BYKdb

Dataset for cluster tadcd of phylum firmicutes

[Download (right click)] [Edit] [Sequences] [Repertoires]

247 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A0H5SF45      ------------------------------------------------------------
A0A1M6JRJ5      ------------------------------------------------------------
A0A1M7Y1S2      ------------------------------------------------------------
A0A3D5R4X5      ------------------------------------------------------------
A0A1I4C3N6      ------------------------------------------------------------
A0A3B9CIM7      ------------------------------------------------------------
A0A1G9WHW8      ------------------------------------------------------------
A0A1H5VAA0      ------------------------------------------------------------
A0A3R6VK11      ------------------------------------------------------------
A0A3R6QUY7      ------------------------------------------------------------
A0A373K3P9      ------------------------------------------------------------
A0A3R6JRU5      ------------------------------------------------------------
A0A1C5MS04      ------------------------------------------------------------
A0A3C1J150      ------------------------------------------------------------
A0A416CXD7      ------------------------------------------------------------
R6XBL9          ------------------------------------------------------------
A0A355W5Z7      ------------------------------------------------------------
A0A143WVN6      ------------------------------------------------------------
W6RXP9          ------------------------------------------------------------
W6S4G8          ------------------------------------------------------------
A0A1G6BLB6      ------------------------------------------------------------
B5CSZ7          ------------------------------------------------------------
A0A1C6G8M0      -----------------------------------------------------------M
A0A416MP73      ------------------------------------------------------------
A0A3E4LL92      ------------------------------------------------------------
A0A415D1L1      ------------------------------------------------------------
A0A414P2K5      ------------------------------------------------------------
V8C417          ------------------------------------------------------------
A0A143XN92      ------------------------------------------------------------
A0A173ZYY6      ------------------------------------------------------------
A0A4Q5EHM9      ------------------------------------------------------------
A0A173SMI2      ------------------------------------------------------------
A0A174ASH7      ------------------------------------------------------------
A6BH65          ------------------------------------------------------------
R7G0D7          ------------------------------------------------------------
A0A396G6S7      ------------------------------------------------------------
A0A3E5A223      ------------------------------------------------------------
R7D5E6          ------------------------------------------------------------
A0A415HQH5      ------------------------------------------------------------
A0A414W2C6      ------------------------------------------------------------
A5ZNE7          ------------------------------------------------------------
A0A395X821      ------------------------------------------------------------
A0A1C5PY68      ------------------------------------------------------------
A0A174CJF8      ------------------------------------------------------------
A0A564SRR2      ------------------------------------------------------------
A0A174R7V0      ------------------------------------------------------------
A0A373MWV2      ------------------------------------------------------------
A0A417CE88      ------------------------------------------------------------
A0A416Y441      ------------------------------------------------------------
A0A357GPJ7      ------------------------------------------------------------
A0A396PAC1      ------------------------------------------------------------
A0A416EYU4      ------------------------------------------------------------
A0A416SCQ2      ------------------------------------------------------------
A0A416TGN7      ------------------------------------------------------------
A0A417SMF6      ------------------------------------------------------------
A0A1Y4MW77      ------------------------------------------------------------
R6UHV6          ------------------------------------------------------------
A0A3R9Q621      ------------------------------------------------------------
A0A069RC75      ------------------------------------------------------------
A0A174F2W5      ------------------------------------------------------------
A0A174S8E9      ------------------------------------------------------------
A0A416ZL97      ------------------------------------------------------------
A0A174LSK1      ------------------------------------------------------------
A0A373GY92      ------------------------------------------------------------
A0A373NZQ6      ------------------------------------------------------------
A0A417I9B9      ------------------------------------------------------------
A0A417MP97      ------------------------------------------------------------
A0A417WQF8      ------------------------------------------------------------
A0A373RZ83      ------------------------------------------------------------
A0A416U6I1      ------------------------------------------------------------
R7JQZ9          ------------------------------------------------------------
A0A3B8KKL6      ------------------------------------------------------------
A0A2K9E6R0      ------------------------------------------------------------
A0A2S8RBI0      ------------------------------------------------------------
A0A0L6JLG6      ------------------------------------------------------------
G8LSN0          ------------------------------------------------------------
A0A1M5UYN6      ------------------------------------------------------------
A0A176JBT8      ------------------------------------------------------------
A0A1I5HIC6      ------------------------------------------------------------
A0A1Y3TC51      ------------------------------------------------------------
A0A1Y3T1N0      ------------------------------------------------------------
A0A1Y3Y8U8      ------------------------------------------------------------
A0A5B0BQY5      ------------------------------------------------------------
A6CLL4          ------------------------------------------------------------
A0A174DL89      ------------------------------------------------------------
A0A176U8D6      ------------------------------------------------------------
A0A1Q6KSQ5      ----------------------------------------------------------ML
A0A3D3U8B3      ----------------------------------------------------------ML
A0A3E5FRL7      ------------------------------------------------------------
A0A1Y4QK93      ------------------------------------------------------------
B1C232          ------------------------------------------------------------
A0A401USI6      ------------------------------------------------------------
A0A1V4IQ10      ------------------------------------------------------------
A0A1S8TRD2      ------------------------------------------------------------
G7M1U2          ------------------------------------------------------------
A0A2T6KJ75      ------------------------------------------------------------
A9KN92          ------------------------------------------------------------
A0A352MUJ1      ------------------------------------------------------------
R5YI67          ------------------------------------------------------------
A0A1Y0IQP5      ------------------------------------------------------------
A0A4R2R7B1      ------------------------------------------------------------
A0A1M6E8I2      ------------------------------------------------------------
A0A1Y4N105      ------------------------------------------------------------
A0A1Y4QP75      ------------------------------------------------------------
A0A3D4QRB5      ------------------------------------------------------------
A0A349DEH5      ------------------------------------------------------------
A0A3D4T7B4      ------------------------------------------------------------
A0A350XYC7      ------------------------------------------------------------
R6DNR8          ------------------------------------------------------------
A0A355KUM5      ------------------------------------------------------------
R5YGY6          ------------------------------------------------------------
A0A0K8J554      ------------------------------------------------------------
A0A3N1XSX6      ------------------------------------------------------------
A0A1C6G0U3      ------------------------------------------------------------
A0A3D4LLB3      ------------------------------------------------------------
A0A0A5GPA9      ------------------------------------------------------------
A0A271M6M4      ------------------------------------------------------------
A0A2V3W8U6      ------------------------------------------------------------
W1UFG0          ------------------------------------------------------------
A0A351SRI8      ------------------------------------------------------------
A0A1V5LU59      ------------------------------------------------------------
A0A1E3BVC3      ------------------------------------------------------------
A0A4Q0I6S0      ------------------------------------------------------------
A3DF66          ------------------------------------------------------------
W4V1T8          ------------------------------------------------------------
A0A1I0RG99      ------------------------------------------------------------
A0A1I5G322      ------------------------------------------------------------
A0A1C6ITD7      ------------------------------------------------------------
A0A381IX63      ------------------------------------------------------------
A0A1G9IUT4      ------------------------------------------------------------
A0A1M6RWV2      ------------------------------------------------------------
A0A143XPI5      ----------------------------------MKEEYSREPQRS--------------
A0A355G1X5      ----------------------------------MNTNVNTTSAPK--------------
A0A0M6WXE3      ----------------------------------MENNRENASAQT--------------
A0A348SAK2      --------------------------------MKMENNRENASAQT--------------
A0A1G9H5B9      ----------------------------------MKKKANQIDLVK--------------
R5EFZ0          ----------------------------------MENTSKSNMQSA--------------
A0A1Y4H8L0      ----------------------------------MNKDENFNEILQ--------------
A0A0M6WYQ8      ----------------------------MDEMREKSGKEQQGEIEK--------------
A0A348SAK1      ----------------------------MDEMREKSGKEQQGEIEK--------------
A0A252F281      ----------------------------------MEEKRWSLASIN--------------
A0A1Y4QKE6      --------MMKFVIMIMVIVIMIIKTIGMKVGDIMDEQRLKESMLE--------------
B1C231          --------------MTMVIVIMIIKPIDMKVGDIMDEQRLKESMME--------------
A0A1Y3TUL5      ----------------------------------MNDEYITIRLSD--------------
A0A1Y4JAX2      ----------------------------------MNDEYITIRLSD--------------
A0A1Y4T590      ----------------------------------MNDEYITIRLSD--------------
R5B467          ----------------------------------MNEQRQGHT-----------------
A0A1Y3T163      MLFTETGFPRVPDMDMIMETMGKTSGEETKEDKSMEDQRKEIENRE--------------
A0A1Y3YCA2      MLFTETGFPRVPDMDMIMETMGKTSGEETKEDKSMEDQRKEIENRE--------------
A0A1Y4L6N9      --------------------------------------MSELNHAE--------------
A0A173T644      ---------------------------------------MDERLED--------------
A0A1C5TSB8      ---------------------------------------MDERLED--------------
C0CIK6          -------------------------------------MTVDERLED--------------
A0A1Y3WEF6      --------------------------MAEQDRYGGNSQNLSRKIEE--------------
A0A417T0L2      --------------------------MAERDLYSKNNQNLSRRIDE--------------
A0A1H9EPU3      ----------------------------------MSNQTDEKFFQDDIGQTPGKILENAP
A0A354IGV3      ------------------------------------MEKKQSLGSA--------------
A0A417JMV2      ----------------------------------MSSDKRNISVND--------------
B0P408          ----------------------------------MSSDKRNISVND--------------
D4MV82          ----------------------------------MSSDKRNISVND--------------
A0A415VWX5      ----------------------------------MSSDKRNISVND--------------
A0A173UY96      ----------------------------------MSSDKRNISVND--------------
A0A173QTL1      ----------------------------------MSSDKRNISVND--------------
A0A174A3T7      ----------------------------------MSSDKRNISVND--------------
A0A174J359      ----------------------------------MSSDKRNISVND--------------
A0A417UUA3      ----------------------------------MSSDKRNISVND--------------
A0A1C6EUV9      ----------------------------------MSNEKHNISVND--------------
A0A173Y645      ----------------------------------MSNEKHNISVND--------------
A0A374AVY6      ----------------------------------MSNEKHNISVND--------------
R7BXS4          ----------------------------------MSNEKHNISVND--------------
A0A143ZUX1      -----------------------------------MYEQNTSA-----------------
S3FFL2          -------------------------MGVAPKQKGAFAGLPVQQ-----------------
A0A328M4V1      -----------------------------MTTRQTFSP----R-----------------
A0A5C8HCX2      -----------------------------MTTKNMNTPPGSTQ-----------------
A0A1W1Z4C3      ------------------------------------MNKQSGS-----------------
A0A239QN83      ------------------------------------MNKQGGS-----------------
A0A3R9WAA7      -----------------------------MNYNDAAFGEVYTI-----------------
A0A1G6BLF1      ----------------------------MAEYSSRQGTAPSAI-----------------
R6HZX3          -----------------------------MQEHSYEHNTDQKV-----------------
A0A1W2CEA6      -------MKNKEKITGLTEEMTGISVRNTAPAAEGPAQEYYSG-----------------
R7FFK6          ------------------------------------MKKSYTI-----------------
A0A373MPB9      ------------------------------------MKKNYTI-----------------
A0A373L519      ------------------------------------MKKNYTI-----------------
A0A373W906      ------------------------------------MKKNYTI-----------------
A0A373VCW2      ------------------------------------MKKNYTI-----------------
W0U604          ------------------------------------MKKNYTI-----------------
A0A374B6G0      ------------------------------------MKKNYTI-----------------
A0A373VM36      ------------------------------------MKKNYTI-----------------
A0A1C5P379      ------------------------------------MKKNYTI-----------------
A0A373XXX0      ------------------------------------MKKNYTI-----------------
A0A5R9MJM9      ------------------------------------MKKNYTI-----------------
A0A356CW82      ------------------------------------MKKNYTI-----------------
R6T4X7          ------------------------------------MKKNYTI-----------------
A0A374HTV1      ------------------------------------MKKNYTI-----------------
A0A374GB66      ------------------------------------MKKNYTI-----------------
A0A374ECC6      ------------------------------------MKKNYTI-----------------
A0A374BM61      ------------------------------------MKKNYTI-----------------
A0A373UGZ4      ------------------------------------MKKNYTI-----------------
A0A373SA66      ------------------------------------MKKNYTI-----------------
A0A1C5X6X7      ------------------------------------MKKNYTI-----------------
A0A1C6JIH3      ------------------------------------MKKNYTI-----------------
A0A373PSC3      ------------------------------------MKKNYTI-----------------
A0A1K1WYK8      ------------------------------------MKNTYTI-----------------
A0A1H6IUB1      ------------------------------------MDNGYSI-----------------
A0A1M7L1F9      ------------------------------------MNNSYSI-----------------
A0A1C6B4L6      ------------------------------------MENSYTI-----------------
A0A1Q6T9P4      ------------------------------------MKNSYTI-----------------
A0A315Y4F9      ------------------------------------MNQSYSI-----------------
A0A354K620      ------------------------------------MNESYSI-----------------
A0A355G3J9      ------------------------------------------------------------
A0A3D2AD87      ------------------------------------------------------------
A0A2T5IYJ6      ----------------------------MEILDKNLSPQQEDS-----------------
A0A3C0QME1      -------------------------------------MNDS-------------------
A0A355FYK5      ---------------------------------MQEDQRNSVNALL--------------
A0A357AQU0      ----------------------------------MEQQKDEVE-----------------
A0A3C1YJQ7      ----------------------------------MEQQKDEVE-----------------
A0A3D0JG38      ----------------------------------MEQQKDEVE-----------------
A0A3C0IHX1      --------------------------MGTLNQKNKNKQDDETE-----------------
R5V506          --------------------------MGTLNQKNKNKQDDETE-----------------
A0A352TIU5      --------------------------MGTLNQKNKNKQDDETE-----------------
A0A3E5FSY5      MIVIIMIMVIVIMIIKPIDMKVGDIMDEQRLKESMMEDDSIEI-----------------
A0A1V5S3C0      ------------------------MSGSDYNASVRDEEYGVSF-----------------
A0A1Y3TC98      --------------------------MQDQRNRIDEREDEMEI-----------------
A0A1Q6REE0      -----------------------------MEIEKTEQQGRDTF-----------------
R5ETF9          -----------------------------MEIEKTEQQGRDTF-----------------
R6VAT5          --------------------------MEKKFVPENSRSYTPVG-----------------
A0A1Q6S448      -------------------------------MDENNQGLQWSH-----------------
A0A351MYR0      -------------------------------MEEKNRGLQWSH-----------------
R6HPC1          -------------------------------MDEKNRGLQWSH-----------------
A0A3D4G5Z5      -------------------------------MDEKNRGLQWSH-----------------
A0A3D5ES03      -------------------------------MDEKNRGLQWSH-----------------
A0A0F2P7X6      --------------------------MEHQGLNNGVDRTEENE-----------------
A0A359B487      --------------------------MEHQGLNNGVNRTEENE-----------------
A0A348P5V4      --------------------------MNYNSEPKKDYEEGLSL-----------------
A0A356PT74      --------------------------MAYSSSGKTHAEESVNL-----------------
A0A3D5LL19      --------------------------MAYSSSGKTHAEESDNL-----------------
R5MNF0          --------------------------MAYSSSGKTHVEESDNL-----------------
A0A1Q9JSI0      ---------------------------MSE--NKNTSINDYEM-----------------
A0A3D5TNI1      ---------------------------MNRIVKKDTDSDGVEI-----------------
A0A358LJD0      ---------------------------MSKIVRKDTDSDGVEV-----------------
R6I3L7          ---------------------------MSKIVRKDTNSDGVEV-----------------
A0A3D1HXX0      ---------------------------MSKIVRKDTDSDGVEV-----------------
A0A3D2QJB8      ---------------------------MSKIVRKDTDSDGVEV-----------------
D4LC36          ------------------------------------MKKEYTI-----------------
R7MQJ4          ------------------------------------MESNYTI-----------------
A0A1V5GLC0      ------------------------------------MENTYSI-----------------
W7V182          --------------------------------MKNDGKDMLDL-----------------
                                                                            

A0A0H5SF45      ---------------------MELSIKDVLGIIYKR-LIFI-------IACTFFCAIMSY
A0A1M6JRJ5      ---------------------MEFTVTDILHLLKKR-FILI-------AACTLGGLLLSF
A0A1M7Y1S2      ---------------------MEFTVRDILYLIKKR-FILI-------AACTFAGLLLSF
A0A3D5R4X5      ------------MTREERYLEEEIDIRQLFHILRKR-LGWI-------ISITLAFLIISA
A0A1I4C3N6      ---------------MFKIFFANLHLEKILWIIKSK-ILYI-------IMFALVGGAVGG
A0A3B9CIM7      ---------------MFKTILSNFHLEKIFWTLKKK-ALYI-------FLSTAVLGMVAG
A0A1G9WHW8      ---------------MFKIIVANFHLEKILWIIKKN-LTYM-------VFCGLVAALLFG
A0A1H5VAA0      ---------------MFKIIVANFHLEKILWIIKKN-LTYM-------VFCGLVAALLFG
A0A3R6VK11      ---------------MLETILNNFHLEKILWILQKR-IAYI-------MILGVLGGMAGG
A0A3R6QUY7      ---------------MLETILNNFHLEKILWILQKR-IAYI-------MILGVLGGMAGG
A0A373K3P9      ---------------MLETILNNFHLEKILWILQKR-IAYI-------MILGVLGGMAGG
A0A3R6JRU5      ---------------MLETILNNFHLEKILWILQKR-IAYI-------MILGVLGGMAGG
A0A1C5MS04      ---------------MLETILNNFHLEKILWILQKR-IAYI-------MILGVLGGMAGG
A0A3C1J150      ---------------MLETILNNFHLEKILWILQKR-IAYI-------MILGVLGGMAGG
A0A416CXD7      ---------------MLETILNNFHLEKILWILQKR-IAYI-------MILGVLGGMAGG
R6XBL9          ---------------MLETILNNFHLEKILWILQKR-IAYI-------MILGVLGGMAGG
A0A355W5Z7      ---------------MLETILNNFHLEKILWILQKR-IAYI-------MILGVLGGMAGG
A0A143WVN6      ----------------MEFQIDDIDFRSIVLDLIKN-IWVI-------ILAVLAVRMGIS
W6RXP9          ----------MEQ----EILEKEISISEIMEALQKR-WKMI-------ALITLIFSVVAG
W6S4G8          ----------MEEVKVVEEFSNEISFSQIIFALKKR-WKII-------FATTIFFTALVA
A0A1G6BLB6      --------MQFEERNEEPVQLFRFNGYTVGRDIIKH-MKMI-------IMISVAAMLLMY
B5CSZ7          ----MRGGNMSQESYKSQSLDSQIDLRYIFRTLKKN-AVFI-------LMCVCLTGMFSY
A0A1C6G8M0      GGVCDFMENKKAVAV-ENAAEDTIDLLEIFRALYRR-WVWI-------VFTALVFGIALG
A0A416MP73      ------MESKEITAMGASAEEDTIDLMEIFRALRKR-WYWI-------VLLAIIFGAALG
A0A3E4LL92      ---------MSQESYKSQSLDSQIDLRYIFRTLKKN-AVFI-------LMCMCLTGMFSY
A0A415D1L1      ---------MSQEGYKSQSLDSQIDLRYIFRTLKKN-AVFI-------LMCVCLTGMFSY
A0A414P2K5      ---------MIQEGYKSQSLDSQIDLRYIFRTLKKN-AVFI-------LMCVCLTGMFSY
V8C417          ---------MSQESYKSQSLDSQIDLRYIFRTLKKN-AVFI-------LMCVCLTGMFSY
A0A143XN92      ----------MQKYRDTNEMELKIDIRTMIKDVLRY-SWLI-------VIMAISFSLIAY
A0A173ZYY6      -------MESSNRNDMPVFMDNDLDPYTLVHDIVSN-WWVI-------ILGAIAGALLTY
A0A4Q5EHM9      -------MESNNRNDMPAFMDTDLDPYTLVHDIVSN-WWVI-------ILGAIAGALLTY
A0A173SMI2      -------MESNNRNDMPAFMDTDLDPYTLVHDIVSN-WWVI-------ILGAIAGALLTY
A0A174ASH7      -------MESNNRNDMPAFMDTDLDPYTLVHDIVSN-WWVI-------ILGAIAGALLTY
A6BH65          -------MESSNRNDMPVFMDNDLDPYTLVHDIVSN-WWVI-------ILGAIAGALLTY
R7G0D7          -------MESSNRNDMPVFMDNDLDPYTLVHDIVSN-WWVI-------ILGAIAGALLTY
A0A396G6S7      -----------MEERIDNETVQQIDLISMLKDIGRE-WLTI-------LLLAIAAALFAD
A0A3E5A223      -----------MEERIDNETVQQIDLISMLKDIGRE-WLTI-------LLLAIAAALFAD
R7D5E6          -----------MEERIDNETVQQIDLISMLKDIGRE-WLTI-------LLLAIAAALFAD
A0A415HQH5      -----------MEERIDNETVQQIDLISMLKDIGRE-WLTI-------LLLAIAAALFAD
A0A414W2C6      -----------MEERIDNETVQQIDLISMLKDIGRE-WLTI-------LLLAIAAALFAD
A5ZNE7          -----------MEERIDNETVQQIDLISMLKDIGRE-WLTI-------LLLAIAAALFAD
A0A395X821      -----------MEERIDNETVQQIDLISMLKDIGRE-WMTI-------LLLAIAAALFAD
A0A1C5PY68      -----------MEERIDNETVQQIDLISMLKDIGRE-WLTI-------LLLAIAAALFAD
A0A174CJF8      -----------MEERIDNETVQQIDLISMLKDIGRE-WLTI-------LLLAIAAALFAD
A0A564SRR2      -----------MEERIDNETVQQIDLISMLKDIGRE-WLTI-------LLLAIAAALFAD
A0A174R7V0      -----------MEERIDNETVQQIDLISMLKDIGRE-WLTI-------LLLAIAAALFAD
A0A373MWV2      --MRRFQMGEYDRTGNGQNGEADWDLRSILCDMAKN-WWII-------LLIACSAAMITY
A0A417CE88      --MRRFQMGEYDRTGNGQNGEADWDLRSILCDMAKN-WWII-------LLIACSAAMITY
A0A416Y441      --MRRFQMGEYDRTGNGQNGEADWDLRSILCDMAKN-WWII-------LLIACSAAMITY
A0A357GPJ7      --MRRFQMGEYDRTGNGQNGEADWDLRSILCDMAKN-WWII-------LLIACSAAMITY
A0A396PAC1      --MRRFQMGEYDRTGNGQNGEADWDLRSILCDMAKN-WWII-------LLIACSAAMITY
A0A416EYU4      --MRRFQMGEYDRTGNGQNGEADWDLRSILCDMAKN-WWII-------LLIACSAAMITY
A0A416SCQ2      --MRRFQMGEYDRTGNGQNGEADWDLRSILCDMAKN-WWII-------LLIACSAAMITY
A0A416TGN7      --MRRFQMGEYDRTGNGQNGEADWDLRSILCDMAKN-WWII-------LLIACSAAMITY
A0A417SMF6      --MRRFQMGEYDRTGNGQNGEADWDLRSILCDMAKN-WWII-------LLIACSAAMITY
A0A1Y4MW77      -------MEEKNIEQDEITIDLTVLFRDFIRGCIKF-WWLI-------LALMVAGGAIMF
R6UHV6          -MNNSQDDLKAQDDLKEQDANYSFDLASTLQDLTKR-WFVI-------LLSGIIAAIGCF
A0A3R9Q621      ---------------------MEFTLAQVIKLLYKR-MLWI-------VLITALALAATF
A0A069RC75      -----------------------MNGKKYIGIFKRR-KWLF-------FMVLAVSVAVSA
A0A174F2W5      -------MGEYDRTGNGQNGEADWDLRSILCDMAKN-WWII-------LLIACSAAMITY
A0A174S8E9      -------MREYDRTGNGQNGEADWDLRSILCDMAKN-WWII-------LLIACSAAMITY
A0A416ZL97      -------MGEYDRTGNGQSSKTDWDLRSILCDIAKN-WWVI-------LLIACSVAMITY
A0A174LSK1      -------MGEYDRTGNGQSSKTDWDLRSILCDIAKN-WWVI-------LLIACSAAMITY
A0A373GY92      -------MGEYDRTGNGQSSKTDWDLRSILCDIAKN-WWVI-------LLIACSAAMITY
A0A373NZQ6      -------MGEYDRTGNGQSSKTDWDLRSILCDIAKN-WWVI-------LLIACSAAMITY
A0A417I9B9      -------MGEYDRTGNGQSSKTDWDLRSILCDIAKN-WWVI-------LLIACSAAMITY
A0A417MP97      -------MGEYDRTGNGQSSKTDWDLRSILCDIAKN-WWVI-------LLIACSAAMITY
A0A417WQF8      -------MGEYDRTGNGQSSKTDWDLRSILCDIAKN-WWVI-------LLIACSAAMITY
A0A373RZ83      -------MGEYDRTGNGQSSKTDWDLRSILCDIAKN-WWVI-------LLIACSAAMITY
A0A416U6I1      -------MGEYDRTGNGQSSKTDWDLRSILCDIAKN-WWVI-------LLIACSAAMITY
R7JQZ9          -------MGEYDRTGNGQSSKTDWDLRSILCDIAKN-WWVI-------LLIACSAAMITY
A0A3B8KKL6      ---------------MERNNFEEIDVREIFFLLLRK-WYVV-------AACFIFVTVSTF
A0A2K9E6R0      ---------------MERNNFEEIDVREIFFLLLRK-WYVV-------AACFIFVTVSTF
A0A2S8RBI0      ---------------MERNNFEEIDVREIFFLLLRK-WYVV-------AACFIFVTVSTF
A0A0L6JLG6      ---------------MQDKDFVEVDIRELILILLRK-WYIL-------LICLVVATGAAY
G8LSN0          ---------------MGKNDYIEIDIREILIVLLKR-WYLI-------AICFILATGSSF
A0A1M5UYN6      -----------------MQKDDRLDLRDYLHIIKKK-IMVI-------ITITFLTTLIGG
A0A176JBT8      -------------------MEKTFEIKDLLNILRKN-KILI-------TSIPFVCLLIGF
A0A1I5HIC6      ---------------MPNNNDIEIDIGDLFFLLLHK-MWFI-------LLWGILSAAAAI
A0A1Y3TC51      -------------MNGERFSLAEISVRGLCMDLFRN-AWMI-------LLAAAAVWLAAT
A0A1Y3T1N0      -------------MNRELFRLDEISIRGLCLELLQS-LWMI-------LVIGVSLWLGIT
A0A1Y3Y8U8      -------------MNRELFRLDEISIRGLCLELLQS-LWMI-------LVIGVSLWLGIT
A0A5B0BQY5      -------------------MKRTIDMTDLMQAVRRR-WMIF-------FGIILIATLIGG
A6CLL4          -------------------MNQSLTLKELFQILQNH-FWLI-------LSIIFLVTASGI
A0A174DL89      -----------------------MNKFKYFKLIKEK-LSII-------ILITISSIIIST
A0A176U8D6      ---MVFMNSDEVMIVNEDEDEVTIDFFGIFHAIAKR-WYIV-------LLAAVACGVALG
A0A1Q6KSQ5      GGVCDFMENKKAVAV-ENAAEDTIDLLEIFRALYRR-WVWI-------VFAALVFGIALG
A0A3D3U8B3      GGVCDFMENKKAVAV-ENAAEDTIDLLEIFRALYRR-WVWI-------VFAALVFGIALG
A0A3E5FRL7      -------------MNQDEINLDSINYRGIIRDLLKN-WWII-------VLIVISLYLAAT
A0A1Y4QK93      -------------MNQDEINLDSINYRGIIRDLLKN-WWVI-------VLIVISLWLAAT
B1C232          -------------MNQDEINLDSINYRGIIRDLLKN-WWII-------VLIVISLYLAAT
A0A401USI6      -----------------MREENDIEFNDYLNIIRKK-IVVI-------LFIIICPTLIAG
A0A1V4IQ10      ------------------MDSETISIEEIFQILKKK-WKLV-------IILPLITTAISI
A0A1S8TRD2      ------------------MDSETTSIEEIFQILKKK-WKLV-------IILPLITTAISI
G7M1U2          ------------------MDSETISIEEIFQILKKK-WKLV-------IILPLITTAISI
A0A2T6KJ75      -------------------MNRTMEIRDFIRLFKKK-KKVI-------LLVTFYITLIGG
A9KN92          --------------MQNNNNDIEINLGEIFILLLHK-IWII-------VLSSIVCAVAAG
A0A352MUJ1      --------------------MEEIDLKELLKLFWKK-KILI-------ILTTLAFLFVGY
R5YI67          --------------------MEEIDLRDLLKLFWKR-KAII-------LLTTMAFLFIGY
A0A1Y0IQP5      ---------------------MEMGLAEMGRVIRQR-VLLI-------VLVTLLAVGLTG
A0A4R2R7B1      ---------------------MEMGLAEMGRVLRQR-VLLI-------VLVTLLAVGLAG
A0A1M6E8I2      -------------------MGEEWNLLELVQIVLKR-KWIV-------VATTIFAAILAI
A0A1Y4N105      ---------------MMEFRINDIDLRSIIVDMVRN-CWMI-------ILVMLATYFAIA
A0A1Y4QP75      ---------------MMEFRINDIDLRSIIVDVIRN-CWMI-------ILVMLATYFAIA
A0A3D4QRB5      --------------------MEELDIRDIIHIIRKH-FWII-------VLTILLFASASG
A0A349DEH5      -----------MRSEKKNQKGLEINVLAFFKELSKK-LWIV-------LIVALIGAIIGA
A0A3D4T7B4      -----------MRSEKKNQKGLEINVLAFFKELSKK-LWIV-------LIVALIGAIIGA
A0A350XYC7      ---------MKSYSDRKSSKGLEINIVAFFRELSKK-IWIV-------LIIAVIGAAIGG
R6DNR8          ---------MKSYSERKSSKGLEINILAFFKELSKK-LWIV-------AIVAFIGAAIGG
A0A355KUM5      ---------MKSYSDRKNSKGIEINILAFFKELSKK-LWIV-------AIIAVIGATIGG
R5YGY6          ---------MKSYSDRKNSKGIEINILAFFKELSKK-LWIV-------AIIAVIGATIGG
A0A0K8J554      ---------------------MELSLKEIIELIYKR-LKLI-------IIFVLIGAGLLF
A0A3N1XSX6      ---------------------MEFTVKEIIKLILKR-LIWI-------ILCLFAGLLISF
A0A1C6G0U3      -------------------MKEKLDFIEVLKIINKR-KIIV-------ISILSIFIIVTA
A0A3D4LLB3      ---------------MYEEEFNDIDLREIFQIIRKY-LALI-------IIITIVFAAAGA
A0A0A5GPA9      -------------------MGQAFGLKEVYQVIRRR-VVLL-------SVVTLLVVIIGI
A0A271M6M4      -------------------MNEAVGLREIFNIIKKE-YLII-------IIITTFMVFLGA
A0A2V3W8U6      -------------------MDQTFQIRDFLQIFKKR-IKFI-------ITVPLLFALLAV
W1UFG0          -----------------MKDTMTISLRELFTIIKRK-LWII-------VLVGIIFGLITA
A0A351SRI8      --------------------MEEFNILEFLKYYWNK-ILIV-------AIVTLLGLILSI
A0A1V5LU59      --------MEKGIGRMENNDFVEIDLREIFFTILRK-WYLI-------AICFILAVGLSF
A0A1E3BVC3      ---------------MEKDDILEIDIREMVYLLLKK-WYLI-------VLCFVLAAGSAF
A0A4Q0I6S0      ---------------MEKDDILEIDIREMVYLLLKK-WYLI-------VLCFVLAAGSAF
A3DF66          ---------------MEKDDILEIDLREIVYILLKK-WYLI-------VLCFVLSAGTAF
W4V1T8          ---------------MEKDDILEIDLREIVYILLKK-WYFI-------VLCFVLAAGSAF
A0A1I0RG99      ---------------------MEFSFKEILEILAKR-FVFI-------AICTFVGICSFF
A0A1I5G322      ---------------------MEFTLKEIFEIFMKR-IVFI-------TVCTIGGLCVSF
A0A1C6ITD7      ----------------------MKNILYYLDIIKKH-LTLI-------IIITLISTILTA
A0A381IX63      -------------------MEQKIEIKEYLQLIRKR-MKII-------VAIVIASILIVS
A0A1G9IUT4      -------------------MEEIINLRQCFQIIKKN-ISLI-------IIITCITMFTSA
A0A1M6RWV2      ----------------MEAYEYEIDLRELFEIILNK-LWLI-------ILIVLITTITTS
A0A143XPI5      ----------------EESIDIFYLFNNVWKGIRQF-YWIF-------LIIISISTAAGY
A0A355G1X5      --------------------GLEINVLFLLKTVLKR-WWIL-------LITTVLCATIGW
A0A0M6WXE3      --------------------ETEFEPISLVCDILKN-WWVI-------LLGALAGAMLFY
A0A348SAK2      --------------------ETEFEPISLVCDILKN-WWVI-------LFGALAGAMLFY
A0A1G9H5B9      ----------------------------MLFFILKH-LWLL-------VLCAELGFGAFY
R5EFZ0          -------------------RLLPFDPIVLVQDVLKR-WLVV-------VLAALAVGIGTY
A0A1Y4H8L0      --------------------TSRLEPFTLVRDILVN-WWVI-------LLGALAAAMLAA
A0A0M6WYQ8      -------------------IDLIEFLRSFQYGIKKM-WWLV-------LVLALIFGLNSY
A0A348SAK1      -------------------IDLIEFLRSFQYGIKKM-WWLV-------LVLALIFGLNSY
A0A252F281      -------------------------LHTMLRDVWKN-LWMI-------VLVAASAVMLTR
A0A1Y4QKE6      --------------DDNIEIDLSELIHGFLKILKDY-WGLF-------LGTIVICTIAFS
B1C231          --------------DDSIEIDLSELIHDFLKILKDY-WGVF-------LGTIVICTIAFS
A0A1Y3TUL5      ----------------------------FLHALIKN-RGLIAATTIAGLAIGVVLSIASY
A0A1Y4JAX2      ----------------------------FLHALIKN-RGLIAATTIAGLAIGVVLSIASY
A0A1Y4T590      ----------------------------FLHALIKN-RGLIAATTIAGLAIGVVLSIASY
R5B467          -------------------IDLAELLGRFARSLRRL-WWLC-------LALIVLCAAASG
A0A1Y3T163      --------------DDEMEIDLVLLFGAFWKSFTRL-WWLV-------LILILAGAGGFY
A0A1Y3YCA2      --------------DDEMEIDLVLLFGAFWKSFTRL-WWLV-------LILILAGAGGFY
A0A1Y4L6N9      --------------TEEMEIDIVSLIQNFISGIFRW-WWLI-------VLLALIGGSIFY
A0A173T644      --------------REELEIDLGILLWNFLQGLARF-WWLV-------ILLAALGSAAYY
A0A1C5TSB8      --------------REELEIDLGILLWNFLQGLARF-WWLV-------ILLAALGSAAYY
C0CIK6          --------------REELEIDLGILLWNFLQGLARF-WWLV-------ILLAALGSAAYY
A0A1Y3WEF6      --------------DD--AIDLRTLFWNVIQGILKF-WWLI-------LLLAAVGAGAFY
A0A417T0L2      --------------DD--VIDLGALFWNVIQGILRF-WWLI-------IFLAAVGAGAFY
A0A1H9EPU3      VTPRKPAIINNNNIAKKTQDEETIDLRQIFGLLWVN-KILI-------ILLGLCVAVIAF
A0A354IGV3      -------------------FLSSIDVSGALRAIVRN-FWLV-------VLAALTGAMGAH
A0A417JMV2      -------------------YETNIDLYSILRDIWKY-ALVI-------MLLAASMSLLSY
B0P408          -------------------YEMNIDLYSILRDIWKY-ALVI-------LLLAASMSLLSY
D4MV82          -------------------YEMNIDLYSILRDIWKY-ALVI-------LLLAASMSLLSY
A0A415VWX5      -------------------YEMNIDLYSILRDIWKY-ALVI-------LLLAASMSLLSY
A0A173UY96      -------------------YEMNIDLYSILRDIWKY-ALVI-------LLLAASMSLLSY
A0A173QTL1      -------------------YEMNIDLYSILRDIWKY-AIVI-------LLLAASMSLLSY
A0A174A3T7      -------------------YEMNIDLYSILRDIWKY-AIVI-------LLLAASMSLLSY
A0A174J359      -------------------YEMNIDLYSILRDIWKY-AILI-------LLLAASMSLLSY
A0A417UUA3      -------------------YEMNIDLYSILRDIWKY-AIVI-------LLLAASMSLLSY
A0A1C6EUV9      -------------------YEMNIDLYSILRDISKY-IVVI-------LLLAASMSLLAY
A0A173Y645      -------------------YEMNIDLYSILRDISKY-IVVI-------LLLAASMSLLAY
A0A374AVY6      -------------------YEMNIDLYSILRDISKY-IVVI-------LLLAASMSLLAY
R7BXS4          -------------------YEMNIDLYSILRDISKY-IVVI-------LLLAASMSLLAY
A0A143ZUX1      --------------------TPSPTTLRYFRQLKKS-WWIP-------TILLVIFAVAGF
S3FFL2          --------------------AGDTPIIRQYMRIANRWRWVI-------LGIVAASLVAGL
A0A328M4V1      --------------------DDDVDLRALIGTLLDN-KWLI-------GITTAVFFALAV
A0A5C8HCX2      --------------------ENEIDLLRLVGELWDH-RKFI-------ISVTALFTLIAV
A0A1W1Z4C3      --------------------IDLARLAVY---ILKR-IWLV-------IICAAIGFGFMY
A0A239QN83      --------------------IDLARLAVY---ILKR-IWLV-------ILCAAIGFGVMY
A0A3R9WAA7      --------------------DLSGIGRNFLRGLKKL-FWLI-------PLLAVSVAMLVC
A0A1G6BLF1      --------------------DLGTIVDDVWKGFWRI-WWLL-------LVIISICATLFY
R6HZX3          --------------------DLELIFRNFLHVLKRT-WWWV-------TLLAILVGALRY
A0A1W2CEA6      --------------------IDWVSVLFR---LLEK-IHWI-------VLAALIGALIAW
R7FFK6          --------------------KDLIFL------FLGH-IWWI-------ICAAVVGAAGTF
A0A373MPB9      --------------------KDLLVL------LLGK-VWYI-------VAASIVCAILAL
A0A373L519      --------------------KDLLVL------LLGK-VWYI-------VAAAVVCAVLAL
A0A373W906      --------------------KDLLVL------LLGK-VWYI-------VAASIVCAILAL
A0A373VCW2      --------------------KDLLVL------LLGK-VWYI-------VAASIVCAILAL
W0U604          --------------------KDLLVL------LLGK-VWYI-------VAASIVCAILAL
A0A374B6G0      --------------------KDLLVL------LLGK-VWYI-------VAASIVCAILAL
A0A373VM36      --------------------KDLLVL------LLGK-VWYI-------VAASIVCAILAL
A0A1C5P379      --------------------KDLLVL------LLGK-VWYI-------VAASIVCAILAL
A0A373XXX0      --------------------KDLLVL------LLGK-VWYI-------VAASIVCAILAL
A0A5R9MJM9      --------------------KDLLVL------LLGK-VWYI-------VAASIVCAILAL
A0A356CW82      --------------------KDLLVL------LLGK-VWYI-------VAASIVCAILAL
R6T4X7          --------------------KDLLVL------LLGK-VWYI-------VAASIVCAILAL
A0A374HTV1      --------------------KDLLVL------LLGK-VWYI-------VAASIVCAILAL
A0A374GB66      --------------------KDLLVL------LLGK-VWYI-------VAASIVCAILAL
A0A374ECC6      --------------------KDLLVL------LLGK-VWYI-------VAASIVCAILAL
A0A374BM61      --------------------KDLLVL------LLGK-VWYI-------VAASIVCAILAL
A0A373UGZ4      --------------------KDLLVL------LLGK-VWYI-------VAASIVCAILAL
A0A373SA66      --------------------KDLLVL------LLGK-VWYI-------VAASVVCAILAL
A0A1C5X6X7      --------------------KDLLVL------LLGK-VWYI-------VAASIVCAILAL
A0A1C6JIH3      --------------------KDLLVL------LLGK-VWYI-------VAASIVCAILAL
A0A373PSC3      --------------------KDLLVL------LLGK-VWYI-------VAASIVCAILAL
A0A1K1WYK8      --------------------KDLLSL------LWNH-LMLI-------IAITIIGGIAAF
A0A1H6IUB1      --------------------KDIISL------LLSK-LWLL-------IIVTIIGGAAAF
A0A1M7L1F9      --------------------KDIINL------LLSK-LWLL-------ILVTIIGGTAAF
A0A1C6B4L6      --------------------KELIGL------FLNK-IWII-------IIVTIAGGILSF
A0A1Q6T9P4      --------------------KELIGL------FLNK-IWII-------IIVTIAGGILSF
A0A315Y4F9      --------------------KDIIRL------LLSH-IWLI-------IVITVLGAGAAF
A0A354K620      --------------------KDILRL------LLNH-LWII-------IIIAILGGAAGF
A0A355G3J9      ---------------------MRLTLKDIAMTVWRS-IGLI-------IVSSLLGAMLLA
A0A3D2AD87      --------------------MQDISIMYLFHLAWRR-IWAI-------VIAACLCAAMTF
A0A2T5IYJ6      --------------------IDLRHYWNV---VARF-KWGI-------IGLAIAITVATA
A0A3C0QME1      --------------------YTIKDIISL---LLSK-LWLL-------ILLAVLGGGGAY
A0A355FYK5      -------GNGLFGNGGSGGGLDLFKLLRA---LLRR-AWAI-------VMVGVVFAAAGY
A0A357AQU0      --------------------IDLLELFWA---LLRK-WWML-------TIAAVLCAAIGF
A0A3C1YJQ7      --------------------IDLLELFWA---LLRK-WWML-------TIAAVLCAAIGF
A0A3D0JG38      --------------------IDLLELFWA---LLRK-WWML-------TIAAVLCAAIGF
A0A3C0IHX1      --------------------IDLGKLFKA---LMQR-LPII-------LLVTLCFSAIGF
R5V506          --------------------IDLGKLFKA---LMQR-LPII-------LLVTLCFSAIGF
A0A352TIU5      --------------------IDLGKLFKA---LVRR-LPII-------LLVTLCFSAIGF
A0A3E5FSY5      --------------------DLSELIHDFLKILKDY-WGVF-------LGTIVICTIAFS
A0A1V5S3C0      --------------------ETILKLIRV---IASK-WWVI-------LILVFIFASAGF
A0A1Y3TC98      --------------------DLGLLFAGMWKNIRRF-WWLA-------LLLTVAGAAGVT
A0A1Q6REE0      --------------------VLLDDFLHQ---AKRM-WLLG-------LALVLICAAGLT
R5ETF9          --------------------VLLDDFLHQ---AKRM-WLLG-------LALILICAAGLT
R6VAT5          --------------------EYASKILTG---IKKH-WYII-------AVLAGICCVGFT
A0A1Q6S448      --------------------IEPLCILRA---LARQ-LWML-------LLAALTCSMAAW
A0A351MYR0      --------------------IEPYCLLRT---LLRQ-LWML-------LMAGAACAMAAW
R6HPC1          --------------------IEPYCLVRT---LLRQ-LWML-------LLAAAACAMAAW
A0A3D4G5Z5      --------------------IEPYCLVRT---LLRQ-LWML-------LLAAAACAMAAW
A0A3D5ES03      --------------------IEPYCLVRT---LLRQ-LWML-------LLAAAACAMAAW
A0A0F2P7X6      --------------------ISLGEIISA---LFKW-WWLV-------VLCTVLAALGAY
A0A359B487      --------------------ISLGEIISA---LFKW-WWLV-------ILCTVLAALGAY
A0A348P5V4      --------------------DTALMYAKK---LMDK-WFVI-------LLSAILCAGVGF
A0A356PT74      --------------------DSVVIYLKK---ILQH-WKIV-------VISAVVLAVLGF
A0A3D5LL19      --------------------DSVVIYLKK---ILQH-WKIV-------VISAVVLAVLGF
R5MNF0          --------------------DSVVIYLKK---ILQH-WKIV-------VISAVVLAVLGF
A0A1Q9JSI0      --------------------NIDLYS------ICKD-IWKY-------ALVILLLAASMS
A0A3D5TNI1      --------------------NI-MYVFGL---LIRR-LWLL-------MLVGLIVGASCA
A0A358LJD0      --------------------NI-MYVFGL---LLRR-LWLL-------ILVALVVGASCA
R6I3L7          --------------------NI-MYAFGL---LLRR-LWLL-------ILVALVVGASCA
A0A3D1HXX0      --------------------NI-MYAFGL---LLRR-LWLL-------ILVALVVGASCA
A0A3D2QJB8      --------------------NI-MYAFGL---LLRR-LWLL-------ILVALVVGASCA
D4LC36          --------------------KD---LVYL---MLGR-IWWI-------IGAALICGLGAF
R7MQJ4          --------------------KK---LIQL---FLSK-IYVI-------IILTIVGGAAAF
A0A1V5GLC0      --------------------KD---LINL---FLSK-LWLI-------ILLAVIGGAAGF
W7V182          --------------------KS---MVAL---LLSK-LWII-------ILAAVLGGTAAF
                                                                            

