVLFLLAGLMDTTIRRRYELKLAFRIPVL--------------
A0A3C1J150      VKYALVG--FAGCFGASFVLFLLAGLMDTTIRRRYELKLAFRIPVL--------------
A0A416CXD7      VKYALVG--FAGCFGASFVLFLLAGLMDTTIRRRYELKLAFRIPVL--------------
A0A6N2X662      VNYALVG--FAGCFGASFVLFLLAGLMDTTIRRRYELKLAFRIPVL--------------
R6XBL9          VKYALVG--FAGCFGASFVLFLLAGLMDTTIRRRYELKLAFRIPVL--------------
A0A355W5Z7      VKYALVG--FAGCFGASFVLFLLAGLMDTTIRRRYELKLAFRIPVL--------------
A0A1G6BLB6      ANAMVKM--FIIVFCLMLVIVAFGSTFQDAIRAENEVEKKIDTKRL--------------
A0A1C6G8M0      L---IGL--MAGIVVSCGVIAIS-VITNTSIKNEEDIQKCSGLSVL--------------
A0A416MP73      L---IGI--LAGIVIACGIVAVS-VITNTSIKSDEDIQKCTGLSVL--------------
A0A3E4LL92      ----LLI--LLVLAGGVGATVCL-CIFTDKIHSMEQAKRLLDIPMI--------------
A0A415D1L1      ----LLI--LLVLAGGIGATVYL-CIFTDKIHSMEQAKRLLDIPMI--------------
A0A396G6S7      VMKVFAV--AAGCL--IALLAGI-SYIRDTIKNPGEVSTKLDTRLL--------------
A0A3E5A223      VMKVFAV--AAGCL--IALLAGI-SYIRDTIKNPGEVSTKLDTRLL--------------
R7D5E6          VMKVFAV--AAGCL--IALLAGI-SYIRDTIKNPGEVSTKLDTRLL--------------
A0A415HQH5      VMKVFAV--AAGCL--IALLAGI-SYIRDTIKNPGEVSTKLDTRLL--------------
A0A414W2C6      VMKVFVV--AAGCL--IALLAGI-SYIRDTIKNPGEVSTKLDTRLL--------------
A5ZNE7          VMKVFAV--AAGCL--IALLAGI-SYIRDTIKNPGEVSTKLDTRLL--------------
A0A395X821      VMKVFAV--AAGCL--IALLAGI-SYIRDTIKNPGEVSTKLDTRLL--------------
A0A1C5PY68      VMKVFVV--TAGCL--IVLLAGI-SYIRDTIKNPGEVSTKLDTRLL--------------
A0A174CJF8      VMKVFVV--AAGCL--IALLAGI-SYIRDTIKNPGEVSTKLDTRLL--------------
A0A564SRR2      VMKVFVV--AAGCL--IALLAGI-SYIRDTIKNPGEVSTKLDTRLL--------------
A0A174R7V0      VMKVFVV--AAGCL--IALLAGI-SYIRDTIKNPGEVSTKLDTRLL--------------
A0A373MWV2      ----MAF--LAAALGTAALVGFF-SFLRDTVKNETEFGRKIDADLL--------------
A0A417CE88      ----MAF--LAAALGTAALVGFF-SFLRDTVKNETEFGRKIDADLL--------------
A0A416Y441      ----MAF--LAAALGTAALVGFF-SFLRDTVKNETEFGRKIDADLL--------------
A0A357GPJ7      ----MAF--LAAALGTAALVGFF-SFLRDTVKNETEFGRKIDADLL--------------
A0A396PAC1      ----MAF--LAAALGTAALVGFF-SFLRDTVKNETEFGRKIDADLL--------------
A0A416EYU4      ----MAF--LAAALGTAALVGFF-SFLRDTVKNETEFGRKIDADLL--------------
A0A416SCQ2      ----MAF--LAAALGTAALVGFF-SFLRDTVKNETEFGRKIDADLL--------------
A0A416TGN7      ----MAF--LAAALGTAALVGFF-SFLRDTVKNETEFGRKIDADLL--------------
A0A417SMF6      ----MAF--LAAALGTAALVGFF-SFLRDTVKNETEFGRKIDADLL--------------
A0A0H5SF45      I---LGA--VAGLVLAIAISFFW-ELIDVKIKSKEDLTKRYQIPIL--------------
A0A1M6JRJ5      L---LGG--IICGFMAFFLSMVK-EVLNLKVVSQEDLLKHYNIPLL--------------
A0A1M7Y1S2      L---LGG--IVCGFLAFFLFVLK-EILNLKVINQEDLLKHYDTPLL--------------
A0A7I8DMN1      L---LGG--ISFGLLSFFVFVLK-EVMNLKVANQEDLLKHYDVPLL--------------
A0A1Y4MW77      VA--KGA--LIGLAVGLVIIAIY-AFFRKTVHKTQELEEVTNIKCL--------------
A0A6S6R676      L---IGG--FLGFIISVAASFIW-EIIDVNVKNQEDLTKKYSMPVL--------------
A0A0K8J554      M---IGA--LAGFFLAFTFAFLW-ELIDVKVKSKDDLMEKYQIPIL--------------
A0A1I0RG99      L---VGG--MFGFVLSIAVSLLL-VLFDLNVKNQDELLKRYQLPIL--------------
A0A1I5G322      L---IGG--MITFIITILISLLG-EVMDVNVKNQDDLLRKYQVPIL--------------
A0A7C6IYW8      L---VGG--MLGLIASVFIILLV-EILDTNIKNKEDLIETYKLPVL--------------
A0A7C6JZF1      L---VGG--ILGLLLSVMASFLW-EAFNVKIKSKEELVKRYSIPVI--------------
A0A3N1XSX6      L---IGG--MLGLVLSIIFSFLW-EIFDVNIKEKEELITNYQLPVL--------------
A0A839K1C1      L---IGG--LLGLAASVIIIFLV-EILDVNIKSKEDLATHHPFPIL--------------
R6UHV6          AV--IGF--FAGAAAVVLIISVL-SFYKDTVKKESDINKKLITQRL--------------
A0A3R9Q621      A---IGG--LMGFVLSVLLVFIW-ELIDVNVKDEEELKQRYNKPVI--------------
A0A069RC75      A---AGV--FFGIMGGLLVVYVL-EYFDNAVRSAEDIQNGIGISVI--------------
A0A174F2W5      ----MAF--LAAALGTAALVGFF-SFLRDTVKNETEFGRKIDADLL--------------
A0A174S8E9      ----MAF--LAAALGTAALVGFF-SFLRDTVKNETEFGRKIDADLL--------------
A0A416ZL97      ----TAF--LAAALAMAALIGLF-SFLRDTVKNEAEFTRKIDADLL--------------
A0A174LSK1      ----TAF--LAAALAMAALIGLF-SFLRDTVKNEAEFTRKIDADLL--------------
A0A373GY92      ----TAF--LAAALAMAALIGLF-SFLRDTVKNEAEFTRKIDADLL--------------
A0A373NZQ6      ----TAF--LAAALAMAALIGLF-SFLRDTVKNEAEFTRKIDADLL--------------
A0A417I9B9      ----TAF--LAAALAMAALIGLF-SFLRDTVKNEAEFTRKIDADLL--------------
A0A417WQF8      ----TAF--LAAALAMAALIGLF-SFLRDTVKNEAEFTRKIDADLL--------------
A0A8B3CFR3      ----TAF--LAAALAMAALIGLF-SFLRDTVKNEAEFTRKIDADLL--------------
A0A373RZ83      ----TAF--LAAALAMAALIGLF-SFLRDTVKNEAEFTRKIDADLL--------------
A0A416U6I1      ----TAF--LAAALAMAALIGLF-SFLRDTVKNEAEFTRKIDADLL--------------
R7JQZ9          ----TAF--LAAALAMAALIGLF-SFLRDTVKNEAEFTRKIDADLL--------------
A0A1M5UYN6      ----YSF--ILGLLISITLVFLL-DFLDNTIKTKEEVEKFIGLPVI--------------
A0A176JBT8      L---LSF--AAGLILATIFVLIK-ELKNKKFESKKGITDLLGIPYL--------------
A0A1I5HIC6      I---LGS--LAGAFISTFIIILI-HIIDDTVKDVEQIEKYLGLTVL--------------
A0A1Y3TC51      RY--PLM--AAGAAGMAALICLL-YVMRFTVKNPLCAQRQLDGKVR--------------
A0A1Y3T1N0      RN--LLT--AAGMLAMAAVICLF-YLLRFTVKSPSSASRLLDGTVR--------------
A0A1Y3Y8U8      RN--LLA--AAGMLAMAAVICLF-YLLRFTVKSPSSASRLLDGTVR--------------
A0A5B0BQY5      I---VSL--GIGFLISIAVVLIG-EVYFTRLNTERKVERSLGIPFL--------------
A6CLL4          G---ISF--TIGIFLAILIVFIR-EAFFTKLNNQEKVERMLNAPYL--------------
A0A176U8D6      V---IGV--VVGLFLACGIIALM-VITNVSVKTDEDVQKCTGLSVL--------------
A0A1Q6KSQ5      L---IGL--MAGIVVSCGVIAIS-VITNTSIKNEEDIQKCSGLSVL--------------
A0A3D3U8B3      L---IGL--MAGIVVSCGVIAIS-VITNTSIKNEEDIQKCSGLSVL--------------
A0A3E5FRL7      RN--YIA--LLGGVAVTGIIICL-YLFRHTLKSSKNATKLLDGRVV--------------
A0A1Y4QK93      RN--YIA--LLGGIAVTGIIACL-YLFRHTLKSSKNAGKLLDGRVV--------------
B1C232          RN--YIA--LLGGVAVAGIIVCL-YLFRHTLKSSENATKLLDGRVV--------------
A0A401USI6      S---IGF--IIGLILSLGLVLLI-NYLNNTIKSEDDVQRYLNLPMV--------------
A0A1V4IQ10      A---IGF--MLGLMISIGIIFLI-ELLDYTFKNKEKLERIVQLPTF--------------
A0A1S8TRD2      A---IGF--IIGLMLSLGIIFLI-EFLDYTFKDKEKLERIVQLPTF--------------
G7M1U2          A---IGF--IIGLMLSFGIIFLI-EFLDYTFKDKEKLERIVQLPTF--------------
A0A2T6KJ75      I---ISA--IIGFLASYSFILIQ-EMFFTLVDSSEKAEKALALPVI--------------
A9KN92          I---LSG--IIGALISAFVIIFI-HIIDDSIKNAEQIEKYLGLTVL--------------
A0A352MUJ1      KYAGIFA--VVGFVISVGVILVL-NLFDSTVKNDKDIEKTLNIKTL--------------
R5YI67          KYAGVFA--VVGFALSIGVILIL-NLFDSTVKNDKDIEKALNIKTL--------------
A0A174DL89      S---LSF--ILGLIFSISLVVLI-NYLDQRIKDKDELKELITFPIL--------------
A0A1Y0IQP5      A---AAL--VLGAMAGAGLAFLL-EFLNNTVKTEGEIEQLLQLPAL--------------
A0A4R2R7B1      A---VAL--VLGAMAGAGLALLL-AFLNNTVQTEAEAEQLLQLPAL--------------
A0A1M6E8I2      A---IGF--IVGIMTGLSIILML-EMLDGTIKTSDDIEKHIGLPVI--------------
A0A7C6SMH0      G---IAG--MLGLMLGVGLILLL-EFVDHTFKKPEEVERHLGLNVV--------------
A0A7X7XYM7      A---VAG--LLGLMLGVGLILLL-EFVDHTFKKPDEVERYLNLNVV--------------
A0A3B8KKL6      A---VAG--LLGIVLGVGLILVL-EFVDHTFKKPDEVERYLSLNVV--------------
A0A2K9E6R0      A---VAG--LLGIVLGVGLILVL-EFVDHTFKKPDEVERYLSLNVV--------------
A0A2S8RBI0      A---VAG--LLGIVLGVGLILVL-EFVDHTFKKPDEVERYLSLNVV--------------
A0A7X8MFK9      A---IAG--FLGLLLGAALIFLL-EFIDHTFKKAEEVEKQLGLNVI--------------
A0A7X9D1M8      G---LAG--LLGLILGAGLIFLF-EFIDHTFKKAEEVEKQLGFNVI--------------
A0A0L6JLG6      G---LAG--FLGILLGVSLIYLL-EFIDHTFKKPEDVEHHLGLNVI--------------
A0A7X8PYA7      G---LAG--IVGLALGAGLIYLL-EMLDYTFKKPEDVERQLELNVI--------------
G8LSN0          G---IAG--ILGLALAAGLIYLL-EIMDYTFKKPEDVERQMELTVI--------------
A0A1Y4N105      QK--LGT--LASGVVMIGIIALL-SIFRQTVKRSKQAKYQLDGRII--------------
A0A1Y4QP75      QK--LGT--LASGVVMIGIIALL-SIFRQTVKRSKQAKYQLDGRII--------------
A0A3D4QRB5      I---IAA--FLGLMVGLGIIFLI-EYLDNTIKTQEDAEEFLKLPVI--------------
A0A349DEH5      AA--IVG--FIGAVATCIIMFII-FLVKDTAKTADELSDKLDVHIL--------------
A0A3D4T7B4      AA--IVG--FIGAVAPCIIMFII-FLVKDTAKTADELSDKLDVHIL--------------
A0A350XYC7      AL--MVG--FVAAVATCVVFFIM-FLVKDTAKTADELSEKLDVHIL--------------
R6DNR8          AL--MVG--FISAIACCVVFFIM-FLVKDTAKTADELSEKLDVHIL--------------
A0A355KUM5      AL--MVG--FIAAVASCVVFFIM-FLVKDTAKTADELSEKLDVHIL--------------
R5YGY6          AL--MIG--FIAAVASCVVFFIM-FLVKDTAKTADELSEKLDVHIL--------------
A0A7G9WCY6      A---IAF--LLGAMLGVGIVFLM-EFLDNTLKNPEDIERHLKLPVL--------------
A0A0A5GPA9      I---LSL--LLGLFLALLLVFLK-EVIFTRADSEEKVEKVFRLSSL--------------
A0A271M6M4      V---IFL--CIGVFLSFIIIFLK-ETIFTKFDSQEKIEQAFKLPSL--------------
A0A1C6G0U3      A---IAS--IIGILISIAFAFIL-DYLDSKIKNKGDVEKYLDLPII--------------
A0A3D4LLB3      A---IAG--ILGAMVILLILFLK-EYFDSTAKTEKDIENLLGLSII--------------
A0A7C7AD93      FFYTVSI--ICGAITALFVVLVI-ELFDSTIKNEEDIENQLNVPVI--------------
A0A2V3W8U6      V---ISF--IIGFLFACTYAFLS-AYFNTKISSKEDIEKYLGLSFL--------------
A0A6N3BXA1      I---IAT--LIGIILAITVILLR-EILDKTIKTTKDIEKYFDFNIL--------------
A0A351SRI8      V---LGT--GLGFVLSSIIIAIC-FYFDDTVKNESDAERELGVPIL--------------
A0A1V5LU59      A---LAG--IIGLALGAGLIYLL-EMIDYTFKKPEQVEKQLGLNLI--------------
A0A7X8R9W1      S---VAG--VLGLLSGILLIYLL-EYVDHTFKKPEDVEGQLGLNVI--------------
A0A1E3BVC3      G---AAG--LFGLVLGVGLIFLL-ELIDHTFKKPEEVERTLGINVI--------------
A0A4Q0I6S0      G---AAG--LFGLVLGVGLIFLL-ELIDHTFKKPEEVERTLGINVI--------------
A3DF66          C---VAG--LFGLVLGIGLIFLL-ELIDHTFKKPEEVEKMLGINVI--------------
W4V1T8          G---AAG--LLGLVLGVGLIFLL-ELIDHTFKKPEEVERILGINVI--------------
A0A1C6ITD7      G---LSF--LLGLMLSICLVILI-DYLDQRIKDKSELKELIHLPIL--------------
A0A381IX63      A---LGG--IIGVVIAIFVVLLL-DYFDNKVKTPEELEDILDTSLL--------------
A0A1M6RWV2      A---IAL--VLGLMIGIGLVFLL-EYLDNSFKGPDDVEKRLNLPVL--------------
A0A841ZT34      F---IAV--IMGLLVSGLGIIVI-ELIKSPLRTDNEIREITQIPII--------------
A0A1G9IUT4      M---IGA--IIGLILGLIVTFVR-EYIDTKVKSSKDVEEKLNLQII--------------
A0A842GR80      F---LAV--IVGLTMSLIIIFSL-EMIQSPLRTDEDFEAVTPIPVV--------------
A0A7X0TNH3      F---LAV--IVGLIMSLIIIFSL-EMIQSPLRTDEDFEAVTPIPVV--------------
A0A842D596      F---LAV--IVGLIMSLIIIFSL-EMIQSPLRTDEDFEAVTPIPVV--------------
A0A842EQ86      F---LAV--IVGLIMSLIIIFSL-EMIQSPLRTDEDFEAVTPIPVV--------------
A0A842A220      F---LAV--IVGLIMSLIIIFSL-EMIQSPLRTDEDFEAVTPIPVV--------------
A0A7X0YM80      F---LAV--IVGLIMSLIIIFSL-EMIQSPLRTDEDFEAVTPIPVV--------------
A0A842GEL5      F---LAV--IVGLIMSLIIIFSL-EMIQSPLRTDEDFEAVTPIPVV--------------
A0A841XVD7      F---LAV--IVGVIMSLIIIFSL-EMIQSPLRTDEDFETVTPIPVV--------------
A0A7X0XME5      F---LAV--IVGLIMSLIIIFSL-EMIQSPLRTDEDFEAVTPIPVV--------------
A0A842B6T1      F---LAV--IVGLIMSLIIIFSL-EMIQSPLRTDEDFEAVTPIPVV--------------
A0A841X7G0      F---LAV--IVGVIMSLIIIFSL-EMIQSPLRTDEDFEAVTPIPVV--------------
A0A841W3M8      F---LAV--IVGLIMSLIIIFSL-EMIQSPLRTDEDFEAVTPIPVV--------------
A0A7X0XVI0      F---LAV--IVGLIMSLIIIFSL-EMIQSPLRTDEDFEAVTPIPVV--------------
A0A7X0Z1K1      F---LAV--IVGLIMSLIIIFSL-EMIQSPLRTDEDFEAVTPIPVV--------------
A0A143ZUX1      LYPAAGA--LLGLAVGLFLVWVL-TRVSHTIQSEDDVYDFLPVKLF--------------
A0A7I8D809      LYPAAGA--LLGLAVGLFLVWVL-TRVSHTIQSEDDVYDFLPVKLF--------------
A0A3R9WAA7      RLIGSGA--AIGAAIALFFIVVY-AFARKTIHKPDDLIQITNVKLL--------------
A0A1G6BLF1      GAAKTGI--LIGFVIDILVLFVY-SMTKRTIRKEKDFAKILNVKCI--------------
A0A355G1X5      RFAAIGG--AIGFALAFIVILIV-NAARDTLMSSDDVQIKLDAKLL--------------
A0A1W2CEA6      ATIAKGA--VLGGLGIMLIFLFI-ILLDDRIRSGEDITKAVDLPVF--------------
A0A355G3J9      GNIAIGF--ALGLVLSVAYVLLS-NALDTTIYGRKEIENAFTLPII--------------
A0A3D2AD87      MSTAIAF--LVGAVLAFAISFII-DISDQSIRGEDEFVNQYEIPLL--------------
A0A143XN92      DIAKKAF--WMSGTAVLALILFF-SMKKDTIKSEEEFRKKLDIRYL--------------
R7FFK6          KNTAIGF--AAGAMLAILVILVI-DFFDNTIKDSSELGEHFQKPMI--------------
A0A373MPB9      KNVALGF--VGGLMVAVLVILVI-DFFDNTVKNSDELGDIYQKPIV--------------
A0A373L519      KNVALGF--VGGLMVAVLVILVI-DFFDNTVKNSDELGDIYQKPIV--------------
A0A373W906      KNVALGF--VGGLMVAVLVILVI-DFFDNTVKNSDELGDIYQKPIV--------------
A0A373VCW2      KNVALGF--VGGLMVAVLVILVI-DFFDNTVKNSDELGDIYQKPIV--------------
W0U604          KNVALGF--VGGLMVAVLVILVI-DFFDNTVKNSDELGDIYQKPIV--------------
A0A374B6G0      KNVALGF--VGGLMVAVLVILVI-DFFDNTVKNSDELGDIYQKPIV--------------
A0A373VM36      KNVALGF--VGGLMVAVLVILVI-DFFDNTVKNSDELGDIYQKPIV--------------
A0A1C5P379      KNVALGF--VGGLMVAVLVILVI-DFFDNTVKNSDELGDIYQKPIV--------------
A0A373XXX0      KNVALGF--VGGLMVAVLVILVI-DFFDNTVKNSDELGDIYQKPIV--------------
A0A5R9MJM9      KNVALGF--VGGLMVAVLVILVI-DFFDNTVKNSDELGDIYQKPIV--------------
A0A356CW82      KNVALGF--VGGLMVAVLVILVI-DFFDNTVKNSDELGDIYQKPIV--------------
R6T4X7          KNVALGF--VGGLMVAVLVILVI-DFFDNTVKNSDELGDIYQKPIV--------------
A0A374HTV1      KNVALGF--VGGLMVAVLVILVI-DFFDNTVKNSDELGDIYQKPIV--------------
A0A374GB66      KNVALGF--VGGLMVAVLVILVI-DFFDNTVKNSDELGDIYQKPIV--------------
A0A374ECC6      KNVALGF--VGGLMVAVLVILVI-DFFDNTVKNSDELGDIYQKPIV--------------
A0A374BM61      KNVALGF--VGGLMVAVLVILVI-DFFDNTVKNSDELGDIYQKPIV--------------
A0A373UGZ4      KNVALGF--VGGLMVAVLVILVI-DFFDNTVKNSDELGDIYQKPIV--------------
A0A373SA66      KNVALGF--VGGLMVAVLVILVI-DFFDNTVKNSDELGDIYQKPIV--------------
A0A1C5X6X7      KNVALGF--VGGLMVAVLVILVI-DFFDNTVKNSDELGEIYQKPIV--------------
A0A1C6JIH3      KNVALGF--VGGLMVAVLVILVI-DFFDNTVKNSDELGEIYQKPIV--------------
A0A373PSC3      KNVALGF--VGGLMVAVLVILVI-DFFDNTVKNSDELGEIYQKPIV--------------
A0A1K1WYK8      KNGILGM--AAAFLIVVMVILII-DYFDNTIKESEKIAKKYDKAII--------------
A0A1H6IUB1      KNAVLGA--MAALMLTCMIIFLI-DFFDNTVKDTDSVADKFKKPII--------------
A0A1M7L1F9      KNAVLGA--MAALMLTCMIIFLV-DFFDNTVRDTDAVGKEFKKPII--------------
A0A1C6B4L6      KNTLLGM--AAALLIVVTIILIT-DYFDNTVKDVALLEKKYKKAII--------------
A0A1Q6T9P4      KNTLLGM--AAALLIVVTIILIT-DYFDNTVKDVALLEKKYKKAII--------------
A0A315Y4F9      KNTMIGA--VAGFMLIVLIIFLI-DFFDNTIKDTDALGKKYNKAII--------------
A0A354K620      KNTALGA--AAGFMLIVLIIFLI-DFFDTTIKDTDDLGKKYNKAII--------------
A0A173ZYY6      GQAKKGG--LVAGALVIILLGLF-SYMKNTIKQENEIEKKLDARSL--------------
A0A6L8RXB5      GQAKKGG--LVAGALVIILLGLF-SYMKNTIKQENEIEKKLDARSL--------------
A0A173SMI2      GQAKKGG--LVAGALVLILLGLF-SYMKNTIKQENEIEKKLDARSL--------------
A0A845KKD0      GQAKKGG--LVAGALVLILLGLF-SYMKNTIKQENEIEKKLDARSL--------------
A0A6N9JW85      RQAKKGG--LVAGALVLILLGMF-SYMKNTIKQENEIEKKLDARSL--------------
A0A174ASH7      GQAKKGG--LVAGALVLILLGLF-SYMKNTIKQENEIEKKLDARSL--------------
A6BH65          RQAKKGG--LVAGALVLILLGMF-SYMKNTIKQENEIEKKLDARSL--------------
R7G0D7          RQAKKGG--LVAGALVLILLGMF-SYMKNTIKQENEIEKKLDARSL--------------
R6HZX3          RSAAKGV--AAGLLLGLALTLLM-AIGRKTVRTADDLKRSTSVPCM--------------
R5EFZ0          HQMKKAA--VIAALAATALLAIL-SYLRDAVRSGTEAREKLDCSYL--------------
A0A3E5FSY5      ---LVGG--IIGLVSGTIILGCM-ALFRKTVKNPEDMKRITNLNCM--------------
A0A1V5S3C0      LYTFIGA--VSGAIVAFAIILIS-NRIKNLVQTSDDIRKRYNLNII--------------
A0A3C0QME1      KMALIGA--MAGLILAAFIVLMI-DFFDNSVRSSEMLTTKYEKAVF--------------
A0A355FYK5      KIAFLAF--MAGALLIALIVVLV-EIFSDTIKDIDDIRNKTNVPII--------------
A0A357AQU0      RYTIMGF--LIGFILVAAAIVIR-TITDNTFRDAEDINKKFGLSVL--------------
A0A3C1YJQ7      RYTIMGF--LIGFILVAAAIVIR-TITDNTFRDAEDINKKFGLSVL--------------
A0A3D0JG38      RYTIMGF--LIGFILVAAAIVIR-TITDNTFRDAEDINKKFGLSVL--------------
A0A3C0IHX1      KITMMAA--AAGFVLSAGVAVLI-YLLDRTIKGEDDI-QSFSISYL--------------
R5V506          KITMMAA--AAGFVLSAGVAVLI-YLLDRTIKGEDDI-QSFSISYL--------------
A0A352TIU5      KITMMAA--AAGFVLSAGVAVLI-YMLDRTIKGEDDI-QSFSISYL--------------
R5B467          ---VRGA--LIGAVLSLLVLYLS-GRARATVMNRDDLQQATSARYL--------------
A0A1Y3TC98      RCLLLGG--AGGAAVSLLIFLLM-SLFWKAVCSPEDMKKITSLRCL--------------
A0A1W1Z4C3      KKGIIGA--LIGAVIACALLTLL-FLMNHRVEKPAELTDNYTPPIL--------------
A0A239QN83      KKGFIGG--LAGAILACAFLTLL-FMMNHQVEKPGEITDHYTPPIL--------------
A0A8A5CVI3      RQGLIGG--LAGAALACALLTLL-FLMNHQVEKPGEITDHYTPPIL--------------
A0A8A5D3H1      KQGLIGA--LAGAVLACALLTLL-FLMNHQVEKPGEITDRYTPPIL--------------
A0A1Q6REE0      YYITCGA--VVGAAVWCVILAFL-VLMKNTVHNEDELRETLNAPCL--------------
R5ETF9          YYITCGA--VVGAAVWCVILAFL-VLMKNTVHNEDELRETLNAPCL--------------
A0A0F2P7X6      ----VGA--VLGLMLGLGIVFML-MFFDRTIKSGDDVKNKLGLTLL--------------
A0A359B487      ----VGA--VLGLMLGLGIVFML-MFFDRTIKSGDDVKNKLGLTLL--------------
R6VAT5          ---LIGT--AVGALLGLLIVFFL-ENLNHTVRHPDEIRKLLNNQRL--------------
D4LC36          ----IGF--AGGALLAILVILLI-DFFDNTVRGTEELREHFSKPII--------------
A0A7X3IXX7      RYLLAGA--AAGLLAGYAVALLR-KVSDVRIRTSHEVEELTDAGVL--------------
A0A1Q6S448      TCLIAAA--AGAALTAAAVV-WA-AVFSGTVQTLEGARSGLDARII--------------
A0A351MYR0      ICLIAAI--AGAALTALGVA-WA-SVSSGTVQTQEGARSDLDAKII--------------
R6HPC1          ICLLAGV--IGAGLTAAAVA-WA-SVTSGTVQTQEGARSDLDAKLI--------------
A0A3D4G5Z5      ICLLAGV--IGAGLTAAAVA-WA-SVTSGTVQTQEGARSDLDAKLI--------------
A0A3D5ES03      ICLLAGV--IGAGLTAAAVA-WA-SVTSGTVQTQEGARSDLDAKLI--------------
A0A348P5V4      LYPMLGF--VLGFFAACLCIIVA-VVFKDTIKNSDEVTNKLGMKLL--------------
A0A356PT74      NYTIVGF--AAGLVISIFAIVLA-VIAKDTVKTADDVKDKLGVDVI--------------
A0A3D5LL19      NYTIVGF--AAGLVISIFAIVLA-VIAKDTVKTADDVKDKLGVDVI--------------
R5MNF0          NYTIVGF--AAGLVISIFAIVLA-VIAKDTVKTADDVKDKLGVDVI--------------
A0A1Q9JSI0      KKTFVYT--L--IFLCGLIGII--SFLKDTVRKPKEVSRKLDGKLL--------------
A0A3D5TNI1      RNAIIGA--LAGAVICALIIIIR-DSARNTVRSQEDIQNKLQLNVI--------------
A0A358LJD0      RNTIIGA--LAGAVICALIIIIR-DSARNTVRSQEDIQNKLQLNVI--------------
R6I3L7          RNAIIGA--LAGAVICALIIIIR-DSARNTVRSQEDIQNKLQLNVI--------------
A0A3D1HXX0      RNAIIGA--LAGAVICALIIIIR-DSARNTVRSQEDIQNKLQLNVI--------------
A0A3D2QJB8      RNAIIGA--LAGAVICALIIIIR-DSARNTVRSQEDIQNKLQLNVI--------------
R7MQJ4          KMAVIGA--FAGMLLAALIILVI-DFFDNTVKDKEEIAQKYEKAII--------------
A0A1V5GLC0      KNTALGA--IAGAMLMALIILVI-DFFDNTFKDPEALREKYKKAVV--------------
W7V182          KNTMLGL--MAAAMLAACIIVVI-DFFDNTVKDAGRLGESYKKAII--------------
A0A143XPI5      RMALNGC--LAGIVLSGILLAVY-ALTRNTICGDEDVKKIMQIKSL--------------
A0A0M6WXE3      EMAKKGF--FLGMAVCILLFAIW-SYMHNTVKQEREVEKKLDARSL----------GAIS
A0A348SAK2      EMAKKGF--FLGMAVCILLFAIW-SYMHNTVKQEREVEKKLDARSL----------GAIS
A0A1G9H5B9      SSLKYGA--AAGAAFAVVLLALL-YILNQKITDLRELKENYKLPIL--------------
A0A1Y4H8L0      RAMKLAF--LAAAAALAALFGLL-SFFRDTVKQEDDVEAKLDTRSL----------GALV
A0A4B9BMD9      KALNVVLGFILGLFISVGAVLAR-AMLRRGVEAPEQLEEHGISVYATIPMSEWLDKRTRL
A0A0M6WYQ8      SSWKRGA--LKGAIIGLVILSLY-VLTRRTVKTGKEIKTHLNLVDL--------------
A0A348SAK1      SSWKRGA--LKGAIIGLVILSLY-VLTRRTVKTGKEIKTHLNLVDL--------------
A0A252F281      SRLILAG--ALGALAMLAVVILM-SCLRDTVKREEEVKEKLDTHLI--------------
A0A1Y4QKE6      NTVIVGG--IIGLVFGTVILGCM-ALFRKTVKNPEDMKRITNLNCM--------------
B1C231          NTVLVGG--IIGLVSGTIILGCM-ALFRKTVKNPEDMKRITNLNCM--------------
A0A7V6WIR4      KMLNIAVAFTLGLIIFIPLAFIL-ELLDYKIKSPEDVEKYLNLPVL-------GVIPYFD
A0A1Y3TUL5      MWLYMS---LLGLAVGIGFSFLK-FLLLPTVVNTKDIENTLGLEVL--------------
A0A1Y4JAX2      MWLYMS---LLGLAVGIGFSFLK-FLLLPTVVNTKDIENTLGLEVL--------------
A0A1Y4T590      MWLYMS---LLGLAVGIGFSFLK-FLLLPTVVNTKDIENTLGLEVL--------------
A0A1Y3T163      RTLALGG--GAGALAGILILGLT-ALFRRTARNPEEMQKITSLRCL--------------
A0A1Y3YCA2      RTLALGG--GAGALAGILILGLT-ALFRRTARNPEEMQKITSLRCL--------------
A0A7W8H9H2      QVMAKWG--LAGAAAGIVFLLAA-AFFKKTVQKPEELSTSISLQCL--------------
A0A1Y4L6N9      RTTVKGA--FLGVLAGLLLVVLY-AFLKRTVQKPEELKKVSNLKCL--------------
A0A173T644      KKAVKGA--LLGAAAGIFLIVLY-AFFRKTVQTPDELKNVMSLPCL--------------
A0A1C5TSB8      KKAVKGA--LLGAAAGIFLIVLY-AFFRKTVQTPDELKNVMSLPCL--------------
C0CIK6          KKAVKGA--LLGAAAGIFLIVLY-AFFRKTVQTPDELKNVMSLPCL--------------
A0A1Y3WEF6      DQILKGA--LFGAGSGFLLICLC-ALFKKTVQKPEELNSVMSLSCI--------------
A0A417T0L2      GQIKKGA--VYGAGAGFLLICLY-AFFKKTVQKPEELKSVMSLSCI--------------
A0A1H9EPU3      VSRNTLLGMLIGIFIACAIVVLR-FMLDDSIKTQEDVENKIGLSVLANMPYKENIEEGLY
A0A354IGV3      DLIRKTA--GICALIMIVLIALL-TLVRDTIQTPTCIERKLDIKRF----------GVIY
A0A417JMV2      ALMKKTF--LMTIVALCGLIAIL-SFLKDTVRKPKEVSRKLDAKLL----------QTLY
A0A415VWX5      ALMKKTF--LMTIVALCGLIAIL-SFLKDTVRKPKEVSRKLDAKLL----------QTLY
A0A173UY96      ALMKKTF--FTTIVALCGLIAIL-SFLKDTVRKPKEVSRKLDAKLL----------QTLY
B0P408          ALMKKTF--FTTIVALCGLIAIL-SFLKDTVRKPKEVSRKLDAKLL----------QTLY
D4MV82          ALMKKTF--FTTIVALCGLIAIL-SFLKDTVRKPKEVSRKLDAKLL----------QTLY
A0A173QTL1      ALMKKTF--FTTIVALCGLIAIL-SFLKDTVRKPKEVSRKLDAKLL----------QTLY
A0A174J359      ALMKKTF--SMTIVALCGLIAIL-SFLKDTVRKPKEVSRKLDAKLL----------QTLY
A0A174A3T7      ALMKKTF--FTTIVALCGLIAIL-SFLKDTVRKPKEVSRKLDAKLL----------QTLY
A0A417UUA3      ALMKKTF--FTTIVALCGLIAIL-SFLKDTVRKPKEVSRKLDAKLL----------QTLY
A0A6N2VB70      ALMKKTF--FTTIVALCGLIAIL-SFLKDTVRKPKEVSRKLDAKLL----------QTLY
A0A1C6EUV9      ALMKKTF--VMTIIALCGLIAIV-SFLKDTVRKPKEVSKKLDGTLL----------QTLY
A0A173Y645      ALMKKTF--VMTIVALCGLIAII-SFLKDTVRKPKEVSKKLDGTLL----------QTLY
A0A374AVY6      ALMKKTF--VMTIVALCGLIAII-SFLKDTVRKPKEVSKKLDGTLL----------QTLY
R7BXS4          ALMKKTF--VMTIVALCGLIAII-SFLKDTVRKPKEVSKKLDGTLL----------QTLY
                                                                            

S3FFL2          GSVP----------------------------KVTDGR----------------------
A0A328M4V1      VSIP----------------------------RSELQRERTLLRVRHRRTVGRQNLLAAG
A0A6A8IF17      GEIP----------------------------LFTRKKKGIL----GKKPQEVKAVIVKE
A0A143WVN6      ATIPYERKYK---------------------------------SIHEYLHKPKKSVLISS
W6RXP9          GVIP----------------------------------------QMSNSSKPGKKYFVVE
W6S4G8          GVIP----------------------------------------KFGRK----REKLVME
A0A3D5R4X5      GAIP----------------------------------HNEKAEKR---------KVVTF
A0A1I4C3N6      GTVP----------------------------------LVESTDK-------VKKSPILG
A0A3B9CIM7      GDVP----------------------------------QMEPAAKG------EKVNKILH
A0A7R7IBN8      GDVP----------------------------------LMIASSKK------HEINKILS
A0A1G9WHW8      GDVP----------------------------------EIETEEAKGVIKNSSYNPKVLN
A0A1H5VAA0      GDVP----------------------------------EIETEETKGVIKNSSYNPKVLN
A0A3R6VK11      GDIP----------------------------------QIQASDRK------SKPVLVLG
A0A3R6QUY7      GDIP----------------------------------QIQAPDRK------SKPVLVLG
A0A373K3P9      GDIP----------------------------------QIQAPDRK------SKPVLVLG
A0A3R6JRU5      GDIP----------------------------------QIQAPDRK------SKPVLVLG
A0A1C5MS04      GDIP----------------------------------QIQAPDRK------SKPVLVLG
A0A3C1J150      GDIP----------------------------------QIQAPDRK------SKPVLVLG
A0A416CXD7      GDIP----------------------------------QIQAPDRK------SKPVLVLG
A0A6N2X662      GDIP----------------------------------QIQAPDRK------SKPVLVLG
R6XBL9          GDIP----------------------------------QIQAPDRK------SKPVLVLG
A0A355W5Z7      GDIP----------------------------------QIQAPDRK------SKPVLVLG
A0A1G6BLB6      GTLYHEKKYK---------------------------------TFTRRSKKKKRSILITD
A0A1C6G8M0      GTIP---------------------------------------DYKGGKKRKEK--IIWP
A0A416MP73      GAIP---------------------------------------DYKG--KKQKK--IMWP
A0A3E4LL92      GSLD---------------------------------------YVKKKSGQKAL--LISD
A0A415D1L1      GSLD---------------------------------------HVKKKSGQKAL--LISD
A0A396G6S7      GTIAYEKKSKAL-------------------------------SMKRKKDYLSM--LIQN
A0A3E5A223      GTIAYEKKSKAL-------------------------------SMKRKKDYLSM--LIQN
R7D5E6          GTIAYEKKSKAL-------------------------------SMKRKKDYLSM--LIQN
A0A415HQH5      GTIAYEKKSKAL-------------------------------SMKRKKDYLSM--LIQN
A0A414W2C6      GTIAYEKKSKAL-------------------------------SMKRKKDYLSM--LIQN
A5ZNE7          GTIAYEKKSKAL-------------------------------SMKRKKDYLSM--LIQN
A0A395X821      GTIAYEKKSKAL-------------------------------SMKRKKDYLSM--LIQN
A0A1C5PY68      GTIAYEKKSKAL-------------------------------SMKRKKDYLSM--LIQN
A0A174CJF8      GTIAYEKKSKAL-------------------------------SMKRKKDYLSM--LIQN
A0A564SRR2      GTIAYEKKSKAL-------------------------------SMKRKKDYLSM--LIQN
A0A174R7V0      GTIAYEKKSKAL-------------------------------SMKRKKDYLSM--LIQN
A0A373MWV2      GTVY----------------------------------------HEKKRKNSSM--LITN
A0A417CE88      GTVY----------------------------------------HEKKRKNSSM--LITN
A0A416Y441      GTVY----------------------------------------HEKKRKNSSM--LITN
A0A357GPJ7      GTVY----------------------------------------HEKKRKNSSM--LITN
A0A396PAC1      GTVY----------------------------------------HEKKRKNSSM--LITN
A0A416EYU4      GTVY----------------------------------------HEKKRKNSSM--LITN
A0A416SCQ2      GTVY----------------------------------------HEKKRKNSSM--LITN
A0A416TGN7      GTVY----------------------------------------HEKKRKNSSM--LITN
A0A417SMF6      GTVY----------------------------------------HEKKRKNSSM--LITN
A0A0H5SF45      GVIP---DFGVKMPKRYLLMQKLPFKNRLN-------------EIIKDK---VEFNQVKN
A0A1M6JRJ5      GAIP---DFAAEDNSR-----DKSIPARLK-------------K-LIRKGYGEDLNQGLI
A0A1M7Y1S2      GCIP---DFSPVNSSR-----KNKILLELK-------------GILIKGENFMKPEKIQN
A0A7I8DMN1      GSIP---DFSTGQGSS-----RYKVIEDIK-------------AILVKKGILNECKKETI
A0A1Y4MW77      ATVP-------------------------------------YLKQKKRSRGKTIMPSILN
A0A6S6R676      GNIP---SFDEISRERTAVKRIMAKLQKS--------------EQQKTDRPIDE------
A0A0K8J554      GAIP---SFNDMIPRKNVLLQKMSFLNRKK-------------KKSNLNQMINE------
A0A1I0RG99      GTIP---NFN-VNIKRK-FVLKKTILTDLLHKKV---------KRNNISKN--K------
A0A1I5G322      GVIP---NYK-NNKKKKVLLIKLTSIAKRLNKKIDSKENKKAGKSENIKENAEK------
A0A7C6IYW8      GEIP---NLN-LSKESGIYKK-IPYISKKK-------------RHLKAKNDYNK------
A0A7C6JZF1      GSIP---YYK-RREKSLFDFIPIPVVGKRS-------------LLLAQRGDAKE------
A0A3N1XSX6      GEIP---NFN-GYKEKQLYKRYFPFLLKYK-------------KFSKTERELMD------
A0A839K1C1      GEIP---SYD-LSKERGIHKRILFKSKNKK-------------HYNNNGFD--D------
R6UHV6          VSIP--------------------TQKKRL-------------SVREKVKGIKRPLSITN
A0A3R9Q621      GNIP---SYQGNDAVREKLRRILPGRNKNR-------------QAGRGKAKSGGLDKIID
A0A069RC75      GSVP---------------------------------------KLKMSGEKGAE--LVIK
A0A174F2W5      GTVY----------------------------------------HEKKRKNSSM--LITN
A0A174S8E9      GTVY----------------------------------------HEKKRKNSSM--LITN
A0A416ZL97      GVVY----------------------------------------HEKKKKNSSM--LITN
A0A174LSK1      GVVY----------------------------------------HEKKKKNSSM--LITN
A0A373GY92      GVVY----------------------------------------HEKKKKNSSM--LITN
A0A373NZQ6      GVVY----------------------------------------HEKKKKNSSM--LITN
A0A417I9B9      GVVY----------------------------------------HEKKKKNSSM--LITN
A0A417WQF8      GVVY----------------------------------------HEKKKKNSSM--LITN
A0A8B3CFR3      GVVY----------------------------------------HEKKKKNSSM--LITN
A0A373RZ83      GVVY----------------------------------------HEKKKKNSSM--LITN
A0A416U6I1      GVVY----------------------------------------HEKKKKNSSM--LITN
R7JQZ9          GVVY----------------------------------------HEKKKKNSSM--LITN
A0A1M5UYN6      GLIP---------------------------------------------KITEKVYLIVK
A0A176JBT8      GEIP----------AIIP---------QGP-------------TNKYLDERYNK--LVAH
A0A1I5HIC6      GTIPLETKYAGKIKNKKK---------AIK-------------KRKKEENIYPEGISIEK
A0A1Y3TC51      GVIP----------FEQK---------GTA-------------LRQKKNPKEAL--LLDS
A0A1Y3T1N0      GIIP----------FESK---------G---------------ILGRKNTKKAL--LLNS
A0A1Y3Y8U8      GIIP----------FESK---------G---------------ILGRKNAKKAL--LLNS
A0A5B0BQY5      GSIL----------MKKE---------KKG-------------KSRNYNSDFES--VTPR
A6CLL4          GSVP---KLP----PQSN---------LNN-------------KHSPNNTYSKF--LISS
A0A176U8D6      GAIP---DYK------------------------------------G--KKQKK--IMWP
A0A1Q6KSQ5      GTIP---DYK------------------------------------GGKKRKEK--IIWP
A0A3D3U8B3      GTIP---DYK------------------------------------GGKKRKEK--IIWP
A0A3E5FRL7      GVIP-----------YEK---------KKR-------------DKHLKKLKQSL--LISS
A0A1Y4QK93      GIIP-----------YEK---------KKR-------------NKHLKKSKQSL--LITS
B1C232          GVIP-----------YEK---------KKR-------------NKHLKKSKQSL--LISS
A0A401USI6      GIIP-------------------------------------------KQNKMVN--LIVE
A0A1V4IQ10      GLIP------------------------DD-------------TKIRKTKNHIT--LIVE
A0A1S8TRD2      GIIP------------------------DD-------------TKVRKIKNHIA--LIVE
G7M1U2          GIIP------------------------DD-------------TKVRKIKNHIT--LIVE
A0A2T6KJ75      GLVP---------------------------------------------PGEGK--LIHD
A9KN92          GTIPLELKNSNKRGKNKK---------AYK-------------RKKGDTNNEHS--SIQK
A0A352MUJ1      ASFA---KNQ----------------------------------------NARP--GVID
R5YI67          ATFA---RNP----------------------------------------NIKQ--GLID
A0A174DL89      GEIP---DFS----------------------------------SVNINNKGNY--LFVN
A0A1Y0IQP5      GAIT---AYD------------------------------------NKGRAGHR--LAVR
A0A4R2R7B1      GAIP---FFE------------------------------------QKGSSGYR--VVVR
A0A1M6E8I2      GSIF---EFN---------------------------------------SESEG--IIVH
A0A7C6SMH0      GTIP---KFKGGKRGKSK---------AKD-------------RRELEREYLKN--LITK
A0A7X7XYM7      GTIP---KFKGGKRGKSK---------AKN-------------RRELEKEYLRN--LITK
A0A3B8KKL6      GTIP---KFKGGKRGKSK---------AKN-------------RRELEKEHLKN--LITI
A0A2K9E6R0      GTIP---KFKGGKRGKSK---------AKN-------------RRELEKEYLKN--LITK
A0A2S8RBI0      GTIP---KFKGGKRGKSK---------AKN-------------RRELEKEYLKN--LITK
A0A7X8MFK9      GTIP---EFEGGKRGKKK---------AKD-------------KKVLEQQYLKN--LIVY
A0A7X9D1M8      GTIP---EFEGAKRGAKK---------PKD-------------EKALEVHYLKN--LIAY
A0A0L6JLG6      GTVP---AFEGGKRGNKK---------AKD-------------EKQLEEEYLKN--LITA
A0A7X8PYA7      GTVP---EFEGGKRGKRK---------AKD-------------PKVLEQDYLKN--LITK
G8LSN0          GAVP---KFEGGKRGKNE---------KKD-------------SKENERDYLKN--LITK
A0A1Y4N105      TTIP---YER------KY---------HSL-------------QELKKKPKKSV--LINS
A0A1Y4QP75      TTIP---YER------KY---------HSL-------------QELKKKPKKSV--LINS
A0A3D4QRB5      GRIP---NFD-----------------TKK-------------SKKKSADRSPR--LATG
A0A349DEH5      GSVQ---QIT-----------------------------------NKNKAAKGL--LVTD
A0A3D4T7B4      GSVQ---QIT-----------------------------------NKNKAAKGL--LVTD
A0A350XYC7      GSVQ---QIT-----------------------------------NKNKTAKGL--LVTD
R6DNR8          GSVQ---QIT-----------------------------------NKNKTAKGL--LVTD
A0A355KUM5      GSVQ---QIT-----------------------------------NKNKTAKGL--LVTD
R5YGY6          GSVQ---QIT-----------------------------------NKNKTAKGL--LVTD
A0A7G9WCY6      ATVP---EIE-------------------------------------GSQSDIN--LITY
A0A0A5GPA9      GVVP---IIS----DEWN---------QKK-------------EDLMQNDRYFK--LLPR
A0A271M6M4      GVIP---VIS----DKPK---------RSN-------------GLFDREDRFNK--MLPQ
A0A1C6G0U3      GGIP---MDK------------------ML-------------KKEVTNTLISN--E---
A0A3D4LLB3      GAVP---NFN-----------------------------------HGSKTAYGN--FLIK
A0A7C7AD93      GTIP---KFR---------------------------------KSDFNIDNIIR--DNKY
A0A2V3W8U6      GEVG---IISKNRKNRLN---------SNK-------------KEDLHSILTSR-----K
A0A6N3BXA1      GVVS---KQK-------------------------------------EKLMYVK--DLDR
A0A351SRI8      GAVP---KYK-----------------EKV-------------SSGKASDLIIC--KDSK
A0A1V5LU59      GVVP---KFEGGKRGKSK---------NKD-------------QKQLEQDYLKN--LITK
A0A7X8R9W1      GTIP---LFEGGKRGKRK---------SKD-------------EKVLEKQYLKN--LITQ
A0A1E3BVC3      GTIP---EFEGGKRGKKK---------AKD-------------EKELQEQYLKN--LIVH
A0A4Q0I6S0      GTIP---EFEGGKRGKKK---------AKD-------------EKELQEQYLKN--LIVH
A3DF66          GTIP---AFDGGKRGKKK---------AKD-------------EKELQEQYLKN--LIVH
W4V1T8          GTIP---AFEGGKRGKKK---------AKD-------------EKELQEEYLKN--LIVH
A0A1C6ITD7      GEIP---NFS-----------------SIN-------------INNEDNYLFAN--VSPK
A0A381IX63      GVIP---FEN-----------------EEE-------------RKKYEGNVTII--GNSK
A0A1M6RWV2      GAVP---AVE-----------------N-----------------ENSLRLITM--KDPK
A0A841ZT34      GHII---NYT-----------------KTK-------------KDSATRKILTG--YSGG
A0A1G9IUT4      GNIP---N-E-----------------NNL-------------DSKNMKSILD-------
A0A842GR80      GHII---KFQ-----------------KNS-------------KRDNNQKLITR--HVAR
A0A7X0TNH3      GHII---KFQ-----------------KNS-------------KRDNNRKLITR--HVAR
A0A842D596      GHII---KFQ-----------------KNS-------------KRDNNRKLITR--HVAR
A0A842EQ86      GHII---KFQ-----------------KNS-------------KRDNNRKLITR--HVAR
A0A842A220      GHII---KFQ-----------------KNS-------------KRDNNRKLITR--HVAR
A0A7X0YM80      GHII---KFQ-----------------KNS-------------KRDNNRKLITR--HVAR
A0A842GEL5      GHII---KFQ-----------------KNS-------------KRDNNRKLITR--HVAR
A0A841XVD7      GHII---KFQ-----------------KNS-------------KRDNNRKLITR--HVAR
A0A7X0XME5      GHII---KFQ-----------------KNS-------------KRDNNRKLITR--HVAR
A0A842B6T1      GHII---KFQ-----------------KNS-------------KRDNNRKLITR--HVAR
A0A841X7G0      GHII---KFQ-----------------KNS-------------KRDNNRKLITR--HVAR
A0A841W3M8      GHII---KFQ-----------------KNS-------------KRDNNRKLITR--HVAR
A0A7X0XVI0      GHII---KFQ-----------------KNS-------------KRDNNRKLITR--HVAR
A0A7X0Z1K1      GHII---KFQ-----------------KNS-------------KRDNNRKLITR--HVAR
A0A143ZUX1      ASIP------------TIGS--------------------------RSRSRKGNSSLLIS
A0A7I8D809      ASIP------------TIGS--------------------------RSRSRKGNSSLLIS
A0A3R9WAA7      GLLP------------HLR---------------------------ERKKNIIGDVRKRA
A0A1G6BLF1      AAIP------------HV---------------RFKKRG-------KNASKNVELVLMDN
A0A355G1X5      GTVY------------TVRNK-------------------------SGKKNQHPVLMITD
A0A1W2CEA6      GAVT------------RQNME-----------RNAAELGADMPRNPAFADGKHQAVFRGN
A0A355G3J9      ATIP------------IQGE------------GKPNGKR-------NSFDNAVEQQVILS
A0A3D2AD87      GSIP------------DFDNIVSSPNYKGYYGKASYRSRLKKHLTDSNNADDSKESVLEK
A0A143XN92      GTIY------------HE--------------RKHKTIR-------SAIKRESVNMLITN
R7FFK6          GEIQ------------SIGG------------KVKKKDR-------GTSADRKRKLIYHN
A0A373MPB9      GEIM------------NIGG------------KTSKKDE-------GSSADRKKQLLFNN
A0A373L519      GEIM------------NIGG------------KTSKKDE-------GSSADRKKQLLFNN
A0A373W906      GEIM------------NIGG------------KTSKKDE-------GSSADRKKQLLFNN
A0A373VCW2      GEIM------------NIGG------------KTSKKDE-------GSSADRKKQLLFNN
W0U604          GEIM------------NIGG------------KTSKKDE-------GSSADRKKQLLFNN
A0A374B6G0      GEIM------------NIGG------------KTSKKDE-------GSSADRKKQLLFNN
A0A373VM36      GEIM------------NIGG------------KTSKKDE-------GSSADRKKQLLFNN
A0A1C5P379      GEIM------------NIGG------------KTSKKDE-------GSSADRKKQLLFNN
A0A373XXX0      GEIM------------NIGG------------KTSKKDE-------GSSADRKKQLLFNN
A0A5R9MJM9      GEIM------------NIGG------------KTSKKDE-------GSSADRKKQLLFNN
A0A356CW82      GEIM------------NIGG------------KTSKKDE-------GSSADRKKQLLFNN
R6T4X7          GEIM------------NIGG------------KTSKKDE-------GSSADRKKQLLFNN
A0A374HTV1      GEIM------------NIGG------------KTSKKDE-------GSSADRKKQLLFNN
A0A374GB66      GEIM------------NIGG------------KTSKKDE-------GSSADRKKQLLFNN
A0A374ECC6      GEIM------------NIGG------------KTSKKDE-------GSSADRKKQLLFNN
A0A374BM61      GEIM------------NIGG------------KTSKKDE-------GSSADRKKQLLFNN
A0A373UGZ4      GEIM------------NIGG------------KTSKKDE-------GSSADRKKQLLFNN
A0A373SA66      GEIM------------NIGG------------KTSKKDE-------GSSADRKKQLLFNN
A0A1C5X6X7      GEIM------------NIGG------------KTSKKDE-------GSSADRKKQLLFNN
A0A1C6JIH3      GEIM------------NIGG------------KTSKKDE-------GSSADRKKQLLFNN
A0A373PSC3      GEIM------------NIGG------------KTSKKDE-------GSSADRKKQLLFNN
A0A1K1WYK8      GEIQ------------QFG--------------EGKKKK-------KGKHRTEPRGLLTD
A0A1H6IUB1      GEIA------------AFG--------------VEKKKK-------DSDEDEHVK--LTD
A0A1M7L1F9      GEIA------------SFG--------------IEKKKK-------DQDEDAHVK--LTD
A0A1C6B4L6      GEIQ------------EFA--------------AERNDK-------SSK-DNYSK--LTD
A0A1Q6T9P4      GEIQ------------EFA--------------AERNDK-------SSK-DNYSK--LTD
A0A315Y4F9      GDIQ------------AFG--------------DSKKKR-------DAD-DVHLK--LTD
A0A354K620      GEIQ------------AFG--------------DSKKKK-------DAD-DDYVK--LTD
A0A173ZYY6      GAIS------------YE--------------WKYKTIR-------DIFRRKKKAILVDD
A0A6L8RXB5      GAIS------------YE--------------WKYKTIR-------DIFRRKKKAILVDD
A0A173SMI2      GAIS------------YE--------------WKYKTIR-------DIFRRKKKAILVDD
A0A845KKD0      GAIS------------YE--------------WKYKTIR-------DIFRRKKKAILVDD
A0A6N9JW85      GAIS------------YE--------------WKYKTIW-------DIFRRKKKAILVDD
A0A174ASH7      GAIS------------YE--------------WKYKTIR-------DIFRRKKKAILVDD
A6BH65          GAIS------------YE--------------WKYKTIR-------DIFRRKKKAILVDD
R7G0D7          GAIS------------YE--------------WKYKTIR-------DIFRRKKKAILVDD
R6HZX3          GTIP------------AI------------------QVK-------RRRKAAGSGVSILN
R5EFZ0          GEIS------------HE--------------RKYKTVF-------ALLRRKKTSILITN
A0A3E5FSY5      ATIP------------QV------------------KFK-------ARKIHKQTRISIND
A0A1V5S3C0      AVVS------------KL------------------DLK-------RRKNSPKKGLLIID
A0A3C0QME1      GEIV------------NFSDGNSK--------KVQSEHR-----------------TILD
A0A355FYK5      GSIP------------YVGKSTGL--------INKKPL--------------FTGGLLIT
A0A357AQU0      GEVM------------DYGTKKDK--------KKRRNVD-------PSKKNNFSFETILN
A0A3C1YJQ7      GEVM------------DYGTKKDK--------KKRRNVD-------PSKKNNFSFETILN
A0A3D0JG38      GEVM------------DYGTKKDK--------KKRRNVD-------PSKKNNFSFETILN
A0A3C0IHX1      GEVP------------EMVEARSG--------KRKRRKK-------KNSPSALRNMLLCA
R5V506          GEVP------------EMVEARSG--------KRKRRKK-------KNSPSALRNMLLCA
A0A352TIU5      GEVP------------EMVEARSG--------KRKRRKK-------KNSPSALRNMLLCA
R5B467          GALP------------AV-------------------RV-------KKRSRTTPAALPEE
A0A1Y3TC98      AFIP------------HV------------------RFK-------ARKKLDDTRLSLLN
A0A1W1Z4C3      SYIR------------RA-----------------------------KGEEKDAGVFLLN
A0A239QN83      SYIR------------RA-----------------------------KGSEKDAGAYLLN
A0A8A5CVI3      SYIR------------RA-----------------------------KGSEKDAGAFLLN
A0A8A5D3H1      SYIR------------RA-----------------------------KGSEKDAGAYLIN
A0A1Q6REE0      GQIP------------AVKISRKRPYPLLHRYRSES------------------------
R5ETF9          GQIP------------AVKISRKRPYPLLHRYRSES------------------------
A0A0F2P7X6      GSIP------------YLSPKA----------RKGQGQS-------QGQGQGQGAPLVTS
A0A359B487      GSIP------------YLSPKA----------RK-------------DQGQGQGAPLVNS
R6VAT5          GSI-------------------------------VKVVK-------KKSSHSTGSLTIDD
D4LC36          AEIQ------------SIGGKA----------KKKNRGT-------DADRKTRLLFGNEN
A0A7X3IXX7      GILP------------KTPSLKGNNRGEVED-DAAHEAV-------RQLRTNLRFVSVDN
A0A1Q6S448      SSVP------------HEGRRTRKLLGWFDDRRRERRAR-------RGGKRLRRNLNISS
A0A351MYR0      STVP------------HEGRRTRKLLGWMDD-RRERQAR-------RGGKRLRRNLNISS
R6HPC1          STVP------------HEGRRTRKLLGWMDD-RWERRSR-------RGGKRLRRNLNISS
A0A3D4G5Z5      STVP------------HEGRRTRKLLGWMDD-RRERRSR-------RGGRRLRRNLNISS
A0A3D5ES03      STVP------------HEGRQTRKLLGWMDD-RRERRSR-------RGGKRLRRNLNISS
A0A348P5V4      GVIG------------RV--------------YR-K----------NKKGESKQGILITD
A0A356PT74      GMVA------------HV--------------NRKK----------KKKGEDYKPLLISD
A0A3D5LL19      GMVA------------HV--------------NRKK----------KKKGEDYKPLLISD
R5MNF0          GMVA------------HV--------------NRKK----------KKKGEDYKPLLISD
A0A1Q9JSI0      ETLY------------HE--------------KRYKTWK-------ARLHRKKNPVLLTN
A0A3D5TNI1      GEVS------------QV--------------PGGERFY-------KKSAHGDRELLITD
A0A358LJD0      GEVS------------QV--------------PGGERFY-------KKSAHGGRELLITD
R6I3L7          GEVS------------QV--------------PSGERFY-------KKSAHGDRELLITD
A0A3D1HXX0      GEVS------------QV--------------PSGERFY-------KKSTHGDRELLITD
A0A3D2QJB8      GEVS------------QV--------------PSGERFY-------KKSAHGDRELLITD
R7MQJ4          GEIP------------EF--------------IDDKK---------KKKDSNDYDLLLTQ
A0A1V5GLC0      GEIQ------------DF--------------TIGRK---------KKG--EDDHFKLTD
W7V182          GEIQ------------QF--------------DESKK---------RKKDVDDNHVKLTD
A0A143XPI5      GTLP------------TVKMKK------------------------RRKDKN-MEVSLLN
A0A0M6WXE3      YEWK------------YKTIKE------------------------WIKHRK-KAVLVDN
A0A348SAK2      YEWK------------YKTIKE------------------------WIKHRK-KAVLVDN
A0A1G9H5B9      -----------------AEIKR------------------------LDSAKKDPEAFLLT
A0A1Y4H8L0      YEPK------------AKNLRE------------------------LFQKQK-KALLVSQ
A0A4B9BMD9      RKKN------------LFSNQQ------------------------RHRTKNIPFLAVDN
A0A0M6WYQ8      GTLP------------EVHVKK------------------------RNKESFYNSVNVLN
A0A348SAK1      GTLP------------EVHVKK------------------------RNKESFYNSVNVLN
A0A252F281      ASVP------------HEKRPD------------------------GKNKKEKHSFLITH
A0A1Y4QKE6      ATIP------------RVKIKA------------------------RKIHKQ-TRISIND
B1C231          ATIP------------QVKFKA------------------------RKIHKQ-TRISIND
A0A7V6WIR4      NKLL------------NNSPRN------------------------RTGEKEINKHILTS
A0A1Y3TUL5      GEIP------------ENV--E------------------------YFRRKK-SLLVEDD
A0A1Y4JAX2      GEIP------------ENV--E------------------------YFRRKK-SLLVEDD
A0A1Y4T590      GEIP------------ENV--E------------------------YFRRKK-SLLVEDD
A0A1Y3T163      AMIP------------QVRFKA------------------------RKKQKK-KKISVLD
A0A1Y3YCA2      AMIP------------QVRFKA------------------------RKKQKK-KKISVLD
A0A7W8H9H2      GDIP------------EVRFKA------------------------RGKQTR-REISCQS
A0A1Y4L6N9      AKIP------------NVRQKA------------------------RKKRIE-SRITVFD
A0A173T644      GNLP------------EMKQKA------------------------RKKKRR-RDISILN
A0A1C5TSB8      GNLP------------EMKQKA------------------------RKKKRR-RDISILN
C0CIK6          GNLP------------EMKQKA------------------------RKKKRR-RDISILN
A0A1Y3WEF6      ANIP------------EVSKKL------------------------RKKQDT-RWIQMQD
A0A417T0L2      ANIP------------EVSRKL------------------------RKKQTT-RWIQMQD
A0A1H9EPU3      ENDP------------EKKEKN------------------------KLKLRQ-NGQVIPT
A0A354IGV3      HERK------------NRTLRD------------------------SLHKVN-RSVLLTN
A0A417JMV2      HEKI------------YKTWKA------------------------RIHRKK-SPVLLTN
A0A415VWX5      HEKI------------YKTWKA------------------------RIHRKK-SPVLLTN
A0A173UY96      HEKI------------YKTWKA------------------------RIHRKK-SPVLLTN
B0P408          HEKI------------YKTWKA------------------------RIHRKK-SPVLLTN
D4MV82          HEKI------------YKTWKA------------------------RIHRKK-SPVLLTN
A0A173QTL1      HEKI------------YKTWKA------------------------RIHRKK-SPVLLTN
A0A174J359      HEKI------------YKTWKA------------------------RIHRKK-SPVLLTN
A0A174A3T7      HEKI------------YKTWKA------------------------RIHRKK-SPVLLTN
A0A417UUA3      HEKI------------YKTWKA------------------------RIHRKK-SPVLLTN
A0A6N2VB70      HEKI------------YKTWKA------------------------RIHRKK-SPVLLTN
A0A1C6EUV9      HERI------------YKSWKA------------------------RIHRKK-SSVLLTN
A0A173Y645      HERL------------YKSWKA------------------------RIHRKK-SSVLLTN
A0A374AVY6      HERS------------YKSWKA------------------------RIHRKK-SSVLLTN
R7BXS4          HERS------------YKSWKA------------------------RIHRKK-SSVLLTN
                                                                            

S3FFL2          SP--RDVLFDRKSDMVDAYLAVQTNLGF-TT--AHGVP--RTFAVTSTRPGEGKSTTALA
A0A328M4V1      AP--TDL-------AVEALRSLRTSLHF-AR--LEAKN--NLLLISSSSPGVGKSFVASN
A0A6A8IF17      GN--RDI-------INEAFRVLRTNLEFMTG--KDKTS--NVIIMTSFNPGSGKSFLTMN
A0A143WVN6      RL--LSM------SFTESNRKLATLIERHMT--RHQ-Q--KVLLVCSVAENEGKSSVASN
W6RXP9          DD--PKA------VASESYRTLKTNIQYSSF--DEK-H--RVMVVTSSTPGEGKSTTTGN
W6S4G8          EE--PRS------LEAECYRTMVTNIQYSSI--DSR-C--KTIVVTSSQKGEGKTTISGN
A0A3D5R4X5      ED--PKS------PVAEAYRSLRTNLKFASL--DKE-I--KSIVVTSTIAGEGKSLTTSN
A0A1I4C3N6      EN--SSF------EMREAYNEIRTFLTFSKR--DEK-C--PVYGILSADKGEGKTVSALN
A0A3B9CIM7      KE--SPF------AVRESYNSIRAKLLFTGK--GEK-C--PVYAITSADPGEGKTLTCIN
A0A7R7IBN8      LD--SPF------GLREAYNNIRANLRLTGN--LKR-C--PVYAITSADSAEGKTLNAVN
A0A1G9WHW8      ED--STF------TITEAYNSIRTKLLYTAK--DQK-C--PIYGITSADSGEGKSLNSMN
A0A1H5VAA0      ED--STF------TITEAYNSIRTKLLYTAK--DQK-C--PIYGITSADSGEGKSLNSMN