A0A0H5SF45      VYNK-FIKD-------PV----YTASVQFCV---------NTN-----DNSSGNIN-ELN
A0A1M6JRJ5      LYTS-YFVD-------KT----YTASTQFYV---------STA-----DSTAANLS-ELD
A0A1M7Y1S2      LYTR-YFVD-------KT----YTASSQFYV---------STI-----ESTSANLS-ELD
A0A3D5R4X5      LISF-FILT-------PI----YQSSTALMVNKTFSESEMLNQ---------IQLS-DIN
A0A1I4C3N6      AYAL-FMGQ-------DL----YRSEITMTA---FSNPDYAND-----SGININVS-DVQ
A0A3B9CIM7      AYAS-ITST-------SL----YMAQISFYV---YSNPDYITD-----SSVNIGSS-DIT
A0A1G9WHW8      GYAY-ATRS-------SV----YQAKISFYA---YSDPDYASD-----TSVNITYS-EVN
A0A1H5VAA0      GYAY-ATRS-------SV----YQAKISFYA---YSDPDYASD-----TSVNITYS-EVN
A0A3R6VK11      AYAY-LTNS-------TL----YRAEVSFYV---YSDPDYVYD-----SSVNISNS-EFT
A0A3R6QUY7      AYAY-LTNS-------TL----YRAEVSFYV---YSDPDYVYD-----SSVNISNS-EFT
A0A373K3P9      AYAY-LTNS-------TL----YRAEVSFYV---YSDPDYVYD-----SSVNISNS-EFT
A0A3R6JRU5      AYAY-LTNS-------TL----YRAEVSFYV---YSDPDYVYD-----SSVNISNS-EFT
A0A1C5MS04      AYAY-LTNS-------TL----YRAEVSFYV---YSDPDYVYD-----SSVNISNS-EFT
A0A3C1J150      AYAY-LTNS-------TL----YRAEVSFYV---YSDPDYVYD-----SSVNISNS-EFT
A0A416CXD7      AYAY-LTNS-------TL----YRAEVSFYV---YSDPDYVYD-----SSVNISNS-EFT
R6XBL9          AYAY-LTNS-------TL----YRAEVSFYV---YSDPDYVYD-----SSVNISNS-EFT
A0A355W5Z7      AYAY-LTNS-------TL----YRAEVSFYV---YSDPDYVYD-----SSVNISNS-EFT
A0A143WVN6      GYYE-LTYE-------PQ----YTSTATLAV---TARGSSNGS-----YS-------SLT
W6RXP9          VLSF-FVIK-------PT----YEAGTKLFI---GKEESQNST-----YDNN-----DIQ
W6S4G8          LITF-FFID-------PV----YEVHTKVFI---GKDAEVN-------YDNN-----DVQ
A0A1G6BLB6      AYLA-YTYA-------ET----YTMTTTFTV---VSASTENDA-----YT-------NIQ
B5CSZ7          VILD-HSLK-------DT----YTVSVNLCV---IPRDNTSEK-----L--------AET
A0A1C6G8M0      MYGK-FVVK-------DV----FQAEASMCI---IDSNKEVSI-----S--------DLQ
A0A416MP73      VYGK-FIVK-------DA----YQAEASMCI---IDSNKEVSM-----S--------DVQ
A0A3E4LL92      VILD-HSLK-------DT----YTVSVNLCV---IPRDNTSEK-----L--------AET
A0A415D1L1      VILD-HSLK-------DT----YTVSVNLCV---IPRDNTSEK-----L--------AET
A0A414P2K5      VILD-HSLK-------DT----YTVSVNLCV---IPRDNTSEK-----L--------AET
V8C417          VILD-HSLK-------DT----YTVSVNLCV---IPRDNTSEK-----L--------AET
A0A143XN92      MIID-SSYK-------PK----YTSSTTFIV---TGKGLNNSI-----YD-------NLL
A0A173ZYY6      VVVS-SRYV-------PE----YTTQATFVV---SSRGDANAY-----S--------NLS
A0A4Q5EHM9      VVVS-SRYV-------PE----YTTQATFVV---ASRGDANAY-----S--------NLS
A0A173SMI2      VVVS-SRYV-------PE----YTTQATFVV---ASRGDANAY-----S--------NLS
A0A174ASH7      VVVS-SRYV-------PE----YTTQATFVV---SSRGDANAY-----S--------NLS
A6BH65          VVVS-SRYV-------PE----YTTQATFVV---SSRGDANAY-----S--------NLS
R7G0D7          VVVS-SRYV-------PE----YTTQATFVV---SSRGDANAY-----S--------NLS
A0A396G6S7      IWIC-ATYQ-------PE----YRTSTTFVV---TAKGMNNNI-----YQ-------NLN
A0A3E5A223      IWIC-ATYQ-------PE----YRTSTTFVV---TAKGMNNNI-----YQ-------NLN
R7D5E6          IWIC-ATYQ-------PE----YRTSTTFVV---TAKGMNNNI-----YQ-------NLN
A0A415HQH5      IWIC-ATYQ-------PE----YRTSTTFVV---TAKGMNNNI-----YQ-------NLN
A0A414W2C6      IWIC-ATYQ-------PE----YRTSTTFVV---TAKGMNNNI-----YQ-------NLN
A5ZNE7          IWIC-ATYQ-------PE----YRTSTTFVV---TAKGMNNNI-----YQ-------NLN
A0A395X821      IWIC-ATYQ-------PE----YRTSTTFVV---TAKGMNNNI-----YQ-------NLN
A0A1C5PY68      IWIC-ATYQ-------PE----YRTSTTFVV---TAKGMNNNI-----YQ-------NLN
A0A174CJF8      IWIC-ATYQ-------PE----YRTSTTFVV---TAKGMNNNI-----YQ-------NLN
A0A564SRR2      IWIC-ATYQ-------PE----YRTSTTFVV---TAKGMNNNI-----YQ-------NLN
A0A174R7V0      IWIC-ATYQ-------PE----YRTSTTFVV---TAKGMNNNI-----YQ-------NLN
A0A373MWV2      TVLT-AVHR-------DQ----YTVKTTFAV---MGRGENANA-----AS-------SLS
A0A417CE88      TVLT-AVHR-------DQ----YTVKTTFAV---MGRGENANA-----AS-------SLS
A0A416Y441      TVLT-AVHR-------DQ----YTVKTTFAV---MGRGENANA-----AS-------SLS
A0A357GPJ7      TVLT-AVHR-------DQ----YTVKTTFAV---MGRGENANA-----AS-------SLS
A0A396PAC1      TVLT-AVHR-------DQ----YTVKTTFAV---MGRGENANA-----AS-------SLS
A0A416EYU4      TVLT-AVHR-------DQ----YTVKTTFAV---MGRGENANA-----AS-------SLS
A0A416SCQ2      TVLT-AVHR-------DQ----YTVKTTFAV---MGRGENANA-----AS-------SLS
A0A416TGN7      TVLT-AVHR-------DQ----YTVKTTFAV---MGRGENANA-----AS-------SLS
A0A417SMF6      TVLT-AVHR-------DQ----YTVKTTFAV---MGRGENANA-----AS-------SLS
A0A1Y4MW77      VTNI-QTYT-------PM----YQASATFTV---TTNTTTDQN-----NQSDYNYYYDSS
R6UHV6          ITAT-QLYS-------PQ----YMTSTTLLV---QSKNNTESA-----YN-------NLT
A0A3R9Q621      AVNK-YLIS-------ES----YTASVQFYV---NTQDSQTQK-----IDLN-----ELN
A0A069RC75      VMTF-YVSE-------PE----YSSYTTLMV---NKARGDNEN-----YIDYE----SYI
A0A174F2W5      TVLT-AVHR-------DQ----YTVKTTFAV---MGRGENANA-----AS-------SLS
A0A174S8E9      TVLT-AVHR-------DQ----YTVKTTFAV---MGRGENANA-----AS-------SLS
A0A416ZL97      TVLT-TVHK-------DR----YTVKTTFAV---MGRGVDANA-----AS-------SLS
A0A174LSK1      TVMA-TVHK-------DR----YTVKTTFAV---MGRGVDANA-----AS-------SLS
A0A373GY92      TVMA-TVHK-------DR----YTVKTTFAV---MGRGVDANA-----AS-------SLS
A0A373NZQ6      TVMA-TVHK-------DR----YTVKTTFAV---MGRGVDANA-----AS-------SLS
A0A417I9B9      TVMA-TVHK-------DR----YTVKTTFAV---MGRGVDANA-----AS-------SLS
A0A417MP97      TVMA-TVHK-------DR----YTVKTTFAV---MGRGVDANA-----AS-------SLS
A0A417WQF8      TVMA-TVHK-------DR----YTVKTTFAV---MGRGVDANA-----AS-------SLS
A0A373RZ83      TVMA-TVHK-------DR----YTVKTTFAV---MGRGVDANA-----AS-------SLS
A0A416U6I1      TVMA-TVHK-------DR----YTVKTTFAV---MGRGVDANA-----AS-------SLS
R7JQZ9          TVMA-TVHK-------DR----YTVKTTFAV---MGRGVDANA-----AS-------SLS
A0A3B8KKL6      LITS-YYLT-------PI----YRSEATLFL---GKESGNVGG-----LSIG-----DIQ
A0A2K9E6R0      LITS-YYLT-------PI----YRSEATLFL---GKESGNVGG-----LSIG-----DIQ
A0A2S8RBI0      LITS-YYLT-------PI----YRSEATLFL---GKESGNVGG-----LSIG-----DIQ
A0A0L6JLG6      TVTA-FYLK-------PV----YRAETTLFL---GKEKDKIGA-----LSLL-----DLQ
G8LSN0          AITK-FYLK-------PV----YRAQTTLFL---GKESDKVAS-----LSIA-----DIQ
A0A1M5UYN6      IYSF-YVLK-------PT----YYSSMSVII---GKTVSVDGN-----ISMDIN---DVT
A0A176JBT8      IYTY-FIAS-------PI----YESKTDLLV---NTTPTANTA-----EPVSPL---EID
A0A1I5HIC6      FISK-VFIT-------PV----YTSSTKLYI---INRQNKDTI-----TSS------DLQ
A0A1Y3TC51      GWHN-LTYQ-------PE----YTSSATLVV---TVKGSSSTY-----S--------SLS
A0A1Y3T1N0      GVHT-LIYE-------PA----YTSTATLVV---TVKGESSAY-----S--------SLS
A0A1Y3Y8U8      GVHT-LIYE-------PV----YTSTATLVV---TVKGQTSAY-----S--------SLS
A0A5B0BQY5      GIG--YTIP-------RT----YEAKTDLLV---NSMGKVEGN-----SAPTMG---EIE
A6CLL4          ILS--LSLP-------KE----YEAKVDLLV---NYSPENNQG-----SLSVG----EVE
A0A174DL89      IATL-FFIE-------PT----YESKISVII---GPNQSTSGD-----YSSSQSSY-DVV
A0A176U8D6      VYGR-FVVK-------DA----YESEASMCI---IDSNKEVSM-----S--------DLQ
A0A1Q6KSQ5      MYGK-FVVK-------DV----FQAEASMCI---IDSNKEVSI-----S--------DLQ
A0A3D3U8B3      MYGK-FVVK-------DV----FQAEASMCI---IDSNKEVSI-----S--------DLQ
A0A3E5FRL7      GIGK-LVYI-------PE----YTVSTTLVV---NAQGTSDTY-----T--------SLA
A0A1Y4QK93      GIGK-LVYV-------PE----YTVSTTLVV---SAKGTSDTY-----T--------SLA
B1C232          GIGK-LVYI-------PE----YTVSTTLVV---NAQGTSDTY-----T--------SLA
A0A401USI6      LLSF-YVIK-------PV----YEAKATVIV---GKDSTDKIT-----QS-------EVM
A0A1V4IQ10      LYSF-YIVK-------PQ----YEASTKVFV---GKETGIEEK-----YNNN-----DVE
A0A1S8TRD2      FYSF-YIVK-------PQ----YEACTKVFV---GKETADKEK-----YDNN-----DVE
G7M1U2          FYSF-YIVK-------PQ----YEACTKVFV---GKETADKEK-----YDNN-----DVE
A0A2T6KJ75      -FSS-FAIP-------PK----FEAKTDVLV---NFTTANVVS-----SG-------EID
A9KN92          LISK-FVMT-------PV----YTSDTKLYI---INRQNKD-T-----ITSS-----DLQ
A0A352MUJ1      IYNA-FITT-------PE----YKAATTLLL---VKSSEGTSS-----VTQA-----DVT
R5YI67          VYNA-FVTT-------PQ----YKSATTLIL---VKAEN--SG-----TTTN-----DVT
A0A1Y0IQP5      AGSF-LVLE-------PE----YEATTTLLV---QSKQAGN-V-----IAYN-----DLL
A0A4R2R7B1      AGSF-LVLE-------PE----YEATTTLLV---QSKQTEK-G-----IAYN-----DLL
A0A1M6E8I2      LVTM-VAIT-------PV----YESNTTLMV---NSSKTSSLG-----DIASGFDIGSIN
A0A1Y4N105      GVYR-LTYS-------PH----YTTTATMAV---TARGSQSGT-----YS-------SLT
A0A1Y4QP75      GVYR-LTYS-------PQ----YTTTATMAV---TARGSQSGT-----YS-------SLT
A0A3D4QRB5      IISV-FFLD-------DV----YASSTTLIV---SKQNQNSNV-----NEIQLS---DVN
A0A349DEH5      VVSE-ATKK-------ET----YTSTASFVV---NTSSDSE-K-----ASSN-----DIY
A0A3D4T7B4      VVSE-ATKK-------ET----YTSTASFVV---NTSSDSE-K-----ASSN-----DIY
A0A350XYC7      VAGE-ATKK-------ET----YTSTVSFVV---NSATENG-Q-----ASSG-----EIN
R6DNR8          FVGH-ATRQ-------ET----YTSTVSFVV---NSATEAG-Q-----TSSG-----EIN
A0A355KUM5      VIGE-ATKS-------ET----YTSTVSFVV---NSATENG-Q-----VSSG-----EIN
R5YGY6          VIGE-ATKS-------ET----YTSTVSFVV---NSATENG-Q-----VSSG-----EIN
A0A0K8J554      VVNR-FIRR-------PI----YTASVQLYV---NPNDTTP-A-----ANLN-----ELN
A0A3N1XSX6      IFSR-YIIN-------PS----YTAYVQLYV---IPDDTEA-S-----LNLN-----ELN
A0A1C6G0U3      IFNF-YIIE-------PT----YVADTTIIV---SKSVTNT-N-----DTISSE---ELS
A0A3D4LLB3      VVSI-YLIQ-------PV----YESSTTLIV---REDKDAEEK-----ISIS-----DVN
A0A0A5GPA9      AIS--LLLP-------RT----YEGEGALLV---NFTSVKSDE-----DEISSS---EIE
A0A271M6M4      AIS--YFMP-------PV----YQAKTDLLV---NFKAEGVES-----KDISTV---EIE
A0A2V3W8U6      IVNS-FIIK-------PV----YEARSDLLV---NNTVPMT-E-----ETLTAL---DIE
W1UFG0          GVNQ-FLLK-------PV----YEANTTIIT---NKEVDEE-K-----VQMSTSD--DFT
A0A351SRI8      VYTA-KIQV-------PV----YEAKTSLVL---VNNMGENTT-----ITTT-----DIT
A0A1V5LU59      VVSQ-YYLK-------PI----YKANATLFL---GKESDKIAS-----LSFA-----DIQ
A0A1E3BVC3      VVTQ-FYIK-------PI----YKAETTLFL---GKEKDQV-S-----LSFA-----DIQ
A0A4Q0I6S0      VVTQ-FYIK-------PI----YKAETTLFL---GKEKDQV-S-----LSFA-----DIQ
A3DF66          VVTQ-FYIK-------PV----YKAETTLFL---GKEKDQV-S-----LSFS-----DIQ
W4V1T8          VVTQ-FYIK-------PV----YKAETTLFL---GKEKDQV-S-----LSFA-----DIQ
A0A1I0RG99      INSK-YIIK-------PT----YVASVQMYV---NPNETTY-S-----ADLN-----ELN
A0A1I5G322      LYSK-YIIK-------PT----YIASVQMYV---NSNDSTS-S-----ADLN-----ELN
A0A1C6ITD7      ITTI-FFIE-------PT----YQANISIII---GQNQSTV-D-----EGTSYPGSYDVV
A0A381IX63      IKTF-FFTT-------PI----YEAQTTIII---NNLLG-K-S-----SQLTKE---DIS
A0A1G9IUT4      GLSF-FVID-------PV----YEANTTLIV---NKVKEVN-T-----QDITND---DVL
A0A1M6RWV2      VVSF-FFLD-------KV----YEASTKLVL---VKGGD---------SDIQYN---DVL
A0A143XPI5      YYAKE-SYR-------PN----YEAYASFAV---DAGVSSYS-----------SSYYNST
A0A355G1X5      SVSFM-TTD-------PT----YTTNLSFTT---YNKAAADV-----------VSSSDIN
A0A0M6WXE3      VASSM-IYV-------PN----YRTQATFVI---TSRENANA-------------YNNLS
A0A348SAK2      VASSM-IYV-------PN----YRTQATFVI---TSRENANA-------------YNNLS
A0A1G9H5B9      MYMTR-RMP-------ET----YTATGTMYV---SSYNPEYI-------DDEYTRPGDLS
R5EFZ0          IYTDA-TYA-------PV----YRTTTTFVV---TTRGSSTS------------VYSNLS
A0A1Y4H8L0      TVLSL-RWQ-------PA----YTTSATFAV---SSRVGASS-------------YADLN
A0A0M6WYQ8      IKARK-NYT-------PV----YTASATVAV---TTIDGSPA-------------YQNNA
A0A348SAK1      IKARK-NYT-------PV----YTASATVAV---TTIDGSPA-------------YQNNA
A0A252F281      VASET-IYK-------PE----YTSSVTMSV---TSKSGSNA-------------VADLN
A0A1Y4QKE6      TFRYL-TYT-------PI----YRCEATFTV---ATDSENTG---------SYSYYYSQN
B1C231          TFRYL-TYT-------PI----YRCEATFTV---ATDSENTG---------SYSYYYSQN
A0A1Y3TUL5      MRGEM---A-------KG----YSITSSIAV---TTQDAGGN-FT---TNTSNPDSSDIQ
A0A1Y4JAX2      MRGEM---A-------KG----YSITSSIAV---TTQDAGGN-FT---TNTSNPDSSDIQ
A0A1Y4T590      MRGEM---A-------KG----YSITSSIAV---TTQDAGGN-FT---TNTSNPDSSDIQ
R5B467          GYARL-SYR-------PQ----YTASMTFLV---NAGGTSQS-----------GSAASTA
A0A1Y3T163      AFQNL-SYE-------PL----YASSATFTV---ATGDG---------ENGTYNFYYNRN
A0A1Y3YCA2      AFQNL-SYE-------PL----YASSATFTV---ATGDG---------ENGTYNFYYNSN
A0A1Y4L6N9      LRASR-FYT-------PM----YRAEAVFTV---MTSTQSNS--E---NSGSYNFYYDST
A0A173T644      VKNSQ-FYT-------PM----YQSVASFTV---MTGGNSEN-GQ---EEGSYNFYYDTT
A0A1C5TSB8      VKNSQ-FYT-------PM----YQSVASFTV---MTGGNSEN-GQ---EEGSYNFYYDTT
C0CIK6          VKNSQ-FYT-------PM----YQSVASFTV---MTGGNSEN-GQ---EEGSYNFYYDTT
A0A1Y3WEF6      LRATRLFYT-------PM----YQSSATFTV---LTGGTMDT------ENSTYNFYYDTN
A0A417T0L2      LRATSLFYT-------PM----YQSSATFTV---LTGGSTDS------ENSTYNFYYDTT
A0A1H9EPU3      VYSKF-VIT-------PL----YSASTQILV---MNENSGTGNTT---TDGKSVSVSDLQ
A0A354IGV3      VVLQT-IYK-------PQ----YTCSATYIV---SSKYSTVS-------------YSNIS
A0A417JMV2      VYVGR-NYH-------KQ----YESTSTFIV---SSKGSNNS------------IYSDLS
B0P408          VYVGR-NYH-------KQ----YESTSTFIV---SSKGSNNS------------VYSDLS
D4MV82          VYVGR-NYH-------KQ----YESTSTFIV---SSKGSNNS------------VYSDLS
A0A415VWX5      VYVGR-NYH-------KQ----YESTSTFIV---SSKGSNNS------------VYSDLS
A0A173UY96      VYVGR-NYH-------KQ----YESTSTFIV---SSKGSNNS------------VYSDLS
A0A173QTL1      VYVGR-SYH-------KQ----YESTSTFIV---SSKGSNNS------------VYSDLS
A0A174A3T7      VYVGR-NYH-------KQ----YESTSTFIV---SSKGSNNS------------VYSDLS
A0A174J359      VYVGR-NYH-------KQ----YESTSTFIV---SSKGSNNS------------VYSDLS
A0A417UUA3      VYVGR-NYH-------KQ----YESTSTFIV---SSKGSNNS------------VYSDLS
A0A1C6EUV9      VYVGR-SYH-------KQ----YESTSTFIV---SSKGSNNS------------VYSDLG
A0A173Y645      VYVGR-SYH-------KQ----YESTSTFIV---SSKGSNNS------------VYSDLS
A0A374AVY6      VYVGR-SYH-------KQ----YESTSTFIV---SSKGSNNS------------VYSDLS
R7BXS4          VYVGR-SYH-------KQ----YESTSTFIV---SSKGSNNS------------VYSDLS
A0A143ZUX1      LFAQ-LTYK-------PT----YSSIGSFWL---QIYSTNE-------NDQTKLVMSDIQ
S3FFL2          VIT--LLMT-------PQ----YTATAQIEI---SREGNQ--V-----TNFQGVERNSNQ
A0A328M4V1      IYS--VLAT-------PI----YQSSAIVQV---ENTVPS--L-----PGLEDLAQTLGT
A0A5C8HCX2      AYS--LLST-------PI----YQADTLVQV---EQKQGNAIL-----SGLSDM---IPN
A0A1W1Z4C3      WRASKAIDT-------------YTASGTMFV---TNSNPNLVNY-------GYTSTSDIS
A0A239QN83      YRASKAPDT-------------YTASGTMFV---TNSNPNLVNY-------GYTSTSDIS
A0A3R9WAA7      VYAR-EKYS-------PR----YTAAVTFTV---NLD-----------LASDGSIYEDSM
A0A1G6BLF1      THVK-MVYE-------PK----YTAEATYLV---TAAS----------YYGYTESYYNET
R6HZX3          VQAQ-RSFV-------PQ----YTATASFSV---KSGYVGTT------DLVDSTQYYDNQ
A0A1W2CEA6      FYVT-RLVT-------PV----YQATSKIYI---AGSD-------------TTISLSDLQ
R7FFK6          LVSS-YVIP-------QQ----FQSNISMYV---KNSEKQN--Q----EQQ-GINNNDLT
A0A373MPB9      FVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----DKT-NVDLQDID
A0A373L519      FVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----DKT-NVDLQDIN
A0A373W906      FVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----DKT-NVDLQDIN
A0A373VCW2      FVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSMGQ----DKT-NVDLQDID
W0U604          FVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----DKT-NVDLQDIN
A0A374B6G0      FVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----DKT-NVDLQDIN
A0A373VM36      FVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----DKT-NVDLQDIN
A0A1C5P379      FVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----DKT-NVDLQDIN
A0A373XXX0      FVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----DKT-NVDLQDIN
A0A5R9MJM9      FVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----DKT-NVDLQDIN
A0A356CW82      FVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----DKT-NVDLQDIN
R6T4X7          FVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----DKT-NVDLQDIN
A0A374HTV1      FVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----DKT-NVDLQDIN
A0A374GB66      FVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----DKT-NVDLQDIN
A0A374ECC6      FVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----DKT-NVDLQDIN
A0A374BM61      FVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----DKT-NVDLQDIN
A0A373UGZ4      FVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----DKT-NVDLQDIN
A0A373SA66      FVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----DKT-NVDLQDIN
A0A1C5X6X7      FVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----DKT-NVDLQDIN
A0A1C6JIH3      FVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----DKT-NVDLQDIN
A0A373PSC3      FVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----DKT-NVDLQDIN
A0A1K1WYK8      SFSK-FVLP-------VK----YSSHITMYV---QS----YTGI----SENAANDVNNIS
A0A1H6IUB1      CYSK-FVMP-------LK----YSSHISMYV---QS----YTGI----TEN-ANQQNNIS
A0A1M7L1F9      CYSK-FVMP-------LK----YSSHISMYV---QS----YTGI----SEN-ANQQNNIS
A0A1C6B4L6      GFSK-MFLP-------FE----YSSHVSMYV---QS----YTGI----SDQ-MADQNNIS
A0A1Q6T9P4      GFSK-MFLP-------FE----YSSHVSMYV---QS----YTGI----SDQ-MADQNNIS
A0A315Y4F9      GISK-FLLP-------LQ----YSSHITMYV---QS----YTGI----TEN-ANSANNIS
A0A354K620      SVSR-FLLP-------LK----YSSHITMYV---QS----YTGI----TEN-ANNVNNIS
A0A355G3J9      GATW-ALIK-------PT----YTATAKLYV---YNEH----------STDTYITSSDLA
A0A3D2AD87      AYCK-FVVN-------PK----YKAQSTIYV---TNGNINPGETVEEQEETDGVKGTDVS
A0A2T5IYJ6      FVVSTVRPV-------------YRATATLMI---EQKQ---GKT----LTSLDDVYGTDG
A0A3C0QME1      AYAH-FMMP-------NQ----YQSYTSMYV---RNSG----NI----LGDLDINISALN
A0A355FYK5      FFAKASYVPIYTVSATIE----FTSTKYIKV---ADAT----GK----EELVTVV---VP
A0A357AQU0      SYAK-FYLP-------ET----FTSSIRMYV---KNLN----ST----ETVSSVTTSDLN
A0A3C1YJQ7      SYAK-FYLP-------ET----FTSSIRMYV---KNLN----ST----ETVSSVTTSDLN
A0A3D0JG38      SYAK-FYLP-------ET----FTSSIRMYV---KNLN----ST----ETVSSVTTSDLN
A0A3C0IHX1      SYGK-YYLP-------LE----YTSSTYMYV---KNGD----TS----EEKTAINQQDLM
R5V506          SYGK-YYLP-------LE----YTSSTYMYV---KNGD----TS----EEKTAINQQDLM
A0A352TIU5      SYGK-YYLP-------LE----YTSSTYMYV---KNGD----AS----EEKTAINQQDLM
A0A3E5FSY5      TFRY-LTYT-------PI----YRCEATFTV---ATDS-----E----NTGSYSYYYSQN
A0A1V5S3C0      VFSR-VTYE-------ER----FSSKILFNA---SNKS-SDIAG----EAAKYTTASDVQ
A0A1Y3TC98      VYQR-VFHQ-------PM----YECSATFTV---ATGN-----S----ENGSYSFYYNSS
A0A1Q6REE0      FVQR-RAYR-------PV----YEASASFTV---RVAN----------PLYASVSSYNEK
R5ETF9          FVQR-RAYR-------PV----YEASASFTV---RVAN----------PLYASVSSYNEK
R6VAT5          LYSY-AAYT-------PQ----YTAAATFTV---TPKG-----D----SLSAYTSISSNA
A0A1Q6S448      IVLT-CFVT-------QQ----YTSSTTFSV---TTRT-------------SNLYYTNIT
A0A351MYR0      IVLS-CFVT-------QQ----YTSSTTFAV---TARA-------------STLYYTNIT
R6HPC1          IVLS-CFVT-------RQ----YTSSTTFAV---TARA-------------STLYYTNIT
A0A3D4G5Z5      IVLS-CFVT-------RQ----YTSSTTFAV---TARA-------------STLYYTNIT
A0A3D5ES03      IVLS-CFVT-------RQ----YTSSTTFAV---TARA-------------STLYYTNIT
A0A0F2P7X6      FYTI-STYV-------PV----YTASASMVV---NSKQ---LKI----VGQEAVLTNDVN
A0A359B487      FYTI-YTYV-------PV----YTASASMVV---NSKQ---LKI----VGQEAVLTNDVN
A0A348P5V4      GVAV-ARYT-------EH----YSSQIMFIA---SNRS----SA----ITVAGQSSSDIN
A0A356PT74      AVAK-LTYT-------PS----YSSKITFIA---NNKS----SA----LAVSGQTQSDLN
A0A3D5LL19      AVAK-LTYT-------PS----YSSKITFIA---NNKS----SA----LAVSGQTQSDLN
R5MNF0          AVAK-LTYT-------PS----YSSKITFIA---NNKS----SA----LAVSGQTQSDLN
A0A1Q9JSI0      LLAY-VKVG-------RSYHKMYESTSTFIV---SGK------------GSNNNVYSNLN
A0A3D5TNI1      GITK-LVEE-------PT----YTSSMTFIV---NNKSEKDLSS----SGDNSVSYNDMS
A0A358LJD0      VVTK-AVEE-------PT----YTSSMTFIV---NNKSEKDLSS----SGDNSVSYNDMS
R6I3L7          VITK-AVEE-------PT----YTLSMTFIV---NNKSEKDLSS----SGENSVSYNDMS
A0A3D1HXX0      VITK-AVEE-------PT----YTSSMTFIV---NNKSEKDLSS----SGDNSVSYNDMS
A0A3D2QJB8      VITK-AVEE-------PT----YTLSMTFIV---NNKSEKDLSS----SGENSVSYNDMS
D4LC36          LISD-FAIP-------RK----YQSNVSMYV---RNKE----------DQKQDINNSDLS
R7MQJ4          GFSK-FFMP-------LK----YQSYTSMYV---KNNN----SV----TETDGVNLNDLN
A0A1V5GLC0      CYTK-FCMP-------LQ----YSSHMSMYV---QCYT----ST----SGPTD--YNDIS
W7V182          CVSK-FLMP-------LK----YASHISMYI---QSYT----TF----NENPDQNFNNIN
                                      :                                     

A0A0H5SF45      YAQKVVSTYVNLLRTNTFYRQVLEATGL--N-----------------------------
A0A1M6JRJ5      YAQKIAETYINFLNTRQFYAQVLELSRL--P-----------------------------
A0A1M7Y1S2      YAQKIAETYINFLNTRQFYSQVLELSGL--P-----------------------------
A0A3D5R4X5      VNIRLAETYSEIIKSRRVASRVIDEMNL--D-----------------------------
A0A1I4C3N6      SAQQLITSYSSVLTSSIFLNDVLEASGLQDQ-----------------------------
A0A3B9CIM7      QAKNLITSYMQILKSRTFLEKVKEETGL--G-----------------------------
A0A1G9WHW8      QAKNLISSYTQILKSNTFLEALKEETGL--N-----------------------------
A0A1H5VAA0      QAKNLISSYTQILKSNTFLEALKEETGL--N-----------------------------
A0A3R6VK11      QAKNLVQSYILILKSNTILQKVLEEAGL--D-----------------------------
A0A3R6QUY7      QAKNLVQSYILILKSNTILQKVLEEAGL--D-----------------------------
A0A373K3P9      QAKNLVQSYILILKSNTILQKVLEEAGL--D-----------------------------
A0A3R6JRU5      QAKNLVQSYILILKSNTILQKVLEEAGL--D-----------------------------
A0A1C5MS04      QAKNLVQSYILILKSNTILQKVLEEAGL--D-----------------------------
A0A3C1J150      QAKNLVQSYILILKSNTILQKVLEEAGL--D-----------------------------
A0A416CXD7      QAKNLVQSYILILKSNTILQKVLEEAGL--D-----------------------------
R6XBL9          QAKNLVQSYILILKSNTILQKVLEEAGL--D-----------------------------
A0A355W5Z7      QAKNLVQSYILILKSNTILQKVLEEAGL--D-----------------------------
A0A143WVN6      TAMNMADVFSEVFQSDALKKMIEADIGE--------------------------------
W6RXP9          MYQKLLKTYAEMIKNDELIEKAIREVNT--T-----------------------------
W6S4G8          MYQKLLLTYAQILKTEDLIGTALNNVDS--D-----------------------------
A0A1G6BLB6      SASTTATSFQTILSNSVVQEAVAKAAGM--------------------------------
B5CSZ7          NIENALERSVNVLNSDTMRDQIMKASGS--------------------------------
A0A1C6G8M0      IGSALTNDYEGIIKSRVVLTKVISNLNL--D-----------------------------
A0A416MP73      LGSALTGDYEGIIKSRVVLNKVIENLKL--D-----------------------------
A0A3E4LL92      NIENALERSVNVLNSDTMRDQIVKASGG--------------------------------
A0A415D1L1      NIENALERSVNVLNSDTMRDQIMKASGS--------------------------------
A0A414P2K5      NIENALERSVNVLNSDTMRDQIMKASGS--------------------------------
V8C417          NIENALERSVNVLNSDTMRDQIMKASGS--------------------------------
A0A143XN92      TAQDMTNRFKNIIDSNILKEKIAEVLSM--------------------------------
A0A173ZYY6      SANTMAKTFEKILKSNIMEKKICEKLKV--------------------------------
A0A4Q5EHM9      SANTMAKTFEKILKSNIMEKKICEKLKV--------------------------------
A0A173SMI2      SANTMAKTFEKILKSNIMEKKICEKLKV--------------------------------
A0A174ASH7      SANTMAKTFEKILKSNIMEKKICEKLKV--------------------------------
A6BH65          SANTMAKTFEKILKSNIMEKKICEKLKV--------------------------------
R7G0D7          SANTMAKTFEKILKSNIMEKKICEKLKV--------------------------------
A0A396G6S7      STKELAGQFTEILGSNVLKKKVAQDLGV--------------------------------
A0A3E5A223      STKELAGQFTEILGSNVLKKKVAQDLGV--------------------------------
R7D5E6          STKELAGQFTEILGSNVLKKKVAQDLGV--------------------------------
A0A415HQH5      STKELAGQFTEILGSNVLKKKVAQDLGV--------------------------------
A0A414W2C6      STKELAGQFTEILGSNVLKKKVAQDLGV--------------------------------
A5ZNE7          STKELAGQFTEILGSNVLKKKVAQDLGV--------------------------------
A0A395X821      STKELASQFTEILGSNVLKKKVAQDLGM--------------------------------
A0A1C5PY68      STKELASQFTEILGSNVLKKKVAQDLGM--------------------------------
A0A174CJF8      STKELASQFTEILGSNVLKKKVAQDLGM--------------------------------
A0A564SRR2      STKELASQFTEILGSNVLKKKVAQDLGM--------------------------------
A0A174R7V0      STKELASQFTEILGSNVLKKKVAQDLGM--------------------------------
A0A373MWV2      STYEMTQKFQAILENNILKKKVMEELGC--------------------------------
A0A417CE88      STYEMTQKFQAILENNILKKKVMEELGC--------------------------------
A0A416Y441      STYEMTQKFQAILENNILKKKVMEELGC--------------------------------
A0A357GPJ7      STYEMTQKFQAILENNILKKKVMEELGC--------------------------------
A0A396PAC1      STYEMTQKFQAILENNILKKKVMEELGC--------------------------------
A0A416EYU4      STYEMTQKFQAILENNILKKKVMEELGC--------------------------------
A0A416SCQ2      STYEMTQKFQAILENNILKKKVMEELGC--------------------------------
A0A416TGN7      STYEMTQKFQAILENNILKKKVMEELGC--------------------------------
A0A417SMF6      STYEMTQKFQAILENNILKKKVMEELGC--------------------------------
A0A1Y4MW77      TAEQLSLTFPYILSSQILNDAIEADLGV--------------------------------
R6UHV6          ATNKMAGVFKNILDSSQLQNSAARQLGY--------------------------------
A0A3R9Q621      YAQKVVNTYINFLKTKVFYNMLIEETRL--P-----------------------------
A0A069RC75      ISQKLVDTYAVVAKSETVMERTIKNLNL--R-----------------------------
A0A174F2W5      STYEMTQKFQAILENNILKKKVMEELGC--------------------------------
A0A174S8E9      ATYEMTQKFQAILENNILKKKVMEELGC--------------------------------
A0A416ZL97      ATYEMAQKFEAILENTILKKKVMEELSL--------------------------------
A0A174LSK1      ATYEMAQKFEAILENTILKKKVMEELSL--------------------------------
A0A373GY92      ATYEMAQKFEAILENTILKKKVMEELSL--------------------------------
A0A373NZQ6      ATYEMAQKFEAILENTILKKKVMEELSL--------------------------------
A0A417I9B9      ATYEMAQKFEAILENTILKKKVMEELSL--------------------------------
A0A417MP97      ATYEMAQKFEAILENTILKKKVMEELSL--------------------------------
A0A417WQF8      ATYEMAQKFEAILENTILKKKVMEELSL--------------------------------
A0A373RZ83      ATYEMAQKFEAILENTILKKKVMEELSL--------------------------------
A0A416U6I1      ATYEMAQKFEAILENTILKKKVMEELSL--------------------------------
R7JQZ9          ATYEMAQKFEAILENTILKKKVMEELSL--------------------------------
A0A3B8KKL6      LNNQLIADYRELLKSRTVAERVGEKLN---------------------------------
A0A2K9E6R0      LNNQLIADYRELLKSRTVAERVGEKLN---------------------------------
A0A2S8RBI0      LNNQLIADYRELLKSRTVAERVGEKLN---------------------------------
A0A0L6JLG6      INSQLVVDYREILKSRLVAEKIQSQLG---------------------------------
G8LSN0          VNNQLVSDYRELLKSNLVAESIEKKLG---------------------------------
A0A1M5UYN6      MYVKALETYIQIAKSEDVAEGARGILGD--R-----------------------------
A0A176JBT8      ASLKLIETYQYILKSQRMADLVIKDLDG--L-----------------------------
A0A1I5HIC6      TGSQLTQDYKILVLSRPVTEQVLSKLNL--D-----------------------------
A0A1Y3TC51      LTTQMADVFGQVFQSDALAEKIAEETG---------------------------------
A0A1Y3T1N0      VTSQMADVFGEVFQSSALRSRIIEDVG---------------------------------
A0A1Y3Y8U8      VTSQMADVFGEVFQSSALRSRIIEDVG---------------------------------
A0A5B0BQY5      TNLRLIETYTDIFTSNRLVSEVKIVLGD--S-----------------------------
A6CLL4          TNLRLISTYKYILKSPRVLEIVAERTEE--N-----------------------------
A0A174DL89      MYQKMVKTYSELLTSKIVLQDVIENTGL--D-----------------------------
A0A176U8D6      VGSALTNDYEGIIKSRVVLTKAIANLKL--D-----------------------------
A0A1Q6KSQ5      IGSALTNDYEGIIKSRVVLTKVISNLNL--N-----------------------------
A0A3D3U8B3      IGSALTNDYEGIIKSRVVLTKVISNLNL--N-----------------------------
A0A3E5FRL7      MANEMADIIKEVFQSDVLLELVENEIG---------------------------------
A0A1Y4QK93      MASEMADIIKEVFQSDVLLELVENEIG---------------------------------
B1C232          MANEMADIIKEVFQSDVLLELVENEIG---------------------------------
A0A401USI6      MYQDLIKTYSEIGKSRVVAENAIKNLKS--G-----------------------------
A0A1V4IQ10      MYQKLLKTYSELIKTNTLVSRALNRYDL--D-----------------------------
A0A1S8TRD2      MYQKLLKTYSELAKTNTLVSKALKEHNI--D-----------------------------
G7M1U2          MYQKLLKTYSELAKTNTLVSKALKEHNI--D-----------------------------
A0A2T6KJ75      ANLRLIETYKYLMKSNRILTKVNGSLDE--T-----------------------------
A9KN92          TGSQLTQDFKVMVLSRPVTEQVISKLNL--N-----------------------------
A0A352MUJ1      LNQKLVYTYTELVKSDTVLNEVANRIQL--N-----------------------------
R5YI67          LNQKLVYTYSELVKSDSVLNEVISRVQL--D-----------------------------
A0A1Y0IQP5      TDQKLVTTYGEIFQSRMIAEAVIDRLSL--N-----------------------------
A0A4R2R7B1      TDQKLVTTYGEIFQSRMIAEAVIERLGL--D-----------------------------
A0A1M6E8I2      LSQKLVVTYSEIVKSRIVLEAVIDKIEL--D-----------------------------
A0A1Y4N105      TAMNMAEVFSEVFQSDTLKEKI----EA--D-----------------------------
A0A1Y4QP75      TAMNMAEVFSEVFQSDTLKEKI----KA--D-----------------------------
A0A3D4QRB5      LSRNLVDTYSVIIKSNRVLENVVSDLGL--N-----------------------------
A0A349DEH5      VQINMAGTFRYILSSRVMKNAIVEKCTP--K-----------------------------
A0A3D4T7B4      VQINMAGTFRYILSSRVMKNAIVEKCTP--K-----------------------------
A0A350XYC7      AQINMAGTFNYILSSPRMKEAIVEKCSE--K-----------------------------
R6DNR8          AQINMAGTFSYILSSRALKEAIVEKCPE--K-----------------------------
A0A355KUM5      AQINMAGTFSYILSSRALKEAIVEKCPE--K-----------------------------
R5YGY6          AQINMAGTFSYILSSRALKEAIVEKCPE--K-----------------------------
A0A0K8J554      YAQKVVATYVNLLRTQKFYKKVLEETGL--N-----------------------------
A0A3N1XSX6      YAQKVVTTYINFLNTNVFYHDIQEESNL--N-----------------------------
A0A1C6G0U3      VTKNLAITYANIIKSRAVLEKVINSMNL--E-----------------------------
A0A3D4LLB3      LSKSLVYTYAEMVKSHTVLDNTAKTLKI--D-----------------------------
A0A0A5GPA9      TNLRLIETYKSILISPRIMDKVKAQYGS--D-----------------------------
A0A271M6M4      TNLRLIETYKYILNSTRIMEKVAEKTGS--K-----------------------------
A0A2V3W8U6      TNLRLIETYHFIIQSDRIIDLVVEELDE--P-----------------------------
W1UFG0          FSQRMAITYSKIITSDTVLNQVIDNLNL--K-----------------------------
A0A351SRI8      INKNLVSTYREIIQSKLILNKTIENLNL--D-----------------------------
A0A1V5LU59      LNNQLVSDYRELLKSDLVAESV--KEKL--G-----------------------------
A0A1E3BVC3      VNNQLVVDYREILQSRRVAEII--NQKF--G-----------------------------
A0A4Q0I6S0      VNNQLVVDYREILQSRRVAEII--NQKF--G-----------------------------
A3DF66          VNNQLVVDYREILQSRRVAEII--NQKF--G-----------------------------
W4V1T8          VNNQLVVDYREILQSRRVAETI--NQKF--G-----------------------------
A0A1I0RG99      YAQKVVTTYINFLQTKVFYKQVIDESKL--N-----------------------------
A0A1I5G322      YAQKVVTTYISFLQTKKFYEQVIEESNL--R-----------------------------
A0A1C6ITD7      MYQKMVKTYSEMITSRVVLEDVIENTGL--D-----------------------------
A0A381IX63      YSQLLGETYKPIVKSRKVAEEIKKNLNL--E-----------------------------
A0A1G9IUT4      ANQKLALTYGEIIKSRTVLDKVIKNLNI--D-----------------------------
A0A1M6RWV2      LNQRLVKTYSEIASSRTIAEEVINNLKL--N-----------------------------
A0A143XPI5      TIKQLSATFPYILTSGALRQIVMND-----------------------------------
A0A355G1X5      SSIMMTNTFKYILEGRPMRETVAKS-----------------------------------
A0A0M6WXE3      SANSMAETFQKILESTIMKKTICEK-----------------------------------
A0A348SAK2      SANSMAETFQKILESTIMKKTICEK-----------------------------------
A0A1G9H5B9      SASQLIKTLLVVVKRDSVMSKVADR-----------------------------------
R5EFZ0          STSNLAGLFTELLNSSIMRKTILQE-----------------------------------
A0A1Y4H8L0      SASEMAGTFQKILQSSALNKILCEE-----------------------------------
A0A0M6WYQ8      SAQQMADVFPYILTSGVLKDVVAKD-----------------------------------
A0A348SAK1      SAQQMADVFPYILTSGVLKDVVAKD-----------------------------------
A0A252F281      TTRQMASAFQGVLESDLLHETVAAA-----------------------------------
A0A1Y4QKE6      TADQLSKTFPYILDSSYFRSILLEE-----------------------------------
B1C231          TADQLSKTFPYILDSSYFRSILLDE-----------------------------------
A0A1Y3TUL5      LAEDMVDAVIYVLKSDRTLKAAIQN-----------------------------------
A0A1Y4JAX2      LAEDMVDAVIYVLKSDRTLKAAIQN-----------------------------------
A0A1Y4T590      LAEDMVDAVIYVLKSDRTLKAAIQN-----------------------------------
R5B467          TAAQMAKTFPYILTSGLLDSAVRAD-----------------------------------
A0A1Y3T163      TADQMSRTFPYILDSSFFRSALLER-----------------------------------
A0A1Y3YCA2      TADQMSRTFPYILDSSFFRSALLER-----------------------------------
A0A1Y4L6N9      TAGQLAKTFPYILSSNLLNEAIKED-----------------------------------
A0A173T644      TAGQLAKTFPYILGSSLLTDAIKED-----------------------------------
A0A1C5TSB8      TAGQLAKTFPYILGSSLLTDAIKED-----------------------------------
C0CIK6          TAGQLAKTFPYILGSSLLTDAIKED-----------------------------------
A0A1Y3WEF6      TVGQLAKTFPYILSSSLLTEAIEED-----------------------------------
A0A417T0L2      TAGQLAKTFPYILSSTLLTEAIEED-----------------------------------
A0A1H9EPU3      SSTFLVKDYTYMITSKPVMKSVIDE-----------------------------------
A0A354IGV3      ATSDTASLFSKLLDSQVLRKHAAEA-----------------------------------
A0A417JMV2      ATSEMATKFSEILNSSILQKKVAKE-----------------------------------
B0P408          ATSEMATKFSEILNSSILQKKVAKE-----------------------------------
D4MV82          ATSEMATKFSEILNSSILQKKVAKE-----------------------------------
A0A415VWX5      ATSEMATKFSEILNSSILQKKVAKE-----------------------------------
A0A173UY96      ATSEMATKFSEILNSSILQKKVAKE-----------------------------------
A0A173QTL1      ATSEMATKFSEILNSSILQKKVAKE-----------------------------------
A0A174A3T7      ATSEMATKFSEILNSSILQKKVAKE-----------------------------------
A0A174J359      ATSEMATKFSEILNSSILQKKVAKE-----------------------------------
A0A417UUA3      ATSEMATKFSEILNSSILQKKVAKE-----------------------------------
A0A1C6EUV9      TTTEMATKFSEILNSSILQKKVAKE-----------------------------------
A0A173Y645      TTTEMATKFSEILNSSILQKKVAKE-----------------------------------
A0A374AVY6      TTTEMATKFSEILNSSILQKKVAKE-----------------------------------
R7BXS4          TTTEMATKFSEILNSSILQKKVAKE-----------------------------------
A0A143ZUX1      AATGLAQTYQYFLTGADTIDYVLEESGLD-------------------------------
S3FFL2          VDQEFYQTQYGLLRSRSLSERVATQLRL--VDDPGFFEMFGVGRE---------------
A0A328M4V1      STSQ-AVTEIALLTSRTVVGGAIDNLKLEIESEPERFPVIGNFMARRYTPPVPGAVAPPF
A0A5C8HCX2      SSPE-SAPEIQLLQSRMILGKTIAELNLRDIVEQKYFPIVGRGWA-RLTKEKPGELAISW
A0A1W1Z4C3      SAVQLVNIYSEVVKSETVMQKVLEYAIEPAGENGNENDLLLSQKY---------------
A0A239QN83      SAVQLVNIYSEVVKSETVMQRVLEYAIEPAGENGNEEDILLSQKY---------------
A0A3R9WAA7      RASQLSATFPYIVTSSILKNIIAEE-----------------------------------
A0A1G6BLF1      TASGLATSLEYVLNSTVMQKTVAEA-----------------------------------
R6HZX3          AAEQVVSSFPYIICSEAMQERICLA-----------------------------------
A0A1W2CEA6      LGSTLATDYQEVFKIWHVHEMVDERLDLD-------------------------------
R7FFK6          VSKSLVSTYIVILNNDVVMDEVGNQLAKEYTEEELSRYFTLKN-G---------------
A0A373MPB9      ASKSLVQTYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTVTS-G---------------
A0A373L519      ASKSLVQTYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTVTS-G---------------
A0A373W906      ASKSLVQTYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTVTS-G---------------
A0A373VCW2      ASKSLVQTYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTVTS-G---------------
W0U604          ASKSLVQTYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTVTS-G---------------
A0A374B6G0      ASKSLVQTYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTVTS-G---------------
A0A373VM36      ASKSLVQTYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTVTS-G---------------
A0A1C5P379      ASKSLVQTYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTVTS-G---------------
A0A373XXX0      ASKSLVQTYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTVTS-G---------------
A0A5R9MJM9      ASKSLVQTYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTVTS-G---------------
A0A356CW82      ASKSLVQTYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTVTS-G---------------
R6T4X7          ASKSLVQTYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTVTS-G---------------
A0A374HTV1      ASKSLVQTYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTVTS-G---------------
A0A374GB66      ASKSLVQTYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTVTS-G---------------
A0A374ECC6      ASKSLVQTYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTVTS-G---------------
A0A374BM61      ASKSLVQTYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTVTS-G---------------
A0A373UGZ4      ASKSLVQTYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTVTS-G---------------
A0A373SA66      ASKSLVQTYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTVTS-G---------------
A0A1C5X6X7      ASKSLVQTYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTVTS-G---------------
A0A1C6JIH3      ASKSLVQTYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTVTS-G---------------
A0A373PSC3      ASKSLVQTYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTVTS-G---------------
A0A1K1WYK8      NSKQLVNTYMEVLKDDEVMNAVSAKLLEQYDEQDLRRVFSFDEDN---------------
A0A1H6IUB1      NSKQLVNTYMEVLKDDAVMNAVGDKLLTQFDADTLSKNFGMSD-G---------------
A0A1M7L1F9      NSKQLVNTYMEVLKDDAVMNSVGELLKKQFDEDTLIKNFGMSE-G---------------
A0A1C6B4L6      NSKQLVNTYMEVLKDDAVMAAIGELLLEQFDEVILSENFTFNMSG---------------
A0A1Q6T9P4      NSKQLVNTYMEVLKDDAVMAAIGELLLEQFDEVILSENFTFNMSG---------------
A0A315Y4F9      NSKQLVNTYMEVLKDDAVMNAVAEKLSKQFEENVLSQNFTINDSG---------------
A0A354K620      NSKQLVNTYMEVLKDDAVMNAVAEKLAKQFEKNVLSQNFSLSESG---------------
A0A355G3J9      VSKSLVDTYLIIIKSDPVLDKVQKDLAAKYPS----------------------------
A0A3D2AD87      ASVSLSFTVVDILKQPDIYREMVNTIEKYNDKN---------------------------
A0A2T5IYJ6      GKEYYLQTQFEILKSRELATRVVTELNIANHPDYLPRSEAEKSWW---------------
A0A3C0QME1      ASRSLLDTYTVVLKSNYVMGEVAERLEMEYTTDELAGVFA--------------------
A0A355FYK5      YENNDINRYSTLMKSDAMIYALADKLNNDYNVV---------------------------
A0A357AQU0      ASKSLVMTYIVILKDPVVVGEVAETLAENHERDYLNRYFA--------------------
A0A3C1YJQ7      ASKSLVMTYIVILKDPVVVGEVAETLAENHERDYLNRYFA--------------------
A0A3D0JG38      ASKSLVMTYIVILKDPVVVGEVAETLAENHERDYLNRYFA--------------------
A0A3C0IHX1      ASKSLVETYIVILKNDTVVKQVGMSLVSKFGVSEISKCFT--------------------
R5V506          ASKSLVETYIVILKNDTVVKQVGMSLVSKFGVSEISKCFT--------------------
A0A352TIU5      ASKSLVETYIVILKNDTVVKQVGMSLVSKFGVSEISKCFT--------------------
A0A3E5FSY5      TADQLSKTFPYILDSSYFRSILLDELG---------------------------------
A0A1V5S3C0      ASVTFATSFKFILTETDYIYSLVKQAVKAQSGQE--------------------------
A0A1Y3TC98      TADQMSLTFPYILESNFFQSALMEELG---------------------------------
A0A1Q6REE0      TAQVMADTFPSILTSGLLQRRVMEELG---------------------------------
R5ETF9          TAQVMADTFPSILTSGLLQRRVMDELG---------------------------------
R6VAT5          STQQLEKTFPYIITSAPLTRVVAEDLG---------------------------------
A0A1Q6S448      AAADVAASYSQLLQSRVLRQTMEQNLG---------------------------------
A0A351MYR0      AAADMASSYTQLLQSRVLRQTMEQDLG---------------------------------
R6HPC1          AAADMAASYSQLLQSRVLRQTMEQNLG---------------------------------
A0A3D4G5Z5      AAADMAASYSQLLQSRVLRQTMEQNLG---------------------------------
A0A3D5ES03      AAADMAASYSQLLQSRVLRQTMEQNLG---------------------------------
A0A0F2P7X6      LSAKLVNTYTAVLTSNRVMELVAGELD---------------------------------
A0A359B487      LSAKLVNTYTAVLTSNRVMELVAGELD---------------------------------
A0A348P5V4      ASVSLAESFKYVFTTTELATKVANSCGYANPDGSP-------------------------
A0A356PT74      ASATLAESFKYVFTTTELSKRVADNSGFKD------------------------------
A0A3D5LL19      ASATLAESFKYVFTTTELSKRVADNSGFKD------------------------------
R5MNF0          ASATLAESFKYVFTTTELSKRVADNSGFKD------------------------------
A0A1Q9JSI0      TTAQMATKFSEILNSSILQKKVAKEMN---------------------------------
A0A3D5TNI1      ASAYMANTFVHLMTGRTMCNAIAAECKTYP------------------------------
A0A358LJD0      ASAYMANTFVHLMTGRTMCNAIASECKSYP------------------------------
R6I3L7          ASAYMANTFVHLMTGRTMCNAIAAECKSYP------------------------------
A0A3D1HXX0      ASAYMANTFVHLMTGRTMCNAIAAECKSYP------------------------------
A0A3D2QJB8      ASAYMANTFVHLMTGRTMCNAIAAECKSYP------------------------------
D4LC36          VSKSLVSTYIVILNNDAVMEQVGEQLLKQHTPEELSGNFT--------------------
R7MQJ4          ASKSLVSTYIAVMQDDAVMEKVGSELLAEFDKDKLSKCFS--------------------
A0A1V5GLC0      KSKQLINTYIEVLKDDAVMNAVGGKLMNEFDEAVLAETFG--------------------
W7V182          NSKQLINTYMEVMKDDAVMNAVAEELRGSFENDVLEQNFS--------------------
                           .                                                

A0A0H5SF45      ------------------------------------------------------------
A0A1M6JRJ5      ------------------------------------------------------------
A0A1M7Y1S2      ------------------------------------------------------------
A0A3D5R4X5      ------------------------------------------------------------
A0A1I4C3N6      ------------------------------------------------------------
A0A3B9CIM7      ------------------------------------------------------------
A0A1G9WHW8      ------------------------------------------------------------
A0A1H5VAA0      ------------------------------------------------------------
A0A3R6VK11      ------------------------------------------------------------
A0A3R6QUY7      ------------------------------------------------------------
A0A373K3P9      ------------------------------------------------------------
A0A3R6JRU5      ------------------------------------------------------------
A0A1C5MS04      ------------------------------------------------------------
A0A3C1J150      ------------------------------------------------------------
A0A416CXD7      ------------------------------------------------------------
R6XBL9          ------------------------------------------------------------
A0A355W5Z7      ------------------------------------------------------------
A0A143WVN6      ------------------------------------------------------------
W6RXP9          ------------------------------------------------------------
W6S4G8          ------------------------------------------------------------
A0A1G6BLB6      ------------------------------------------------------------
B5CSZ7          ------------------------------------------------------------
A0A1C6G8M0      ------------------------------------------------------------
A0A416MP73      ------------------------------------------------------------
A0A3E4LL92      ------------------------------------------------------------
A0A415D1L1      ------------------------------------------------------------
A0A414P2K5      ------------------------------------------------------------
V8C417          ------------------------------------------------------------
A0A143XN92      ------------------------------------------------------------
A0A173ZYY6      ------------------------------------------------------------
A0A4Q5EHM9      ------------------------------------------------------------
A0A173SMI2      ------------------------------------------------------------
A0A174ASH7      ------------------------------------------------------------
A6BH65          ------------------------------------------------------------
R7G0D7          ------------------------------------------------------------
A0A396G6S7      ------------------------------------------------------------
A0A3E5A223      ------------------------------------------------------------
R7D5E6          ------------------------------------------------------------
A0A415HQH5      ------------------------------------------------------------
A0A414W2C6      ------------------------------------------------------------
A5ZNE7          ------------------------------------------------------------
A0A395X821      ------------------------------------------------------------
A0A1C5PY68      ------------------------------------------------------------
A0A174CJF8      ------------------------------------------------------------
A0A564SRR2      ------------------------------------------------------------
A0A174R7V0      ------------------------------------------------------------
A0A373MWV2      ------------------------------------------------------------
A0A417CE88      ------------------------------------------------------------
A0A416Y441      ------------------------------------------------------------
A0A357GPJ7      ------------------------------------------------------------
A0A396PAC1      ------------------------------------------------------------
A0A416EYU4      ------------------------------------------------------------
A0A416SCQ2      ------------------------------------------------------------
A0A416TGN7      ------------------------------------------------------------
A0A417SMF6      ------------------------------------------------------------
A0A1Y4MW77      ------------------------------------------------------------
R6UHV6          ------------------------------------------------------------
A0A3R9Q621      ------------------------------------------------------------
A0A069RC75      ------------------------------------------------------------
A0A174F2W5      ------------------------------------------------------------
A0A174S8E9      ------------------------------------------------------------
A0A416ZL97      ------------------------------------------------------------
A0A174LSK1      ------------------------------------------------------------
A0A373GY92      ------------------------------------------------------------
A0A373NZQ6      ------------------------------------------------------------
A0A417I9B9      ------------------------------------------------------------
A0A417MP97      ------------------------------------------------------------
A0A417WQF8      ------------------------------------------------------------
A0A373RZ83      ------------------------------------------------------------
A0A416U6I1      ------------------------------------------------------------
R7JQZ9          ------------------------------------------------------------
A0A3B8KKL6      ------------------------------------------------------------
A0A2K9E6R0      ------------------------------------------------------------
A0A2S8RBI0      ------------------------------------------------------------
A0A0L6JLG6      ------------------------------------------------------------
G8LSN0          ------------------------------------------------------------
A0A1M5UYN6      ------------------------------------------------------------
A0A176JBT8      ------------------------------------------------------------
A0A1I5HIC6      ------------------------------------------------------------
A0A1Y3TC51      ------------------------------------------------------------
A0A1Y3T1N0      ------------------------------------------------------------
A0A1Y3Y8U8      ------------------------------------------------------------
A0A5B0BQY5      ------------------------------------------------------------
A6CLL4          ------------------------------------------------------------
A0A174DL89      ------------------------------------------------------------
A0A176U8D6      ------------------------------------------------------------
A0A1Q6KSQ5      ------------------------------------------------------------
A0A3D3U8B3      ------------------------------------------------------------
A0A3E5FRL7      ------------------------------------------------------------
A0A1Y4QK93      ------------------------------------------------------------
B1C232          ------------------------------------------------------------
A0A401USI6      ------------------------------------------------------------
A0A1V4IQ10      ------------------------------------------------------------
A0A1S8TRD2      ------------------------------------------------------------
G7M1U2          ------------------------------------------------------------
A0A2T6KJ75      ------------------------------------------------------------
A9KN92          ------------------------------------------------------------
A0A352MUJ1      ------------------------------------------------------------
R5YI67          ------------------------------------------------------------
A0A1Y0IQP5      ------------------------------------------------------------
A0A4R2R7B1      ------------------------------------------------------------
A0A1M6E8I2      ------------------------------------------------------------
A0A1Y4N105      ------------------------------------------------------------
A0A1Y4QP75      ------------------------------------------------------------
A0A3D4QRB5      ------------------------------------------------------------
A0A349DEH5      ------------------------------------------------------------
A0A3D4T7B4      ------------------------------------------------------------
A0A350XYC7      ------------------------------------------------------------
R6DNR8          ------------------------------------------------------------
A0A355KUM5      ------------------------------------------------------------
R5YGY6          ------------------------------------------------------------
A0A0K8J554      ------------------------------------------------------------
A0A3N1XSX6      ------------------------------------------------------------
A0A1C6G0U3      ------------------------------------------------------------
A0A3D4LLB3      ------------------------------------------------------------
A0A0A5GPA9      ------------------------------------------------------------
A0A271M6M4      ------------------------------------------------------------
A0A2V3W8U6      ------------------------------------------------------------
W1UFG0          ------------------------------------------------------------
A0A351SRI8      ------------------------------------------------------------
A0A1V5LU59      ------------------------------------------------------------
A0A1E3BVC3      ------------------------------------------------------------
A0A4Q0I6S0      ------------------------------------------------------------
A3DF66          ------------------------------------------------------------
W4V1T8          ------------------------------------------------------------
A0A1I0RG99      ------------------------------------------------------------
A0A1I5G322      ------------------------------------------------------------
A0A1C6ITD7      ------------------------------------------------------------
A0A381IX63      ------------------------------------------------------------
A0A1G9IUT4      ------------------------------------------------------------
A0A1M6RWV2      ------------------------------------------------------------
A0A143XPI5      ------------------------------------------------------------
A0A355G1X5      ------------------------------------------------------------
A0A0M6WXE3      ------------------------------------------------------------
A0A348SAK2      ------------------------------------------------------------
A0A1G9H5B9      ------------------------------------------------------------
R5EFZ0          ------------------------------------------------------------
A0A1Y4H8L0      ------------------------------------------------------------
A0A0M6WYQ8      ------------------------------------------------------------
A0A348SAK1      ------------------------------------------------------------
A0A252F281      ------------------------------------------------------------
A0A1Y4QKE6      ------------------------------------------------------------
B1C231          ------------------------------------------------------------
A0A1Y3TUL5      ------------------------------------------------------------
A0A1Y4JAX2      ------------------------------------------------------------
A0A1Y4T590      ------------------------------------------------------------
R5B467          ------------------------------------------------------------
A0A1Y3T163      ------------------------------------------------------------
A0A1Y3YCA2      ------------------------------------------------------------
A0A1Y4L6N9      ------------------------------------------------------------
A0A173T644      ------------------------------------------------------------
A0A1C5TSB8      ------------------------------------------------------------
C0CIK6          ------------------------------------------------------------
A0A1Y3WEF6      ------------------------------------------------------------
A0A417T0L2      ------------------------------------------------------------
A0A1H9EPU3      ------------------------------------------------------------
A0A354IGV3      ------------------------------------------------------------
A0A417JMV2      ------------------------------------------------------------
B0P408          ------------------------------------------------------------
D4MV82          ------------------------------------------------------------
A0A415VWX5      ------------------------------------------------------------
A0A173UY96      ------------------------------------------------------------
A0A173QTL1      ------------------------------------------------------------
A0A174A3T7      ------------------------------------------------------------
A0A174J359      ------------------------------------------------------------
A0A417UUA3      ------------------------------------------------------------
A0A1C6EUV9      ------------------------------------------------------------
A0A173Y645      ------------------------------------------------------------
A0A374AVY6      ------------------------------------------------------------
R7BXS4          ------------------------------------------------------------
A0A143ZUX1      ------------------------------------------------------------
S3FFL2          ----------------------------------DQGPFAL------------VNNRYTA
A0A328M4V1      AGLSSYDWGGSSLDIYQLDVPRSLLDQQLYLDAGQNGTYTLSDDDDGVLLTGRVGDKVTA
A0A5C8HCX2      MHIPQLNGQ----------------DQQLTLTVGENGHYTLEGEE--FTVNGMVGQRLEK
A0A1W1Z4C3      ------------------------------------------------------------
A0A239QN83      ------------------------------------------------------------
A0A3R9WAA7      ------------------------------------------------------------
A0A1G6BLF1      ------------------------------------------------------------
R6HZX3          ------------------------------------------------------------
A0A1W2CEA6      ------------------------------------------------------------
R7FFK6          ------------------------------------------------------------
A0A373MPB9      ------------------------------------------------------------
A0A373L519      ------------------------------------------------------------
A0A373W906      ------------------------------------------------------------
A0A373VCW2      ------------------------------------------------------------
W0U604          ------------------------------------------------------------
A0A374B6G0      ------------------------------------------------------------
A0A373VM36      ------------------------------------------------------------
A0A1C5P379      ------------------------------------------------------------
A0A373XXX0      ------------------------------------------------------------
A0A5R9MJM9      ------------------------------------------------------------
A0A356CW82      ------------------------------------------------------------
R6T4X7          ------------------------------------------------------------
A0A374HTV1      ------------------------------------------------------------
A0A374GB66      ------------------------------------------------------------
A0A374ECC6      ------------------------------------------------------------
A0A374BM61      ------------------------------------------------------------
A0A373UGZ4      ------------------------------------------------------------
A0A373SA66      ------------------------------------------------------------
A0A1C5X6X7      ------------------------------------------------------------
A0A1C6JIH3      ------------------------------------------------------------
A0A373PSC3      ------------------------------------------------------------
A0A1K1WYK8      ------------------------------------------------------------
A0A1H6IUB1      ------------------------------------------------------------
A0A1M7L1F9      ------------------------------------------------------------
A0A1C6B4L6      ------------------------------------------------------------
A0A1Q6T9P4      ------------------------------------------------------------
A0A315Y4F9      ------------------------------------------------------------
A0A354K620      ------------------------------------------------------------
A0A355G3J9      ------------------------------------------------------------
A0A3D2AD87      ------------------------------------------------------------
A0A2T5IYJ6      ------------------------------------------------------------
A0A3C0QME1      ------------------------------------------------------------
A0A355FYK5      ------------------------------------------------------------
A0A357AQU0      ------------------------------------------------------------
A0A3C1YJQ7      ------------------------------------------------------------
A0A3D0JG38      ------------------------------------------------------------
A0A3C0IHX1      ------------------------------------------------------------
R5V506          ------------------------------------------------------------
A0A352TIU5      ------------------------------------------------------------
A0A3E5FSY5      ------------------------------------------------------------
A0A1V5S3C0      ------------------------------------------------------------
A0A1Y3TC98      ------------------------------------------------------------
A0A1Q6REE0      ------------------------------------------------------------
R5ETF9          ------------------------------------------------------------
R6VAT5          ------------------------------------------------------------
A0A1Q6S448      ------------------------------------------------------------
A0A351MYR0      ------------------------------------------------------------
R6HPC1          ------------------------------------------------------------
A0A3D4G5Z5      ------------------------------------------------------------
A0A3D5ES03      ------------------------------------------------------------
A0A0F2P7X6      ------------------------------------------------------------
A0A359B487      ------------------------------------------------------------
A0A348P5V4      ------------------------------------------------------------
A0A356PT74      ------------------------------------------------------------
A0A3D5LL19      ------------------------------------------------------------
R5MNF0          ------------------------------------------------------------
A0A1Q9JSI0      ------------------------------------------------------------
A0A3D5TNI1      ------------------------------------------------------------
A0A358LJD0      ------------------------------------------------------------
R6I3L7          ------------------------------------------------------------
A0A3D1HXX0      ------------------------------------------------------------
A0A3D2QJB8      ------------------------------------------------------------
D4LC36          ------------------------------------------------------------
R7MQJ4          ------------------------------------------------------------
A0A1V5GLC0      ------------------------------------------------------------
W7V182          ------------------------------------------------------------
                                                                            