A0A3R6VK11      EN--SSF------AVKESYNTIRANLLFTGK--GER-C--PVYAVTSADKDEGKTLNSVN
A0A3R6QUY7      EN--SSF------AVKESYNTIRANLLFTGK--GER-C--PVYAVTSADKDEGKTLNSVN
A0A373K3P9      EN--SSF------AVKESYNTIRANLLFTGK--GER-C--PVYAVTSADKDEGKTLNSVN
A0A3R6JRU5      EN--SSF------AVKESYNTIRANLLFTGK--GER-C--PVYAVTSADKDEGKTLNSVN
A0A1C5MS04      EN--SSF------AVKESYNTIRANLLFTGK--GER-C--PVYAVTSADKDEGKTLNSVN
A0A3C1J150      EN--SSF------AVKESYNTIRANLLFTGK--GEH-C--PVYAVTSADKDEGKTLNSVN
A0A416CXD7      EN--SSF------AVKESYNTIRANLLFTGK--GEH-C--PVYAVTSADKDEGKTLNSVN
A0A6N2X662      EN--SSF------AVRESYNTIRANLLFTGK--GER-C--PVYAVTSADKDEGKTLNSVN
R6XBL9          EN--SSF------AVKESYNTIRANLLFTGK--GER-C--PVYAVTSADKDEGKTLNSVN
A0A355W5Z7      EN--SSF------AVKESYNTIRANLLFTGK--GER-C--PVYAVTSADKDEGKTLNSVN
A0A1G6BLB6      PT--VSF------SYSEAVRRMVSRVRNKMN--HRN-S--KVLMVTSVLENEGKSTVAVN
A0A1C6G8M0      DE--LPF------SAAEAIYQLRTAILYSSK--D---V--KMIAVTSAFENQGKSFISFH
A0A416MP73      ED--LPF------NASEAIYQLRTGILYSSK--D---V--KTIVVTSAFENQGKSFISFH
A0A3E4LL92      QD--TDH------VYEEAVDRIVTSIGSEMS--AEG-Y--KTLMVGSIKENDGKSTVTAN
A0A415D1L1      QD--TDH------VYEEAVDRIVTSIRSEMS--AEG-Y--KTLMVGSVKENDGKSTVTAN
A0A396G6S7      PL--RSF------AYVESSKMAASRVRSYMD--KED-A--KVLLVTSVMENEGKSTVAAN
A0A3E5A223      PL--RSF------AYVESSKMAASRVRSYMD--KED-A--KVLLVTSVMENEGKSTVAAN
R7D5E6          PL--RSF------AYVESSKMAASRVRSYMD--KED-A--KVLLVTSVMENEGKSTVAAN
A0A415HQH5      PL--RSF------AYVESSKMAASRVRSYMD--KED-A--KVLLVTSVMENEGKSTVAAN
A0A414W2C6      PL--RSF------AYVESSKMAASRVRSYMD--KED-A--KVLLVTSVMENEGKSTVAAN
A5ZNE7          PL--RSF------AYVESSKMAASRVRSYMD--KED-A--KVLLVTSVMENEGKSTVAAN
A0A395X821      PL--RSF------AYVESSKMAASRVRSYMD--KED-A--KVLLVTSVMENEGKSTVAAN
A0A1C5PY68      PL--RSF------AYVESSKMAASRVRSYMD--KED-A--KVLLVTSVMENEGKSTVAAN
A0A174CJF8      PL--RSF------AYVESSKMAASRVRSYMD--KED-A--KVLLVTSVMENEGKSTVAAN
A0A564SRR2      PL--RSF------AYVESSKMAASRVRSYMD--KED-A--KVLLVTSVMENEGKSTVAAN
A0A174R7V0      PL--RSF------AYVESSKMAASRVRSYMD--KED-A--KVLLVTSVMENEGKSTVAAN
A0A373MWV2      PA--RSF------PYVESLKRIASRVRGRLD--RRG-G--KVLLVTSVAENEGKSTLAAN
A0A417CE88      PA--RSF------PYVESLKRIASRVRGRLD--RRG-G--KVLLVTSVAENEGKSTLAAN
A0A416Y441      PA--RSF------PYVESLKRIASRVRGRLD--RRG-G--KVLLVTSVAENEGKSTLAAN
A0A357GPJ7      PA--RSF------PYVESLKRIASRVRGRLD--RRG-G--KVLLVTSVAENEGKSTLAAN
A0A396PAC1      PA--RSF------PYVESLKRIASRVRGRLD--RRG-G--KVLLVTSVAENEGKSTLAAN
A0A416EYU4      PA--RSF------PYVESLKRIASRVRGRLD--RRG-G--KVLLVTSVAENEGKSTLAAN
A0A416SCQ2      PA--RSF------PYVESLKRIASRVRGRLD--RRG-G--KVLLVTSVAENEGKSTLAAN
A0A416TGN7      PA--RSF------PYVESLKRIASRVRGRLD--RRG-G--KVLLVTSVAENEGKSTLAAN
A0A417SMF6      PA--RSF------PYVESLKRIASRVRGRLD--RRG-G--KVLLVTSVAENEGKSTLAAN
A0A0H5SF45      QE--ANF------LVNEAYKALRTNLLYTIR--KNG-C--KKILVNSPNPRDGKSTTCTN
A0A1M6JRJ5      TQ--DSF------LVTESYKALRTNLRFSIR--KEE-C--KKILITSPSPEDGKSTTSIN
A0A1M7Y1S2      RQ--NSF------LVAESYKTLRTNLRFSIR--KEG-C--KKILITSPSPEDGKSTISIN
A0A7I8DMN1      MG--DSF------LTVESYKAFRTNLKFSIR--KEE-C--KKILITSPSPEDGKSTTSIN
A0A1Y4MW77      LQ--TNP------LFLENIESLHIRLAKELA--DIN-G--KTLIFTSTVAKEGKSTIATN
A0A6S6R676      -N--TKF------LVTEAYKAFRTNLRFSLR--KEG-C--KKIIVSSPVPEDGKSTTSTN
A0A0K8J554      -Q--ANF------IITEAYKALRINLLYTIR--KQG-C--KKILINSPNPEEGKSTTCLN
A0A1I0RG99      -D--TEF------VIAEAYKSLRSNLNFTLR--FNG-C--KKIIISSPVPQDGKSTTITN
A0A1I5G322      -D--TQF------IITEAYNSLRTNLKFTLR--HQG-C--KKIVISSSLPEDGKSTITTN
A0A7C6IYW8      -N--LKF------IFSESFKSFRTNLRFVLV--KEG-C--KKIIISSPLPGDGKSTACIN
A0A7C6JZF1      -E--RRF------DVNEAFQELKTNMRFTLF--HGG-C--KKIIITSPLPEEGKSTTSSN
A0A3N1XSX6      -N--SKF------IITESYKSLRTNLRFTLL--KDQ-C--KKIIVSSPVPEEGKSTTSIN
A0A839K1C1      -N--SKV------IFSESFKSLRTNLRFTLV--KEG-C--KKIIISSPLPSDGKSTTSVN
R6UHV6          PV--ISF------EFREAFKRLRQKIVSDSK--THH-N--KVYAVTSSLENEGKTTVAVN
A0A3R9Q621      EN--TKF------IITEAYRALRSNLRYTLR--KDG-C--KIIMINSPMPEDGKSTTCAN
A0A069RC75      TS--PKS------PGAEAFRSIRTNMQFANI--DQN-I--KTILFTSSIPGEGKTLVSAN
A0A174F2W5      PA--RSF------PYVESLKRIASRVRGRLD--RRG-G--KVLLVTSVAENEGKSTLAAN
A0A174S8E9      PA--RSF------PYVESLKRIASRVRGRLD--RRG-G--KVLLVTSVAENEGKSTLAAN
A0A416ZL97      PA--RSF------LYVESLKRIASRVRGRLN--RKG-G--KVLLVTSVAENEGKSTLAAN
A0A174LSK1      PA--RSF------LYVESLKRIASRVRGRLD--RKG-G--KVLLVTSVAENEGKSTLAAN
A0A373GY92      PA--RSF------LYVESLKRIASRVRGRLD--RKG-G--KVLLVTSVAENEGKSTLAAN
A0A373NZQ6      PA--RSF------LYVESLKRIASRVRGRLD--RKG-G--KVLLVTSVAENEGKSTLAAN
A0A417I9B9      PA--RSF------LYVESLKRIASRVRGRLD--RKG-G--KVLLVTSVAENEGKSTLAAN
A0A417WQF8      PA--RSF------LYVESLKRIASRVRGRLD--RKG-G--KVLLVTSVAENEGKSTLAAN
A0A8B3CFR3      PA--RSF------LYVESLKRIASRVRGRLD--RKG-G--KVLLVTSVAENEGKSTLAAN
A0A373RZ83      PA--RSF------LYVESLKRIASRVRGRLD--RKG-G--KVLLVTSVAENEGKSTLAAN
A0A416U6I1      PA--RSF------LYVESLKRIASRVRGRLD--RKG-G--KVLLVTSVAENEGKSTLAAN
R7JQZ9          PA--RSF------LYVESLKRIASRVRGRLD--RKG-G--KVLLVTSVAENEGKSTLAAN
A0A1M5UYN6      SN--PSS------IAAEGFRTLRTNIQYSSI--DKK-I--RTIVVTSAGQGEGKTQVSGN
A0A176JBT8      TE--PHS------SSSEAYRSVRANLDILRQ--SKQ-P--VTILVTSTSAGDGKSLTCGN
A0A1I5HIC6      AS--LEF------SVNEAYKTLRTNIQFCGK--D---I--KTICITSSLPDEGKTVVAFR
A0A1Y3TC51      PV--VSM------GFAEAGRRTAARVEYHMR--RHR-Q--KMLLVSSIAENEGKSTVAAN
A0A1Y3T1N0      PL--VSM------DFAEASRRAEAKVEYHMR--RND-Q--KILLVTSISENEGKSTVAAN
A0A1Y3Y8U8      PL--VSM------DFAEASRRAEAKVEYHMR--RND-Q--KILLVTSISENEGKSTVAAN
A0A5B0BQY5      VQ--FPK------AEKEDFNKLAATIHYFIK--QKK-V--KTIMMTSSGAGEGKTFIGSN
A6CLL4          SE--ANS------PAMELYREIRTNIQFLLK--KEK-T--KVLLVTSSGASEGKSLTTGN
A0A176U8D6      EN--LPF------NASEAIYQLRTGILYSSK--D---V--KTIAVTSAFENQGKSFISFH
A0A1Q6KSQ5      DE--LPF------SAAEAIYQLRTAILYSSK--D---V--KMIAVTSAFENQGKSFISFH
A0A3D3U8B3      DE--LPF------SAAEAIYQLRTAILYSSK--D---V--KMIAVTSAFENQGKSFISFH
A0A3E5FRL7      PI--ASM------NFVEANGRMSSRIEYHLN--RYN-Y--QVLLVTGISENEGKSTVAAN
A0A1Y4QK93      PI--ASM------NFVEANGRMSSRIEHHFD--KHN-F--KVLLVTGIGENDGKSTVAAN
B1C232          PI--ASM------NFVEANGRMSSRIEHNFD--KHN-F--KVLLVTGTGENEGKSTVAAN
A0A401USI6      RE--PKS------PVTEAFKSMRTNLLFSME--NRG-I--KTLMVCSPGPKDGKTSVSTN
A0A1V4IQ10      QK--PKS------IVAEAYRTLITNILYSES--EKN-I--KTILITSSKLQEGKSTVAGN
A0A1S8TRD2      KK--PKS------IVAEAYRTLITNILYSES--EKT-I--KTILVTSSKLQEGKSTVAGN
G7M1U2          KK--PKS------IVAEAYRTLITNILYSES--EKT-I--KTILVTSSKLQEGKSTVAGN
A0A2T6KJ75      LP--TFD------VFTEMFRSIRANLLYVLS--KNN-A--KTLLVTSAESGDGKSFVSAN
A9KN92          AT--LEF------TINEAYKSLRTNIQFCGK--D---I--KTICITSSLPNEGKTVVSFR
A0A352MUJ1      LD--PKS------QIAEGFKSLRTNLQFMKG--SDGDL--KSVLITSSLPGEGKSWVATN
R5YI67          LD--PKS------QCAEGFKSLRTNLQFMNG--SEG-L--KSVLITSALPGAGKSWVATN
A0A174DL89      ES--PKS------LPSEAINILRTNLQFCNV--NYN-L--KKILITSSSPSEGKSTIISN
A0A1Y0IQP5      QD--PRS------AEAEAFRTLRTNIQYDEA--GQH-V--KVLMVTSTAAGEGKTTVIAN
A0A4R2R7B1      QD--PRS------AVAEAFRTLRTNIQYDEA--GKH-V--KVLIVTSTLAGEGKSMVLAN
A0A1M6E8I2      EN--PKS------PISEAYRSLRTNINFANL--DNN-M--KTILITSATPGEGKTQTVMN
A0A7C6SMH0      ND--PKA------AATEAFRELRTNLHYINI--DKE-V--KTMVLTSPSMGDGKSVTAAN
A0A7X7XYM7      ND--PKA------AATEAFRELRTNLHYINI--DKE-V--KTMVLTSPSMGDGKSVTAAN
A0A3B8KKL6      ND--PKA------AATEAFRELRTNLHYINI--DKE-V--KTMVVTSPSMGDGKSVTAAN
A0A2K9E6R0      ND--PKA------AATEAFRELRTNLHYINI--DKE-V--KTMVVTSPSMGDGKSVTAAN
A0A2S8RBI0      ND--PKA------AATEAFRELRTNLHYINI--DKE-V--KTMVVTSPSMGDGKSVTAAN
A0A7X8MFK9      NN--PKA------PATEAFRELRTNLYYTSV--DKE-L--KTLVVTSPTLGDGKTVTAVN
A0A7X9D1M8      NK--PKA------PATEAFRELRTNLYYTSI--DKE-L--KTIVVTSPTLGDGKTVTAVN
A0A0L6JLG6      ND--PKA------AASEAYRELRTNLQYKSV--DKD-M--KVILLTSPSLGDGKTVTTVN
A0A7X8PYA7      ND--PKA------PASEAFREIRTNLHYMSV--DKE-L--KSIVITSPTLGDGKTVTAVN
G8LSN0          ND--PKA------PASEAFREIRTNLHYKSV--DKE-L--KTIVITSPALGDGKTVTSVN
A0A1Y4N105      PL--LSM------PYSEANRKLGALIERHMR--RRN-Q--QVLLVTSVAENEGKSSTAGN
A0A1Y4QP75      PL--LSM------PYSEANRKLGALIERHMR--RRN-Q--QVLLVTSVAENEGKSSIAGN
A0A3D4QRB5      AA--TRA------PVTEAYKTLRTNIQFSNV--DNN-L--KVLMVTSTSKDEGKSSTAAN
A0A349DEH5      RK--NGF------SFIETYKSIRTKIENNSA--RTG-N--KVFLITSACENEGKTTSCVN
A0A3D4T7B4      RK--NGF------SFIETYKSIRTKIENNSA--RTG-N--KVFLITSACENEGKTTSCVN
A0A350XYC7      RK--NGF------SFIETYKAIRTKIENNST--RTG-N--KVFLVTSACENEGKTTVCVN
R6DNR8          RK--NGF------SFIETYKAIRTKIENNST--KTG-N--KVYLVTSACENEGKTTSCVN
A0A355KUM5      RK--NGF------SFIETYKAIRTKIENNST--RTG-N--KVFLVTSACENEGKTTSCVN
R5YGY6          RK--NGF------SFIETYKSIRTKIENNST--RTG-N--KVFLVTSACENEGKTTSCVN
A0A7G9WCY6      RE--PKS------PISEAYRMLRTNIQFANL--DND-L--KTIVITSTGPSEGKSTTISN
A0A0A5GPA9      LG--TYS------PITEAYRSIRTNLQYTLN--QKS-A--KTVLFTSTHSSEGKSITAAN
A0A271M6M4      LN--PYS------AVTEAYRAVRTNVQYTIS--QED-A--QTILITSSHPGEGKSLTAAN
A0A1C6G0U3      ------G------PILEAYRSIRTNIEFFNI--DKT-I--KVIMVTSSQPGEGKSTFISN
A0A3D4LLB3      DN--PSS------PTAEAYRKITTNIEFSNV--DNV-I--KTIMITSAKQDEGKTTTICN
A0A7C7AD93      CS--L-----------DSFRTIRTYLLYISK--KSG-I--KAIVITSARAQEGKSSTAAM
A0A2V3W8U6      GP--MST------PVLEAYRSIRTNLQFQLM--DKS-L--KTILVTSTSKNEGKTITCSN
A0A6N3BXA1      KN--L---------VQEEFIKIRTNIQYANI--DNE-M--KVILFTSTHKDEGKSILSLN
A0A351SRI8      SG--I----------SEAIRTLRTNLQFSSI--DRK-I--KTILVTSSVPGEGKSFVASN
A0A1V5LU59      ND--PKA------PASEAFREIRTNLHYTSV--DKE-L--KTIVVTSPTLGDGKTVTAVN
A0A7X8R9W1      NN--PKA------PATEAFRELRTNLQYAGV--DKE-L--KTIVVTSPTMGDGKTVTAVN
A0A1E3BVC3      NN--PKA------TSAEAFRELRTNLYYSSV--DRE-I--KTIVVTSPTLGDGKTVTAVN
A0A4Q0I6S0      NN--PKA------TSAEAFRELRTNLYYSSV--DRE-I--KTIVVTSPTLGDGKTVTAVN
A3DF66          NN--PKS------ATAEAFRELRTNLYYSSV--DSE-V--KTIVVTSPTLGDGKTVTAVN
W4V1T8          NN--PKS------ASAEAFRELRTNLHYSSV--DRE-V--KTIVVTSPTLGDGKTVTAVN
A0A1C6ITD7      S------------LPSEAINILRTNLQFCNV--NSN-L--KKILITSSSPSEGKSTIISN
A0A381IX63      SS--V----------SEAYRNTRTNIQFSNL--DEN-L--NVIAITSSKPSEGKSTMISN
A0A1M6RWV2      SP--I----------SEAYRILRTNIQFSNL--DNK-L--KTILVTSSGPAEGKSTTISN
A0A841ZT34      NS--LIN------HAVEDFRMLCANLTILGK--NKH-L--KTFTFTSIRGGEGKSSTVAN
A0A1G9IUT4      ----------------ENYKNIRTNIEFSNV--DKN-I--KSIVITSSQKNEGKTTIVSS
A0A842GR80      SS--LYK------QAAEGFRVFCANLLFISQ--KNN-L--QVFTFTSVRSGEGKSTSIAN
A0A7X0TNH3      SS--LYK------QAAEGFRVFCANLLFISQ--KNN-L--QVFTFTSVRSGEGKSTSIAN
A0A842D596      SS--LYK------QAAEGFRVFCANLLFISQ--KNN-L--QVFTFTSVRSGEGKSTSIAN
A0A842EQ86      SS--LYK------QAAEGFRVFCANLLFISQ--KNN-L--QVFTFTSVRSGEGKSTSIAN
A0A842A220      SS--LYK------QAAEGFRVFCANLLFISQ--KNN-L--QVFTFTSVRSGEGKSTSIAN
A0A7X0YM80      SS--LYK------QAAEGFRVFCANLLFISQ--KNN-L--QVFTFTSVRSGEGKSTSIAN
A0A842GEL5      SS--LYK------QAAEGFRVFCANLLFISQ--KNN-L--QVFTFTSVRSGEGKSTSIAN
A0A841XVD7      SS--LYK------QAAEGFRVFCANLLFISQ--KNN-L--QVFTFTSVRSGEGKSTSIAN
A0A7X0XME5      SS--LYK------QAAEGFRVFCANLLFISQ--KNN-L--QVFTFTSVRSGEGKSTSIAN
A0A842B6T1      SS--LYK------QAAEGFRVFCANLLFISQ--KNN-L--QVFTFTSVRSGEGKSTSIAN
A0A841X7G0      SS--LYK------QAAEGFRVFCANLLFISQ--KNN-L--QVFTFTSVRSGEGKSTSIAN
A0A841W3M8      SS--LYK------QAAEGFRVFCANLLFISQ--KNN-L--QVFTFTSVRSGEGKSTSIAN
A0A7X0XVI0      SS--LYK------QAAEGFRVFCANLLFISQ--KNN-L--QVFTFTSVRSGEGKSTSIAN
A0A7X0Z1K1      SS--LYK------QAAEGFRVFCANLLFISQ--KNN-L--QVFTFTSVRSGEGKSTSIAN
A0A143ZUX1      PR--SDF------SYVEAYKSLRVRVESLAA--ERG-Y--KKFIVTSTLADEGKSTVAAN
A0A7I8D809      PR--SDF------SYVEAYKSLRVRVESLAA--ERG-Y--KKFIVTSTLADEGKSTVAAN
A0A3R9WAA7      QTDRMAL------GYMDDMYKIRTRLNKIIT--NRD-I--KTLLITSAIPAEGKSTFAFN
A0A1G6BLF1      FR--VPP------GFVEAMRSVRRRIENHSL--DTK-K--NIYLVTSALPEEGKSTVAAN
A0A355G1X5      RS--LGF------SFIESYKAIRTRVETLCT--RKD-Y--KTILVTSAGANEGKTTFSLN
A0A1W2CEA6      LK--LDY------AGEEAINAVCSSMSFTGK--NL-----KRVLVSSCGANEGKTFATIQ
A0A355G3J9      ED--TPF------SVKEAYHKARSNILYLPS--DEE-NGCKTLVITSALVSEGKSTFSVN
A0A3D2AD87      KQ--IPF------VIVESYKNIRTGVAYLLS--REE-K--SSFTITSANAGEGKSTTAAN
A0A143XN92      PI--LSR------KYINSIEITAAKVRNRMD--AKR-I--KTVMITSMMENEGKSTVAAN
R7FFK6          SD--LPF------SILETYKALRSSLNFLVS--TSE-N--KIVAVTSASPNEGKSVTVAN
A0A373MPB9      KD--IPF------NIVENYKTMRTNLMFTLS--TTR-N--KIVVVSSPNPSEGKSVTVAN
A0A373L519      KD--IPF------NIVENYKTMRTNLMFTLS--TTR-N--KIVVVSSPNPSEGKSVTVAN
A0A373W906      KD--IPF------NIVENYKTMRTNLMFTLS--TTR-N--KIVVVSSPNPSEGKSVTVAN
A0A373VCW2      KD--IPF------NIVENYKTMRTNLMFTLS--TTR-N--KIVVVSSPNPSEGKSVTVAN
W0U604          KD--IPF------NIVENYKTMRTNLMFTLS--TTR-N--KIVVVSSPNPSEGKSVTVAN
A0A374B6G0      KD--IPF------NIVENYKTMRTNLMFTLS--TTR-N--KIVVVSSPNPSEGKSVTVAN
A0A373VM36      KD--IPF------NIVENYKTMRTNLMFTLS--TTR-N--KIVVVSSPNPSEGKSVTVAN
A0A1C5P379      KD--IPF------NIVENYKTMRTNLMFTLS--TTR-N--KIVVVSSPNPSEGKSVTVAN
A0A373XXX0      KD--IPF------NIVENYKTMRTNLMFTLS--TTR-N--KIVVVSSPNPSEGKSVTVAN
A0A5R9MJM9      KD--IPF------NIVENYKTMRTNLMFTLS--TTR-N--KIVVVSSPNPSEGKSVTVAN
A0A356CW82      KD--IPF------NIVENYKTMRTNLMFTLS--TTR-N--KIVVVSSPNPSEGKSVTVAN
R6T4X7          KD--IPF------NIVENYKTMRTNLMFTLS--TTR-N--KIVVVSSPNPSEGKSVTVAN
A0A374HTV1      KD--IPF------NVVENYKTMRTNLMFTLS--TTR-N--KIVVVSSPNPSEGKSVTVAN
A0A374GB66      KD--IPF------NIVENYKTMRTNLMFTLS--TTR-N--KIVVVSSPNPSEGKSVTVAN
A0A374ECC6      KD--IPF------NIVENYKTMRTNLMFTLS--TTR-N--KIVVVSSPNPSEGKSVTVAN
A0A374BM61      KD--IPF------NIVENYKTMRTNLMFTLS--TTR-N--KIVVVSSPNPSEGKSVTVAN
A0A373UGZ4      KD--IPF------NIVENYKTMRTNLMFTLS--TTR-N--KIVVVSSPNPSEGKSVTVAN
A0A373SA66      KD--IPF------NIVENYKTMRTNLMFTLS--TTR-N--KIVVVSSPNPSEGKSVTVAN
A0A1C5X6X7      KD--IPF------NIVENYKTMRTNLMFTLS--TTR-N--KIVVVSSPNPSEGKSVTVAN
A0A1C6JIH3      KD--IPF------NIVENYKTMRTNLMFTLS--TTR-N--KIVVVSSPNPSEGKSVTVAN
A0A373PSC3      KD--IPF------NIVENYKTMRTNLMFTLS--TTR-N--KIVVVSSPNPSEGKSVTVAN
A0A1K1WYK8      KD--VPF------NIVESYKTIRANILFTAA--DSD-K--KVIAVSSPNPGEGKSTSAAN
A0A1H6IUB1      KS--VPF------NVVESYKSIRTNISFALS--TVD-K--KIFAVSSANPREGKSTTSSN
A0A1M7L1F9      KN--VPF------TVVESYKSIRTNVSFALS--TVD-K--KIFAVSSSNPREGKSTTSAN
A0A1C6B4L6      KD--IPF------YIVERYKSIRTNVNFSLA--TSD-K--KIFAVSSANPSEGKSIISAN
A0A1Q6T9P4      KD--IPF------YIVERYKSIRTNVNFSLA--TSD-K--KIFAVSSANPSEGKSIISAN
A0A315Y4F9      KD--APF------YIIESYKSIRTNLSFALS--TVE-K--KTFVVSSANPGEGKSTTSAN
A0A354K620      KE--TPF------HIIESYKSIRTNLSFALS--TFD-K--KVFAVSSANPGEGKSTTSAN
A0A173ZYY6      PV--ASF------RFVESYKKLAAKVEYRMA--KNE-Q--KVLVVTSVSENEGKSTVAAN
A0A6L8RXB5      PV--ASF------RFVESYKKLAAKVEYRMA--KNE-Q--KVLVVTSVSENEGKSTVAAN
A0A173SMI2      PV--ASF------RFVESYKKLAAKVEYRMA--KNE-Q--KVLVVTSVSENEGKSTVAAN
A0A845KKD0      PV--ASF------RFVESYKKLAAKVEYRMA--KNE-Q--KVLVVTSVSENEGKSTVAAN
A0A6N9JW85      PV--ASF------RFVESYKKLAAKVEYRMA--KNE-Q--KVLVVTSVSENEGKSTVAAN
A0A174ASH7      PV--ASF------RFVESYKKLAAKVEYRMA--KNE-Q--KVLVVTSVSENEGKSTVAAN
A6BH65          PV--ASF------RFVESYKKLAAKVEYRMA--KNE-Q--KVLVVTSVSENEGKSTVAAN
R7G0D7          PV--ASF------RFVESYKKLAAKVEYRMA--KNE-Q--KVLVVTSVSENEGKSTVAAN
R6HZX3          PH--LGD------TLSVPIGALQVRLLRSQP--AGG-TG-RIILITSTMPGEGKTTVSFN
R5EFZ0          PV--TSF------RFVESIRKLRRRVEQHMD--GG-----KVLIVTSLLENEGKSTVTVN
A0A3E5FSY5      RR--ISF------AFKENMRSLQIRLERVFK--KEE-H--KVIVVTSTAANEGKTTLTIN
A0A1V5S3C0      KT--VGL------PFIETFKLIRTKIENASF--KKG-Y--KVFAVTSSAENEGKTTVAVN
A0A3C0QME1      EK--MDF------NIVENYKSIRSNIMFAFS--TMP-R--KILAVSSANPGEGKSTTASN
A0A355FYK5      DEDKVSF------AFIECVKAIRTKLENLSA--NKG-F--KTFMVTSTYENEGKTTVAIN
A0A357AQU0      KE--IPF------SVVESFKSIRTNIMFAVA--TQG-K--KVIAVTSANPSEGKSSTTTN
A0A3C1YJQ7      KD--IPF------SVVESFKSIRTNIMFAVA--TQG-K--KVIAVTSANPSEGKSSTTTN
A0A3D0JG38      KE--IPF------SVVESFKSIRTNIMFAVA--TQG-K--KVIAVTSANPSEGKSSTTTN
A0A3C0IHX1      KD--IPF------PCSEAYRSIRTNLMFALA--PQE-H--KIVAVTSPNAADGKSLTAAN
R5V506          KD--IPF------PCSEAYRSIRTNLMFALA--PQE-H--KIVAVTSPNAADGKSLTAAN
A0A352TIU5      KD--IPF------PCSEAYRSIRTNLMFALA--PQE-H--KIVAVTSPNAADGKSLTAAN
R5B467          MA--RSS------AYCEAMRIVAMRVDKAMQ--HHA-Y--RTLLVSSAAPGEGKTTFVCQ
A0A1Y3TC98      EK--LPF------GYRESIRSLQKRVVKNLE--HMD-G--KILMVTSSTAGEGKTTVAVN
A0A1W1Z4C3      DK--TDM------DMVESYAKLRMNLLYTMS--EKM-R--RTVLVTSAISGEGKSTIAAN
A0A239QN83      EK--SDM------DLVEGYAKLRMNLLYTLS--EKM-H--RTVLVTSAISGEGKSTIAAN
A0A8A5CVI3      EK--TDM------DLVEGYAKLRMNLLYTLS--EKM-H--RTVLVTSAISGEGKSTIAAN
A0A8A5D3H1      EK--SDM------DLVEGYAKLRMNLLYTLS--EKM-H--RTVLVTSAISGEGKSTIAAN
A0A1Q6REE0      -------------GFSESVRLLRLRVEKAMQ--ENG-Q--KILLVSSAIPGEGKTTVSVN
R5ETF9          -------------GFSESVRLLRLRVEKAMQ--ENG-Q--KILLVSSAIPGEGKTTVSVN
A0A0F2P7X6      DQ--VGF------GFVESYKAAGTNLRFASA--VTS-A--KKLLVTSILTGEGKSTVAVN
A0A359B487      DQ--VGF------GFVESYKAAGTNLRFASA--VTN-A--KKLLVTSILTGEGKSTVAVN
R6VAT5          AH--TDP------RFKESVFSIRNKIIKLCA--DQK-I--NSVMVASTTTNEGKTTVAAN
D4LC36          IP--FST------VEAYKSFRTALSFVISTC--DS-----RIVAMTSANPSEGKSVTVAN
A0A7X3IXX7      PP--------------------------------------RCVVVTSPNPGEGKSTVTTA
A0A1Q6S448      PA--ISF------AFTESIHRIAEKFQHEHA--KGR----RVFLFSSVSAAEGKSTLAAN
A0A351MYR0      PA--ISF------AFTESIHRIAEKFQHEHA--RGR----RVFLFSSVSAAEGKSTLAAN
R6HPC1          PA--ISF------AFTESIHRIAEKFQHEHA--KGR----RVFLFSSVSAAEGKSTLAAN
A0A3D4G5Z5      PA--ISF------AFTESIHRIAEKFQHEHA--KGR----RVFLFSSVSAAEGKSTLAAN
A0A3D5ES03      PA--ISF------AFTESIHRIAEKFQHEHA--KGR----RVFLFSSVSAAEGKSTLAAN
A0A348P5V4      KK--SGF------GFIESYKLIRTKIEHAAS--RQD-Y--KAIIVTSTMENEGKTTSATN
A0A356PT74      RR--SGF------PFIETFKIIRTKIEHTAQ--REK-Y--KTFVVTSTAENEGKTTSAVN
A0A3D5LL19      RR--SGF------PFIETFKIIRTKIEHTAQ--REK-Y--KTFVVTSTAENEGKTTSAVN
R5MNF0          SR--SGF------PFIETFKIIRTKIEHTAQ--REK-Y--KTFVVTSTAENEGKTTSAVN
A0A1Q9JSI0      PG--TSF------RYVENMKKLARRVSSQMQ--DHN-A--KTLMVTSAVENEGKSTVAAN
A0A3D5TNI1      KA--CGF------AFIETYKAMRTKLELLNG--RRG-Y--KSFVISSAGANEGKTTVAVN
A0A358LJD0      KA--CGF------AFVETYKAMRTKLELLNG--RRG-Y--KSFVVSSAGANEGKTTVAVN
R6I3L7          KA--CGF------AFVETYKAMRTKLELLNG--RRG-Y--KSFVVSSTGANEGKTTVAVN
A0A3D1HXX0      KA--CGF------AFVETYKAMRTKLELLNG--RRG-Y--KSFVVSSAGANEGKTTVAVN
A0A3D2QJB8      KA--CGF------AFVETYKAMRTKLELLNG--RRG-Y--KSFVVSSAGANEGKTTVAVN
R7MQJ4          KG--IPF------TIKESYKSMRTNVMFSLS--VSE-K--KVIVVSSANPGEGKSTTAAN
A0A1V5GLC0      GN--IPF------YITESYKSLRTNITFALA--TSD-K--KIFAISSANPSEGKSTVSAN
W7V182          KN--VPF------AVVESYKSIRTNITFALS--TSE-K--KIFTVSSANPSEGKSTTSAN
A0A143XPI5      QK--LSP------SFMEGIRTLRIRVDAALQ--EVS-A--KTILVNSAIQGEGKTTIAVN
A0A0M6WXE3      PL--ASF------RFVESFKMLAARVEYHMS--KIN-G--KVLVVTSVCENEGKSSVAGN
A0A348SAK2      PL--ASF------RFVESFKMLAARVEYHMS--KIN-G--KVLVVTSVCENEGKSSVAGN
A0A1G9H5B9      NR--SPL------EVSENYAKLRMNLFYTLV--DKE-Q--KIVVITSSVSGEGKSTISAN
A0A1Y4H8L0      PL--AGF------GFVESYRKFVSKLEYQME--KHH-S--KVLVVSSVSENEGKSTVAAN
A0A4B9BMD9      PA--DSA--------VEAVRALRTSLHFAMM--ETE-N--NILMITGATPDSGKTFVSST
A0A0M6WYQ8      KR--IPQ------GYLEAFRKVGIKVMKQME--EEE-F--KTLLVTSSVPEEGKTAFSVN
A0A348SAK1      KR--IPQ------GYLEAFRKVGIKVMKQME--EEE-F--KTLLVTSSVPEEGKTAFSVN
A0A252F281      TV--ISF------AFEESIRQIRTRLEYAAK--QDG-A--KVFLISSFGENEGKSTISAN
A0A1Y4QKE6      RR--IPF------AFKENMRSLQMRLERVFK--KEE-H--KVIVVTSTAANEGKTTLTIN
B1C231          RR--ISF------AFKENMRSLQIRLERVFK--KEE-H--KVIVVTSTAANEGKTTLTIN
A0A7V6WIR4      SN--PKS------LTAEAYRMLQANLNFSIL--GGS-C--RSILVTSAVQGVGKSTIVSN
A0A1Y3TUL5      DP--IGA------EVRESFVSAAHILHNRLG--VGE-H--QCIYITSAEQDEGKTHVAAN
A0A1Y4JAX2      DP--MGA------EVRESFVSAAHILHNRLG--VGE-H--QCIYITSAEQDEGKTHVAAN
A0A1Y4T590      DP--MGA------EVRESFVSAAHILHNRLG--VGE-H--QCIYITSAEQDEGKTHVAAN
A0A1Y3T163      KR--LSF------GYRESLRALEIRLENMMA--KEG-G--KVLLISSTASGEGKSTLAVN
A0A1Y3YCA2      KR--LSF------GYRESLRALEIRLENMMA--KEG-G--KVLLISSTASGEGKSTLAVN
A0A7W8H9H2      SQ--TPQ------NFKEAVRSLWVRLERELV--KDK-G--KVLLITSTVSGEGKSVIARN
A0A1Y4L6N9      SR--VGA------GFRENIKGLQMRVKREME--RID-G--KVLLVTSTVAEEGKTTVAVN
A0A173T644      KE--FSQ------RFKESLLSIELKAERELQ--DKN-G--KILLVTSTISGEGKSTVALN
A0A1C5TSB8      KE--FSQ------RFKESLLSIELKAERELQ--DKN-G--KILLVTSTISGEGKSTVALN
C0CIK6          KE--FSQ------RFKESLLSIELKAERELQ--DKN-G--KILLVTSTISGEGKSTVALN
A0A1Y3WEF6      SR--TPQ------AFRENIQSLQIRISRELE--EKG-G--KVLVLTSTLPGEGKSTLAYN
A0A417T0L2      SR--TPQ------AFRENIQSLQIRISRELE--EKG-G--KVLVLTSTMPGEGKSTLAYN
A0A1H9EPU3      -N--KDI------RISKNISEAYKKLRSNIQFSGRH-V--RVIGITSTVPNEGKSVLSLN
A0A354IGV3      PV--ASF------PFTETISKMCTRLEYAAT--RHG-R--KVILITSVGENEGKSTIAAN
A0A417JMV2      PG--TSF------QYVEDMKKLARKVSSKMK--EKN-A--KTLLVASVEENEGKSTVAAN
A0A415VWX5      PG--TSF------QYVEDMKKLARKVSSKMK--EKN-A--KTLLVASVEENEGKSTVAAN
A0A173UY96      PG--TSF------QYVEDMKKLARKVSSKMK--EKN-A--KTLLVASVEENEGKSTVAAN
B0P408          PG--TSF------QYVEDMKKLARKVSSKMK--EKN-A--KTLLVASVEENEGKSTVAAN
D4MV82          PG--TSF------QYVEDMKKLARKVSSKMK--EKN-A--KTLLVASVEENEGKSTVAAN
A0A173QTL1      PG--TSF------QYVEDMKKLARKVSSKMK--EKN-A--KTLLVASVEENEGKSTVAAN
A0A174J359      PG--TSF------QYVEDMKKLARKVSSKMK--EKN-A--KTLLVASVEENEGKSTVAAN
A0A174A3T7      PG--TSF------QYVEDMKKLARKVSSKMK--EKN-A--KTLLVASVEENEGKSTVAAN
A0A417UUA3      PG--TSF------QYVEDMKKLARKVSSKMK--EKN-A--KTLLVASVEENEGKSTVAAN
A0A6N2VB70      PG--TSF------QYVEDMKKLARKVSSKMK--EKN-A--KTLLVASVEENEGKSTVAAN
A0A1C6EUV9      PG--TSF------QYVEDMKKLARKVSSKMK--DKQ-A--KTLLVASVEENEGKSTVAAN
A0A173Y645      PG--TSF------QYVEDMKKLARKVSSKMK--DKQ-A--KTLLVASVEENEGKSTVAAN
A0A374AVY6      PG--TSF------QYVEDMKKLARKVSSKMK--DKQ-A--KTLLVASVEENEGKSTVAAN
R7BXS4          PG--TSF------QYVEDMKKLARKVSSKMK--DKQ-A--KTLLVASVEENEGKSTVAAN
                                                            . .     **:     

S3FFL2          LATMLS-RAQRRVILIDGDMRSP---SVHHLGG---VDHNRGLSNFLAGE-----N----
A0A328M4V1      LAAVIA-QAGQRVLLIDADMRKG---TLHKIVG---GNPERGLSELISGQ-----A----
A0A6A8IF17      IAVSLA-IKGKKVLVIDGDLRHA---SASSYI----DSPDKGLSDYLGGR-----I----
A0A143WVN6      IALALA-DRHKKVLLVDGDLRKP---ALHRIFDLHDQVKY-SLSEYLLGQ-----C----
W6RXP9          LALALA-EGEAKVILIDCDMRKP---TVHKKFH--ISNDK-GLSDVLIGK-----V----
W6S4G8          LALSLA-GWGNRVVLIDCDIRRA---ALHKAFN--ISNSK-GLTDVLVNQ-----A----
A0A3D5R4X5      LATAIA-QTGNKVLLVDTDFRKP---SIHKIAR--KPNAD-GLADVLINK-----S----
A0A1I4C3N6      IASSLA-NTGKKILFIDADLRES---RTAEVLG--MSGT--GLSEYLGSD-----E----
A0A3B9CIM7      LASAYA-QLGKKILLIDADMRKS---NLKSLLD--IEGKE-GLSEYLAGI-----T----