A0A0H5SF45      ---------------------------YSVQQ----LKAMTQISS--------VNDTEIF
A0A1M6JRJ5      ---------------------------YSMPD----LKKMTEIKT--------VQNTEIF
A0A1M7Y1S2      ---------------------------YSVTD----LRNMTEIKA--------IQNTEIF
A0A3D5R4X5      ---------------------------ISYEG----LRNITEVSL--------VRDTEFI
A0A1I4C3N6      ---------------------------YSVLA----LQRRISARQ--------ITNTSMF
A0A3B9CIM7      ---------------------------YSTDY----LKSQISASA--------IENTAAF
A0A1G9WHW8      ---------------------------YSTST----FKNIISTSA--------VEDTAVF
A0A1H5VAA0      ---------------------------YSTST----FKNIISTSA--------VEDTAVF
A0A3R6VK11      ---------------------------YGTEA----LSGRIGTSV--------VENTAVF
A0A3R6QUY7      ---------------------------YGTEA----LSGRIGTSV--------VENTAVF
A0A373K3P9      ---------------------------YGTEA----LSGRIGTSV--------VENTAVF
A0A3R6JRU5      ---------------------------YGTEA----LSGRIGTSV--------VENTAVF
A0A1C5MS04      ---------------------------YGTEA----LSGRIGTSV--------VENTAVF
A0A3C1J150      ---------------------------YGTEA----LSGRIGTSV--------VENTAVF
A0A416CXD7      ---------------------------YGTEA----LSGRIGTSV--------VENTAVF
R6XBL9          ---------------------------YGTEA----LSGRIGTSV--------VENTAVF
A0A355W5Z7      ---------------------------YGTEA----LSGRIGTSV--------VENTAVF
A0A143WVN6      ------------------------------SN----IQGTINSSI--------ISQTNLI
W6RXP9          ---------------------------MTAEE----ILDSLTVNP--------LTDTQIL
W6S4G8          ---------------------------MTMEE----VMKDITVEP--------ITDTQIL
A0A1G6BLB6      ------------------------------DS----IPGTVTTSL--------VENTNLM
B5CSZ7          ------------------------------SR----VKGNLSASV--------VADTNII
A0A1C6G8M0      ---------------------------IAYKS----LYNAVSVDN--------PEATRII
A0A416MP73      ---------------------------LTYKQ----LYNIVSVEN--------PDSTRIL
A0A3E4LL92      ------------------------------SR----VQGNLSASV--------VTDTNII
A0A415D1L1      ------------------------------SR----VKGNLSASV--------VADTNII
A0A414P2K5      ------------------------------SR----VKGNLSASV--------VADTNII
V8C417          ------------------------------SR----VKGNLSASV--------VADTNII
A0A143XN92      ------------------------------DS----FDAEAEAEI--------VPETNLM
A0A173ZYY6      ------------------------------EE----LDADIHAKV--------LEGTNML
A0A4Q5EHM9      ------------------------------EE----LDADIHAKV--------LEGTNML
A0A173SMI2      ------------------------------EE----LDADIHAKV--------LEGTNML
A0A174ASH7      ------------------------------EE----LDADIHAKV--------LEGTNML
A6BH65          ------------------------------EE----LDADIHAKV--------LEGTNML
R7G0D7          ------------------------------EE----LDADIHAKV--------LEGTNML
A0A396G6S7      ------------------------------NS----LEVETSVDL--------VPETNLI
A0A3E5A223      ------------------------------NS----LEVETSVDL--------VPETNLI
R7D5E6          ------------------------------NS----LEVETSVDL--------VPETNLI
A0A415HQH5      ------------------------------NS----LEVETSVDL--------VSETNLI
A0A414W2C6      ------------------------------NS----LEVETSVDL--------VPETNLI
A5ZNE7          ------------------------------NS----LEVETSVDL--------VPETNLI
A0A395X821      ------------------------------NN----LNVETSVDL--------VPETNLI
A0A1C5PY68      ------------------------------NN----LNVKTSVDL--------VPETNLI
A0A174CJF8      ------------------------------NN----LNVKTSVDL--------VPETNLI
A0A564SRR2      ------------------------------NN----LNVKTSVDL--------VPETNLI
A0A174R7V0      ------------------------------NN----LNVKTSVDL--------VPETNLI
A0A373MWV2      ------------------------------SS----FPADMSASI--------VPESNLM
A0A417CE88      ------------------------------SS----FPADMSASI--------VPESNLM
A0A416Y441      ------------------------------SS----FPADMSASI--------VPESNLM
A0A357GPJ7      ------------------------------SS----FPADMSASI--------VPESNLM
A0A396PAC1      ------------------------------SS----FPADMSASI--------VPESNLM
A0A416EYU4      ------------------------------SS----FPADMSASI--------VPESNLM
A0A416SCQ2      ------------------------------SS----FPADMSASI--------VPESNLM
A0A416TGN7      ------------------------------SS----FPADMSASI--------VPESNLM
A0A417SMF6      ------------------------------SS----FPADMSASI--------VPESNLM
A0A1Y4MW77      ------------------------------EA----INGSISASI--------IPNSNMI
R6UHV6          ------------------------------TS----FPGNLSCSV--------IEETNIL
A0A3R9Q621      ---------------------------YTVDM----LKDCIRITV--------VSNTEIF
A0A069RC75      ---------------------------VSPQK----LLKKVKIDQ--------VDETEVL
A0A174F2W5      ------------------------------SS----FPADMSASI--------VPESNLM
A0A174S8E9      ------------------------------SS----FPADMSASI--------VPESNLM
A0A416ZL97      ------------------------------SS----FPAKMNASI--------VPESNLM
A0A174LSK1      ------------------------------SS----FPAKMNASI--------VPESNLM
A0A373GY92      ------------------------------SS----FPAKMNASI--------VPESNLM
A0A373NZQ6      ------------------------------SS----FPAKMNASI--------VPESNLM
A0A417I9B9      ------------------------------SS----FPAKMNASI--------VPESNLM
A0A417MP97      ------------------------------SS----FPAKMNASI--------VPESNLM
A0A417WQF8      ------------------------------SS----FPAKMNASI--------VPESNLM
A0A373RZ83      ------------------------------SS----FPAKMNDSI--------VPESNLM
A0A416U6I1      ------------------------------SS----FPAKMNDSI--------VPESNLM
R7JQZ9          ------------------------------SS----FPAKMNDSI--------VPESNLM
A0A3B8KKL6      ---------------------------VSPSK----LLSNVDVRT--------VKDSRIF
A0A2K9E6R0      ---------------------------VSPSK----LLSNVDVRT--------VKDSRIF
A0A2S8RBI0      ---------------------------VSPSK----LLSNVDVRT--------VKDSRIF
A0A0L6JLG6      ---------------------------VEAKA----FQNNVDVMT--------IKDSRIF
G8LSN0          ---------------------------VSAAK----FKRSVNVQT--------VKDSRIF
A0A1M5UYN6      ---------------------------YSSGQ----LMGMLSVGA--------QSNTQIM
A0A176JBT8      ---------------------------LTEDE----FLDNVKAES--------NGNSQII
A0A1I5HIC6      ---------------------------MTHEE----LVSNITVKV--------PENTRIL
A0A1Y3TC51      ------------------------------EE----IAGKISCTP--------IQETNLL
A0A1Y3T1N0      ------------------------------EE----ITGDITCTP--------ITDTNLL
A0A1Y3Y8U8      ------------------------------EE----IAGDITCTP--------ITDTNLL
A0A5B0BQY5      ---------------------------YAKPE----VAKKVKLET--------GNGSQII
A6CLL4          ---------------------------DNVQC----LNEQISVTS--------SSDSQII
A0A174DL89      ---------------------------LNLES----LESMIKIKT--------TTESEFI
A0A176U8D6      ---------------------------IEYKD----LYNAVSIEN--------PDGTRII
A0A1Q6KSQ5      ---------------------------IAYKS----LYNAVSVDN--------PEATRII
A0A3D3U8B3      ---------------------------IAYKS----LYNAVSVDN--------PEATRII
A0A3E5FRL7      ------------------------------KT----NQGTITCNQ--------IQETNLL
A0A1Y4QK93      ------------------------------KT----NQGTITCNQ--------IQETNLL
B1C232          ------------------------------KT----NQGTITCNQ--------IQETNLL
A0A401USI6      ---------------------------IVVKE----FMLDLSITP--------KIGTQII
A0A1V4IQ10      ---------------------------SQSSA----VLSSLTTVP--------MANTQIL
A0A1S8TRD2      ---------------------------LQSSA----VLNTLTTIP--------TANTQIL
G7M1U2          ---------------------------LQSSA----VLNALTTIP--------TANTQIL
A0A2T6KJ75      ---------------------------YKKGE----ISQKVEIQS--------SINSQIL
A9KN92          ---------------------------MTHDE----LVSNINVKV--------PENTRIL
A0A352MUJ1      ---------------------------RSVGQ----LRKNVTIES--------VKNTEIL
R5YI67          ---------------------------KTTAQ----LRKNVTIES--------VKNTEII
A0A1Y0IQP5      ---------------------------STEQE----LLEKIRVTT--------SGESLLT
A0A4R2R7B1      ---------------------------LTEQE----LLENVRVRS--------SSESLLT
A0A1M6E8I2      ---------------------------MTYNE----LLEDITSSP--------VGSTEIL
A0A1Y4N105      ---------------------------LEVDN----LDYQISASV--------ISETNLM
A0A1Y4QP75      ---------------------------LEVDN----LDYQISASV--------ISETNLM
A0A3D4QRB5      ---------------------------ISVNE----LKSKINVSA--------EGNTEIL
A0A349DEH5      ---------------------------VDFGT----VDRSISVSV--------VSSTNII
A0A3D4T7B4      ---------------------------VDFGT----VDRSISVSV--------VSSTNII
A0A350XYC7      ---------------------------VTYGL----VDRSISVRV--------VTSTNVI
R6DNR8          ---------------------------LNYST----VDKSISVSV--------VSSTNVI
A0A355KUM5      ---------------------------VNFGT----VDKSISVNV--------VSSTNVI
R5YGY6          ---------------------------VNFGT----VDKSISVNV--------VSSTNVI
A0A0K8J554      ---------------------------YSESQ----LKNMTNIQS--------VGDTEIF
A0A3N1XSX6      ---------------------------YSINE----LKHMTTIKT--------INNTEIF
A0A1C6G0U3      ---------------------------NSYEE----VYSSINVQS--------IEDTQII
A0A3D4LLB3      ------------------------------KL----DDKSITVSP--------VKDTQII
A0A0A5GPA9      ---------------------------LEMEE----LVQRFTIGT--------NAESQII
A0A271M6M4      ---------------------------EKPEQ----LAKKIEVIS--------NSDSQVI
A0A2V3W8U6      ---------------------------FTNNE----LQKKLRVET--------NDNSQII
W1UFG0          ---------------------------MKAKK----LAKYIDVEN--------IQDTQII
A0A351SRI8      ---------------------------ISYEE----LKKNVKVGN--------VEDTEII
A0A1V5LU59      ---------------------------VDIKK----FKSNVNVQT--------VKDTRIF
A0A1E3BVC3      ---------------------------VGISE----FQNNVNVKT--------VKDSRLF
A0A4Q0I6S0      ---------------------------VGISE----FQNNVNVKT--------VKDSRLF
A3DF66          ---------------------------VGIQE----FQKNVNVKT--------VKDSRLF
W4V1T8          ---------------------------VGIRE----FQNNVTVKT--------VKDSRLF
A0A1I0RG99      ---------------------------YTPMQ----LKAMTHIKA--------INNTEIF
A0A1I5G322      ---------------------------LSREQ----LKNMTNIES--------INNTEIF
A0A1C6ITD7      ---------------------------LNLAD----LESMIKIRT--------TTESEFI
A0A381IX63      ---------------------------EDYHA----ISNSIDINS--------V-NGPVM
A0A1G9IUT4      ---------------------------TDVKK----LSNDIRVTT--------LTDTQII
A0A1M6RWV2      ---------------------------MSYGE----FSNKVRVNS--------VRDTEVI
A0A143XPI5      ---------------------------LGLEE----MNVNITASA--------VEETNLF
A0A355G1X5      ---------------------------CSFNISADQLRHYVSVNT--------QADTNII
A0A0M6WXE3      ---------------------------LDMDK----LDADISANV--------VKGTNML
A0A348SAK2      ---------------------------LDMDK----LDADISANV--------VKGTNML
A0A1G9H5B9      ---------------------------VSETH-----PGIDAGMVSSSLSMESVSETGVV
R5EFZ0          ---------------------------TDISS----FDGTIDTAV--------VPNTNLI
A0A1Y4H8L0      ---------------------------LEVDS----IDAAITSNV--------IPNTNLL
A0A0M6WYQ8      ---------------------------MKLDS----VPGSISVKA--------EEGTNML
A0A348SAK1      ---------------------------MKLDS----VPGSISVKA--------EEGTNML
A0A252F281      ---------------------------MGETS----LPAQLESSI--------IEGTNLL
A0A1Y4QKE6      ---------------------------LGVNS----LNGTLSAST--------VSESNIV
B1C231          ---------------------------LGVNS----LNGTLSAST--------VSESNIV
A0A1Y3TUL5      ---------------------------IK-------LVGIVETDIYKNLYLTRYKETQII
A0A1Y4JAX2      ---------------------------IK-------LVGIAETDIYKNLYLTRYKETQII
A0A1Y4T590      ---------------------------IE-------LVGIAETDIYKNLLLTRYKETQII
R5B467          ---------------------------TGLAT----LP-AISATS--------EEGTNLC
A0A1Y3T163      ---------------------------LGTDT----LNGTITSET--------VENSNMV
A0A1Y3YCA2      ---------------------------LGTDT----LNGTITSET--------VENSNMV
A0A1Y4L6N9      ---------------------------LGISS----INGSITASV--------VPDSNLI
A0A173T644      ---------------------------LGVDS----INGSISAQA--------VSDSNLI
A0A1C5TSB8      ---------------------------LGVDS----INGSISAQA--------VSDSNLI
C0CIK6          ---------------------------LGVDS----INGSISAQA--------VSDSNLI
A0A1Y3WEF6      ---------------------------LGVDA----VNGRISAQA--------VSDSNMI
A0A417T0L2      ---------------------------LGVDA----VNGSISAQA--------VSNSNMI
A0A1H9EPU3      ---------------------------YGLDLTYSGLASKVSVTS--------PTDTRIL
A0A354IGV3      ---------------------------IGVEN----LPAQIKTEV--------AKDTNVL
A0A417JMV2      ---------------------------MDMDY----FPGSASAEV--------VNETNLL
B0P408          ---------------------------MDMDY----FPGSASAEV--------VNETNLL
D4MV82          ---------------------------MDMDY----FPGSASAEV--------VNETNLL
A0A415VWX5      ---------------------------MDMDY----FPGSASAEV--------VNETNLL
A0A173UY96      ---------------------------MDMDY----FPGSASAEV--------VNETNLL
A0A173QTL1      ---------------------------MDMDY----FPGSASAEV--------VNETNLL
A0A174A3T7      ---------------------------MDMDY----FPGSASAEV--------VNETNLL
A0A174J359      ---------------------------MDMDY----FPGSASAEV--------VNETNLL
A0A417UUA3      ---------------------------MDMDY----FPGSASAEV--------VNETNLL
A0A1C6EUV9      ---------------------------MNMDY----FPGTASAEV--------VNETNLL
A0A173Y645      ---------------------------MNMDY----FPGTASAEV--------VNETNLL
A0A374AVY6      ---------------------------MNMDY----FPGTASAEV--------VNETNLL
R7BXS4          ---------------------------MNMDY----FPGTASAEV--------VNETNLL
A0A143ZUX1      ---------------------------LNPSQ----VKKMVSISQ--------ATGS-VL
S3FFL2          AG-------------------RSERLRIAGDI----LRSHIEISP--------ARLSRLV
A0A328M4V1      KGITIQVKSMLANPGTRFDVTRHGRLALITSL----QQALVATEQ--------GKDSGII
A0A5C8HCX2      DGVALTIADIKAKPGTQFVLSQRTELEAINAL----QETFTVSER--------SKESGML
A0A1W1Z4C3      -PG------------------------LSTDF----IRNVISMNS--------VHETPMV
A0A239QN83      -PG------------------------LTTDD----IRKVISMNS--------IHETPMV
A0A3R9WAA7      ---------------------------LGINE----LSEQITADN--------VKDTNLF
A0A1G6BLF1      ---------------------------LDMES----VPGTIAVAV--------VEETNMI
R6HZX3          ---------------------------LNTSW----INGTVTASS--------IGETNIF
A0A1W2CEA6      ---------------------------YSYSQ----LEKMVSVSN--------PSGSHLL
R7FFK6          -K-------------------------VTDTS----LKACFSMTA--------VDETEVL
A0A373MPB9      -R-------------------------VSNDD----LRNAYSMIA--------VNQTEVL
A0A373L519      -R-------------------------VSNDG----LRNAYSMTA--------VNQTEVL
A0A373W906      -R-------------------------VSNDG----LRNAYSMTA--------VNQTEVL
A0A373VCW2      -R-------------------------VSNDD----LRNAYSMIA--------VNQTEVL
W0U604          -R-------------------------VSNDD----LRNAYSMIA--------VNQTEVL
A0A374B6G0      -R-------------------------VSNDG----LRNAYSMTA--------VNQTEVL
A0A373VM36      -R-------------------------VSNDG----LRNAYSMTA--------VNQTEVL
A0A1C5P379      -R-------------------------VSNDG----LRNAYSMTA--------VNQTEVL
A0A373XXX0      -R-------------------------VSNDG----LRNAYSMTA--------VNQTEVL
A0A5R9MJM9      -R-------------------------VSNDG----LRNAYSMTA--------VNQTEVL
A0A356CW82      -R-------------------------VSNDG----LRNAYSMTA--------VNQTEVL
R6T4X7          -R-------------------------VSNDG----LRNAYSMTA--------VNQTEVL
A0A374HTV1      -R-------------------------VSNDG----LRNAYSMTA--------VNQTEVL
A0A374GB66      -R-------------------------VSNDG----LRNAYSMTA--------VNQTEVL
A0A374ECC6      -R-------------------------VSNDG----LRNAYSMTA--------VNQTEVL
A0A374BM61      -R-------------------------VSNDG----LRNAYSMTA--------VNQTEVL
A0A373UGZ4      -R-------------------------VSNDG----LRNAYSMTA--------VNQTEVL
A0A373SA66      -R-------------------------VSNDG----LRNAYSMTA--------VNQTEVL
A0A1C5X6X7      -R-------------------------VSNDG----LRNAYSMTA--------VNQTEVL
A0A1C6JIH3      -R-------------------------VSNDG----LRNAYSMTA--------VNQTEVL
A0A373PSC3      -R-------------------------VSNDG----LRNAYSMTA--------VNQTEVL
A0A1K1WYK8      -K-------------------------IDPAS----IRSCLTISS--------VTDTSAV
A0A1H6IUB1      -K-------------------------IAPAS----IRNCLSISS--------VTDTSAV
A0A1M7L1F9      -R-------------------------ISPSA----IRDCYSISS--------VTDTSAV
A0A1C6B4L6      -E-------------------------IETES----LRKCIELST--------VTDTSAV
A0A1Q6T9P4      -E-------------------------IETES----LRKCIELST--------VTDTSAV
A0A315Y4F9      -K-------------------------ITPAS----IRSCLAISS--------VTDTSAV
A0A354K620      -K-------------------------IAPAS----IRSCLAISS--------VTDTSAV
A0A355G3J9      ---------------------------LTAKQ----ILAMLSGSA--------INETEAF
A0A3D2AD87      ---------------------------YRLLK----NKISVSRSE--------EERSMLI
A0A2T5IYJ6      -QQIDWRQLLPRGHQSNPIPSDEEKLTLLVDR----FMANLSIEP--------IRQTQLV
A0A3C0QME1      ------------------M-NDGK---ISLSS----LRNKITMSS--------VDETEVM
A0A355FYK5      -------------------------------E----LRNAVVLGE--------TGVSGIF
A0A357AQU0      ------------------LDENGC---PTTGS----ILNYVSMGS--------VDNTEVL
A0A3C1YJQ7      ------------------LDENGC---PTTGS----ILNYVSMGS--------VDNTEVL
A0A3D0JG38      ------------------LDENGC---PTTGS----ILNYVSMGA--------VDNTEVL
A0A3C0IHX1      ------------------V-KNGV---ISTSE----LKDAISMSA--------DGDTEVL
R5V506          ------------------V-KNGV---ISTSE----LKDAISMSA--------DGDTEVL
A0A352TIU5      ------------------V-KNGV---ISTSE----LKDAISMSA--------DGDTEVL
A0A3E5FSY5      -----------------------------VNS----LNGTLSAST--------VSESNIV
A0A1V5S3C0      ---------------------------YSISQ----LKSCVSANV--------VTDTTMI
A0A1Y3TC98      -----------------------------TDT----LNGEISSET--------ITDSNVV
A0A1Q6REE0      ------------------------------ID----EVPAMSVSA--------TAHSSIL
R5ETF9          ------------------------------ID----EVPDMSVSA--------TAHSSIL
R6VAT5          -----------------------------LSD----VPGTLTATA--------VEDTNLF
A0A1Q6S448      ------------------------------MP----LNGTVSAQQ--------LGETNLI
A0A351MYR0      ------------------------------MP----LDGTVTAQQ--------LGETNLI
R6HPC1          ------------------------------MS----LDGTVSAQQ--------LGETNLI
A0A3D4G5Z5      ------------------------------MS----LDGTVSAQQ--------LGETNLI
A0A3D5ES03      ------------------------------MS----LDGTVSAQQ--------LGETNLI
A0A0F2P7X6      ---------------------------LPASA----ISPYVSVAP--------VRDTEVL
A0A359B487      ---------------------------LPAAA----ISPYVSVAP--------VRDTEVL
A0A348P5V4      ---------------------------ITASQ----IKRYVSVQS--------IEETQII
A0A356PT74      ---------------------------ISVAD----IKSWVSVEA--------VEDTAII
A0A3D5LL19      ---------------------------ISVSD----IKSWVSVEA--------VEDTAII
R5MNF0          ---------------------------ISVLD----IKNWVSVEA--------VEDTAII
A0A1Q9JSI0      -----------------------------MDY----FPGTASSEV--------INETNLL
A0A3D5TNI1      ---------------------------KTADE----VEEMIAASR--------KTDSSII
A0A358LJD0      ---------------------------KTADQ----VSKMIAASR--------KTDSSII
R6I3L7          ---------------------------KTADQ----VAKMIAVSR--------KTDSSII
A0A3D1HXX0      ---------------------------KTADQ----VAKMIAASR--------KTDSSII
A0A3D2QJB8      ---------------------------KTADQ----VAKMIAASR--------KTDSSII
D4LC36          ------------------IKNGK----ITNES----LKSAFTMAA--------VNNTEVL
R7MQJ4          ------------------IKDENGEESISAAS----IRNCLTMAA--------VGDTEVM
A0A1V5GLC0      ------------------SYQNR----ISPSS----IRNCMRITS--------VTDTSVL
W7V182          ------------------VVNGR----ITPAS----LRSCISISS--------VTDTSAL
                                                                            

A0A0H5SF45      QITLSSNSADDAYTLVEAMQKIAPQLIANI------------------------------
A0A1M6JRJ5      SITLTSKNPDDSYRLVKSMETIAPKLIEKI------------------------------
A0A1M7Y1S2      SITLTSNNPNDSYRLVKSMEMIVPKLIEKI------------------------------
A0A3D5R4X5      NIKVQNPNPEQARDIANKLAEVFQEEVVEI------------------------------
A0A1I4C3N6      VIYVVDPNPMNAQLIANTIGEIAPTRLVGL------------------------------
A0A3B9CIM7      VVRVVDQNPVNAMNIANAIGELAPNEIIRI------------------------------
A0A1G9WHW8      YVYVVDSNPLNAQKIANAIGELAPDMIVTL------------------------------
A0A1H5VAA0      YVYVVDSNPLNAQKIANAIGELAPDMIVTL------------------------------
A0A3R6VK11      YVYTYDSDPYRAMELANAIGRVAPKEIGRI------------------------------
A0A3R6QUY7      YVYTYDSDPYRAMELANAIGRVAPKEIGRI------------------------------
A0A373K3P9      YVYTYDSDPYRALELANAIGRVAPKEIGRI------------------------------
A0A3R6JRU5      YVYTYDSDPYRALELANAIGRVAPKEIGRI------------------------------
A0A1C5MS04      YVYTYDSDPYRAMELANAIGRVAPKEIGRI------------------------------
A0A3C1J150      YVYTYDSDPYRAMELANAIGRVAPKEISRI------------------------------
A0A416CXD7      YVYTYDSDPYRAMELANAIGRVAPKEIGRI------------------------------
R6XBL9          YVYTYDSDPYRAMELANAIGRVAPKEIGRI------------------------------
A0A355W5Z7      YVYTYDSDPYRAMELANAIGRVAPKEIGRI------------------------------
A0A143WVN6      TLTVTSDTPAHAYQMIQSALDNYSSVSDYL------------------------------
W6RXP9          EIKLQGKKPKEIAEILNGINNEFIFQANEL------------------------------
W6S4G8          QIKLTGKNKDDLAVVLESITEEFIKESKEI------------------------------
A0A1G6BLB6      TLSVTESSPKMTYAVMNAILDNYSSVSDKV------------------------------
B5CSZ7          RMSASGTNAESAYKLLKGALQQYPELSDYF------------------------------
A0A1C6G8M0      RIRVVSGNKEEAVDIANEILSVSIEEIPHV------------------------------
A0A416MP73      KIYVTAGTVREAVNIANEILSVSVDEIPHV------------------------------
A0A3E4LL92      RMSASGTNAESAYKLLKGALKQYPELSDYF------------------------------
A0A415D1L1      KMSASGTNAESAYKLLKGALQQYPELSDYF------------------------------
A0A414P2K5      RMSASGTNAESAYKLLKGALQQYPELSDYF------------------------------
V8C417          RMSASGTNAESAYKLLKGALQQYPELSDYY------------------------------
A0A143XN92      VLRVTADTSKKAFQILRAIMENYTVVSDYV------------------------------
A0A173ZYY6      VLSVTADTPKDSIDIIRTVMDNYSSVSLYT------------------------------
A0A4Q5EHM9      VLSVTADTPKDSIDIIRTVMDNYSSVSLYT------------------------------
A0A173SMI2      VLSVTADTPKDSIDIIRTVMDNYSSVSLYT------------------------------
A0A174ASH7      VLSVTADTPKESIDIIRTVMDNYSSVSLYT------------------------------
A6BH65          VLSVTADTPKESIDIIRTVMDNYSSVSLYT------------------------------
R7G0D7          VLSVTADTPKESIDIIRTVMDNYSSVSLYT------------------------------
A0A396G6S7      TLSVKAGTAAESYRILQSVMENYNTVSDYA------------------------------
A0A3E5A223      TLSVKAGTAAESYRILQSVMENYNTVSDYA------------------------------
R7D5E6          TLSVKAGTAAESYRILQSVMENYNTVSDYA------------------------------
A0A415HQH5      TLSVKAGTAAESYRILQSVMENYNTVSDYA------------------------------
A0A414W2C6      TFSVKAGTAAESYRILQSVMENYNTVSDYA------------------------------
A5ZNE7          TLSVKAGTAAESYRILQSVMENYNTVSDYA------------------------------
A0A395X821      TLSVKAGTAAESYRVLQSVMENYNTVSDYA------------------------------
A0A1C5PY68      TLSVKAGTAAESYRVLQSVMENYNTVSDYA------------------------------
A0A174CJF8      TFSVKAGTAAESYRVLQSVMENYNTVSDYA------------------------------
A0A564SRR2      TFSVKAGTAAESYRVLQSVMENYNTVSDYA------------------------------
A0A174R7V0      TFSVKAETAAESYRVLQSVMENYNTVSDYA------------------------------
A0A373MWV2      ELSVTADSPETAFRVLRSVLKNYTTISDYI------------------------------
A0A417CE88      ELSVTADSPETAFRVLRSVLKNYTTISDYI------------------------------
A0A416Y441      ELSVTADSPETAFRVLRSVLKNYTTISDYI------------------------------
A0A357GPJ7      ELSVTADSPETAFRVLRSVLKNYTTISDYI------------------------------
A0A396PAC1      ELSVTADSPETAFRVLRSVLKNYTTISDYI------------------------------
A0A416EYU4      ELSVTADSPETAFRVLRSVLKNYTTISDYI------------------------------
A0A416SCQ2      ELSVTADSPETAFRVLRSVLKNYTTISDYI------------------------------
A0A416TGN7      ELSVTADSPETAFRVLRSVLKNYTTISDYI------------------------------
A0A417SMF6      ELSVTADSPETAFRVLRSVLKNYTTISDYI------------------------------
A0A1Y4MW77      TMTVISSDPDDAKEILESTIRVYPSVARFV------------------------------
R6UHV6          SFTVTSDSPIKSYRLLKAVLECYPQFTKNV------------------------------
A0A3R9Q621      QVSVTTNSASDSFELAKAIQNIAPDFIKSI------------------------------
A0A069RC75      KISASSTDPALAAAIANEIAQVFKEEIFRI------------------------------
A0A174F2W5      ELSVTADSPETAFRVLRSVLKNYTTISDYI------------------------------
A0A174S8E9      ELSVTADSPETAFRVLRSVLKNYTTISDYI------------------------------
A0A416ZL97      ELSVTADSPEMAFRILKSVLNNYTSISDYI------------------------------
A0A174LSK1      ELSVTADSPEMAFRILKSVLNNYTSISDYI------------------------------
A0A373GY92      ELSVTADSPEMAFRILKSVLNNYTSISDYI------------------------------
A0A373NZQ6      ELSVTADSPEMAFRILKSVLNNYTSISDYI------------------------------
A0A417I9B9      ELSVTADSPEMAFRILKSVLNNYTSISDYI------------------------------
A0A417MP97      ELSVTADSPEMAFRILKSVLNNYTSISDYI------------------------------
A0A417WQF8      ELSVTADSPEMAFRILKSVLNNYTSISDYI------------------------------
A0A373RZ83      ELSVTADSPEMAFRILKSVLNNYTSISDYI------------------------------
A0A416U6I1      ELSVTADSPEMAFRILKSVLNNYTSISDYI------------------------------
R7JQZ9          ELSVTADSPEMAFRILKSVLNNYTSISDYI------------------------------
A0A3B8KKL6      KISYEDSNPTLARDVVNELSNEIQELAADI------------------------------
A0A2K9E6R0      KISYEDSNPTLARDVVNELSNEIQELAADI------------------------------
A0A2S8RBI0      KISYEDSNPTLARDVVNELSNEIQELAADI------------------------------
A0A0L6JLG6      KISYEDYDPKLAAKVVNELGTIIMQLASDI------------------------------
G8LSN0          SISYEDTDPKLAADVVNELALVIKQLASDV------------------------------
A0A1M5UYN6      NITVQAGNEEEAKEIVLAITQSFKENAEKL------------------------------
A0A176JBT8      SIIVENKNPDDAALIANKTAVIFQSEIKKL------------------------------
A0A1I5HIC6      EISVQNPNPETAKQLADSIAEESAERMVSI------------------------------
A0A1Y3TC51      VLSVTCRHPRDAYLFINAALEHYGEVAGDV------------------------------
A0A1Y3T1N0      TLSVSSPDPRQAYLFINSALENYEQVAQDV------------------------------
A0A1Y3Y8U8      TLSVSSPDPRQAYLFINSALENYEQVAQDV------------------------------
A0A5B0BQY5      TITARDSTPEKAANLANTYALTFQEEIRTL------------------------------
A6CLL4          SITATALNPNQAVDIVNNTAETFKEETYNL------------------------------
A0A174DL89      NITVEGKVPEVTTLVANQLTLSLKNISSEI------------------------------
A0A176U8D6      KINVVSQDQKEAVDIANEILQISIEEIPNV------------------------------
A0A1Q6KSQ5      RIRVVSGNKEEAVDIANEILSVSIEEIPHV------------------------------
A0A3D3U8B3      RIRVVSGNKEEAVDIANEILSVSIEEIPHV------------------------------
A0A3E5FRL7      VLNVTSKDPQNAYQFMNSALKHYDEVSDYV------------------------------
A0A1Y4QK93      VLNVTSKDPQNAYQFMNSALKHYNEVSDYV------------------------------
B1C232          VLNVTSKDPQNAYQFMNSALKHYDEVSDYV------------------------------
A0A401USI6      EISYKSKNPEIAAEGANALSQAFIEESQNL------------------------------
A0A1V4IQ10      EIKYKNLNKSLAKDTVSAITNEFIKETQEL------------------------------
A0A1S8TRD2      EIRYINLNKSLAKDTVSAITDEFIKETQEL------------------------------
G7M1U2          EIRYINLNKSLAKDTVSAITDEFIKETQEL------------------------------
A0A2T6KJ75      TILAEEKTPEKAAALANTLATTFQEEIKTL------------------------------
A9KN92          EITVQNQDPLLAKQLADSIAEVASERMVSV------------------------------
A0A352MUJ1      KISVLDSNKDDAATIANSIAEVFSEQVKEY------------------------------
R5YI67          KISVQDSNKDEAPIIANSIAEVFSEQIKEI------------------------------
A0A1Y0IQP5      SVTVTDHDPKQAVAIANAMAAVFMENLSRI------------------------------
A0A4R2R7B1      AVTVTDHDPKQAVTIANAMAAVFMENLGRI------------------------------
A0A1M6E8I2      KISVKNTDPAMASEIANTIADVFIKEVMRI------------------------------
A0A1Y4N105      TLTVTSNTPKMTYQIMQSALDNYTSVSDYL------------------------------
A0A1Y4QP75      TLTVTSNTPKMTYQIMQSALDNYTSVSDYL------------------------------
A0A3D4QRB5      RITVEDLIPEQARDIADSTAEVFISEVNKL------------------------------
A0A349DEH5      VMSVTTGNPQTSYAIAQTACEVYGDIVAEK------------------------------
A0A3D4T7B4      VMSVTTGNPQTSYAIAQTACEVYGDIVAEK------------------------------
A0A350XYC7      VMSVTTDNPKTSYAIANTVVDVYGDIVSEI------------------------------
R6DNR8          VMSVTTGDPKIAYAIASTVVDVYGDIVSER------------------------------
A0A355KUM5      VMSVTTGDPKISYAIASTVVDVYGDIVTER------------------------------
R5YGY6          VMSVTTGDPKISYAIASTVVDVYGDIVTER------------------------------
A0A0K8J554      KISVNSHSASDSYELVKAMEYIAPQIISEV------------------------------
A0A3N1XSX6      QISVTSSSARDSYTLVETMQRIAPQLIKSI------------------------------
A0A1C6G0U3      KISVQNKSPEIARDIANSIPEIFKEEVKRL------------------------------
A0A3D4LLB3      KVAVQNTDPVLARDIADALVEEFTLEIQRI------------------------------
A0A0A5GPA9      TVQAVGPSKEAASELVNVTLDTFQQEVESL------------------------------
A0A271M6M4      TLKVEASSQKQAVKLANSTAEIFKTEIKSL------------------------------
A0A2V3W8U6      SLYVKENDLDTAVEIANLFATKSKEEISQL------------------------------
W1UFG0          KISVRNGNPKTAAKICNEIPIVFEKEVKRI------------------------------
A0A351SRI8      LIYVYNEDARLSRKIANEIASVFESEIVGI------------------------------
A0A1V5LU59      SISYEDTDPELAANVVNELSVVIKQMATDI------------------------------
A0A1E3BVC3      SISYEDTDPKRAADVVNELASVIQKMADEI------------------------------
A0A4Q0I6S0      SISYEDTDPKRAADVVNELASVIQKMADEI------------------------------
A3DF66          SISYEDTDPKRAADIVNELATVIQKMADEI------------------------------
W4V1T8          SISYEDTDPKRAADVVNELASVIQKMADEI------------------------------
A0A1I0RG99      EISVTTTNPNDAYKLVDAMKKIAPVLIKSI------------------------------
A0A1I5G322      EISVSSMNPNHSFLLVKSMEKIAPELIKSI------------------------------
A0A1C6ITD7      SISIEGKIAKDTATIANQLVLSLKNISSEL------------------------------
A0A381IX63      NITVKNADPKVAREIANEVPVVFGGELENI------------------------------
A0A1G9IUT4      NVSVREDNPKLANNIANEIASVFTSELSRI------------------------------
A0A1M6RWV2      EIKVQDTNPQLAARIANELSEVFIDRIHEF------------------------------
A0A143XPI5      RIETSGRDPELVYEVLESVIKNYPEVAEYI------------------------------
A0A355G1X5      IVSVTTESPDKSYEIASGIASHYQDIVDYA------------------------------
A0A0M6WXE3      TLSVTAHSPKDSIDIIKTVMDNYTSISYYT------------------------------
A0A348SAK2      TLSVTAHSPKDSIDIIKTVMDNYTSISYYT------------------------------
A0A1G9H5B9      AVKSTTLEAQLSADIANAVMEIAPEEIVRV------------------------------
R5EFZ0          TMTVTDSDPRMAFLAAQAIIEHHESLTYQV------------------------------
A0A1Y4H8L0      ELSVSSSSPREAFDTIHAVMDNYAQVSYFS------------------------------
A0A0M6WYQ8      TISVSGTNAELSYKTLKSVIKNYPEVAQFV------------------------------
A0A348SAK1      TISVSGTNAELSYKTLKSVIKNYPEVAQFV------------------------------
A0A252F281      TISATADNARTAFLTVKAVMENYNTVSDQV------------------------------
A0A1Y4QKE6      TMSVESNSPQDAMSILTSAIEVYPDAARFV------------------------------
B1C231          TMGVESNSPQDAMSILTSAIEIYPDVARFV------------------------------
A0A1Y3TUL5      EMDLTWRSAEEGVEILNAINEVAPEILIET------------------------------
A0A1Y4JAX2      EMDLTWRSAEEGVEILNAINEVAPEILIET------------------------------
A0A1Y4T590      EMDLTWRSAEEGVEILNAINEVAPEILIET------------------------------
R5B467          TLSVTGSDAQQCYDVLQSVIVHYPDVAELV------------------------------
A0A1Y3T163      TMRVESPDPEDAREILDTALEIYPETARFV------------------------------
A0A1Y3YCA2      TMRVESPDPEDARKILDTALEIYPETARFV------------------------------
A0A1Y4L6N9      TMSVVSMNASEAKTILESAIRVYPNISRFV------------------------------
A0A173T644      TMTVTSSDPQDAKAILESAIKVYPEVSRFV------------------------------
A0A1C5TSB8      TMTVTSSDPQDAKAILESAIKVYPEVSRFV------------------------------
C0CIK6          TMTVTSSDPQDAKAILESAIKVYPEVSRFV------------------------------
A0A1Y3WEF6      TMTVTSNSPEDARAILESTIKVYPDVVRFV------------------------------
A0A417T0L2      TMTVTSNSAEDAKAILESAIKVYPDVARFV------------------------------
A0A1H9EPU3      TITVTDPDPVMSKNLADSIRDAAIKHIQGI------------------------------
A0A354IGV3      TLTSTADTAYDAFICLKAVTENYNLISDNV------------------------------
A0A417JMV2      VLKVQADSPEMAFRLNKAIMNNYSVVTDQL------------------------------
B0P408          VLKVQADSPEMAFRLNKAIMNNYSVVTDQL------------------------------
D4MV82          VLKVQADSPEMAFRLNKAIMNNYSVVTDQL------------------------------
A0A415VWX5      VLKVQADSPEMAFRLNKAIMNNYSVVTDQL------------------------------
A0A173UY96      VLKVQADSPEMAFRLNKAIMNNYSVVTDQL------------------------------
A0A173QTL1      VLKVQADSPEMAFRLNKAIMNNYSVVTDQL------------------------------
A0A174A3T7      VLKVQADSPEMAFRLNKAIMNNYSVVTDQL------------------------------
A0A174J359      VLKVQADSPEMAFRLNKAIMNNYSVVTDQL------------------------------
A0A417UUA3      VLKVQADSPEMAFRLNKAIMNNYSVVTDQL------------------------------
A0A1C6EUV9      VLKVQADSPEMAFRLNKAIMNNYSVVTNQL------------------------------
A0A173Y645      VLKVQADSPEMAFSLNKAIMNNYSVVTNRL------------------------------
A0A374AVY6      VLKVQADSPEMAFSLNKAIMNNYSVVTNQL------------------------------
R7BXS4          VLKVQADSPEMAFSLNKAIMNNYSVVTNQL------------------------------
A0A143ZUX1      ELKVTASDPETAYRLAVAYMGAIDIVVNPKDDS---------------------------
S3FFL2          DLYFTSPDASFSARVVNAWADAYIQTNLERKSQATSYGRNLLQRQLAQAKERLDESQRQL
A0A328M4V1      ELDYRNADPVLATQLVDQISALYVRQNVDRNSAEAANSLAFVKQQLPKVRLELEQATQAM
A0A5C8HCX2      ELTMTGDDPQLITRILNSIANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSELDQAEEKL
A0A1W1Z4C3      RVSCTTPYPELSADICNSVLQVAPTAIKDV------------------------------
A0A239QN83      QVSCTTTDPKLSADICNSVLQVAPTAIKDV------------------------------
A0A3R9WAA7      TIRVSSDNPTRAYEVLQSVIKNYPKVAETV------------------------------
A0A1G6BLF1      TIKATADSAQMAYNILQAVIESYPIVAESV------------------------------
R6HZX3          TLTVTSTNPQDAYDILNAVIQNYPQVASFV------------------------------
A0A1W2CEA6      YIYVKSSVPEEAKLLADTYAEVVQDYIANK------------------------------
R7FFK6          KITTTTQNAELSASLCNIMADVAPQFLIRV------------------------------
A0A373MPB9      QITATTTNAKLSSDLCNIMADVAPSFLIRV------------------------------
A0A373L519      QITATTTNAKLSSDLCNIMADVAPSFLIRV------------------------------
A0A373W906      QITATTTNAKLSSDLCNIMADVAPSFLIRV------------------------------
A0A373VCW2      QITATTTNAKLSSDLCNIMADVAPSFLIRV------------------------------
W0U604          QITATTTNAKLSSDLCNIMADVAPSFLIRV------------------------------
A0A374B6G0      QITATTTNAKLSSDLCNIMADVAPSFLIRV------------------------------
A0A373VM36      QITATTTNAKLSSDLCNIMADVAPSFLIRV------------------------------
A0A1C5P379      QITATTTNAKLSSDLCNIMADVAPSFLIRV------------------------------
A0A373XXX0      QITATTTNAKLSSDLCNIMADVAPSFLIRV------------------------------
A0A5R9MJM9      QITATTTNAKLSSDLCNIMADVAPSFLIRV------------------------------
A0A356CW82      QITATTTNAKLSSDLCNIMADVAPSFLIRV------------------------------
R6T4X7          QITATTTNAKLSSDLCNIMADVAPSFLIRV------------------------------
A0A374HTV1      QITATTTNAKLSSDLCNIMADVAPSFLIRV------------------------------
A0A374GB66      QITATTTNAKLSSDLCNIMADVAPSFLIRV------------------------------
A0A374ECC6      QITATTTNAKLSSDLCNIMADVAPSFLIRV------------------------------
A0A374BM61      QITATTTNAKLSSDLCNIMADVAPSFLIRV------------------------------
A0A373UGZ4      QITATTTNAKLSSDLCNIMADVAPSFLIRV------------------------------
A0A373SA66      QITATTTNAKLSSDLCNIMADVAPSFLIRV------------------------------
A0A1C5X6X7      QITATTTNAKLSSDLCNIMADVAPSFLIRV------------------------------
A0A1C6JIH3      QITATTTNAKLSSDLCNIMADVAPSFLIRV------------------------------
A0A373PSC3      QITATTTNAKLSSDLCNIMADVAPSFLIRV------------------------------
A0A1K1WYK8      TITATTVNPNLAADICNDITQVAPKYVEEA------------------------------
A0A1H6IUB1      KIVSTTKNAEVAAALCNDLTEVAPSYVEEA------------------------------
A0A1M7L1F9      KIVATTKNAEVAAALCNDLTEVAPDYVEEA------------------------------
A0A1C6B4L6      KVIATAKNPEIAASICNNLTSIAPEYVAKA------------------------------
A0A1Q6T9P4      KVIATAKNPEIAASICNNLTSIAPEYVAKA------------------------------
A0A315Y4F9      KVNATAKNAEVAAAICNDLTQVAPQYVEEA------------------------------
A0A354K620      KVTATAENAEVAAAICNDLTQVAPKYVEEA------------------------------
A0A355G3J9      YISAEHTNRQLATDVLTDIVKVAPQEIIRV------------------------------
A0A3D2AD87      YISATSTDKNEAIDLANDFAALCQTFIPNN------------------------------
A0A2T5IYJ6      KISFESHDRSLTAAVANAMAKTYINSQMEARITLTQQAAEWLSSRLGVLKSNVEVSEKKL
A0A3C0QME1      KITANTTNPEISAAICNQIAESAEECLTRI------------------------------
A0A355FYK5      SLTVTNIYPEFCSRTMDAVLDVFPDYMRTS------------------------------
A0A357AQU0      KVSATTPDAKLSAEISNIFAEVAPDYLIRI------------------------------
A0A3C1YJQ7      KVSATTPDAKLSAEISNIFAEVAPDYLIRI------------------------------
A0A3D0JG38      KVSATTPNAKLSAEISNIFAEVAPDYLIRI------------------------------
A0A3C0IHX1      KISAQTKDPHVSAEICDIYAEVAPTFLIRI------------------------------
R5V506          KISAQTKDPHVSAEICDIYAEVAPTFLIRI------------------------------
A0A352TIU5      KISAQTKDPHVSAEICDIYAEVAPTFLIRI------------------------------
A0A3E5FSY5      TMGVESNSPQDAMSILTSAIEIYPDVARFV------------------------------
A0A1V5S3C0      SVSVSTHDPDMSYQIAKALTSVYSQVMEGS------------------------------
A0A1Y3TC98      TMRVESPDPEDARAILEAALAIYPETARFV------------------------------
A0A1Q6REE0      TLKVRDTDPQRAYDVMSAVIACYPEVAEFV------------------------------
R5ETF9          TLKVRDTDPQRAYDVMSAVIACYPEVAEFV------------------------------
R6VAT5          TITVTSSNYETAYNVLKSVINNYPSVAEYV------------------------------
A0A1Q6S448      RVTVTADTPRQALVLLQAVSDNYGSLSAHV------------------------------
A0A351MYR0      RVTVTADTPRQALVLLKAVSDNYGSLSAHV------------------------------
R6HPC1          RVTVTADTPRQALVLLKAVSDNYGTLSAHV------------------------------
A0A3D4G5Z5      RVTVTADTPRQALVLLKAVSDNYGTLSAHV------------------------------
A0A3D5ES03      RVTVTADTPRQALVLLKAVSDNYGTLSAHV------------------------------
A0A0F2P7X6      RIFVSNPDPLLAAKICNSIMHVAPTAISST------------------------------
A0A359B487      RIFVSNPDPLLAAKICNSIMHVAPTAISST------------------------------
A0A348P5V4      YLTVTTTNPDVSYGIAQAYVDNYNEAIATA------------------------------
A0A356PT74      NLTVTTPNADVSYGIANAYVNNYESAINAA------------------------------
A0A3D5LL19      NLTVTTPNADVSYGIANAYVNNYESAINAA------------------------------
R5MNF0          NLTVTTPNADVSYGIANAYVNNYESAINAA------------------------------
A0A1Q9JSI0      VLKVQADSPELAFRLNKAIMNNYSVVSDEL------------------------------
A0A3D5TNI1      DMTVTAGSPEEAYELAQAVKDTYKDVVQVY------------------------------
A0A358LJD0      DMTVTASSPEEAYELAQAVKDTYKDVVQVY------------------------------
R6I3L7          DMTVTASSPEEAYELAQAVKDTYKDVVRVY------------------------------
A0A3D1HXX0      DMTVTASSPEEAYELAQAVKDTYKDVVQVY------------------------------
A0A3D2QJB8      DMTVTASSPEEAYELAQAVKDTYKDVVQVY------------------------------
D4LC36          KITATTKNAALSAELCNIMADVAPEVLIRV------------------------------
R7MQJ4          KITAETADPEVSAALCNIISNVTPDFLIRV------------------------------
A0A1V5GLC0      TVSATTRSPEVAAAICNDVAEVAPKFLDDA------------------------------
W7V182          KLSAVTKNPEVSAAICNDIAKVAPDYLHDA------------------------------
                 .                                                          

A0A0H5SF45      ------------------------------------------------------------
A0A1M6JRJ5      ------------------------------------------------------------
A0A1M7Y1S2      ------------------------------------------------------------
A0A3D5R4X5      ------------------------------------------------------------
A0A1I4C3N6      ------------------------------------------------------------
A0A3B9CIM7      ------------------------------------------------------------
A0A1G9WHW8      ------------------------------------------------------------
A0A1H5VAA0      ------------------------------------------------------------
A0A3R6VK11      ------------------------------------------------------------
A0A3R6QUY7      ------------------------------------------------------------
A0A373K3P9      ------------------------------------------------------------
A0A3R6JRU5      ------------------------------------------------------------
A0A1C5MS04      ------------------------------------------------------------
A0A3C1J150      ------------------------------------------------------------
A0A416CXD7      ------------------------------------------------------------
R6XBL9          ------------------------------------------------------------
A0A355W5Z7      ------------------------------------------------------------
A0A143WVN6      ------------------------------------------------------------
W6RXP9          ------------------------------------------------------------
W6S4G8          ------------------------------------------------------------
A0A1G6BLB6      ------------------------------------------------------------
B5CSZ7          ------------------------------------------------------------
A0A1C6G8M0      ------------------------------------------------------------
A0A416MP73      ------------------------------------------------------------
A0A3E4LL92      ------------------------------------------------------------
A0A415D1L1      ------------------------------------------------------------
A0A414P2K5      ------------------------------------------------------------
V8C417          ------------------------------------------------------------
A0A143XN92      ------------------------------------------------------------
A0A173ZYY6      ------------------------------------------------------------
A0A4Q5EHM9      ------------------------------------------------------------
A0A173SMI2      ------------------------------------------------------------
A0A174ASH7      ------------------------------------------------------------
A6BH65          ------------------------------------------------------------
R7G0D7          ------------------------------------------------------------
A0A396G6S7      ------------------------------------------------------------
A0A3E5A223      ------------------------------------------------------------
R7D5E6          ------------------------------------------------------------
A0A415HQH5      ------------------------------------------------------------
A0A414W2C6      ------------------------------------------------------------
A5ZNE7          ------------------------------------------------------------
A0A395X821      ------------------------------------------------------------
A0A1C5PY68      ------------------------------------------------------------
A0A174CJF8      ------------------------------------------------------------
A0A564SRR2      ------------------------------------------------------------
A0A174R7V0      ------------------------------------------------------------
A0A373MWV2      ------------------------------------------------------------
A0A417CE88      ------------------------------------------------------------
A0A416Y441      ------------------------------------------------------------
A0A357GPJ7      ------------------------------------------------------------
A0A396PAC1      ------------------------------------------------------------
A0A416EYU4      ------------------------------------------------------------
A0A416SCQ2      ------------------------------------------------------------
A0A416TGN7      ------------------------------------------------------------
A0A417SMF6      ------------------------------------------------------------
A0A1Y4MW77      ------------------------------------------------------------
R6UHV6          ------------------------------------------------------------
A0A3R9Q621      ------------------------------------------------------------
A0A069RC75      ------------------------------------------------------------
A0A174F2W5      ------------------------------------------------------------
A0A174S8E9      ------------------------------------------------------------
A0A416ZL97      ------------------------------------------------------------
A0A174LSK1      ------------------------------------------------------------
A0A373GY92      ------------------------------------------------------------
A0A373NZQ6      ------------------------------------------------------------
A0A417I9B9      ------------------------------------------------------------
A0A417MP97      ------------------------------------------------------------
A0A417WQF8      ------------------------------------------------------------
A0A373RZ83      ------------------------------------------------------------
A0A416U6I1      ------------------------------------------------------------
R7JQZ9          ------------------------------------------------------------
A0A3B8KKL6      ------------------------------------------------------------
A0A2K9E6R0      ------------------------------------------------------------
A0A2S8RBI0      ------------------------------------------------------------
A0A0L6JLG6      ------------------------------------------------------------
G8LSN0          ------------------------------------------------------------
A0A1M5UYN6      ------------------------------------------------------------
A0A176JBT8      ------------------------------------------------------------
A0A1I5HIC6      ------------------------------------------------------------
A0A1Y3TC51      ------------------------------------------------------------
A0A1Y3T1N0      ------------------------------------------------------------
A0A1Y3Y8U8      ------------------------------------------------------------
A0A5B0BQY5      ------------------------------------------------------------
A6CLL4          ------------------------------------------------------------
A0A174DL89      ------------------------------------------------------------
A0A176U8D6      ------------------------------------------------------------
A0A1Q6KSQ5      ------------------------------------------------------------
A0A3D3U8B3      ------------------------------------------------------------
A0A3E5FRL7      ------------------------------------------------------------
A0A1Y4QK93      ------------------------------------------------------------
B1C232          ------------------------------------------------------------
A0A401USI6      ------------------------------------------------------------
A0A1V4IQ10      ------------------------------------------------------------
A0A1S8TRD2      ------------------------------------------------------------
G7M1U2          ------------------------------------------------------------
A0A2T6KJ75      ------------------------------------------------------------
A9KN92          ------------------------------------------------------------
A0A352MUJ1      ------------------------------------------------------------
R5YI67          ------------------------------------------------------------
A0A1Y0IQP5      ------------------------------------------------------------
A0A4R2R7B1      ------------------------------------------------------------
A0A1M6E8I2      ------------------------------------------------------------
A0A1Y4N105      ------------------------------------------------------------
A0A1Y4QP75      ------------------------------------------------------------
A0A3D4QRB5      ------------------------------------------------------------
A0A349DEH5      ------------------------------------------------------------
A0A3D4T7B4      ------------------------------------------------------------
A0A350XYC7      ------------------------------------------------------------
R6DNR8          ------------------------------------------------------------
A0A355KUM5      ------------------------------------------------------------
R5YGY6          ------------------------------------------------------------
A0A0K8J554      ------------------------------------------------------------
A0A3N1XSX6      ------------------------------------------------------------
A0A1C6G0U3      ------------------------------------------------------------
A0A3D4LLB3      ------------------------------------------------------------
A0A0A5GPA9      ------------------------------------------------------------
A0A271M6M4      ------------------------------------------------------------
A0A2V3W8U6      ------------------------------------------------------------
W1UFG0          ------------------------------------------------------------
A0A351SRI8      ------------------------------------------------------------
A0A1V5LU59      ------------------------------------------------------------
A0A1E3BVC3      ------------------------------------------------------------
A0A4Q0I6S0      ------------------------------------------------------------
A3DF66          ------------------------------------------------------------
W4V1T8          ------------------------------------------------------------
A0A1I0RG99      ------------------------------------------------------------
A0A1I5G322      ------------------------------------------------------------
A0A1C6ITD7      ------------------------------------------------------------
A0A381IX63      ------------------------------------------------------------
A0A1G9IUT4      ------------------------------------------------------------
A0A1M6RWV2      ------------------------------------------------------------
A0A143XPI5      ------------------------------------------------------------
A0A355G1X5      ------------------------------------------------------------
A0A0M6WXE3      ------------------------------------------------------------
A0A348SAK2      ------------------------------------------------------------
A0A1G9H5B9      ------------------------------------------------------------
R5EFZ0          ------------------------------------------------------------
A0A1Y4H8L0      ------------------------------------------------------------
A0A0M6WYQ8      ------------------------------------------------------------
A0A348SAK1      ------------------------------------------------------------
A0A252F281      ------------------------------------------------------------
A0A1Y4QKE6      ------------------------------------------------------------
B1C231          ------------------------------------------------------------
A0A1Y3TUL5      ------------------------------------------------------------
A0A1Y4JAX2      ------------------------------------------------------------
A0A1Y4T590      ------------------------------------------------------------
R5B467          ------------------------------------------------------------
A0A1Y3T163      ------------------------------------------------------------
A0A1Y3YCA2      ------------------------------------------------------------
A0A1Y4L6N9      ------------------------------------------------------------
A0A173T644      ------------------------------------------------------------
A0A1C5TSB8      ------------------------------------------------------------
C0CIK6          ------------------------------------------------------------
A0A1Y3WEF6      ------------------------------------------------------------
A0A417T0L2      ------------------------------------------------------------
A0A1H9EPU3      ------------------------------------------------------------
A0A354IGV3      ------------------------------------------------------------
A0A417JMV2      ------------------------------------------------------------
B0P408          ------------------------------------------------------------
D4MV82          ------------------------------------------------------------
A0A415VWX5      ------------------------------------------------------------
A0A173UY96      ------------------------------------------------------------
A0A173QTL1      ------------------------------------------------------------
A0A174A3T7      ------------------------------------------------------------
A0A174J359      ------------------------------------------------------------
A0A417UUA3      ------------------------------------------------------------
A0A1C6EUV9      ------------------------------------------------------------
A0A173Y645      ------------------------------------------------------------
A0A374AVY6      ------------------------------------------------------------
R7BXS4          ------------------------------------------------------------
A0A143ZUX1      ------------------------------------------------------------
S3FFL2          VNYASQQQIINLPAPSSGASGTTTSERSIVADNLATLNAALTQATADRIQAEARYQQAGR
A0A328M4V1      NAFQTRAHSVDI-----------SMQTKALLDQIVAIDASLQ------------------
A0A5C8HCX2      NVYRQQRDSVDL-----------NLEAKAVLEQIVNVDNQLN------------------
A0A1W1Z4C3      ------------------------------------------------------------
A0A239QN83      ------------------------------------------------------------
A0A3R9WAA7      ------------------------------------------------------------
A0A1G6BLF1      ------------------------------------------------------------
R6HZX3          ------------------------------------------------------------
A0A1W2CEA6      ------------------------------------------------------------
R7FFK6          ------------------------------------------------------------
A0A373MPB9      ------------------------------------------------------------
A0A373L519      ------------------------------------------------------------
A0A373W906      ------------------------------------------------------------
A0A373VCW2      ------------------------------------------------------------
W0U604          ------------------------------------------------------------
A0A374B6G0      ------------------------------------------------------------
A0A373VM36      ------------------------------------------------------------
A0A1C5P379      ------------------------------------------------------------
A0A373XXX0      ------------------------------------------------------------
A0A5R9MJM9      ------------------------------------------------------------
A0A356CW82      ------------------------------------------------------------
R6T4X7          ------------------------------------------------------------
A0A374HTV1      ------------------------------------------------------------
A0A374GB66      ------------------------------------------------------------
A0A374ECC6      ------------------------------------------------------------
A0A374BM61      ------------------------------------------------------------
A0A373UGZ4      ------------------------------------------------------------
A0A373SA66      ------------------------------------------------------------
A0A1C5X6X7      ------------------------------------------------------------
A0A1C6JIH3      ------------------------------------------------------------
A0A373PSC3      ------------------------------------------------------------
A0A1K1WYK8      ------------------------------------------------------------
A0A1H6IUB1      ------------------------------------------------------------
A0A1M7L1F9      ------------------------------------------------------------
A0A1C6B4L6      ------------------------------------------------------------
A0A1Q6T9P4      ------------------------------------------------------------
A0A315Y4F9      ------------------------------------------------------------
A0A354K620      ------------------------------------------------------------
A0A355G3J9      ------------------------------------------------------------
A0A3D2AD87      ------------------------------------------------------------
A0A2T5IYJ6      QAYREENNLVDSGNNFGVLGLSAGQLQQTNQRLIEAQFKVAE------------------
A0A3C0QME1      ------------------------------------------------------------
A0A355FYK5      ------------------------------------------------------------
A0A357AQU0      ------------------------------------------------------------
A0A3C1YJQ7      ------------------------------------------------------------
A0A3D0JG38      ------------------------------------------------------------
A0A3C0IHX1      ------------------------------------------------------------
R5V506          ------------------------------------------------------------
A0A352TIU5      ------------------------------------------------------------
A0A3E5FSY5      ------------------------------------------------------------
A0A1V5S3C0      ------------------------------------------------------------
A0A1Y3TC98      ------------------------------------------------------------
A0A1Q6REE0      ------------------------------------------------------------
R5ETF9          ------------------------------------------------------------
R6VAT5          ------------------------------------------------------------
A0A1Q6S448      ------------------------------------------------------------
A0A351MYR0      ------------------------------------------------------------
R6HPC1          ------------------------------------------------------------
A0A3D4G5Z5      ------------------------------------------------------------
A0A3D5ES03      ------------------------------------------------------------
A0A0F2P7X6      ------------------------------------------------------------
A0A359B487      ------------------------------------------------------------
A0A348P5V4      ------------------------------------------------------------
A0A356PT74      ------------------------------------------------------------
A0A3D5LL19      ------------------------------------------------------------
R5MNF0          ------------------------------------------------------------
A0A1Q9JSI0      ------------------------------------------------------------
A0A3D5TNI1      ------------------------------------------------------------
A0A358LJD0      ------------------------------------------------------------
R6I3L7          ------------------------------------------------------------
A0A3D1HXX0      ------------------------------------------------------------
A0A3D2QJB8      ------------------------------------------------------------
D4LC36          ------------------------------------------------------------
R7MQJ4          ------------------------------------------------------------
A0A1V5GLC0      ------------------------------------------------------------
W7V182          ------------------------------------------------------------
                                                                            

A0A0H5SF45      ------------------------------------------------------------
A0A1M6JRJ5      ------------------------------------------------------------
A0A1M7Y1S2      ------------------------------------------------------------
A0A3D5R4X5      ------------------------------------------------------------
A0A1I4C3N6      ------------------------------------------------------------
A0A3B9CIM7      ------------------------------------------------------------
A0A1G9WHW8      ------------------------------------------------------------
A0A1H5VAA0      ------------------------------------------------------------
A0A3R6VK11      ------------------------------------------------------------
A0A3R6QUY7      ------------------------------------------------------------
A0A373K3P9      ------------------------------------------------------------
A0A3R6JRU5      ------------------------------------------------------------
A0A1C5MS04      ------------------------------------------------------------
A0A3C1J150      ------------------------------------------------------------
A0A416CXD7      ------------------------------------------------------------
R6XBL9          ------------------------------------------------------------
A0A355W5Z7      ------------------------------------------------------------
A0A143WVN6      ------------------------------------------------------------
W6RXP9          ------------------------------------------------------------
W6S4G8          ------------------------------------------------------------
A0A1G6BLB6      ------------------------------------------------------------
B5CSZ7          ------------------------------------------------------------
A0A1C6G8M0      ------------------------------------------------------------
A0A416MP73      ------------------------------------------------------------
A0A3E4LL92      ------------------------------------------------------------
A0A415D1L1      ------------------------------------------------------------
A0A414P2K5      ------------------------------------------------------------
V8C417          ------------------------------------------------------------
A0A143XN92      ------------------------------------------------------------
A0A173ZYY6      ------------------------------------------------------------
A0A4Q5EHM9      ------------------------------------------------------------
A0A173SMI2      ------------------------------------------------------------
A0A174ASH7      ------------------------------------------------------------
A6BH65          ------------------------------------------------------------
R7G0D7          ------------------------------------------------------------
A0A396G6S7      ------------------------------------------------------------
A0A3E5A223      ------------------------------------------------------------
R7D5E6          ------------------------------------------------------------
A0A415HQH5      ------------------------------------------------------------
A0A414W2C6      ------------------------------------------------------------
A5ZNE7          ------------------------------------------------------------
A0A395X821      ------------------------------------------------------------
A0A1C5PY68      ------------------------------------------------------------
A0A174CJF8      ------------------------------------------------------------
A0A564SRR2      ------------------------------------------------------------
A0A174R7V0      ------------------------------------------------------------
A0A373MWV2      ------------------------------------------------------------
A0A417CE88      ------------------------------------------------------------
A0A416Y441      ------------------------------------------------------------
A0A357GPJ7      ------------------------------------------------------------
A0A396PAC1      ------------------------------------------------------------
A0A416EYU4      ------------------------------------------------------------
A0A416SCQ2      ------------------------------------------------------------
A0A416TGN7      ------------------------------------------------------------
A0A417SMF6      ------------------------------------------------------------
A0A1Y4MW77      ------------------------------------------------------------
R6UHV6          ------------------------------------------------------------
A0A3R9Q621      ------------------------------------------------------------
A0A069RC75      ------------------------------------------------------------
A0A174F2W5      ------------------------------------------------------------
A0A174S8E9      ------------------------------------------------------------
A0A416ZL97      ------------------------------------------------------------
A0A174LSK1      ------------------------------------------------------------
A0A373GY92      ------------------------------------------------------------
A0A373NZQ6      ------------------------------------------------------------
A0A417I9B9      ------------------------------------------------------------
A0A417MP97      ------------------------------------------------------------
A0A417WQF8      ------------------------------------------------------------
A0A373RZ83      ------------------------------------------------------------
A0A416U6I1      ------------------------------------------------------------
R7JQZ9          ------------------------------------------------------------
A0A3B8KKL6      ------------------------------------------------------------
A0A2K9E6R0      ------------------------------------------------------------
A0A2S8RBI0      ------------------------------------------------------------
A0A0L6JLG6      ------------------------------------------------------------
G8LSN0          ------------------------------------------------------------
A0A1M5UYN6      ------------------------------------------------------------
A0A176JBT8      ------------------------------------------------------------
A0A1I5HIC6      ------------------------------------------------------------
A0A1Y3TC51      ------------------------------------------------------------
A0A1Y3T1N0      ------------------------------------------------------------
A0A1Y3Y8U8      ------------------------------------------------------------
A0A5B0BQY5      ------------------------------------------------------------
A6CLL4          ------------------------------------------------------------
A0A174DL89      ------------------------------------------------------------
A0A176U8D6      ------------------------------------------------------------
A0A1Q6KSQ5      ------------------------------------------------------------
A0A3D3U8B3      ------------------------------------------------------------
A0A3E5FRL7      ------------------------------------------------------------
A0A1Y4QK93      ------------------------------------------------------------
B1C232          ------------------------------------------------------------
A0A401USI6      ------------------------------------------------------------
A0A1V4IQ10      ------------------------------------------------------------
A0A1S8TRD2      ------------------------------------------------------------
G7M1U2          ------------------------------------------------------------
A0A2T6KJ75      ------------------------------------------------------------
A9KN92          ------------------------------------------------------------
A0A352MUJ1      ------------------------------------------------------------
R5YI67          ------------------------------------------------------------
A0A1Y0IQP5      ------------------------------------------------------------
A0A4R2R7B1      ------------------------------------------------------------
A0A1M6E8I2      ------------------------------------------------------------
A0A1Y4N105      ------------------------------------------------------------
A0A1Y4QP75      ------------------------------------------------------------
A0A3D4QRB5      ------------------------------------------------------------
A0A349DEH5      ------------------------------------------------------------
A0A3D4T7B4      ------------------------------------------------------------
A0A350XYC7      ------------------------------------------------------------
R6DNR8          ------------------------------------------------------------
A0A355KUM5      ------------------------------------------------------------
R5YGY6          ------------------------------------------------------------
A0A0K8J554      ------------------------------------------------------------
A0A3N1XSX6      ------------------------------------------------------------
A0A1C6G0U3      ------------------------------------------------------------
A0A3D4LLB3      ------------------------------------------------------------
A0A0A5GPA9      ------------------------------------------------------------
A0A271M6M4      ------------------------------------------------------------
A0A2V3W8U6      ------------------------------------------------------------
W1UFG0          ------------------------------------------------------------
A0A351SRI8      ------------------------------------------------------------
A0A1V5LU59      ------------------------------------------------------------
A0A1E3BVC3      ------------------------------------------------------------
A0A4Q0I6S0      ------------------------------------------------------------
A3DF66          ------------------------------------------------------------
W4V1T8          ------------------------------------------------------------
A0A1I0RG99      ------------------------------------------------------------
A0A1I5G322      ------------------------------------------------------------
A0A1C6ITD7      ------------------------------------------------------------
A0A381IX63      ------------------------------------------------------------
A0A1G9IUT4      ------------------------------------------------------------
A0A1M6RWV2      ------------------------------------------------------------
A0A143XPI5      ------------------------------------------------------------
A0A355G1X5      ------------------------------------------------------------
A0A0M6WXE3      ------------------------------------------------------------
A0A348SAK2      ------------------------------------------------------------
A0A1G9H5B9      ------------------------------------------------------------
R5EFZ0          ------------------------------------------------------------
A0A1Y4H8L0      ------------------------------------------------------------
A0A0M6WYQ8      ------------------------------------------------------------
A0A348SAK1      ------------------------------------------------------------
A0A252F281      ------------------------------------------------------------
A0A1Y4QKE6      ------------------------------------------------------------
B1C231          ------------------------------------------------------------
A0A1Y3TUL5      ------------------------------------------------------------
A0A1Y4JAX2      ------------------------------------------------------------
A0A1Y4T590      ------------------------------------------------------------
R5B467          ------------------------------------------------------------
A0A1Y3T163      ------------------------------------------------------------
A0A1Y3YCA2      ------------------------------------------------------------
A0A1Y4L6N9      ------------------------------------------------------------
A0A173T644      ------------------------------------------------------------
A0A1C5TSB8      ------------------------------------------------------------
C0CIK6          ------------------------------------------------------------
A0A1Y3WEF6      ------------------------------------------------------------
A0A417T0L2      ------------------------------------------------------------
A0A1H9EPU3      ------------------------------------------------------------
A0A354IGV3      ------------------------------------------------------------
A0A417JMV2      ------------------------------------------------------------
B0P408          ------------------------------------------------------------
D4MV82          ------------------------------------------------------------
A0A415VWX5      ------------------------------------------------------------
A0A173UY96      ------------------------------------------------------------
A0A173QTL1      ------------------------------------------------------------
A0A174A3T7      ------------------------------------------------------------
A0A174J359      ------------------------------------------------------------
A0A417UUA3      ------------------------------------------------------------
A0A1C6EUV9      ------------------------------------------------------------
A0A173Y645      ------------------------------------------------------------
A0A374AVY6      ------------------------------------------------------------
R7BXS4          ------------------------------------------------------------
A0A143ZUX1      ------------------------------------------------------------
S3FFL2          AGASTEALRNSAISALRQQRAELAANYQKLMVQFEPEYPAARALSAQIAQLDRSIAREES
A0A328M4V1      ---------------------QLRMQMSDMQRHFTPAHPSYKALQSQIGQME--------
A0A5C8HCX2      ---------------------ELTFREAEISQLYKKDHPTYRALLEKRQTLE--------
A0A1W1Z4C3      ------------------------------------------------------------
A0A239QN83      ------------------------------------------------------------
A0A3R9WAA7      ------------------------------------------------------------
A0A1G6BLF1      ------------------------------------------------------------
R6HZX3          ------------------------------------------------------------
A0A1W2CEA6      ------------------------------------------------------------
R7FFK6          ------------------------------------------------------------
A0A373MPB9      ------------------------------------------------------------
A0A373L519      ------------------------------------------------------------
A0A373W906      ------------------------------------------------------------
A0A373VCW2      ------------------------------------------------------------
W0U604          ------------------------------------------------------------
A0A374B6G0      ------------------------------------------------------------
A0A373VM36      ------------------------------------------------------------
A0A1C5P379      ------------------------------------------------------------
A0A373XXX0      ------------------------------------------------------------
A0A5R9MJM9      ------------------------------------------------------------
A0A356CW82      ------------------------------------------------------------
R6T4X7          ------------------------------------------------------------
A0A374HTV1      ------------------------------------------------------------
A0A374GB66      ------------------------------------------------------------
A0A374ECC6      ------------------------------------------------------------
A0A374BM61      ------------------------------------------------------------
A0A373UGZ4      ------------------------------------------------------------
A0A373SA66      ------------------------------------------------------------
A0A1C5X6X7      ------------------------------------------------------------
A0A1C6JIH3      ------------------------------------------------------------
A0A373PSC3      ------------------------------------------------------------
A0A1K1WYK8      ------------------------------------------------------------
A0A1H6IUB1      ------------------------------------------------------------
A0A1M7L1F9      ------------------------------------------------------------
A0A1C6B4L6      ------------------------------------------------------------
A0A1Q6T9P4      ------------------------------------------------------------
A0A315Y4F9      ------------------------------------------------------------
A0A354K620      ------------------------------------------------------------
A0A355G3J9      ------------------------------------------------------------
A0A3D2AD87      ------------------------------------------------------------
A0A2T5IYJ6      ----------------------------------------------------------IS
A0A3C0QME1      ------------------------------------------------------------
A0A355FYK5      ------------------------------------------------------------
A0A357AQU0      ------------------------------------------------------------
A0A3C1YJQ7      ------------------------------------------------------------
A0A3D0JG38      ------------------------------------------------------------
A0A3C0IHX1      ------------------------------------------------------------
R5V506          ------------------------------------------------------------
A0A352TIU5      ------------------------------------------------------------
A0A3E5FSY5      ------------------------------------------------------------
A0A1V5S3C0      ------------------------------------------------------------
A0A1Y3TC98      ------------------------------------------------------------
A0A1Q6REE0      ------------------------------------------------------------
R5ETF9          ------------------------------------------------------------
R6VAT5          ------------------------------------------------------------
A0A1Q6S448      ------------------------------------------------------------
A0A351MYR0      ------------------------------------------------------------
R6HPC1          ------------------------------------------------------------
A0A3D4G5Z5      ------------------------------------------------------------
A0A3D5ES03      ------------------------------------------------------------
A0A0F2P7X6      ------------------------------------------------------------
A0A359B487      ------------------------------------------------------------
A0A348P5V4      ------------------------------------------------------------
A0A356PT74      ------------------------------------------------------------
A0A3D5LL19      ------------------------------------------------------------
R5MNF0          ------------------------------------------------------------
A0A1Q9JSI0      ------------------------------------------------------------
A0A3D5TNI1      ------------------------------------------------------------
A0A358LJD0      ------------------------------------------------------------
R6I3L7          ------------------------------------------------------------
A0A3D1HXX0      ------------------------------------------------------------
A0A3D2QJB8      ------------------------------------------------------------
D4LC36          ------------------------------------------------------------
R7MQJ4          ------------------------------------------------------------
A0A1V5GLC0      ------------------------------------------------------------
W7V182          ------------------------------------------------------------
                                                                            

A0A0H5SF45      ------------------------------------------------------------
A0A1M6JRJ5      ------------------------------------------------------------
A0A1M7Y1S2      ------------------------------------------------------------
A0A3D5R4X5      ------------------------------------------------------------
A0A1I4C3N6      ------------------------------------------------------------
A0A3B9CIM7      ------------------------------------------------------------
A0A1G9WHW8      ------------------------------------------------------------
A0A1H5VAA0      ------------------------------------------------------------
A0A3R6VK11      ------------------------------------------------------------
A0A3R6QUY7      ------------------------------------------------------------
A0A373K3P9      ------------------------------------------------------------
A0A3R6JRU5      ------------------------------------------------------------
A0A1C5MS04      ------------------------------------------------------------
A0A3C1J150      ------------------------------------------------------------
A0A416CXD7      ------------------------------------------------------------
R6XBL9          ------------------------------------------------------------
A0A355W5Z7      ------------------------------------------------------------
A0A143WVN6      ------------------------------------------------------------
W6RXP9          ------------------------------------------------------------
W6S4G8          ------------------------------------------------------------
A0A1G6BLB6      ------------------------------------------------------------
B5CSZ7          ------------------------------------------------------------
A0A1C6G8M0      ------------------------------------------------------------
A0A416MP73      ------------------------------------------------------------
A0A3E4LL92      ------------------------------------------------------------
A0A415D1L1      ------------------------------------------------------------
A0A414P2K5      ------------------------------------------------------------
V8C417          ------------------------------------------------------------
A0A143XN92      ------------------------------------------------------------
A0A173ZYY6      ------------------------------------------------------------
A0A4Q5EHM9      ------------------------------------------------------------
A0A173SMI2      ------------------------------------------------------------
A0A174ASH7      ------------------------------------------------------------
A6BH65          ------------------------------------------------------------
R7G0D7          ------------------------------------------------------------
A0A396G6S7      ------------------------------------------------------------
A0A3E5A223      ------------------------------------------------------------
R7D5E6          ------------------------------------------------------------
A0A415HQH5      ------------------------------------------------------------
A0A414W2C6      ------------------------------------------------------------
A5ZNE7          ------------------------------------------------------------
A0A395X821      ------------------------------------------------------------
A0A1C5PY68      ------------------------------------------------------------
A0A174CJF8      ------------------------------------------------------------
A0A564SRR2      ------------------------------------------------------------
A0A174R7V0      ------------------------------------------------------------
A0A373MWV2      ------------------------------------------------------------
A0A417CE88      ------------------------------------------------------------
A0A416Y441      ------------------------------------------------------------
A0A357GPJ7      ------------------------------------------------------------
A0A396PAC1      ------------------------------------------------------------
A0A416EYU4      ------------------------------------------------------------
A0A416SCQ2      ------------------------------------------------------------
A0A416TGN7      ------------------------------------------------------------
A0A417SMF6      ------------------------------------------------------------
A0A1Y4MW77      ------------------------------------------------------------
R6UHV6          ------------------------------------------------------------
A0A3R9Q621      ------------------------------------------------------------
A0A069RC75      ------------------------------------------------------------
A0A174F2W5      ------------------------------------------------------------
A0A174S8E9      ------------------------------------------------------------
A0A416ZL97      ------------------------------------------------------------
A0A174LSK1      ------------------------------------------------------------
A0A373GY92      ------------------------------------------------------------
A0A373NZQ6      ------------------------------------------------------------
A0A417I9B9      ------------------------------------------------------------
A0A417MP97      ------------------------------------------------------------
A0A417WQF8      ------------------------------------------------------------
A0A373RZ83      ------------------------------------------------------------
A0A416U6I1      ------------------------------------------------------------
R7JQZ9          ------------------------------------------------------------
A0A3B8KKL6      ------------------------------------------------------------
A0A2K9E6R0      ------------------------------------------------------------
A0A2S8RBI0      ------------------------------------------------------------
A0A0L6JLG6      ------------------------------------------------------------
G8LSN0          ------------------------------------------------------------
A0A1M5UYN6      ------------------------------------------------------------
A0A176JBT8      ------------------------------------------------------------
A0A1I5HIC6      ------------------------------------------------------------
A0A1Y3TC51      ------------------------------------------------------------
A0A1Y3T1N0      ------------------------------------------------------------
A0A1Y3Y8U8      ------------------------------------------------------------
A0A5B0BQY5      ------------------------------------------------------------
A6CLL4          ------------------------------------------------------------
A0A174DL89      ------------------------------------------------------------
A0A176U8D6      ------------------------------------------------------------
A0A1Q6KSQ5      ------------------------------------------------------------
A0A3D3U8B3      ------------------------------------------------------------
A0A3E5FRL7      ------------------------------------------------------------
A0A1Y4QK93      ------------------------------------------------------------
B1C232          ------------------------------------------------------------
A0A401USI6      ------------------------------------------------------------
A0A1V4IQ10      ------------------------------------------------------------
A0A1S8TRD2      ------------------------------------------------------------
G7M1U2          ------------------------------------------------------------
A0A2T6KJ75      ------------------------------------------------------------
A9KN92          ------------------------------------------------------------
A0A352MUJ1      ------------------------------------------------------------
R5YI67          ------------------------------------------------------------
A0A1Y0IQP5      ------------------------------------------------------------
A0A4R2R7B1      ------------------------------------------------------------
A0A1M6E8I2      ------------------------------------------------------------
A0A1Y4N105      ------------------------------------------------------------
A0A1Y4QP75      ------------------------------------------------------------
A0A3D4QRB5      ------------------------------------------------------------
A0A349DEH5      ------------------------------------------------------------
A0A3D4T7B4      ------------------------------------------------------------
A0A350XYC7      ------------------------------------------------------------
R6DNR8          ------------------------------------------------------------
A0A355KUM5      ------------------------------------------------------------
R5YGY6          ------------------------------------------------------------
A0A0K8J554      ------------------------------------------------------------
A0A3N1XSX6      ------------------------------------------------------------
A0A1C6G0U3      ------------------------------------------------------------
A0A3D4LLB3      ------------------------------------------------------------
A0A0A5GPA9      ------------------------------------------------------------
A0A271M6M4      ------------------------------------------------------------
A0A2V3W8U6      ------------------------------------------------------------
W1UFG0          ------------------------------------------------------------
A0A351SRI8      ------------------------------------------------------------
A0A1V5LU59      ------------------------------------------------------------
A0A1E3BVC3      ------------------------------------------------------------
A0A4Q0I6S0      ------------------------------------------------------------
A3DF66          ------------------------------------------------------------
W4V1T8          ------------------------------------------------------------
A0A1I0RG99      ------------------------------------------------------------
A0A1I5G322      ------------------------------------------------------------
A0A1C6ITD7      ------------------------------------------------------------
A0A381IX63      ------------------------------------------------------------
A0A1G9IUT4      ------------------------------------------------------------
A0A1M6RWV2      ------------------------------------------------------------
A0A143XPI5      ------------------------------------------------------------
A0A355G1X5      ------------------------------------------------------------
A0A0M6WXE3      ------------------------------------------------------------
A0A348SAK2      ------------------------------------------------------------
A0A1G9H5B9      ------------------------------------------------------------
R5EFZ0          ------------------------------------------------------------
A0A1Y4H8L0      ------------------------------------------------------------
A0A0M6WYQ8      ------------------------------------------------------------
A0A348SAK1      ------------------------------------------------------------
A0A252F281      ------------------------------------------------------------
A0A1Y4QKE6      ------------------------------------------------------------
B1C231          ------------------------------------------------------------
A0A1Y3TUL5      ------------------------------------------------------------
A0A1Y4JAX2      ------------------------------------------------------------
A0A1Y4T590      ------------------------------------------------------------
R5B467          ------------------------------------------------------------
A0A1Y3T163      ------------------------------------------------------------
A0A1Y3YCA2      ------------------------------------------------------------
A0A1Y4L6N9      ------------------------------------------------------------
A0A173T644      ------------------------------------------------------------
A0A1C5TSB8      ------------------------------------------------------------
C0CIK6          ------------------------------------------------------------
A0A1Y3WEF6      ------------------------------------------------------------
A0A417T0L2      ------------------------------------------------------------
A0A1H9EPU3      ------------------------------------------------------------
A0A354IGV3      ------------------------------------------------------------
A0A417JMV2      ------------------------------------------------------------
B0P408          ------------------------------------------------------------
D4MV82          ------------------------------------------------------------
A0A415VWX5      ------------------------------------------------------------
A0A173UY96      ------------------------------------------------------------
A0A173QTL1      ------------------------------------------------------------
A0A174A3T7      ------------------------------------------------------------
A0A174J359      ------------------------------------------------------------
A0A417UUA3      ------------------------------------------------------------
A0A1C6EUV9      ------------------------------------------------------------
A0A173Y645      ------------------------------------------------------------
A0A374AVY6      ------------------------------------------------------------
R7BXS4          ------------------------------------------------------------
A0A143ZUX1      ------------------------------------------------------------
S3FFL2          RVSGSQLADYREAQERERALKAQVDALKSSYLDLRRRSIQYNIYQQEVDTNRALYDGLLQ
A0A328M4V1      --------------GQKAALQKQVGQLPDIQQQMLR-------LARDVQVSNTTYTSLLN
A0A5C8HCX2      --------------QERKRLNKRVSAMPSTQQEVLR-------LSRDVEAGRAVYLQLLN
A0A1W1Z4C3      ------------------------------------------------------------
A0A239QN83      ------------------------------------------------------------
A0A3R9WAA7      ------------------------------------------------------------
A0A1G6BLF1      ------------------------------------------------------------
R6HZX3          ------------------------------------------------------------
A0A1W2CEA6      ------------------------------------------------------------
R7FFK6          ------------------------------------------------------------
A0A373MPB9      ------------------------------------------------------------
A0A373L519      ------------------------------------------------------------
A0A373W906      ------------------------------------------------------------
A0A373VCW2      ------------------------------------------------------------
W0U604          ------------------------------------------------------------
A0A374B6G0      ------------------------------------------------------------
A0A373VM36      ------------------------------------------------------------
A0A1C5P379      ------------------------------------------------------------
A0A373XXX0      ------------------------------------------------------------
A0A5R9MJM9      ------------------------------------------------------------
A0A356CW82      ------------------------------------------------------------
R6T4X7          ------------------------------------------------------------
A0A374HTV1      ------------------------------------------------------------
A0A374GB66      ------------------------------------------------------------
A0A374ECC6      ------------------------------------------------------------
A0A374BM61      ------------------------------------------------------------
A0A373UGZ4      ------------------------------------------------------------
A0A373SA66      ------------------------------------------------------------
A0A1C5X6X7      ------------------------------------------------------------
A0A1C6JIH3      ------------------------------------------------------------
A0A373PSC3      ------------------------------------------------------------
A0A1K1WYK8      ------------------------------------------------------------
A0A1H6IUB1      ------------------------------------------------------------
A0A1M7L1F9      ------------------------------------------------------------
A0A1C6B4L6      ------------------------------------------------------------
A0A1Q6T9P4      ------------------------------------------------------------
A0A315Y4F9      ------------------------------------------------------------
A0A354K620      ------------------------------------------------------------
A0A355G3J9      ------------------------------------------------------------
A0A3D2AD87      ------------------------------------------------------------
A0A2T5IYJ6      KRYGSKHPTLIQAELELNEAKKALEIAKADSLELSKKEFKFKELQREVETNRNLYDTFFA
A0A3C0QME1      ------------------------------------------------------------
A0A355FYK5      ------------------------------------------------------------
A0A357AQU0      ------------------------------------------------------------
A0A3C1YJQ7      ------------------------------------------------------------
A0A3D0JG38      ------------------------------------------------------------
A0A3C0IHX1      ------------------------------------------------------------
R5V506          ------------------------------------------------------------
A0A352TIU5      ------------------------------------------------------------
A0A3E5FSY5      ------------------------------------------------------------
A0A1V5S3C0      ------------------------------------------------------------
A0A1Y3TC98      ------------------------------------------------------------
A0A1Q6REE0      ------------------------------------------------------------
R5ETF9          ------------------------------------------------------------
R6VAT5          ------------------------------------------------------------
A0A1Q6S448      ------------------------------------------------------------
A0A351MYR0      ------------------------------------------------------------
R6HPC1          ------------------------------------------------------------
A0A3D4G5Z5      ------------------------------------------------------------
A0A3D5ES03      ------------------------------------------------------------
A0A0F2P7X6      ------------------------------------------------------------
A0A359B487      ------------------------------------------------------------
A0A348P5V4      ------------------------------------------------------------
A0A356PT74      ------------------------------------------------------------
A0A3D5LL19      ------------------------------------------------------------
R5MNF0          ------------------------------------------------------------
A0A1Q9JSI0      ------------------------------------------------------------
A0A3D5TNI1      ------------------------------------------------------------
A0A358LJD0      ------------------------------------------------------------
R6I3L7          ------------------------------------------------------------
A0A3D1HXX0      ------------------------------------------------------------
A0A3D2QJB8      ------------------------------------------------------------
D4LC36          ------------------------------------------------------------
R7MQJ4          ------------------------------------------------------------
A0A1V5GLC0      ------------------------------------------------------------
W7V182          ------------------------------------------------------------
                                                                            