A0A7R7IBN8      IAISYT-QIDKKVLLIDADMRKR---SMSTMLD--IDESD-GLSEYLAGI-----V----
A0A1G9WHW8      LAISYS-FLGKKVLLIDGDLRKS---GISRVLK--TTSRQ-GLSQYLAGI-----N----
A0A1H5VAA0      LAISYS-FLGKKVLLIDGDLRKS---GISRVLK--TTSRQ-GLSQYLAGI-----N----
A0A3R6VK11      IAISYA-QLGKKVLLIDGDMRNM---SVASLLK--LRGRL-GLSQYLAGL-----R----
A0A3R6QUY7      IAISYA-QLGKKVLLIDGDMRNM---SVASLLK--LRGRL-GLSQYLAGL-----R----
A0A373K3P9      IAISYA-QLGKKVLLIDGDMRNM---SVASLLK--LRGRL-GLSQYLAGL-----R----
A0A3R6JRU5      IAISYA-QLGKKVLLIDGDMRNM---SVASLLK--LRGRL-GLSQYLAGL-----R----
A0A1C5MS04      IAISYA-QLGKKVLLIDGDMRNM---AVASLLK--LRGRL-GLSQYLAGL-----R----
A0A3C1J150      IAISYA-QLGKKVLLIDGDMRNM---SVASLLK--LRGRL-GLSQYLAGL-----R----
A0A416CXD7      IAISYA-QLGKKVLLIDGDMRNM---SVASLLK--LRGRL-GLSQYLAGL-----R----
A0A6N2X662      IAISYA-QLGKKVLLIDGDMRNM---SVASLLK--LRGRL-GLSQYLAGL-----R----
R6XBL9          IAISYA-QLGKKVLLIDGDMRNM---SVASLLK--LRGRL-GLSQYLAGL-----R----
A0A355W5Z7      IAISYA-QLGKKVLLIDGDMRNM---SVASLLK--LRGRL-GLSQYLAGL-----R----
A0A1G6BLB6      LALELV-EEEQKVLLIDGDFRKP---ALYKVLQIDPKEVT-DLGEVLNHK-----I----
A0A1C6G8M0      LAYSLS-QVGKRVLLVDTDMRKS---VLQRRMG--LEGVKLGLSEYLSGN-----A----
A0A416MP73      LAYSLS-QVGKRVLLVDTDMRKS---VLQRRMG--LDGVKLGLSEYLSGN-----A----
A0A3E4LL92      MVLDLA-RRGKKVVLVDCDMRHP---SLAKIFDAAVDPKE-QLSEYLLGK-----C----
A0A415D1L1      IALNLA-RRGKKVVLVDCDMRHP---SLAKIFDATVDPKE-QFSEYLLGK-----C----
A0A396G6S7      LALSLA-QGGSRVMLIDCDFRKP---AQYKIFNVRDNEEK-DLGDVLINH-----A----
A0A3E5A223      LALSLA-QEGSRVMLIDCDFRKP---AQYKIFNVRDNEET-DLGDVLINH-----A----
R7D5E6          LALSLA-QGGSRVMLIDCDFRKP---AQYKIFNVRDNEEK-DLGDVLINH-----A----
A0A415HQH5      LALSLA-QGGSRVMLIDCDFRKP---AQYKIFNVRDNEEK-DLGDVLINH-----A----
A0A414W2C6      LALSLA-QEGSRVMLIDCDFRKP---AQYKIFNVRDNEET-DLGDVLINH-----A----
A5ZNE7          LALSLA-QEGSRVMLIDCDFRKP---AQYKIFNVRDNEET-DLGDVLINH-----A----
A0A395X821      LALSLA-QGGSRVMLIDCDFRKP---AQYKIFNVRDNEEK-DLGDVLINH-----A----
A0A1C5PY68      LALSLA-QGGSRVMLIDCDFRKP---AQYKIFNVRDNEET-DLGDVLINH-----A----
A0A174CJF8      LALSLA-QGGSRVMLIDCDFRKP---AQYKIFNVRDNEET-DLGDVLINH-----A----
A0A564SRR2      LALSLA-QEGSRVMLIDCDFRKP---AQYKIFNVRDNEET-DLGDVLINH-----A----
A0A174R7V0      LALSLA-QGGSRVMLIDCDFRKP---AQYKIFNVRDNEEK-DLGDVLINH-----A----
A0A373MWV2      LALALS-EEQNRVLLLDCDFRQP---ALYKIFELPQKAGK-DFGQVAAGK-----E----
A0A417CE88      LALALS-EEQNRVLLLDCDFRQP---ALYKIFELPQKAGK-DFGQVAVGK-----E----
A0A416Y441      LALAIS-EEQNRVLLLDCDFRQP---ALYKIFELPQKAGK-DFGQVAVGK-----E----
A0A357GPJ7      LALALS-EEQNRVLLLDCDFRQP---ALYKIFELPQKAGK-DFGQVAVGK-----E----
A0A396PAC1      LALALS-EEQNRVLLLDCDFRQP---ALYKIFELPQKAGK-DFGQVAVGK-----E----
A0A416EYU4      LALALS-EEQNRVLLLDCDFRQP---ALYKIFELPQKAGK-DFGQVAVGK-----E----
A0A416SCQ2      LALALS-EEQNRVLLLDCDFRQP---ALYKIFELPQKAGK-DFGQVAVGK-----E----
A0A416TGN7      LALALS-EEQNRVLLLDCDFRQP---ALYKIFELPQKAGK-DFGQVAVGK-----E----
A0A417SMF6      LALALS-EEQNRVLLLDCDFRQP---ALYKIFELPQKAGK-DFGQVAVGK-----E----
A0A0H5SF45      IAIALA-KTGARVLLIDCDLRKG---RLHVPFN--LNSTP-GVTNLLSGM-----N----
A0A1M6JRJ5      LSIAIS-QAGYKVLLIDCDLRKG---RLHHYFK--AKSQP-GLSDLLSHI-----N----
A0A1M7Y1S2      LSIAIA-HAGYKVLLIDCDLRKG---RIHHHFK--GKSQP-GLSDFLSNI-----N----
A0A7I8DMN1      LAIAIS-QSGYKVLLIDGDLRKG---RIHHYFK--GKNQP-GLSDLLSHM-----N----
A0A1Y4MW77      VAYALA-KNNKKVLLIDADLRKQ---DLSKQMN--LTTNGVGLSSIKYGS-----D----
A0A6S6R676      IAITIA-QTNSRVLVLDCDLRKG---RLHNFFG--IKSSP-GISDCLSGM-----I----
A0A0K8J554      IGIALA-NAGAKVLLIDCDLRKG---RLHKPLN--VKSTP-GLSNVLSVM-----K----
A0A1I0RG99      VGISIA-QTGAKVLLMDCDLRKG---RLHRLFN--IQLIP-GVSDALSST-----M----
A0A1I5G322      LGIVIG-QTGSKVLLVDCDLRKG---RLHNFFN--IKSSP-GVTNVLSNM-----I----
A0A7C6IYW8      LGITLS-QAGSSVLIIDCDLRKG---KLHSYFN--IKYRP-GLSDALSGM-----V----
A0A7C6JZF1      LAIKLA-QSGERVLLLDCDLRKG---KISSYFK--LRSKP-GMSDLLSGL-----L----
A0A3N1XSX6      LGITIS-QTGSKVLLIDCDLRKG---KIHNYFN--LKYKP-GLSDVLSGM-----A----
A0A839K1C1      LGITLS-QAGFRVLIIDCDLRKG---KIHNYFN--LKYKP-GLSDALSGM-----A----
R6UHV6          LALSLA-KMDYKVLLIDGDLRKP---AVAKFLEAKITNGK-SIIDFLRGK-----A----
A0A3R9Q621      LGITMA-QTGARVLLVDCDLRKG---KLHRFFN--FKSMP-GLSDILSGL-----A----
A0A069RC75      MATALC-GIGKKVMLFDCDFRKP---RLAKVFG--LSNTV-GITDALMSK-----R----
A0A174F2W5      LALALS-EEQNRVLLLDCDFRQP---ALYKIFELPQKAGK-DFGQVAAGK-----E----
A0A174S8E9      LALALS-EEQNRVLLLDCDFRQP---ALYKIFELPQKAGK-DFGQVAVGK-----E----
A0A416ZL97      LALALA-EEQNRVLLLDCDFRQP---ALHKIFEIPEKDGK-DFGKVVLGK-----E----
A0A174LSK1      LALALA-EEQNRVLLLDCDFRQP---ALHKIFEIPEKDGK-DFGKVVLGK-----E----
A0A373GY92      LALALA-EEQNRVLLLDCDFRQP---ALHKIFEIPEKDGK-DFGKVVLGK-----E----
A0A373NZQ6      LALALA-EEQNRVLLLDCDFRQP---ALHKIFEIPEKDGK-DFGKVVLGK-----E----
A0A417I9B9      LALALA-EEQNRVLLLDCDFRQP---ALHKIFEIPEKDGK-DFGKVVLGK-----E----
A0A417WQF8      LALALA-EEQNRVLLLDCDFRQP---ALHKIFEIPEKDGK-DFGKVVLGK-----E----
A0A8B3CFR3      LALALA-EEQNRVLLLDCDFRQP---ALHKIFEIPEKDGK-DFGKVVLGK-----E----
A0A373RZ83      LALALA-EEQNRVLLLDCDFRQP---ALHKIFEIPEKDGK-DFGKVVLGK-----E----
A0A416U6I1      LALALA-EEQNRVLLLDCDFRQP---ALHKIFEIPEKDGK-DFGKVVLGK-----E----
R7JQZ9          LALALA-EEQNRVLLLDCDFRQP---ALHKIFEIPEKDGK-DFGKVVLGK-----E----
A0A1M5UYN6      LALTMA-NLEKKTIIIDCDMRRP---NVHRKFR--ISNEI-GLSDILSEQ-----A----
A0A176JBT8      LAVTLA-KDNKKVVFVDSDMRKP---NGHSLFN--LHNRC-GLTNYLTGF-----S----
A0A1I5HIC6      LATALS-ESGKKVLFIDADLRKS---VIVNRLK--ISNGANGLSQYLSGM-----S----
A0A1Y3TC51      LALALA-EKHKKVLLVDGDLRRP---AQHKVFEEKGKERF-SFSQVLKGE-----A----
A0A1Y3T1N0      IALALA-EKHQKVLLVDGDLRQP---AQYKVFEEKSAGRT-SVEQVFTGK-----A----
A0A1Y3Y8U8      IALALA-EKHQKVLLVDGDLRQP---AQYKVFEEKSAGRT-SVEQVFRGK-----A----
A0A5B0BQY5      LAVKLA-MDGQKTLFIDADFRKS---DGRLLFN--LPERK-GLTSVISGF-----Y----
A6CLL4          LAISMA-MDGVKTVVIDMDLRKG---VGSQLFH--LPSKK-GISNYLHGI-----T----
A0A176U8D6      LAYSLS-QVGKRVLLVDTDMRKS---VLQRRMG--LDGVKLGLSEYLSGN-----A----
A0A1Q6KSQ5      LAYSLS-QVGKRVLLVDTDMRKS---VLQRRMG--LEGVKLGLSEYLSGN-----A----
A0A3D3U8B3      LAYSLS-QVGKRVLLVDTDMRKS---VLQRRMG--LEGVKLGLSEYLSGN-----A----
A0A3E5FRL7      ICLSFV-EKNKKVLLIDGDFRKP---AQYKIFDKEVLDTN-PLQDVITGK-----T----
A0A1Y4QK93      ICLLFV-EKNKKVLLIDGDFRKP---AQYKIFDKEVLDTN-PLQDVITEK-----K----
B1C232          ICLSFV-EKNKKVLLIDGDFRKP---AQYKIFDKEVLDTN-PLQDVITGK-----A----
A0A401USI6      IASTIA-QTGKSILLIDCDLRKP---CIHRHFN--ITNNAKGLVDIVLQE-----R----
A0A1V4IQ10      LALSFA-ENDNKVIIVDCDLRKP---SLHQKFN--IPNTS-GLSDVILKK-----E----
A0A1S8TRD2      LALSFA-ENDKKVIIVDCDLRKP---SLHEKFN--ISNTS-GLSDVILKR-----D----
G7M1U2          LALSFA-ENDKKVIIVDCDLRKP---SLHEKFN--ISNTS-GLSDVILKR-----D----
A0A2T6KJ75      LSIVFA-MDQKKTVFIDADLRRG---TGRNLFH--LPKRI-GITSYLAGQ-----C----
A9KN92          LATAFA-DSGKKVLFIDADLRKS---VIISKLK--IDNAVNGLSQYISGM-----N----
A0A352MUJ1      LAITFA-RGGYRTILVDADMRKG---VQHKKFR--LKQVP-GLSDFLNSR-----IEDYE
R5YI67          LAITFA-RGGYRTILVDADMRKG---IQHKKFR--LNQVP-GLSDFLSSS-----SENLE
A0A174DL89      LGISMA-LTNKKVIIIDCDMRKP---KIHRIFS--LSNII-GLSHILSNQ-----A----
A0A1Y0IQP5      LAVTMA-QAGKKVLLIDGDLRKP---TLHHVFH--LGGQK-GLTEVLCEE-----T----
A0A4R2R7B1      LAVTMA-QAGKRVLLIDGDLRKP---TLHHVFH--LGGQI-GLTEVLCEG-----V----
A0A1M6E8I2      LAVAMA-QNDKKVIVVDCDMRKP---RIHKILN--ISNTS-GIAEYLMDG-----R----
A0A7C6SMH0      LAVTLA-KSGKKVLIVDADLRKP---KVHHYFG--VKNNI-GLTNILTDT-----K----
A0A7X7XYM7      LAVTLA-KSGKKVLIVDADLRKP---KVHHYFG--VKNSI-GLTNILTDT-----K----
A0A3B8KKL6      LAVILA-KSGKRVLIVDADLRKP---KVHHYFG--VKNNI-GLTSILTDT-----K----
A0A2K9E6R0      LAVILA-KSGKRVLIVDADLRKP---KVHHYFG--VKNNI-GLTSILTDT-----K----
A0A2S8RBI0      LAVTLA-KSGKRVLIVDADLRKP---KVHHYFG--VKNNI-GLTSILTDT-----K----
A0A7X8MFK9      LAVTLA-RLGKKVLIIDADMRKP---KVHLYFG--IKNKG-GLTNLLTEQ-----N----
A0A7X9D1M8      LAVILA-HSGKKVLIIDADMRKP---KVHHYLG--VKNNY-GLTNLLAEQ-----K----
A0A0L6JLG6      LAITLA-QSGKKVLVIDADLRKP---KVHHYFG--VKNTE-GLTNILATE-----K----
A0A7X8PYA7      VAVAFA-KSGKKVLVIDADLRKP---KVHHYFG--IANEK-GLTNIIKGD-----I----
G8LSN0          MAVTLA-KSGKKVLLIDSDLRKP---KVHLYFG--IPNEK-GLTNIIKGD-----I----
A0A1Y4N105      IALSMV-DRGKKVVIIDCDFRKP---ALYKVFE--LKELKNGLSDYLDGN-----C----
A0A1Y4QP75      IALSMV-DRGKKVVIIDCDFRKP---ALYKVFE--LKELKNCLSDYLDGN-----C----
A0A3D4QRB5      LAVSIA-QSNKKVLLIDCDLRSS---IVHRIFH--LLNEK-GLTNILVGE-----A----
A0A349DEH5      IALSLA-QNGKKVLIIDADLRKP---SVSKLLS--LPDTDCGLSDVILGN-----A----
A0A3D4T7B4      IALSLA-QNGKKVLIIDADLRKP---SVSKLLS--LPDTDCGLSDVILGN-----A----
A0A350XYC7      VALSLA-QNGKNVLIIDADLRKP---SVGKMLS--LKENDRGLSDVILGK-----V----
R6DNR8          IALSLA-QNGKNVLIIDADLRKP---SVSKMLS--LQDTEEGLSDVILGK-----A----
A0A355KUM5      IALSIA-QNGKNVLIIDADLRKP---SVSKMLS--LPATEYGLSDVILGN-----V----
R5YGY6          IALSIA-QNGKNVLIIDADLRKP---SVSKMLS--LPTTEYGLSDVILGN-----V----
A0A7G9WCY6      LAITLI-GMGHKTLIIDADLRKP---KVHKVFN--LDNDS-GMTNVLMGE----------
A0A0A5GPA9      IAYSMA-MDHVNTVFVDLDLRKG---VGNHLFN--NPVRK-GATNYLEGY-----A----
A0A271M6M4      LAICLA-MDHMETIFVDLDLRKG---VGRQLFH--IPLRK-GVTTYLEGM-----A----
A0A1C6G0U3      ISKVFATLDDKKILLIDCDFRRP---KIHKIFK--ISNTQ-GLTNILVKN-----I----
A0A3D4LLB3      LAMVMT-ELKKNILLIDLDLRKP---TVHKQFK--LSNKT-GLTDLLMKK-----D----
A0A7C7AD93      LAIVLA-QSGKKTLLMDCDLRSP---SLHSIFA--TPQVG-LSNYLSGEE-----S----
A0A2V3W8U6      LAMMMA-IDNKKTVVIDADLRKE---KMGM-----SNGQI-GLTHYLAGN-----R----
A0A6N3BXA1      TAYKFSELEETKVLLIDCDLRNP---TINKILN--KPNQK-GVMDILLGK-----K----
A0A351SRI8      LAVALA-NSGQRVLLVDCDIRKG---RQHRIFG--SPNKK-GLSNLLLED-----V----
A0A1V5LU59      MAVTIA-KSGKKVLIIDTDLRKP---KVHLYFG--IKNAE-GVTNMLSSD-----K----
A0A7X8R9W1      LAVTLS-RSGSKVLIIDADLRKP---KVHSYFG--IENKE-GLTNALTSE-----K----
A0A1E3BVC3      LAVTLA-RSGKKVLVIDADLRKP---KVHHYFG--VKNKE-GLTNILTDS-----K----
A0A4Q0I6S0      LAVTLA-RSGKKVLVIDADLRKP---KVHHYFG--VKNKE-GLTNILTDS-----K----
A3DF66          LAITLA-RSGKKVLVIDADLRKP---KVHHYFG--VKNKE-GLTNLLTDS-----K----
W4V1T8          LATTLA-RSGKKVLVIDADLRKP---KVHHYFG--VKNKE-GLTNLLTES-----K----
A0A1C6ITD7      LGISIA-LTNKKVVIIDCDMRKP---RIHRLFS--LSNII-GLSHILSNQ-----A----
A0A381IX63      IGAAFGNLENKKVLIIDCDLRNP---SIHRMFG--LSNAI-GLTDVLIGN-----K----
A0A1M6RWV2      LAVTMV-NMGHKVLLIDADFRKP---QIHKIFN--LSNDV-GMTNIL-MG-----E----
A0A841ZT34      VAAIFG-NQNLKVLVIDADLRLP---KQHKIWR--TSNSV-GLADVMLSN-----L----
A0A1G9IUT4      LGSSFA-QLDKKILIIDCDFRNP---SIHKVFD--ISNKQ-GIADVLLNK-----V----
A0A842GR80      TAAFLG-LKGFRVLVIDADLRLP---KQHGIWN--VPNVS-GLTDMLGRA-----V----
A0A7X0TNH3      TAAFLG-LKGFKVLVIDADLRLP---KQHGIWN--VPNVS-GLTDMLGRA-----V----
A0A842D596      TAAFLG-LKGFKVLVIDADLRLP---KQHGIWN--VPNVS-GLTDMLGRA-----V----
A0A842EQ86      TAAFLG-LKGFKVLVIDADLRLP---KQHGIWN--VPNVS-GLTDMLGRA-----V----
A0A842A220      TAAFLG-LKGFKVLVIDADLRLP---KQHGIWN--VPNVS-GLTDMLGRA-----V----
A0A7X0YM80      TAAFLG-LKGFKVLVIDADLRLP---KQHGIWN--VPNVS-GLTDMLGRA-----V----
A0A842GEL5      TAAFLG-LKGFKVLVIDADLRLP---KQHGIWN--VPNVS-GLTDMLGRA-----V----
A0A841XVD7      TAAFLG-LKGFKVLVIDADLRLP---KQHGIWN--VPNVS-GLTDMLGRA-----V----
A0A7X0XME5      TAAFLG-LKGFKVLVIDADLRLP---KQHGIWN--VPNVS-GLTDMLGRA-----V----
A0A842B6T1      TAAFLG-LKGFKVLVIDADLRLP---KQHGIWN--VPNVW-GLTDMLGRA-----V----
A0A841X7G0      TAAFLG-LKGFKVLVIDADLRLP---KQHGIWN--VPNVS-GLTDMLGRA-----V----
A0A841W3M8      TAAFLG-LKGFKVLVIDADLRLP---KQHGIWN--VPNVS-GLTDMLGRA-----V----
A0A7X0XVI0      TAAFLG-LKGFKVLVIDADLRLP---KQHGIWN--VPNVS-GLTDMLGRA-----V----
A0A7X0Z1K1      TAAFLG-LKGFKVLVIDADLRLP---KQHGIWN--VPNVS-GLTDMLGRA-----V----
A0A143ZUX1      LAIALA-QKGKKVLLIDVDLRRP---TQHNLFQQTTYRN-KGLSDILTGS-----V----
A0A7I8D809      LAIALA-QKGKKVLLIDVDLRRP---TQHNLFQQTTYRN-KGLSDILTGS-----V----
A0A3R9WAA7      LATAMA-ELDRKVILVDCDFRRP---SIMKMLPYSAGT--VCLNDVLKEK-----E----
A0A1G6BLF1      IALSLA-LKGEKVVIVDMDLRNP---SLADSFALESVK--CGTIDVLKGR-----K----
A0A355G1X5      LALSLS-QNGKSVLLIDADMRKP---TLYRFLNLNIPRG-NDLASVICGK-----T----
A0A1W2CEA6      IAIGMT-RRGARVLLIDADLRLS---VMKEKYDIHFGGQPTGLAHLLSGQ-----C----
A0A355G3J9      LAITLA-KSGNKVLLIDGDLRKP---KVSLYLDLY--GK-YGLSEYLANL-----T----
A0A3D2AD87      LAVAFS-QLGKTVLLVDADLRRA---SLHKKFKLE--NG-KGLADVLTGT-----A----
A0A143XN92      LALEFA-KMGKNVLLIDLDLRKP---AQHDIFGRKGEQF-VGIAEWLENK-----I----
R7FFK6          LATAIS-ETDKTVLLIDADMRKP---VQHKNFQVS--NK-LGLSNVITDA-----S----
A0A373MPB9      LAASMA-ETENKVLLIDADMRKP---VQHRNFKLK--NN-VGLSTILSGE-----S----
A0A373L519      LAASMA-ETENRVLLIDADMRKP---VQHRNFKLK--NN-VGLSTILSGE-----S----
A0A373W906      LAASMA-ETENKVLLIDADMRRP---VQHRNFKLK--NN-VGLSTILSGE-----S----
A0A373VCW2      LAASMA-ETENKVLLIDADMRRP---VQHRNFKLK--NN-VGLSTILSGE-----S----
W0U604          LAASMA-ETENKVLLIDADMRRP---VQHRNFKLK--NN-VGLSTILSGE-----S----
A0A374B6G0      LAASMA-ETENKVLLIDADMRKP---VQHRNFKLK--NN-VGLSTILSGE-----S----
A0A373VM36      LAASMA-ETENKVLLIDADMRRP---VQHRNFKLK--NN-VGLSTILSGE-----S----
A0A1C5P379      LAASMA-ETENKVLLIDADMRRP---VQHRNFKLK--NN-VGLSTILSGE-----S----
A0A373XXX0      LAASMA-ETENKVLLIDADMRRP---VQHRNFKLK--NN-VGLSTILSGE-----S----
A0A5R9MJM9      LAASMA-ETENKVLLIDADMRRP---VQHRNFKLK--NN-VGLSTILSGE-----S----
A0A356CW82      LAASMA-ETENKVLLIDADMRRP---VQHRNFKLK--NN-VGLSTILSGE-----S----
R6T4X7          LAASMA-ETENKVLLIDADMRRP---VQHRNFKLK--NN-VGLSTILSGE-----S----
A0A374HTV1      LAASMA-ETENKVLLIDADMRRP---VQHRNFKLK--NN-VGLSTILSGE-----S----
A0A374GB66      LAASMA-ETENKVLLIDADMRRP---VQHRNFKLK--NN-VGLSTILSGE-----S----
A0A374ECC6      LAASMA-ETENKVLLIDADMRRP---VQHRNFKLK--NN-VGLSTILSGE-----S----
A0A374BM61      LAASMA-ETENKVLLIDADMRRP---VQHRNFKLK--NN-VGLSTILSGE-----S----
A0A373UGZ4      LAASMA-ETENKVLLIDADMRRP---VQHRNFKLK--NN-VGLSTILSGE-----S----
A0A373SA66      LAASMA-ETENKVLLIDADMRRP---VQHRNFKLK--NN-VGLSTILSGE-----S----
A0A1C5X6X7      LAASMA-ETENKVLLIDADMRRP---VQHRNFKLK--NN-VGLSTILSGE-----S----
A0A1C6JIH3      LAASMA-ETENKVLLIDADMRRP---VQHRNFKLK--NN-VGLSTILSGE-----S----
A0A373PSC3      LAASMA-ETENKVLLIDADMRRP---VQHRNFKLK--NN-VGLSTILSGE-----S----
A0A1K1WYK8      LAIALA-QTGSAVLLIDADMRKP---VQHRTFKIK--ND-EGLSTLIIKK-----S----
A0A1H6IUB1      IAIALA-QGGNKILLIDADMRKA---VQHKVFGLK--NK-KGLSSAISKM-----C----
A0A1M7L1F9      IAIALA-QGGNKILLIDADMRKA---VQHKIFGLK--NK-KGLSSAISKM-----S----
A0A1C6B4L6      IAIALA-QGGNKALLIDADMRKA---VQHKIFEIK--NK-KGLSTAISKM-----N----
A0A1Q6T9P4      IAIALA-QGGNKALLIDADMRKA---VQHKIFEIK--NK-KGLSTAISKM-----N----
A0A315Y4F9      IAIAIA-QSGSHVLLIDADMRKS---VQHKIFELV--NK-KGLSTAVSKM-----H----
A0A354K620      IAVAIA-QSGSHVLLIDADMRRS---VQHKIFELV--NK-KGLSTAVSKM-----H----
A0A173ZYY6      LAITLA-EQSKRVLLVDGDIRRP---SQFLIFGMEPKEE-NELGEYLRGN-----G----
A0A6L8RXB5      LAITLA-EQSKRVLLVDGDIRRP---SQFLIFGMEPKEE-NELGEYLKGN-----R----
A0A173SMI2      LAITLA-EQSKRVLLVDGDIRRP---SQFLIFGMEPKEE-NELGEYLRGN-----G----
A0A845KKD0      LAITLA-EQSKRVLLVDGDIRRP---SQFLIFGMEPKEE-NELGEYLRGN-----G----
A0A6N9JW85      LAITLA-EQSKRVLLVDGDIRRP---SQFLIFGMEPKEE-NELGEYLKGN-----R----
A0A174ASH7      LAITLA-EQSKRVLLVDGDIRRP---SQFLIFGMEPKEE-NELGEYLRGN-----G----
A6BH65          LAITLA-EQSKRVLLVDGDIRRP---SQFLIFGMEPKEE-NELGEYLRGN-----G----
R7G0D7          LAITLA-EQSKRVLLVDGDIRRP---SQFLIFGMEPKEE-NELGEYLKGN-----R----
R6HZX3          LAASLA-QSGKRVILVDADLRHQ---VVKARFGITT-PS-AGLLE-LSRA-----A----
R5EFZ0          LALAME-QKGKRVLLIDCDLRKP---ACGMVLGQSK-FT-YGLNDILGGK-----E----
A0A3E5FSY5      LAETFA-ANGKRVLLIDADLRRQ---SIAKILKCD--NN-EGLVDLYLQK-----G----
A0A1V5S3C0      TALSLA-KSGKSVLLIDCDIRKP---AVYKVLGVPVGGD-KGIYDIVRGK-----S----
A0A3C0QME1      IAIAFA-QMESKVLLIDADMRKP---VQHKVFELS--NK-KGLSTAIGHM-----N----
A0A355FYK5      IATSLA-QKGKSVLLIDADLRKP---AVLRTIGVKYDDK-SGLIPIIKGE-----S----
A0A357AQU0      IAIAMA-MANEKVLLIDGDLRKP---VQHKIYNIK--ND-SGLSNIVSKQ-----K----
A0A3C1YJQ7      IAIAMA-MANEKVLLIDGDLRKP---VQHKIYNIK--ND-SGLSNIVSKQ-----K----
A0A3D0JG38      IAIAMA-MANEKVLLIDGDLRKP---VQHKIYNIK--ND-SGLSNIVSKQ-----K----
A0A3C0IHX1      IAMAMA-MMNKKVLFIDADLRKP---VQHQRLKLE--NK-VGLSEVLGHM-----T----
R5V506          IAMAMA-MMNKKVLFIDADLRKP---VQHQRLKLE--NK-VGLSEVLGHM-----T----
A0A352TIU5      IAMAMA-MMNKKVLFIDADLRKP---VQHQRLKLE--NK-VGLSEVLGHM-----T----
R5B467          LALALV-RQGRHVLVIDCDLRNP---SVHKTLGRPA--Q-TGLAEYLAGT-----A----
A0A1Y3TC98      LAQMLA-ADGSRVLLIDGDLRKH---GSAGLLGVSG--K-YSLKDVAGMD-----T----
A0A1W1Z4C3      LAVSLA-LSGKKVLLVDGDMRRA---CQSEMFYYDP-NS-PGLSDILTSN-----I----
A0A239QN83      LAVSLA-MSGKKILLVDADMRRA---CQSEIFYYDP-NA-SGLADILTGS-----T----
A0A8A5CVI3      LAVSLA-MSGKKILLVDADMRRA---CQSEIFYYDP-NS-PGLADILTGS-----T----
A0A8A5D3H1      LAVSLA-MSGKKILLVDADMRRA---CQSEIFYYDP-NS-PGLADILTGS-----T----
A0A1Q6REE0      LAVSLA-QKGRRVLLIDCDFRNP---SVAKTLSSKSHPL-DEGRNLTNFT-----G----
R5ETF9          LAVSLA-QKGRRVLLIDCDFRNP---SVAKTLSSKSHPL-DEGRNLTNFT-----G----
A0A0F2P7X6      LAITIA-RTGKSVLLVDCDLRKS---NMHGVLELDLEDH-QGLAAVLNGA-----C----
A0A359B487      LAITIA-HTGKSVLLVDCDLRKS---NMHGVLELDLEDN-QGLAAVLNGA-----C----
R6VAT5          LAIALA-KKHYRTVIIDCDLRNP---TVRQQLNIPESCS-LGIVDVITGT-----C----
D4LC36          LAVAVA-QTDKKVLLIDADMRKP---VQHKCFRLS--NK-VGLSDVITGD-----K----
A0A7X3IXX7      IANSFA-HAGEAAVIVDADLRRP---TVAGVFG--VDGS-VGLTQVLSGQ-----V----
A0A1Q6S448      TAISLA-SRGVSVLFIDLDLRRP---VQSEMLGLSVKQK-NELGTLLTES-----A----
A0A351MYR0      TAISLA-SRGVSVLFIDLDLRRP---VQSEMLGLSVKQK-NELGTLLTES-----A----
R6HPC1          TAISLA-SRGVSVLFIDLDLRRP---VQSEMLGLPVKQK-NELGTLLSES-----A----
A0A3D4G5Z5      TAISLA-SRGVSVLFIDLDLRRP---VQSEMLGLSVKQK-NELGTLLSES-----A----
A0A3D5ES03      TAISLA-SRGVSVLFIDLDLRRP---VQSEMLGLSVKQK-NELGTLLSES-----A----
A0A348P5V4      IALSLA-QNGKSVLLIDADLRKP---SVAKTLGFSASDD-EGICGIVSGK-----K----
A0A356PT74      IALALA-QNGKSVLLVDGDLRKP---AVAKLLGINASED-GGVYGVINGE-----K----
A0A3D5LL19      IALALA-QNGKSVLLVDGDLRKP---AVAKLLGINASED-GGVYGVINGE-----K----
R5MNF0          IALALA-QNGKSVLLVDGDLRKP---AVAKLLGINASED-GGVYGVINGE-----K----
A0A1Q9JSI0      LALAMA-EESAKVLLIDADLRKP---SQYKIFGIDKEEI-KQFGEVLNGN-----E----
A0A3D5TNI1      LSLALA-QNGYSVLLIDADLRKP---SVLKNLGITNISG-NGIADVVGRV-----K----
A0A358LJD0      LSLALA-QNGYSVLLVDADLRKP---SVLKNLGISNLSG-NGIADVVNGA-----K----
R6I3L7          LSLALA-QNGYSVLLVDADLRKP---SVLKNLGISNLSG-NGIADVVNGE-----K----
A0A3D1HXX0      LSLALA-QNGYSVLLVDADLRKP---SVLKNLGISNLSG-NGIADVVNGA-----K----
A0A3D2QJB8      LSLALA-QNGYSVLLVDADLRKP---SVLKNLGISNLSG-NGIADVVNGA-----K----
R7MQJ4          LAITFS-QMEHKVLLIDADMRKP---VQHKIFGLKN--K-KGLSSIIGKM-----N----
A0A1V5GLC0      TAIALA-QGGNKVLLVDADMRKS---VQHKIFDLKN--K-KGLSTAVSKM-----N----
W7V182          IAIALA-QGGNKVLLIDGDLRKS---CQHKIFGIKN--K-KGLSTAISKM-----A----
A0A143XPI5      LALVRA-LRGEKVLLIDADLRNP---SVSQVLHLDTNK--KEIADVLEGK-----L----
A0A0M6WXE3      LAITLA-KKGKRIILIDGDIRCP---AQYLLLGMSPKKE-NELGEFLNGR-----T----
A0A348SAK2      LAITLA-KKGKRIILIDGDIRCP---AQYLLLGMSPKKE-NELGEFLEGR-----I----
A0A1G9H5B9      LAISCA-MSGNKVILVDSDMRRS---SQSEIFKYETDK--EGLSDVLAGR-----C----
A0A1Y4H8L0      IAISLV-QRGKKVLLIDGDLRRP---SQFLILGIETQDK-NELGEYLKSG-----R----
A0A4B9BMD9      LAAVIA-QSDQKVLFIDADLRRG---YSHNL--FTVSNE-HGLSEYLAGK-----D----
A0A0M6WYQ8      LAIIEA-KLGKNVILVDCDMRRP---SVAKAM-NQEGEF-PGLQAVLQGK-----V----
A0A348SAK1      LAIIEA-KLGKNVILVDCDMRRP---SVSKAM-NQEGEF-PGLQAVLQGK-----V----
A0A252F281      SALSLA-EKGYHVLLIDADFRKP---AQYKVLNRDVDEA-NCLGEYLRGT-----C----
A0A1Y4QKE6      LAETFA-TNGKRVLLIDADLRRQ---SIASI--LHCKDN-QGLIDVYLQK-----G----
B1C231          LAETFA-ANGKRVLLIDADLRRQ---SIAKI--LKCDNN-EGLVDLYLQK-----G----
A0A7V6WIR4      LAVVLA-QAGYRVLVVDCDLRKP---SQHNIFGL--ENS-RGLLNVLLRK-----V----
A0A1Y3TUL5      LAVQLS-DLEHKVLLIDLDVRNP---SLGGLFLDKVDYA-HSLNALYRGD-----A----
A0A1Y4JAX2      LAVQLS-DLEHKVLLIDLDVRNP---SLGGLFLDKVDYA-HSLNALYRGD-----A----
A0A1Y4T590      LAVQLS-DLEHKVLLIDLDVRNP---SLGGLFLDKVDYA-HSLNALYRGD-----A----
A0A1Y3T163      LSELLA-SRGKRVLLIDGDLRKQ---DDAGI--IGIRDG-AGLADIVKGE-----K----
A0A1Y3YCA2      LSELLA-SRGKRVLLIDGDLRKQ---DDAGI--IGIRDS-AGLADIVKGE-----K----
A0A7W8H9H2      LALTAA-SNGKKVLLMDGDFRKK---EKAPL--HGDVHD-HGLADVISGK-----T----
A0A1Y4L6N9      LAFSLA-EYGYKVLLLDGDMRKQ---TDWKY--IEGVKG-KGLYEVLRKE-----C----
A0A173T644      MAYAAA-LHEKKVLFIDADLRKQ---TDRRC--LTETEG-KGLYGVVTGK-----C----
A0A1C5TSB8      MAYAAA-LHEKKVLFIDADLRKQ---TDRRC--LTETEG-KGLYGVVTGK-----C----
C0CIK6          MAYAAA-LHEKKVLFIDADLRKQ---TDRRC--LTETEG-KGLYGVVTGK-----C----
A0A1Y3WEF6      LAIAAA-SHGVKVLFVDADLRKK---ADRKH--LTEEKG-RGLASVVTGK-----C----
A0A417T0L2      LAIAAA-SHGVKVLFIDADLRKQ---ADRKH--LTEEKG-RGLASVVAGK-----C----
A0A1H9EPU3      LAISLA-ELGKRVIFIDADLRKSVLVGRYKI----SKQV-KGLTHYLSGV-----N----
A0A354IGV3      LALGLA-QRHSKVLLIDGDLRKP---AVYKLLQLRLQPE-QALSHYLSDDSVRLSD----
A0A417JMV2      LALALA-EESEKVLLIDADLRKP---SQYKIFGLDQEEI-QQFGEVLNGN-----E----
A0A415VWX5      LALALA-EESEKVLLIDADLRKP---SQYKIFGLDQEEI-QQFGEVLNGN-----E----
A0A173UY96      LALALA-EESEKVLLIDADLRKP---SQYKIFGLDQEEI-QQFGEVLNGN-----E----
B0P408          LALALA-EESEKVLLIDADLRKP---SQYKIFGLNQEEI-QQFGEVLNGN-----E----
D4MV82          LALALA-EESEKVLLIDADLRKP---SQYKIFGLNQEEI-QQFGEVLNGN-----E----
A0A173QTL1      LALALA-EESEKVLLIDADLRKP---SQYKIFGLDQEEI-QQFGEVLNGN-----E----
A0A174J359      LALALA-EESEKVLLIDADLRKP---SQYKIFGLDQEEI-QQFGEVLNGN-----E----
A0A174A3T7      LALALA-EESEKVLLIDADLRKP---SQYKIFGLDQEEI-QQFGEVLNGN-----E----
A0A417UUA3      LALALA-EESEKVLLIDADLRKP---SQYKIFGLDQEEI-QQFGEVLNGN-----E----
A0A6N2VB70      LALALA-EESEKVLLIDADLRKP---SQYKIFGLDQEEI-QQFGEVLNGN-----E----
A0A1C6EUV9      LALALA-EESEKVLLIDADLRKP---SQYKIFGLAPEEV-QEFGEVLNGN-----E----
A0A173Y645      LALALA-EESEKVLLIDADLRKP---SQYKIFGLAPEEV-QEFGEVLNGN-----E----
A0A374AVY6      LALALA-EESEKVLLIDADLRKP---SQYKIFGLAPEEV-QEFGEVLNGN-----E----
R7BXS4          LALALA-EESEKVLLIDADLRKP---SQYKIFGLAPEEV-QEFGEVLNGN-----E----
                             :..* *.*                                       

S3FFL2          -D-IASLTFSMSE----L----N------FTAMSAGPI-PPNAAELLTGDRFGVLLTRLL
A0A328M4V1      -E-LPEVLRNVDG----IS---K------LFFISRGKI-PPNPSELLMHARFTSLLEGLK
A0A6A8IF17      -DNLDEIIVPDPK----HK---S------MDILPVGTI-PPNPTELLFDERLKQTIDTVR
A0A143WVN6      -SFEQ---VITEV----PN---G------LQIICQTRG-LNNSTKYIMSKNMLDFILKCR
W6RXP9          -DIME---AAHKY----NK---N------LLILTAGKI-PPNPSEMLGSKTMKELLDRLK
W6S4G8          -SLKD---VAVGI----KE---T------LLLIPAGRV-SPNPTELLNSKAMELLLEELK
A0A3D5R4X5      -DYRSS--VKQSR----TK---N------LDLMFSGLI-PPNPSELLGSKSMLEFIEKVK