A0A0H5SF45      ----------KENSKISVVDPVVY-P--AGPS---GPNIYLN-TILGA--VAGLVLAIAI
A0A1M6JRJ5      ----------KSDAVINVVDPVVY-Q--PSPS---GPNTILN-TLLGG--IICGFMAFFL
A0A1M7Y1S2      ----------KTNSMIYVVDPVVC-P--TSPS---GPNILLN-TLLGG--IVCGFLAFFL
A0A3D5R4X5      ----------MNVDNVKILDKAVT-P--TSPI---KPNKMMNIAIAGV--LGLMLSVGLV
A0A1I4C3N6      ----------VKSGGLQVLDEAKL-P--TEPY---ESTSTILFALIGA--VGFGVMSAVG
A0A3B9CIM7      ----------VKSGGIEVLDEAEL-P--TVPY---QSTSVLKYAVLGA--AAGFLLAAAW
A0A1G9WHW8      ----------VKAGGVQVLDSAEL-P--TSPY---QQTNVPFTAILGF--FFGAILAFIF
A0A1H5VAA0      ----------VKAGGVQVLDSAEL-P--TSPY---QQTNVPFTAILGF--FFGAILAFIF
A0A3R6VK11      ----------VKSGGIEVIDYATL-P--EAPY---SSTSLVKYALVGF--AGCFGASFVL
A0A3R6QUY7      ----------VKSGGIEVIDYATL-P--EAPY---SSTSLVKYALVGF--VGCFGASFVL
A0A373K3P9      ----------VKSGGIEVIDYATL-P--EAPY---SSTSLVKYALVGF--AGCFGASFVL
A0A3R6JRU5      ----------VKSGGIEVIDYATL-P--EAPY---SSTSLVKYALVGF--AGCFGASFVL
A0A1C5MS04      ----------VKSGGIEVIDYATL-P--EAPY---SSTSLVKYALVGF--AGCFGASFVL
A0A3C1J150      ----------VKSGGIEVIDYATL-P--EAPY---SSTSLVKYALVGF--AGCFGASFVL
A0A416CXD7      ----------VKSGGIEVIDYATL-P--EAPY---SSTSLVKYALVGF--AGCFGASFVL
R6XBL9          ----------VKSGGIEVIDYATL-P--EAPY---SSTSLVKYALVGF--AGCFGASFVL
A0A355W5Z7      ----------VKSGGIEVIDYATL-P--EAPY---SSTSLVKYALVGF--AGCFGASFVL
A0A143WVN6      ----------FSNASLQMVREPNV-P--YGPS---NYVNYLRIQRMAT--LAAGGLTAAV
W6RXP9          ----------VPNGNVKVIREVRV-P--KDPV---APNKVMNIA-IAF--LLGLMVGVGL
W6S4G8          ----------VPNGNVKIIRHVKE-A--EAPI---SPNKKMNII-LGF--LIGLVSGMAI
A0A1G6BLB6      ----------LGSVIMTILDQSDI-P--TQPD---AAFAPANAMVKMF--IIVFCLMLVI
B5CSZ7          ----------ESGYVLQPLSSISA-N--NVQK---TEKATLRYSLLLI--LLVLAGGIGA
A0A1C6G8M0      ----------LGSNTPTVLDKADE-F--FAEN---TRRSVVSYILIGL--MAGIVVSCGV
A0A416MP73      ----------LGSSKPTILDKADD-L--FAEN---TRRSVLSYALIGI--LAGIVIACGI
A0A3E4LL92      ----------ESGYVLQPLSSISA-N--NVQR---TEKATVKYSALLI--LLVLAGGVGA
A0A415D1L1      ----------ESGYVLQPLSSISA-N--NVQK---TEKATLRYSLLLI--LLVLAGGIGA
A0A414P2K5      ----------ESGYVLQPLSSISA-N--NVQK---TEKATLRYSLLLI--LLVLAGGIGA
V8C417          ----------ESGYVLQPLSSISA-N--NVQK---TEKATLRYSLLLI--FLVLAGGIGA
A0A143XN92      ----------VSNVILEVLEEPQI-P--MAAS---NANQAEDIAKKAF--WMSGTAVLAL
A0A173ZYY6      ----------VGSAVMDVLEEPKV-P--YTPD---NPLDAGGQAKKGG--LVAGALVIIL
A0A4Q5EHM9      ----------VGSAVMDVLEEPKV-P--YTPD---NPLDAGGQAKKGG--LVAGALVIIL
A0A173SMI2      ----------VGSAVMDVLEEPKV-P--YTPD---NPLDAGGQAKKGG--LVAGALVLIL
A0A174ASH7      ----------VGSAVMDVLEEPKI-P--YTPD---NPLDAGGQAKKGG--LVAGALVLIL
A6BH65          ----------VGSAVMDVLEEPKI-P--YTPD---NPLDAGRQAKKGG--LVAGALVLIL
R7G0D7          ----------VGSAVMDVLEEPKI-P--YTPD---NPLDAGRQAKKGG--LVAGALVLIL
A0A396G6S7      ----------IKNVIIETIQQPSV-A--MAPI---NPLDEKRTVMKVF--AVAAGCLIAL
A0A3E5A223      ----------IKNVIIETIQQPSV-A--MAPI---NPLDEKRTVMKVF--AVAAGCLIAL
R7D5E6          ----------IKNVIIETIQQPSV-A--MAPI---NPLDEKRTVMKVF--AVAAGCLIAL
A0A415HQH5      ----------IKNVIIETIQQPSV-A--MAPI---NPLDEKRTVMKVF--AVAAGCLIAL
A0A414W2C6      ----------IKNVIIETIQQPSV-A--MAPI---NPLDEKRTVMKVF--VVAAGCLIAL
A5ZNE7          ----------IKNVIIETIQQPSV-A--MAPI---NPLDEKRTVMKVF--AVAAGCLIAL
A0A395X821      ----------IKNVIIETIQQPSV-A--MAPI---NPLDEKRTVMKVF--AVAAGCLIAL
A0A1C5PY68      ----------IKNVIIETIQQPSV-A--MAPI---NPLDEKRTVMKVF--VVTAGCLIVL
A0A174CJF8      ----------IKNVIIETIQQPSV-A--MAPI---NPLDEKRTVMKVF--VVAAGCLIAL
A0A564SRR2      ----------IKNVIIETIQQPSV-A--MAPI---NPLDEKRTVMKVF--VVAAGCLIAL
A0A174R7V0      ----------IKNVIIETIQQPSV-A--MAPI---NPLDEKRTVMKVF--VVAAGCLIAL
A0A373MWV2      ----------IPNVVLETLQQPQV-S--DNPS---NRIPTEKYAAMAF--LAAALGTAAL
A0A417CE88      ----------IPNVVLETLQQPQV-S--GNPS---NRIPTEKYAAMAF--LAAALGTAAL
A0A416Y441      ----------IPNVVLETLQQPQV-S--GNPS---NRIPTEKYAAMAF--LAAALGTAAL
A0A357GPJ7      ----------IPNVVLETLQQPQV-S--DNPS---NRIPTEKYAAMAF--LAAALGTAAL
A0A396PAC1      ----------IPNVVLETLQQPQV-S--DNPS---NRIPTEKYAAMAF--LAAALGTAAL
A0A416EYU4      ----------IPNVVLETLQQPQV-S--DNPS---NRIPTEKYAAMAF--LAAALGTAAL
A0A416SCQ2      ----------IPNVVLETLQQPQV-S--DNPS---NRIPTEKYAAMAF--LAAALGTAAL
A0A416TGN7      ----------IPNVVLETLQQPQV-S--GNPS---NRIPTEKYAAMAF--LAAALGTAAL
A0A417SMF6      ----------IPNVVLETLQQPQV-S--GNPS---NRIPTEKYAAMAF--LAAALGTAAL
A0A1Y4MW77      ----------IGMTKFNMIENPSV-S--NVPY---NQLNYFNTVAKGA--LIGLAVGLVI
R6UHV6          ----------VSSIVLQTLEEPVV-P--TEPT---NPSNALKLAVIGF--FAGAAAVVLI
A0A3R9Q621      ----------KNTTEISVVDPVVM-P--RQPS---GPHVLLNTA-IGG--LMGFVLSVLL
A0A069RC75      ----------MNDENVRVIDYAKI-P--AVPS---KPDKILNMA-AGV--FFGIMGGLLV
A0A174F2W5      ----------IPNVVLETLQQPQV-S--GNPS---NRIPTEKYAAMAF--LAAALGTAAL
A0A174S8E9      ----------IPNVVLETLQQPQV-S--GNPS---NRIPTEKYAAMAF--LAAALGTAAL
A0A416ZL97      ----------IPNVVLETLQQPQV-S--GVPS---NQIPTKKYAATAF--LAAALAMAAL
A0A174LSK1      ----------IPNVVLETLQQPQV-S--GVPS---NQIPTKKYAATAF--LAAALAMAAL
A0A373GY92      ----------IPNVVLETLQQPQV-S--GVPS---NQIPTKKYAATAF--LAAALAMAAL
A0A373NZQ6      ----------IPNVVLETLQQPQV-S--GVPS---NQIPTKKYAATAF--LAAALAMAAL
A0A417I9B9      ----------IPNVVLETLQQPQV-S--GVPS---NQIPTKKYAATAF--LAAALAMAAL
A0A417MP97      ----------IPNVVLETLQQPQV-S--GVPS---NQIPTKKYAATAF--LAAALAMAAL
A0A417WQF8      ----------IPNVVLETLQQPQV-S--GVPS---NQIPTKKYAATAF--LAAALAMAAL
A0A373RZ83      ----------IPNVVLETLQQPQV-S--GVPS---NQIPTKKYAATAF--LAAALAMAAL
A0A416U6I1      ----------IPNVVLETLQQPQV-S--GVPS---NQIPTKKYAATAF--LAAALAMAAL
R7JQZ9          ----------IPNVVLETLQQPQV-S--GVPS---NQIPTKKYAATAF--LAAALAMAAL
A0A3B8KKL6      ----------IEVKNVMVVDEANM-P--NSPV---KPNKKMNVA-VAG--LLGIVLGVGL
A0A2K9E6R0      ----------IEVKNVMVVDEANM-P--NSPV---KPNKKMNVA-VAG--LLGIVLGVGL
A0A2S8RBI0      ----------IEVKNVMVVDEANM-P--NSPV---KPNKKMNVA-VAG--LLGIVLGVGL
A0A0L6JLG6      ----------IEVKNVKVIDTAKD-P--KDPV---KPNKKMNVG-LAG--FLGILLGVSL
G8LSN0          ----------IQVKNVSIIDVAKV-P--ERPV---GPSAKKNVG-IAG--ILGLALAAGL
A0A1M5UYN6      ----------IPNGNIKIFQN----P--RSFQ---DSVNKIKIILYSF--ILGLLISITL
A0A176JBT8      ----------MKIENVNILTIATP-Y--SSTS---KPILLFNLL-LSF--AAGLILATIF
A0A1I5HIC6      ----------LEMEKVNIVEEGDI-P--SFPT---SPSIIKNAI-LGS--LAGAFISTFI
A0A1Y3TC51      ----------FSNASLRTVQEPEV-P--SAPS---NTSAAMRYRYPLM--AAGAAGMAAL
A0A1Y3T1N0      ----------FSNASLQILQEPQV-P--SSPS---NTSWIMARRNLLT--AAGMLAMAAV
A0A1Y3Y8U8      ----------FSNASLQILQEPQV-P--SSPS---NTSWIMARRNLLA--AAGMLAMAAV
A0A5B0BQY5      ----------MNLDNITILKEVIV-GTDTKMI---KPFTFYYLI-VSL--GIGFLISIAV
A6CLL4          ----------MQIDNIQILSYAQE-QDSTTPV---KPSLILSAG-ISF--TIGIFLAILI
A0A174DL89      ----------RGVDNVILVDSASI-P--EKPT---KPNIIINIS-LSF--ILGLIFSISL
A0A176U8D6      ----------LGSSVPTVLDKAEL-S--FTEN---TRHSILFYSVIGV--VVGLFLACGI
A0A1Q6KSQ5      ----------LGSNTPTVLDKADE-F--FAEN---TRRSVVSYILIGL--MAGIVVSCGV
A0A3D3U8B3      ----------LGSNTPTVLDKADE-F--FAEN---TRRSVVSYILIGL--MAGIVVSCGV
A0A3E5FRL7      ----------FTNATLQVLQEPSI-P--ITPS---NSSKLINYRNYIA--LLGGVAVTGI
A0A1Y4QK93      ----------FTNATLQVLQEPSI-P--TTPS---NSSRLINYRNYIA--LLGGIAVTGI
B1C232          ----------FTNATLQVLQEPSI-P--TTPS---NSSRLINYRNYIA--LLGGVAVAGI
A0A401USI6      ----------LPSGIAKIMDKALI-P--ELPI---TPKKKFNIS-IGF--IIGLILSLGL
A0A1V4IQ10      ----------IPNGIVKVIEDVVI-S--ETLT---SSKKKMYVA-IGF--MLGLMISIGI
A0A1S8TRD2      ----------IPDSTVKVIEDVVI-S--ETLT---SSKKRMYVA-IGF--IIGLMLSLGI
G7M1U2          ----------IPDSTVKVIEDVVI-S--ETLT---SSKKRMYVA-IGF--IIGLMLSFGI
A0A2T6KJ75      ----------MNLENVHILSQATV-NEDTKSV---KPITALFFI-ISA--IIGFLASYSF
A9KN92          ----------LEMEKVNIVEEGNI-P--TIPT---SPHIMKNTI-LSG--IIGALISAFV
A0A352MUJ1      ----------YHMENIRVVDKAVA-P--SSPS---NINPVKYAG-IFA--VVGFVISVGV
R5YI67          ----------YNMENIRVVDKAVA-P--SAPS---NINPVKYAG-VFA--VVGFALSIGV
A0A1Y0IQP5      ----------MQVDNISILDTAKLTSDVQQPV---RPKPFLNMA-AAL--VLGAMAGAGL
A0A4R2R7B1      ----------MQVDNVSILDTAKLTSDVLEPV---RPKPYLNMA-VAL--VLGAMAGAGL
A0A1M6E8I2      ----------LKVDNVEIIDEAIP-I--DHPV---NINLKFNGA-IGF--IVGIMTGLSI
A0A1Y4N105      ----------FSNASLQMVQDASV-P--MSAS---NPLNYSRIQKLGT--LASGVVMIGI
A0A1Y4QP75      ----------FSNASLQMVQDASV-P--MSAS---NPLNYSRIQKLGT--LASGVVMIGI
A0A3D4QRB5      ----------LNMENVQVIDTARV-S--QIPI---RPTTVRNCI-IAA--FLGLMVGLGI
A0A349DEH5      ----------YPYAQLNLLDTPVL-S--TYPN---STKSAVSLAAIVG--FIGAVATCII
A0A3D4T7B4      ----------YPYAQLNLLDTPVL-S--TYPN---STKSAVSLAAIVG--FIGAVAPCII
A0A350XYC7      ----------YSNAKLTLCDRPVL-S--TAPN---SNRSVFSLALMVG--FVAAVATCVV
R6DNR8          ----------YPNAKLTLCDKPVL-S--TAPN---SNRSVVSLALMVG--FISAIACCVV
A0A355KUM5      ----------YPNAKLTLCDTPVL-P--TYPN---SNRSVVSLALMVG--FIAAVASCVV
R5YGY6          ----------YPNAKLTLCDTPVL-P--TYPN---SNRSVVSLALMIG--FIAAVASCVV
A0A0K8J554      ----------KNNAKITVIDPVVF-P--TGPS---GPNILLNTM-IGA--LAGFFLAFTF
A0A3N1XSX6      ----------KPSAQISVVDPVSV-P--TKPS---SPNILKNTL-IGG--MLGLVLSIIF
A0A1C6G0U3      ----------TNTNKVEIIDKAIV-N--EKPI---KPRKLINIA-IAS--IIGILISIAF
A0A3D4LLB3      ----------TKTNNVAVVDYARL-P--LAPV---KPDIIMNTA-IAG--ILGAMVILLI
A0A0A5GPA9      ----------MNLNNVQILTRSNP-DAHETPI---KPNLLMNTI-LSL--LLGLFLALLL
A0A271M6M4      ----------MKIDNVDILTGAKI-VNKGRPV---KPDPVIYMV-IFL--CIGVFLSFII
A0A2V3W8U6      ----------MNLENVNILTEAKV-EKHKTPI---SPKLFFNTV-ISF--IIGFLFACTY
W1UFG0          ----------TKASGVEVIDKATV-P--TKHI---RPRKTVNTI-IAT--LIGIILAITV
A0A351SRI8      ----------FNIENISIIDEATV-G--EEPY---NVHVLKQIV-LGT--GLGFVLSSII
A0A1V5LU59      ----------IQVKNVKVIDIAKV-P--ETPI---SPNKKKNVA-LAG--IIGLALGAGL
A0A1E3BVC3      ----------IQVKNIKVIDTAKI-P--ENPI---KPNKKMNVG-AAG--LFGLVLGVGL
A0A4Q0I6S0      ----------IQVKNIKVIDTAKI-P--ENPI---KPNKKMNVG-AAG--LFGLVLGVGL
A3DF66          ----------IQVKNIKVIDTAKI-P--ENPI---KPNKKMNIC-VAG--LFGLVLGIGL
W4V1T8          ----------IQVKNIKVIDTAKI-P--ENPI---KPNKKMNVG-AAG--LLGLVLGVGL
A0A1I0RG99      ----------KETSQITVVDPPTL-P--TSPS---SPNILKNTL-VGG--MFGFVLSIAV
A0A1I5G322      ----------KDTAQISIVDPPAL-P--TSPS---SPNIFKNTL-IGG--MITFIITILI
A0A1C6ITD7      ----------RGVDNVIMVDTASI-P--EKPS---KPNIILNIG-LSF--LLGLMLSICL
A0A381IX63      ----------SKVDGGQVIDEALL-P--TQPI---SPNKFRNLA-LGG--IIGVVIAIFV
A0A1G9IUT4      ----------MKTNNVEIIDKSTI-P--DKPV---KPNKIMNTM-IGA--IIGLILGLIV
A0A1M6RWV2      ----------IKMENVRILDYAVV-P--SNPI---KPRPMLNIA-IAL--VLGLMIGIGL
A0A143XPI5      ----------IGSTKLVIVDDSGVP---KEPS---NQPNLKRMALNGC--LAGIVLSGIL
A0A355G1X5      ----------YPNATLQIYEKPFKP---TAHD---PQLSLMRFAAIGG--AIGFALAFIV
A0A0M6WXE3      ----------VGTTVLDVLEDPKIP---YAPV---NPPQNGEMAKKGF--FLGMAVCILL
A0A348SAK2      ----------VGTTVLDVLEDPKIP---YAPV---NPPQNGEMAKKGF--FLGMAVCILL
A0A1G9H5B9      ----------VGVGNVDIMDYAVVP---VLPN---EKKAVFSSLKYGA--AAGAAFAVVL
R5EFZ0          ----------IDDIGLEVLQYPAVP---TSPT---NQNFAFHQMKKAA--VIAALAATAL
A0A1Y4H8L0      ----------LGNAVLEPLDEPEIP---LYPS---NPLNTSRAMKLAF--LAAAAALAAL
A0A0M6WYQ8      ----------LGNTTLKILDETGVP---DDTT---NQGVISSSWKRGA--LKGAIIGLVI
A0A348SAK1      ----------LGNTTLKILDETGVP---DDTT---KQGVISSSWKRGA--LKGAIIGLVI
A0A252F281      ----------LSGAVFTVVREPQIA---RAPS---NAMSLRSRLILAG--ALGALAMLAV
A0A1Y4QKE6      ----------LGQIQFHMINNPQLP---TSPY---NKLTFTNTVIVGG--IIGLVFGTVI
B1C231          ----------LGQIQFHMINNPQLP---TDPY---NKLTFTNTVLVGG--IIGLVSGTII
A0A1Y3TUL5      ----------LKIGSVSVINEPKAT---YRIG---GNVNASMWLYMS---LLGLAVGIGF
A0A1Y4JAX2      ----------LKIGSVSVINEPKAT---YRIG---GNVNASMWLYMS---LLGLAVGIGF
A0A1Y4T590      ----------LKIGSVSVINEPKAT---YRIG---GNVNASMWLYMS---LLGLAVGIGF
R5B467          ----------VGPTELVMMDQTGVP---TQPS---NPFSWRHSLVRGA--LIGAVLSLLV
A0A1Y3T163      ----------LGDIQFNYLNEPETP---TEPF---NHIGLRRTLALGG--GAGALAGILI
A0A1Y3YCA2      ----------LGDIQFNYLNEPETP---TEPF---NHIGLRRTLALGG--GAGALAGILI
A0A1Y4L6N9      ----------IGNTKFNMIDVPTEP---TEPF---NKPNYVRTTVKGA--FLGVLAGLLL
A0A173T644      ----------IGETKFNMIDVPTAP---KEPY---NQPNFVKKAVKGA--LLGAAAGIFL
A0A1C5TSB8      ----------IGETKFNMIDVPTAP---KEPY---NQPNFVKKAVKGA--LLGAAAGIFL
C0CIK6          ----------IGETKFNMIDVPTAP---KEPY---NQPNFVKKAVKGA--LLGAAAGIFL
A0A1Y3WEF6      ----------IGDTRFSMIDEPTTP---TEPY---NRPSYLDQILKGA--LFGAGSGFLL
A0A417T0L2      ----------IGDTKFNMIDEPSTP---TEPY---NRPSYRGQIKKGA--VYGAGAGFLL
A0A1H9EPU3      ----------IGVDTVKAIDGDIGA---VTPT---SPSSPNVSRNTLLGMLIGIFIACAI
A0A354IGV3      ----------FSSIVLTVIDGPYIP---TQPS---NQIDSRDLIRKTA--GICALIMIVL
A0A417JMV2      ----------IGNVVLDVLQKPTVP---SGPV---NKFQPTALMKKTF--LMTIVALCGL
B0P408          ----------IGNVVLDVLQKPTVP---SGPV---NKFQPTALMKKTF--FTTIVALCGL
D4MV82          ----------IGNVVLDVLQKPTVP---SGPV---NKFQPTALMKKTF--FTTIVALCGL
A0A415VWX5      ----------IGNVVLDVLQKPTVP---SGPV---NKFQPTALMKKTF--LMTIVALCGL
A0A173UY96      ----------IGNVVLDVLQKPTVP---SGPV---NKFQPTALMKKTF--FTTIVALCGL
A0A173QTL1      ----------IGNVVLDVLQKPTVP---SGPV---NKFQPTALMKKTF--FTTIVALCGL
A0A174A3T7      ----------IGNVVLDVLQKPTVP---SGPV---NKFQPTALMKKTF--FTTIVALCGL
A0A174J359      ----------IGNVVLDVLQKPTVP---SGPV---NKFQPTALMKKTF--SMTIVALCGL
A0A417UUA3      ----------IGNVVLDVLQKPTVP---SGPV---NKFQPTALMKKTF--FTTIVALCGL
A0A1C6EUV9      ----------IGTVVLDVLQNPTVP---SGPV---NEFQPAALMKKTF--VMTIIALCGL
A0A173Y645      ----------IGTVVLDVLQNPTVP---SGPV---NEFQPAALMKKTF--VMTIVALCGL
A0A374AVY6      ----------IGTVVLDVLQNPTVP---SGPV---NEFQPAALMKKTF--VMTIVALCGL
R7BXS4          ----------IGTVVLDVLQNPTVP---SGPV---NEFQPAALMKKTF--VMTIVALCGL
A0A143ZUX1      ----------SGSGTAFVNSVQKIQP--RMPQGPNTDYKKILYPAAGA--LLGLAVGLFL
S3FFL2          RFKEIGVAGGVGINNIAVVDAADVP---QKPS----RPRLLLNLAIAL--FVGLGLGVLV
A0A328M4V1      QAQQLNIARAGTVGNVRVIDRAATDT--AKPV----WPRKLLLVFGAT--VFGGLLAVGF
A0A5C8HCX2      RQQELSISKSSAIGNVRIIDPAVTQ---PQPV----KPKKALNVVLGF--ILGLFISVGA
A0A1W1Z4C3      ----------VAAGEAKAQDYATIP---MFAN----GRNDMKKGIIGA--LIGAVIACAL
A0A239QN83      ----------VTAGEAKAQDYAVVP---LLAN----GRADMKKGFIGG--LAGAILACAF
A0A3R9WAA7      ----------VGTTHLNMIEESGIP---AFPS---NPVDYRRLIGSGA--AIGAAIALFF
A0A1G6BLF1      ----------IGSTTLEVMSESGVP---TAPS---NEDWSHGAAKTGI--LIGFVIDILV
R6HZX3          ----------IGGTQLSMIEEPQVP---TVPV---NTFRGSRSAAKGV--AAGLLLGLAL
A0A1W2CEA6      ----------MELRKPQILEKARTP---IKPI----YPNVNATIAKGA--VLGGLGIMLI
R7FFK6          ----------VGAGSVEKIGDAKIY---DTPV----SPNVTKNTAIGF--AAGAMLAILV
A0A373MPB9      ----------IGAGSVEKIGDAEVY---NTPV----SPNTTKNVALGF--VGGLMVAVLV
A0A373L519      ----------IGAGSVEKIGDAEVY---NTPV----SPNTTKNVALGF--VGGLMVAVLV
A0A373W906      ----------IGAGSVEKIGDAEVY---NTPV----SPNTTKNVALGF--VGGLMVAVLV
A0A373VCW2      ----------IGAGSVEKIGDAEVY---NTPV----SPNTTKNVALGF--VGGLMVAVLV
W0U604          ----------IGAGSVEKIGDAEVY---NTPV----SPNTTKNVALGF--VGGLMVAVLV
A0A374B6G0      ----------IGAGSVEKIGDAEVY---NSPV----SPNTTKNVALGF--VGGLMVAVLV
A0A373VM36      ----------IGAGSVEKIGDAEVY---NTPV----SPNTTKNVALGF--VGGLMVAVLV
A0A1C5P379      ----------IGAGSVEKIGDAEVY---NTPV----SPNTTKNVALGF--VGGLMVAVLV
A0A373XXX0      ----------IGAGSVEKIGDAEVY---NTPV----SPNTTKNVALGF--VGGLMVAVLV
A0A5R9MJM9      ----------IGAGSVEKIGDAEVY---NTPV----SPNTTKNVALGF--VGGLMVAVLV
A0A356CW82      ----------IGAGSVEKIGDAEVY---NTPV----SPNTTKNVALGF--VGGLMVAVLV
R6T4X7          ----------IGAGSVEKIGDAEVY---NTPV----SPNTTKNVALGF--VGGLMVAVLV
A0A374HTV1      ----------IGAGSVEKIGDAEVY---NTPV----SPNTTKNVALGF--VGGLMVAVLV
A0A374GB66      ----------IGAGSVEKIGDAEVY---NTPV----SPNTTKNVALGF--VGGLMVAVLV
A0A374ECC6      ----------IGAGSVEKIGDAEVY---NTPV----SPNTTKNVALGF--VGGLMVAVLV
A0A374BM61      ----------IGAGSVEKIGDAEVY---NTPV----SPNTTKNVALGF--VGGLMVAVLV
A0A373UGZ4      ----------IGAGSVEKIGDAEVY---NTPV----SPNTTKNVALGF--VGGLMVAVLV
A0A373SA66      ----------IGAGSVEKIGDAEVY---NTPV----SPNTTKNVALGF--VGGLMVAVLV
A0A1C5X6X7      ----------IGAGSVEKIGDAEVY---NTPV----SPNTTKNVALGF--VGGLMVAVLV
A0A1C6JIH3      ----------IGAGSVEKIGDAEVY---NTPV----SPNTTKNVALGF--VGGLMVAVLV
A0A373PSC3      ----------IGAGSVEKIGDAEVY---NTPV----SPNTTKNVALGF--VGGLMVAVLV
A0A1K1WYK8      ----------VGVGSINTIGKAKVY---KKPV----APNNTKNGILGM--AAAFLIVVMV
A0A1H6IUB1      ----------VGVGSINTIDRAKVY---NSPV----APNMKKNAVLGA--MAALMLTCMI
A0A1M7L1F9      ----------VGVGSINTIDVAKVY---NNPV----APNMKKNAVLGA--MAALMLTCMI
A0A1C6B4L6      ----------VGVGSINTIDKAKVY---ETPV----APNVIKNTLLGM--AAALLIVVTI
A0A1Q6T9P4      ----------VGVGSINTIDKAKVY---ETPV----APNVIKNTLLGM--AAALLIVVTI
A0A315Y4F9      ----------VGVGSINTIDTAKVY---NTPV----APNIMKNTMIGA--VAGFMLIVLI
A0A354K620      ----------VGVGSINTIDTAKVY---KHPV----APNTMKNTALGA--AAGFMLIVLI
A0A355G3J9      ----------VKAASVEIIEEPKLP---TEDE---SEWPIVGNIAIGF--ALGLVLSVAY
A0A3D2AD87      ----------VDKNIRVSTTNADST---SVVY-----PRTVMSTAIAF--LVGAVLAFAI
A0A2T5IYJ6      RIKQANDSLELDTANARVIDKAVVP---NAPT----KPRKTLIIGISL--VLSLLFGAAL
A0A3C0QME1      ----------VGAGSVEVIDVAESV---YKPV----SPNKPKMALIGA--MAGLILAAFI
A0A355FYK5      ----------ASTINVRLINYPSSP---AISN----SDNSVKIAFLAF--MAGALLIALI
A0A357AQU0      ----------VGAGSVEIIGAAVPA---TVKS----GPSVSRYTIMGF--LIGFILVAAA
A0A3C1YJQ7      ----------VGAGSVEIIGAAVPA---TVKS----GPSVSRYTIMGF--LIGFILVAAA
A0A3D0JG38      ----------VGAGSVEIIGAAVPA---TVKS----GPSVSRYTIMGF--LIGFILVAAA
A0A3C0IHX1      ----------IGAGSVEVIGDAEIP---QSPS----APDVKKITMMAA--AAGFVLSAGV
R5V506          ----------IGAGSVEVIGDAEIP---QSPS----APDVKKITMMAA--AAGFVLSAGV
A0A352TIU5      ----------IGAGSVEVIGDAEVP---QSPS----APDVKKITMMAA--AAGFVLSAGV
A0A3E5FSY5      ----------LGQIQFHMINNPQLP---TDPY---NKLTFTNTVLVGG--IIGLVSGTII
A0A1V5S3C0      ----------FPNAKYTVVNDATEP---NSPD---ADYSGFLYTFIGA--VSGAIVAFAI
A0A1Y3TC98      ----------LGDIQFNMLDGPETP---AAPF---NQMSVRRCLLLGG--AGGAAVSLLI
A0A1Q6REE0      ----------VGSTVLVLLDESGMP---TAPV---AEFNYRYYITCGA--VVGAAVWCVI
R5ETF9          ----------VGSTVLVLLDESGMP---TAPV---AEFNYRYYITCGA--VVGAAVWCVI
R6VAT5          ----------VGATDLVLVVPPSAS---STPI---NPISYREKALIGT--AVGALLGLLI
A0A1Q6S448      ----------SSSAVLTQLNAPSLS---VSAA---RSYNVPRTCLIAA--AAGAALTAAA
A0A351MYR0      ----------SSTAVLSQLNSPSLS---VAPS---RSYNVPRICLIAA--IAGAALTALG
R6HPC1          ----------SSTAVLSQLNAPTLS---VAPS---RSYNVPKICLLAG--VIGAGLTAAA
A0A3D4G5Z5      ----------SSTAVLSQLNAPTLS---VAPS---RSYNVPKICLLAG--VIGAGLTAAA
A0A3D5ES03      ----------SSTAVLSQLNAPTLS---VAPS---RSYNVPKICLLAG--VIGAGLTAAA
A0A0F2P7X6      ----------VEVGSINVLDNAKVP---EFPN----APATFRNVGVGA--VLGLMLGLGI
A0A359B487      ----------VEVGSINVLDNAKVP---EFPN----APATFRNVGVGA--VLGLMLGLGI
A0A348P5V4      ----------FPNTALTVIDPPLKA---EAPN---GDNTKLLYPMLGF--VLGFFAACLC
A0A356PT74      ----------FPSTTLTVIDPPLLA---SAPN---RDASARNYTIVGF--AAGLVISIFA
A0A3D5LL19      ----------FPSTTLTVIDPPLLA---SAPN---RDASARNYTIVGF--AAGLVISIFA
R5MNF0          ----------FPSTTLTVIDPPLLA---SAPN---RDASARNYTIVGF--AAGLVISIFA
A0A1Q9JSI0      ----------MGNVVLDVLQNPTVP---SGPVNKFQPTALMKKTFVYT--L--IFLCGLI
A0A3D5TNI1      ----------SGGSI-HLCDMPELP---TEPD---KSVGITRNAIIGA--LAGAVICALI
A0A358LJD0      ----------SGGSI-HLCDEPELP---TKPD---KSVGTVRNTIIGA--LAGAVICALI
R6I3L7          ----------SGGSI-HLCDEPELP---TKPD---KSVGTVRNAIIGA--LAGAVICALI
A0A3D1HXX0      ----------SGGSI-HLCDEPELP---TKPD---KSVGTVRNAIIGA--LAGAVICALI
A0A3D2QJB8      ----------SGGSI-HLCDEPELP---TKPD---KSVGTVRNAIIGA--LAGAVICALI
D4LC36          ----------VGAGSVEKIGDAKIY---EAAV----SPSVTKNTAIGF--AGGALLAILV
R7MQJ4          ----------VGAGSVEAIGTAKVN---NNPV----SPNFLKMAVIGA--FAGMLLAALI
A0A1V5GLC0      ----------IGVGQINYIDTAKVY---PNPV----GPNIKKNTALGA--IAGAMLMALI
W7V182          ----------VGVGQINTIGTAEVY---NSPV----APNVKKNTMLGL--MAAAMLAACI
                                                                            

A0A0H5SF45      SFFWELIDVKIKSKEDLTKRYQIPIL----------GVIPDFG-----------------
A0A1M6JRJ5      SMVKEVLNLKVVSQEDLLKHYNIPLL----------GAIPDFA-----------------
A0A1M7Y1S2      FVLKEILNLKVINQEDLLKHYDTPLL----------GCIPDFS-----------------
A0A3D5R4X5      FLIE-FLDKTIKTPEDIERYLNLSII----------GAIPHNE-----------------
A0A1I4C3N6      FLFFGLQDTRIRRKYEVEDMFNIPII----------GTVPLVE-----------------
A0A3B9CIM7      FLLRSMLDTTVRRKYEIEDLFTIPIL----------GDVPQME-----------------
A0A1G9WHW8      FILKGLLNTTIRKKYEIEDMFTIPIL----------GDVPEIE-----------------
A0A1H5VAA0      FILKGLLNTTIRKKYEIEDMFTIPIL----------GDVPEIE-----------------
A0A3R6VK11      FLLAGLMDTTIRRRYELKLAFRIPVL----------GDIPQIQ-----------------
A0A3R6QUY7      FLLAGLMDTTIRRRYELKLAFRIPVL----------GDIPQIQ-----------------
A0A373K3P9      FLLAGLMDTTIRRRYELKLAFRIPVL----------GDIPQIQ-----------------
A0A3R6JRU5      FLLAGLMDTTIRRRYELKLAFRIPVL----------GDIPQIQ-----------------
A0A1C5MS04      FLLAGLMDTTIRRRYELKLAFRIPVL----------GDIPQIQ-----------------
A0A3C1J150      FLLAGLMDTTIRRRYELKLAFRIPVL----------GDIPQIQ-----------------
A0A416CXD7      FLLAGLMDTTIRRRYELKLAFRIPVL----------GDIPQIQ-----------------
R6XBL9          FLLAGLMDTTIRRRYELKLAFRIPVL----------GDIPQIQ-----------------
A0A355W5Z7      FLLAGLMDTTIRRRYELKLAFRIPVL----------GDIPQIQ-----------------
A0A143WVN6      IVLVSILRPTVKRKSSARRQLDGRIL----------ATIPYER-----------------
W6RXP9          TFLLEYLDNTFKTKESVEGALNIPVM----------GVIPQMS-----------------
W6S4G8          VFLIEYMNNTYKSKEEVERNLKLPVL----------GVIPKFG-----------------
A0A1G6BLB6      VAFGSTFQDAIRAENEVEKKIDTKRL----------GTLYHEK-----------------
B5CSZ7          TVCLCIFTDKIHSMEQAKRLLDIPMI----------GSLDYVK-----------------
A0A1C6G8M0      IAISVITNTSIKNEEDIQKCSGLSVL----------GTIPDYK-----------------
A0A416MP73      VAVSVITNTSIKSDEDIQKCTGLSVL----------GAIPDYK-----------------
A0A3E4LL92      TVCLCIFTDKIHSMEQAKRLLDIPMI----------GSLDYVK-----------------
A0A415D1L1      TVYLCIFTDKIHSMEQAKRLLDIPMI----------GSLDHVK-----------------
A0A414P2K5      TVCLCIFTDKIHSMEQAKRLLDIPMI----------GSLDYVK-----------------
V8C417          TVCLCIFTDKIHSMEQAKRLLDIPMI----------GSLDYVK-----------------
A0A143XN92      ILFFSMKKDTIKSEEEFRKKLDIRYL----------GTIYHER-----------------
A0A173ZYY6      LGLFSYMKNTIKQENEIEKKLDARSL----------GAISYEW-----------------
A0A4Q5EHM9      LGLFSYMKNTIKQENEIEKKLDARSL----------GAISYEW-----------------
A0A173SMI2      LGLFSYMKNTIKQENEIEKKLDARSL----------GAISYEW-----------------
A0A174ASH7      LGLFSYMKNTIKQENEIEKKLDARSL----------GAISYEW-----------------
A6BH65          LGMFSYMKNTIKQENEIEKKLDARSL----------GAISYEW-----------------
R7G0D7          LGMFSYMKNTIKQENEIEKKLDARSL----------GAISYEW-----------------
A0A396G6S7      LAGISYIRDTIKNPGEVSTKLDTRLL----------GTIAYEK-----------------
A0A3E5A223      LAGISYIRDTIKNPGEVSTKLDTRLL----------GTIAYEK-----------------
R7D5E6          LAGISYIRDTIKNPGEVSTKLDTRLL----------GTIAYEK-----------------
A0A415HQH5      LAGISYIRDTIKNPGEVSTKLDTRLL----------GTIAYEK-----------------
A0A414W2C6      LAGISYIRDTIKNPGEVSTKLDTRLL----------GTIAYEK-----------------
A5ZNE7          LAGISYIRDTIKNPGEVSTKLDTRLL----------GTIAYEK-----------------
A0A395X821      LAGISYIRDTIKNPGEVSTKLDTRLL----------GTIAYEK-----------------
A0A1C5PY68      LAGISYIRDTIKNPGEVSTKLDTRLL----------GTIAYEK-----------------
A0A174CJF8      LAGISYIRDTIKNPGEVSTKLDTRLL----------GTIAYEK-----------------
A0A564SRR2      LAGISYIRDTIKNPGEVSTKLDTRLL----------GTIAYEK-----------------
A0A174R7V0      LAGISYIRDTIKNPGEVSTKLDTRLL----------GTIAYEK-----------------
A0A373MWV2      VGFFSFLRDTVKNETEFGRKIDADLL----------GTVYHEK-----------------
A0A417CE88      VGFFSFLRDTVKNETEFGRKIDADLL----------GTVYHEK-----------------
A0A416Y441      VGFFSFLRDTVKNETEFGRKIDADLL----------GTVYHEK-----------------
A0A357GPJ7      VGFFSFLRDTVKNETEFGRKIDADLL----------GTVYHEK-----------------
A0A396PAC1      VGFFSFLRDTVKNETEFGRKIDADLL----------GTVYHEK-----------------
A0A416EYU4      VGFFSFLRDTVKNETEFGRKIDADLL----------GTVYHEK-----------------
A0A416SCQ2      VGFFSFLRDTVKNETEFGRKIDADLL----------GTVYHEK-----------------
A0A416TGN7      VGFFSFLRDTVKNETEFGRKIDADLL----------GTVYHEK-----------------
A0A417SMF6      VGFFSFLRDTVKNETEFGRKIDADLL----------GTVYHEK-----------------
A0A1Y4MW77      IAIYAFFRKTVHKTQELEEVTNIKCL----------ATVPYLK-----------------
R6UHV6          ISVLSFYKDTVKKESDINKKLITQRL----------VSIPTQK-----------------
A0A3R9Q621      VFIWELIDVNVKDEEELKQRYNKPVI----------GNIPSYQ-----------------
A0A069RC75      VYVLEYFDNAVRSAEDIQNGIGISVI----------GSVPKLK-----------------
A0A174F2W5      VGFFSFLRDTVKNETEFGRKIDADLL----------GTVYHEK-----------------
A0A174S8E9      VGFFSFLRDTVKNETEFGRKIDADLL----------GTVYHEK-----------------
A0A416ZL97      IGLFSFLRDTVKNEAEFTRKIDADLL----------GVVYHEK-----------------
A0A174LSK1      IGLFSFLRDTVKNEAEFTRKIDADLL----------GVVYHEK-----------------
A0A373GY92      IGLFSFLRDTVKNEAEFTRKIDADLL----------GVVYHEK-----------------
A0A373NZQ6      IGLFSFLRDTVKNEAEFTRKIDADLL----------GVVYHEK-----------------
A0A417I9B9      IGLFSFLRDTVKNEAEFTRKIDADLL----------GVVYHEK-----------------
A0A417MP97      IGLFSFLRDTVKNEAEFTRKIDADLL----------GVVYHEK-----------------
A0A417WQF8      IGLFSFLRDTVKNEAEFTRKIDADLL----------GVVYHEK-----------------
A0A373RZ83      IGLFSFLRDTVKNEAEFTRKIDADLL----------GVVYHEK-----------------
A0A416U6I1      IGLFSFLRDTVKNEAEFTRKIDADLL----------GVVYHEK-----------------
R7JQZ9          IGLFSFLRDTVKNEAEFTRKIDADLL----------GVVYHEK-----------------
A0A3B8KKL6      ILVLEFVDHTFKKPDEVERYLSLNVV----------GTIPKFK-----------------
A0A2K9E6R0      ILVLEFVDHTFKKPDEVERYLSLNVV----------GTIPKFK-----------------
A0A2S8RBI0      ILVLEFVDHTFKKPDEVERYLSLNVV----------GTIPKFK-----------------
A0A0L6JLG6      IYLLEFIDHTFKKPEDVEHHLGLNVI----------GTVPAFE-----------------
G8LSN0          IYLLEIMDYTFKKPEDVERQMELTVI----------GAVPKFE-----------------
A0A1M5UYN6      VFLLDFLDNTIKTKEEVEKFIGLPVI----------GLIPKIT-----------------
A0A176JBT8      VLIKELKNKKFESKKGITDLLGIPYL----------GEIPAII-----------------
A0A1I5HIC6      IILIHIIDDTVKDVEQIEKYLGLTVL----------GTIPLET-----------------
A0A1Y3TC51      ICLLYVMRFTVKNPLCAQRQLDGKVR----------GVIPFEQ-----------------
A0A1Y3T1N0      ICLFYLLRFTVKSPSSASRLLDGTVR----------GIIPFES-----------------
A0A1Y3Y8U8      ICLFYLLRFTVKSPSSASRLLDGTVR----------GIIPFES-----------------
A0A5B0BQY5      VLIGEVYFTRLNTERKVERSLGIPFL----------GSILMKK-----------------
A6CLL4          VFIREAFFTKLNNQEKVERMLNAPYL----------GSVPKLP-----------------
A0A174DL89      VVLINYLDQRIKDKDELKELITFPIL----------GEIPDFS-----------------
A0A176U8D6      IALMVITNVSVKTDEDVQKCTGLSVL----------GAIPDYK-----------------
A0A1Q6KSQ5      IAISVITNTSIKNEEDIQKCSGLSVL----------GTIPDYK-----------------
A0A3D3U8B3      IAISVITNTSIKNEEDIQKCSGLSVL----------GTIPDYK-----------------
A0A3E5FRL7      IICLYLFRHTLKSSKNATKLLDGRVV----------GVIPYEK-----------------
A0A1Y4QK93      IACLYLFRHTLKSSKNAGKLLDGRVV----------GIIPYEK-----------------
B1C232          IVCLYLFRHTLKSSENATKLLDGRVV----------GVIPYEK-----------------
A0A401USI6      VLLINYLNNTIKSEDDVQRYLNLPMV----------GIIPKQN-----------------
A0A1V4IQ10      IFLIELLDYTFKNKEKLERIVQLPTF----------GLIPDDT-----------------
A0A1S8TRD2      IFLIEFLDYTFKDKEKLERIVQLPTF----------GIIPDDT-----------------
G7M1U2          IFLIEFLDYTFKDKEKLERIVQLPTF----------GIIPDDT-----------------
A0A2T6KJ75      ILIQEMFFTLVDSSEKAEKALALPVI----------GLVPPGE-----------------
A9KN92          IIFIHIIDDSIKNAEQIEKYLGLTVL----------GTIPLEL-----------------
A0A352MUJ1      ILVLNLFDSTVKNDKDIEKTLNIKTL----------ASFAKNQ-----------------
R5YI67          ILILNLFDSTVKNDKDIEKALNIKTL----------ATFARNP-----------------
A0A1Y0IQP5      AFLLEFLNNTVKTEGEIEQLLQLPAL----------GAITAYD-----------------
A0A4R2R7B1      ALLLAFLNNTVQTEAEAEQLLQLPAL----------GAIPFFE-----------------
A0A1M6E8I2      ILMLEMLDGTIKTSDDIEKHIGLPVI----------GSIFEFN-----------------
A0A1Y4N105      IALLSIFRQTVKRSKQAKYQLDGRII----------TTIPYER-----------------
A0A1Y4QP75      IALLSIFRQTVKRSKQAKYQLDGRII----------TTIPYER-----------------
A0A3D4QRB5      IFLIEYLDNTIKTQEDAEEFLKLPVI----------GRIPNFD-----------------
A0A349DEH5      MFIIFLVKDTAKTADELSDKLDVHIL----------GSVQQIT-----------------
A0A3D4T7B4      MFIIFLVKDTAKTADELSDKLDVHIL----------GSVQQIT-----------------
A0A350XYC7      FFIMFLVKDTAKTADELSEKLDVHIL----------GSVQQIT-----------------
R6DNR8          FFIMFLVKDTAKTADELSEKLDVHIL----------GSVQQIT-----------------
A0A355KUM5      FFIMFLVKDTAKTADELSEKLDVHIL----------GSVQQIT-----------------
R5YGY6          FFIMFLVKDTAKTADELSEKLDVHIL----------GSVQQIT-----------------
A0A0K8J554      AFLWELIDVKVKSKDDLMEKYQIPIL----------GAIPSFN-----------------
A0A3N1XSX6      SFLWEIFDVNIKEKEELITNYQLPVL----------GEIPNFN-----------------
A0A1C6G0U3      AFILDYLDSKIKNKGDVEKYLDLPII----------GGIPM-------------------
A0A3D4LLB3      LFLKEYFDSTAKTEKDIENLLGLSII----------GAVPNFN-----------------
A0A0A5GPA9      VFLKEVIFTRADSEEKVEKVFRLSSL----------GVVPIIS-----------------
A0A271M6M4      IFLKETIFTKFDSQEKIEQAFKLPSL----------GVIPVIS-----------------
A0A2V3W8U6      AFLSAYFNTKISSKEDIEKYLGLSFL----------GEVGIIS-----------------
W1UFG0          ILLREILDKTIKTTKDIEKYFDFNIL----------GVVSK-------------------
A0A351SRI8      IAICFYFDDTVKNESDAERELGVPIL----------GAVPKYK-----------------
A0A1V5LU59      IYLLEMIDYTFKKPEQVEKQLGLNLI----------GVVPKFE-----------------
A0A1E3BVC3      IFLLELIDHTFKKPEEVERTLGINVI----------GTIPEFE-----------------
A0A4Q0I6S0      IFLLELIDHTFKKPEEVERTLGINVI----------GTIPEFE-----------------
A3DF66          IFLLELIDHTFKKPEEVEKMLGINVI----------GTIPAFD-----------------
W4V1T8          IFLLELIDHTFKKPEEVERILGINVI----------GTIPAFE-----------------
A0A1I0RG99      SLLLVLFDLNVKNQDELLKRYQLPIL----------GTIPNFN-----------------
A0A1I5G322      SLLGEVMDVNVKNQDDLLRKYQVPIL----------GVIPNYK-----------------
A0A1C6ITD7      VILIDYLDQRIKDKSELKELIHLPIL----------GEIPNFS-----------------
A0A381IX63      VLLLDYFDNKVKTPEELEDILDTSLL----------GVIPFEN-----------------
A0A1G9IUT4      TFVREYIDTKVKSSKDVEEKLNLQII----------GNIPNEN-----------------
A0A1M6RWV2      VFLLEYLDNSFKGPDDVEKRLNLPVL----------GAVPAVE-----------------
A0A143XPI5      LAVYALTRNTICGDEDVKKIMQIKSL----------GTLPTVK-----------------
A0A355G1X5      ILIVNAARDTLMSSDDVQIKLDAKLL----------GTVYTVR-----------------
A0A0M6WXE3      FAIWSYMHNTVKQEREVEKKLDARSL----------GAISYEW-----------------
A0A348SAK2      FAIWSYMHNTVKQEREVEKKLDARSL----------GAISYEW-----------------
A0A1G9H5B9      LALLYILNQKITDLRELKENYKLPIL----------AEIK--------------------
R5EFZ0          LAILSYLRDAVRSGTEAREKLDCSYL----------GEISHER-----------------
A0A1Y4H8L0      FGLLSFFRDTVKQEDDVEAKLDTRSL----------GALVYEP-----------------
A0A0M6WYQ8      LSLYVLTRRTVKTGKEIKTHLNLVDL----------GTLPEVH-----------------
A0A348SAK1      LSLYVLTRRTVKTGKEIKTHLNLVDL----------GTLPEVH-----------------
A0A252F281      VILMSCLRDTVKREEEVKEKLDTHLI----------ASVPHEK-----------------
A0A1Y4QKE6      LGCMALFRKTVKNPEDMKRITNLNCM----------ATIPRVK-----------------
B1C231          LGCMALFRKTVKNPEDMKRITNLNCM----------ATIPQVK-----------------
A0A1Y3TUL5      SFLKFLLLPTVVNTKDIENTLGLEVL----------GEIPENV-----------------
A0A1Y4JAX2      SFLKFLLLPTVVNTKDIENTLGLEVL----------GEIPENV-----------------
A0A1Y4T590      SFLKFLLLPTVVNTKDIENTLGLEVL----------GEIPENV-----------------
R5B467          LYLSGRARATVMNRDDLQQATSARYL----------GALPAVR-----------------
A0A1Y3T163      LGLTALFRRTARNPEEMQKITSLRCL----------AMIPQVR-----------------
A0A1Y3YCA2      LGLTALFRRTARNPEEMQKITSLRCL----------AMIPQVR-----------------
A0A1Y4L6N9      VVLYAFLKRTVQKPEELKKVSNLKCL----------AKIPNVR-----------------
A0A173T644      IVLYAFFRKTVQTPDELKNVMSLPCL----------GNLPEMK-----------------
A0A1C5TSB8      IVLYAFFRKTVQTPDELKNVMSLPCL----------GNLPEMK-----------------
C0CIK6          IVLYAFFRKTVQTPDELKNVMSLPCL----------GNLPEMK-----------------
A0A1Y3WEF6      ICLCALFKKTVQKPEELNSVMSLSCI----------ANIPEVS-----------------
A0A417T0L2      ICLYAFFKKTVQKPEELKSVMSLSCI----------ANIPEVS-----------------
A0A1H9EPU3      VVLRFMLDDSIKTQEDVENKIGLSVLANMPYKENIEEGLYEND-----------------
A0A354IGV3      IALLTLVRDTIQTPTCIERKLDIKRF----------GVIYHER-----------------
A0A417JMV2      IAILSFLKDTVRKPKEVSRKLDAKLL----------QTLYHEK-----------------
B0P408          IAILSFLKDTVRKPKEVSRKLDAKLL----------QTLYHEK-----------------
D4MV82          IAILSFLKDTVRKPKEVSRKLDAKLL----------QTLYHEK-----------------
A0A415VWX5      IAILSFLKDTVRKPKEVSRKLDAKLL----------QTLYHEK-----------------
A0A173UY96      IAILSFLKDTVRKPKEVSRKLDAKLL----------QTLYHEK-----------------
A0A173QTL1      IAILSFLKDTVRKPKEVSRKLDAKLL----------QTLYHEK-----------------
A0A174A3T7      IAILSFLKDTVRKPKEVSRKLDAKLL----------QTLYHEK-----------------
A0A174J359      IAILSFLKDTVRKPKEVSRKLDAKLL----------QTLYHEK-----------------
A0A417UUA3      IAILSFLKDTVRKPKEVSRKLDAKLL----------QTLYHEK-----------------
A0A1C6EUV9      IAIVSFLKDTVRKPKEVSKKLDGTLL----------QTLYHER-----------------
A0A173Y645      IAIISFLKDTVRKPKEVSKKLDGTLL----------QTLYHER-----------------
A0A374AVY6      IAIISFLKDTVRKPKEVSKKLDGTLL----------QTLYHER-----------------
R7BXS4          IAIISFLKDTVRKPKEVSKKLDGTLL----------QTLYHER-----------------
A0A143ZUX1      VWVLTRVSHTIQSEDDVYDFLPVKLF----------ASIPTIG-----------------
S3FFL2          AFALEQMDEAIADPSEVERQFGLPLL----------GSVPKVT-----------------
A0A328M4V1      VFLRQLLNRGVEDPAAIER-LGLPVY----------VSIPR-S-----------------
A0A5C8HCX2      VLARAMLRRGVEAPEQLEE-HGISVY----------ATIPM-S-----------------
A0A1W1Z4C3      LTLLFLMNHRVEKPAELTDNYTPPIL----------SYIRRAK-----------------
A0A239QN83      LTLLFMMNHQVEKPGEITDHYTPPIL----------SYIRRAK-----------------
A0A3R9WAA7      IVVYAFARKTIHKPDDLIQITNVKLL----------GLLPHLR-----------------
A0A1G6BLF1      LFVYSMTKRTIRKEKDFAKILNVKCI----------AAIPHVR-----------------
R6HZX3          TLLMAIGRKTVRTADDLKRSTSVPCM----------GTIPAIQ-----------------
A0A1W2CEA6      FLFIILLDDRIRSGEDITKAVDLPVF----------GAVTRQN-----------------
R7FFK6          ILVIDFFDNTIKDSSELGEHFQKPMI----------GEIQSIG-----------------
A0A373MPB9      ILVIDFFDNTVKNSDELGDIYQKPIV----------GEIMNIG-----------------
A0A373L519      ILVIDFFDNTVKNSDELGDIYQKPIV----------GEIMNIG-----------------
A0A373W906      ILVIDFFDNTVKNSDELGDIYQKPIV----------GEIMNIG-----------------
A0A373VCW2      ILVIDFFDNTVKNSDELGDIYQKPIV----------GEIMNIG-----------------
W0U604          ILVIDFFDNTVKNSDELGDIYQKPIV----------GEIMNIG-----------------
A0A374B6G0      ILVIDFFDNTVKNSDELGDIYQKPIV----------GEIMNIG-----------------
A0A373VM36      ILVIDFFDNTVKNSDELGDIYQKPIV----------GEIMNIG-----------------
A0A1C5P379      ILVIDFFDNTVKNSDELGDIYQKPIV----------GEIMNIG-----------------
A0A373XXX0      ILVIDFFDNTVKNSDELGDIYQKPIV----------GEIMNIG-----------------
A0A5R9MJM9      ILVIDFFDNTVKNSDELGDIYQKPIV----------GEIMNIG-----------------
A0A356CW82      ILVIDFFDNTVKNSDELGDIYQKPIV----------GEIMNIG-----------------
R6T4X7          ILVIDFFDNTVKNSDELGDIYQKPIV----------GEIMNIG-----------------
A0A374HTV1      ILVIDFFDNTVKNSDELGDIYQKPIV----------GEIMNIG-----------------
A0A374GB66      ILVIDFFDNTVKNSDELGDIYQKPIV----------GEIMNIG-----------------
A0A374ECC6      ILVIDFFDNTVKNSDELGDIYQKPIV----------GEIMNIG-----------------
A0A374BM61      ILVIDFFDNTVKNSDELGDIYQKPIV----------GEIMNIG-----------------
A0A373UGZ4      ILVIDFFDNTVKNSDELGDIYQKPIV----------GEIMNIG-----------------
A0A373SA66      ILVIDFFDNTVKNSDELGDIYQKPIV----------GEIMNIG-----------------
A0A1C5X6X7      ILVIDFFDNTVKNSDELGEIYQKPIV----------GEIMNIG-----------------
A0A1C6JIH3      ILVIDFFDNTVKNSDELGEIYQKPIV----------GEIMNIG-----------------
A0A373PSC3      ILVIDFFDNTVKNSDELGEIYQKPIV----------GEIMNIG-----------------
A0A1K1WYK8      ILIIDYFDNTIKESEKIAKKYDKAII----------GEIQQFG-----------------
A0A1H6IUB1      IFLIDFFDNTVKDTDSVADKFKKPII----------GEIAAFG-----------------
A0A1M7L1F9      IFLVDFFDNTVRDTDAVGKEFKKPII----------GEIASFG-----------------
A0A1C6B4L6      ILITDYFDNTVKDVALLEKKYKKAII----------GEIQEFA-----------------
A0A1Q6T9P4      ILITDYFDNTVKDVALLEKKYKKAII----------GEIQEFA-----------------
A0A315Y4F9      IFLIDFFDNTIKDTDALGKKYNKAII----------GDIQAFG-----------------
A0A354K620      IFLIDFFDTTIKDTDDLGKKYNKAII----------GEIQAFG-----------------
A0A355G3J9      VLLSNALDTTIYGRKEIENAFTLPII----------ATIPIQG-----------------
A0A3D2AD87      SFIIDISDQSIRGEDEFVNQYEIPLL----------GSIPDFDNIVSSPNYKGYYGKASY
A0A2T5IYJ6      AFLLDYLDSTFKNAEDVEDKLGISML----------GMVPLIK-----------------
A0A3C0QME1      VLMIDFFDNSVRSSEMLTTKYEKAVF----------GEIVNFS-----------------
A0A355FYK5      VVLVEIFSDTIKDIDDIRNKTNVPII----------GSIPYVG-----------------
A0A357AQU0      IVIRTITDNTFRDAEDINKKFGLSVL----------GEVMDYG-----------------
A0A3C1YJQ7      IVIRTITDNTFRDAEDINKKFGLSVL----------GEVMDYG-----------------
A0A3D0JG38      IVIRTITDNTFRDAEDINKKFGLSVL----------GEVMDYG-----------------
A0A3C0IHX1      AVLIYLLDRTIKGEDDI-QSFSISYL----------GEVPEMV-----------------
R5V506          AVLIYLLDRTIKGEDDI-QSFSISYL----------GEVPEMV-----------------
A0A352TIU5      AVLIYMLDRTIKGEDDI-QSFSISYL----------GEVPEMV-----------------
A0A3E5FSY5      LGCMALFRKTVKNPEDMKRITNLNCM----------ATIPQVK-----------------
A0A1V5S3C0      ILISNRIKNLVQTSDDIRKRYNLNII----------AVVSKLD-----------------
A0A1Y3TC98      FLLMSLFWKAVCSPEDMKKITSLRCL----------AFIPHVR-----------------
A0A1Q6REE0      LAFLVLMKNTVHNEDELRETLNAPCL----------GQIPAVK-----------------
R5ETF9          LAFLVLMKNTVHNEDELRETLNAPCL----------GQIPAVK-----------------
R6VAT5          VFFLENLNHTVRHPDEIRKLLNNQRL----------GSIVKVV-----------------
A0A1Q6S448      VVWAAVFSGTVQTLEGARSGLDARII----------SSVPHEG-----------------
A0A351MYR0      VAWASVSSGTVQTQEGARSDLDAKII----------STVPHEG-----------------
R6HPC1          VAWASVTSGTVQTQEGARSDLDAKLI----------STVPHEG-----------------
A0A3D4G5Z5      VAWASVTSGTVQTQEGARSDLDAKLI----------STVPHEG-----------------
A0A3D5ES03      VAWASVTSGTVQTQEGARSDLDAKLI----------STVPHEG-----------------
A0A0F2P7X6      VFMLMFFDRTIKSGDDVKNKLGLTLL----------GSIPYLS-----------------
A0A359B487      VFMLMFFDRTIKSGDDVKNKLGLTLL----------GSIPYLS-----------------
A0A348P5V4      IIVAVVFKDTIKNSDEVTNKLGMKLL----------GVIGRVY-----------------
A0A356PT74      IVLAVIAKDTVKTADDVKDKLGVDVI----------GMVAHVN-----------------
A0A3D5LL19      IVLAVIAKDTVKTADDVKDKLGVDVI----------GMVAHVN-----------------
R5MNF0          IVLAVIAKDTVKTADDVKDKLGVDVI----------GMVAHVN-----------------
A0A1Q9JSI0      GII-SFLKDTVRKPKEVSRKLDGKLL----------ETLYHEK-----------------
A0A3D5TNI1      IIIRDSARNTVRSQEDIQNKLQLNVI----------GEVSQVP-----------------
A0A358LJD0      IIIRDSARNTVRSQEDIQNKLQLNVI----------GEVSQVP-----------------
R6I3L7          IIIRDSARNTVRSQEDIQNKLQLNVI----------GEVSQVP-----------------
A0A3D1HXX0      IIIRDSARNTVRSQEDIQNKLQLNVI----------GEVSQVP-----------------
A0A3D2QJB8      IIIRDSARNTVRSQEDIQNKLQLNVI----------GEVSQVP-----------------
D4LC36          ILLIDFFDNTVRGTEELREHFSKPII----------AEIQSIG-----------------
R7MQJ4          ILVIDFFDNTVKDKEEIAQKYEKAII----------GEIPEFI-----------------
A0A1V5GLC0      ILVIDFFDNTFKDPEALREKYKKAVV----------GEIQDFT-----------------
W7V182          IVVIDFFDNTVKDAGRLGESYKKAII----------GEIQQFD-----------------
                                                      .                     

A0A0H5SF45      --------------VKMPKR---YLLMQKLPFKNRLNEIIKDKVEF---NQVKN--QEAN
A0A1M6JRJ5      --------------AEDNSR--------DKSIPARLKKLIRKGYGEDLNQGLIT---QDS
A0A1M7Y1S2      --------------PVNSSR--------KNKILLELKGILIKGENFMKPEKIQN--RQNS
A0A3D5R4X5      --------------KAEKR------------------------------KVVTF--EDPK
A0A1I4C3N6      --------------STDK----------------------------VKKSPILG--ENSS
A0A3B9CIM7      --------------PAAKG---------------------------EKVNKILH--KESP
A0A1G9WHW8      --------------TEEAKG---------------------VIKNSSYNPKVLN--EDST
A0A1H5VAA0      --------------TEETKG---------------------VIKNSSYNPKVLN--EDST
A0A3R6VK11      --------------ASDRK---------------------------SKPVLVLG--ENSS
A0A3R6QUY7      --------------APDRK---------------------------SKPVLVLG--ENSS
A0A373K3P9      --------------APDRK---------------------------SKPVLVLG--ENSS
A0A3R6JRU5      --------------APDRK---------------------------SKPVLVLG--ENSS
A0A1C5MS04      --------------APDRK---------------------------SKPVLVLG--ENSS
A0A3C1J150      --------------APDRK---------------------------SKPVLVLG--ENSS
A0A416CXD7      --------------APDRK---------------------------SKPVLVLG--ENSS
R6XBL9          --------------APDRK---------------------------SKPVLVLG--ENSS
A0A355W5Z7      --------------APDRK---------------------------SKPVLVLG--ENSS
A0A143WVN6      --------------KYKSIH--------------------EYLHKPKKSVLISS--RLLS
W6RXP9          --------------NSSKPG---------------------------KKYFVVE--DDPK
W6S4G8          --------------RK-------------------------------REKLVME--EEPR
A0A1G6BLB6      --------------KYKTFT--------------------RRSKKKKRSILITD--PTVS
B5CSZ7          --------------KKSGQK----------------------------ALLISD--QDTD
A0A1C6G8M0      --------------GGKKRK----------------------------EKIIWP--DELP
A0A416MP73      --------------G--KKQ----------------------------KKIMWP--EDLP
A0A3E4LL92      --------------KKSGQK----------------------------ALLISD--QDTD
A0A415D1L1      --------------KKSGQK----------------------------ALLISD--QDTD
A0A414P2K5      --------------KKSGQK----------------------------ALLISD--QDTD
V8C417          --------------KKSGQK----------------------------ALLISD--QDTD
A0A143XN92      --------------KHKTIR--------------------SAIKRESVNMLITN--PILS
A0A173ZYY6      --------------KYKTIR--------------------DIFRRKKKAILVDD--PVAS
A0A4Q5EHM9      --------------KYKTIR--------------------DIFRRKKKAILVDD--PVAS
A0A173SMI2      --------------KYKTIR--------------------DIFRRKKKAILVDD--PVAS
A0A174ASH7      --------------KYKTIR--------------------DIFRRKKKAILVDD--PVAS
A6BH65          --------------KYKTIR--------------------DIFRRKKKAILVDD--PVAS
R7G0D7          --------------KYKTIR--------------------DIFRRKKKAILVDD--PVAS
A0A396G6S7      --------------KSKALS--------------------MKRKKDYLSMLIQN--PLRS
A0A3E5A223      --------------KSKALS--------------------MKRKKDYLSMLIQN--PLRS
R7D5E6          --------------KSKALS--------------------MKRKKDYLSMLIQN--PLRS
A0A415HQH5      --------------KSKALS--------------------MKRKKDYLSMLIQN--PLRS
A0A414W2C6      --------------KSKALS--------------------MKRKKDYLSMLIQN--PLRS
A5ZNE7          --------------KSKALS--------------------MKRKKDYLSMLIQN--PLRS
A0A395X821      --------------KSKALS--------------------MKRKKDYLSMLIQN--PLRS
A0A1C5PY68      --------------KSKALS--------------------MKRKKDYLSMLIQN--PLRS
A0A174CJF8      --------------KSKALS--------------------MKRKKDYLSMLIQN--PLRS
A0A564SRR2      --------------KSKALS--------------------MKRKKDYLSMLIQN--PLRS
A0A174R7V0      --------------KSKALS--------------------MKRKKDYLSMLIQN--PLRS
A0A373MWV2      --------------KRKNSS-----------------------------MLITN--PARS
A0A417CE88      --------------KRKNSS-----------------------------MLITN--PARS
A0A416Y441      --------------KRKNSS-----------------------------MLITN--PARS
A0A357GPJ7      --------------KRKNSS-----------------------------MLITN--PARS
A0A396PAC1      --------------KRKNSS-----------------------------MLITN--PARS
A0A416EYU4      --------------KRKNSS-----------------------------MLITN--PARS
A0A416SCQ2      --------------KRKNSS-----------------------------MLITN--PARS
A0A416TGN7      --------------KRKNSS-----------------------------MLITN--PARS
A0A417SMF6      --------------KRKNSS-----------------------------MLITN--PARS
A0A1Y4MW77      --------------QKKRSR--------------------------GKTIMPSILNLQTN
R6UHV6          --------------KRLSVR--------------------EKVKGIKRPLSITN--PVIS
A0A3R9Q621      --------------GNDAVR-----EKLRRILPGRNKNRQAGRGKAKSGGLDKIIDENTK
A0A069RC75      --------------MSGEKG----------------------------AELVIK--TSPK
A0A174F2W5      --------------KRKNSS-----------------------------MLITN--PARS
A0A174S8E9      --------------KRKNSS-----------------------------MLITN--PARS
A0A416ZL97      --------------KKKNSS-----------------------------MLITN--PARS
A0A174LSK1      --------------KKKNSS-----------------------------MLITN--PARS
A0A373GY92      --------------KKKNSS-----------------------------MLITN--PARS
A0A373NZQ6      --------------KKKNSS-----------------------------MLITN--PARS
A0A417I9B9      --------------KKKNSS-----------------------------MLITN--PARS
A0A417MP97      --------------KKKNSS-----------------------------MLITN--PARS
A0A417WQF8      --------------KKKNSS-----------------------------MLITN--PARS
A0A373RZ83      --------------KKKNSS-----------------------------MLITN--PARS
A0A416U6I1      --------------KKKNSS-----------------------------MLITN--PARS
R7JQZ9          --------------KKKNSS-----------------------------MLITN--PARS
A0A3B8KKL6      --------------GGKRGK--------------SKAKNRRELEKEHLKNLITI--NDPK
A0A2K9E6R0      --------------GGKRGK--------------SKAKNRRELEKEYLKNLITK--NDPK
A0A2S8RBI0      --------------GGKRGK--------------SKAKNRRELEKEYLKNLITK--NDPK
A0A0L6JLG6      --------------GGKRGN--------------KKAKDEKQLEEEYLKNLITA--NDPK
G8LSN0          --------------GGKRGK--------------NEKKDSKENERDYLKNLITK--NDPK
A0A1M5UYN6      --------------EKVYLI----------------------------------VKSNPS
A0A176JBT8      --------------PQGPTN---------------------KYLDERYNKLVAH--TEPH
A0A1I5HIC6      --------------KYAGKI-----------KNKKKAIKKRKKEENIYPEGISIEKASLE
A0A1Y3TC51      --------------KGTALR---------------------QKKNPKEALLLDS--PVVS
A0A1Y3T1N0      --------------KG--IL---------------------GRKNTKKALLLNS--PLVS
A0A1Y3Y8U8      --------------KG--IL---------------------GRKNAKKALLLNS--PLVS
A0A5B0BQY5      --------------EKKGKS-----------------------RNYNSDFESVTPRVQFP
A6CLL4          --------------PQSNLN------------------NKHSPNNTYSKFLISS--SEAN
A0A174DL89      --------------SVNINN--------------------------KGNYLFVN--ESPK
A0A176U8D6      --------------G--KKQ----------------------------KKIMWP--ENLP
A0A1Q6KSQ5      --------------GGKKRK----------------------------EKIIWP--DELP
A0A3D3U8B3      --------------GGKKRK----------------------------EKIIWP--DELP
A0A3E5FRL7      --------------KKRDKH----------------------LKKLKQSLLISS--PIAS
A0A1Y4QK93      --------------KKRNKH----------------------LKKSKQSLLITS--PIAS
B1C232          --------------KKRNKH----------------------LKKSKQSLLISS--PIAS
A0A401USI6      --------------KMVNLI----------------------------------VEREPK
A0A1V4IQ10      --------------KIRKTK----------------------------NHITLIVEQKPK
A0A1S8TRD2      --------------KVRKIK----------------------------NHIALIVEKKPK
G7M1U2          --------------KVRKIK----------------------------NHITLIVEKKPK
A0A2T6KJ75      --------------GKLIHD------------------------------------LPTF
A9KN92          --------------KNSNKR-------------GKNKKAYKRKKGDTNNEHSSIQKATLE
A0A352MUJ1      --------------NARPGV----------------------------------IDLDPK
R5YI67          --------------NIKQGL----------------------------------IDLDPK
A0A1Y0IQP5      --------------NKGRAG----------------------------HRLAVR--QDPR
A0A4R2R7B1      --------------QKGSSG----------------------------YRVVVR--QDPR
A0A1M6E8I2      --------------SESEGI-------------------------------IVH--ENPK
A0A1Y4N105      --------------KYHSLQ--------------------ELKKKPKKSVLINS--PLLS
A0A1Y4QP75      --------------KYHSLQ--------------------ELKKKPKKSVLINS--PLLS
A0A3D4QRB5      --------------TKKSKK----------------------KSADRSPRLATG--AATR
A0A349DEH5      --------------NKNKAA---------------------------KGLLVTD--RKNG
A0A3D4T7B4      --------------NKNKAA---------------------------KGLLVTD--RKNG
A0A350XYC7      --------------NKNKTA---------------------------KGLLVTD--RKNG
R6DNR8          --------------NKNKTA---------------------------KGLLVTD--RKNG
A0A355KUM5      --------------NKNKTA---------------------------KGLLVTD--RKNG
R5YGY6          --------------NKNKTA---------------------------KGLLVTD--RKNG
A0A0K8J554      --------------DMIPRK------------NVLLQKMSFLNRKKKKSNLNQMINEQAN
A0A3N1XSX6      --------------GYKEKQ-------------LYKRYFPFLLKYKKFSKTERELMDNSK
A0A1C6G0U3      --------------------------------------------DKMLKKEVTNTLISNE
A0A3D4LLB3      --------------HGSKTA---------------------------YGNFLIK--DNPS
A0A0A5GPA9      --------------DEWNQK------------------KEDLMQNDRYFKLLPR--LGTY
A0A271M6M4      --------------DKPKRS------------------NGLFDREDRFNKMLPQ--LNPY
A0A2V3W8U6      --------------KNRKNR-------------------LNSNKKEDLHSILTSRKGPMS
W1UFG0          ----------------------------------------------QKEKLMYVKDLDRK
A0A351SRI8      --------------EKVSSG--------------------------KASDLIIC--KDSK
A0A1V5LU59      --------------GGKRGK--------------SKNKDQKQLEQDYLKNLITK--NDPK
A0A1E3BVC3      --------------GGKRGK--------------KKAKDEKELQEQYLKNLIVH--NNPK
A0A4Q0I6S0      --------------GGKRGK--------------KKAKDEKELQEQYLKNLIVH--NNPK
A3DF66          --------------GGKRGK--------------KKAKDEKELQEQYLKNLIVH--NNPK
W4V1T8          --------------GGKRGK--------------KKAKDEKELQEEYLKNLIVH--NNPK
A0A1I0RG99      --------------VNIKRK-FVLKKTILTDLLHKKV---------KRNNISKN--KDTE
A0A1I5G322      --------------NNKKKKVLLIKLTSIAKRLNKKIDSKENKKAGKSENIKENAEKDTQ
A0A1C6ITD7      --------------SININN--------------------------EDNYLFAN--VSPK
A0A381IX63      --------------EEERKK--------------------------YEGNVTII--GNSK
A0A1G9IUT4      --------------NLDS--------------------------------------KNMK
A0A1M6RWV2      --------------NENSLR------------------------------LITM--KDPK
A0A143XPI5      --------------M----K--------------------KRRKDKNMEVSLLNQK--LS
A0A355G1X5      --------------N----K--------------------SGKKNQHPVLMITDRS--LG
A0A0M6WXE3      --------------KYKTIK--------------------EWIKHRKKAVLVDNPL--AS
A0A348SAK2      --------------KYKTIK--------------------EWIKHRKKAVLVDNPL--AS
A0A1G9H5B9      -------------------R--------------------LDSAKKDPEAFLLTNR--SP
R5EFZ0          --------------KYKTVF--------------------ALLRRKKTSILITNPV--TS
A0A1Y4H8L0      --------------KAKNLR--------------------ELFQKQKKALLVSQPL--AG
A0A0M6WYQ8      --------------VK---K--------------------RNKESFYNSVNVLNKR--IP
A0A348SAK1      --------------VK---K--------------------RNKESFYNSVNVLNKR--IP
A0A252F281      --------------RP---D--------------------GKNKKEKHSFLITHTV--IS
A0A1Y4QKE6      --------------I----K--------------------ARKIHKQTRISINDRR--IP
B1C231          --------------F----K--------------------ARKIHKQTRISINDRR--IS
A0A1Y3TUL5      --------------EY--------------------------FRRKKSLLVEDDDP--IG
A0A1Y4JAX2      --------------EY--------------------------FRRKKSLLVEDDDP--MG
A0A1Y4T590      --------------EY--------------------------FRRKKSLLVEDDDP--MG
R5B467          --------------V-------------------------KKRSRTTPAALPEEMA--RS
A0A1Y3T163      --------------F----K--------------------ARKKQKKKKISVLDKR--LS
A0A1Y3YCA2      --------------F----K--------------------ARKKQKKKKISVLDKR--LS
A0A1Y4L6N9      --------------Q----K--------------------ARKKRIESRITVFDSR--VG
A0A173T644      --------------Q----K--------------------ARKKKRRRDISILNKE--FS
A0A1C5TSB8      --------------Q----K--------------------ARKKKRRRDISILNKE--FS
C0CIK6          --------------Q----K--------------------ARKKKRRRDISILNKE--FS
A0A1Y3WEF6      --------------K----K--------------------LRKKQDTRWIQMQDSR--TP
A0A417T0L2      --------------R----K--------------------LRKKQTTRWIQMQDSR--TP
A0A1H9EPU3      --------------PEKKEK--------------------NKLKLRQNGQVIPT-N--KD
A0A354IGV3      --------------KNRTLR--------------------DSLHKVNRSVLLTNPV--AS
A0A417JMV2      --------------IYKTWK--------------------ARIHRKKSPVLLTNPG--TS
B0P408          --------------IYKTWK--------------------ARIHRKKSPVLLTNPG--TS
D4MV82          --------------IYKTWK--------------------ARIHRKKSPVLLTNPG--TS
A0A415VWX5      --------------IYKTWK--------------------ARIHRKKSPVLLTNPG--TS
A0A173UY96      --------------IYKTWK--------------------ARIHRKKSPVLLTNPG--TS
A0A173QTL1      --------------IYKTWK--------------------ARIHRKKSPVLLTNPG--TS
A0A174A3T7      --------------IYKTWK--------------------ARIHRKKSPVLLTNPG--TS
A0A174J359      --------------IYKTWK--------------------ARIHRKKSPVLLTNPG--TS
A0A417UUA3      --------------IYKTWK--------------------ARIHRKKSPVLLTNPG--TS
A0A1C6EUV9      --------------IYKSWK--------------------ARIHRKKSSVLLTNPG--TS
A0A173Y645      --------------LYKSWK--------------------ARIHRKKSSVLLTNPG--TS
A0A374AVY6      --------------SYKSWK--------------------ARIHRKKSSVLLTNPG--TS
R7BXS4          --------------SYKSWK--------------------ARIHRKKSSVLLTNPG--TS
A0A143ZUX1      -------------------S--------------------RSRSRKGNSSLLISPR--SD
S3FFL2          ---DGRSPRDVLFDR--------------------------------------------K
A0A328M4V1      ---ELQRERTLLRVR--------------------------HRRTVGRQNLLAAGA--PT
A0A5C8HCX2      ---EWLDKRTRLRKKNLFSN--------------------QQRHRTKNIPFLAVDN--PA
A0A1W1Z4C3      ------------------------------------------GEEKDAGVFLLNDK--TD
A0A239QN83      ------------------------------------------GSEKDAGAYLLNEK--SD
A0A3R9WAA7      ----------------ERKK--------------------NIIGDVRKRAQTDR----MA
A0A1G6BLF1      ---------------FKKRG--------------------KNASKNVELVLMDNFR--VP
R6HZX3          ------------VKRRRKAA--------------------GSG------VSILNPH--LG
A0A1W2CEA6      ----MERNAAELGADMPRNP--------------------AFADGKHQAVFRGNLK--LD
R7FFK6          ------------GKVKKKDR--------------------GTSADRKRKLIYHNSD--LP
A0A373MPB9      ------------GKTSKKDE--------------------GSSADRKKQLLFNNKD--IP
A0A373L519      ------------GKTSKKDE--------------------GSSADRKKQLLFNNKD--IP
A0A373W906      ------------GKTSKKDE--------------------GSSADRKKQLLFNNKD--IP
A0A373VCW2      ------------GKTSKKDE--------------------GSSADRKKQLLFNNKD--IP
W0U604          ------------GKTSKKDE--------------------GSSADRKKQLLFNNKD--IP
A0A374B6G0      ------------GKTSKKDE--------------------GSSADRKKQLLFNNKD--IP
A0A373VM36      ------------GKTSKKDE--------------------GSSADRKKQLLFNNKD--IP
A0A1C5P379      ------------GKTSKKDE--------------------GSSADRKKQLLFNNKD--IP
A0A373XXX0      ------------GKTSKKDE--------------------GSSADRKKQLLFNNKD--IP
A0A5R9MJM9      ------------GKTSKKDE--------------------GSSADRKKQLLFNNKD--IP
A0A356CW82      ------------GKTSKKDE--------------------GSSADRKKQLLFNNKD--IP
R6T4X7          ------------GKTSKKDE--------------------GSSADRKKQLLFNNKD--IP
A0A374HTV1      ------------GKTSKKDE--------------------GSSADRKKQLLFNNKD--IP
A0A374GB66      ------------GKTSKKDE--------------------GSSADRKKQLLFNNKD--IP
A0A374ECC6      ------------GKTSKKDE--------------------GSSADRKKQLLFNNKD--IP
A0A374BM61      ------------GKTSKKDE--------------------GSSADRKKQLLFNNKD--IP
A0A373UGZ4      ------------GKTSKKDE--------------------GSSADRKKQLLFNNKD--IP
A0A373SA66      ------------GKTSKKDE--------------------GSSADRKKQLLFNNKD--IP
A0A1C5X6X7      ------------GKTSKKDE--------------------GSSADRKKQLLFNNKD--IP
A0A1C6JIH3      ------------GKTSKKDE--------------------GSSADRKKQLLFNNKD--IP
A0A373PSC3      ------------GKTSKKDE--------------------GSSADRKKQLLFNNKD--IP
A0A1K1WYK8      --------------EGKKKK--------------------KGKHRTEPRGLLTDKD--VP
A0A1H6IUB1      --------------VEKKKK--------------------DSDEDEHVK--LTDKS--VP
A0A1M7L1F9      --------------IEKKKK--------------------DQDEDAHVK--LTDKN--VP
A0A1C6B4L6      --------------AERNDK--------------------SSK-DNYSK--LTDKD--IP
A0A1Q6T9P4      --------------AERNDK--------------------SSK-DNYSK--LTDKD--IP
A0A315Y4F9      --------------DSKKKR--------------------DAD-DVHLK--LTDKD--AP
A0A354K620      --------------DSKKKK--------------------DAD-DDYVK--LTDKE--TP
A0A355G3J9      EGK------------PNGKR--------------------NSFDNAVEQQVILSED--TP
A0A3D2AD87      RSR----------LKKHLTD--------------------SNNADDSKESVLEKKQ--IP
A0A2T5IYJ6      KRK----------------------------------------KDTSAIYFLDSKQ----
A0A3C0QME1      DGNSK--------KVQSEHR------------------------------TILDEK--MD
A0A355FYK5      KSTGL--------INKKPL---------------------------FTGGLLITDEDKVS
A0A357AQU0      TKKDK--------KKRRNVD--------------------PSKKNNFSFETILNKE--IP
A0A3C1YJQ7      TKKDK--------KKRRNVD--------------------PSKKNNFSFETILNKD--IP
A0A3D0JG38      TKKDK--------KKRRNVD--------------------PSKKNNFSFETILNKE--IP
A0A3C0IHX1      EARSG--------KRKRRKK--------------------KNSPSALRNMLLCAKD--IP
R5V506          EARSG--------KRKRRKK--------------------KNSPSALRNMLLCAKD--IP
A0A352TIU5      EARSG--------KRKRRKK--------------------KNSPSALRNMLLCAKD--IP
A0A3E5FSY5      FKA----------RKIHKQT--------------------R--------ISINDRR--IS
A0A1V5S3C0      LKR----------RK----------------------------NSPKKGLLIIDKT--VG
A0A1Y3TC98      FKA--------------RKK--------------------LDDTR----LSLLNEK--LP
A0A1Q6REE0      ISR----------KR--------------------------------PYPLLHRYR--SE
R5ETF9          ISR----------KR--------------------------------PYPLLHRYR--SE
R6VAT5          KKK---------------------------------------SSHSTGSLTIDDAH--TD
A0A1Q6S448      RRTRKLLGWFDDRRRERRAR--------------------RGGKRLRRNLNISSPA--IS
A0A351MYR0      RRTRKLLGWMDD-RRERQAR--------------------RGGKRLRRNLNISSPA--IS
R6HPC1          RRTRKLLGWMDD-RWERRSR--------------------RGGKRLRRNLNISSPA--IS
A0A3D4G5Z5      RRTRKLLGWMDD-RRERRSR--------------------RGGRRLRRNLNISSPA--IS
A0A3D5ES03      RQTRKLLGWMDD-RRERRSR--------------------RGGKRLRRNLNISSPA--IS
A0A0F2P7X6      PKA----------RKGQGQS--------------------QGQGQGQGAPLVTSDQ--VG
A0A359B487      PKA----------RK--------------------------DQGQGQGAPLVNSDQ--VG
A0A348P5V4      R-K----------NK--KGE--------------------SKQG-----ILITDKK--SG
A0A356PT74      RKK----------KK--KGE--------------------DYKP-----LLISDRR--SG
A0A3D5LL19      RKK----------KK--KGE--------------------DYKP-----LLISDRR--SG
R5MNF0          RKK----------KK--KGE--------------------DYKP-----LLISDSR--SG
A0A1Q9JSI0      RYK----------TW--KAR--------------------LHRKKNP--VLLTNPG--TS
A0A3D5TNI1      GGE----------RF--YKK--------------------SAHGDRE--LLITDKA--CG
A0A358LJD0      GGE----------RF--YKK--------------------SAHGGRE--LLITDKA--CG
R6I3L7          SGE----------RF--YKK--------------------SAHGDRE--LLITDKA--CG
A0A3D1HXX0      SGE----------RF--YKK--------------------STHGDRE--LLITDKA--CG
A0A3D2QJB8      SGE----------RF--YKK--------------------SAHGDRE--LLITDKA--CG
D4LC36          GKA----------KK--KNR--------------------GTDADRKTRLLFGNEN--IP
R7MQJ4          DDK----------KK--KKD--------------------SNDYD----LLLTQKG--IP
A0A1V5GLC0      IGR----------KK--KG----------------------EDDH----FKLTDGN--IP
W7V182          ESK----------KR--KKD--------------------VDDNH----VKLTDKN--VP
                                                                            

A0A0H5SF45      FLVNEAYKALRTNLLYTIR--KN--G-CKKILVNSPNPRDGKSTTCTNIAIALAKT-GAR
A0A1M6JRJ5      FLVTESYKALRTNLRFSIR--KE--E-CKKILITSPSPEDGKSTTSINLSIAISQA-GYK
A0A1M7Y1S2      FLVAESYKTLRTNLRFSIR--KE--G-CKKILITSPSPEDGKSTISINLSIAIAHA-GYK
A0A3D5R4X5      SPVAEAYRSLRTNLKFASL--DK--E-IKSIVVTSTIAGEGKSLTTSNLATAIAQT-GNK
A0A1I4C3N6      FEMREAYNEIRTFLTFSKR--DE--K-CPVYGILSADKGEGKTVSALNIASSLANT-GKK
A0A3B9CIM7      FAVRESYNSIRAKLLFTGK--GE--K-CPVYAITSADPGEGKTLTCINLASAYAQL-GKK
A0A1G9WHW8      FTITEAYNSIRTKLLYTAK--DQ--K-CPIYGITSADSGEGKSLNSMNLAISYSFL-GKK
A0A1H5VAA0      FTITEAYNSIRTKLLYTAK--DQ--K-CPIYGITSADSGEGKSLNSMNLAISYSFL-GKK
A0A3R6VK11      FAVKESYNTIRANLLFTGK--GE--R-CPVYAVTSADKDEGKTLNSVNIAISYAQL-GKK
A0A3R6QUY7      FAVKESYNTIRANLLFTGK--GE--R-CPVYAVTSADKDEGKTLNSVNIAISYAQL-GKK
A0A373K3P9      FAVKESYNTIRANLLFTGK--GE--R-CPVYAVTSADKDEGKTLNSVNIAISYAQL-GKK
A0A3R6JRU5      FAVKESYNTIRANLLFTGK--GE--R-CPVYAVTSADKDEGKTLNSVNIAISYAQL-GKK
A0A1C5MS04      FAVKESYNTIRANLLFTGK--GE--R-CPVYAVTSADKDEGKTLNSVNIAISYAQL-GKK
A0A3C1J150      FAVKESYNTIRANLLFTGK--GE--H-CPVYAVTSADKDEGKTLNSVNIAISYAQL-GKK
A0A416CXD7      FAVKESYNTIRANLLFTGK--GE--H-CPVYAVTSADKDEGKTLNSVNIAISYAQL-GKK
R6XBL9          FAVKESYNTIRANLLFTGK--GE--R-CPVYAVTSADKDEGKTLNSVNIAISYAQL-GKK
A0A355W5Z7      FAVKESYNTIRANLLFTGK--GE--R-CPVYAVTSADKDEGKTLNSVNIAISYAQL-GKK
A0A143WVN6      MSFTESNRKLATLIERHMT--RH--Q-QKVLLVCSVAENEGKSSVASNIALALADR-HKK
W6RXP9          AVASESYRTLKTNIQYSSF--DE--K-HRVMVVTSSTPGEGKSTTTGNLALALAEG-EAK
W6S4G8          SLEAECYRTMVTNIQYSSI--DS--R-CKTIVVTSSQKGEGKTTISGNLALSLAGW-GNR
A0A1G6BLB6      FSYSEAVRRMVSRVRNKMN--HR--N-SKVLMVTSVLENEGKSTVAVNLALELVEE-EQK
B5CSZ7          HVYEEAVDRIVTSIRSEMS--AE--G-YKTLMVGSIKENDGKSTVTANIALNLARR-GKK
A0A1C6G8M0      FSAAEAIYQLRTAILYSSK--D-----VKMIAVTSAFENQGKSFISFHLAYSLSQV-GKR
A0A416MP73      FNASEAIYQLRTGILYSSK--D-----VKTIVVTSAFENQGKSFISFHLAYSLSQV-GKR
A0A3E4LL92      HVYEEAVDRIVTSIGSEMS--AE--G-YKTLMVGSIKENDGKSTVTANMVLDLARR-GKK
A0A415D1L1      HVYEEAVDRIVTSIRSEMS--AE--G-YKTLMVGSVKENDGKSTVTANIALNLARR-GKK
A0A414P2K5      HVYEEAVDRIVTSIRSEMS--AE--G-YKTLMVGSIKENDGKSTVTANIALNLARR-GKK
V8C417          HVYEEAVDRIVTSIRSEMS--AE--G-YKTLMVGSIKENDGKSTVTANIALNLARR-GKK
A0A143XN92      RKYINSIEITAAKVRNRMD--AK--R-IKTVMITSMMENEGKSTVAANLALEFAKM-GKN
A0A173ZYY6      FRFVESYKKLAAKVEYRMA--KN--E-QKVLVVTSVSENEGKSTVAANLAITLAEQ-SKR
A0A4Q5EHM9      FRFVESYKKLAAKVEYRMA--KN--E-QKVLVVTSVSENEGKSTVAANLAITLAEQ-SKR
A0A173SMI2      FRFVESYKKLAAKVEYRMA--KN--E-QKVLVVTSVSENEGKSTVAANLAITLAEQ-SKR
A0A174ASH7      FRFVESYKKLAAKVEYRMA--KN--E-QKVLVVTSVSENEGKSTVAANLAITLAEQ-SKR
A6BH65          FRFVESYKKLAAKVEYRMA--KN--E-QKVLVVTSVSENEGKSTVAANLAITLAEQ-SKR
R7G0D7          FRFVESYKKLAAKVEYRMA--KN--E-QKVLVVTSVSENEGKSTVAANLAITLAEQ-SKR
A0A396G6S7      FAYVESSKMAASRVRSYMD--KE--D-AKVLLVTSVMENEGKSTVAANLALSLAQG-GSR
A0A3E5A223      FAYVESSKMAASRVRSYMD--KE--D-AKVLLVTSVMENEGKSTVAANLALSLAQE-GSR
R7D5E6          FAYVESSKMAASRVRSYMD--KE--D-AKVLLVTSVMENEGKSTVAANLALSLAQG-GSR
A0A415HQH5      FAYVESSKMAASRVRSYMD--KE--D-AKVLLVTSVMENEGKSTVAANLALSLAQG-GSR
A0A414W2C6      FAYVESSKMAASRVRSYMD--KE--D-AKVLLVTSVMENEGKSTVAANLALSLAQE-GSR
A5ZNE7          FAYVESSKMAASRVRSYMD--KE--D-AKVLLVTSVMENEGKSTVAANLALSLAQE-GSR
A0A395X821      FAYVESSKMAASRVRSYMD--KE--D-AKVLLVTSVMENEGKSTVAANLALSLAQG-GSR
A0A1C5PY68      FAYVESSKMAASRVRSYMD--KE--D-AKVLLVTSVMENEGKSTVAANLALSLAQG-GSR
A0A174CJF8      FAYVESSKMAASRVRSYMD--KE--D-AKVLLVTSVMENEGKSTVAANLALSLAQG-GSR
A0A564SRR2      FAYVESSKMAASRVRSYMD--KE--D-AKVLLVTSVMENEGKSTVAANLALSLAQE-GSR
A0A174R7V0      FAYVESSKMAASRVRSYMD--KE--D-AKVLLVTSVMENEGKSTVAANLALSLAQG-GSR
A0A373MWV2      FPYVESLKRIASRVRGRLD--RR--G-GKVLLVTSVAENEGKSTLAANLALALSEE-QNR
A0A417CE88      FPYVESLKRIASRVRGRLD--RR--G-GKVLLVTSVAENEGKSTLAANLALALSEE-QNR
A0A416Y441      FPYVESLKRIASRVRGRLD--RR--G-GKVLLVTSVAENEGKSTLAANLALAISEE-QNR
A0A357GPJ7      FPYVESLKRIASRVRGRLD--RR--G-GKVLLVTSVAENEGKSTLAANLALALSEE-QNR
A0A396PAC1      FPYVESLKRIASRVRGRLD--RR--G-GKVLLVTSVAENEGKSTLAANLALALSEE-QNR
A0A416EYU4      FPYVESLKRIASRVRGRLD--RR--G-GKVLLVTSVAENEGKSTLAANLALALSEE-QNR
A0A416SCQ2      FPYVESLKRIASRVRGRLD--RR--G-GKVLLVTSVAENEGKSTLAANLALALSEE-QNR
A0A416TGN7      FPYVESLKRIASRVRGRLD--RR--G-GKVLLVTSVAENEGKSTLAANLALALSEE-QNR
A0A417SMF6      FPYVESLKRIASRVRGRLD--RR--G-GKVLLVTSVAENEGKSTLAANLALALSEE-QNR
A0A1Y4MW77      PLFLENIESLHIRLAKELA--DI--N-GKTLIFTSTVAKEGKSTIATNVAYALAKN-NKK
R6UHV6          FEFREAFKRLRQKIVSDSK--TH--H-NKVYAVTSSLENEGKTTVAVNLALSLAKM-DYK
A0A3R9Q621      FIITEAYRALRSNLRYTLR--KD--G-CKIIMINSPMPEDGKSTTCANLGITMAQT-GAR
A0A069RC75      SPGAEAFRSIRTNMQFANI--DQ--N-IKTILFTSSIPGEGKTLVSANMATALCGI-GKK
A0A174F2W5      FPYVESLKRIASRVRGRLD--RR--G-GKVLLVTSVAENEGKSTLAANLALALSEE-QNR
A0A174S8E9      FPYVESLKRIASRVRGRLD--RR--G-GKVLLVTSVAENEGKSTLAANLALALSEE-QNR
A0A416ZL97      FLYVESLKRIASRVRGRLN--RK--G-GKVLLVTSVAENEGKSTLAANLALALAEE-QNR
A0A174LSK1      FLYVESLKRIASRVRGRLD--RK--G-GKVLLVTSVAENEGKSTLAANLALALAEE-QNR
A0A373GY92      FLYVESLKRIASRVRGRLD--RK--G-GKVLLVTSVAENEGKSTLAANLALALAEE-QNR
A0A373NZQ6      FLYVESLKRIASRVRGRLD--RK--G-GKVLLVTSVAENEGKSTLAANLALALAEE-QNR
A0A417I9B9      FLYVESLKRIASRVRGRLD--RK--G-GKVLLVTSVAENEGKSTLAANLALALAEE-QNR
A0A417MP97      FLYVESLKRIASRVRGRLD--RK--G-GKVLLVTSVAENEGKSTLAANLALALAEE-QNR
A0A417WQF8      FLYVESLKRIASRVRGRLD--RK--G-GKVLLVTSVAENEGKSTLAANLALALAEE-QNR
A0A373RZ83      FLYVESLKRIASRVRGRLD--RK--G-GKVLLVTSVAENEGKSTLAANLALALAEE-QNR
A0A416U6I1      FLYVESLKRIASRVRGRLD--RK--G-GKVLLVTSVAENEGKSTLAANLALALAEE-QNR
R7JQZ9          FLYVESLKRIASRVRGRLD--RK--G-GKVLLVTSVAENEGKSTLAANLALALAEE-QNR
A0A3B8KKL6      AAATEAFRELRTNLHYINI--DK--E-VKTMVVTSPSMGDGKSVTAANLAVILAKS-GKR
A0A2K9E6R0      AAATEAFRELRTNLHYINI--DK--E-VKTMVVTSPSMGDGKSVTAANLAVILAKS-GKR
A0A2S8RBI0      AAATEAFRELRTNLHYINI--DK--E-VKTMVVTSPSMGDGKSVTAANLAVTLAKS-GKR
A0A0L6JLG6      AAASEAYRELRTNLQYKSV--DK--D-MKVILLTSPSLGDGKTVTTVNLAITLAQS-GKK
G8LSN0          APASEAFREIRTNLHYKSV--DK--E-LKTIVITSPALGDGKTVTSVNMAVTLAKS-GKK
A0A1M5UYN6      SIAAEGFRTLRTNIQYSSI--DK--K-IRTIVVTSAGQGEGKTQVSGNLALTMANL-EKK
A0A176JBT8      SSSSEAYRSVRANLDILRQ--SK--Q-PVTILVTSTSAGDGKSLTCGNLAVTLAKD-NKK
A0A1I5HIC6      FSVNEAYKTLRTNIQFCGK--D-----IKTICITSSLPDEGKTVVAFRLATALSES-GKK
A0A1Y3TC51      MGFAEAGRRTAARVEYHMR--RH--R-QKMLLVSSIAENEGKSTVAANLALALAEK-HKK
A0A1Y3T1N0      MDFAEASRRAEAKVEYHMR--RN--D-QKILLVTSISENEGKSTVAANIALALAEK-HQK
A0A1Y3Y8U8      MDFAEASRRAEAKVEYHMR--RN--D-QKILLVTSISENEGKSTVAANIALALAEK-HQK
A0A5B0BQY5      KAEKEDFNKLAATIHYFIK--QK--K-VKTIMMTSSGAGEGKTFIGSNLAVKLAMD-GQK
A6CLL4          SPAMELYREIRTNIQFLLK--KE--K-TKVLLVTSSGASEGKSLTTGNLAISMAMD-GVK
A0A174DL89      SLPSEAINILRTNLQFCNV--NY--N-LKKILITSSSPSEGKSTIISNLGISMALT-NKK
A0A176U8D6      FNASEAIYQLRTGILYSSK--D-----VKTIAVTSAFENQGKSFISFHLAYSLSQV-GKR
A0A1Q6KSQ5      FSAAEAIYQLRTAILYSSK--D-----VKMIAVTSAFENQGKSFISFHLAYSLSQV-GKR
A0A3D3U8B3      FSAAEAIYQLRTAILYSSK--D-----VKMIAVTSAFENQGKSFISFHLAYSLSQV-GKR
A0A3E5FRL7      MNFVEANGRMSSRIEYHLN--RY--N-YQVLLVTGISENEGKSTVAANICLSFVEK-NKK
A0A1Y4QK93      MNFVEANGRMSSRIEHHFD--KH--N-FKVLLVTGIGENDGKSTVAANICLLFVEK-NKK
B1C232          MNFVEANGRMSSRIEHNFD--KH--N-FKVLLVTGTGENEGKSTVAANICLSFVEK-NKK
A0A401USI6      SPVTEAFKSMRTNLLFSME--NR--G-IKTLMVCSPGPKDGKTSVSTNIASTIAQT-GKS
A0A1V4IQ10      SIVAEAYRTLITNILYSES--EK--N-IKTILITSSKLQEGKSTVAGNLALSFAEN-DNK
A0A1S8TRD2      SIVAEAYRTLITNILYSES--EK--T-IKTILVTSSKLQEGKSTVAGNLALSFAEN-DKK
G7M1U2          SIVAEAYRTLITNILYSES--EK--T-IKTILVTSSKLQEGKSTVAGNLALSFAEN-DKK
A0A2T6KJ75      DVFTEMFRSIRANLLYVLS--KN--N-AKTLLVTSAESGDGKSFVSANLSIVFAMD-QKK
A9KN92          FTINEAYKSLRTNIQFCGK--D-----IKTICITSSLPNEGKTVVSFRLATAFADS-GKK
A0A352MUJ1      SQIAEGFKSLRTNLQFMKG--SD--GDLKSVLITSSLPGEGKSWVATNLAITFARG-GYR
R5YI67          SQCAEGFKSLRTNLQFMNG--SE--G-LKSVLITSALPGAGKSWVATNLAITFARG-GYR
A0A1Y0IQP5      SAEAEAFRTLRTNIQYDEA--GQ--H-VKVLMVTSTAAGEGKTTVIANLAVTMAQA-GKK
A0A4R2R7B1      SAVAEAFRTLRTNIQYDEA--GK--H-VKVLIVTSTLAGEGKSMVLANLAVTMAQA-GKR
A0A1M6E8I2      SPISEAYRSLRTNINFANL--DN--N-MKTILITSATPGEGKTQTVMNLAVAMAQN-DKK
A0A1Y4N105      MPYSEANRKLGALIERHMR--RR--N-QQVLLVTSVAENEGKSSTAGNIALSMVDR-GKK
A0A1Y4QP75      MPYSEANRKLGALIERHMR--RR--N-QQVLLVTSVAENEGKSSIAGNIALSMVDR-GKK
A0A3D4QRB5      APVTEAYKTLRTNIQFSNV--DN--N-LKVLMVTSTSKDEGKSSTAANLAVSIAQS-NKK
A0A349DEH5      FSFIETYKSIRTKIENNSA--RT--G-NKVFLITSACENEGKTTSCVNIALSLAQN-GKK
A0A3D4T7B4      FSFIETYKSIRTKIENNSA--RT--G-NKVFLITSACENEGKTTSCVNIALSLAQN-GKK
A0A350XYC7      FSFIETYKAIRTKIENNST--RT--G-NKVFLVTSACENEGKTTVCVNVALSLAQN-GKN
R6DNR8          FSFIETYKAIRTKIENNST--KT--G-NKVYLVTSACENEGKTTSCVNIALSLAQN-GKN
A0A355KUM5      FSFIETYKAIRTKIENNST--RT--G-NKVFLVTSACENEGKTTSCVNIALSIAQN-GKN
R5YGY6          FSFIETYKSIRTKIENNST--RT--G-NKVFLVTSACENEGKTTSCVNIALSIAQN-GKN
A0A0K8J554      FIITEAYKALRINLLYTIR--KQ--G-CKKILINSPNPEEGKSTTCLNIGIALANA-GAK
A0A3N1XSX6      FIITESYKSLRTNLRFTLL--KD--Q-CKKIIVSSPVPEEGKSTTSINLGITISQT-GSK
A0A1C6G0U3      GPILEAYRSIRTNIEFFNI--DK--T-IKVIMVTSSQPGEGKSTFISNISKVFATLDDKK
A0A3D4LLB3      SPTAEAYRKITTNIEFSNV--DN--V-IKTIMITSAKQDEGKTTTICNLAMVMTEL-KKN
A0A0A5GPA9      SPITEAYRSIRTNLQYTLN--QK--S-AKTVLFTSTHSSEGKSITAANIAYSMAMD-HVN
A0A271M6M4      SAVTEAYRAVRTNVQYTIS--QE--D-AQTILITSSHPGEGKSLTAANLAICLAMD-HME
A0A2V3W8U6      TPVLEAYRSIRTNLQFQLM--DK--S-LKTILVTSTSKNEGKTITCSNLAMMMAID-NKK
W1UFG0          NLVQEEFIKIRTNIQYANI--DN--E-MKVILFTSTHKDEGKSILSLNTAYKFSELEETK
A0A351SRI8      SGISEAIRTLRTNLQFSSI--DR--K-IKTILVTSSVPGEGKSFVASNLAVALANS-GQR
A0A1V5LU59      APASEAFREIRTNLHYTSV--DK--E-LKTIVVTSPTLGDGKTVTAVNMAVTIAKS-GKK
A0A1E3BVC3      ATSAEAFRELRTNLYYSSV--DR--E-IKTIVVTSPTLGDGKTVTAVNLAVTLARS-GKK
A0A4Q0I6S0      ATSAEAFRELRTNLYYSSV--DR--E-IKTIVVTSPTLGDGKTVTAVNLAVTLARS-GKK
A3DF66          SATAEAFRELRTNLYYSSV--DS--E-VKTIVVTSPTLGDGKTVTAVNLAITLARS-GKK
W4V1T8          SASAEAFRELRTNLHYSSV--DR--E-VKTIVVTSPTLGDGKTVTAVNLATTLARS-GKK
A0A1I0RG99      FVIAEAYKSLRSNLNFTLR--FN--G-CKKIIISSPVPQDGKSTTITNVGISIAQT-GAK
A0A1I5G322      FIITEAYNSLRTNLKFTLR--HQ--G-CKKIVISSSLPEDGKSTITTNLGIVIGQT-GSK
A0A1C6ITD7      SLPSEAINILRTNLQFCNV--NS--N-LKKILITSSSPSEGKSTIISNLGISIALT-NKK
A0A381IX63      SSVSEAYRNTRTNIQFSNL--DE--N-LNVIAITSSKPSEGKSTMISNIGAAFGNLENKK
A0A1G9IUT4      SILDENYKNIRTNIEFSNV--DK--N-IKSIVITSSQKNEGKTTIVSSLGSSFAQL-DKK
A0A1M6RWV2      SPISEAYRILRTNIQFSNL--DN--K-LKTILVTSSGPAEGKSTTISNLAVTMVNM-GHK
A0A143XPI5      PSFMEGIRTLRIRVDAALQ--EV--S-AKTILVNSAIQGEGKTTIAVNLALVRALR-GEK
A0A355G1X5      FSFIESYKAIRTRVETLCT--RK--D-YKTILVTSAGANEGKTTFSLNLALSLSQN-GKS
A0A0M6WXE3      FRFVESFKMLAARVEYHMS--KI--N-GKVLVVTSVCENEGKSSVAGNLAITLAKK-GKR
A0A348SAK2      FRFVESFKMLAARVEYHMS--KI--N-GKVLVVTSVCENEGKSSVAGNLAITLAKK-GKR
A0A1G9H5B9      LEVSENYAKLRMNLFYTLV--DK--E-QKIVVITSSVSGEGKSTISANLAISCAMS-GNK
R5EFZ0          FRFVESIRKLRRRVEQHMD------G-GKVLIVTSLLENEGKSTVTVNLALAMEQK-GKR
A0A1Y4H8L0      FGFVESYRKFVSKLEYQME--KH--H-SKVLVVSSVSENEGKSTVAANIAISLVQR-GKK
A0A0M6WYQ8      QGYLEAFRKVGIKVMKQME--EE--E-FKTLLVTSSVPEEGKTAFSVNLAIIEAKL-GKN
A0A348SAK1      QGYLEAFRKVGIKVMKQME--EE--E-FKTLLVTSSVPEEGKTAFSVNLAIIEAKL-GKN
A0A252F281      FAFEESIRQIRTRLEYAAK--QD--G-AKVFLISSFGENEGKSTISANSALSLAEK-GYH
A0A1Y4QKE6      FAFKENMRSLQMRLERVFK--KE--E-HKVIVVTSTAANEGKTTLTINLAETFATN-GKR
B1C231          FAFKENMRSLQIRLERVFK--KE--E-HKVIVVTSTAANEGKTTLTINLAETFAAN-GKR
A0A1Y3TUL5      AEVRESFVSAAHILHNRLG--VG--E-HQCIYITSAEQDEGKTHVAANLAVQLSDL-EHK
A0A1Y4JAX2      AEVRESFVSAAHILHNRLG--VG--E-HQCIYITSAEQDEGKTHVAANLAVQLSDL-EHK
A0A1Y4T590      AEVRESFVSAAHILHNRLG--VG--E-HQCIYITSAEQDEGKTHVAANLAVQLSDL-EHK
R5B467          SAYCEAMRIVAMRVDKAMQ--HH--A-YRTLLVSSAAPGEGKTTFVCQLALALVRQ-GRH
A0A1Y3T163      FGYRESLRALEIRLENMMA--KE--G-GKVLLISSTASGEGKSTLAVNLSELLASR-GKR
A0A1Y3YCA2      FGYRESLRALEIRLENMMA--KE--G-GKVLLISSTASGEGKSTLAVNLSELLASR-GKR
A0A1Y4L6N9      AGFRENIKGLQMRVKREME--RI--D-GKVLLVTSTVAEEGKTTVAVNLAFSLAEY-GYK
A0A173T644      QRFKESLLSIELKAERELQ--DK--N-GKILLVTSTISGEGKSTVALNMAYAAALH-EKK
A0A1C5TSB8      QRFKESLLSIELKAERELQ--DK--N-GKILLVTSTISGEGKSTVALNMAYAAALH-EKK
C0CIK6          QRFKESLLSIELKAERELQ--DK--N-GKILLVTSTISGEGKSTVALNMAYAAALH-EKK
A0A1Y3WEF6      QAFRENIQSLQIRISRELE--EK--G-GKVLVLTSTLPGEGKSTLAYNLAIAAASH-GVK
A0A417T0L2      QAFRENIQSLQIRISRELE--EK--G-GKVLVLTSTMPGEGKSTLAYNLAIAAASH-GVK
A0A1H9EPU3      IRISKNISEAYKKLRSNIQFSGR--H-VRVIGITSTVPNEGKSVLSLNLAISLAEL-GKR
A0A354IGV3      FPFTETISKMCTRLEYAAT--RH--G-RKVILITSVGENEGKSTIAANLALGLAQR-HSK
A0A417JMV2      FQYVEDMKKLARKVSSKMK--EK--N-AKTLLVASVEENEGKSTVAANLALALAEE-SEK
B0P408          FQYVEDMKKLARKVSSKMK--EK--N-AKTLLVASVEENEGKSTVAANLALALAEE-SEK
D4MV82          FQYVEDMKKLARKVSSKMK--EK--N-AKTLLVASVEENEGKSTVAANLALALAEE-SEK
A0A415VWX5      FQYVEDMKKLARKVSSKMK--EK--N-AKTLLVASVEENEGKSTVAANLALALAEE-SEK
A0A173UY96      FQYVEDMKKLARKVSSKMK--EK--N-AKTLLVASVEENEGKSTVAANLALALAEE-SEK
A0A173QTL1      FQYVEDMKKLARKVSSKMK--EK--N-AKTLLVASVEENEGKSTVAANLALALAEE-SEK
A0A174A3T7      FQYVEDMKKLARKVSSKMK--EK--N-AKTLLVASVEENEGKSTVAANLALALAEE-SEK
A0A174J359      FQYVEDMKKLARKVSSKMK--EK--N-AKTLLVASVEENEGKSTVAANLALALAEE-SEK
A0A417UUA3      FQYVEDMKKLARKVSSKMK--EK--N-AKTLLVASVEENEGKSTVAANLALALAEE-SEK
A0A1C6EUV9      FQYVEDMKKLARKVSSKMK--DK--Q-AKTLLVASVEENEGKSTVAANLALALAEE-SEK
A0A173Y645      FQYVEDMKKLARKVSSKMK--DK--Q-AKTLLVASVEENEGKSTVAANLALALAEE-SEK
A0A374AVY6      FQYVEDMKKLARKVSSKMK--DK--Q-AKTLLVASVEENEGKSTVAANLALALAEE-SEK
R7BXS4          FQYVEDMKKLARKVSSKMK--DK--Q-AKTLLVASVEENEGKSTVAANLALALAEE-SEK
A0A143ZUX1      FSYVEAYKSLRVRVESLAA--ER--G-YKKFIVTSTLADEGKSTVAANLAIALAQK-GKK
S3FFL2          SDMVDAYLAVQTNLGFTTA--HG--V-PRTFAVTSTRPGEGKSTTALALATMLSRA-QRR
A0A328M4V1      DLAVEALRSLRTSLHFARL--EA--K-NNLLLISSSSPGVGKSFVASNLAAVIAQA-GQR
A0A5C8HCX2      DSAVEAVRALRTSLHFAMM--ET--E-NNILMITGATPDSGKTFVSSTLAAVIAQS-DQK
A0A1W1Z4C3      MDMVESYAKLRMNLLYTMS--EK--M-RRTVLVTSAISGEGKSTIAANLAVSLALS-GKK
A0A239QN83      MDLVEGYAKLRMNLLYTLS--EK--M-HRTVLVTSAISGEGKSTIAANLAVSLAMS-GKK
A0A3R9WAA7      LGYMDDMYKIRTRLNKIIT--NR--D-IKTLLITSAIPAEGKSTFAFNLATAMAEL-DRK
A0A1G6BLF1      PGFVEAMRSVRRRIENHSL--DT--K-KNIYLVTSALPEEGKSTVAANIALSLALK-GEK
R6HZX3          DTLSVPIGALQVRLLRSQP--AGG-T-GRIILITSTMPGEGKTTVSFNLAASLAQS-GKR
A0A1W2CEA6      YAGEEAINAVCSSMSFTGK------N-LKRVLVSSCGANEGKTFATIQIAIGMTRR-GAR
R7FFK6          FSILETYKALRSSLNFLVS--TS--E-NKIVAVTSASPNEGKSVTVANLATAISET-DKT
A0A373MPB9      FNIVENYKTMRTNLMFTLS--TT--R-NKIVVVSSPNPSEGKSVTVANLAASMAET-ENK
A0A373L519      FNIVENYKTMRTNLMFTLS--TT--R-NKIVVVSSPNPSEGKSVTVANLAASMAET-ENR
A0A373W906      FNIVENYKTMRTNLMFTLS--TT--R-NKIVVVSSPNPSEGKSVTVANLAASMAET-ENK
A0A373VCW2      FNIVENYKTMRTNLMFTLS--TT--R-NKIVVVSSPNPSEGKSVTVANLAASMAET-ENK
W0U604          FNIVENYKTMRTNLMFTLS--TT--R-NKIVVVSSPNPSEGKSVTVANLAASMAET-ENK
A0A374B6G0      FNIVENYKTMRTNLMFTLS--TT--R-NKIVVVSSPNPSEGKSVTVANLAASMAET-ENK
A0A373VM36      FNIVENYKTMRTNLMFTLS--TT--R-NKIVVVSSPNPSEGKSVTVANLAASMAET-ENK
A0A1C5P379      FNIVENYKTMRTNLMFTLS--TT--R-NKIVVVSSPNPSEGKSVTVANLAASMAET-ENK
A0A373XXX0      FNIVENYKTMRTNLMFTLS--TT--R-NKIVVVSSPNPSEGKSVTVANLAASMAET-ENK
A0A5R9MJM9      FNIVENYKTMRTNLMFTLS--TT--R-NKIVVVSSPNPSEGKSVTVANLAASMAET-ENK
A0A356CW82      FNIVENYKTMRTNLMFTLS--TT--R-NKIVVVSSPNPSEGKSVTVANLAASMAET-ENK
R6T4X7          FNIVENYKTMRTNLMFTLS--TT--R-NKIVVVSSPNPSEGKSVTVANLAASMAET-ENK
A0A374HTV1      FNVVENYKTMRTNLMFTLS--TT--R-NKIVVVSSPNPSEGKSVTVANLAASMAET-ENK
A0A374GB66      FNIVENYKTMRTNLMFTLS--TT--R-NKIVVVSSPNPSEGKSVTVANLAASMAET-ENK
A0A374ECC6      FNIVENYKTMRTNLMFTLS--TT--R-NKIVVVSSPNPSEGKSVTVANLAASMAET-ENK
A0A374BM61      FNIVENYKTMRTNLMFTLS--TT--R-NKIVVVSSPNPSEGKSVTVANLAASMAET-ENK
A0A373UGZ4      FNIVENYKTMRTNLMFTLS--TT--R-NKIVVVSSPNPSEGKSVTVANLAASMAET-ENK
A0A373SA66      FNIVENYKTMRTNLMFTLS--TT--R-NKIVVVSSPNPSEGKSVTVANLAASMAET-ENK
A0A1C5X6X7      FNIVENYKTMRTNLMFTLS--TT--R-NKIVVVSSPNPSEGKSVTVANLAASMAET-ENK
A0A1C6JIH3      FNIVENYKTMRTNLMFTLS--TT--R-NKIVVVSSPNPSEGKSVTVANLAASMAET-ENK
A0A373PSC3      FNIVENYKTMRTNLMFTLS--TT--R-NKIVVVSSPNPSEGKSVTVANLAASMAET-ENK
A0A1K1WYK8      FNIVESYKTIRANILFTAA--DS--D-KKVIAVSSPNPGEGKSTSAANLAIALAQT-GSA
A0A1H6IUB1      FNVVESYKSIRTNISFALS--TV--D-KKIFAVSSANPREGKSTTSSNIAIALAQG-GNK
A0A1M7L1F9      FTVVESYKSIRTNVSFALS--TV--D-KKIFAVSSSNPREGKSTTSANIAIALAQG-GNK
A0A1C6B4L6      FYIVERYKSIRTNVNFSLA--TS--D-KKIFAVSSANPSEGKSIISANIAIALAQG-GNK
A0A1Q6T9P4      FYIVERYKSIRTNVNFSLA--TS--D-KKIFAVSSANPSEGKSIISANIAIALAQG-GNK
A0A315Y4F9      FYIIESYKSIRTNLSFALS--TV--E-KKTFVVSSANPGEGKSTTSANIAIAIAQS-GSH
A0A354K620      FHIIESYKSIRTNLSFALS--TF--D-KKVFAVSSANPGEGKSTTSANIAVAIAQS-GSH
A0A355G3J9      FSVKEAYHKARSNILYLPS--DEENG-CKTLVITSALVSEGKSTFSVNLAITLAKS-GNK
A0A3D2AD87      FVIVESYKNIRTGVAYLLS--RE--E-KSSFTITSANAGEGKSTTAANLAVAFSQL-GKT
A0A2T5IYJ6      NGYAEAMRTVRTSVVLSGI--DK--P-HKVVMLTSSVPSEGKSTSAINLAVALAQM--ER
A0A3C0QME1      FNIVENYKSIRSNIMFAFS--TM--P-RKILAVSSANPGEGKSTTASNIAIAFAQM-ESK
A0A355FYK5      FAFIECVKAIRTKLENLSA--NK--G-FKTFMVTSTYENEGKTTVAINIATSLAQK-GKS
A0A357AQU0      FSVVESFKSIRTNIMFAVA--TQ--G-KKVIAVTSANPSEGKSSTTTNIAIAMAMA-NEK
A0A3C1YJQ7      FSVVESFKSIRTNIMFAVA--TQ--G-KKVIAVTSANPSEGKSSTTTNIAIAMAMA-NEK
A0A3D0JG38      FSVVESFKSIRTNIMFAVA--TQ--G-KKVIAVTSANPSEGKSSTTTNIAIAMAMA-NEK
A0A3C0IHX1      FPCSEAYRSIRTNLMFALA--PQ--E-HKIVAVTSPNAADGKSLTAANIAMAMAMM-NKK
R5V506          FPCSEAYRSIRTNLMFALA--PQ--E-HKIVAVTSPNAADGKSLTAANIAMAMAMM-NKK
A0A352TIU5      FPCSEAYRSIRTNLMFALA--PQ--E-HKIVAVTSPNAADGKSLTAANIAMAMAMM-NKK
A0A3E5FSY5      FAFKENMRSLQIRLERVFK--KE--E-HKVIVVTSTAANEGKTTLTINLAETFAAN-GKR
A0A1V5S3C0      LPFIETFKLIRTKIENASF--KK--G-YKVFAVTSSAENEGKTTVAVNTALSLAKS-GKS
A0A1Y3TC98      FGYRESIRSLQKRVVKNLE--HM--D-GKILMVTSSTAGEGKTTVAVNLAQMLAAD-GSR
A0A1Q6REE0      SGFSESVRLLRLRVEKAMQ--EN--G-QKILLVSSAIPGEGKTTVSVNLAVSLAQK-GRR
R5ETF9          SGFSESVRLLRLRVEKAMQ--EN--G-QKILLVSSAIPGEGKTTVSVNLAVSLAQK-GRR
R6VAT5          PRFKESVFSIRNKIIKLCA--DQ--K-INSVMVASTTTNEGKTTVAANLAIALAKK-HYR
A0A1Q6S448      FAFTESIHRIAEKFQHEHA--K---G-RRVFLFSSVSAAEGKSTLAANTAISLASR-GVS
A0A351MYR0      FAFTESIHRIAEKFQHEHA--R---G-RRVFLFSSVSAAEGKSTLAANTAISLASR-GVS
R6HPC1          FAFTESIHRIAEKFQHEHA--K---G-RRVFLFSSVSAAEGKSTLAANTAISLASR-GVS
A0A3D4G5Z5      FAFTESIHRIAEKFQHEHA--K---G-RRVFLFSSVSAAEGKSTLAANTAISLASR-GVS
A0A3D5ES03      FAFTESIHRIAEKFQHEHA--K---G-RRVFLFSSVSAAEGKSTLAANTAISLASR-GVS
A0A0F2P7X6      FGFVESYKAAGTNLRFASA--VT--S-AKKLLVTSILTGEGKSTVAVNLAITIART-GKS
A0A359B487      FGFVESYKAAGTNLRFASA--VT--N-AKKLLVTSILTGEGKSTVAVNLAITIAHT-GKS
A0A348P5V4      FGFIESYKLIRTKIEHAAS--RQ--D-YKAIIVTSTMENEGKTTSATNIALSLAQN-GKS
A0A356PT74      FPFIETFKIIRTKIEHTAQ--RE--K-YKTFVVTSTAENEGKTTSAVNIALALAQN-GKS
A0A3D5LL19      FPFIETFKIIRTKIEHTAQ--RE--K-YKTFVVTSTAENEGKTTSAVNIALALAQN-GKS
R5MNF0          FPFIETFKIIRTKIEHTAQ--RE--K-YKTFVVTSTAENEGKTTSAVNIALALAQN-GKS
A0A1Q9JSI0      FRYVENMKKLARRVSSQMQ--DH--N-AKTLMVTSAVENEGKSTVAANLALAMAEE-SAK
A0A3D5TNI1      FAFIETYKAMRTKLELLNG--RR--G-YKSFVISSAGANEGKTTVAVNLSLALAQN-GYS
A0A358LJD0      FAFVETYKAMRTKLELLNG--RR--G-YKSFVVSSAGANEGKTTVAVNLSLALAQN-GYS
R6I3L7          FAFVETYKAMRTKLELLNG--RR--G-YKSFVVSSTGANEGKTTVAVNLSLALAQN-GYS
A0A3D1HXX0      FAFVETYKAMRTKLELLNG--RR--G-YKSFVVSSAGANEGKTTVAVNLSLALAQN-GYS
A0A3D2QJB8      FAFVETYKAMRTKLELLNG--RR--G-YKSFVVSSAGANEGKTTVAVNLSLALAQN-GYS
D4LC36          FSTVEAYKSFRTALSFVIS--TC--D-SRIVAMTSANPSEGKSVTVANLAVAVAQT-DKK
R7MQJ4          FTIKESYKSMRTNVMFSLS--VS--E-KKVIVVSSANPGEGKSTTAANLAITFSQM-EHK
A0A1V5GLC0      FYITESYKSLRTNITFALA--TS--D-KKIFAISSANPSEGKSTVSANTAIALAQG-GNK
W7V182          FAVVESYKSIRTNITFALS--TS--E-KKIFTVSSANPSEGKSTTSANIAIALAQG-GNK
                                                . .     **:                 