A0A1I4C3N6      -AELNI--QR--S----GR---G------FDVILAGAK-PSNAADLLAGGKIRELINAQK
A0A3B9CIM7      -KELKV--YK--R----AE---N------LYVAMAGEV-PPNPAELLSGERWSELLEKCK
A0A7R7IBN8      -DTQPI--IQ--Y----LD---N------LFVISAGMM-PPNPADLLSSSRWNELLEYCK
A0A1G9WHW8      -KDYEL--FN--Y----NN---N------LDILFAGEI-PPNPMELLSSEKCKNLLESLK
A0A1H5VAA0      -KDYDL--FN--Y----NN---N------LDILFAGEI-PPNPMELLSSEKCKNLLESLK
A0A3R6VK11      -ETPQI--VE--Y----RQ---N------LDVLVGGEN-PPNPSELLGGERMKELLTTLR
A0A3R6QUY7      -ETPQI--VE--Y----RQ---N------LDVLVGGEN-PPNPSELLGGERMKELLTTLR
A0A373K3P9      -ETPQI--VE--Y----RQ---N------LDVLVGGEN-PPNPSELLGGERMKELLTTLR
A0A3R6JRU5      -ETPQI--VE--Y----RQ---N------LDVLVGGEN-PPNPSELLGGERMKELLTTLR
A0A1C5MS04      -ETPQI--VE--Y----RQ---N------LDVLVGGEN-PPNPSELLGGERMKELLTTLR
A0A3C1J150      -ETPQI--VE--Y----RQ---N------LDVLVGGEN-PPNPSELLGGERMKELLTTLR
A0A416CXD7      -ETPQI--VE--Y----RQ---N------LDVLVGGEN-PPNPSELLGGERMKELLTTLR
A0A6N2X662      -ETPQI--VE--Y----RQ---N------LDVLVGGEN-PPNPSELLGGERMKELLTTLR
R6XBL9          -ETPQI--VE--Y----RQ---N------LDVLVGGEN-PPNPSELLGGERMKELLTTLR
A0A355W5Z7      -ETPQI--VE--Y----RQ---N------LDVLVGGEN-PPNPSELLGGERMKELLTTLR
A0A1G6BLB6      -SPKNM--IYQKE----NS---N------LHLLLNTVI-YPNSTELLSQGLLERIIGELK
A0A1C6G8M0      -EVGQV--IYDVG----IP---N------MHVLFSGKL-VTNASALLSAKWLRTLCDSVK
A0A416MP73      -ELGQV--IYDVG----LP---N------MHVLFSGKL-VPNASALLSAKWLENLCAEVR
A0A3E4LL92      -ELDKVLKRTEVQ----AH---P------IYCLWQKKA-VARPYRLLESERFASLIHQLK
A0A415D1L1      -ELDQVLKQTEVQ----AH---P------MGCIWQKKA-VAKPYRLLGSERFISLIDQLK
A0A396G6S7      -STEKI--IRNWN----NS---G------LYMILNKTS-SNAIETLLKSMTLKQIIAFCR
A0A3E5A223      -STEKI--IRNWN----NS---G------LYMILNKTS-SNAIETLLKSMTLKQIIAFCR
R7D5E6          -STEKI--IRNWN----NS---G------LYMILNKTS-SNAIETLLKSMTLKQIIAFCR
A0A415HQH5      -STEKI--IRNWN----NS---G------LYMILNKTS-SNAIETLLKSMTLKQIIAFCR
A0A414W2C6      -STEKI--IRNWN----NS---G------LYMILNKTS-SNAIETLLKSMTLKQIIAFCR
A5ZNE7          -STEKI--IRNWN----NS---G------LYMILNKTS-SNAIETLLKSMTLKQIIAFCR
A0A395X821      -STEKI--IRNWN----NS---G------LYMILNKTS-LNAIETLLKSMTLKQIIAFCR
A0A1C5PY68      -STEKI--IRNWN----NS---G------LYMILNKTS-SNAIETLLKSMTLKQIIAFCR
A0A174CJF8      -STEKI--IRNWN----NS---G------LYMILNKTS-SNAIETLLKSMTLKQIIAFCR
A0A564SRR2      -STEKI--IRNWN----NS---G------LYMILNKTS-SNAIETLLKSMTLKQIIAFCR
A0A174R7V0      -STEKI--IRNWN----NS---G------LYMILNKTS-SNAIETLLKSMTLKQIIAFCR
A0A373MWV2      -PASSV--FEKYK----DT---N------VYMGICRER-LEEPSEAVGGEIFRRILDMCR
A0A417CE88      -SASSV--FEKYK----DT---N------VYMGICRER-LEEPSEAVGGKIFRRILDTCR
A0A416Y441      -SASSV--FEKYK----DT---N------VYMGICRER-LEEPSEAVGGEIFRRILDTCR
A0A357GPJ7      -SASSV--FEKYK----DT---N------VYMGICRER-LEEPSEAVGGEIFRRILDTCR
A0A396PAC1      -SASSV--FEKYK----DT---N------VYMGICRER-LEEPSEAVGGEIFRRILDTCR
A0A416EYU4      -SASSV--FEKYK----DT---N------VYMGICRER-LEEPSEAVGGEIFRRILDTCR
A0A416SCQ2      -SASSV--FEKYK----DT---N------VYMGICRER-LEEPSEAVGGEIFRRILDTCR
A0A416TGN7      -SASSV--FEKYK----DT---N------VYMGICRER-LEEPSEAVGGEIFRRILDTCR
A0A417SMF6      -SASSV--FEKYK----DT---N------VYMGICRER-LEEPSEAVGGEIFRRILDTCR
A0A0H5SF45      -TEKET--IQYTS----YN---N------LQIIPCGSI-APNPTELLSSIQMEELIKKLE
A0A1M6JRJ5      -SLKEC--LYITP----YE---N------LHMMPMGST-PPNPSELLGSKQMELLIKELE
A0A1M7Y1S2      -SLKEC--LYITP----YD---N------LHIMPMGSI-PPNPSELLGSRQMELLIKELE
A0A7I8DMN1      -TIKEC--LYITP----YD---N------LHIMPMGSM-PPNPSELLGSRQMELLINDLE
A0A1Y4MW77      -VVEDA--IVYLE----KQ---N------LYFLGGNST-IDDLTAVLTNPNMEQFMNDMR
A0A6S6R676      -DVEET--IYSTS----HD---N------LYVMPMGSI-PPNPTELMASKQMEDLIQKLE
A0A0K8J554      -TDEEV--VQDTD----YE---N------LQLIACGTI-APNPTELLSSIQMEELLLRLE
A0A1I0RG99      -DVKKS--IYKTS----YD---N------LYVMPMGTI-PPNPSELLASIQMEELLSQLN
A0A1I5G322      -DIENA--IQKTT----YD---N------LYVLPLGTI-PPNPSELMASSQMEELLKKLE
A0A7C6IYW8      -EFKDA--IRKTS----HE---N------LDIIPLGSI-SPNPSELLSSSQMEKLLVNLE
A0A7C6JZF1      -SEKEV--IQYTP----YE---K------LQVITMGSI-PPNPAVLLGSPQLEELFQRLE
A0A3N1XSX6      -ELTNV--IRKTS----YE---N------LNIITIGSI-SPNPSELLSSSHMEELINVLE
A0A839K1C1      -ELKDV--IIKTS----YD---N------LDIIPLGSI-SPNPSELLASSQMEKLLLNLE
R6UHV6          -RLSEI--ASYDE----IN---N------ITIMGSNKG-TQQANELITGEKMDYLISAAR
A0A3R9Q621      -SETEV--IHSTA----YK---N------LHVLPMGSK-PPNPAEMLASVHMEELIAKLA
A0A069RC75      -DYREF--VKETH----IE---N------LHIMTAGNS-VQNPAELLQSERIRELIRKIE
A0A174F2W5      -PASSV--FEKYK----DT---N------VYMGICRER-LEEPSEAVGGEIFRRILDMCR
A0A174S8E9      -SASSV--FEKYK----DT---N------VYMGICRER-LEEPSEAVGGEIFRRILDTCR
A0A416ZL97      -SASGV--FEKHK----DT---N------VYTGICRNR-LEEPSLAIGGEIFHRILETCR
A0A174LSK1      -SASGV--FEKHK----DT---N------VYTGICRNR-LEEPSLAIGGEIFHRILETCR
A0A373GY92      -SASGV--FEKHK----DT---N------VYTGICRNR-LEEPSLAIGGEIFHRILETCR
A0A373NZQ6      -SASGV--FEKHK----DT---N------VYTGICRNR-LEEPSLAIGGEIFHRILETCR
A0A417I9B9      -SASGV--FEKHK----DT---N------VYTGICRNR-LEEPSLAIGGEIFHRILETCR
A0A417WQF8      -SASGV--FEKHK----DT---N------VYTGICRNR-LEEPSLAIGGEIFHRILETCR
A0A8B3CFR3      -SASGV--FEKHK----DT---N------VYTGICRNR-LEEPSLAIGGEIFHRILETCR
A0A373RZ83      -SASGV--FEKHK----DT---N------VYTGICRNR-LEEPSLAIGGEIFHRILETCR
A0A416U6I1      -SASGV--FEKHK----DT---N------VYTGICRNR-LEEPSLAIGGEIFHRILETCR
R7JQZ9          -SASGV--FEKHK----DT---N------VYTGICRNR-LEEPSLAIGGEIFHRILETCR
A0A1M5UYN6      -EFEE---VVHSY----DK---H------LCVIPSGPM-PPNPAEMLNSIKMKFFIEKLK
A0A176JBT8      -SSDEI--IQSTA----IP---K------LSFISAGPI-SPNPHELIISKKMDLLIDRLK
A0A1I5HIC6      -TLEEV--IHKTN----VE---N------VDIIFTGIL-PPHPSEMLGNEEFKDLVRSQR
A0A1Y3TC51      -DWKDA--AFYNK----RS---D------IWELFQFRA-VREPARILREEKLEGLAEEWK
A0A1Y3T1N0      -SWKEN--LYYNK----AA---G------IWELFQFSG-AKDPAAVFAEAPMKTLAREWK
A0A1Y3Y8U8      -SWKEN--LYYNK----AA---G------IWELFQFSG-AKDPAAVFAEAPMKTLAREWK
A0A5B0BQY5      -ELDTI--IQETG----IE---N------LSFIGTGPL-PLNPVKFILADGMDKLLDDIK
A6CLL4          -PLNEI--IQRTD----IP---K------LFFISAGPL-PPNPTELLSSDRLSSMINTLK
A0A176U8D6      -ELGQV--IYDVG----LP---N------MHVLFSGKL-VPNASALLSAKWLENLCAEVR
A0A1Q6KSQ5      -EVGQV--IYDVG----IP---N------MHVLFSGKL-VTNASALLSAKWLRTLCDSVK
A0A3D3U8B3      -EVGQV--IYDVG----IP---N------MHVLFSGKL-VTNASALLSAKWLRTLCDSVK
A0A3E5FRL7      -TLKES--IYFNK----KS---N------IYELFLYHA-IDDPSKLMNAVTLKKIMEQLK
A0A1Y4QK93      -SLKDS--IYFNK----KS---N------IYELFLYHA-IDDPSKLMNVVTLKKIMDQLK
B1C232          -TLKES--IYFNK----KS---N------IYELFLYHA-VDDPSKLMDVITLKKIIDQLK
A0A401USI6      -KIEE---ISIGI----DD---K------FDVLTAGKA-NYNPSELLSSQKMKDFIKDME
A0A1V4IQ10      -SLDK---VIQKH----NE---N------LYLMSSGKF-TGKPASMLASQEMDNILTELK
A0A1S8TRD2      -SLDN---VIQKH----NK---N------LYVISSGKF-TEKPASMLASQTMDDILTELK
G7M1U2          -SLDN---VIQKH----NK---N------LYVISSGKF-TEKPASMLASQTMDDILTELN
A0A2T6KJ75      -TLHEI--IQSTE----VP---N------LSFISAGPV-PPNPTELLSSTKFVQLLEELK
A9KN92          -SLEEV--IHKSN----VE---N------RDIIFTGIL-PPNPSEMLGSEEFKNLVKNLR
A0A352MUJ1      NELPKY--VQPTE----LD---N------LCVLPCGSI-TYDSSELLLSNRIIKTVETLK
R5YI67          EELQKC--IQPTE----LD---N------LCVLTCGSI-TYDSSELLLSNKIIKAVEILK
A0A174DL89      -ELEEC--LQSSG----IN---N------LSILTAGVI-PPNPSELISSNGMKILLDRLT
A0A1Y0IQP5      -PLED---VIVPS----AA---G------PDVITAGAI-PSNPSELLGSPKLRAALADVR
A0A4R2R7B1      -APEE---VILPS----AA---G------PDVIPAGAI-PANPSELLGSPKLRGLLSDLR
A0A1M6E8I2      -NIDDY--INRMY----NL---D------IDVMTSGKL-PGNPSELLQSNVMKKMVEFLE
A0A7C6SMH0      -DDLKVKAIEKTE----TS---N------LDIITSGPV-PPNPYEMLSSNKMQNFIDKVK
A0A7X7XYM7      -EDIKAKAIEKTE----IS---N------LDIITSGPV-PPNPYEMLSSNKMQSFVEKVK
A0A3B8KKL6      -EDIKAKAIEKTE----IS---N------LDIITSGPV-PPNPYEMLSSNKMQSFVEKVK
A0A2K9E6R0      -EDIKAKAIEKTE----IS---N------LDIITSGPV-PPNPYEMLSSNKMQSFVEKVK
A0A2S8RBI0      -EDIKAKAIEKTE----IS---N------LDIITSGPV-PPNPYEMLSSNKMQSFVEKVK
A0A7X8MFK9      -EDLKVKIVKKED----IS---N------LHVITCGPI-PPNPAEMLSSNKMKNLLDKLK
A0A7X9D1M8      -ES-KAKAIEKED----IS---N------LHIITCGPI-PPNPAEMLSSNKMKKLLDKLK
A0A0L6JLG6      -ELKKSMIQNKEG----IE---N------LFIIPSGPI-PPNPSEILSSDKMRQLVEKLK
A0A7X8PYA7      -DDKEINSMTLRG----IQ---N------LFVIPSGPI-PPNPAEILSSNKMQQLLEKLK
G8LSN0          -EDKDINVLELKD----IP---N------LSVITSGPI-PPNPAEILSSNKMQNLLEDLR
A0A1Y4N105      -KYEDI----ITY----QN---N------LAIISQKDS-KKNSSNYFLTAQFTQFIKKCR
A0A1Y4QP75      -KYEDI----ITY----QN---N------LAIISQKDS-KKNSSNYFLTTQFAQFIKKCR
A0A3D4QRB5      -EPSSI--VNSGG----IS---N------LHIISAGPK-PPNPSELLGSTRMQAFLQQAA
A0A349DEH5      -TLNQA--IKLVN----NF---N------VCILADQKS-VPNPSELLSTDKMEAIIDEVR
A0A3D4T7B4      -TLNQA--IKLVN----NF---N------VCILADQKS-VPNPSELLSTDKMEAIIDEVR
A0A350XYC7      -ELNKA--IKSVN----TF---N------VCVLADQNG-VNNPSELLSTEKMEHIIEEVR
R6DNR8          -DLGKA--IKSVN----SF---N------VCVLADQKG-VNNPSELLSTEKMESIIEEVR
A0A355KUM5      -ELNQA--IKRVT----SF---N------VCVLADQKG-VNNPSELLSTEKMESIIEEAR
R5YGY6          -ELNQA--IKRVT----SF---N------VCVLADQKG-VNNPSELLSTEKMESIIEEAR
A0A7G9WCY6      -SLENA--VKRIG----GI---K------LDILTSGPI-PPNPSELLGSKKMKDFIEECS
A0A0A5GPA9      -SIDEV--VSRTD----IP---H------LSYVAKGPM-PKNPAEVLSSDKINTMLAELK
A0A271M6M4      -TIEEI--IVKTN----VS---N------LSFIGTGPL-SANPAELLSSEKIDIMLETLQ
A0A1C6G0U3      -HISEC----INT----VS---G------LNIITSGTK-PINPSDILASKKMINFIKQIR
A0A3D4LLB3      -DYKAY---LQNI----YP---G------LDVLTTGMI-PANPAEIINSRALKELIKEVS
A0A7C7AD93      -ALEDI--VYESI----TA---N------LFVLPAGTN-AINPVELISSDAMKNLINSLK
A0A2V3W8U6      -SVQDI--LLDTF----TP---N------LQSITCGPI-PPNPAELLSSERMDQLLQELK
A0A6N3BXA1      -DIKNS--IEKVN-----D---K------FDILFTGKI-PQNPTEILASKKMKNLIDYLK
A0A351SRI8      -AQVYRTYINESD----VP---N------LYLMFKGVT-PPNPSELLNSDKNKKLVSSLS
A0A1V5LU59      -GNNKVKPTKIEG----IS---N------LDIIPSGPI-PPNPAELLSSKRMNQLLEELK
A0A7X8R9W1      -ERSKINTLKYDQ----NS---N------LQILTSGPV-PPNAAEMLNSKRMIQLLEELK
A0A1E3BVC3      -EDIKVKPTEKSD----IS---N------LYIITSGPI-PPNPAEMLNSNRMKKLLEKMK
A0A4Q0I6S0      -EDIKVKPTEKSD----IS---N------LYIITSGPI-PPNPAEMLNSNRMKKLLEKMK
A3DF66          -EEVKIKTTERSD----IS---N------LYIITSGPI-PPNPAEMLNSNRMKSLLEKVR
W4V1T8          -EEIKIKTTEKSD----IS---N------LYIITSGPI-PPNPAEMLNSNRMKSLLEKVK
A0A1C6ITD7      -ELEEC--LQSSG----IE---N------LSILTAGVI-PPNPSELISSNGMKMLLDRLS
A0A381IX63      -TFNQC--VQNTE----VK---N------LKVLTTGNI-PNNPAEILNSNRMRSFVEETK
A0A1M6RWV2      -KLEDV--IHTVG----GL---K------LDIITTGPI-PPNPSEILGSNAMKKFIEQCK
A0A841ZT34      -AFKEA--VQSSY----ID---Q------VDLITSGTV-SVDPSNLLSNQSVKALLSWAK
A0A1G9IUT4      -NLKDC--VHEIS----SE---N------LNVLTCGSI-PSNPSELLSSHKMQKLLEELK
A0A842GR80      -SYEKC--VARTS----EE---N------VAFIPSGIL-ARDPSDLLTEHKIQDIFRWAK
A0A7X0TNH3      -SYEKC--VARTS----EE---N------VAFIPSGIL-ARDPSDLLTEQKIQDIFRWAK
A0A842D596      -SYEKC--VARTS----EE---N------VAFIPSGIL-ARDPSDLLTEQKIQDIFRWAK
A0A842EQ86      -SYEKC--VARTS----EE---N------VAFIPSGIL-ARDPSDLLTEHKIQDIFRWAK
A0A842A220      -SYEKC--VARTS----EE---N------VAFIPSGIL-ARDPSDLLTEQKIQDIFRWAK
A0A7X0YM80      -SYEKC--VARTS----EE---N------VAFIPSGIL-ARDPSDLLTEHKIQDIFRWAK
A0A842GEL5      -SYEKC--VARTS----EE---N------VAFIPSGIL-ARDPSDLLTEQKIQDIFRWAK
A0A841XVD7      -SYEKC--VARTS----EE---N------VAFIPSGIL-ARDPSDLLTEQKIQDIFRWAK
A0A7X0XME5      -SYEKC--VARTS----EE---N------VAFIPSGIL-ARDPSDLLTEQKIQDIFRWAK
A0A842B6T1      -SYEKC--VARTS----EE---N------VAFIPSGIL-ARDPSDLLTEQKIQDIFRWAK
A0A841X7G0      -SYEKC--VARTS----EE---N------VAFIPSGIL-ARDPSDLLTEQKIQDIFRWAK
A0A841W3M8      -SYEKC--VARTS----EE---N------VAFIPSGIL-ARDPSDLLTEQKIQDIFRWAK
A0A7X0XVI0      -SYEKC--VARTS----EE---N------VAFIPSGIL-ARDPSDLLTEQKIQDIFRWAK
A0A7X0Z1K1      -SYEKC--VARTS----EE---N------VAFIPSGIL-ARDPSDLLTEQKIQDIFRWAK
A0A143ZUX1      -YPMDA--IHHNE----KY---G------VYILYSGKP-TDQASELLGNDLMNEFFKIVE
A0A7I8D809      -YPMDA--IHHNE----KY---G------VYILYSGKP-TDQASELLGNDLMNEFFKIVE
A0A3R9WAA7      -KLTDA--IRYYD----EY---K------IAVLACSKQ-LEESSEILGKRAIGSILEQLK
A0A1G6BLF1      -EIQDA--LVQYK----DT---S------LEILPGGKA-ISKTSRVLSSEKVGNLIRTLQ
A0A355G1X5      -DLSDA--IKYVE----KY---K------LFILSSIEP-NSEPTEILASQQMNKIIKAAK
A0A1W2CEA6      -ALEDA--IYHTN----IP---G------LDLLPDGAS-IKTPLALLTSAEFDSLMATVG
A0A355G3J9      -DELCP--MNYSE----N-----------LDVITSGKC-TSYAADLLSTTRAKESISAFR
A0A3D2AD87      -TLDEA--IVTIK----PG----------LNILTAGFI-PPNPSELLDSVNFEETMKLLN
A0A143XN92      -DLKEK--IVRIN----NS---N------LFILFNSQP-LQNSLELMDYSSWKDWIKKME
R7FFK6          -LLDEA--LHQNV----TG---T------LDLLTAGTI-PPNPSELLASKQMAELLDKLK
A0A373MPB9      -TFDKC--VHETK----NG---N------FAVLTSGVL-PPNPSELLASEKMRELLEYVQ
A0A373L519      -TFDKC--VHETK----NG---N------FAVLTSGVL-PPNPSELLASEKMRELLEYVQ
A0A373W906      -TFDKC--VHETK----NG---N------FAVLTSGVL-PPNPSELLASEKMRELLEYVQ
A0A373VCW2      -TFDKC--VHETK----NG---N------FAVLTSGVL-PPNPSELLASEKMRELLEYVQ
W0U604          -TFDKC--VHETK----NG---N------FAVLTSGVL-PPNPSELLASEKMRELLEYVQ
A0A374B6G0      -TFDKC--VHETK----NG---N------FAVLTSGVL-PPNPSELLASEKMRELLEYVQ
A0A373VM36      -TFDKC--VHETK----NG---N------FAVLTSGVL-PPNPSELLASEKMRELLEYVQ
A0A1C5P379      -TFDKC--VHETK----NG---N------FAVLTSGVL-PPNPSELLASEKMRELLEYVQ
A0A373XXX0      -TFDKC--VHETK----NG---N------FAVLTSGVL-PPNPSELLASEKMRELLEYVQ
A0A5R9MJM9      -TFDKC--VHETK----NG---N------FAVLTSGVL-PPNPSELLASEKMRELLEYVQ
A0A356CW82      -TFDKC--VHETK----NG---N------FAVLTSGVL-PPNPSELLASEKMRELLEYVQ
R6T4X7          -TFDKC--VHETK----NG---N------FAVLTSGVL-PPNPSELLASEKMRELLEYVQ
A0A374HTV1      -TFDKC--VHETK----NG---N------FAVLTSGVL-PPNPSELLASEKMRELLEYVQ
A0A374GB66      -TFDKC--VHETK----NG---N------FAVLTSGVL-PPNPSELLASEKMRELLEYVQ
A0A374ECC6      -TFDKC--VHETK----NG---N------FAVLTSGVL-PPNPSELLASEKMRELLEYVQ
A0A374BM61      -TFDKC--VHETK----NG---N------FAVLTSGVL-PPNPSELLASEKMRELLEYVQ
A0A373UGZ4      -TFDKC--VHETK----NG---N------FAVLTSGVL-PPNPSELLASEKMRELLEYVQ
A0A373SA66      -TFDKC--VHETK----NG---N------FAVLTSGVL-PPNPSELLASEKMRELLEYVQ
A0A1C5X6X7      -TFDKC--VHETK----NG---N------FAVLTSGVL-PPNPSELLASEKMRELLEYVQ
A0A1C6JIH3      -TFDKC--VHETK----NG---N------FAVLTSGVL-PPNPSELLASEKMRELLEYVQ
A0A373PSC3      -TFDKC--VHETK----NG---N------FAVLTSGVL-PPNPSELLASEKMRELLEYVQ
A0A1K1WYK8      -SMAKS--VKSNV----IN---N------LDLLPSGPL-PPNPSELLASENFKKLLEQFA
A0A1H6IUB1      -SLEEC--IHKNV----ME---N------LDVMTAGPV-PPNPSELLASDNMGAILEKLS
A0A1M7L1F9      -KLEEC--IQKDV----ME---N------LDVMTAGPV-PPNPSELLASDNMGAILEQLS
A0A1C6B4L6      -KLDEC--IQKNV----ME---N------LDVMTSGPL-PPNPSELLASENMLAILDELN
A0A1Q6T9P4      -KLDEC--IQKNV----ME---N------LDVMTSGPL-PPNPSELLASENMLAILDELN
A0A315Y4F9      -TPDEC--IQKNV----ME---N------LDVMTAGPI-PPNPSELLASEMMEQMLNELS
A0A354K620      -SPDKC--IQKNV----ME---N------LDIMTAGPI-PPNPSELLASDTMEQMLHDLS
A0A173ZYY6      -SLADV--MVPCT----RK----------HMLFMGGKNCYSSSTEMLNSESFFKLMAACR
A0A6L8RXB5      -ALADV--MVPCT----RK----------HMLFMGGKNCYSSSTEMLNSDSFYKLMTACR
A0A173SMI2      -SLADV--MVPCT----RK----------HMLFMGGKNCYSSSTEMLNSESFFKLMAASR
A0A845KKD0      -SLADV--MVPCT----RK----------HMLFMGGKNCYSSSTEMLNSESFFKLMTACR
A0A6N9JW85      -ALADV--MVPCT----RK----------HMLFMGGKNCYSSSTEMLNSDSFYKLMTACR
A0A174ASH7      -SLADV--MVPCT----RK----------HMLFMGGKNCYSSSTEMLNSDSFYKLMTACR
A6BH65          -SLADV--MVPCT----RK----------HMLFMGGKNCYSSSTEMLNSDSFYKLMTACR
R7G0D7          -ALADV--MVPCT----RK----------HMLFMGGKNCYSSSTEMLNSDSFYKLMTACR
R6HZX3          -KPDIA--RVLIP----VPGVAN------LSLLAGDTR-MTSPMGILDSPKMRSLLERTR
R5EFZ0          -NLSEC--FLRYQ----NS---D------MYMLLAKRG-EQNTGDLLISPRMNALLDWAR
A0A3E5FSY5      -DVLKN--IRKLD----NS---K------FWFIGNDKP-INNPVSVLSHPDFKKFIEKMK
A0A1V5S3C0      -TFEEA--IKYVE----KY---N------MYLLISGEP-VSDPSEVLASSITQETINEAK
A0A3C0QME1      -PLEES--VHKGV----YK---H------LDVMPSGPI-PPNPSEMLASQQFSDILDELE
A0A355FYK5      -TYQES--IKYVK----SL---G------LFILPSGGI-TQKSSEVLDADKVRHVIEQAR
A0A357AQU0      -KFDAV--VHKAV----YK---DKDCDGFVDLLTAGTI-PPNPSEILASEALKNLITEAS
A0A3C1YJQ7      -KFDAV--VHKAV----YK---DKDCDGFVDLLTAGTI-PPNPSEILASEALKNLITEAS
A0A3D0JG38      -KFDAV--VHKAV----YK---DKDCDGFVDLLTAGTI-PPNPSEILASEALKNLITEAS
A0A3C0IHX1      -TWQVA--RHLAP----LP---N------MDVLTAGTC-PPNPSELLASPAMKKLLEEAE
R5V506          -TWQVA--RHLAP----LP---N------MDVLTAGTC-PPNPSELLASPAMKKLLEEAE
A0A352TIU5      -TWQVA--RHLAP----LP---N------MDVLTAGTC-PPNPSELLASPAMKKLLEEAE
R5B467          -KPGQI--VTALG----KD---K------PDVIFAGRR-AGAQTEQLGSAAFHTLLHDLR
A0A1Y3TC98      -KKVKA--GELLE----RIPGST------MWLLGNNEV-VKQPAPVLSSRMVKLFIREMR
A0A1W1Z4C3      -KVEQA--ILNST----WD---N------LDVLPAGAV-PTNPCELLESPAMQELLKELE
A0A239QN83      -TAKKA--IVSTV----WE---N------LDILPAGSM-PSNPCELLESPTMAKLIQELE
A0A8A5CVI3      -TAKKA--IVSTV----WE---N------LDILPAGSM-PSNPCELLESPAMEKLIQELE
A0A8A5D3H1      -TAKKA--IVSTV----WE---N------LDILPAGSM-PSNPCELLESPTMEKLIQELE
A0A1Q6REE0      -SGEAA--GALAQ----ATDVEG------LFVIVGNADGKADYFDAPTQARLTKLIRYAR
R5ETF9          -SGEAA--GALAQ----ATDVEG------LFVIVGNADGKADYFDVPTQARLTKLIRYAR
A0A0F2P7X6      -AAEEG--IVFAA----EQ---G------IYVMPNGYI-VPNPSELLGSEKMAALLAALE
A0A359B487      -AAEEC--IVFAT----EQ---G------IHVMPNGYI-VPNPSELLGSEKMAALLAALE
R6VAT5          -SLQDA--IVKTK----KN---G------LYVLPGTIP-VNNASELMGSKQLADLVAALE
D4LC36          -PLDKA--LNRNV----TG---S------LDVLTSGTI-PPNPSELLASRQMKELLETLK
A0A7X3IXX7      -ALQDA--LQQV-------PGSS------LMVLPAGRI-PPNPSELVGSQRMKHVLTELR
A0A1Q6S448      -APEKI--LAAAV----TDPATG------LHSLLSTKS-YTDVIELLASDQLAKVVALAR
A0A351MYR0      -APEKI--LSAVV----TDPATG------LHSLLSTKS-YTDVIELLASAQLAKVVALAR
R6HPC1          -APEKI--LSAAV----TDPSTG------LHSLLSTKS-YTDVIELLASDQLAKVVALAR
A0A3D4G5Z5      -APEKI--LSAAV----TDPSTG------LHSLLSTKS-YTDVIELLASDQLAKVVALAR
A0A3D5ES03      -DPEKI--LSAAV----TDPSTG------LHSLLSTKS-YTDVIELLASDQLAKVVALAR
A0A348P5V4      -TLKES--IKYSE----KY---Q------LFVLVSGVA-VENSTEILSSPKMEEIVEAAK
A0A356PT74      -TLAEA--IKYSE----KY---N------LFLLVSGKP-VFDPSELLSTDAMSDIIKSAE
A0A3D5LL19      -TLAEA--IKYSE----KY---N------LFLLVSGKP-VFDPSELLSTDAMSDIIKSAE
R5MNF0          -TLAEA--IKYSE----KY---N------LFLLVSGKP-VFDPSELLSTDAMSDIIKSAE
A0A1Q9JSI0      -NAENL--VLPIA----NS---D------LLLVADSMI-YPNSTEMIARPLFQKVLDFFK
A0A3D5TNI1      -NSSDA--IKYIE----KY---K------IFVLAGDEC-IADPTEVLSNAKTGEFIAAAK
A0A358LJD0      -NSSDA--IKYIE----KY---K------IFVLAGDES-IADPTEVLSNAKTGEFLAAAR
R6I3L7          -NSSDA--IKYIE----KY---K------MFVLAGDES-ITDPTEMLSNAKTGEFIAAAR
A0A3D1HXX0      -NSSDA--IKYIE----KY---K------IFVLAGDES-ITDPTEVLSNAKTGEFIAAAR
A0A3D2QJB8      -NSSDA--IKYIE----KY---K------IFVLAGDES-ITDPTEVLSNAKTGEFIAAAR
R7MQJ4          -KFDEC--VNKNV----VK---S------LDILTSGTK-PANPSELLASEQAAELLNTLS
A0A1V5GLC0      -SVEEC--IIRNV----ED---N------LDVMCAGPI-PPNPSELLASENMSQMLEKLS
W7V182          -ALDEC--ISKDV----ME---D------LDIMTAGPI-PPNPSELLASSNMENILDQLS
A0A143XPI5      -SWKSA--LISEQ----ET---G------LQLLAGTYR-RDNSAKLMESTYMEQLLEEAK
A0A0M6WXE3      -GANNI--LLNTE----RK---R------LGFIGGKVS-YSASTEMLGNRQLPVLIEACS
A0A348SAK2      -DANHI--LLNTE----RK---R------LGFIGGKVS-YSASTEMLGNRQLPVLIEACS
A0A1G9H5B9      -QWQNV--IMKDV----AQ---K------VDLLPAGHL-PPNPAELLESARMQQLLLELN
A0A1Y4H8L0      -FSDEI--ITKTD----IG---G------LYFMGGRNC-YSMSTDMLQSGNIEKLLKTCR
A0A4B9BMD9      -ELNKV--IQHFG----KG---G------FDVITRGQV-PPNPSELLMRDRMRQLLEWAN
A0A0M6WYQ8      -KISEA--MTTVELEKCPG---S------LQILYGKTT-EGSSSDLLESKQMERLISILK
A0A348SAK1      -KISEA--MTTVELEKCPG---S------LQILYGGTK-EGSSSDLLESKQMERLISILK
A0A252F281      -SVDKI--IQTNA----EV---N------LYEMFGKNY-YSDSVELLGSARMKKLLEVSR
A0A1Y4QKE6      -DVLKN--IRKLD----DS---K------LWFIGNDNP-VDNPVSVLSHPDLKEFIEKMK
B1C231          -DVLKN--IRKLD----NS---K------FWFIGNDKP-INNPVSVLSHPDFKKFIEKMK
A0A7V6WIR4      -GMPEC--LHQT-----RE---G------PWVLPSGPV-PPNPLEIISSKQLQNFWSEQL
A0A1Y3TUL5      -SPEDV--ITHL------T---G------YLDLLPSIL-EPKEIPL--SDALLTLIKDLS
A0A1Y4JAX2      -SPEDV--ITHL------T---G------YLDLLPSIL-EPKEIPL--SDALLTLIKDLS
A0A1Y4T590      -SPEDV--ITHL------T---G------YLDLLPSIL-EPKEIPL--SDALLTLIKDLS
A0A1Y3T163      -TIREG--LRKLK----KS---G------IWFLGSRRI-VKQPASVLSSPRTGELIQALK
A0A1Y3YCA2      -TIREG--LRKLK----KS---G------IWFLGSRRT-VKQPASVLSSPRTGELIQALK
A0A7W8H9H2      -ALEKA--IFRDK----ES---G------VYTMAAGRV-SGRIIRLLGSKTMGTIFTTCK
A0A1Y4L6N9      -TVKDA--IFHDE----ES---G------VYFLGGKEP-IKEVTQTLNSSNLLDVMESLR
A0A173T644      -SLEKA--VEKDG----RS---G------ISFLCGSLP-VRNVPAVLNRPEFQETLRRVR
A0A1C5TSB8      -SLEKA--VEKDG----RS---G------ISFLCGSLP-VRNVPAVLNRPEFQETLRRVR
C0CIK6          -SLEKA--VEKDG----RS---G------ISFLCGSLP-VRNVPAVLNRPEFQETLRRVR
A0A1Y3WEF6      -SLQEA--VYREE----ET---G------VDFLGGSKP-VKGVQQILNHSSFHEVIKEMK
A0A417T0L2      -TLKEA--VYREK----ET---G------VDFLGGNKP-VKGVQQILNHSHFHEVMEEMK
A0A1H9EPU3      -SFDEV--VCETN----VK---N------LHMVFSGIV-PPNPAELLESVYFRELVKQLR
A0A354IGV3      -FVSSA--VMQEE----KT---G------LYVIAGDHS-VPMSSELVSSARMQALLAHFR
A0A417JMV2      -QIDNL--VTDLP----KS---E------LLLIAGSMI-YPNSTEMIASPIFQKIVEFFK
A0A415VWX5      -QIDNL--VTDLP----KS---E------LLLIAGSMI-YPNSTEMIASPIFQKIVEFFK
A0A173UY96      -QIDNL--VTDLP----KS---E------LLLIAGSMI-YPNSTEMIASPIFQKIVEFFK
B0P408          -QIDNL--VTDLP----KS---E------LLLIAGSMI-YPNSTEMIASPIFQKIVEFFK
D4MV82          -QIDNL--VTDLP----KS---E------LLLIAGSMI-YPNSTEMIASPIFQKIVEFFK
A0A173QTL1      -QIDNL--VTDLP----KS---E------LLLIAGSMI-YPNSTEMIASPIFQKIVEFFK
A0A174J359      -QIDNL--VTDLP----KS---E------LLLIAGSMI-YPNSTEMIASPIFQKIVEFFK
A0A174A3T7      -QIDNL--VTDLP----KS---E------LLLIAGSMI-YPNSTEMIASPIFQKIVEFFK
A0A417UUA3      -QIDNL--VTDLP----KS---E------LLLIAGSMI-YPNSTEMIASPIFQKIVEFFK
A0A6N2VB70      -QIDNL--VTDLP----KS---E------LLLIAGSMI-YPNSTEMIASPIFQKIVEFFK
A0A1C6EUV9      -KADHL--VHALA----KS---E------LLLVTGTMI-YPNSTEMIASDMFYKIVDFFK
A0A173Y645      -KSDHL--VHALA----KS---E------LLLVTGTMI-YPNSTEMIASDMFYKIVDFFK
A0A374AVY6      -KSDHL--VHALA----KS---E------LLLVTGTMI-YPNSTEMIASDMFYKIVDFFK
R7BXS4          -KSDHL--VHALA----KS---E------LLLVTGTMI-YPNSTEMIASDMFYKIVDFFK
                                                                            

S3FFL2          DQYDHVVVDSPPVMGLADAPLIASRVEGVIYAIESHGIRATLVKTALGRLLNANVHIFGG
A0A328M4V1      SRFDLIIIDTPPILAVTDAAVIGHHVGTSLLVVQ-FGLNQPREIALAKQRFEQNGVPIKG
A0A6A8IF17      EQYDYVLIDCPPVELVADTQIIEKLADRTVFVVR-AGLLERSMLAELEKIYEEKKYKNMS
A0A143WVN6      ENYDLIVLDTPPIGAGVDVEAILNYGDTSIMTVRQDWSEIGAINDFSDLL-KQNDKEFMG
W6RXP9          EVVDYIILDTPPVQAVADAQILSTRADGTLLVIKAGETKKEATENAINLL-NKVNANVIG
W6S4G8          ETCDYVILDTAPVEAVADAQILSAKADGTLVVIKSGDTRINVIQDALNLL-NKVRGKILG
A0A3D5R4X5      EEYDYVIFDTPPVALVTDAAILANEVDGVILVTSFGMVDYQIAKRAVELL-KNANANILG
A0A1I4C3N6      ENYDMIIVDLAPAGRVIDGLELADCLTSYVLVVREMVTKFEREEMIIRNI-EELKGDICG
A0A3B9CIM7      EEYDCIFVDLPPAGIVADALVLAATATAYILVVREGVTKFDREQMVVQML-EPVGANICG
A0A7R7IBN8      KEFDVIFIDLPPVGIVSDALLLSNSTTAYLLITREKVSKFDREKKVVLQL-EALKANICG
A0A1G9WHW8      ETYDVIFIDFPPVGEVADALALADSVTSFVLVVRENHTKFDKEENVIRTI-EPLGADICG
A0A1H5VAA0      ETYDVIFIDFPPVGEVADALALADSVTSFVLVVRENHTKFDKEENVIRTI-EPLGADICG
A0A3R6VK11      SRYDCIIIDLPPVGIVTDALLLSHEVTAYLLVVRAGVSHMSREKSAVTLL-EQVDADICG
A0A3R6QUY7      SRYDCIIIDLPPVGIVTDALLLSHEVTAYLLVVRAGVSHMSREKAAVTLL-EQVDADICG
A0A373K3P9      SRYDCIIIDLPPVGIVTDALLLSHEVTAYLLVVRAGVSHMSREKSAVTLL-EQVDADICG
A0A3R6JRU5      SRYDCIIIDLPPVGIVTDALLLSHEVTAYLLVVRAGVSHMSREKSAVTLL-EQVDADICG
A0A1C5MS04      SRYDCIIIDLPPVGIVTDALLLSHEVTAYLLVVRAGVSHMSREKSAVTLL-EQVDADICG
A0A3C1J150      SRYDCIIIDLPPVGIVTDALLLSHEVTAYLLVVRAGVSHMSREKSAVTLL-EQVDADICG
A0A416CXD7      SRYDCIIIDLPPVGIVTDALLLSHEVTAYLLVVRAGVSHMSREKSAVTLL-EQVDADICG
A0A6N2X662      SRYDCIIIDLPPVGIVTDALLLSYEVTAYLLVVRAGVSHMSREKSAVTLL-EQVDADICG
R6XBL9          SRYDCIIIDLPPVGIVTDALLLSHEVTAYLLVVRAGVSHMSREKSAVTLL-EQVDADICG
A0A355W5Z7      SRYDCIIIDLPPVGIVTDALLLSHEVTAYLLVVRAGVSHMSREKAAVTLL-EQVDADICG
A0A1G6BLB6      REYDYIIIDCSPMALVADAEEMLNMVDNTLLVVRQHYANVRDINDAIDII-NSRKEKLIG
A0A1C6G8M0      DSYDYIIFDTPPVGVVGDAAIVSSVCDGTLLVIENGVTKKKTLCQIAAEL-EKIDTNILG
A0A416MP73      DSYDYVIFDTPPICVVGDAAIVASFCDGALLVIENGVTKKKTLAQMKFEM-DKVGANVIG
A0A3E4LL92      EQFDYVVMDTPPLELIRDAEIISETADAMLMVMCQDEVHAVAVNDAVDLL-EENGVTVIG
A0A415D1L1      EQFDYVVMDTPPLELIRDAEIISETADAMLMVMRQDEVHAVAVNDTVDLL-EENGVTVIG
A0A396G6S7      EKMDYVVIDTSPLALVADTEELAQMTDASVLVVRQDTVLTKDINDAIDIL-NNTRGKVLG
A0A3E5A223      EKMDYVVIDTSPLALVADTEELAQMTDASVLVVRQDTVLTKDINDAIDIL-NNTRGKVLG
R7D5E6          EKMDYVVIDTSPLALVADTEELAQMTDASVLVVRQDTVLTKDINDAIDIL-NNTRGKVLG
A0A415HQH5      EKMDYVVIDTSPLALVADTEELAQMTDASVLVVRQDTVLTKDINDAIDIL-NNTRGKVLG
A0A414W2C6      EKMDYVVIDTSPLALVADTEELAQMTDASVLVVRQDTVLTKDINDAIDIL-NNTRGKVLG
A5ZNE7          EKMDYVVIDTSPLALVADTEELAQMTDASVLVVRQDTVLTKDINDAIDIL-NNTRGKVLG
A0A395X821      EKMDYVVIDTSPLALVADTEELAQMTDASVLVVRQDTVLTKDINDAIDIL-NNTRGKVLG
A0A1C5PY68      EKMDYVVIDTSPLALVADTEELAQMTDASVLVVRQDTVLTKDINDAIDIL-NNTRGKVLG
A0A174CJF8      EKMDYVVIDTSPLALVADTEELAQMTDASVLVVRQDTVLTKDINDAIDIL-NNTRGKVLG
A0A564SRR2      EKMDYVVIDTSPLALVADTEELAQMTDASVLVVRQDTVLTKDINDAIDIL-NNTRGKVLG
A0A174R7V0      EKMDYVVIDTSPLALVADTEELAQMTDASVLVVRQDTVLTKDINDAIDIL-NNTRGKVLG
A0A373MWV2      TNMDYIILDTPPMGAAADAEELVELADGAVLAVRQDGVLTRDINDAIDAL-NQKEEKVIG
A0A417CE88      TNMDYIILDTPPMGAAADAEELVELADGAVLAVRQDGVLTRDINDAIDAL-NQKEEKVIG
A0A416Y441      TNMDYIILDTPPMGAAADAEELVELADGAVLAVRQDGVLTRDINDAIDAL-NQKEEKVIG
A0A357GPJ7      TNMDYIILDTPPMGAAADAEELVELADGAVLAVRQDGVLTRDINDAIDAL-NQKEEKVIG
A0A396PAC1      TNMDYIILDTPPMGAAADAEELVELADGAVLAVRQDGVLTRDINDAIDAL-NQKEEKVIG
A0A416EYU4      TNMDYIILDTPPMGAAADAEELVELADGAVLAVRQDGVLTRDINDAIDAL-NQKEEKVIG
A0A416SCQ2      TNMDYIILDTPPMGAAADAEELVELADGAVLAVRQDGVLTRDINDAIDAL-NQKEEKVIG
A0A416TGN7      TNMDYIILDTPPMGAAADAEELVELADGAVLAVRQDGVLTRDINDAIDAL-NQKEEKVIG
A0A417SMF6      TNMDYIILDTPPMGAAADAEELVELADGAVLAVRQDGVLTRDINDAIDAL-NQKEEKVIG
A0A0H5SF45      QNYDYIIIDTAPVNLVADALSLAKMVDGVLMVVREKSTTYPHVETALNKY-ELIGGNILG
A0A1M6JRJ5      TEYDYIVLDTPPVNVVADSLSFIKSTDGAILVTRENKTTYSDIDNALMKY-HYAKANILG
A0A1M7Y1S2      AEYDYIILDTPPINIVADSLSFIKSTDGAILVVRENKTTYTDIDNALMKY-RYARANILG
A0A7I8DMN1      MEYDYIILDTPPINVVADSLSLIKSMDGAVLVVRENKTTYADIENALMKY-RYAKANVLG
A0A1Y4MW77      QKMDYIIFDAPPCEAFEDVFLLEKYGDAFVYVIKQDFVQRPRIVDCIGTL-ADSELPLLG
A0A6S6R676      KEYDYIIMDTPPVNVVSDSLSLVKLVDGVVLVVREGMTSHPNIEGALTKY-KFAETNLLG
A0A0K8J554      KRYDYIILDSAPVNLVADALSLAKLVDGILMVVRENGTTYPNIDSALNKY-ELIDGKLLG
A0A1I0RG99      NEYEYILIDTPPVKVVSDALNLVKMVDGVLIVVREGVTSHPCVSSVITKF-QFLNANILG
A0A1I5G322      REYDYIIIDTPPVRVVSDALILMKAADGVLIVVREEVTSHSDITNFLSKC-KYMEIKVLG
A0A7C6IYW8      KEYDYIIFDTPPVNVLSDALSLVKYSDGLLIVLREGITSHPNLTNALDKF-KLSQGNILG
A0A7C6JZF1      KNYDYIIIDSPPVNVVSDVLSLAKSVDGIAVVVREGVTTHPNVANALEKF-KLADAVVLG
A0A3N1XSX6      KDYDYIIFDTPPVNVLSDSLSLVKLSDGLIIVVREGVTSHPNVSNALEKF-RLSQGNILG
A0A839K1C1      KEYNYIIFDTPPVNVLSDSLSLVKYSDGLLIVVREGMTSHPNLTNALEKL-MLSHGNILG
R6UHV6          EQYDYIIIDTPPLCFVSDAEDILTLSDSSLIVVRRNVANALSINDTIDII-LASGVKLMG
A0A3R9Q621      KSYDYIIIDTPPINVVSDVIGLVKLVDGMLIVVRQAVTSHPNIAGALSKY-ELVNANILG
A0A069RC75      NDYDYIIVDTPPATAVTDASIVSTFSDAAVIVCSSGIVDIDELKRAKAQL-EGVNARIMG
A0A174F2W5      TNMDYIILDTPPMGAAADAEELVELADGAVLAVRQDGVLTRDINDAIDAL-NQKEEKVIG
A0A174S8E9      TNMDYIILDTPPMGAAADAEELVELADGAVLAVRQDGVLTRDINDAIDAL-NQKEEKVIG
A0A416ZL97      TNMDYIILDTPPMGMTADAEELAEYADAAVLSVRQDGALTRDINDAIDAL-NQKEEKVIG
A0A174LSK1      TNMDYIILDTPPMGMTADAEELAEYADAAVLSVRQDGVLTRDINDAIDAL-NQKEEKVIG
A0A373GY92      TNMDYIILDTPPMGMTADAEELAEYADAAVLSVRQDGVLTRDINDAIDAL-NQKEEKVIG
A0A373NZQ6      TNMDYIILDTPPMGMTADAEELAEYADAAVLSVRQDGVLTRDINDAIDAL-NQKEEKVIG
A0A417I9B9      TNMDYIILDTPPMGMTADAEELAEYADAAVLSVRQDGVLTRDINDAIDAL-NQKEEKVIG
A0A417WQF8      TNMDYIILDTPPMGMTADAEELAEYADAAVLSVRQDGVLTRDINDAIDAL-NQKEEKVIG
A0A8B3CFR3      TNMDYIILDTPPMGMTADAEELAEYADAAVLSVRQDGVLTRDINDAIDAL-NQKEEKVIG
A0A373RZ83      TNMDYIILDTPPMGMTADAEELAEYADAAVLSVRQDGALTRDINDAIDAL-NQKEEKVIG
A0A416U6I1      TNMDYIILDTPPMGMTADAEELAEYADAAVLSVRQDGALTRDINDAIDAL-NQKEEKVIG
R7JQZ9          TNMDYIILDTPPMGMTADAEELAEYADAAVLSVRQDGALTRDINDAIDAL-NQKEEKVIG
A0A1M5UYN6      NDFDYIILDTPPVIPVTDAQVIANEADGVILVVASNEADKDAVVRAKELL-LKVRANILG
A0A176JBT8      QKFDVILFDSSP-LLVSDSILLSGKMDGCIYVLNARKTNRDDANEKIELL-KRSSNELIG
A0A1I5HIC6      EIYDYIIIDTPPLGVVIDSANVAEICDGTILVIESGKISYRLIQRVLKQL-ITGKSRVLG
A0A1Y3TC51      REMDYIIIDCSPVAVSADAEVWVSVADSVLLVVREDWADVRVINDAVDMI-SQNGTDFTG
A0A1Y3T1N0      QEMDYIIIDCPPTAVSTDAEVWMEAADTVLLVVREDWSDVRIVNDTVDMI-WQSGCDFSG
A0A1Y3Y8U8      QEMDYIIIDCPPTAVSTDAEVWMEAADTVLLVVREDWSDVRIVNDTVDMI-WQSGCDFSG
A0A5B0BQY5      ILFDVVIIDSPP-LTVADGISLIQAVDGCIYVTHVKKTTEDNALKYLEYL-KNVNATVLG
A6CLL4          KEVDLILIDTPP-LIVSDAAVLSSRVDGCLFLINARKTRMETAKKNLNKL-NRVGANIIG
A0A176U8D6      DSYDYVIFDTPPICVVGDAAIVASFCDGALLVIENGVTKKKTLAQMKSEM-DKVGANVIG
A0A1Q6KSQ5      DSYDYIIFDTPPVGVVGDAAIVSSVCDGTLLVIENGVTKKKTLCQIAAEL-EKIDTNILG
A0A3D3U8B3      DSYDYIIFDTPPVGVVGDAAIVSSVCDGTLLVIENGVTKKKTLCQIAAEL-EKIDTNILG
A0A3E5FRL7      EHFDYIVIDCSPVAVSVDAEVWMEVVDSTILVIRQDWTDIRVVNDTVDLI-WQSNCNFTG
A0A1Y4QK93      KHFDYIVIDCSPVAVSVDAEVWMEVVDSTILLVRQDWTDIRMVNDTVDLI-WQSGCDFTG
B1C232          EQFDYIIIDCSPISVSVDAEVWMEVVDSTILLVRQDWTDIRIINDTVDLI-WQSDCDFIG
A0A401USI6      KKYDYVILDTPPIIAFADALTLATEKIGVILVIGSEESTIENCKKSKQLL-LNINATIIG
A0A1V4IQ10      KNFDIILLDSPPVQAVTDAQILSTKVDCTLVVIRSGVTNAKSVLETKSLL-TKINGLVIG
A0A1S8TRD2      QKYDIILLDSPPAQAVTDAQILSSKVDCTLIVIRSGLTNAKSVLETKNLL-IKVNGLVIG
G7M1U2          QKYDIILLDSPPAQAVTDAQILSSKVDCTLIVIRSGLTNAKSVLETKSLL-TKVSGLVIG
A0A2T6KJ75      NQFDIIIVDTPP-LLVADTLHISANVDGCLYVVNAESSKVEQAIYSIELL-KQVQAPLIG
A9KN92          DEYDYIIIDTPPLGVVIDSANVADICDGTIMVIESNKISYRFAQRVLKQL-ITEKSKVLG
A0A352MUJ1      KNCDIVIFDATPSNLVTDAVVLSRLVDTSFIVTEHEKTQIDDIAKIKTQI-EDVGGNIAG
R5YI67          KNCDIVIFDATPSNLVTDAIVLSRLVDTSFIVTEHEKTQIEDIEKIKTQI-EDVGGNIAG
A0A174DL89      SNFDFILIDSPPLPLVADSQALSTFVDGTIIITKLGYTTKSALLNTKEIL-DGLKTNVIG
A0A1Y0IQP5      TRYDLVLIDSPPLLPVTDGQVLSTLCDGVLLVVRSGAVTRDHLQQAKALL-DRVGAQVIG
A0A4R2R7B1      IRYDLVLIDSPPLLPVTDGQVLSTLCDGVLFVVRSGEVARDQLQQAKGLL-ERVGAQVIG
A0A1M6E8I2      KKYDYVLFDSPPVVPVTDAVVMTRYIEGAILVVASGNVGVDMVKKAKKSL-EFSGVKLIG
A0A7C6SMH0      EEYDIVIFDTPPVGQVTDAAILAGLTDGTILVLASAGTRIDMAKRACKAL-EGVNANMIG
A0A7X7XYM7      DEYDIVIFDTPPVGQVTDAAILAGLTDGTILVLACAGTRIDMAKRACKAL-DGVNANTIG
A0A3B8KKL6      GEYDIVIFDTPPVGQVTDAAILAGLADGTILVLACAGTRIDMAKRACKAL-EGVNANMIG
A0A2K9E6R0      GEYDIVIFDTPPVGQVTDAAILAGLADGTILVLACAGTRIDMAKRACKAL-EGVNANMIG
A0A2S8RBI0      GEYDIVIFDTPPVGQVTDAAILAGLADGTILVLACAGTRIDMAKRACKAL-EGVNANMIG
A0A7X8MFK9      NEYDLIIIDTPPVAQVTDAAIVAGITDGVLLVLASRQTRIEMAKRAKKLL-NGVNANIVG
A0A7X9D1M8      SEYDTIIIDTPPVGQVTDAAIISGIADGVLLVLASGQTRIDMAKRAKRLL-EGVNANITG
A0A0L6JLG6      SEYDVIFIDTPPVGQVTDAAILTGIADGSIVVVAGGQTRIDMAKRAKKAL-TAINANIIG
A0A7X8PYA7      DDYDTIIIDTPPVGQVTDAAILAGTTDGAILVFACSQTRIDMAKRAKKAL-ASVNSNIIG
G8LSN0          GNYDFILLDTPPVGQVTDAAILAGIADGTIMVFACSQTRIDMAKRAKKAL-ESVGSNILG
A0A1Y4N105      SNFDYIIIDTPPMGACVDVEAIINHSDSSVMVVREDWSEIGAINDLCDVL-KQNDQDFIG
A0A1Y4QP75      SNFDYIIIDTPPMGACVDVEAIINHSDSSVMVVREDWSEIGAINDLCDVL-KQNDQDFIG
A0A3D4QRB5      EIYDMIILDAPPIMPVSDALVLSKYTDGVVYVVGYGDIAREMVIRAKTDL-EKVGAKILG
A0A349DEH5      KNFDYVLIDTAPASVVTDTSVIAGFVDAAIIVVREDFSPYSRIRMSIEDI-DANGAEIIG
A0A3D4T7B4      KNFDYVLIDTAPASVVTDTSVIAGFVDAAIIVVREDFSPYSRIRMSIEDI-DANGAEIIG
A0A350XYC7      NAFDYVLIDTAPASVVTDTAVIAGFADAAIIVVREDFAPYSRIRMSIEDI-DSNGAEIIG
R6DNR8          KAFDFVLIDTAPASVVTDTSVIAGFVDAAIVVVREDFAPYSRIRMSIEDI-DSNGAEIIG
A0A355KUM5      KEFDYVLIDTAPASVVTDTSVIAGFVDAAIIVVREDFSPYSRIRMSIEDI-DSNGAEIIG
R5YGY6          KEFDYVLIDTAPASVVTDTSVIAGFVDAAIIVVREDFSPYSRIRMSIEDI-DSNGAEIIG
A0A7G9WCY6      RSYDFVLIDAPPIGIVTDSAILSSICDGTIFVVAAGEAQKDQTLKAKEML-EKVGKKTLG
A0A0A5GPA9      EHFDLVIIDTPP-LVVADAVALSTRVDGCVFVVNAQKTNTEQVSKSLQRL-NKVKATIFG
A0A271M6M4      ESYDLVIIDTPP-LVVSDAVVLSTKVDGCIFIVNAQKTKVDQTVKSIQKL-KKVEANILG
A0A1C6G0U3      NEYDYIFIDSPPVNIVSDSEVLSRIVDGVIVVIGCNEVDRNSVKQCKEKL-NNLNANILG
A0A3D4LLB3      ADYDYILLDVPPVMLVSDPIIISTFSNAVILAIEHGKTEKELAKKAVNSL-KQVDANIIG
A0A7C7AD93      EEFDYIILDTPPVGMFTEAQVLSQFTDGYLIVVSSNESEKALARKAVKLL-RYAEANIIG
A0A2V3W8U6      EHFDRIIIDSPP-LFFSDAAILATKVDGCLLVVQSDTTKVTHIQQGLGQL-TNVNATILG
A0A6N3BXA1      NDYDYIFIDTPPAGVVSDCSILSRYSDGLVYIMASKESEIDYIKDSIKGL-QGIK--IIG
A0A351SRI8      NNFDIIIFDSAPINGLADSLVMSTLVDGVIIVTACKETSKTLLKTVKKDL-ENVGANILG
A0A1V5LU59      NEYDVIIIDTPPVGQVTDAAIIAGITDGVLLVFASSQTRIDIAKRAKKAL-ESVNSNIIG
A0A7X8R9W1      KEYDIIIIDTPPIGQVTDAAILAGVTDGTILVLASNETRIEITKRAKKAL-DSVNASIIG
A0A1E3BVC3      EEYDIIIIDTPPVGQVTDAAIVAGITDGVMLVLASGQTRIEMAKRATKSL-ESVKARFVG
A0A4Q0I6S0      EEYDIIIIDTPPVGQVTDAAIVAGITDGVMLVLASGQTRIEMAKRATKSL-ESVKARFVG
A3DF66          EEYDIVIIDTPPVGQVTDAAILAGITDGVILVLASGQTRIEMAKRAFKSL-ESVKARFIG
W4V1T8          EEYDIIVIDTPPVGQVTDAAVIAGITDGVMLVLASGQTRIEMAKRAYKSL-ESVKAQFVG
A0A1C6ITD7      SNFDFILIDSPPLPLVADSQVLSTFVDGTIIVTKFGYTTKSALINTKEIL-DGLNTNVIG
A0A381IX63      EHFDYVFIDTPPIGIVSDAGIVSTYSDGIILVAASNEVDDNVIKLSKDRL-VKVNANIIG
A0A1M6RWV2      EYYDIILIDSPPAGIVTDAAVLSKITDGTLFVVAAGQTTIELAQKAKDML-DKVQAKVIG
A0A841ZT34      EEYDFVLIDAPP-SFISDTFYVAKESDGTILVVEMGKTTKQKFAKGLSDF-NLVNLPIYG
A0A1G9IUT4      NEYDYIFIDSPPIGRVTDAGVISNYVDSTIIVIAENEVNIDDVKVAKKKL-QQVNANILG
A0A842GR80      ERYDFVLVDTPP-AFISDTVFCAKESDGTIIVVESGKTTKQNFVKTLSNL-SAVDISVYG
A0A7X0TNH3      ERYDFVLVDTPP-AFISDTVFCAKESDGTIIVVESGKTTKQNFVKTLSNL-SAVDISVYG
A0A842D596      ERYDFVLVDTPP-AFISDTVFCAKESDGTIIVVESGKTTKQNFVKTLSNL-SAVDISVYG
A0A842EQ86      ERYDFVLVDTPP-AFISDTVFCAKESDGTIIVVESGKTTKQNFVKTLSNL-SAVDISVYG
A0A842A220      ERYDFVLVDTPP-AFISDTVFCAKESDGTIIVVESGKTTKQNFVKTLSNL-SAVDISVYG
A0A7X0YM80      ERYDFVLVDTPP-AFISDTVFCAKESDGTIIVVESGKTTKQNFVKTLSNL-SAVDISVYG
A0A842GEL5      ERYDFVLVDTPP-AFISDTVFCAKESDGTIIVVESGKTTKQNFVKTLSNL-SAVDISVYG
A0A841XVD7      ERYDFVLVDTPP-AFISDTVFCAKESDGTIIVVESGKTTKQNFVKTLSNL-SAVDISVYG
A0A7X0XME5      ERYDFVLVDTPP-AFISDTVFCAKESDGTIIVVESGKTTKQNFVKTLSNL-SAVDISVYG
A0A842B6T1      ERYDFVLVDTPP-AFISDTVFCAKESDGTIIVVESGKTTKQNFVKTLSNL-SAVDISVYG
A0A841X7G0      ERYDFVLVDTPP-AFISDTVFCAKESDGTIIVVESGKTTKQNFVKTLSNL-SAVDISVYG
A0A841W3M8      ERYDFVLVDTPP-AFISDTVFCAKESDGTIIVVESGKTTKQNFVKTLSNL-SAVDISVYG
A0A7X0XVI0      ERYDFVLVDTPP-AFISDTVFCAKESDGTIIVVESGKTTKQNFVKTLSNL-SAVDISVYG
A0A7X0Z1K1      ERYDFVLVDTPP-AFISDTVFCAKESDGTIIVVESGKTTKQNFVKTLSNL-SAVDISVYG
A0A143ZUX1      PNFDFIIIDTPPAHVVSDAMTIRRFVDATILVVRQDFTPASTIRHTLEDL-DSEETPVIG
A0A7I8D809      PNFDFIIIDTPPAHVVSDAMTIRRFVDATILVVRQDFTPASTIRHTLEDL-DSEETPVIG
A0A3R9WAA7      EEYDYIILDSAPSAVISDTIELAKYADGVIYVIRQDYSRVRQIQQGMEHIVESSRAEIIG
A0A1G6BLF1      KEYDYVILDTPPCALLNDATMVASQAQAAIFVVRQDYARVDRIYEGIENL-AETGVDIMG
A0A355G1X5      KEFDYVIIDTAPAAVVTDATILSNFADACIMVVRENFSDVSRIRSVISDL-ESYKAELIG
A0A1W2CEA6      RDYDFVIVDTPPLGVVVDAAEISRRCDGSLLVLEYNRTHGKALKEAVRLL-RRTGTPVLG
A0A355G3J9      KDYDYIIIDSPPINEVSDAMTLVDVVNGYIMCSIAGYSDAEETKQAVLSL-EQIGAKIFG
A0A3D2AD87      EQYDYVIVDTPPLNVVTDSMIIAPQTGGVILIVRDGYTPHYSIKKVLGDM-DFANINILG
A0A143XN92      QEMDYILIDTSPVALTSDGESLAHIIKDTILVVRYDTMLAADLNEVADTL-NEAGSRVIG
R7FFK6          EKYDIILIDCAPVNVVSDVAGMANSIAGVVMVVHYGTTTYAETEDAVKQL-ELANCNVLG
A0A373MPB9      HKYDYVIIDGTPLLPVTDVMSLADEVAGVLLIARYGRTTYQEIEESMKKL-EIGDCNLLG
A0A373L519      HKYDYVIVDGTPLLPVTDVMSLADEVAGVLLIARYGRTTYQEIEESMKKL-EIGDCNLLG
A0A373W906      HKYDYVIVDGTPLLPVTDVMSLADEVAGVLLIARYGRTTYQEIEESMKKL-EIGDCNLLG
A0A373VCW2      HKYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKL-EIGDCNLLG
W0U604          HKYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKL-EIGDCNLLG
A0A374B6G0      HKYDYVIVDGTPLLPVTDVMSLADEVAGVLLIARYGRTTYQEIEESMKKL-EIGDCNLLG
A0A373VM36      HKYDYVIIDGTPLLPVTDVMSLADEVAGVLLIARYGRTTYQEIEESMKKL-EIGDCNLLG
A0A1C5P379      HKYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKL-EIGDCNLLG
A0A373XXX0      HKYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKL-EIGDCNLLG
A0A5R9MJM9      HKYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKL-EIGDCNLLG
A0A356CW82      HKYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKL-EIGDCNLLG
R6T4X7          HKYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKL-EIGDCNLLG
A0A374HTV1      HKYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKL-EIGDCNLLG
A0A374GB66      HKYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKL-EIGDCNLLG
A0A374ECC6      HKYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKL-EIGDCNLLG
A0A374BM61      HKYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKL-EIGDCNLLG
A0A373UGZ4      HKYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKL-EIGDCNLLG
A0A373SA66      HKYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKL-EIGDCNLLG
A0A1C5X6X7      HKYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKL-EIGDCNLLG
A0A1C6JIH3      HKYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKL-EIGDCNLLG
A0A373PSC3      HKYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKL-EIGDCNLLG
A0A1K1WYK8      TNYDYVIIDTPPVNVVSDAMVMKDSISGIMLVIRYAMTTYEELANCMKQI-ELAKVNMLG
A0A1H6IUB1      EEYSMILIDTPPVNVVTDAMELAKYVSGIVLVLRYGVTTNEDAEDAIKKI-EFAKMNMLG
A0A1M7L1F9      SEYSMILIDTPPVNVVTDAMELAKYISGIIVVLRYGVTTNEDVDAAIKKV-EFAQMNMLG
A0A1C6B4L6      KKYQIIIIDTPPVNVVTDAMELAKCVSGIVVVLCYGRTTTEDIEAVVKKM-EFSKVNMLG
A0A1Q6T9P4      KKYQIIIIDTPPVNVVTDAMELAKCVSGIVVVLRYGRTTTEDIEAVVKKM-DFSKVNMLG
A0A315Y4F9      EKYDAILIDTPPVNVVTDAMELAKSVSGIVLVVRYGRTTDEDVDNVFKRV-ELANMNLLG
A0A354K620      EKYDVILIDTPPVNVVTDAMELAKMISGIVLVVRYGKTTDEDVENVFKRI-ELAKMNLLG
A0A173ZYY6      KFVDYVIIDTPPAGIIGDAQIFAHCADAVMIVSKQNYMLAEDINEVMDDF-RDKEGKVLG
A0A6L8RXB5      KFVDYVIIDTPPAGIIGDAQIFAHCADAVMIVSKQNYMLAEDINEVMDAF-RDKEGKVLG
A0A173SMI2      KFVDYVIIDTPPAGIIGDAQIFAHCADAVMIVAKQNYMLAEDINEVMDAF-RDKEGKVLG
A0A845KKD0      KFVDYVIIDTPPAGIIGDAQIFAHCADAVMIVSRQNYMLAEDINEVMDAF-RDKEGKVLG
A0A6N9JW85      KFVDYVIIDTPPAGIIGDAQIFAHCADAVMIVSKQNYMLAEDINEVMDAF-RDKEGKVLG
A0A174ASH7      KFVDYVIIDTPPAGIIGDAQIFAHCADAVMIVAKQNYMLAEDINEVMDAF-RDKEGKVLG
A6BH65          KFVDYVIIDTPPAGIIGDAQIFAHCADAVMIVAKQNYMLAEDINEVMDAF-RDKEGKVLG
R7G0D7          KFVDYVIIDTPPAGIIGDAQIFAHCADAVMIVSKQNYMLAEDINEVMDAF-RDKEGKVLG
R6HZX3          TLADYVIIDAPPAGLLADAAVLCRSADQVLYVVRYDSFARNQVADAMHSV-SGRGAELTG
R5EFZ0          ECFDFIVLDLPPMSAASDAEGMADLADASLLVVRQNAAAAPALNNAVASL-DGHKAKVLG
A0A3E5FSY5      KEFDYVIIDTPPCGIFQDVTLIQEYSDALLYVVKYDFLPYQKIQNGLSIL-K-EDCCFMG
A0A1V5S3C0      KNFDFVIIDCAPAGVVADATIVSNYCDAVLFVVAENKTSLREIEYAVSDL-STTKAEVFG
A0A3C0QME1      PQYDYIIIDTPPINVVSDTLVMGKILSGLLLVVKYGQTTFEELQDAINHA-NLSELNVIG
A0A355FYK5      KEFDFIIIDTPPSRVVSDSMVMSSLADSLVFVIRKDHAKIADINETLEEI-AGTNIDIAG
A0A357AQU0      EQYTVILIDTPPVNMVSDVYGLSDSIAGIVLVAEFEGTTSYDIKHALEGA-KLSNVNVLG
A0A3C1YJQ7      EQYTVILIDTPPVNMVSDVYGLSDSIAGIVLVAEFEGTTSYDIKHALEGA-KLSNVNVLG
A0A3D0JG38      EQYTVILIDTPPVNMVSDVYGLSDSIAGIVLVAEFEGTTSYDIKHALEGA-KLSNVNVLG
A0A3C0IHX1      QQYDYIIIDTPPVNVVSDALGLSDCIGGILMVARYYVTTTKELETALQAI-SVTGATVLG
R5V506          QQYDYIIIDTPPVNVVSDALGLSDCIGGILMVARYYVTTTKELETALQAI-SVTGATVLG
A0A352TIU5      QQYDYIIIDTPPVNVVSDALGLSDCIGGILMVARYYVTTTKELETALQAI-SVTGATVLG
R5B467          EHYDVVLLDTPPCAVMTDALETGAATDCALLVVRQDASSRVSVINSLAAL-DALGVPVLG
A0A1Y3TC98      RKMDYVIIDSPPCTMFQDAGILADHADAVLYVVKYDELPLQKIQEGLSFL-GSQRTPFTG
A0A1W1Z4C3      EKYDLILMDVPPINIVSDPLALSGQCAGALFVVRQNFSDHREIRRALISA-EMTGLEVLG
A0A239QN83      EQYDLVLMDVPPINIVSDPLALSSQAAGTLFVVRQEFSDHREIRRALVSC-EMTGLEVLG
A0A8A5CVI3      ETYDLILMDVPPINIVSDPLALSSKCAGALFVVRQEFSDHREIRRALVSC-EMTGLEVLG
A0A8A5D3H1      EQYDLILMDVPPINIVSDPLALSSQAAGTLFVVRQEFSDHREIRRALVSC-EMTGMEVLG
A0A1Q6REE0      DKYDYVILDTPPCSLLTDAAEAAEAAEAGLMVIRQDYASRDQILDGAQRL-SDSRLPIIG
R5ETF9          DKYDYVILDTPPCSLLTDAAEAAEAAEAGLMVIRQDYASRDQILDGAQRL-SDSRLPIIG
A0A0F2P7X6      KQYDYIILDTPPSYLLTDAVALSVYADGVILVVKQGCAKVDVINSAQAAF-ENAGVRIIG
A0A359B487      KQYDYIILDTPPAYLLTDAVALSVYANGVILVVKQGCAKVDVINSAQAAF-ENAGVRIIG
R6VAT5          KIFDYVVIDAPPVGIVSDALEMKDYVGGLVFVVRQDYAKVSKILDSISLF-GYSKIKILG
D4LC36          ERYDMILIDCAPINVVSDVAGLSQEIAGVVMVVHYGFTTYPELDDAVNRL-ALANCNVLG
A0A7X3IXX7      ESY-MVFVDAPPVLPVTDASLLAAAADGAILVIEVGGTRKEQVELAASML-RRVSVTLLG
A0A1Q6S448      ERYDYVIIDSPPLGFFSDSELLSDLSDASVLVVRQDTVPAPEINDAIDAL-RAGKAEFLG
A0A351MYR0      ERYDYVIIDSPPLGFFSDSELLSDLSDASVLVVRQDTVPAPEINDAIDAL-RAGKAEFLG
R6HPC1          EQYDYVIIDSPPLGFFSDSELLSDLSDASVLVVRQDTVPAPEINDAIDAL-RAGKAEFLG
A0A3D4G5Z5      EQYDYVIIDSPPLGFFSDSELLSDLSDASVLVVRQDTVPAPEINDAIDAL-RAGKAEFLG
A0A3D5ES03      EQYDYVIIDSPPLGFFSDSELLSDLSDASVLVVRQDTVPAPEINDAIDAL-RAGKAEFLG
A0A348P5V4      KEFDYVIIDTAPCGIIADASILAGYADTIVLVVKQDYASARRIKRAVDNF-ENSGTEIIG
A0A356PT74      KEFDYIIIDTAPCGVVADASILSSYADGILLVVRNDMVASRRIKRAVENL-ENSGTKLVG
A0A3D5LL19      KEFDYIIIDTAPCGVVADASILSSYADGILLVVRNDMVASRRIKRAVENL-ENSGTKLVG
R5MNF0          KEFDYIIIDTAPCGVVADASILSSYADGILLVVRNDMVASRRIKRAVENL-ENSGTKLVG
A0A1Q9JSI0      ERLDYIIIDTPPMSQAADAEEMVDLVDASILVVKQHTALVKDINEAIAIL-KSGEGTMLG
A0A3D5TNI1      EKFDYIIIDTPPAGIVADAAICAKYTDSSIFVIREDRFPVPAILEAVSDL-TQGGTDLAG
A0A358LJD0      EKFDYIIIDTPPVGIVADAAICAKYTDSSIFVIREDVFPVPAILEAVSDL-TQGGSDLAG
R6I3L7          EKFDYIIIDTPPIGIVADAAICAKYTDSSIFVIREDVFPVPAILEAVSDL-TQGGTDLAG
A0A3D1HXX0      EKFDYIIIDTPPVGIVADAAICAKYTDSSIFVIREDVFPVPAILEAVSDL-TQGGTDLAG
A0A3D2QJB8      EKFDYIIIDTPPVGIVADAAICAKYTDSSIFVIREDVFPVPAILEAVSDL-TQGGTDLAG
R7MQJ4          EAYDYIIVDTPPVNIVSDAMGLSNSIAGILMVLRYGRTTFDDLDNAMKKI-ELADVKMLG
A0A1V5GLC0      AEYSAIVIDTPPINVVTDAMELARNISGIILVTSYGKTTVDDMDSAMKKI-EFANMNLLG
W7V182          ERYSVIIIDTPPVNVVTDAMELANKVSGIIMVARYAKTTTDDIDNAMKKI-EFAKMNMLG
A0A143XPI5      EQFDCVIVDAPPCTILSDAIILAKKLDSVIMVIRYDYARVNQILRGSESL-ADTGISMIG
A0A0M6WXE3      KIVDYVIIDTPPSGMIGDAQIFAQHADAVMVVARQNVTLAEDINEMMDDF-RDNHTKVLG
A0A348SAK2      KIVDYVIIDTPPSGMIGDAQIFAQHADAVMVVARQNVTLAEDINEMMDDF-RDNHTKVLG
A0A1G9H5B9      DAYDLVLLDMPPVDIVADPLAVSAHVAGCILMVRQHFTTHQDLRKALNAA-EMTDMNVLG
A0A1Y4H8L0      RLVDYVVIDTPPAGPLGDAELFARYADEVLLVVRQNYMLAEDINDVLDHF-REVGCHVVG
A0A4B9BMD9      DHYDLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRL-EQAGVNIKG
A0A0M6WYQ8      KKADLVIFDTAPSEMLADAPVLARYLDAAVYVIRYDYAKMRQIRMGVENI-SMSGIHMLG
A0A348SAK1      KKADLVIFDTAPSEMLADAPVLARYLDAAVYVIRYDYAKMRQIRMGVENL-SMSGIHMLG
A0A252F281      QKMDFIIIDSPPMSALSDTEVLAELVDATVLVVREDTSAVPDLNESIMIL-NESKSRLLG
A0A1Y4QKE6      KEFDYVIIDTPPCGIFQDVTLIQKYADALLYVVKYDFLPYQKIQNGLSIL-KE-DCCFMG
B1C231          KEFDYVIIDTPPCGIFQDVTLIQEYSDALLYVVKYDFLPYQKIQNGLSIL-KE-DCCFMG
A0A7V6WIR4      KVYDYVLVDAPPILPVADTVVLATQLDGIILVLDAMATPVDVALEAKTRL-ARVNAKVIG
A0A1Y3TUL5      QNYDYVLMDSAPVGRVAETLSLNRIAKSALFVIRFDYSNMNTIRDSLERL-DKSGINPLG
A0A1Y4JAX2      QNYDYVLMDSAPVGRVAETLSLNRIAKSALFVIRFDYSNMNTIRDSLERL-DKSGINPLG
A0A1Y4T590      QNYDYVLMDSAPVGRVAETLSLNRIAKSALFVIRFDYSNMNTIRDSLERL-DKSGINPLG
A0A1Y3T163      KEMDYIIIDTPPCEMFQDAGMLSDYADGILYVVKYDFIPQRRIWEGLSFL-GGRSARILG
A0A1Y3YCA2      KEMDYIIIDTPPCETFQDAGMLSDYADGILYVVKYDFIPQRRIWEGLSFL-GGRSARILG
A0A7W8H9H2      KTMDLIIIDAPPCDLFSDASVLADHADSILYITRYDFIQKRRVLDGVSAM-EDTGVPILG
A0A1Y4L6N9      KEMDYVIIDAPPSEMFEDAAVLSEYADGILYVVRYDFVQRRRVLDGLAEL-DGVHTRLLG
A0A173T644      GEYDLVILDSPPAEMFEDASLMAEFSDGICYVIRHDFVQKRRILESLAGL-ESSGTTILG
A0A1C5TSB8      GEYDLVILDSPPAEMFEDASLMAEFSDGICYVIRHDFVQKRRILESLAGL-ESSGTTILG
C0CIK6          GEYDLVILDSPPAEMFEDASLMAEFSDGICYVIRHDFVQKRRILESLAGL-ESSGTTILG
A0A1Y3WEF6      AQWDLILLDAPPTEMFEDASILAEQADGILYVIRYDQVQKRRILDSISGL-EDSSAPLLG
A0A417T0L2      AQWDLILLDAPPVEMFEDASILAEQSDGILYVIRYDQVQKRRILDSISGL-EDSKAPLLG
A0A1H9EPU3      QAYDYVVIDTPPVGTVIDGAIIGKECDGVVMVVGSGDISYKLVERAKEQL-ETSGSRILG
A0A354IGV3      EEMDFILIDSPPMALFSDAEALANLSDASVMVIRQSRSLAQEINTAADTL-ESGHSELLG
A0A417JMV2      TKLDYIIIDTPPMSQAADAEELVDLADASILVVRQHTALVKDINETIGIL-NSAEGTMLG
A0A415VWX5      TKLDYIIIDTPPMSQAADAEELVDLADASILVVRQHTALVKDINETISIL-NSAEGTMLG
A0A173UY96      TKLDYIIIDTPPMSQAADAEELVELADASILVVRQHTALVKDINETIGIL-NSAEGTMLG
B0P408          TKLDYIIIDTPPMSQAADAEELVDLADASILVVRQHTALVKDINETISIL-NSAEGTMLG
D4MV82          TKLDYIIIDTPPMSQAADAEELVDLADASILVVRQHTALVKDINETISIL-NSAEGTMLG
A0A173QTL1      TKLDYIIIDTPPMSQAADAEELVDLADASILVVRQHTALVKDINETIGIL-NSAEGTMLG
A0A174J359      TKLDYIIIDTPPMSQAADAEELVDLADASILVVRQHTALVKDINETISIL-NSAEGTMLG
A0A174A3T7      TKLDYIIIDTPPMSQAADAEELVDLADASILVVRQHTALVKDINETISIL-NSAEGTMLG
A0A417UUA3      TKLDYIIIDTPPMSQAADAEELVDLADASILVVRQHTALVKDINETISIL-NSAEGTMLG
A0A6N2VB70      TKLDYIIIDTPPMSQAADAEELVDLADASILVVRQHTALVKDINETISIL-NSAEGTMLG
A0A1C6EUV9      DRLDYVIIDTPPMSQAADAEELVDYADASILVVRQHTALVKDINEAISVL-NSGDGTMLG
A0A173Y645      ERLDYVIIDTPPMSQAADAEELVDYADASILVVRQHTALVKDINEAISIL-NSGEGTMLG
A0A374AVY6      ERLDYVIIDTPPMSQAADAEELVDYADASILVVRQHTALVKDINEAISIL-NSGEGTMLG
R7BXS4          ERLDYVIIDTPPMSQAADAEELVDYADASILVVRQHTALVKDINEAISIL-NSGEGTMLG
                     :..* .*     :                                         .