A0A0H5SF45      VLLIDCDLRKG---RLHVPFN--LNSTP-GVTNLLSGM-----N-----TEKET--IQYT
A0A1M6JRJ5      VLLIDCDLRKG---RLHHYFK--AKSQP-GLSDLLSHI-----N-----SLKEC--LYIT
A0A1M7Y1S2      VLLIDCDLRKG---RIHHHFK--GKSQP-GLSDFLSNI-----N-----SLKEC--LYIT
A0A3D5R4X5      VLLVDTDFRKP---SIHKIAR--KPNAD-GLADVLINK-----S-----DYRSS--VKQS
A0A1I4C3N6      ILFIDADLRES---RTAEVLG--MSGT--GLSEYLGSD-----E-----AELNI--QR--
A0A3B9CIM7      ILLIDADMRKS---NLKSLLD--IEGKE-GLSEYLAGI-----T-----KELKV--YK--
A0A1G9WHW8      VLLIDGDLRKS---GISRVLK--TTSRQ-GLSQYLAGI-----N-----KDYEL--FN--
A0A1H5VAA0      VLLIDGDLRKS---GISRVLK--TTSRQ-GLSQYLAGI-----N-----KDYDL--FN--
A0A3R6VK11      VLLIDGDMRNM---SVASLLK--LRGRL-GLSQYLAGL-----R-----ETPQI--VE--
A0A3R6QUY7      VLLIDGDMRNM---SVASLLK--LRGRL-GLSQYLAGL-----R-----ETPQI--VE--
A0A373K3P9      VLLIDGDMRNM---SVASLLK--LRGRL-GLSQYLAGL-----R-----ETPQI--VE--
A0A3R6JRU5      VLLIDGDMRNM---SVASLLK--LRGRL-GLSQYLAGL-----R-----ETPQI--VE--
A0A1C5MS04      VLLIDGDMRNM---AVASLLK--LRGRL-GLSQYLAGL-----R-----ETPQI--VE--
A0A3C1J150      VLLIDGDMRNM---SVASLLK--LRGRL-GLSQYLAGL-----R-----ETPQI--VE--
A0A416CXD7      VLLIDGDMRNM---SVASLLK--LRGRL-GLSQYLAGL-----R-----ETPQI--VE--
R6XBL9          VLLIDGDMRNM---SVASLLK--LRGRL-GLSQYLAGL-----R-----ETPQI--VE--
A0A355W5Z7      VLLIDGDMRNM---SVASLLK--LRGRL-GLSQYLAGL-----R-----ETPQI--VE--
A0A143WVN6      VLLVDGDLRKP---ALHRIFDLHDQVKY-SLSEYLLGQ-----C-----SFEQV---ITE
W6RXP9          VILIDCDMRKP---TVHKKFH--ISNDK-GLSDVLIGK-----V-----DIMEA---AHK
W6S4G8          VVLIDCDIRRA---ALHKAFN--ISNSK-GLTDVLVNQ-----A-----SLKDV---AVG
A0A1G6BLB6      VLLIDGDFRKP---ALYKVLQIDPKEVT-DLGEVLNHK-----I-----SPKNM--IYQK
B5CSZ7          VVLVDCDMRHP---SLAKIFDATVDPKE-QFSEYLLGK-----C-----ELDQVLKQTEV
A0A1C6G8M0      VLLVDTDMRKS---VLQRRMG--LEGVKLGLSEYLSGN-----A-----EVGQV--IYDV
A0A416MP73      VLLVDTDMRKS---VLQRRMG--LDGVKLGLSEYLSGN-----A-----ELGQV--IYDV
A0A3E4LL92      VVLVDCDMRHP---SLAKIFDAAVDPKE-QLSEYLLGK-----C-----ELDKVLKRTEV
A0A415D1L1      VVLVDCDMRHP---SLAKIFDATVDPKE-QFSEYLLGK-----C-----ELDQVLKQTEV
A0A414P2K5      VVLVDCDMRHP---SLAKIFDATVDPKE-QFSEYLLGK-----C-----ELDQVLKQTEV
V8C417          VVLVDCDMRHP---SLAKIFDATVDPKE-QFSEYLLGK-----C-----ELDQVLKQTEV
A0A143XN92      VLLIDLDLRKP---AQHDIFGRKGEQFV-GIAEWLENK-----I-----DLKEK--IVRI
A0A173ZYY6      VLLVDGDIRRP---SQFLIFGMEPKEEN-ELGEYLRGN-----G-----SLADV--MVPC
A0A4Q5EHM9      VLLVDGDIRRP---SQFLIFGMEPKEEN-ELGEYLKGN-----R-----ALADV--MVPC
A0A173SMI2      VLLVDGDIRRP---SQFLIFGMEPKEEN-ELGEYLRGN-----G-----SLADV--MVPC
A0A174ASH7      VLLVDGDIRRP---SQFLIFGMEPKEEN-ELGEYLRGN-----G-----SLADV--MVPC
A6BH65          VLLVDGDIRRP---SQFLIFGMEPKEEN-ELGEYLRGN-----G-----SLADV--MVPC
R7G0D7          VLLVDGDIRRP---SQFLIFGMEPKEEN-ELGEYLKGN-----R-----ALADV--MVPC
A0A396G6S7      VMLIDCDFRKP---AQYKIFNVRDNEEK-DLGDVLINH-----A-----STEKI--IRNW
A0A3E5A223      VMLIDCDFRKP---AQYKIFNVRDNEET-DLGDVLINH-----A-----STEKI--IRNW
R7D5E6          VMLIDCDFRKP---AQYKIFNVRDNEEK-DLGDVLINH-----A-----STEKI--IRNW
A0A415HQH5      VMLIDCDFRKP---AQYKIFNVRDNEEK-DLGDVLINH-----A-----STEKI--IRNW
A0A414W2C6      VMLIDCDFRKP---AQYKIFNVRDNEET-DLGDVLINH-----A-----STEKI--IRNW
A5ZNE7          VMLIDCDFRKP---AQYKIFNVRDNEET-DLGDVLINH-----A-----STEKI--IRNW
A0A395X821      VMLIDCDFRKP---AQYKIFNVRDNEEK-DLGDVLINH-----A-----STEKI--IRNW
A0A1C5PY68      VMLIDCDFRKP---AQYKIFNVRDNEET-DLGDVLINH-----A-----STEKI--IRNW
A0A174CJF8      VMLIDCDFRKP---AQYKIFNVRDNEET-DLGDVLINH-----A-----STEKI--IRNW
A0A564SRR2      VMLIDCDFRKP---AQYKIFNVRDNEET-DLGDVLINH-----A-----STEKI--IRNW
A0A174R7V0      VMLIDCDFRKP---AQYKIFNVRDNEEK-DLGDVLINH-----A-----STEKI--IRNW
A0A373MWV2      VLLLDCDFRQP---ALYKIFELPQKAGK-DFGQVAAGK-----E-----PASSV--FEKY
A0A417CE88      VLLLDCDFRQP---ALYKIFELPQKAGK-DFGQVAVGK-----E-----SASSV--FEKY
A0A416Y441      VLLLDCDFRQP---ALYKIFELPQKAGK-DFGQVAVGK-----E-----SASSV--FEKY
A0A357GPJ7      VLLLDCDFRQP---ALYKIFELPQKAGK-DFGQVAVGK-----E-----SASSV--FEKY
A0A396PAC1      VLLLDCDFRQP---ALYKIFELPQKAGK-DFGQVAVGK-----E-----SASSV--FEKY
A0A416EYU4      VLLLDCDFRQP---ALYKIFELPQKAGK-DFGQVAVGK-----E-----SASSV--FEKY
A0A416SCQ2      VLLLDCDFRQP---ALYKIFELPQKAGK-DFGQVAVGK-----E-----SASSV--FEKY
A0A416TGN7      VLLLDCDFRQP---ALYKIFELPQKAGK-DFGQVAVGK-----E-----SASSV--FEKY
A0A417SMF6      VLLLDCDFRQP---ALYKIFELPQKAGK-DFGQVAVGK-----E-----SASSV--FEKY
A0A1Y4MW77      VLLIDADLRKQ---DLSKQMN--LTTNGVGLSSIKYGS-----D-----VVEDA--IVYL
R6UHV6          VLLIDGDLRKP---AVAKFLEAKITNGK-SIIDFLRGK-----A-----RLSEI--ASYD
A0A3R9Q621      VLLVDCDLRKG---KLHRFFN--FKSMP-GLSDILSGL-----A-----SETEV--IHST
A0A069RC75      VMLFDCDFRKP---RLAKVFG--LSNTV-GITDALMSK-----R-----DYREF--VKET
A0A174F2W5      VLLLDCDFRQP---ALYKIFELPQKAGK-DFGQVAAGK-----E-----PASSV--FEKY
A0A174S8E9      VLLLDCDFRQP---ALYKIFELPQKAGK-DFGQVAVGK-----E-----SASSV--FEKY
A0A416ZL97      VLLLDCDFRQP---ALHKIFEIPEKDGK-DFGKVVLGK-----E-----SASGV--FEKH
A0A174LSK1      VLLLDCDFRQP---ALHKIFEIPEKDGK-DFGKVVLGK-----E-----SASGV--FEKH
A0A373GY92      VLLLDCDFRQP---ALHKIFEIPEKDGK-DFGKVVLGK-----E-----SASGV--FEKH
A0A373NZQ6      VLLLDCDFRQP---ALHKIFEIPEKDGK-DFGKVVLGK-----E-----SASGV--FEKH
A0A417I9B9      VLLLDCDFRQP---ALHKIFEIPEKDGK-DFGKVVLGK-----E-----SASGV--FEKH
A0A417MP97      VLLLDCDFRQP---ALHKIFEIPEKDGK-DFGKVVLGK-----E-----SASGV--FEKH
A0A417WQF8      VLLLDCDFRQP---ALHKIFEIPEKDGK-DFGKVVLGK-----E-----SASGV--FEKH
A0A373RZ83      VLLLDCDFRQP---ALHKIFEIPEKDGK-DFGKVVLGK-----E-----SASGV--FEKH
A0A416U6I1      VLLLDCDFRQP---ALHKIFEIPEKDGK-DFGKVVLGK-----E-----SASGV--FEKH
R7JQZ9          VLLLDCDFRQP---ALHKIFEIPEKDGK-DFGKVVLGK-----E-----SASGV--FEKH
A0A3B8KKL6      VLIVDADLRKP---KVHHYFG--VKNNI-GLTSILTDT-----K-----EDIKAKAIEKT
A0A2K9E6R0      VLIVDADLRKP---KVHHYFG--VKNNI-GLTSILTDT-----K-----EDIKAKAIEKT
A0A2S8RBI0      VLIVDADLRKP---KVHHYFG--VKNNI-GLTSILTDT-----K-----EDIKAKAIEKT
A0A0L6JLG6      VLVIDADLRKP---KVHHYFG--VKNTE-GLTNILATE-----K-----ELKKSMIQNKE
G8LSN0          VLLIDSDLRKP---KVHLYFG--IPNEK-GLTNIIKGD-----I-----EDKDINVLELK
A0A1M5UYN6      TIIIDCDMRRP---NVHRKFR--ISNEI-GLSDILSEQ-----A-----EFEEV---VHS
A0A176JBT8      VVFVDSDMRKP---NGHSLFN--LHNRC-GLTNYLTGF-----S-----SSDEI--IQST
A0A1I5HIC6      VLFIDADLRKS---VIVNRLK--ISNGANGLSQYLSGM-----S-----TLEEV--IHKT
A0A1Y3TC51      VLLVDGDLRRP---AQHKVFEEKGKERF-SFSQVLKGE-----A-----DWKDA--AFYN
A0A1Y3T1N0      VLLVDGDLRQP---AQYKVFEEKSAGRT-SVEQVFTGK-----A-----SWKEN--LYYN
A0A1Y3Y8U8      VLLVDGDLRQP---AQYKVFEEKSAGRT-SVEQVFRGK-----A-----SWKEN--LYYN
A0A5B0BQY5      TLFIDADFRKS---DGRLLFN--LPERK-GLTSVISGF-----Y-----ELDTI--IQET
A6CLL4          TVVIDMDLRKG---VGSQLFH--LPSKK-GISNYLHGI-----T-----PLNEI--IQRT
A0A174DL89      VIIIDCDMRKP---KIHRIFS--LSNII-GLSHILSNQ-----A-----ELEEC--LQSS
A0A176U8D6      VLLVDTDMRKS---VLQRRMG--LDGVKLGLSEYLSGN-----A-----ELGQV--IYDV
A0A1Q6KSQ5      VLLVDTDMRKS---VLQRRMG--LEGVKLGLSEYLSGN-----A-----EVGQV--IYDV
A0A3D3U8B3      VLLVDTDMRKS---VLQRRMG--LEGVKLGLSEYLSGN-----A-----EVGQV--IYDV
A0A3E5FRL7      VLLIDGDFRKP---AQYKIFDKEVLDTN-PLQDVITGK-----T-----TLKES--IYFN
A0A1Y4QK93      VLLIDGDFRKP---AQYKIFDKEVLDTN-PLQDVITEK-----K-----SLKDS--IYFN
B1C232          VLLIDGDFRKP---AQYKIFDKEVLDTN-PLQDVITGK-----A-----TLKES--IYFN
A0A401USI6      ILLIDCDLRKP---CIHRHFN--ITNNAKGLVDIVLQE-----R-----KIEEI---SIG
A0A1V4IQ10      VIIVDCDLRKP---SLHQKFN--IPNTS-GLSDVILKK-----E-----SLDKV---IQK
A0A1S8TRD2      VIIVDCDLRKP---SLHEKFN--ISNTS-GLSDVILKR-----D-----SLDNV---IQK
G7M1U2          VIIVDCDLRKP---SLHEKFN--ISNTS-GLSDVILKR-----D-----SLDNV---IQK
A0A2T6KJ75      TVFIDADLRRG---TGRNLFH--LPKRI-GITSYLAGQ-----C-----TLHEI--IQST
A9KN92          VLFIDADLRKS---VIISKLK--IDNAVNGLSQYISGM-----N-----SLEEV--IHKS
A0A352MUJ1      TILVDADMRKG---VQHKKFR--LKQVP-GLSDFLNSR-----IEDYENELPKY--VQPT
R5YI67          TILVDADMRKG---IQHKKFR--LNQVP-GLSDFLSSS-----SENLEEELQKC--IQPT
A0A1Y0IQP5      VLLIDGDLRKP---TLHHVFH--LGGQK-GLTEVLCEE-----T-----PLEDV---IVP
A0A4R2R7B1      VLLIDGDLRKP---TLHHVFH--LGGQI-GLTEVLCEG-----V-----APEEV---ILP
A0A1M6E8I2      VIVVDCDMRKP---RIHKILN--ISNTS-GIAEYLMDG-----R-----NIDDY--INRM
A0A1Y4N105      VVIIDCDFRKP---ALYKVFE--LKELKNGLSDYLDGN-----C-----KYEDI----IT
A0A1Y4QP75      VVIIDCDFRKP---ALYKVFE--LKELKNCLSDYLDGN-----C-----KYEDI----IT
A0A3D4QRB5      VLLIDCDLRSS---IVHRIFH--LLNEK-GLTNILVGE-----A-----EPSSI--VNSG
A0A349DEH5      VLIIDADLRKP---SVSKLLS--LPDTDCGLSDVILGN-----A-----TLNQA--IKLV
A0A3D4T7B4      VLIIDADLRKP---SVSKLLS--LPDTDCGLSDVILGN-----A-----TLNQA--IKLV
A0A350XYC7      VLIIDADLRKP---SVGKMLS--LKENDRGLSDVILGK-----V-----ELNKA--IKSV
R6DNR8          VLIIDADLRKP---SVSKMLS--LQDTEEGLSDVILGK-----A-----DLGKA--IKSV
A0A355KUM5      VLIIDADLRKP---SVSKMLS--LPATEYGLSDVILGN-----V-----ELNQA--IKRV
R5YGY6          VLIIDADLRKP---SVSKMLS--LPTTEYGLSDVILGN-----V-----ELNQA--IKRV
A0A0K8J554      VLLIDCDLRKG---RLHKPLN--VKSTP-GLSNVLSVM-----K-----TDEEV--VQDT
A0A3N1XSX6      VLLIDCDLRKG---KIHNYFN--LKYKP-GLSDVLSGM-----A-----ELTNV--IRKT
A0A1C6G0U3      ILLIDCDFRRP---KIHKIFK--ISNTQ-GLTNILVKN-----I-----HISEC----IN
A0A3D4LLB3      ILLIDLDLRKP---TVHKQFK--LSNKT-GLTDLLMKK-----D-----DYKAY---LQN
A0A0A5GPA9      TVFVDLDLRKG---VGNHLFN--NPVRK-GATNYLEGY-----A-----SIDEV--VSRT
A0A271M6M4      TIFVDLDLRKG---VGRQLFH--IPLRK-GVTTYLEGM-----A-----TIEEI--IVKT
A0A2V3W8U6      TVVIDADLRKE---KMGM-----SNGQI-GLTHYLAGN-----R-----SVQDI--LLDT
W1UFG0          VLLIDCDLRNP---TINKILN--KPNQK-GVMDILLGK-----K-----DIKNS--IEKV
A0A351SRI8      VLLVDCDIRKG---RQHRIFG--SPNKK-GLSNLLLED-----V-----AQVYRTYINES
A0A1V5LU59      VLIIDTDLRKP---KVHLYFG--IKNAE-GVTNMLSSD-----K-----GNNKVKPTKIE
A0A1E3BVC3      VLVIDADLRKP---KVHHYFG--VKNKE-GLTNILTDS-----K-----EDIKVKPTEKS
A0A4Q0I6S0      VLVIDADLRKP---KVHHYFG--VKNKE-GLTNILTDS-----K-----EDIKVKPTEKS
A3DF66          VLVIDADLRKP---KVHHYFG--VKNKE-GLTNLLTDS-----K-----EEVKIKTTERS
W4V1T8          VLVIDADLRKP---KVHHYFG--VKNKE-GLTNLLTES-----K-----EEIKIKTTEKS
A0A1I0RG99      VLLMDCDLRKG---RLHRLFN--IQLIP-GVSDALSST-----M-----DVKKS--IYKT
A0A1I5G322      VLLVDCDLRKG---RLHNFFN--IKSSP-GVTNVLSNM-----I-----DIENA--IQKT
A0A1C6ITD7      VVIIDCDMRKP---RIHRLFS--LSNII-GLSHILSNQ-----A-----ELEEC--LQSS
A0A381IX63      VLIIDCDLRNP---SIHRMFG--LSNAI-GLTDVLIGN-----K-----TFNQC--VQNT
A0A1G9IUT4      ILIIDCDFRNP---SIHKVFD--ISNKQ-GIADVLLNK-----V-----NLKDC--VHEI
A0A1M6RWV2      VLLIDADFRKP---QIHKIFN--LSNDV-GMTNILMGE-----------KLEDV--IHTV
A0A143XPI5      VLLIDADLRNP---SVSQVLHLDTNK--KEIADVLEGK-----L-----SWKSA--LISE
A0A355G1X5      VLLIDADMRKP---TLYRFLNLNIPRG-NDLASVICGK-----T-----DLSDA--IKYV
A0A0M6WXE3      IILIDGDIRCP---AQYLLLGMSPKKE-NELGEFLNGR-----T-----GANNI--LLNT
A0A348SAK2      IILIDGDIRCP---AQYLLLGMSPKKE-NELGEFLEGR-----I-----DANHI--LLNT
A0A1G9H5B9      VILVDSDMRRS---SQSEIFKYETDK--EGLSDVLAGR-----C-----QWQNV--IMKD
R5EFZ0          VLLIDCDLRKP----ACGMVLGQSKFT-YGLNDILGGK-----E-----NLSEC--FLRY
A0A1Y4H8L0      VLLIDGDLRRP---SQFLILGIETQDK-NELGEYLKSG-----R-----FSDEI--ITKT
A0A0M6WYQ8      VILVDCDMRRP---SVAKAM-NQEGEF-PGLQAVLQGK-----V-----KISEA--MTTV
A0A348SAK1      VILVDCDMRRP---SVSKAM-NQEGEF-PGLQAVLQGK-----V-----KISEA--MTTV
A0A252F281      VLLIDADFRKP---AQYKVLNRDVDEA-NCLGEYLRGT-----C-----SVDKI--IQTN
A0A1Y4QKE6      VLLIDADLRRQ---SIASI--LHCKDN-QGLIDVYLQK-----G-----DVLKN--IRKL
B1C231          VLLIDADLRRQ---SIAKI--LKCDNN-EGLVDLYLQK-----G-----DVLKN--IRKL
A0A1Y3TUL5      VLLIDLDVRNP---SLGGLFLDKVDYA-HSLNALYRGD-----A-----SPEDV--ITHL
A0A1Y4JAX2      VLLIDLDVRNP---SLGGLFLDKVDYA-HSLNALYRGD-----A-----SPEDV--ITHL
A0A1Y4T590      VLLIDLDVRNP---SLGGLFLDKVDYA-HSLNALYRGD-----A-----SPEDV--ITHL
R5B467          VLVIDCDLRNP---SVHKT--LGRPAQ-TGLAEYLAGT-----A-----KPGQI--VTAL
A0A1Y3T163      VLLIDGDLRKQ---DDAGI--IGIRDG-AGLADIVKGE-----K-----TIREG--LRKL
A0A1Y3YCA2      VLLIDGDLRKQ---DDAGI--IGIRDS-AGLADIVKGE-----K-----TIREG--LRKL
A0A1Y4L6N9      VLLLDGDMRKQ---TDWKY--IEGVKG-KGLYEVLRKE-----C-----TVKDA--IFHD
A0A173T644      VLFIDADLRKQ---TDRRC--LTETEG-KGLYGVVTGK-----C-----SLEKA--VEKD
A0A1C5TSB8      VLFIDADLRKQ---TDRRC--LTETEG-KGLYGVVTGK-----C-----SLEKA--VEKD
C0CIK6          VLFIDADLRKQ---TDRRC--LTETEG-KGLYGVVTGK-----C-----SLEKA--VEKD
A0A1Y3WEF6      VLFVDADLRKK---ADRKH--LTEEKG-RGLASVVTGK-----C-----SLQEA--VYRE
A0A417T0L2      VLFIDADLRKQ---ADRKH--LTEEKG-RGLASVVAGK-----C-----TLKEA--VYRE
A0A1H9EPU3      VIFIDADLRKSVLVGRYKI----SKQV-KGLTHYLSGV-----N-----SFDEV--VCET
A0A354IGV3      VLLIDGDLRKP---AVYKLLQLRLQPE-QALSHYLSDDSVRLSD-----FVSSA--VMQE
A0A417JMV2      VLLIDADLRKP---SQYKIFGLDQEEI-QQFGEVLNGN-----E-----QIDNL--VTDL
B0P408          VLLIDADLRKP---SQYKIFGLNQEEI-QQFGEVLNGN-----E-----QIDNL--VTDL
D4MV82          VLLIDADLRKP---SQYKIFGLNQEEI-QQFGEVLNGN-----E-----QIDNL--VTDL
A0A415VWX5      VLLIDADLRKP---SQYKIFGLDQEEI-QQFGEVLNGN-----E-----QIDNL--VTDL
A0A173UY96      VLLIDADLRKP---SQYKIFGLDQEEI-QQFGEVLNGN-----E-----QIDNL--VTDL
A0A173QTL1      VLLIDADLRKP---SQYKIFGLDQEEI-QQFGEVLNGN-----E-----QIDNL--VTDL
A0A174A3T7      VLLIDADLRKP---SQYKIFGLDQEEI-QQFGEVLNGN-----E-----QIDNL--VTDL
A0A174J359      VLLIDADLRKP---SQYKIFGLDQEEI-QQFGEVLNGN-----E-----QIDNL--VTDL
A0A417UUA3      VLLIDADLRKP---SQYKIFGLDQEEI-QQFGEVLNGN-----E-----QIDNL--VTDL
A0A1C6EUV9      VLLIDADLRKP---SQYKIFGLAPEEV-QEFGEVLNGN-----E-----KADHL--VHAL
A0A173Y645      VLLIDADLRKP---SQYKIFGLAPEEV-QEFGEVLNGN-----E-----KSDHL--VHAL
A0A374AVY6      VLLIDADLRKP---SQYKIFGLAPEEV-QEFGEVLNGN-----E-----KSDHL--VHAL
R7BXS4          VLLIDADLRKP---SQYKIFGLAPEEV-QEFGEVLNGN-----E-----KSDHL--VHAL
A0A143ZUX1      VLLIDVDLRRP---TQHNLFQQTTYRN-KGLSDILTGS-----V-----YPMDA--IHHN
S3FFL2          VILIDGDMRSP---SVHHLGGVD--HN-RGLSNFLAGE-----N-----DIASL--TFSM
A0A328M4V1      VLLIDADMRKG---TLHKIVGGN--PE-RGLSELISGQ-----A-----ELPEV--LRNV
A0A5C8HCX2      VLFIDADLRRG---YSHNLFTVS--NE-HGLSEYLAGK-----D-----ELNKV--IQHF
A0A1W1Z4C3      VLLVDGDMRRA---CQSEMFYYD--PNSPGLSDILTSN-----I-----KVEQA--ILNS
A0A239QN83      ILLVDADMRRA---CQSEIFYYD--PNASGLADILTGS-----T-----TAKKA--IVST
A0A3R9WAA7      VILVDCDFRRP---SIMKMLPYS--AGTVCLNDVLKEK-----E-----KLTDA--IRYY
A0A1G6BLF1      VVIVDMDLRNP---SLADSFALESVK--CGTIDVLKGR-----K-----EIQDA--LVQY
R6HZX3          VILVDADLRHQ---VVKARFGITTPS--AGLLE-LSRA-----A-----KPDIA--RVLI
A0A1W2CEA6      VLLIDADLRLS---VMKEKYDIHFGGQPTGLAHLLSGQ-----C-----ALEDA--IYHT
R7FFK6          VLLIDADMRKP---VQHKNFQVS--NK-LGLSNVITDA-----S-----LLDEA--LHQN
A0A373MPB9      VLLIDADMRKP---VQHRNFKLK--NN-VGLSTILSGE-----S-----TFDKC--VHET
A0A373L519      VLLIDADMRKP---VQHRNFKLK--NN-VGLSTILSGE-----S-----TFDKC--VHET
A0A373W906      VLLIDADMRRP---VQHRNFKLK--NN-VGLSTILSGE-----S-----TFDKC--VHET
A0A373VCW2      VLLIDADMRRP---VQHRNFKLK--NN-VGLSTILSGE-----S-----TFDKC--VHET
W0U604          VLLIDADMRRP---VQHRNFKLK--NN-VGLSTILSGE-----S-----TFDKC--VHET
A0A374B6G0      VLLIDADMRKP---VQHRNFKLK--NN-VGLSTILSGE-----S-----TFDKC--VHET
A0A373VM36      VLLIDADMRRP---VQHRNFKLK--NN-VGLSTILSGE-----S-----TFDKC--VHET
A0A1C5P379      VLLIDADMRRP---VQHRNFKLK--NN-VGLSTILSGE-----S-----TFDKC--VHET
A0A373XXX0      VLLIDADMRRP---VQHRNFKLK--NN-VGLSTILSGE-----S-----TFDKC--VHET
A0A5R9MJM9      VLLIDADMRRP---VQHRNFKLK--NN-VGLSTILSGE-----S-----TFDKC--VHET
A0A356CW82      VLLIDADMRRP---VQHRNFKLK--NN-VGLSTILSGE-----S-----TFDKC--VHET
R6T4X7          VLLIDADMRRP---VQHRNFKLK--NN-VGLSTILSGE-----S-----TFDKC--VHET
A0A374HTV1      VLLIDADMRRP---VQHRNFKLK--NN-VGLSTILSGE-----S-----TFDKC--VHET
A0A374GB66      VLLIDADMRRP---VQHRNFKLK--NN-VGLSTILSGE-----S-----TFDKC--VHET
A0A374ECC6      VLLIDADMRRP---VQHRNFKLK--NN-VGLSTILSGE-----S-----TFDKC--VHET
A0A374BM61      VLLIDADMRRP---VQHRNFKLK--NN-VGLSTILSGE-----S-----TFDKC--VHET
A0A373UGZ4      VLLIDADMRRP---VQHRNFKLK--NN-VGLSTILSGE-----S-----TFDKC--VHET
A0A373SA66      VLLIDADMRRP---VQHRNFKLK--NN-VGLSTILSGE-----S-----TFDKC--VHET
A0A1C5X6X7      VLLIDADMRRP---VQHRNFKLK--NN-VGLSTILSGE-----S-----TFDKC--VHET
A0A1C6JIH3      VLLIDADMRRP---VQHRNFKLK--NN-VGLSTILSGE-----S-----TFDKC--VHET
A0A373PSC3      VLLIDADMRRP---VQHRNFKLK--NN-VGLSTILSGE-----S-----TFDKC--VHET
A0A1K1WYK8      VLLIDADMRKP---VQHRTFKIK--ND-EGLSTLIIKK-----S-----SMAKS--VKSN
A0A1H6IUB1      ILLIDADMRKA---VQHKVFGLK--NK-KGLSSAISKM-----C-----SLEEC--IHKN
A0A1M7L1F9      ILLIDADMRKA---VQHKIFGLK--NK-KGLSSAISKM-----S-----KLEEC--IQKD
A0A1C6B4L6      ALLIDADMRKA---VQHKIFEIK--NK-KGLSTAISKM-----N-----KLDEC--IQKN
A0A1Q6T9P4      ALLIDADMRKA---VQHKIFEIK--NK-KGLSTAISKM-----N-----KLDEC--IQKN
A0A315Y4F9      VLLIDADMRKS---VQHKIFELV--NK-KGLSTAVSKM-----H-----TPDEC--IQKN
A0A354K620      VLLIDADMRRS---VQHKIFELV--NK-KGLSTAVSKM-----H-----SPDKC--IQKN
A0A355G3J9      VLLIDGDLRKP---KVSLYLDLY--GK-YGLSEYLANL-----T-----DELCP--MNYS
A0A3D2AD87      VLLVDADLRRA---SLHKKFKLE--NG-KGLADVLTGT-----A-----TLDEA--IVTI
A0A2T5IYJ6      VLLIDGDMRKP---TIAKVLGLPP-NS-PGLSNVVAGT-----S-----VLDDC--ILHV
A0A3C0QME1      VLLIDADMRKP---VQHKVFELS--NK-KGLSTAIGHM-----N-----PLEES--VHKG
A0A355FYK5      VLLIDADLRKP---AVLRTIGVKYDDK-SGLIPIIKGE-----S-----TYQES--IKYV
A0A357AQU0      VLLIDGDLRKP---VQHKIYNIK--ND-SGLSNIVSKQ-----K-----KFDAV--VHKA
A0A3C1YJQ7      VLLIDGDLRKP---VQHKIYNIK--ND-SGLSNIVSKQ-----K-----KFDAV--VHKA
A0A3D0JG38      VLLIDGDLRKP---VQHKIYNIK--ND-SGLSNIVSKQ-----K-----KFDAV--VHKA
A0A3C0IHX1      VLFIDADLRKP---VQHQRLKLE--NK-VGLSEVLGHM-----T-----TWQVA--RHLA
R5V506          VLFIDADLRKP---VQHQRLKLE--NK-VGLSEVLGHM-----T-----TWQVA--RHLA
A0A352TIU5      VLFIDADLRKP---VQHQRLKLE--NK-VGLSEVLGHM-----T-----TWQVA--RHLA
A0A3E5FSY5      VLLIDADLRRQ---SIAKILKCDN--N-EGLVDLYLQK-----G-----DVLKN--IRKL
A0A1V5S3C0      VLLIDCDIRKP---AVYKVLGVPVGGD-KGIYDIVRGK-----S-----TFEEA--IKYV
A0A1Y3TC98      VLLIDGDLRKH---GSAGLLGVSG--K-YSLKDVAGMD-----T-----KKVKA--GELL
A0A1Q6REE0      VLLIDCDFRNP---SVAKTLSSKSHPL-DEGRNLTNFT-----G-----SGEAA--GALA
R5ETF9          VLLIDCDFRNP---SVAKTLSSKSHPL-DEGRNLTNFT-----G-----SGEAA--GALA
R6VAT5          TVIIDCDLRNP---TVRQQLNIPESCS-LGIVDVITGT-----C-----SLQDA--IVKT
A0A1Q6S448      VLFIDLDLRRP---VQSEMLGLSVKQK-NELGTLLTES-----A-----APEKI--LAAA
A0A351MYR0      VLFIDLDLRRP---VQSEMLGLSVKQK-NELGTLLTES-----A-----APEKI--LSAV
R6HPC1          VLFIDLDLRRP---VQSEMLGLPVKQK-NELGTLLSES-----A-----APEKI--LSAA
A0A3D4G5Z5      VLFIDLDLRRP---VQSEMLGLSVKQK-NELGTLLSES-----A-----APEKI--LSAA
A0A3D5ES03      VLFIDLDLRRP---VQSEMLGLSVKQK-NELGTLLSES-----A-----DPEKI--LSAA
A0A0F2P7X6      VLLVDCDLRKS---NMHGVLELDLEDH-QGLAAVLNGA-----C-----AAEEG--IVFA
A0A359B487      VLLVDCDLRKS---NMHGVLELDLEDN-QGLAAVLNGA-----C-----AAEEC--IVFA
A0A348P5V4      VLLIDADLRKP---SVAKTLGFSASDD-EGICGIVSGK-----K-----TLKES--IKYS
A0A356PT74      VLLVDGDLRKP---AVAKLLGINASED-GGVYGVINGE-----K-----TLAEA--IKYS
A0A3D5LL19      VLLVDGDLRKP---AVAKLLGINASED-GGVYGVINGE-----K-----TLAEA--IKYS
R5MNF0          VLLVDGDLRKP---AVAKLLGINASED-GGVYGVINGE-----K-----TLAEA--IKYS
A0A1Q9JSI0      VLLIDADLRKP---SQYKIFGIDKEEI-KQFGEVLNGN-----E-----NAENL--VLPI
A0A3D5TNI1      VLLIDADLRKP---SVLKNLGITNISG-NGIADVVGRV-----K-----NSSDA--IKYI
A0A358LJD0      VLLVDADLRKP---SVLKNLGISNLSG-NGIADVVNGA-----K-----NSSDA--IKYI
R6I3L7          VLLVDADLRKP---SVLKNLGISNLSG-NGIADVVNGE-----K-----NSSDA--IKYI
A0A3D1HXX0      VLLVDADLRKP---SVLKNLGISNLSG-NGIADVVNGA-----K-----NSSDA--IKYI
A0A3D2QJB8      VLLVDADLRKP---SVLKNLGISNLSG-NGIADVVNGA-----K-----NSSDA--IKYI
D4LC36          VLLIDADMRKP---VQHKCFRLSN--K-VGLSDVITGD-----K-----PLDKA--LNRN
R7MQJ4          VLLIDADMRKP---VQHKIFGLKN--K-KGLSSIIGKM-----N-----KFDEC--VNKN
A0A1V5GLC0      VLLVDADMRKS---VQHKIFDLKN--K-KGLSTAVSKM-----N-----SVEEC--IIRN
W7V182          VLLIDGDLRKS---CQHKIFGIKN--K-KGLSTAISKM-----A-----ALDEC--ISKD
                 :..* *.*                                                   

A0A0H5SF45      SYNN----------LQIIPCGSI-APNPTELLSSIQMEELIKKLEQNYDYIIIDTAPVNL
A0A1M6JRJ5      PYEN----------LHMMPMGST-PPNPSELLGSKQMELLIKELETEYDYIVLDTPPVNV
A0A1M7Y1S2      PYDN----------LHIMPMGSI-PPNPSELLGSRQMELLIKELEAEYDYIILDTPPINI
A0A3D5R4X5      RTKN----------LDLMFSGLI-PPNPSELLGSKSMLEFIEKVKEEYDYVIFDTPPVAL
A0A1I4C3N6      SGRG----------FDVILAGAK-PSNAADLLAGGKIRELINAQKENYDMIIVDLAPAGR
A0A3B9CIM7      RAEN----------LYVAMAGEV-PPNPAELLSGERWSELLEKCKEEYDCIFVDLPPAGI
A0A1G9WHW8      YNNN----------LDILFAGEI-PPNPMELLSSEKCKNLLESLKETYDVIFIDFPPVGE
A0A1H5VAA0      YNNN----------LDILFAGEI-PPNPMELLSSEKCKNLLESLKETYDVIFIDFPPVGE
A0A3R6VK11      YRQN----------LDVLVGGEN-PPNPSELLGGERMKELLTTLRSRYDCIIIDLPPVGI
A0A3R6QUY7      YRQN----------LDVLVGGEN-PPNPSELLGGERMKELLTTLRSRYDCIIIDLPPVGI
A0A373K3P9      YRQN----------LDVLVGGEN-PPNPSELLGGERMKELLTTLRSRYDCIIIDLPPVGI
A0A3R6JRU5      YRQN----------LDVLVGGEN-PPNPSELLGGERMKELLTTLRSRYDCIIIDLPPVGI
A0A1C5MS04      YRQN----------LDVLVGGEN-PPNPSELLGGERMKELLTTLRSRYDCIIIDLPPVGI
A0A3C1J150      YRQN----------LDVLVGGEN-PPNPSELLGGERMKELLTTLRSRYDCIIIDLPPVGI
A0A416CXD7      YRQN----------LDVLVGGEN-PPNPSELLGGERMKELLTTLRSRYDCIIIDLPPVGI
R6XBL9          YRQN----------LDVLVGGEN-PPNPSELLGGERMKELLTTLRSRYDCIIIDLPPVGI
A0A355W5Z7      YRQN----------LDVLVGGEN-PPNPSELLGGERMKELLTTLRSRYDCIIIDLPPVGI
A0A143WVN6      VPNG----------LQIICQTRG-LNNSTKYIMSKNMLDFILKCRENYDLIVLDTPPIGA
W6RXP9          YNKN----------LLILTAGKI-PPNPSEMLGSKTMKELLDRLKEVVDYIILDTPPVQA
W6S4G8          IKET----------LLLIPAGRV-SPNPTELLNSKAMELLLEELKETCDYVILDTAPVEA
A0A1G6BLB6      ENSN----------LHLLLNTVI-YPNSTELLSQGLLERIIGELKREYDYIIIDCSPMAL
B5CSZ7          QAHP----------MDCIWQKKA-VAKPYRLLGSERFISLINQLKEQFDYVVMDTPPLEL
A0A1C6G8M0      GIPN----------MHVLFSGKL-VTNASALLSAKWLRTLCDSVKDSYDYIIFDTPPVGV
A0A416MP73      GLPN----------MHVLFSGKL-VPNASALLSAKWLENLCAEVRDSYDYVIFDTPPICV
A0A3E4LL92      QAHP----------IYCLWQKKA-VARPYRLLESERFASLIHQLKEQFDYVVMDTPPLEL
A0A415D1L1      QAHP----------MGCIWQKKA-VAKPYRLLGSERFISLIDQLKEQFDYVVMDTPPLEL
A0A414P2K5      QAHP----------MDCIWQKKA-VAKPYRLLGSERFISLINQLKEQFDYVVMDTPPLEL
V8C417          QAHP----------MDCIWQKKA-VAKPYRLLGSERFISLINQLKEQFDYVVMDTPPLEL
A0A143XN92      NNSN----------LFILFNSQP-LQNSLELMDYSSWKDWIKKMEQEMDYILIDTSPVAL
A0A173ZYY6      TRKH----------MLFMGGKNC-YSSSTEMLNSESFFKLMAACRKFVDYVIIDTPPAGI
A0A4Q5EHM9      TRKH----------MLFMGGKNC-YSSSTEMLNSDSFYKLMTACRKFVDYVIIDTPPAGI
A0A173SMI2      TRKH----------MLFMGGKNC-YSSSTEMLNSESFFKLMAASRKFVDYVIIDTPPAGI
A0A174ASH7      TRKH----------MLFMGGKNC-YSSSTEMLNSDSFYKLMTACRKFVDYVIIDTPPAGI
A6BH65          TRKH----------MLFMGGKNC-YSSSTEMLNSDSFYKLMTACRKFVDYVIIDTPPAGI
R7G0D7          TRKH----------MLFMGGKNC-YSSSTEMLNSDSFYKLMTACRKFVDYVIIDTPPAGI
A0A396G6S7      NNSG----------LYMILNKTS-SNAIETLLKSMTLKQIIAFCREKMDYVVIDTSPLAL
A0A3E5A223      NNSG----------LYMILNKTS-SNAIETLLKSMTLKQIIAFCREKMDYVVIDTSPLAL
R7D5E6          NNSG----------LYMILNKTS-SNAIETLLKSMTLKQIIAFCREKMDYVVIDTSPLAL
A0A415HQH5      NNSG----------LYMILNKTS-SNAIETLLKSMTLKQIIAFCREKMDYVVIDTSPLAL
A0A414W2C6      NNSG----------LYMILNKTS-SNAIETLLKSMTLKQIIAFCREKMDYVVIDTSPLAL
A5ZNE7          NNSG----------LYMILNKTS-SNAIETLLKSMTLKQIIAFCREKMDYVVIDTSPLAL
A0A395X821      NNSG----------LYMILNKTS-LNAIETLLKSMTLKQIIAFCREKMDYVVIDTSPLAL
A0A1C5PY68      NNSG----------LYMILNKTS-SNAIETLLKSMTLKQIIAFCREKMDYVVIDTSPLAL
A0A174CJF8      NNSG----------LYMILNKTS-SNAIETLLKSMTLKQIIAFCREKMDYVVIDTSPLAL
A0A564SRR2      NNSG----------LYMILNKTS-SNAIETLLKSMTLKQIIAFCREKMDYVVIDTSPLAL
A0A174R7V0      NNSG----------LYMILNKTS-SNAIETLLKSMTLKQIIAFCREKMDYVVIDTSPLAL
A0A373MWV2      KDTN----------VYMGICRER-LEEPSEAVGGEIFRRILDMCRTNMDYIILDTPPMGA
A0A417CE88      KDTN----------VYMGICRER-LEEPSEAVGGKIFRRILDTCRTNMDYIILDTPPMGA
A0A416Y441      KDTN----------VYMGICRER-LEEPSEAVGGEIFRRILDTCRTNMDYIILDTPPMGA
A0A357GPJ7      KDTN----------VYMGICRER-LEEPSEAVGGEIFRRILDTCRTNMDYIILDTPPMGA
A0A396PAC1      KDTN----------VYMGICRER-LEEPSEAVGGEIFRRILDTCRTNMDYIILDTPPMGA
A0A416EYU4      KDTN----------VYMGICRER-LEEPSEAVGGEIFRRILDTCRTNMDYIILDTPPMGA
A0A416SCQ2      KDTN----------VYMGICRER-LEEPSEAVGGEIFRRILDTCRTNMDYIILDTPPMGA
A0A416TGN7      KDTN----------VYMGICRER-LEEPSEAVGGEIFRRILDTCRTNMDYIILDTPPMGA
A0A417SMF6      KDTN----------VYMGICRER-LEEPSEAVGGEIFRRILDTCRTNMDYIILDTPPMGA
A0A1Y4MW77      EKQN----------LYFLGGNST-IDDLTAVLTNPNMEQFMNDMRQKMDYIIFDAPPCEA
R6UHV6          EINN----------ITIMGSNKG-TQQANELITGEKMDYLISAAREQYDYIIIDTPPLCF
A0A3R9Q621      AYKN----------LHVLPMGSK-PPNPAEMLASVHMEELIAKLAKSYDYIIIDTPPINV
A0A069RC75      HIEN----------LHIMTAGNS-VQNPAELLQSERIRELIRKIENDYDYIIVDTPPATA
A0A174F2W5      KDTN----------VYMGICRER-LEEPSEAVGGEIFRRILDMCRTNMDYIILDTPPMGA
A0A174S8E9      KDTN----------VYMGICRER-LEEPSEAVGGEIFRRILDTCRTNMDYIILDTPPMGA
A0A416ZL97      KDTN----------VYTGICRNR-LEEPSLAIGGEIFHRILETCRTNMDYIILDTPPMGM
A0A174LSK1      KDTN----------VYTGICRNR-LEEPSLAIGGEIFHRILETCRTNMDYIILDTPPMGM
A0A373GY92      KDTN----------VYTGICRNR-LEEPSLAIGGEIFHRILETCRTNMDYIILDTPPMGM
A0A373NZQ6      KDTN----------VYTGICRNR-LEEPSLAIGGEIFHRILETCRTNMDYIILDTPPMGM
A0A417I9B9      KDTN----------VYTGICRNR-LEEPSLAIGGEIFHRILETCRTNMDYIILDTPPMGM
A0A417MP97      KDTN----------VYTGICRNR-LEEPSLAIGGEIFHRILETCRTNMDYIILDTPPMGM
A0A417WQF8      KDTN----------VYTGICRNR-LEEPSLAIGGEIFHRILETCRTNMDYIILDTPPMGM
A0A373RZ83      KDTN----------VYTGICRNR-LEEPSLAIGGEIFHRILETCRTNMDYIILDTPPMGM
A0A416U6I1      KDTN----------VYTGICRNR-LEEPSLAIGGEIFHRILETCRTNMDYIILDTPPMGM
R7JQZ9          KDTN----------VYTGICRNR-LEEPSLAIGGEIFHRILETCRTNMDYIILDTPPMGM
A0A3B8KKL6      EISN----------LDIITSGPV-PPNPYEMLSSNKMQSFVEKVKGEYDIVIFDTPPVGQ
A0A2K9E6R0      EISN----------LDIITSGPV-PPNPYEMLSSNKMQSFVEKVKGEYDIVIFDTPPVGQ
A0A2S8RBI0      EISN----------LDIITSGPV-PPNPYEMLSSNKMQSFVEKVKGEYDIVIFDTPPVGQ
A0A0L6JLG6      GIEN----------LFIIPSGPI-PPNPSEILSSDKMRQLVEKLKSEYDVIFIDTPPVGQ
G8LSN0          DIPN----------LSVITSGPI-PPNPAEILSSNKMQNLLEDLRGNYDFILLDTPPVGQ
A0A1M5UYN6      YDKH----------LCVIPSGPM-PPNPAEMLNSIKMKFFIEKLKNDFDYIILDTPPVIP
A0A176JBT8      AIPK----------LSFISAGPI-SPNPHELIISKKMDLLIDRLKQKFDVILFDSSPL-L
A0A1I5HIC6      NVEN----------VDIIFTGIL-PPHPSEMLGNEEFKDLVRSQREIYDYIIIDTPPLGV
A0A1Y3TC51      KRSD----------IWELFQFRA-VREPARILREEKLEGLAEEWKREMDYIIIDCSPVAV
A0A1Y3T1N0      KAAG----------IWELFQFSG-AKDPAAVFAEAPMKTLAREWKQEMDYIIIDCPPTAV
A0A1Y3Y8U8      KAAG----------IWELFQFSG-AKDPAAVFAEAPMKTLAREWKQEMDYIIIDCPPTAV
A0A5B0BQY5      GIEN----------LSFIGTGPL-PLNPVKFILADGMDKLLDDIKILFDVVIIDSPPL-T
A6CLL4          DIPK----------LFFISAGPL-PPNPTELLSSDRLSSMINTLKKEVDLILIDTPPL-I
A0A174DL89      GINN----------LSILTAGVI-PPNPSELISSNGMKILLDRLTSNFDFILIDSPPLPL
A0A176U8D6      GLPN----------MHVLFSGKL-VPNASALLSAKWLENLCAEVRDSYDYVIFDTPPICV
A0A1Q6KSQ5      GIPN----------MHVLFSGKL-VTNASALLSAKWLRTLCDSVKDSYDYIIFDTPPVGV
A0A3D3U8B3      GIPN----------MHVLFSGKL-VTNASALLSAKWLRTLCDSVKDSYDYIIFDTPPVGV
A0A3E5FRL7      KKSN----------IYELFLYHA-IDDPSKLMNAVTLKKIMEQLKEHFDYIVIDCSPVAV
A0A1Y4QK93      KKSN----------IYELFLYHA-IDDPSKLMNVVTLKKIMDQLKKHFDYIVIDCSPVAV
B1C232          KKSN----------IYELFLYHA-VDDPSKLMDVITLKKIIDQLKEQFDYIIIDCSPISV
A0A401USI6      IDDK----------FDVLTAGKA-NYNPSELLSSQKMKDFIKDMEKKYDYVILDTPPIIA
A0A1V4IQ10      HNEN----------LYLMSSGKF-TGKPASMLASQEMDNILTELKKNFDIILLDSPPVQA
A0A1S8TRD2      HNKN----------LYVISSGKF-TEKPASMLASQTMDDILTELKQKYDIILLDSPPAQA
G7M1U2          HNKN----------LYVISSGKF-TEKPASMLASQTMDDILTELNQKYDIILLDSPPAQA
A0A2T6KJ75      EVPN----------LSFISAGPV-PPNPTELLSSTKFVQLLEELKNQFDIIIVDTPPL-L
A9KN92          NVEN----------RDIIFTGIL-PPNPSEMLGSEEFKNLVKNLRDEYDYIIIDTPPLGV
A0A352MUJ1      ELDN----------LCVLPCGSI-TYDSSELLLSNRIIKTVETLKKNCDIVIFDATPSNL
R5YI67          ELDN----------LCVLTCGSI-TYDSSELLLSNKIIKAVEILKKNCDIVIFDATPSNL
A0A1Y0IQP5      SAAG----------PDVITAGAI-PSNPSELLGSPKLRAALADVRTRYDLVLIDSPPLLP
A0A4R2R7B1      SAAG----------PDVIPAGAI-PANPSELLGSPKLRGLLSDLRIRYDLVLIDSPPLLP
A0A1M6E8I2      YNLD----------IDVMTSGKL-PGNPSELLQSNVMKKMVEFLEKKYDYVLFDSPPVVP
A0A1Y4N105      YQNN----------LAIISQKDS-KKNSSNYFLTAQFTQFIKKCRSNFDYIIIDTPPMGA
A0A1Y4QP75      YQNN----------LAIISQKDS-KKNSSNYFLTTQFAQFIKKCRSNFDYIIIDTPPMGA
A0A3D4QRB5      GISN----------LHIISAGPK-PPNPSELLGSTRMQAFLQQAAEIYDMIILDAPPIMP
A0A349DEH5      NNFN----------VCILADQKS-VPNPSELLSTDKMEAIIDEVRKNFDYVLIDTAPASV
A0A3D4T7B4      NNFN----------VCILADQKS-VPNPSELLSTDKMEAIIDEVRKNFDYVLIDTAPASV
A0A350XYC7      NTFN----------VCVLADQNG-VNNPSELLSTEKMEHIIEEVRNAFDYVLIDTAPASV
R6DNR8          NSFN----------VCVLADQKG-VNNPSELLSTEKMESIIEEVRKAFDFVLIDTAPASV
A0A355KUM5      TSFN----------VCVLADQKG-VNNPSELLSTEKMESIIEEARKEFDYVLIDTAPASV
R5YGY6          TSFN----------VCVLADQKG-VNNPSELLSTEKMESIIEEARKEFDYVLIDTAPASV
A0A0K8J554      DYEN----------LQLIACGTI-APNPTELLSSIQMEELLLRLEKRYDYIILDSAPVNL
A0A3N1XSX6      SYEN----------LNIITIGSI-SPNPSELLSSSHMEELINVLEKDYDYIIFDTPPVNV
A0A1C6G0U3      TVSG----------LNIITSGTK-PINPSDILASKKMINFIKQIRNEYDYIFIDSPPVNI
A0A3D4LLB3      IYPG----------LDVLTTGMI-PANPAEIINSRALKELIKEVSADYDYILLDVPPVML
A0A0A5GPA9      DIPH----------LSYVAKGPM-PKNPAEVLSSDKINTMLAELKEHFDLVIIDTPPL-V
A0A271M6M4      NVSN----------LSFIGTGPL-SANPAELLSSEKIDIMLETLQESYDLVIIDTPPL-V
A0A2V3W8U6      FTPN----------LQSITCGPI-PPNPAELLSSERMDQLLQELKEHFDRIIIDSPPL-F
W1UFG0          N-DK----------FDILFTGKI-PQNPTEILASKKMKNLIDYLKNDYDYIFIDTPPAGV
A0A351SRI8      DVPN----------LYLMFKGVT-PPNPSELLNSDKNKKLVSSLSNNFDIIIFDSAPING
A0A1V5LU59      GISN----------LDIIPSGPI-PPNPAELLSSKRMNQLLEELKNEYDVIIIDTPPVGQ
A0A1E3BVC3      DISN----------LYIITSGPI-PPNPAEMLNSNRMKKLLEKMKEEYDIIIIDTPPVGQ
A0A4Q0I6S0      DISN----------LYIITSGPI-PPNPAEMLNSNRMKKLLEKMKEEYDIIIIDTPPVGQ
A3DF66          DISN----------LYIITSGPI-PPNPAEMLNSNRMKSLLEKVREEYDIVIIDTPPVGQ
W4V1T8          DISN----------LYIITSGPI-PPNPAEMLNSNRMKSLLEKVKEEYDIIVIDTPPVGQ
A0A1I0RG99      SYDN----------LYVMPMGTI-PPNPSELLASIQMEELLSQLNNEYEYILIDTPPVKV
A0A1I5G322      TYDN----------LYVLPLGTI-PPNPSELMASSQMEELLKKLEREYDYIIIDTPPVRV
A0A1C6ITD7      GIEN----------LSILTAGVI-PPNPSELISSNGMKMLLDRLSSNFDFILIDSPPLPL
A0A381IX63      EVKN----------LKVLTTGNI-PNNPAEILNSNRMRSFVEETKEHFDYVFIDTPPIGI
A0A1G9IUT4      SSEN----------LNVLTCGSI-PSNPSELLSSHKMQKLLEELKNEYDYIFIDSPPIGR
A0A1M6RWV2      GGLK----------LDIITTGPI-PPNPSEILGSNAMKKFIEQCKEYYDIILIDSPPAGI
A0A143XPI5      Q----ETG------LQLLAGTYR-RDNSAKLMESTYMEQLLEEAKEQFDCVIVDAPPCTI
A0A355G1X5      E----KYK------LFILSSIEP-NSEPTEILASQQMNKIIKAAKKEFDYVIIDTAPAAV
A0A0M6WXE3      E----RKR------LGFIGGKVS-YSASTEMLGNRQLPVLIEACSKIVDYVIIDTPPSGM
A0A348SAK2      E----RKR------LGFIGGKVS-YSASTEMLGNRQLPVLIEACSKIVDYVIIDTPPSGM
A0A1G9H5B9      V----AQK------VDLLPAGHL-PPNPAELLESARMQQLLLELNDAYDLVLLDMPPVDI
R5EFZ0          Q----NSD------MYMLLAKRG-EQNTGDLLISPRMNALLDWARECFDFIVLDLPPMSA
A0A1Y4H8L0      D----IGG------LYFMGGRNC-YSMSTDMLQSGNIEKLLKTCRRLVDYVVIDTPPAGP
A0A0M6WYQ8      ELEKCPGS------LQILYGKTT-EGSSSDLLESKQMERLISILKKKADLVIFDTAPSEM
A0A348SAK1      ELEKCPGS------LQILYGGTK-EGSSSDLLESKQMERLISILKKKADLVIFDTAPSEM
A0A252F281      A----EVN------LYEMFGKNY-YSDSVELLGSARMKKLLEVSRQKMDFIIIDSPPMSA
A0A1Y4QKE6      D----DSK------LWFIGNDNP-VDNPVSVLSHPDLKEFIEKMKKEFDYVIIDTPPCGI
B1C231          D----NSK------FWFIGNDKP-INNPVSVLSHPDFKKFIEKMKKEFDYVIIDTPPCGI
A0A1Y3TUL5      T----G----------YLDLLPS-ILEPKEIPLSDALLTLIKDLSQNYDYVLMDSAPVGR
A0A1Y4JAX2      T----G----------YLDLLPS-ILEPKEIPLSDALLTLIKDLSQNYDYVLMDSAPVGR
A0A1Y4T590      T----G----------YLDLLPS-ILEPKEIPLSDALLTLIKDLSQNYDYVLMDSAPVGR
R5B467          G----KDK------PDVIFAGRR-AGAQTEQLGSAAFHTLLHDLREHYDVVLLDTPPCAV
A0A1Y3T163      K----KSG------IWFLGSRRI-VKQPASVLSSPRTGELIQALKKEMDYIIIDTPPCEM
A0A1Y3YCA2      K----KSG------IWFLGSRRT-VKQPASVLSSPRTGELIQALKKEMDYIIIDTPPCET
A0A1Y4L6N9      E----ESG------VYFLGGKEP-IKEVTQTLNSSNLLDVMESLRKEMDYVIIDAPPSEM
A0A173T644      G----RSG------ISFLCGSLP-VRNVPAVLNRPEFQETLRRVRGEYDLVILDSPPAEM
A0A1C5TSB8      G----RSG------ISFLCGSLP-VRNVPAVLNRPEFQETLRRVRGEYDLVILDSPPAEM
C0CIK6          G----RSG------ISFLCGSLP-VRNVPAVLNRPEFQETLRRVRGEYDLVILDSPPAEM
A0A1Y3WEF6      E----ETG------VDFLGGSKP-VKGVQQILNHSSFHEVIKEMKAQWDLILLDAPPTEM
A0A417T0L2      K----ETG------VDFLGGNKP-VKGVQQILNHSHFHEVMEEMKAQWDLILLDAPPVEM
A0A1H9EPU3      N----VKN------LHMVFSGIV-PPNPAELLESVYFRELVKQLRQAYDYVVIDTPPVGT
A0A354IGV3      E----KTG------LYVIAGDHS-VPMSSELVSSARMQALLAHFREEMDFILIDSPPMAL
A0A417JMV2      P----KSE------LLLIAGSMI-YPNSTEMIASPIFQKIVEFFKTKLDYIIIDTPPMSQ
B0P408          P----KSE------LLLIAGSMI-YPNSTEMIASPIFQKIVEFFKTKLDYIIIDTPPMSQ
D4MV82          P----KSE------LLLIAGSMI-YPNSTEMIASPIFQKIVEFFKTKLDYIIIDTPPMSQ
A0A415VWX5      P----KSE------LLLIAGSMI-YPNSTEMIASPIFQKIVEFFKTKLDYIIIDTPPMSQ
A0A173UY96      P----KSE------LLLIAGSMI-YPNSTEMIASPIFQKIVEFFKTKLDYIIIDTPPMSQ
A0A173QTL1      P----KSE------LLLIAGSMI-YPNSTEMIASPIFQKIVEFFKTKLDYIIIDTPPMSQ
A0A174A3T7      P----KSE------LLLIAGSMI-YPNSTEMIASPIFQKIVEFFKTKLDYIIIDTPPMSQ
A0A174J359      P----KSE------LLLIAGSMI-YPNSTEMIASPIFQKIVEFFKTKLDYIIIDTPPMSQ
A0A417UUA3      P----KSE------LLLIAGSMI-YPNSTEMIASPIFQKIVEFFKTKLDYIIIDTPPMSQ
A0A1C6EUV9      A----KSE------LLLVTGTMI-YPNSTEMIASDMFYKIVDFFKDRLDYVIIDTPPMSQ
A0A173Y645      A----KSE------LLLVTGTMI-YPNSTEMIASDMFYKIVDFFKERLDYVIIDTPPMSQ
A0A374AVY6      A----KSE------LLLVTGTMI-YPNSTEMIASDMFYKIVDFFKERLDYVIIDTPPMSQ
R7BXS4          A----KSE------LLLVTGTMI-YPNSTEMIASDMFYKIVDFFKERLDYVIIDTPPMSQ
A0A143ZUX1      -EK---YG------VYILYSGKP-TDQASELLGNDLMNEFFKIVEPNFDFIIIDTPPAHV
S3FFL2          -SE---LN------FTAMSAGPI-PPNAAELLTGDRFGVLLTRLLDQYDHVVVDSPPVMG
A0A328M4V1      DGI---SK------LFFISRGKI-PPNPSELLMHARFTSLLEGLKSRFDLIIIDTPPILA
A0A5C8HCX2      -GK---GG------FDVITRGQV-PPNPSELLMRDRMRQLLEWANDHYDLVIVDTPPMLA
A0A1W1Z4C3      -TW---DN------LDVLPAGAV-PTNPCELLESPAMQELLKELEEKYDLILMDVPPINI
A0A239QN83      -VW---EN------LDILPAGSM-PSNPCELLESPTMAKLIQELEEQYDLVLMDVPPINI
A0A3R9WAA7      -DE---YK------IAVLACSKQ-LEESSEILGKRAIGSILEQLKEEYDYIILDSAPSAV
A0A1G6BLF1      -KD---TS------LEILPGGKA-ISKTSRVLSSEKVGNLIRTLQKEYDYVILDTPPCAL
R6HZX3          -PVPGVAN------LSLLAGDTR-MTSPMGILDSPKMRSLLERTRTLADYVIIDAPPAGL
A0A1W2CEA6      -NI---PG------LDLLPDGAS-IKTPLALLTSAEFDSLMATVGRDYDFVIVDTPPLGV
R7FFK6          -VT---GT------LDLLTAGTI-PPNPSELLASKQMAELLDKLKEKYDIILIDCAPVNV
A0A373MPB9      -KN---GN------FAVLTSGVL-PPNPSELLASEKMRELLEYVQHKYDYVIIDGTPLLP
A0A373L519      -KN---GN------FAVLTSGVL-PPNPSELLASEKMRELLEYVQHKYDYVIVDGTPLLP
A0A373W906      -KN---GN------FAVLTSGVL-PPNPSELLASEKMRELLEYVQHKYDYVIVDGTPLLP
A0A373VCW2      -KN---GN------FAVLTSGVL-PPNPSELLASEKMRELLEYVQHKYDYVIVDGTPLLP
W0U604          -KN---GN------FAVLTSGVL-PPNPSELLASEKMRELLEYVQHKYDYVIVDGTPLLP
A0A374B6G0      -KN---GN------FAVLTSGVL-PPNPSELLASEKMRELLEYVQHKYDYVIVDGTPLLP
A0A373VM36      -KN---GN------FAVLTSGVL-PPNPSELLASEKMRELLEYVQHKYDYVIIDGTPLLP
A0A1C5P379      -KN---GN------FAVLTSGVL-PPNPSELLASEKMRELLEYVQHKYDYVIVDGTPLLP
A0A373XXX0      -KN---GN------FAVLTSGVL-PPNPSELLASEKMRELLEYVQHKYDYVIVDGTPLLP
A0A5R9MJM9      -KN---GN------FAVLTSGVL-PPNPSELLASEKMRELLEYVQHKYDYVIVDGTPLLP
A0A356CW82      -KN---GN------FAVLTSGVL-PPNPSELLASEKMRELLEYVQHKYDYVIVDGTPLLP
R6T4X7          -KN---GN------FAVLTSGVL-PPNPSELLASEKMRELLEYVQHKYDYVIVDGTPLLP
A0A374HTV1      -KN---GN------FAVLTSGVL-PPNPSELLASEKMRELLEYVQHKYDYVIVDGTPLLP
A0A374GB66      -KN---GN------FAVLTSGVL-PPNPSELLASEKMRELLEYVQHKYDYVIVDGTPLLP
A0A374ECC6      -KN---GN------FAVLTSGVL-PPNPSELLASEKMRELLEYVQHKYDYVIVDGTPLLP
A0A374BM61      -KN---GN------FAVLTSGVL-PPNPSELLASEKMRELLEYVQHKYDYVIVDGTPLLP
A0A373UGZ4      -KN---GN------FAVLTSGVL-PPNPSELLASEKMRELLEYVQHKYDYVIVDGTPLLP
A0A373SA66      -KN---GN------FAVLTSGVL-PPNPSELLASEKMRELLEYVQHKYDYVIVDGTPLLP
A0A1C5X6X7      -KN---GN------FAVLTSGVL-PPNPSELLASEKMRELLEYVQHKYDYVIVDGTPLLP
A0A1C6JIH3      -KN---GN------FAVLTSGVL-PPNPSELLASEKMRELLEYVQHKYDYVIVDGTPLLP
A0A373PSC3      -KN---GN------FAVLTSGVL-PPNPSELLASEKMRELLEYVQHKYDYVIVDGTPLLP
A0A1K1WYK8      -VI---NN------LDLLPSGPL-PPNPSELLASENFKKLLEQFATNYDYVIIDTPPVNV
A0A1H6IUB1      -VM---EN------LDVMTAGPV-PPNPSELLASDNMGAILEKLSEEYSMILIDTPPVNV
A0A1M7L1F9      -VM---EN------LDVMTAGPV-PPNPSELLASDNMGAILEQLSSEYSMILIDTPPVNV
A0A1C6B4L6      -VM---EN------LDVMTSGPL-PPNPSELLASENMLAILDELNKKYQIIIIDTPPVNV
A0A1Q6T9P4      -VM---EN------LDVMTSGPL-PPNPSELLASENMLAILDELNKKYQIIIIDTPPVNV
A0A315Y4F9      -VM---EN------LDVMTAGPI-PPNPSELLASEMMEQMLNELSEKYDAILIDTPPVNV
A0A354K620      -VM---EN------LDIMTAGPI-PPNPSELLASDTMEQMLHDLSEKYDVILIDTPPVNV
A0A355G3J9      -EN-----------LDVITSGKC-TSYAADLLSTTRAKESISAFRKDYDYIIIDSPPINE
A0A3D2AD87      -K----PG------LNILTAGFI-PPNPSELLDSVNFEETMKLLNEQYDYVIVDTPPLNV
A0A2T5IYJ6      -ED---AN------IDVLTAGLV-PPNPLELLSSQKFMDLIAKLSETYDRIVIDSPPTLL
A0A3C0QME1      -VY---KH------LDVMPSGPI-PPNPSEMLASQQFSDILDELEPQYDYIIIDTPPINV
A0A355FYK5      -KS---LG------LFILPSGGI-TQKSSEVLDADKVRHVIEQARKEFDFIIIDTPPSRV
A0A357AQU0      -VY---KDKDCDGFVDLLTAGTI-PPNPSEILASEALKNLITEASEQYTVILIDTPPVNM
A0A3C1YJQ7      -VY---KDKDCDGFVDLLTAGTI-PPNPSEILASEALKNLITEASEQYTVILIDTPPVNM
A0A3D0JG38      -VY---KDKDCDGFVDLLTAGTI-PPNPSEILASEALKNLITEASEQYTVILIDTPPVNM
A0A3C0IHX1      -PL---PN------MDVLTAGTC-PPNPSELLASPAMKKLLEEAEQQYDYIIIDTPPVNV
R5V506          -PL---PN------MDVLTAGTC-PPNPSELLASPAMKKLLEEAEQQYDYIIIDTPPVNV
A0A352TIU5      -PL---PN------MDVLTAGTC-PPNPSELLASPAMKKLLEEAEQQYDYIIIDTPPVNV
A0A3E5FSY5      -DN---SK------FWFIGNDKP-INNPVSVLSHPDFKKFIEKMKKEFDYVIIDTPPCGI
A0A1V5S3C0      -EK---YN------MYLLISGEP-VSDPSEVLASSITQETINEAKKNFDFVIIDCAPAGV
A0A1Y3TC98      -ERIPGST------MWLLGNNEV-VKQPAPVLSSRMVKLFIREMRRKMDYVIIDSPPCTM
A0A1Q6REE0      -QATDVEG------LFVIVGNADGKADYFDAPTQARLTKLIRYARDKYDYVILDTPPCSL
R5ETF9          -QATDVEG------LFVIVGNADGKADYFDVPTQARLTKLIRYARDKYDYVILDTPPCSL
R6VAT5          -KK---NG------LYVLPGTIP-VNNASELMGSKQLADLVAALEKIFDYVVIDAPPVGI
A0A1Q6S448      -VTDPATG------LHSLLSTKS-YTDVIELLASDQLAKVVALARERYDYVIIDSPPLGF
A0A351MYR0      -VTDPATG------LHSLLSTKS-YTDVIELLASAQLAKVVALARERYDYVIIDSPPLGF
R6HPC1          -VTDPSTG------LHSLLSTKS-YTDVIELLASDQLAKVVALAREQYDYVIIDSPPLGF
A0A3D4G5Z5      -VTDPSTG------LHSLLSTKS-YTDVIELLASDQLAKVVALAREQYDYVIIDSPPLGF
A0A3D5ES03      -VTDPSTG------LHSLLSTKS-YTDVIELLASDQLAKVVALAREQYDYVIIDSPPLGF
A0A0F2P7X6      -AE---QG------IYVMPNGYI-VPNPSELLGSEKMAALLAALEKQYDYIILDTPPSYL
A0A359B487      -TE---QG------IHVMPNGYI-VPNPSELLGSEKMAALLAALEKQYDYIILDTPPAYL
A0A348P5V4      -EK---YQ------LFVLVSGVA-VENSTEILSSPKMEEIVEAAKKEFDYVIIDTAPCGI
A0A356PT74      -EK---YN------LFLLVSGKP-VFDPSELLSTDAMSDIIKSAEKEFDYIIIDTAPCGV
A0A3D5LL19      -EK---YN------LFLLVSGKP-VFDPSELLSTDAMSDIIKSAEKEFDYIIIDTAPCGV
R5MNF0          -EK---YN------LFLLVSGKP-VFDPSELLSTDAMSDIIKSAEKEFDYIIIDTAPCGV
A0A1Q9JSI0      -AN---SD------LLLVADSMI-YPNSTEMIARPLFQKVLDFFKERLDYIIIDTPPMSQ
A0A3D5TNI1      -EK---YK------IFVLAGDEC-IADPTEVLSNAKTGEFIAAAKEKFDYIIIDTPPAGI
A0A358LJD0      -EK---YK------IFVLAGDES-IADPTEVLSNAKTGEFLAAAREKFDYIIIDTPPVGI
R6I3L7          -EK---YK------MFVLAGDES-ITDPTEMLSNAKTGEFIAAAREKFDYIIIDTPPIGI
A0A3D1HXX0      -EK---YK------IFVLAGDES-ITDPTEVLSNAKTGEFIAAAREKFDYIIIDTPPVGI
A0A3D2QJB8      -EK---YK------IFVLAGDES-ITDPTEVLSNAKTGEFIAAAREKFDYIIIDTPPVGI
D4LC36          -VT---GS------LDVLTSGTI-PPNPSELLASRQMKELLETLKERYDMILIDCAPINV
R7MQJ4          -VV---KS------LDILTSGTK-PANPSELLASEQAAELLNTLSEAYDYIIVDTPPVNI
A0A1V5GLC0      -VE---DN------LDVMCAGPI-PPNPSELLASENMSQMLEKLSAEYSAIVIDTPPINV
W7V182          -VM---ED------LDIMTAGPI-PPNPSELLASSNMENILDQLSERYSVIIIDTPPVNV
                                                                  :..* .*   