S3FFL2          VLTKFEATKS----------------------NSGYGYEYG------YGYGRDEKAGD--
A0A328M4V1      AIFNLVEKRS----------------------AGYYAYAY-------YTYAAAKS-----
A0A6A8IF17      LILNGTEG-S----------------------GGRYGYRYGYRYGYHYGYGSGYH-----
A0A143WVN6      FVLNAFHE---NILIEKS--------------YGQYPYQNYQSRSVRKAEE---------
W6RXP9          GILNGAED-RKNKTY------------------YYYGE----------------------
W6S4G8          VVLNATEDGRLSKMY------------------QYYGEEHKKKGDKVS------------
A0A3D5R4X5      SVLNKIPMGRGGYSYYKY--------------YSSYYGEYEKTSRKKRKKRSDVID----
A0A1I4C3N6      FIYNGISTKSEDYNY--K--------------KAAEKYGFVDTSAKVVSAKKKVAAR---
A0A3B9CIM7      FVFNGISMKSQDYHY--K----------------HYAKDYKY------------------
A0A7R7IBN8      FIYNGISMKSKDYTY--N----------------KYGKDYFG------------------
A0A1G9WHW8      FIYNGIAVNSREYKY--N--------------TKKYGKEYGYGLKYSASK----------
A0A1H5VAA0      FIYNGIAVNSREYKY--N--------------TKKYGKEYGYGLKYSASK----------
A0A3R6VK11      ILFNGLPPKSKDCNY--R--------------LQQYWQEYKQQNGEAV------------
A0A3R6QUY7      ILFNGLPPKSKDCNY--R--------------LQQYWQEYKQQNGEAV------------
A0A373K3P9      ILFNGLPPKSKDCNY--R--------------LQQYWQEYKQQNGEAV------------
A0A3R6JRU5      ILFNGLPPKSKDCNY--R--------------LQQYWQEYKQQNGEAV------------
A0A1C5MS04      ILFNGLPPKSKDCNY--R--------------LQQYWQEYKQQNGEAV------------
A0A3C1J150      ILFNGLPPKSKDCNY--R--------------LQQYWQEYKQQNGEAV------------
A0A416CXD7      ILFNGLPPKSKDCNY--R--------------LQQYWQEYKQQNGEAV------------
A0A6N2X662      ILFNGLPPKSKDCNY--R--------------LQQYWQEYKQQNGEAV------------
R6XBL9          ILFNGLPPKSKDCNY--R--------------LQQYWQEYKQQNGEAV------------
A0A355W5Z7      ILFNGLPPKSKDCNY--R--------------LQQYWQEYKQQNGEAV------------
A0A1G6BLB6      CVFNNVGGNRVSLTH--G--------------GQGYGEYGNYGYGRYHQYDHSEREGE--
A0A1C6G8M0      VVQNMVGSKKDSSYY--G--------------KGNYGYYYGNNQNKK-------------
A0A416MP73      VVQNMVGSKKDSSYY--G--------------KGNYGYYYGNYGNNQNKNKFTKAIVN--
A0A3E4LL92      GVLNMTKG---ERNI--S--------------KDRESYGKYYNENAK-KNAGE-------
A0A415D1L1      GVLNMTKG---ERDT--S--------------KDRYGYSKYYKENAKIENAGE-------
A0A396G6S7      CILNGVTS---QNMA--G--------------SGHYGYGGHYGKRA--------------
A0A3E5A223      CILNGVTS---QNMA--G--------------SGHYGYGGHYGKRA--------------
R7D5E6          CILNGVTS---QNMA--G--------------SGHYGYGGHYGKRA--------------
A0A415HQH5      CILNGVTS---QNMA--G--------------SGHYGYGGHYGKRA--------------
A0A414W2C6      CILNGVTS---QNMA--G--------------SGHYGCGGHYGKRA--------------
A5ZNE7          CILNGVTS---QNMA--G--------------SGHYGCGGHYGKRA--------------
A0A395X821      CILNGVTS---QNMA--G--------------SGHYGYGGHYGKRA--------------
A0A1C5PY68      CILNGVTS---QNMA--G--------------SGHYGYGGHYGKRA--------------
A0A174CJF8      CILNGVTS---QNMA--G--------------SGHYGYGGHYGKRA--------------
A0A564SRR2      CILNGVTS---QNMA--G--------------SGHYGYGGHYGKRA--------------
A0A174R7V0      CILNGVTS---QNMA--G--------------SGHYGYGGHYGKRA--------------
A0A373MWV2      CVFGNVYPGFGERIG--G--------------SYGYGYGYGAYSRAER------------
A0A417CE88      CVFGNVYPGFGERIG--G--------------SYGYGYGYGAYSRAER------------
A0A416Y441      CVFGNVYPGFGERIG--G--------------SYGYGYGYGAYSRAER------------
A0A357GPJ7      CVFGNVYPGFGERIG--G--------------SYGYGYGYGAYSRAER------------
A0A396PAC1      CVFGNVYPGFGERIG--G--------------SYGYGYGYGAYSRAER------------
A0A416EYU4      CVFGNVYPGFGERIG--G--------------SYGYGYGYGAYSRAER------------
A0A416SCQ2      CVFGNVYPGFGERIG--G--------------SYGYGYGYGAYSRAER------------
A0A416TGN7      CVFGNVYPGFGERIG--G--------------SYGYGYGYGAYSRAER------------
A0A417SMF6      CVFGNVYPGFGERIG--G--------------SYGYGYGYGAYSRAER------------
A0A0H5SF45      FVLNGSALTQENKSK--S--------------SYYYYQRNND------------------
A0A1M6JRJ5      FVLNGISEKELGGHK--S--------------KYYYSTKKNKNNGIVH------------
A0A1M7Y1S2      VVLNGISERDLGGYK--S--------------KYYYYNPDNK------------------
A0A7I8DMN1      FVLNGISEKGLGKYK--S--------------KYYYYDSESDVNKKKKKLEQKL------
A0A1Y4MW77      YVFNGDSFTFRDYSR--Y--------------GYRYYNKYGYRHYSYYNNEKKAAK----
A0A6S6R676      FVLNGVAHNSGKSYK--S--------------RYYYYNAGNNDD----------------
A0A0K8J554      FVINGITFKQGE--K--S--------------KSKYYYNVNQDD----------------
A0A1I0RG99      FVLNGISLNQQE--R--S--------------KYRYYN----------------------
A0A1I5G322      FILNGISLNQEK--K--S--------------KYHYYYYNNYND----------------
A0A7C6IYW8      FILNNVSVNQGK--K--F--------------NYYYSHYGAKND----------------
A0A7C6JZF1      FIINGSSRNQGK--R--S--------------KSYYYYQGKNG-----------------
A0A3N1XSX6      FVINGVSINQTK--K--S--------------KYYYYQYGDSND----------------
A0A839K1C1      FVLNDVSINRGK--K--L--------------NYYYSHYGASHD----------------
R6UHV6          CVYNDAENVSIVGRG--S--------------VY-SDYQYGKYGYGKYGKYGSTAE----
A0A3R9Q621      FVLNGVIRKQGLKSK--S--------------GYYYRSKDD-------------------
A0A069RC75      AIFNRA-----SEAS--S--------------YYSYYGK---------------------
A0A174F2W5      CVFGNVYPGFGERIG--G--------------SYGYGYGYGAYSRAER------------
A0A174S8E9      CVFGNVYPGFGERIG--G--------------SYGYGYGYGAYSRAER------------
A0A416ZL97      CVFGNVYPGFGERIG--N--------------SYGYGYGYGTYSRAER------------
A0A174LSK1      CVFGNVYPGFGERIG--N--------------SYGYGYGYGTYSRAER------------
A0A373GY92      CVFGNVYPGFGERIG--N--------------SYGYGYGYGTYSRAER------------
A0A373NZQ6      CVFGNVYPGFGERIG--N--------------SYGYGYGYGTYSRAER------------
A0A417I9B9      CVFGNVYPGFGERIG--N--------------SYGYGYGYGTYSRAER------------
A0A417WQF8      CVFGNVYPGFGERIG--N--------------SYGYGYGYGTYSRAER------------
A0A8B3CFR3      CVFGNVYPGFGERIG--N--------------SYGYGYGYGTYSRAER------------
A0A373RZ83      CVFGNVYPGFGERIG--N--------------SYGYGYGYGTYSRAER------------
A0A416U6I1      CVFGNVYPGFGERIG--N--------------SYGYGYGYGTYSRAER------------
R7JQZ9          CVFGNVYPGFGERIG--N--------------SYGYGYGYGTYSRAER------------
A0A1M5UYN6      VVLNKIEF---SKGK--G--------------YW-YNYEYYYSYGSSNKHKNTKSKRLKQ
A0A176JBT8      AILNEKKT---HKSN--P--------------HYYYGGYMG-------------------
A0A1I5HIC6      AVLNKANI---YGKG--Y--------------KKNYYGKYYGR-----------------
A0A1Y3TC51      FVLNAFHR---EWSR--P--------------AGRQEYSYGRAYRSQDMPGEGLTGRSGE
A0A1Y3T1N0      FILNAFHR---DWIS--Q--------------SSGYGYDY---------------GNYGK
A0A1Y3Y8U8      FILNAFHR---DWIS--Q--------------SSGYGYDY---------------GDYGK
A0A5B0BQY5      SVLNGNKK---GLNR--H--------------S---------------------------
A6CLL4          VILNKTKK---EKSQ--T--------------YY-Y------------------------
A0A176U8D6      VVQNMVGS---KKDS--S--------------YYGKGNYGYYYGNYGNNQNKK-------
A0A1Q6KSQ5      VVQNMVGS---KKDS--S--------------YYGKGNYGYY---YGNNQNKK-------
A0A3D3U8B3      VVQNMVGS---KKDS--S--------------YY--------------------------
A0A3E5FRL7      FALNMFID---NDSH--H--------------ND-YGYSYYDYKTHRHESR---------
A0A1Y4QK93      FALNMFID---DEIR--H--------------ND-YGYSYYDYKNHRHESR---------
B1C232          FALNMFID---DEIR--H--------------ND-YGYSYYDYKTHRHESR---------
A0A401USI6      IVLNKVDK---RSFI--G--------------YG-YDYYSYDKEKSSRLRNKSGRKKRNN
A0A1V4IQ10      TVLHRTEY---NKDT--Y-----------------YYSSHSSSSNTIKSLLG--------
A0A1S8TRD2      TVLHRTEY---NKDT--Y-----------------YYRSHGSSNKITRSLLG--------
G7M1U2          TVLHRTEY---NKDT--Y-----------------YYRSHGSSNKTTRSLLG--------
A0A2T6KJ75      TIINKSKG---SVRS--Y--------------SY-YN-----------------------
A9KN92          AVLNKANI---YGVG--Y--------------NKKYYGKYYSHVYANDYDENGN------
A0A352MUJ1      IVINKVQD---DKAS--K--------------GN-YYYMNESDIKRRKTRSRR-------
R5YI67          IVINKVQD---EKSS--K--------------GN-YYYMNEEDIKRKKRKRSEHH-----
A0A174DL89      VVLNNSPL---DSSV--N--------------YY-YQ-----------------------
A0A1Y0IQP5      AVLNGKKR---KGKE--Q--------------TYSYYASPAGDRDD--------------
A0A4R2R7B1      AVLNGKQR---KRSE--P--------------AYSYYAAPEGDPHD--------------
A0A1M6E8I2      SVLNIIPT---NHSK--G--------------YNSYYYYYEESET---------------
A0A7C6SMH0      AVLTKIDF---RKTS--Y--------------YG-YSYSYKYD-----------------
A0A7X7XYM7      AVLTKIDF---RKTS--Y--------------YG-YSYSYKYD-----------------
A0A3B8KKL6      AVLTKIDF---RKTS--Y--------------YG-YSYSYQYD-----------------
A0A2K9E6R0      AVLTKIDF---RKTS--Y--------------YG-YSYSYQYD-----------------
A0A2S8RBI0      AVLTKIDF---RKTS--Y--------------YG-YSYSYQYD-----------------
A0A7X8MFK9      AVLTKIEI---SRTG--Y--------------YN-YKYE---------------------
A0A7X9D1M8      AVLTKIEA---GRTG--Y--------------YY-YKYE---------------------
A0A0L6JLG6      IVMTKIDS---RSAY--Y--------------HY-YKYE---------------------
A0A7X8PYA7      TVLTKMDT---GRGN--Y-----------------YNYEYK-------------------
G8LSN0          TVLTKLDI---GRAR--Y--------------YS-YNYEYK-------------------
A0A1Y4N105      FILNAFHR---SIFS--N--------------DS-YSHYGDYQRRTTSNLHK--------
A0A1Y4QP75      FILNAFHR---SIFS--N--------------DS-YSHYGDYQRRTTSNLHK--------
A0A3D4QRB5      SVINDIPL---DTLV--G-----------------YGSYYYYYGSDSDGKGKKSRNKKRR
A0A349DEH5      CIFNADTS---NVSK--T--------------GR-YGKRYGHYGKSGR--YGYGSYGYGY
A0A3D4T7B4      CIFNADTS---NVSK--T--------------GR-YGKRYGHYGKSGR--YGYGSYGYGY
A0A350XYC7      CVFNADTS---NVSN--S--------------SR-YGRHYGKKGT-----YGYGGYG-GY
R6DNR8          CIFNADTS---NLSK--S--------------SR-YGRRYGHYGKSGRYGYGYGSYGYGY
A0A355KUM5      CIFNADTS---NLSK--T--------------SR-YGRRYG-------------------
R5YGY6          CIFNADTS---NLSK--T--------------SR-YGRRYGGYGK--RYGYGSYGYGYGQ
A0A7G9WCY6      VVVNKVKI---TKRN--Y--------------GTYYNYYYAEEK----------------
A0A0A5GPA9      VVLNRGVK---ETNA--H--------------YY-Y------------------------
A0A271M6M4      VVLNSGKE---SKRT--S--------------YY-Y------------------------
A0A1C6G0U3      CIVNKENI---KKGN--Y--------------YY--------------------------
A0A3D4LLB3      AVFNNIPV---SKQN--N--------------YY-YYKSYC-------------------
A0A7C7AD93      ALLNKVPD---SKLY--R--------------KYGYYYG---------------------
A0A2V3W8U6      AIINKKKE---RKND--I--------------NY-YHYGTR-------------------
A0A6N3BXA1      CILNKFDA---KSVS--Y---------------YNYSNYSYYYGE---------------
A0A351SRI8      IVLNRTDT---NKSK------------------Y-YGHYYQ-------------------
A0A1V5LU59      AILTKLNT---GRGS------------------Y-YSYKYK-------------------
A0A7X8R9W1      VVLTKIDN---KRIS--Y---------------YSYSYKYE-------------------
A0A1E3BVC3      AVLTKLDT---ERTG------------------Y-YSYKYE-------------------
A0A4Q0I6S0      AVLTKLDT---ERTG------------------Y-YSYKYE-------------------
A3DF66          AVLTKLDT---ERTG--Y---------------Y-YSYKYE-------------------
W4V1T8          AVLTKLDT---ERTG------------------Y-YSYKYD-------------------
A0A1C6ITD7      VLLNNSPI---NSSS--N--------------YY-YKE----------------------
A0A381IX63      CILNKFDY---KNHN--E--------------YE-YYGYYYSAEGNKRKKRKNK------
A0A1M6RWV2      VLVNKVNI---EKRR--Y--------------QY-YYYYLED------------------
A0A841ZT34      IVKNKVQM---QEET--S--------------NY-YL-----------------------
A0A1G9IUT4      SIFNKSSL---YKSE--C---------------Y-YGYYYENE-----------------
A0A842GR80      ILQNKVKM---KGQS--S---------------Y-YM-----------------------
A0A7X0TNH3      ILQNKVKM---KGQS--S---------------Y-YM-----------------------
A0A842D596      ILQNKVKM---KGQS--S---------------Y-YM-----------------------
A0A842EQ86      ILQNKVKM---KGQS--S---------------Y-YM-----------------------
A0A842A220      ILQNKVKM---KGQS--S---------------Y-YM-----------------------
A0A7X0YM80      ILQNKVKM---KGQS--S---------------Y-YM-----------------------
A0A842GEL5      ILQNKVKM---KGQS--S---------------Y-YM-----------------------
A0A841XVD7      ILQNKVKM---KGQS--S---------------Y-YM-----------------------
A0A7X0XME5      ILQNKVKM---KGQS--S---------------Y-YM-----------------------
A0A842B6T1      ILQNKVKM---KGQS--S---------------Y-YM-----------------------
A0A841X7G0      ILQNKVKM---KGQS--S---------------Y-YM-----------------------
A0A841W3M8      ILQNKVKM---KGQS--S---------------Y-YM-----------------------
A0A7X0XVI0      ILQNKVKM---KGQS--S---------------Y-YM-----------------------
A0A7X0Z1K1      ILQNKVKM---KGQS--S---------------Y-YM-----------------------
A0A143ZUX1      CVFNGVARPNRLLG------------------YGRYSSYY------------------YD
A0A7I8D809      CVFNGVARPNRLLG------------------YGRYSSYY------------------YD
A0A3R9WAA7      CVLNNVRHM-----------------------PAGYGYGYGYYGKYG-----------RK
A0A1G6BLF1      CLLNGAEVGLTGTGYSKSYS------------YARYGYGHGEKR--------------YG
A0A355G1X5      CVYNNTANRDGLLGL-----------------YSKSSYGYKSYHSYG-----------YG
A0A1W2CEA6      CILNKTAVSR----------------------IGKSGYSYYYG---------------GK
A0A355G3J9      FVVIGVDFKV-----------EQYGRYKRYGKYGYRSYRYSKEYGYKK---------KYD
A0A3D2AD87      AVMNGSHPKN------------KNKYIYRKYSYGYYGSYYKYDYHKN----------GYN
A0A143XN92      GIFNNAYSNIL---------------------ERIGMEQYGRKTSY--------------
R7FFK6          FVLNEVVHKH----------------------SAGYYSNYKYKYKY-----------KYD
A0A373MPB9      FVLNDISAKN----------------------GSHYGYKYSYKYKY-----------DYS
A0A373L519      FVLNDISAKN----------------------GSHYGYKYSYKYKY-----------DYS
A0A373W906      FVLNDISAKN----------------------GSHYG----YKYKY-----------DYS
A0A373VCW2      FVLNDISAKN----------------------GSHYGYKYSYKYKY-----------DYS
W0U604          FVLNDISAKN----------------------GSHYGYKYSYKYKY-----------DYS
A0A374B6G0      FVLNDISAKN----------------------GSHYGYKYSYKYKY-----------DYS
A0A373VM36      FVLNDISAKN----------------------GSHYGYKYSYKYKY-----------DYS
A0A1C5P379      FVLNDISAKN----------------------GSHYRYKYSYKYKY-----------DYS
A0A373XXX0      FVLNDISAKN----------------------GSHYG----YKYKY-----------DYS
A0A5R9MJM9      FVLNDISAKN----------------------GSHYGYKYNYKYKY-----------DYS
A0A356CW82      FVLNDISTKN----------------------GSHYGYKYNYKYKY-----------DYS
R6T4X7          FVLNDISAKN----------------------GSHYGYKYSYKYKY-----------DYS
A0A374HTV1      FVLNDISAKN----------------------GSHYGYKYSYKYKY-----------DYS
A0A374GB66      FVLNDISAKN----------------------GSHYGYKYSYKYKY-----------DYS
A0A374ECC6      FVLNDISAKN----------------------GSHYGYKYSYKYKY-----------DYS
A0A374BM61      FVLNDISAKN----------------------GSHYGYKYSYKYKY-----------DYS
A0A373UGZ4      FVLNDISAKN----------------------GSHYGYKYSYKYKY-----------DYS
A0A373SA66      FVLNDISAKN----------------------GSHYGYKYSYKYKY-----------DYS
A0A1C5X6X7      FVLNDISAKN----------------------GSHYGYKYSYKYKY-----------DYS
A0A1C6JIH3      FVLNDISAKN----------------------GSHYGYKYSYKYKY-----------DYS
A0A373PSC3      FVLNDISAKN----------------------GSHYGYKYNYKYKY-----------DYS
A0A1K1WYK8      FVLNDVHHNH----------------------GANYYNY---KYKYKKYGYGYGSY-GYG
A0A1H6IUB1      FIMNDIKMKK----------------------SGYYSSKYKGKYYYKK-GYGYGGYGGY-
A0A1M7L1F9      FIMNDVKIKK----------------------AGYY-SKYKNKYYYKK-GYGYGGY-GY-
A0A1C6B4L6      FILNSIKNKR----------------------SGRYYSKY--KYDYKR-G--Y----GY-
A0A1Q6T9P4      FILNGIKNKR----------------------SGRYYSKY--KYDYKR-G--Y----GY-
A0A315Y4F9      FILNGVKSKH----------------------AG-YYSK------YGK-GKYY----GY-
A0A354K620      FIMNGINTKR----------------------AG-YYAKG--KYYYKK-GYGY----GY-
A0A173ZYY6      VVLNGVRSFSGLV-------------------DSPVGHYYGKYSKYG-------------
A0A6L8RXB5      VVLNGVRSFSGLV-------------------DSPVGHYYGKYSKYG-------------
A0A173SMI2      VVLNGVRSFSGLV-------------------DSPVGHYYGKYSKYG-------------
A0A845KKD0      VVLNGVRSFSGLV-------------------DSPVGHYYGKYSKYG-------------
A0A6N9JW85      VVLNGVRSFSGLV-------------------DSPVGHYYGKYSKYG-------------
A0A174ASH7      VVLNGVRSFSGLV-------------------DSPVGHYYGKYSKYG-------------
A6BH65          VVLNGVRSFSGLV-------------------DSPVGHYYGKYSKYG-------------
R7G0D7          VVLNGVRSFSGLV-------------------DSPVGHYYGKYSKYG-------------
R6HZX3          YVINGRPTR----------RGRGYGYGYDRYGYGKYGYG-------------------TK
R5EFZ0          CVLNNVYATQLST------GQSYGGYSKYSH-YGHYGN--------------------YG
A0A3E5FSY5      YVFNIYTKKSS-------------------E-YGHYSYGYNQ----------------YR
A0A1V5S3C0      CIYNNARRGILSMA-----GDTRGGY----F-SRSYSYSYSKS---------------YG
A0A3C0QME1      FVVNNI-------------SRKGSGH-YYSY-KYKYKYRY-KSYEYH-----------YV
A0A355FYK5      AVFTMN-------------DEESRGRILNKG-GSGSRY---YKRYYR-----------YG
A0A357AQU0      VILNAV-------------AGSSTGYGYKKY-GYKYGYKYGYKYGYR-----------YG
A0A3C1YJQ7      VILNAV-------------AGSSTGYGYKKY-GYKYGYKYGYKYGYR-----------YG
A0A3D0JG38      VILNAV-------------AGSSTGYGYKKY-GYKYGYKYGYKYGYR-----------YG
A0A3C0IHX1      LVLTEV-------------DFKQGGY-YKKY-YKKGSY-------YT-----------YG
R5V506          LVLTEV-------------DFKQGGY-YKKY-YKKGSY-------YT-----------YG
A0A352TIU5      LVLTEV-------------DFKQGGY-YKKY-YKKGSY-------YT-----------YG
R5B467          YTLNACAGR----------SHGGYGYGFGYG-YGGYGYGYGYGG--------------YG
A0A1Y3TC98      YVFNNFPEGPGEY------GYSRYGYGRYG--YGKYGYGRYGYGKYGY----------GR
A0A1W1Z4C3      FVFY---------------GENIHQGRYYSK-RSQRGYQYYNKYDTRIQASSQ----KLS
A0A239QN83      FVFY---------------GEKLHQGKYYSK-RSQRGYEYYNKYDTRSRVIG--------
A0A8A5CVI3      FVFY---------------GEKLHQGKYYSK-RSQRGYEYYNKYDTRSRVVG--------
A0A8A5D3H1      FVFY---------------GEKLHQGKYYSK-RSQRGYEYYNKYDTRSRIAG--------
A0A1Q6REE0      CALNNVRRGLS--------GSKEYGYG--------YGYGYGYGY---------------G
R5ETF9          CALNNVRKSLS--------GSKEYGYG--------YGYGYGYGY---------------G
A0A0F2P7X6      CILNGIK------------YNQLGAFYQSQN-YERFLGDYYKDYALT-----------NK
A0A359B487      CILNGIK------------YNQLGAFYQSRN-YERFLGDYYKNYALT-----------NK
R6VAT5          CIFNMASGVLSTRGYGRYGYNSYGGYGSYGS-YGRYGYGYGQYG--------------DY
D4LC36          FAVNEV--------------SSKHGSG-----Y-YSNYKYKYKYKYD-----------YQ
A0A7X3IXX7      AVLNLAPARGV--------GSSHYGFG-----YGGYRRGYSSYYGET-----------KK
A0A1Q6S448      CILNDMAHLTA--------YSAGYGYG-----CGYYGYGYGKKY--------------DK
A0A351MYR0      CILNDMSHLTA--------YSAGYGYG-----YGYYGYGYGKKY--------------DK
R6HPC1          CILNDMAHLTA--------YSAGYGYG-----YGYYGYGYGKKY--------------DK
A0A3D4G5Z5      CILNDMVHLTA--------YSAGYGYG-----YGYYGYGYGKKY--------------DK
A0A3D5ES03      CILNDMAHLTA--------YSAGYGYG-----YGYYGYGYGKKY--------------DK
A0A348P5V4      CIFN----------NSENGMSN----------SKIYGRKYG-----------------YG
A0A356PT74      CIYN----------DTESGMPKRFMSS---Y-NKKYGYGYG-----------------YG
A0A3D5LL19      CIYN----------DTESGMPKRFMSS---Y-NKKYGYGYG-----------------YG
R5MNF0          CIYN----------DTESGMPNRFMSS---Y-NKKYGYGYG-----------------YG
A0A1Q9JSI0      CVYN-------DVFPGFAETAKAYGYK---Y-GYGYGYGYGYG--YGSYGYGG----KYG
A0A3D5TNI1      CVYNISTDRSRGGYGSYSVSRRRYGYG---Y-GRHYGYGYGKH--YG-----------YG
A0A358LJD0      CVYNISTDRSKGGYGNYSISRRRYG----------YGYSYGKRYGYG-----------YG
R6I3L7          CVYNISTDRSKGGYGNYSISRRGYG----------YGYGYGKH--YG-----------YG
A0A3D1HXX0      CVYNISTDRSKGGYGNYSISRRRYG----------YGYGYGKH--YG-----------YG
A0A3D2QJB8      CVYNISTDRSKGGYGNYSISSRRYG----------YGYGYGKH--YG-----------YG
R7MQJ4          FILN-----------DISKKHGSYS---------KYGYNYKSH--YY-----------DS
A0A1V5GLC0      FILN-----------GI--KIKKNG---------KYYSNYK----YR-----------SV
W7V182          FILN-----------DI--KTGRSG---------KYYSKYR----YD-----------KG
A0A143XPI5      YVLNAVESGIM-----------SYGY---------YAYRYGYYHK----GYRYYSINNKD
A0A0M6WXE3      VVLNGVMTFQSIADSPVGDH---------------------YSRYSRYGRYG--------
A0A348SAK2      VVLNGVMTFQSIADSPVGDH---------------------YSRYSRYGRYG--------
A0A1G9H5B9      FVFYGEHMHES-------------GYYS-----RKYYRKYYKNYYSKRTTRGSTLGSNLE
A0A1Y4H8L0      VVLNRVQSFENLTAQTVGRYAGRYGYGY----GYGYG------------AYA-------Q
A0A4B9BMD9      AILNGVIKRAS----------------T----AYSYGYNY--------------------
A0A0M6WYQ8      YVLNRDRSTGG-------------GYGY----GYGYYGRYRYGRYGRYGRYG--------
A0A348SAK1      YVLNRDRSTGG-------------GYGY----GYGYYGRYRYGRYGRYGRYG--------
A0A252F281      CVYNDKHTSPLSRLPIYGKYADYYGYRG----YYG--------------NYG--------
A0A1Y4QKE6      YVFNIYTKKSS-----------------------------EYGHHSY--GYN-------R
B1C231          YVFNIYTKKSS-----------------------------EYGHYSY--GYN-------Q
A0A7V6WIR4      TVLNRVRIKNR---------------------------EYYYDYPGIEKG----------
A0A1Y3TUL5      CIVNRV---------------------------KTLGDKL-NNNYNYE-SEGSASRRGRG
A0A1Y4JAX2      CIVNRV---------------------------KTLGDKL-NNNYNYE-SEGSASRRGRG
A0A1Y4T590      CIVNRV---------------------------KTLGDKLNNNNYNYE-SEGSASRRGRG
A0A1Y3T163      YVFNSYPESVS-----------EYGYGR-----YGYG---RYGRY----GYG-------K
A0A1Y3YCA2      YVFNSYPESVS-----------EYGYGR-----YGYG---RYGRY----GYG-------K
A0A7W8H9H2      YVFNSVPVHHN-----------GYGY-------YGYG-RYGYGYY----GYG-------K
A0A1Y4L6N9      YVFNGIKVGHS-----------GYGYGY----GYGYGYNYGYGYR----RDG-------E
A0A173T644      YAFNGVPLHKG-----------RYGY-------YGYG-RYGYGY------YG-------K
A0A1C5TSB8      YAFNGVPLHKG-----------RYGY-------YGYG-RYGYGY------YG-------K
C0CIK6          YAFNGVPLHKG-----------RYGY-------YGYG-RYGYGY------YG-------K
A0A1Y3WEF6      YVFNGVPVHRG-----------GYGY-------YGYG-RYGYGYY----GYG-------S
A0A417T0L2      YVFNGVPVHRG-----------GYGY-------YGYG-RYGYGYY----GYG-------S
A0A1H9EPU3      VALNKV--------PMDKGKGYYGKYYG----GY-YGGYYGYGNY----SYG--------
A0A354IGV3      CILNDVY-GMPFPLSLLDNDSYSYGYGD----LHNYGRYRKYGKYGKYGGYGRYGGYGRY
A0A417JMV2      CVYNDVFHGVA---QTARNYGYKYAYGS----GYGYGSKYGYGNHGY--GYG----YGYG
A0A415VWX5      CVYNDVFHGVA---QTARNYGYKYAYGS----GYGYGNKYGYGNH----GYG----YGYG
A0A173UY96      CVYNDVFHGVA---QTARNYGYKYAYGS----GYGYGSKYGYGNHGY--GYG----YGYG
B0P408          CVYNDVFHGVA---QTARNYGYKYAYGS----GYGYGNKYGYGNHGY--GYG----YGYG
D4MV82          CVYNDVFHGVA---QTARNYGYKYAYGS----GYGYGNKYGYGNHGY--GYG----YGYG
A0A173QTL1      CVYNDVFHGVA---QTARNYGYKYAYGS----GYGYGSKYGYGNHGY--GYG----YGYG
A0A174J359      CVYNDVFHGVA---QTARNYGYKYAYGS----GYGYGSKYGYGNH----GYG----YGYG
A0A174A3T7      CVYNDVFHGVA---QTARNYGYKYAYGS----GYGYGNKYGYGNHGY--GYG----YGYG
A0A417UUA3      CVYNDVFHGVA---QTARNYGYKYAYGS----GYGYGSKYGYGNH----GYG----YGYG
A0A6N2VB70      CVYNDVFHGVA---QTARNYGYKYAYGS----GYGYGSKYGYGNHGY--GYG----YGYG
A0A1C6EUV9      CVYNDVFHGIA---QTARNYGYRYAYGS----GSSYGYGYGYGSK-Y--GYGGKYGYGYG
A0A173Y645      CVYNDVFHGIA---QTARNYGYRYAYGS----GSSYGYGYGYGNK-Y--GYGGK--YGYG
A0A374AVY6      CVYNDVFHGIA---QTARNYGYRYAYGS----GSSYGYGYGYGNK-Y--G------YGYG
R7BXS4          CVYNDVFHGIA---QTARNYGYRYAYGS----GSSYGYGYGYGNK-Y--G------YGYG
                                                                            

S3FFL2          ------------------------------------------------------------
A0A328M4V1      ------------------------------------------------------------
A0A6A8IF17      ------------------------------------------------------------
A0A143WVN6      ------------------------------------------------------------
W6RXP9          ------------------------------------------------------------
W6S4G8          ------------------------------------------------------------
A0A3D5R4X5      ------------------------------------------------------------
A0A1I4C3N6      ------------------------------------------------------------
A0A3B9CIM7      ------------------------------------------------------------
A0A7R7IBN8      ------------------------------------------------------------
A0A1G9WHW8      ------------------------------------------------------------
A0A1H5VAA0      ------------------------------------------------------------
A0A3R6VK11      ------------------------------------------------------------
A0A3R6QUY7      ------------------------------------------------------------
A0A373K3P9      ------------------------------------------------------------
A0A3R6JRU5      ------------------------------------------------------------
A0A1C5MS04      ------------------------------------------------------------
A0A3C1J150      ------------------------------------------------------------
A0A416CXD7      ------------------------------------------------------------
A0A6N2X662      ------------------------------------------------------------
R6XBL9          ------------------------------------------------------------
A0A355W5Z7      ------------------------------------------------------------
A0A1G6BLB6      ------------------------------------------------------------
A0A1C6G8M0      ------------------------------------------------------------
A0A416MP73      ------------------------------------------------------------
A0A3E4LL92      ------------------------------------------------------------
A0A415D1L1      ------------------------------------------------------------
A0A396G6S7      ------------------------------------------------------------
A0A3E5A223      ------------------------------------------------------------
R7D5E6          ------------------------------------------------------------
A0A415HQH5      ------------------------------------------------------------
A0A414W2C6      ------------------------------------------------------------
A5ZNE7          ------------------------------------------------------------
A0A395X821      ------------------------------------------------------------
A0A1C5PY68      ------------------------------------------------------------
A0A174CJF8      ------------------------------------------------------------
A0A564SRR2      ------------------------------------------------------------
A0A174R7V0      ------------------------------------------------------------
A0A373MWV2      ------------------------------------------------------------
A0A417CE88      ------------------------------------------------------------
A0A416Y441      ------------------------------------------------------------
A0A357GPJ7      ------------------------------------------------------------
A0A396PAC1      ------------------------------------------------------------
A0A416EYU4      ------------------------------------------------------------
A0A416SCQ2      ------------------------------------------------------------
A0A416TGN7      ------------------------------------------------------------
A0A417SMF6      ------------------------------------------------------------
A0A0H5SF45      ------------------------------------------------------------
A0A1M6JRJ5      ------------------------------------------------------------
A0A1M7Y1S2      ------------------------------------------------------------
A0A7I8DMN1      ------------------------------------------------------------
A0A1Y4MW77      ------------------------------------------------------------
A0A6S6R676      ------------------------------------------------------------
A0A0K8J554      ------------------------------------------------------------
A0A1I0RG99      ------------------------------------------------------------
A0A1I5G322      ------------------------------------------------------------
A0A7C6IYW8      ------------------------------------------------------------
A0A7C6JZF1      ------------------------------------------------------------
A0A3N1XSX6      ------------------------------------------------------------
A0A839K1C1      ------------------------------------------------------------
R6UHV6          ------------------------------------------------------------
A0A3R9Q621      ------------------------------------------------------------
A0A069RC75      ------------------------------------------------------------
A0A174F2W5      ------------------------------------------------------------
A0A174S8E9      ------------------------------------------------------------
A0A416ZL97      ------------------------------------------------------------
A0A174LSK1      ------------------------------------------------------------
A0A373GY92      ------------------------------------------------------------
A0A373NZQ6      ------------------------------------------------------------
A0A417I9B9      ------------------------------------------------------------
A0A417WQF8      ------------------------------------------------------------
A0A8B3CFR3      ------------------------------------------------------------
A0A373RZ83      ------------------------------------------------------------
A0A416U6I1      ------------------------------------------------------------
R7JQZ9          ------------------------------------------------------------
A0A1M5UYN6      KSI---------------------------------------------------------
A0A176JBT8      ------------------------------------------------------------
A0A1I5HIC6      ------------------------------------------------------------
A0A1Y3TC51      HTARGE-RG---------------------------------------------------
A0A1Y3T1N0      NIRRGDQRG---------------------------------------------------
A0A1Y3Y8U8      NIRRGDQRG---------------------------------------------------
A0A5B0BQY5      ------------------------------------------------------------
A6CLL4          ------------------------------------------------------------
A0A176U8D6      ------------------------------------------------------------
A0A1Q6KSQ5      ------------------------------------------------------------
A0A3D3U8B3      ------------------------------------------------------------
A0A3E5FRL7      ------------------------------------------------------------
A0A1Y4QK93      ------------------------------------------------------------
B1C232          ------------------------------------------------------------
A0A401USI6      NEKPNPINI---------------------------------------------------
A0A1V4IQ10      ------------------------------------------------------------
A0A1S8TRD2      ------------------------------------------------------------
G7M1U2          ------------------------------------------------------------
A0A2T6KJ75      ------------------------------------------------------------
A9KN92          ------------------------------------------------------------
A0A352MUJ1      ------------------------------------------------------------
R5YI67          ------------------------------------------------------------
A0A174DL89      ------------------------------------------------------------
A0A1Y0IQP5      ------------------------------------------------------------
A0A4R2R7B1      ------------------------------------------------------------
A0A1M6E8I2      ------------------------------------------------------------
A0A7C6SMH0      ------------------------------------------------------------
A0A7X7XYM7      ------------------------------------------------------------
A0A3B8KKL6      ------------------------------------------------------------
A0A2K9E6R0      ------------------------------------------------------------
A0A2S8RBI0      ------------------------------------------------------------
A0A7X8MFK9      ------------------------------------------------------------
A0A7X9D1M8      ------------------------------------------------------------
A0A0L6JLG6      ------------------------------------------------------------
A0A7X8PYA7      ------------------------------------------------------------
G8LSN0          ------------------------------------------------------------
A0A1Y4N105      ------------------------------------------------------------
A0A1Y4QP75      ------------------------------------------------------------
A0A3D4QRB5      AQHSA-------------------------------------------------------
A0A349DEH5      GQSKK-------------------------------------------------------
A0A3D4T7B4      GQSKK-------------------------------------------------------
A0A350XYC7      GQSSK-------------------------------------------------------
R6DNR8          GQSKK-------------------------------------------------------
A0A355KUM5      ------------------------------------------------------------
R5YGY6          SSSKK-------------------------------------------------------
A0A7G9WCY6      ------------------------------------------------------------
A0A0A5GPA9      ------------------------------------------------------------
A0A271M6M4      ------------------------------------------------------------
A0A1C6G0U3      ------------------------------------------------------------
A0A3D4LLB3      ------------------------------------------------------------
A0A7C7AD93      ------------------------------------------------------------
A0A2V3W8U6      ------------------------------------------------------------
A0A6N3BXA1      ------------------------------------------------------------
A0A351SRI8      ------------------------------------------------------------
A0A1V5LU59      ------------------------------------------------------------
A0A7X8R9W1      ------------------------------------------------------------
A0A1E3BVC3      ------------------------------------------------------------
A0A4Q0I6S0      ------------------------------------------------------------
A3DF66          ------------------------------------------------------------
W4V1T8          ------------------------------------------------------------
A0A1C6ITD7      ------------------------------------------------------------
A0A381IX63      ------------------------------------------------------------
A0A1M6RWV2      ------------------------------------------------------------
A0A841ZT34      ------------------------------------------------------------
A0A1G9IUT4      ------------------------------------------------------------
A0A842GR80      ------------------------------------------------------------
A0A7X0TNH3      ------------------------------------------------------------
A0A842D596      ------------------------------------------------------------
A0A842EQ86      ------------------------------------------------------------
A0A842A220      ------------------------------------------------------------
A0A7X0YM80      ------------------------------------------------------------
A0A842GEL5      ------------------------------------------------------------
A0A841XVD7      ------------------------------------------------------------
A0A7X0XME5      ------------------------------------------------------------
A0A842B6T1      ------------------------------------------------------------
A0A841X7G0      ------------------------------------------------------------
A0A841W3M8      ------------------------------------------------------------
A0A7X0XVI0      ------------------------------------------------------------
A0A7X0Z1K1      ------------------------------------------------------------
A0A143ZUX1      YRESDS------------------------------------------------------
A0A7I8D809      YRESDS------------------------------------------------------
A0A3R9WAA7      SYYGKN------------------------------------------------------
A0A1G6BLF1      YGYGGY------------------------------------------------------
A0A355G1X5      YGFEDD------------------------------------------------------
A0A1W2CEA6      NGYGKQ------------------------------------------------------
A0A355G3J9      RSYESY------------------------------------------------------
A0A3D2AD87      YDYTSK------------------------------------------------------
A0A143XN92      ------------------------------------------------------------
R7FFK6          YQYRTE------------------------------------------------------
A0A373MPB9      YKYGGK------------------------------------------------------
A0A373L519      YKYGGK------------------------------------------------------
A0A373W906      YKYGGK------------------------------------------------------
A0A373VCW2      YKYGGK------------------------------------------------------
W0U604          YKYGGK------------------------------------------------------
A0A374B6G0      YKYGGK------------------------------------------------------
A0A373VM36      YKYGGK------------------------------------------------------
A0A1C5P379      YKYGGK------------------------------------------------------
A0A373XXX0      YKYGGK------------------------------------------------------
A0A5R9MJM9      YKYGGK------------------------------------------------------
A0A356CW82      YKYGGK------------------------------------------------------
R6T4X7          YKYGGK------------------------------------------------------
A0A374HTV1      YKYGGK------------------------------------------------------
A0A374GB66      YKYGGK------------------------------------------------------
A0A374ECC6      YKYGGK------------------------------------------------------
A0A374BM61      YKYGGK------------------------------------------------------
A0A373UGZ4      YKYGGK------------------------------------------------------
A0A373SA66      YKYGGK------------------------------------------------------
A0A1C5X6X7      YKYGGK------------------------------------------------------
A0A1C6JIH3      YKYGGK------------------------------------------------------
A0A373PSC3      YKYGGK------------------------------------------------------
A0A1K1WYK8      YTYGNN------------------------------------------------------
A0A1H6IUB1      --YGSK------------------------------------------------------
A0A1M7L1F9      --YGSK------------------------------------------------------
A0A1C6B4L6      --YGEK------------------------------------------------------
A0A1Q6T9P4      --YGEK------------------------------------------------------
A0A315Y4F9      --YGAK------------------------------------------------------
A0A354K620      --YGEK------------------------------------------------------
A0A173ZYY6      -RYGNY------------------------------------------------------
A0A6L8RXB5      -RYGNY------------------------------------------------------
A0A173SMI2      -RYGNY------------------------------------------------------
A0A845KKD0      -RYGNY------------------------------------------------------
A0A6N9JW85      -RYGNY------------------------------------------------------
A0A174ASH7      -RYGNY------------------------------------------------------
A6BH65          -RYGNY------------------------------------------------------
R7G0D7          -RYGNY------------------------------------------------------
R6HZX3          YGYGKN------------------------------------------------------
R5EFZ0          SSGSRK------------------------------------------------------
A0A3E5FSY5      YSKGGE------------------------------------------------------
A0A1V5S3C0      ADYGQE------------------------------------------------------
A0A3C0QME1      SHSEDSMTSTPKLSMREDAPQEVPAETKAVETTAPIEETPAEVVEESAPIEETPAEVVEE
A0A355FYK5      GKYGYG------------------------------------------------------
A0A357AQU0      YGYGNN------------------------------------------------------
A0A3C1YJQ7      YGYGNN------------------------------------------------------
A0A3D0JG38      YGYGNN------------------------------------------------------
A0A3C0IHX1      NGNGNG------------------------------------------------------
R5V506          NGNGNG------------------------------------------------------
A0A352TIU5      NENGNG------------------------------------------------------
R5B467          YGYGSG------------------------------------------------------
A0A1Y3TC98      YGYGSD------------------------------------------------------
A0A1W1Z4C3      QNDNRN------------------------------------------------------
A0A239QN83      ---DPD------------------------------------------------------
A0A8A5CVI3      ---DPD------------------------------------------------------
A0A8A5D3H1      ---DPD------------------------------------------------------
A0A1Q6REE0      YGYGSK------------------------------------------------------
R5ETF9          YGYGSK------------------------------------------------------
A0A0F2P7X6      PAQEAA------------------------------------------------------
A0A359B487      PAQEAA------------------------------------------------------
R6VAT5          YGNEEN------------------------------------------------------
D4LC36          YGSAKQ------------------------------------------------------
A0A7X3IXX7      SSRGFR------------------------------------------------------
A0A1Q6S448      YGCGHR------------------------------------------------------
A0A351MYR0      YGYGHR------------------------------------------------------
R6HPC1          YGYGHR------------------------------------------------------
A0A3D4G5Z5      YGYGHR------------------------------------------------------
A0A3D5ES03      YGYGHR------------------------------------------------------
A0A348P5V4      YGYG--------------------------------------------------------
A0A356PT74      YGYGSN------------------------------------------------------
A0A3D5LL19      YGYGSN------------------------------------------------------
R5MNF0          YGYGSN------------------------------------------------------
A0A1Q9JSI0      YGYGKR------------------------------------------------------
A0A3D5TNI1      YGYGGH------------------------------------------------------
A0A358LJD0      YGYGGH------------------------------------------------------
R6I3L7          YGYGSH------------------------------------------------------
A0A3D1HXX0      YGYGSH------------------------------------------------------
A0A3D2QJB8      YGYGSH------------------------------------------------------
R7MQJ4          YGYGEE------------------------------------------------------
A0A1V5GLC0      YGYGND------------------------------------------------------
W7V182          YGYGVK------------------------------------------------------
A0A143XPI5      MELHNK------------------------------------------------------
A0A0M6WXE3      -RYGKY------------------------------------------------------
A0A348SAK2      -RYGKY------------------------------------------------------
A0A1G9H5B9      TARGST------------------------------------------------------
A0A1Y4H8L0      YANDRG------------------------------------------------------
A0A4B9BMD9      YGYSYS------------------------------------------------------
A0A0M6WYQ8      -GYRHY------------------------------------------------------
A0A348SAK1      -GYRHY------------------------------------------------------
A0A252F281      -KYGKS------------------------------------------------------
A0A1Y4QKE6      YGYVK-------------------------------------------------------
B1C231          YRYSKG------------------------------------------------------
A0A7V6WIR4      ------------------------------------------------------------
A0A1Y3TUL5      SSSGKS------------------------------------------------------
A0A1Y4JAX2      SSSGKS------------------------------------------------------
A0A1Y4T590      SSSGKS------------------------------------------------------
A0A1Y3T163      YGYGGG------------------------------------------------------
A0A1Y3YCA2      YGYGGG------------------------------------------------------
A0A7W8H9H2      YGYGKY------------------------------------------------------
A0A1Y4L6N9      YGDEKY------------------------------------------------------
A0A173T644      YGYGEQ------------------------------------------------------
A0A1C5TSB8      YGYGEQ------------------------------------------------------
C0CIK6          YGYGEQ------------------------------------------------------
A0A1Y3WEF6      YGYGER------------------------------------------------------
A0A417T0L2      YGYGKK------------------------------------------------------
A0A1H9EPU3      ------------------------------------------------------------
A0A354IGV3      GDYGAA------------------------------------------------------
A0A417JMV2      YGYGYG------------------------------------------------------
A0A415VWX5      YGYGYG------------------------------------------------------
A0A173UY96      YGYGYG------------------------------------------------------
B0P408          YGYGYG------------------------------------------------------
D4MV82          YGYGYG------------------------------------------------------
A0A173QTL1      YGYGYG------------------------------------------------------
A0A174J359      YGYGYG------------------------------------------------------
A0A174A3T7      YGYGYG------------------------------------------------------
A0A417UUA3      YGYGYG------------------------------------------------------
A0A6N2VB70      YGYGYG------------------------------------------------------
A0A1C6EUV9      YGYGRS------------------------------------------------------
A0A173Y645      YGYGRS------------------------------------------------------
A0A374AVY6      YGYGRS------------------------------------------------------
R7BXS4          YGYGRS------------------------------------------------------
                                                                            

S3FFL2          ------------------------------------------------------------
A0A328M4V1      ------------------------------------------------------------
A0A6A8IF17      ------------------------------------------------------------
A0A143WVN6      ------------------------------------------------------------
W6RXP9          ------------------------------------------------------------
W6S4G8          ------------------------------------------------------------
A0A3D5R4X5      ------------------------------------------------------------
A0A1I4C3N6      ------------------------------------------------------------
A0A3B9CIM7      ------------------------------------------------------------
A0A7R7IBN8      ------------------------------------------------------------
A0A1G9WHW8      ------------------------------------------------------------
A0A1H5VAA0      ------------------------------------------------------------
A0A3R6VK11      ------------------------------------------------------------
A0A3R6QUY7      ------------------------------------------------------------
A0A373K3P9      ------------------------------------------------------------
A0A3R6JRU5      ------------------------------------------------------------
A0A1C5MS04      ------------------------------------------------------------
A0A3C1J150      ------------------------------------------------------------
A0A416CXD7      ------------------------------------------------------------
A0A6N2X662      ------------------------------------------------------------
R6XBL9          ------------------------------------------------------------
A0A355W5Z7      ------------------------------------------------------------
A0A1G6BLB6      ------------------------------------------------------------
A0A1C6G8M0      ------------------------------------------------------------
A0A416MP73      ------------------------------------------------------------
A0A3E4LL92      ------------------------------------------------------------
A0A415D1L1      ------------------------------------------------------------
A0A396G6S7      ------------------------------------------------------------
A0A3E5A223      ------------------------------------------------------------
R7D5E6          ------------------------------------------------------------
A0A415HQH5      ------------------------------------------------------------
A0A414W2C6      ------------------------------------------------------------
A5ZNE7          ------------------------------------------------------------
A0A395X821      ------------------------------------------------------------
A0A1C5PY68      ------------------------------------------------------------
A0A174CJF8      ------------------------------------------------------------
A0A564SRR2      ------------------------------------------------------------
A0A174R7V0      ------------------------------------------------------------
A0A373MWV2      ------------------------------------------------------------
A0A417CE88      ------------------------------------------------------------
A0A416Y441      ------------------------------------------------------------
A0A357GPJ7      ------------------------------------------------------------
A0A396PAC1      ------------------------------------------------------------
A0A416EYU4      ------------------------------------------------------------
A0A416SCQ2      ------------------------------------------------------------
A0A416TGN7      ------------------------------------------------------------
A0A417SMF6      ------------------------------------------------------------
A0A0H5SF45      ------------------------------------------------------------
A0A1M6JRJ5      ------------------------------------------------------------
A0A1M7Y1S2      ------------------------------------------------------------
A0A7I8DMN1      ------------------------------------------------------------
A0A1Y4MW77      ------------------------------------------------------------
A0A6S6R676      ------------------------------------------------------------
A0A0K8J554      ------------------------------------------------------------
A0A1I0RG99      ------------------------------------------------------------
A0A1I5G322      ------------------------------------------------------------
A0A7C6IYW8      ------------------------------------------------------------
A0A7C6JZF1      ------------------------------------------------------------
A0A3N1XSX6      ------------------------------------------------------------
A0A839K1C1      ------------------------------------------------------------
R6UHV6          ------------------------------------------------------------
A0A3R9Q621      ------------------------------------------------------------
A0A069RC75      ------------------------------------------------------------
A0A174F2W5      ------------------------------------------------------------
A0A174S8E9      ------------------------------------------------------------
A0A416ZL97      ------------------------------------------------------------
A0A174LSK1      ------------------------------------------------------------
A0A373GY92      ------------------------------------------------------------
A0A373NZQ6      ------------------------------------------------------------
A0A417I9B9      ------------------------------------------------------------
A0A417WQF8      ------------------------------------------------------------
A0A8B3CFR3      ------------------------------------------------------------
A0A373RZ83      ------------------------------------------------------------
A0A416U6I1      ------------------------------------------------------------
R7JQZ9          ------------------------------------------------------------
A0A1M5UYN6      ------------------------------------------------------------
A0A176JBT8      ------------------------------------------------------------
A0A1I5HIC6      ------------------------------------------------------------
A0A1Y3TC51      ------------------------------------------------------------
A0A1Y3T1N0      ------------------------------------------------------------
A0A1Y3Y8U8      ------------------------------------------------------------
A0A5B0BQY5      ------------------------------------------------------------
A6CLL4          ------------------------------------------------------------
A0A176U8D6      ------------------------------------------------------------
A0A1Q6KSQ5      ------------------------------------------------------------
A0A3D3U8B3      ------------------------------------------------------------
A0A3E5FRL7      ------------------------------------------------------------
A0A1Y4QK93      ------------------------------------------------------------
B1C232          ------------------------------------------------------------
A0A401USI6      ------------------------------------------------------------
A0A1V4IQ10      ------------------------------------------------------------
A0A1S8TRD2      ------------------------------------------------------------
G7M1U2          ------------------------------------------------------------
A0A2T6KJ75      ------------------------------------------------------------
A9KN92          ------------------------------------------------------------
A0A352MUJ1      ------------------------------------------------------------
R5YI67          ------------------------------------------------------------
A0A174DL89      ------------------------------------------------------------
A0A1Y0IQP5      ------------------------------------------------------------
A0A4R2R7B1      ------------------------------------------------------------
A0A1M6E8I2      ------------------------------------------------------------
A0A7C6SMH0      ------------------------------------------------------------
A0A7X7XYM7      ------------------------------------------------------------
A0A3B8KKL6      ------------------------------------------------------------
A0A2K9E6R0      ------------------------------------------------------------
A0A2S8RBI0      ------------------------------------------------------------
A0A7X8MFK9      ------------------------------------------------------------
A0A7X9D1M8      ------------------------------------------------------------
A0A0L6JLG6      ------------------------------------------------------------
A0A7X8PYA7      ------------------------------------------------------------
G8LSN0          ------------------------------------------------------------
A0A1Y4N105      ------------------------------------------------------------
A0A1Y4QP75      ------------------------------------------------------------
A0A3D4QRB5      ------------------------------------------------------------
A0A349DEH5      ------------------------------------------------------------
A0A3D4T7B4      ------------------------------------------------------------
A0A350XYC7      ------------------------------------------------------------
R6DNR8          ------------------------------------------------------------
A0A355KUM5      ------------------------------------------------------------
R5YGY6          ------------------------------------------------------------
A0A7G9WCY6      ------------------------------------------------------------
A0A0A5GPA9      ------------------------------------------------------------
A0A271M6M4      ------------------------------------------------------------
A0A1C6G0U3      ------------------------------------------------------------
A0A3D4LLB3      ------------------------------------------------------------
A0A7C7AD93      ------------------------------------------------------------
A0A2V3W8U6      ------------------------------------------------------------
A0A6N3BXA1      ------------------------------------------------------------
A0A351SRI8      ------------------------------------------------------------
A0A1V5LU59      ------------------------------------------------------------
A0A7X8R9W1      ------------------------------------------------------------
A0A1E3BVC3      ------------------------------------------------------------
A0A4Q0I6S0      ------------------------------------------------------------
A3DF66          ------------------------------------------------------------
W4V1T8          ------------------------------------------------------------
A0A1C6ITD7      ------------------------------------------------------------
A0A381IX63      ------------------------------------------------------------
A0A1M6RWV2      ------------------------------------------------------------
A0A841ZT34      ------------------------------------------------------------
A0A1G9IUT4      ------------------------------------------------------------
A0A842GR80      ------------------------------------------------------------
A0A7X0TNH3      ------------------------------------------------------------
A0A842D596      ------------------------------------------------------------
A0A842EQ86      ------------------------------------------------------------
A0A842A220      ------------------------------------------------------------
A0A7X0YM80      ------------------------------------------------------------
A0A842GEL5      ------------------------------------------------------------
A0A841XVD7      ------------------------------------------------------------
A0A7X0XME5      ------------------------------------------------------------
A0A842B6T1      ------------------------------------------------------------
A0A841X7G0      ------------------------------------------------------------
A0A841W3M8      ------------------------------------------------------------
A0A7X0XVI0      ------------------------------------------------------------
A0A7X0Z1K1      ------------------------------------------------------------
A0A143ZUX1      ------------------------------------------------------------
A0A7I8D809      ------------------------------------------------------------
A0A3R9WAA7      ------------------------------------------------------------
A0A1G6BLF1      ------------------------------------------------------------
A0A355G1X5      ------------------------------------------------------------
A0A1W2CEA6      ------------------------------------------------------------
A0A355G3J9      ------------------------------------------------------------
A0A3D2AD87      ------------------------------------------------------------
A0A143XN92      ------------------------------------------------------------
R7FFK6          ------------------------------------------------------------
A0A373MPB9      ------------------------------------------------------------
A0A373L519      ------------------------------------------------------------
A0A373W906      ------------------------------------------------------------
A0A373VCW2      ------------------------------------------------------------
W0U604          ------------------------------------------------------------
A0A374B6G0      ------------------------------------------------------------
A0A373VM36      ------------------------------------------------------------
A0A1C5P379      ------------------------------------------------------------
A0A373XXX0      ------------------------------------------------------------
A0A5R9MJM9      ------------------------------------------------------------
A0A356CW82      ------------------------------------------------------------
R6T4X7          ------------------------------------------------------------
A0A374HTV1      ------------------------------------------------------------
A0A374GB66      ------------------------------------------------------------
A0A374ECC6      ------------------------------------------------------------
A0A374BM61      ------------------------------------------------------------
A0A373UGZ4      ------------------------------------------------------------
A0A373SA66      ------------------------------------------------------------
A0A1C5X6X7      ------------------------------------------------------------
A0A1C6JIH3      ------------------------------------------------------------
A0A373PSC3      ------------------------------------------------------------
A0A1K1WYK8      ------------------------------------------------------------
A0A1H6IUB1      ------------------------------------------------------------
A0A1M7L1F9      ------------------------------------------------------------
A0A1C6B4L6      ------------------------------------------------------------
A0A1Q6T9P4      ------------------------------------------------------------
A0A315Y4F9      ------------------------------------------------------------
A0A354K620      ------------------------------------------------------------
A0A173ZYY6      ------------------------------------------------------------
A0A6L8RXB5      ------------------------------------------------------------
A0A173SMI2      ------------------------------------------------------------
A0A845KKD0      ------------------------------------------------------------
A0A6N9JW85      ------------------------------------------------------------
A0A174ASH7      ------------------------------------------------------------
A6BH65          ------------------------------------------------------------
R7G0D7          ------------------------------------------------------------
R6HZX3          ------------------------------------------------------------
R5EFZ0          ------------------------------------------------------------
A0A3E5FSY5      ------------------------------------------------------------
A0A1V5S3C0      ------------------------------------------------------------
A0A3C0QME1      SAPIEETPAEVVEESAPIEETPAEVVEESAPIEETPAELLEAENLLEEIPLQDAEEAPVK
A0A355FYK5      ------------------------------------------------------------
A0A357AQU0      ------------------------------------------------------------
A0A3C1YJQ7      ------------------------------------------------------------
A0A3D0JG38      ------------------------------------------------------------
A0A3C0IHX1      ------------------------------------------------------------
R5V506          ------------------------------------------------------------
A0A352TIU5      ------------------------------------------------------------
R5B467          ------------------------------------------------------------
A0A1Y3TC98      ------------------------------------------------------------
A0A1W1Z4C3      ------------------------------------------------------------
A0A239QN83      ------------------------------------------------------------
A0A8A5CVI3      ------------------------------------------------------------
A0A8A5D3H1      ------------------------------------------------------------
A0A1Q6REE0      ------------------------------------------------------------
R5ETF9          ------------------------------------------------------------
A0A0F2P7X6      ------------------------------------------------------------
A0A359B487      ------------------------------------------------------------
R6VAT5          ------------------------------------------------------------
D4LC36          ------------------------------------------------------------
A0A7X3IXX7      ------------------------------------------------------------
A0A1Q6S448      ------------------------------------------------------------
A0A351MYR0      ------------------------------------------------------------
R6HPC1          ------------------------------------------------------------
A0A3D4G5Z5      ------------------------------------------------------------
A0A3D5ES03      ------------------------------------------------------------
A0A348P5V4      ------------------------------------------------------------
A0A356PT74      ------------------------------------------------------------
A0A3D5LL19      ------------------------------------------------------------
R5MNF0          ------------------------------------------------------------
A0A1Q9JSI0      ------------------------------------------------------------
A0A3D5TNI1      ------------------------------------------------------------
A0A358LJD0      ------------------------------------------------------------
R6I3L7          ------------------------------------------------------------
A0A3D1HXX0      ------------------------------------------------------------
A0A3D2QJB8      ------------------------------------------------------------
R7MQJ4          ------------------------------------------------------------
A0A1V5GLC0      ------------------------------------------------------------
W7V182          ------------------------------------------------------------
A0A143XPI5      ------------------------------------------------------------
A0A0M6WXE3      ------------------------------------------------------------
A0A348SAK2      ------------------------------------------------------------
A0A1G9H5B9      ------------------------------------------------------------
A0A1Y4H8L0      ------------------------------------------------------------
A0A4B9BMD9      ------------------------------------------------------------
A0A0M6WYQ8      ------------------------------------------------------------
A0A348SAK1      ------------------------------------------------------------
A0A252F281      ------------------------------------------------------------
A0A1Y4QKE6      ------------------------------------------------------------
B1C231          ------------------------------------------------------------
A0A7V6WIR4      ------------------------------------------------------------
A0A1Y3TUL5      ------------------------------------------------------------
A0A1Y4JAX2      ------------------------------------------------------------
A0A1Y4T590      ------------------------------------------------------------
A0A1Y3T163      ------------------------------------------------------------
A0A1Y3YCA2      ------------------------------------------------------------
A0A7W8H9H2      ------------------------------------------------------------
A0A1Y4L6N9      ------------------------------------------------------------
A0A173T644      ------------------------------------------------------------
A0A1C5TSB8      ------------------------------------------------------------
C0CIK6          ------------------------------------------------------------
A0A1Y3WEF6      ------------------------------------------------------------
A0A417T0L2      ------------------------------------------------------------
A0A1H9EPU3      ------------------------------------------------------------
A0A354IGV3      ------------------------------------------------------------
A0A417JMV2      ------------------------------------------------------------
A0A415VWX5      ------------------------------------------------------------
A0A173UY96      ------------------------------------------------------------
B0P408          ------------------------------------------------------------
D4MV82          ------------------------------------------------------------
A0A173QTL1      ------------------------------------------------------------
A0A174J359      ------------------------------------------------------------
A0A174A3T7      ------------------------------------------------------------
A0A417UUA3      ------------------------------------------------------------
A0A6N2VB70      ------------------------------------------------------------
A0A1C6EUV9      ------------------------------------------------------------
A0A173Y645      ------------------------------------------------------------
A0A374AVY6      ------------------------------------------------------------
R7BXS4          ------------------------------------------------------------
                                                                            

S3FFL2          --------------------------------------------------------
A0A328M4V1      --------------------------------------------------------
A0A6A8IF17      --------------------------------------------------------
A0A143WVN6      --------------------------------------------------------
W6RXP9          --------------------------------------------------------
W6S4G8          --------------------------------------------------------
A0A3D5R4X5      --------------------------------------------------------
A0A1I4C3N6      --------------------------------------------------------
A0A3B9CIM7      --------------------------------------------------------
A0A7R7IBN8      --------------------------------------------------------
A0A1G9WHW8      --------------------------------------------------------
A0A1H5VAA0      --------------------------------------------------------
A0A3R6VK11      --------------------------------------------------------
A0A3R6QUY7      --------------------------------------------------------
A0A373K3P9      --------------------------------------------------------
A0A3R6JRU5      --------------------------------------------------------
A0A1C5MS04      --------------------------------------------------------
A0A3C1J150      --------------------------------------------------------
A0A416CXD7      --------------------------------------------------------
A0A6N2X662      --------------------------------------------------------
R6XBL9          --------------------------------------------------------
A0A355W5Z7      --------------------------------------------------------
A0A1G6BLB6      --------------------------------------------------------
A0A1C6G8M0      --------------------------------------------------------
A0A416MP73      --------------------------------------------------------
A0A3E4LL92      --------------------------------------------------------
A0A415D1L1      --------------------------------------------------------
A0A396G6S7      --------------------------------------------------------
A0A3E5A223      --------------------------------------------------------
R7D5E6          --------------------------------------------------------
A0A415HQH5      --------------------------------------------------------
A0A414W2C6      --------------------------------------------------------
A5ZNE7          --------------------------------------------------------
A0A395X821      --------------------------------------------------------
A0A1C5PY68      --------------------------------------------------------
A0A174CJF8      --------------------------------------------------------
A0A564SRR2      --------------------------------------------------------
A0A174R7V0      --------------------------------------------------------
A0A373MWV2      --------------------------------------------------------
A0A417CE88      --------------------------------------------------------
A0A416Y441      --------------------------------------------------------
A0A357GPJ7      --------------------------------------------------------
A0A396PAC1      --------------------------------------------------------
A0A416EYU4      --------------------------------------------------------
A0A416SCQ2      --------------------------------------------------------
A0A416TGN7      --------------------------------------------------------
A0A417SMF6      --------------------------------------------------------
A0A0H5SF45      --------------------------------------------------------
A0A1M6JRJ5      --------------------------------------------------------
A0A1M7Y1S2      --------------------------------------------------------
A0A7I8DMN1      --------------------------------------------------------
A0A1Y4MW77      --------------------------------------------------------
A0A6S6R676      --------------------------------------------------------
A0A0K8J554      --------------------------------------------------------
A0A1I0RG99      --------------------------------------------------------
A0A1I5G322      --------------------------------------------------------
A0A7C6IYW8      --------------------------------------------------------
A0A7C6JZF1      --------------------------------------------------------
A0A3N1XSX6      --------------------------------------------------------
A0A839K1C1      --------------------------------------------------------
R6UHV6          --------------------------------------------------------
A0A3R9Q621      --------------------------------------------------------
A0A069RC75      --------------------------------------------------------
A0A174F2W5      --------------------------------------------------------
A0A174S8E9      --------------------------------------------------------
A0A416ZL97      --------------------------------------------------------
A0A174LSK1      --------------------------------------------------------
A0A373GY92      --------------------------------------------------------
A0A373NZQ6      --------------------------------------------------------
A0A417I9B9      --------------------------------------------------------
A0A417WQF8      --------------------------------------------------------
A0A8B3CFR3      --------------------------------------------------------
A0A373RZ83      --------------------------------------------------------
A0A416U6I1      --------------------------------------------------------
R7JQZ9          --------------------------------------------------------
A0A1M5UYN6      --------------------------------------------------------
A0A176JBT8      --------------------------------------------------------
A0A1I5HIC6      --------------------------------------------------------
A0A1Y3TC51      --------------------------------------------------------
A0A1Y3T1N0      --------------------------------------------------------
A0A1Y3Y8U8      --------------------------------------------------------
A0A5B0BQY5      --------------------------------------------------------
A6CLL4          --------------------------------------------------------
A0A176U8D6      --------------------------------------------------------
A0A1Q6KSQ5      --------------------------------------------------------
A0A3D3U8B3      --------------------------------------------------------
A0A3E5FRL7      --------------------------------------------------------
A0A1Y4QK93      --------------------------------------------------------
B1C232          --------------------------------------------------------
A0A401USI6      --------------------------------------------------------
A0A1V4IQ10      --------------------------------------------------------
A0A1S8TRD2      --------------------------------------------------------
G7M1U2          --------------------------------------------------------
A0A2T6KJ75      --------------------------------------------------------
A9KN92          --------------------------------------------------------
A0A352MUJ1      --------------------------------------------------------
R5YI67          --------------------------------------------------------
A0A174DL89      --------------------------------------------------------
A0A1Y0IQP5      --------------------------------------------------------
A0A4R2R7B1      --------------------------------------------------------
A0A1M6E8I2      --------------------------------------------------------
A0A7C6SMH0      --------------------------------------------------------
A0A7X7XYM7      --------------------------------------------------------
A0A3B8KKL6      --------------------------------------------------------
A0A2K9E6R0      --------------------------------------------------------
A0A2S8RBI0      --------------------------------------------------------
A0A7X8MFK9      --------------------------------------------------------
A0A7X9D1M8      --------------------------------------------------------
A0A0L6JLG6      --------------------------------------------------------
A0A7X8PYA7      --------------------------------------------------------
G8LSN0          --------------------------------------------------------
A0A1Y4N105      --------------------------------------------------------
A0A1Y4QP75      --------------------------------------------------------
A0A3D4QRB5      --------------------------------------------------------
A0A349DEH5      --------------------------------------------------------
A0A3D4T7B4      --------------------------------------------------------
A0A350XYC7      --------------------------------------------------------
R6DNR8          --------------------------------------------------------
A0A355KUM5      --------------------------------------------------------
R5YGY6          --------------------------------------------------------
A0A7G9WCY6      --------------------------------------------------------
A0A0A5GPA9      --------------------------------------------------------
A0A271M6M4      --------------------------------------------------------
A0A1C6G0U3      --------------------------------------------------------
A0A3D4LLB3      --------------------------------------------------------
A0A7C7AD93      --------------------------------------------------------
A0A2V3W8U6      --------------------------------------------------------
A0A6N3BXA1      --------------------------------------------------------
A0A351SRI8      --------------------------------------------------------
A0A1V5LU59      --------------------------------------------------------
A0A7X8R9W1      --------------------------------------------------------
A0A1E3BVC3      --------------------------------------------------------
A0A4Q0I6S0      --------------------------------------------------------
A3DF66          --------------------------------------------------------
W4V1T8          --------------------------------------------------------
A0A1C6ITD7      --------------------------------------------------------
A0A381IX63      --------------------------------------------------------
A0A1M6RWV2      --------------------------------------------------------
A0A841ZT34      --------------------------------------------------------
A0A1G9IUT4      --------------------------------------------------------
A0A842GR80      --------------------------------------------------------
A0A7X0TNH3      --------------------------------------------------------
A0A842D596      --------------------------------------------------------
A0A842EQ86      --------------------------------------------------------
A0A842A220      --------------------------------------------------------
A0A7X0YM80      --------------------------------------------------------
A0A842GEL5      --------------------------------------------------------
A0A841XVD7      --------------------------------------------------------
A0A7X0XME5      --------------------------------------------------------
A0A842B6T1      --------------------------------------------------------
A0A841X7G0      --------------------------------------------------------
A0A841W3M8      --------------------------------------------------------
A0A7X0XVI0      --------------------------------------------------------
A0A7X0Z1K1      --------------------------------------------------------
A0A143ZUX1      ----------SQSQSSKKKQRITRNG------------------------------
A0A7I8D809      ----------SQSQSSKKKQRITRNG------------------------------
A0A3R9WAA7      ----------TGIAANQVD-------------------------------------
A0A1G6BLF1      ----------GIKEDEEKKSENNK--------------------------------
A0A355G1X5      ----------EESAGNEE--------------------------------------
A0A1W2CEA6      ----------ETKAGRHPVRIKKGN-------------------------------
A0A355G3J9      ----------DREKAQTKKRKHNKKKI-----------------------------
A0A3D2AD87      ----------PESQKETGEQ------------------------------------
A0A143XN92      --------------------------------------------------------
R7FFK6          ----------PSETESTETVAAEAEADAKHIEGEKQA-------------------
A0A373MPB9      ----------DTSAES----------------------------------------
A0A373L519      ----------DTSAES----------------------------------------
A0A373W906      ----------DTSAES----------------------------------------
A0A373VCW2      ----------DASAES----------------------------------------
W0U604          ----------DASAES----------------------------------------
A0A374B6G0      ----------DASAES----------------------------------------
A0A373VM36      ----------DASAES----------------------------------------
A0A1C5P379      ----------DTSAES----------------------------------------
A0A373XXX0      ----------DASAES----------------------------------------
A0A5R9MJM9      ----------DTSAES----------------------------------------
A0A356CW82      ----------DTSAES----------------------------------------
R6T4X7          ----------DTSAES----------------------------------------
A0A374HTV1      ----------DTSAES----------------------------------------
A0A374GB66      ----------DTSAES----------------------------------------
A0A374ECC6      ----------DASAES----------------------------------------
A0A374BM61      ----------DASAES----------------------------------------
A0A373UGZ4      ----------DTSAES----------------------------------------
A0A373SA66      ----------DTSAES----------------------------------------
A0A1C5X6X7      ----------DTSAES----------------------------------------
A0A1C6JIH3      ----------DASAES----------------------------------------
A0A373PSC3      ----------DASAES----------------------------------------
A0A1K1WYK8      ----------PTE------------------------------ETKENENAD----
A0A1H6IUB1      ----------PET-DDDTAEEVKEETAKKETVKKESPSTKTNKNSKNKNAKKKGKK
A0A1M7L1F9      ----------PETSDDDTDVEEKEETVKKEAAPKKT-NNNSNNKSKKSNGKKKGKK
A0A1C6B4L6      ----------TDK------------------------------NETKNEKK-----
A0A1Q6T9P4      ----------TDT------------------------------NETKNEKK-----
A0A315Y4F9      ----------PEL------------------------------DTVEAKAETQGKD
A0A354K620      ----------PEP------------------------------DTEESKAETQEKN
A0A173ZYY6      ----------GRSKGM----------------------------------------
A0A6L8RXB5      ----------GRSKGM----------------------------------------
A0A173SMI2      ----------GRSKGM----------------------------------------
A0A845KKD0      ----------GRSKGM----------------------------------------
A0A6N9JW85      ----------GRSKGM----------------------------------------
A0A174ASH7      ----------GRSKGM----------------------------------------
A6BH65          ----------GRSKGM----------------------------------------
R7G0D7          ----------GRSKGM----------------------------------------
R6HZX3          ----------GSRKQDNAHRSSGDLGRG----------------------------
R5EFZ0          --------------------------------------------------------
A0A3E5FSY5      ----------YKE-------------------------------------------
A0A1V5S3C0      ----------SNTRRK----------------------------------------
A0A3C0QME1      SAIEEAPVALTEETAVEESSEQADIETTKVDLSKESDKKESE--------------
A0A355FYK5      ----------DGKYGYGSGGSGYGSGSGGYGYGYGSGGYG----------------
A0A357AQU0      ----------NEKKA-------EEALAAKKEQEKATDKKS----------------
A0A3C1YJQ7      ----------NEKKA-------EEALAAKKEQEKATDKKS----------------
A0A3D0JG38      ----------NEKKA-------EEALAAKKEQEKATDKKS----------------
A0A3C0IHX1      ----------SKKKSHSHSTQQSEPVSTTTDTDSDKQPVS----------------
R5V506          ----------SKKKSHSHSTQQSEPVSTTTDTDSDKQPVS----------------
A0A352TIU5      ----------SKKKSHSHSTQQSEPVSTTTDTDSDKQPVS----------------
R5B467          ----------ENRERNGAD-------------------------------------
A0A1Y3TC98      ----------GDETETEEQED-----------------------------------
A0A1W1Z4C3      ----------QETRNNRRGNKE----------------------------------
A0A239QN83      ----------NPKKKQKQ--------------------------------------
A0A8A5CVI3      ----------NPKKKHATKNED----------------------------------
A0A8A5D3H1      ----------NPKKKQKQ--------------------------------------
A0A1Q6REE0      ----------SRQEKK----------------------------------------
R5ETF9          ----------SRQEKK----------------------------------------
A0A0F2P7X6      ----------AASDKN----------------------------------------
A0A359B487      ----------AASDKN----------------------------------------
R6VAT5          ----------SQAEEASYTDSDSADED-----------------------------
D4LC36          ----------AEEKEKAGSAC-----------------------------------
A0A7X3IXX7      ----------AKRRATPDRARSRRSSSAGSSASSHSARDV----------------
A0A1Q6S448      ----------SGQKQQ----------------------------------------
A0A351MYR0      ----------SGRKQQ----------------------------------------
R6HPC1          ----------SGQKQQ----------------------------------------
A0A3D4G5Z5      ----------SGQKQQ----------------------------------------
A0A3D5ES03      ----------SGQKQQ----------------------------------------
A0A348P5V4      --------------------------------------------------------
A0A356PT74      ----------QK--------------------------------------------
A0A3D5LL19      ----------QK--------------------------------------------
R5MNF0          ----------QK--------------------------------------------
A0A1Q9JSI0      ----------DQKKSE-------------------RSKLKTDKSKSDF--------
A0A3D5TNI1      ----------AGSRDK-------------------KDK------------------
A0A358LJD0      ----------SGSNDK-------------------NSRSK----------------
R6I3L7          ----------SGSHGK-------------------NSK------------------
A0A3D1HXX0      ----------SGSHGK-------------------NSK------------------
A0A3D2QJB8      ----------SGSHGK-------------------NSK------------------
R7MQJ4          ----------TSEDKD----------------ESKKDKSDNKVKKEKK--------
A0A1V5GLC0      ----------PEQDDDDSSDSDKNNKSDSKENDKKDSKNNKKGKKGGK--------
W7V182          ----------YEEDSD-----EDKTETPEKSEKKTEEKNQSKKKKGGK--------
A0A143XPI5      ----------STSQEK----------------------------------------
A0A0M6WXE3      ----------TNNKEV----------------------------------------
A0A348SAK2      ----------ANNKEV----------------------------------------
A0A1G9H5B9      ----------LQTNQGSTQGSNLETTRGSTHINTQETENESADHRSVDK-------
A0A1Y4H8L0      ----------EQQ-------------------------------------------
A0A4B9BMD9      ----------EKE-------------------------------------------
A0A0M6WYQ8      ----------SRYEKQF-----------------DEPEEETGAVNQKEVFTETKEN
A0A348SAK1      ----------SRYEKQL-----------------DEPVAETGAVNQKEVFTETKET
A0A252F281      ----------SRKREG----------------------------------------
A0A1Y4QKE6      ----------DEYKE-----------------------------------------
B1C231          ----------GEYKE-----------------------------------------
A0A7V6WIR4      --------------------------------------------------------
A0A1Y3TUL5      ----------SSRH------------------------------------------
A0A1Y4JAX2      ----------SSRH------------------------------------------
A0A1Y4T590      ----------SSRH------------------------------------------
A0A1Y3T163      ----------SYRQPYG-------------------------QKNAYEEEEAENG-
A0A1Y3YCA2      ----------SYRQPYG-------------------------QKNAY-EEEAGNG-
A0A7W8H9H2      ----------GYGKYGE-------------------------NHD-----------
A0A1Y4L6N9      ----------ANREK-----------------------------------------
A0A173T644      ----------DEETQS----------------------------------------
A0A1C5TSB8      ----------DEETQS----------------------------------------
C0CIK6          ----------DEETQS----------------------------------------
A0A1Y3WEF6      ----------KNRERIS-------------------------AEEDRGRNRRAKDD
A0A417T0L2      ----------QESKKKN-------------------------DTEELQS-------
A0A1H9EPU3      --------------------------------------------SYENEEASKDKK
A0A354IGV3      ----------AQAEAEN------------------------VSATDKEPEVK----
A0A417JMV2      ----------SRTKKGN---------------------EDKTQESKTERQVKKDHE
A0A415VWX5      ----------SRTKKGN---------------------EDKTQESKTERQVKKDHE
A0A173UY96      ----------SRTKKGN---------------------EDKTQESKTERQVKKDHE
B0P408          ----------SRTKKGN---------------------EDKTQESKTERQVKKDHE
D4MV82          ----------SRTKKGN---------------------EDKTQESKTERQVKKDHE
A0A173QTL1      ----------SRTKKGN---------------------EDKTQESKTERQVKKDHE
A0A174J359      ----------SRTKKGN---------------------EDKTQESKTERQVKKDHE
A0A174A3T7      ----------SRTKKGN---------------------EDKTQESKTERQVKKDHE
A0A417UUA3      ----------SRTKKGN---------------------EDKTQESKTERQVKKDHE
A0A6N2VB70      ----------SRTKKGN---------------------EDKTQESKTERQVKKDHE
A0A1C6EUV9      ----------SRQSQKEDQKEEHQKEQYKKEDHNKEQKEQHNKDSVTERQVKKEDE
A0A173Y645      ----------SRQSKQE------------------EQKEQHNKDSVTERQVKKEDE
A0A374AVY6      ----------SRQSKQE------------------EQKEQHNKDSVTERQVKKEDE
R7BXS4          ----------SRQSKQE------------------EQKEQHNKDSVTERQVKKEDE
                                                                        

© 1998-2022Legal notice