A0A0H5SF45      VADALSLAKMVDGVLMVVREKSTTYPHVETALNKY-ELIGGNILGFVLNGSA--------
A0A1M6JRJ5      VADSLSFIKSTDGAILVTRENKTTYSDIDNALMKY-HYAKANILGFVLNGIS--------
A0A1M7Y1S2      VADSLSFIKSTDGAILVVRENKTTYTDIDNALMKY-RYARANILGVVLNGIS--------
A0A3D5R4X5      VTDAAILANEVDGVILVTSFGMVDYQIAKRAVELL-KNANANILGSVLNKIP--------
A0A1I4C3N6      VIDGLELADCLTSYVLVVREMVTKFEREEMIIRNI-EELKGDICGFIYNGIS--------
A0A3B9CIM7      VADALVLAATATAYILVVREGVTKFDREQMVVQML-EPVGANICGFVFNGIS--------
A0A1G9WHW8      VADALALADSVTSFVLVVRENHTKFDKEENVIRTI-EPLGADICGFIYNGIA--------
A0A1H5VAA0      VADALALADSVTSFVLVVRENHTKFDKEENVIRTI-EPLGADICGFIYNGIA--------
A0A3R6VK11      VTDALLLSHEVTAYLLVVRAGVSHMSREKSAVTLL-EQVDADICGILFNGLP--------
A0A3R6QUY7      VTDALLLSHEVTAYLLVVRAGVSHMSREKAAVTLL-EQVDADICGILFNGLP--------
A0A373K3P9      VTDALLLSHEVTAYLLVVRAGVSHMSREKSAVTLL-EQVDADICGILFNGLP--------
A0A3R6JRU5      VTDALLLSHEVTAYLLVVRAGVSHMSREKSAVTLL-EQVDADICGILFNGLP--------
A0A1C5MS04      VTDALLLSHEVTAYLLVVRAGVSHMSREKSAVTLL-EQVDADICGILFNGLP--------
A0A3C1J150      VTDALLLSHEVTAYLLVVRAGVSHMSREKSAVTLL-EQVDADICGILFNGLP--------
A0A416CXD7      VTDALLLSHEVTAYLLVVRAGVSHMSREKSAVTLL-EQVDADICGILFNGLP--------
R6XBL9          VTDALLLSHEVTAYLLVVRAGVSHMSREKSAVTLL-EQVDADICGILFNGLP--------
A0A355W5Z7      VTDALLLSHEVTAYLLVVRAGVSHMSREKAAVTLL-EQVDADICGILFNGLP--------
A0A143WVN6      GVDVEAILNYGDTSIMTVRQDWSEIGAINDFSDLL-KQNDKEFMGFVLNAFHENIL----
W6RXP9          VADAQILSTRADGTLLVIKAGETKKEATENAINLL-NKVNANVIGGILNGAED-------
W6S4G8          VADAQILSAKADGTLVVIKSGDTRINVIQDALNLL-NKVRGKILGVVLNATEDG------
A0A1G6BLB6      VADAEEMLNMVDNTLLVVRQHYANVRDINDAIDII-NSRKEKLIGCVFNNVGGNRV----
B5CSZ7          IRDAEIISETADAMLMVMRQDEVHAVAVNDTVDLL-EENGVTVIGGVLNMTKGERD----
A0A1C6G8M0      VGDAAIVSSVCDGTLLVIENGVTKKKTLCQIAAEL-EKIDTNILGVVQNMVGSKKD----
A0A416MP73      VGDAAIVASFCDGALLVIENGVTKKKTLAQMKFEM-DKVGANVIGVVQNMVGSKKD----
A0A3E4LL92      IRDAEIISETADAMLMVMCQDEVHAVAVNDAVDLL-EENGVTVIGGVLNMTKGERN----
A0A415D1L1      IRDAEIISETADAMLMVMRQDEVHAVAVNDTVDLL-EENGVTVIGGVLNMTKGERD----
A0A414P2K5      IRDAEIISETADAMLMVMRQDEVHAVAVNDTVDLL-EENGVTVIGGVLNMTKGERD----
V8C417          IRDAEIISETADAMLMVMRQDEVHAVAVNDTVDLL-EENGVTVIGGVLNMTKGERD----
A0A143XN92      TSDGESLAHIIKDTILVVRYDTMLAADLNEVADTL-NEAGSRVIGGIFNNAYSNIL----
A0A173ZYY6      IGDAQIFAHCADAVMIVSKQNYMLAEDINEVMDDF-RDKEGKVLGVVLNGVRSFSG----
A0A4Q5EHM9      IGDAQIFAHCADAVMIVSKQNYMLAEDINEVMDAF-RDKEGKVLGVVLNGVRSFSG----
A0A173SMI2      IGDAQIFAHCADAVMIVAKQNYMLAEDINEVMDAF-RDKEGKVLGVVLNGVRSFSG----
A0A174ASH7      IGDAQIFAHCADAVMIVAKQNYMLAEDINEVMDAF-RDKEGKVLGVVLNGVRSFSG----
A6BH65          IGDAQIFAHCADAVMIVAKQNYMLAEDINEVMDAF-RDKEGKVLGVVLNGVRSFSG----
R7G0D7          IGDAQIFAHCADAVMIVSKQNYMLAEDINEVMDAF-RDKEGKVLGVVLNGVRSFSG----
A0A396G6S7      VADTEELAQMTDASVLVVRQDTVLTKDINDAIDIL-NNTRGKVLGCILNGVTSQNM----
A0A3E5A223      VADTEELAQMTDASVLVVRQDTVLTKDINDAIDIL-NNTRGKVLGCILNGVTSQNM----
R7D5E6          VADTEELAQMTDASVLVVRQDTVLTKDINDAIDIL-NNTRGKVLGCILNGVTSQNM----
A0A415HQH5      VADTEELAQMTDASVLVVRQDTVLTKDINDAIDIL-NNTRGKVLGCILNGVTSQNM----
A0A414W2C6      VADTEELAQMTDASVLVVRQDTVLTKDINDAIDIL-NNTRGKVLGCILNGVTSQNM----
A5ZNE7          VADTEELAQMTDASVLVVRQDTVLTKDINDAIDIL-NNTRGKVLGCILNGVTSQNM----
A0A395X821      VADTEELAQMTDASVLVVRQDTVLTKDINDAIDIL-NNTRGKVLGCILNGVTSQNM----
A0A1C5PY68      VADTEELAQMTDASVLVVRQDTVLTKDINDAIDIL-NNTRGKVLGCILNGVTSQNM----
A0A174CJF8      VADTEELAQMTDASVLVVRQDTVLTKDINDAIDIL-NNTRGKVLGCILNGVTSQNM----
A0A564SRR2      VADTEELAQMTDASVLVVRQDTVLTKDINDAIDIL-NNTRGKVLGCILNGVTSQNM----
A0A174R7V0      VADTEELAQMTDASVLVVRQDTVLTKDINDAIDIL-NNTRGKVLGCILNGVTSQNM----
A0A373MWV2      AADAEELVELADGAVLAVRQDGVLTRDINDAIDAL-NQKEEKVIGCVFGNVYPGFG----
A0A417CE88      AADAEELVELADGAVLAVRQDGVLTRDINDAIDAL-NQKEEKVIGCVFGNVYPGFG----
A0A416Y441      AADAEELVELADGAVLAVRQDGVLTRDINDAIDAL-NQKEEKVIGCVFGNVYPGFG----
A0A357GPJ7      AADAEELVELADGAVLAVRQDGVLTRDINDAIDAL-NQKEEKVIGCVFGNVYPGFG----
A0A396PAC1      AADAEELVELADGAVLAVRQDGVLTRDINDAIDAL-NQKEEKVIGCVFGNVYPGFG----
A0A416EYU4      AADAEELVELADGAVLAVRQDGVLTRDINDAIDAL-NQKEEKVIGCVFGNVYPGFG----
A0A416SCQ2      AADAEELVELADGAVLAVRQDGVLTRDINDAIDAL-NQKEEKVIGCVFGNVYPGFG----
A0A416TGN7      AADAEELVELADGAVLAVRQDGVLTRDINDAIDAL-NQKEEKVIGCVFGNVYPGFG----
A0A417SMF6      AADAEELVELADGAVLAVRQDGVLTRDINDAIDAL-NQKEEKVIGCVFGNVYPGFG----
A0A1Y4MW77      FEDVFLLEKYGDAFVYVIKQDFVQRPRIVDCIGTL-ADSELPLLGYVFNGDSF-------
R6UHV6          VSDAEDILTLSDSSLIVVRRNVANALSINDTIDII-LASGVKLMGCVYNDAENVSI----
A0A3R9Q621      VSDVIGLVKLVDGMLIVVRQAVTSHPNIAGALSKY-ELVNANILGFVLNGVIR-------
A0A069RC75      VTDASIVSTFSDAAVIVCSSGIVDIDELKRAKAQL-EGVNARIMGAIFN-----------
A0A174F2W5      AADAEELVELADGAVLAVRQDGVLTRDINDAIDAL-NQKEEKVIGCVFGNVYPGFG----
A0A174S8E9      AADAEELVELADGAVLAVRQDGVLTRDINDAIDAL-NQKEEKVIGCVFGNVYPGFG----
A0A416ZL97      TADAEELAEYADAAVLSVRQDGALTRDINDAIDAL-NQKEEKVIGCVFGNVYPGFG----
A0A174LSK1      TADAEELAEYADAAVLSVRQDGVLTRDINDAIDAL-NQKEEKVIGCVFGNVYPGFG----
A0A373GY92      TADAEELAEYADAAVLSVRQDGVLTRDINDAIDAL-NQKEEKVIGCVFGNVYPGFG----
A0A373NZQ6      TADAEELAEYADAAVLSVRQDGVLTRDINDAIDAL-NQKEEKVIGCVFGNVYPGFG----
A0A417I9B9      TADAEELAEYADAAVLSVRQDGVLTRDINDAIDAL-NQKEEKVIGCVFGNVYPGFG----
A0A417MP97      TADAEELAEYADAAVLSVRQDGVLTRDINDAIDAL-NQKEEKVIGCVFGNVYPGFG----
A0A417WQF8      TADAEELAEYADAAVLSVRQDGVLTRDINDAIDAL-NQKEEKVIGCVFGNVYPGFG----
A0A373RZ83      TADAEELAEYADAAVLSVRQDGALTRDINDAIDAL-NQKEEKVIGCVFGNVYPGFG----
A0A416U6I1      TADAEELAEYADAAVLSVRQDGALTRDINDAIDAL-NQKEEKVIGCVFGNVYPGFG----
R7JQZ9          TADAEELAEYADAAVLSVRQDGALTRDINDAIDAL-NQKEEKVIGCVFGNVYPGFG----
A0A3B8KKL6      VTDAAILAGLADGTILVLACAGTRIDMAKRACKAL-EGVNANMIGAVLTKIDF-------
A0A2K9E6R0      VTDAAILAGLADGTILVLACAGTRIDMAKRACKAL-EGVNANMIGAVLTKIDF-------
A0A2S8RBI0      VTDAAILAGLADGTILVLACAGTRIDMAKRACKAL-EGVNANMIGAVLTKIDF-------
A0A0L6JLG6      VTDAAILTGIADGSIVVVAGGQTRIDMAKRAKKAL-TAINANIIGIVMTKIDS-------
G8LSN0          VTDAAILAGIADGTIMVFACSQTRIDMAKRAKKAL-ESVGSNILGTVLTKLDI-------
A0A1M5UYN6      VTDAQVIANEADGVILVVASNEADKDAVVRAKELL-LKVRANILGVVLNKIEF-------
A0A176JBT8      VSDSILLSGKMDGCIYVLNARKTNRDDANEKIELL-KRSSNELIGAILNEKKT-------
A0A1I5HIC6      VIDSANVAEICDGTILVIESGKISYRLIQRVLKQL-ITGKSRVLGAVLNKANIYG-----
A0A1Y3TC51      SADAEVWVSVADSVLLVVREDWADVRVINDAVDMI-SQNGTDFTGFVLNAFHREWS----
A0A1Y3T1N0      STDAEVWMEAADTVLLVVREDWSDVRIVNDTVDMI-WQSGCDFSGFILNAFHRDWI----
A0A1Y3Y8U8      STDAEVWMEAADTVLLVVREDWSDVRIVNDTVDMI-WQSGCDFSGFILNAFHRDWI----
A0A5B0BQY5      VADGISLIQAVDGCIYVTHVKKTTEDNALKYLEYL-KNVNATVLGSVLNGNKK-------
A6CLL4          VSDAAVLSSRVDGCLFLINARKTRMETAKKNLNKL-NRVGANIIGVILNKTKK-------
A0A174DL89      VADSQALSTFVDGTIIITKLGYTTKSALLNTKEIL-DGLKTNVIGVVLNNSPL-------
A0A176U8D6      VGDAAIVASFCDGALLVIENGVTKKKTLAQMKSEM-DKVGANVIGVVQNMVGSKKD----
A0A1Q6KSQ5      VGDAAIVSSVCDGTLLVIENGVTKKKTLCQIAAEL-EKIDTNILGVVQNMVGSKKD----
A0A3D3U8B3      VGDAAIVSSVCDGTLLVIENGVTKKKTLCQIAAEL-EKIDTNILGVVQNMVGSKKD----
A0A3E5FRL7      SVDAEVWMEVVDSTILVIRQDWTDIRVVNDTVDLI-WQSNCNFTGFALNMFID-------
A0A1Y4QK93      SVDAEVWMEVVDSTILLVRQDWTDIRMVNDTVDLI-WQSGCDFTGFALNMFID-------
B1C232          SVDAEVWMEVVDSTILLVRQDWTDIRIINDTVDLI-WQSDCDFIGFALNMFID-------
A0A401USI6      FADALTLATEKIGVILVIGSEESTIENCKKSKQLL-LNINATIIGIVLNKVDK-------
A0A1V4IQ10      VTDAQILSTKVDCTLVVIRSGVTNAKSVLETKSLL-TKINGLVIGTVLHRT---------
A0A1S8TRD2      VTDAQILSSKVDCTLIVIRSGLTNAKSVLETKNLL-IKVNGLVIGTVLHRT---------
G7M1U2          VTDAQILSSKVDCTLIVIRSGLTNAKSVLETKSLL-TKVSGLVIGTVLHRT---------
A0A2T6KJ75      VADTLHISANVDGCLYVVNAESSKVEQAIYSIELL-KQVQAPLIGTIIN-----------
A9KN92          VIDSANVADICDGTIMVIESNKISYRFAQRVLKQL-ITEKSKVLGAVLNKANIYGV----
A0A352MUJ1      VTDAVVLSRLVDTSFIVTEHEKTQIDDIAKIKTQI-EDVGGNIAGIVINKVQD-------
R5YI67          VTDAIVLSRLVDTSFIVTEHEKTQIEDIEKIKTQI-EDVGGNIAGIVINKVQD-------
A0A1Y0IQP5      VTDGQVLSTLCDGVLLVVRSGAVTRDHLQQAKALL-DRVGAQVIGAVLNGKKR-------
A0A4R2R7B1      VTDGQVLSTLCDGVLFVVRSGEVARDQLQQAKGLL-ERVGAQVIGAVLNGKQR-------
A0A1M6E8I2      VTDAVVMTRYIEGAILVVASGNVGVDMVKKAKKSL-EFSGVKLIGSVLNIIPT-------
A0A1Y4N105      CVDVEAIINHSDSSVMVVREDWSEIGAINDLCDVL-KQNDQDFIGFILNAFHR-------
A0A1Y4QP75      CVDVEAIINHSDSSVMVVREDWSEIGAINDLCDVL-KQNDQDFIGFILNAFHR-------
A0A3D4QRB5      VSDALVLSKYTDGVVYVVGYGDIAREMVIRAKTDL-EKVGAKILGSVINDIPL-------
A0A349DEH5      VTDTSVIAGFVDAAIIVVREDFSPYSRIRMSIEDI-DANGAEIIGCIFNADTS-------
A0A3D4T7B4      VTDTSVIAGFVDAAIIVVREDFSPYSRIRMSIEDI-DANGAEIIGCIFNADTS-------
A0A350XYC7      VTDTAVIAGFADAAIIVVREDFAPYSRIRMSIEDI-DSNGAEIIGCVFNADTS-------
R6DNR8          VTDTSVIAGFVDAAIVVVREDFAPYSRIRMSIEDI-DSNGAEIIGCIFNADTS-------
A0A355KUM5      VTDTSVIAGFVDAAIIVVREDFSPYSRIRMSIEDI-DSNGAEIIGCIFNADTS-------
R5YGY6          VTDTSVIAGFVDAAIIVVREDFSPYSRIRMSIEDI-DSNGAEIIGCIFNADTS-------
A0A0K8J554      VADALSLAKLVDGILMVVRENGTTYPNIDSALNKY-ELIDGKLLGFVINGITF-------
A0A3N1XSX6      LSDSLSLVKLSDGLIIVVREGVTSHPNVSNALEKF-RLSQGNILGFVINGVSI-------
A0A1C6G0U3      VSDSEVLSRIVDGVIVVIGCNEVDRNSVKQCKEKL-NNLNANILGCIVNKENI-------
A0A3D4LLB3      VSDPIIISTFSNAVILAIEHGKTEKELAKKAVNSL-KQVDANIIGAVFNNIPV-------
A0A0A5GPA9      VADAVALSTRVDGCVFVVNAQKTNTEQVSKSLQRL-NKVKATIFGVVLNRGVK-------
A0A271M6M4      VSDAVVLSTKVDGCIFIVNAQKTKVDQTVKSIQKL-KKVEANILGVVLNSGKE-------
A0A2V3W8U6      FSDAAILATKVDGCLLVVQSDTTKVTHIQQGLGQL-TNVNATILGAIINKKKE-------
W1UFG0          VSDCSILSRYSDGLVYIMASKESEIDYIKDSIKGL-QGI--KIIGCILNKFDA-------
A0A351SRI8      LADSLVMSTLVDGVIIVTACKETSKTLLKTVKKDL-ENVGANILGIVLNRTDT-------
A0A1V5LU59      VTDAAIIAGITDGVLLVFASSQTRIDIAKRAKKAL-ESVNSNIIGAILTKLNT-------
A0A1E3BVC3      VTDAAIVAGITDGVMLVLASGQTRIEMAKRATKSL-ESVKARFVGAVLTKLDT-------
A0A4Q0I6S0      VTDAAIVAGITDGVMLVLASGQTRIEMAKRATKSL-ESVKARFVGAVLTKLDT-------
A3DF66          VTDAAILAGITDGVILVLASGQTRIEMAKRAFKSL-ESVKARFIGAVLTKLDT-------
W4V1T8          VTDAAVIAGITDGVMLVLASGQTRIEMAKRAYKSL-ESVKAQFVGAVLTKLDT-------
A0A1I0RG99      VSDALNLVKMVDGVLIVVREGVTSHPCVSSVITKF-QFLNANILGFVLNGISL-------
A0A1I5G322      VSDALILMKAADGVLIVVREEVTSHSDITNFLSKC-KYMEIKVLGFILNGISL-------
A0A1C6ITD7      VADSQVLSTFVDGTIIVTKFGYTTKSALINTKEIL-DGLNTNVIGVLLNNSPI-------
A0A381IX63      VSDAGIVSTYSDGIILVAASNEVDDNVIKLSKDRL-VKVNANIIGCILNKFDY-------
A0A1G9IUT4      VTDAGVISNYVDSTIIVIAENEVNIDDVKVAKKKL-QQVNANILGSIFNKSSL-------
A0A1M6RWV2      VTDAAVLSKITDGTLFVVAAGQTTIELAQKAKDML-DKVQAKVIGVLVNKVNI-------
A0A143XPI5      LSDAIILAKKLDSVIMVIRYDYARVNQILRGSESL-ADTGISMIGYVLNAVESGIM----
A0A355G1X5      VTDATILSNFADACIMVVRENFSDVSRIRSVISDL-ESYKAELIGCVYNNTANRDG----
A0A0M6WXE3      IGDAQIFAQHADAVMVVARQNVTLAEDINEMMDDF-RDNHTKVLGVVLNGVMTFQSIADS
A0A348SAK2      IGDAQIFAQHADAVMVVARQNVTLAEDINEMMDDF-RDNHTKVLGVVLNGVMTFQSIADS
A0A1G9H5B9      VADPLAVSAHVAGCILMVRQHFTTHQDLRKALNAA-EMTDMNVLGFVFYGEHMHES----
R5EFZ0          ASDAEGMADLADASLLVVRQNAAAAPALNNAVASL-DGHKAKVLGCVLNNV---------
A0A1Y4H8L0      LGDAELFARYADEVLLVVRQNYMLAEDINDVLDHF-REVGCHVVGVVLNRVQSFENLTAQ
A0A0M6WYQ8      LADAPVLARYLDAAVYVIRYDYAKMRQIRMGVENI-SMSGIHMLGYVLNRDR-------S
A0A348SAK1      LADAPVLARYLDAAVYVIRYDYAKMRQIRMGVENL-SMSGIHMLGYVLNRDR-------S
A0A252F281      LSDTEVLAELVDATVLVVREDTSAVPDLNESIMIL-NESKSRLLGCVYNDKHTSPL---S
A0A1Y4QKE6      FQDVTLIQKYADALLYVVKYDFLPYQKIQNGLSIL-KE-DCCFMGYVFNIYTKKSS----
B1C231          FQDVTLIQEYSDALLYVVKYDFLPYQKIQNGLSIL-KE-DCCFMGYVFNIYTKKSS----
A0A1Y3TUL5      VAETLSLNRIAKSALFVIRFDYSNMNTIRDSLERL-DKSGINPLGCIVNRV--------K
A0A1Y4JAX2      VAETLSLNRIAKSALFVIRFDYSNMNTIRDSLERL-DKSGINPLGCIVNRV--------K
A0A1Y4T590      VAETLSLNRIAKSALFVIRFDYSNMNTIRDSLERL-DKSGINPLGCIVNRV--------K
R5B467          MTDALETGAATDCALLVVRQDASSRVSVINSLAAL-DALGVPVLGYTLNACAGRSH----
A0A1Y3T163      FQDAGMLSDYADGILYVVKYDFIPQRRIWEGLSFL-GGRSARILGYVFNSYPESVS----
A0A1Y3YCA2      FQDAGMLSDYADGILYVVKYDFIPQRRIWEGLSFL-GGRSARILGYVFNSYPESVS----
A0A1Y4L6N9      FEDAAVLSEYADGILYVVRYDFVQRRRVLDGLAEL-DGVHTRLLGYVFNGIKVGHS----
A0A173T644      FEDASLMAEFSDGICYVIRHDFVQKRRILESLAGL-ESSGTTILGYAFNGVPLHKG----
A0A1C5TSB8      FEDASLMAEFSDGICYVIRHDFVQKRRILESLAGL-ESSGTTILGYAFNGVPLHKG----
C0CIK6          FEDASLMAEFSDGICYVIRHDFVQKRRILESLAGL-ESSGTTILGYAFNGVPLHKG----
A0A1Y3WEF6      FEDASILAEQADGILYVIRYDQVQKRRILDSISGL-EDSSAPLLGYVFNGVPVHRG----
A0A417T0L2      FEDASILAEQSDGILYVIRYDQVQKRRILDSISGL-EDSKAPLLGYVFNGVPVHRG----
A0A1H9EPU3      VIDGAIIGKECDGVVMVVGSGDISYKLVERAKEQL-ETSGSRILGVALNKV--------P
A0A354IGV3      FSDAEALANLSDASVMVIRQSRSLAQEINTAADTL-ESGHSELLGCILNDVY-GMPFPLS
A0A417JMV2      AADAEELVDLADASILVVRQHTALVKDINETIGIL-NSAEGTMLGCVYNDVFHGVA---Q
B0P408          AADAEELVDLADASILVVRQHTALVKDINETISIL-NSAEGTMLGCVYNDVFHGVA---Q
D4MV82          AADAEELVDLADASILVVRQHTALVKDINETISIL-NSAEGTMLGCVYNDVFHGVA---Q
A0A415VWX5      AADAEELVDLADASILVVRQHTALVKDINETISIL-NSAEGTMLGCVYNDVFHGVA---Q
A0A173UY96      AADAEELVELADASILVVRQHTALVKDINETIGIL-NSAEGTMLGCVYNDVFHGVA---Q
A0A173QTL1      AADAEELVDLADASILVVRQHTALVKDINETIGIL-NSAEGTMLGCVYNDVFHGVA---Q
A0A174A3T7      AADAEELVDLADASILVVRQHTALVKDINETISIL-NSAEGTMLGCVYNDVFHGVA---Q
A0A174J359      AADAEELVDLADASILVVRQHTALVKDINETISIL-NSAEGTMLGCVYNDVFHGVA---Q
A0A417UUA3      AADAEELVDLADASILVVRQHTALVKDINETISIL-NSAEGTMLGCVYNDVFHGVA---Q
A0A1C6EUV9      AADAEELVDYADASILVVRQHTALVKDINEAISVL-NSGDGTMLGCVYNDVFHGIA---Q
A0A173Y645      AADAEELVDYADASILVVRQHTALVKDINEAISIL-NSGEGTMLGCVYNDVFHGIA---Q
A0A374AVY6      AADAEELVDYADASILVVRQHTALVKDINEAISIL-NSGEGTMLGCVYNDVFHGIA---Q
R7BXS4          AADAEELVDYADASILVVRQHTALVKDINEAISIL-NSGEGTMLGCVYNDVFHGIA---Q
A0A143ZUX1      VSDAMTIRRFVDATILVVRQDFTPASTIRHTLEDL-DSEETPVIGCVFNGVARPNR----
S3FFL2          LADAPLIASRVEGVIYAIESHGIRATLVKTALGRL-LNANVHIFGGVLTKFEATKS----
A0A328M4V1      VTDAAVIGHHVGTSLLVVQFGLNQPREIALAKQRF-EQNGVPIKGAIFNLVE-KRS----
A0A5C8HCX2      VSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRL-EQAGVNIKGAILNGVI-KRA----
A0A1W1Z4C3      VSDPLALSGQCAGALFVVRQNFSDHREIRRALISA-EMTGLEVLGFVFYGEN-IHQ----
A0A239QN83      VSDPLALSSQAAGTLFVVRQEFSDHREIRRALVSC-EMTGLEVLGFVFYGEK-LHQ----
A0A3R9WAA7      ISDTIELAKYADGVIYVIRQDYSRVRQIQQGMEHIVESSRAEIIGCVLNNVR-HMP----
A0A1G6BLF1      LNDATMVASQAQAAIFVVRQDYARVDRIYEGIENL-AETGVDIMGCLLNGAE-VGL----
R6HZX3          LADAAVLCRSADQVLYVVRYDSFARNQVADAMHSV-SGRGAELTGYVINGRP-TRR----
A0A1W2CEA6      VVDAAEISRRCDGSLLVLEYNRTHGKALKEAVRLL-RRTGTPVLGCILNKTA-VSR----
R7FFK6          VSDVAGMANSIAGVVMVVHYGTTTYAETEDAVKQL-ELANCNVLGFVLNEVV-HKH----
A0A373MPB9      VTDVMSLADEVAGVLLIARYGRTTYQEIEESMKKL-EIGDCNLLGFVLNDIS-AKN----
A0A373L519      VTDVMSLADEVAGVLLIARYGRTTYQEIEESMKKL-EIGDCNLLGFVLNDIS-AKN----
A0A373W906      VTDVMSLADEVAGVLLIARYGRTTYQEIEESMKKL-EIGDCNLLGFVLNDIS-AKN----
A0A373VCW2      VTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKL-EIGDCNLLGFVLNDIS-AKN----
W0U604          VTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKL-EIGDCNLLGFVLNDIS-AKN----
A0A374B6G0      VTDVMSLADEVAGVLLIARYGRTTYQEIEESMKKL-EIGDCNLLGFVLNDIS-AKN----
A0A373VM36      VTDVMSLADEVAGVLLIARYGRTTYQEIEESMKKL-EIGDCNLLGFVLNDIS-AKN----
A0A1C5P379      VTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKL-EIGDCNLLGFVLNDIS-AKN----
A0A373XXX0      VTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKL-EIGDCNLLGFVLNDIS-AKN----
A0A5R9MJM9      VTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKL-EIGDCNLLGFVLNDIS-AKN----
A0A356CW82      VTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKL-EIGDCNLLGFVLNDIS-TKN----
R6T4X7          VTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKL-EIGDCNLLGFVLNDIS-AKN----
A0A374HTV1      VTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKL-EIGDCNLLGFVLNDIS-AKN----
A0A374GB66      VTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKL-EIGDCNLLGFVLNDIS-AKN----
A0A374ECC6      VTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKL-EIGDCNLLGFVLNDIS-AKN----
A0A374BM61      VTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKL-EIGDCNLLGFVLNDIS-AKN----
A0A373UGZ4      VTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKL-EIGDCNLLGFVLNDIS-AKN----
A0A373SA66      VTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKL-EIGDCNLLGFVLNDIS-AKN----
A0A1C5X6X7      VTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKL-EIGDCNLLGFVLNDIS-AKN----
A0A1C6JIH3      VTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKL-EIGDCNLLGFVLNDIS-AKN----
A0A373PSC3      VTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKL-EIGDCNLLGFVLNDIS-AKN----
A0A1K1WYK8      VSDAMVMKDSISGIMLVIRYAMTTYEELANCMKQI-ELAKVNMLGFVLNDVH-HNH----
A0A1H6IUB1      VTDAMELAKYVSGIVLVLRYGVTTNEDAEDAIKKI-EFAKMNMLGFIMNDIK-MKK----
A0A1M7L1F9      VTDAMELAKYISGIIVVLRYGVTTNEDVDAAIKKV-EFAQMNMLGFIMNDVK-IKK----
A0A1C6B4L6      VTDAMELAKCVSGIVVVLCYGRTTTEDIEAVVKKM-EFSKVNMLGFILNSIK-NKR----
A0A1Q6T9P4      VTDAMELAKCVSGIVVVLRYGRTTTEDIEAVVKKM-DFSKVNMLGFILNGIK-NKR----
A0A315Y4F9      VTDAMELAKSVSGIVLVVRYGRTTDEDVDNVFKRV-ELANMNLLGFILNGVK-SKH----
A0A354K620      VTDAMELAKMISGIVLVVRYGKTTDEDVENVFKRI-ELAKMNLLGFIMNGIN-TKR----
A0A355G3J9      VSDAMTLVDVVNGYIMCSIAGYSDAEETKQAVLSL-EQIGAKIFGFVVIGVD-FKV----
A0A3D2AD87      VTDSMIIAPQTGGVILIVRDGYTPHYSIKKVLGDM-DFANINILGAVMNGSH-PKN----
A0A2T5IYJ6      VSDSLVMSKAVDAVLYVIRSDTTAQNAARTGVNRL-RAAKAPLIGVILNKVN-MKR----
A0A3C0QME1      VSDTLVMGKILSGLLLVVKYGQTTFEELQDAINHA-NLSELNVIGFVVNNIS-RKG----
A0A355FYK5      VSDSMVMSSLADSLVFVIRKDHAKIADINETLEEI-AGTNIDIAGAVFTMND-EES----
A0A357AQU0      VSDVYGLSDSIAGIVLVAEFEGTTSYDIKHALEGA-KLSNVNVLGVILNAVA-GSS----
A0A3C1YJQ7      VSDVYGLSDSIAGIVLVAEFEGTTSYDIKHALEGA-KLSNVNVLGVILNAVA-GSS----
A0A3D0JG38      VSDVYGLSDSIAGIVLVAEFEGTTSYDIKHALEGA-KLSNVNVLGVILNAVA-GSS----
A0A3C0IHX1      VSDALGLSDCIGGILMVARYYVTTTKELETALQAI-SVTGATVLGLVLTEVD-FKQ----
R5V506          VSDALGLSDCIGGILMVARYYVTTTKELETALQAI-SVTGATVLGLVLTEVD-FKQ----
A0A352TIU5      VSDALGLSDCIGGILMVARYYVTTTKELETALQAI-SVTGATVLGLVLTEVD-FKQ----
A0A3E5FSY5      FQDVTLIQEYSDALLYVVKYDFLPYQKIQNGLSIL-KE-DCCFMGYVFNIYT-KKS----
A0A1V5S3C0      VADATIVSNYCDAVLFVVAENKTSLREIEYAVSDL-STTKAEVFGCIYNNAR-RGI----
A0A1Y3TC98      FQDAGILADHADAVLYVVKYDELPLQKIQEGLSFL-GSQRTPFTGYVFNNF---------
A0A1Q6REE0      LTDAAEAAEAAEAGLMVIRQDYASRDQILDGAQRL-SDSRLPIIGCALNNV---------
R5ETF9          LTDAAEAAEAAEAGLMVIRQDYASRDQILDGAQRL-SDSRLPIIGCALNNV---------
R6VAT5          VSDALEMKDYVGGLVFVVRQDYAKVSKILDSISLF-GYSKIKILGCIFNMAS-GVL----
A0A1Q6S448      FSDSELLSDLSDASVLVVRQDTVPAPEINDAIDAL-RAGKAEFLGCILNDM---------
A0A351MYR0      FSDSELLSDLSDASVLVVRQDTVPAPEINDAIDAL-RAGKAEFLGCILNDM---------
R6HPC1          FSDSELLSDLSDASVLVVRQDTVPAPEINDAIDAL-RAGKAEFLGCILNDM---------
A0A3D4G5Z5      FSDSELLSDLSDASVLVVRQDTVPAPEINDAIDAL-RAGKAEFLGCILNDM---------
A0A3D5ES03      FSDSELLSDLSDASVLVVRQDTVPAPEINDAIDAL-RAGKAEFLGCILNDM---------
A0A0F2P7X6      LTDAVALSVYADGVILVVKQGCAKVDVINSAQAAF-ENAGVRIIGCILNGIK-YNQ----
A0A359B487      LTDAVALSVYANGVILVVKQGCAKVDVINSAQAAF-ENAGVRIIGCILNGIK-YNQ----
A0A348P5V4      IADASILAGYADTIVLVVKQDYASARRIKRAVDNF-ENSGTEIIGCIFNNSE-NGM----
A0A356PT74      VADASILSSYADGILLVVRNDMVASRRIKRAVENL-ENSGTKLVGCIYNDTE-SGM----
A0A3D5LL19      VADASILSSYADGILLVVRNDMVASRRIKRAVENL-ENSGTKLVGCIYNDTE-SGM----
R5MNF0          VADASILSSYADGILLVVRNDMVASRRIKRAVENL-ENSGTKLVGCIYNDTE-SGM----
A0A1Q9JSI0      AADAEEMVDLVDASILVVKQHTALVKDINEAIAIL-KSGEGTMLGCVYN-----------
A0A3D5TNI1      VADAAICAKYTDSSIFVIREDRFPVPAILEAVSDL-TQGGTDLAGCVYNIST-DRS----
A0A358LJD0      VADAAICAKYTDSSIFVIREDVFPVPAILEAVSDL-TQGGSDLAGCVYNIST-DRS----
R6I3L7          VADAAICAKYTDSSIFVIREDVFPVPAILEAVSDL-TQGGTDLAGCVYNIST-DRS----
A0A3D1HXX0      VADAAICAKYTDSSIFVIREDVFPVPAILEAVSDL-TQGGTDLAGCVYNIST-DRS----
A0A3D2QJB8      VADAAICAKYTDSSIFVIREDVFPVPAILEAVSDL-TQGGTDLAGCVYNIST-DRS----
D4LC36          VSDVAGLSQEIAGVVMVVHYGFTTYPELDDAVNRL-ALANCNVLGFAVNEV---SS----
R7MQJ4          VSDAMGLSNSIAGILMVLRYGRTTFDDLDNAMKKI-ELADVKMLGFILNDIS-KKH----
A0A1V5GLC0      VTDAMELARNISGIILVTSYGKTTVDDMDSAMKKI-EFANMNLLGFILNGI---KI----
W7V182          VTDAMELANKVSGIIMVARYAKTTTDDIDNAMKKI-EFAKMNMLGFILNDI---KT----
                  :                                         *               

A0A0H5SF45      ---------LTQENKSK--SSYYYY------------------QRNND------------
A0A1M6JRJ5      ---------EKELGGHK--SKYYYS------------------TKKNKN-----------
A0A1M7Y1S2      ---------ERDLGGYK--SKYYYY------------------NPDNK------------
A0A3D5R4X5      ---------MGRGGYSYYKYYSSYY------------------GEYEKT-----------
A0A1I4C3N6      ---------TKSEDYNY--KKAAEK------------------YGFVDT-----------
A0A3B9CIM7      ---------MKSQDYHY--K--HYA------------------KDYKY------------
A0A1G9WHW8      ---------VNSREYKY--NTKKYG------------------KEYGYG-----------
A0A1H5VAA0      ---------VNSREYKY--NTKKYG------------------KEYGYG-----------
A0A3R6VK11      ---------PKSKDCNY--RLQQYW------------------QEYKQQ-----------
A0A3R6QUY7      ---------PKSKDCNY--RLQQYW------------------QEYKQQ-----------
A0A373K3P9      ---------PKSKDCNY--RLQQYW------------------QEYKQQ-----------
A0A3R6JRU5      ---------PKSKDCNY--RLQQYW------------------QEYKQQ-----------
A0A1C5MS04      ---------PKSKDCNY--RLQQYW------------------QEYKQQ-----------
A0A3C1J150      ---------PKSKDCNY--RLQQYW------------------QEYKQQ-----------
A0A416CXD7      ---------PKSKDCNY--RLQQYW------------------QEYKQQ-----------
R6XBL9          ---------PKSKDCNY--RLQQYW------------------QEYKQQ-----------
A0A355W5Z7      ---------PKSKDCNY--RLQQYW------------------QEYKQQ-----------
A0A143WVN6      -------IEKSYGQYPY--QNY-----------------------QSRS-----------
W6RXP9          ---------RKNKTYYY----------------------------YGE------------
W6S4G8          ---------RLSKMYQY----------------------------YGEE-----------
A0A1G6BLB6      -------S-LTHGGQGY--GEYGNY------------------G-YGRY-----------
B5CSZ7          ---------TSKDRDGY--RKY-----------------------YNEN-----------
A0A1C6G8M0      -------S-SYYGKGNY--GYY-----------------------YGNN-----------
A0A416MP73      -------S-SYYGKGNY--GYY-----------------------YGNY-----------
A0A3E4LL92      ---------ISKDRESY--GKY-----------------------YNEN-----------
A0A415D1L1      ---------TSKDRYGY--SKY-----------------------YKEN-----------
A0A414P2K5      ---------TSKDRDGY--RKY-----------------------YNEN-----------
V8C417          ---------TSKDRDGY--RKY-----------------------YNEN-----------
A0A143XN92      -------ERIGMEQYGR--KTS-----------------------Y--------------
A0A173ZYY6      -------LVDSPVGHYY--GKYSKY------------------GRYGNY-----------
A0A4Q5EHM9      -------LVDSPVGHYY--GKYSKY------------------GRYGNY-----------
A0A173SMI2      -------LVDSPVGHYY--GKYSKY------------------GRYGNY-----------
A0A174ASH7      -------LVDSPVGHYY--GKYSKY------------------GRYGNY-----------
A6BH65          -------LVDSPVGHYY--GKYSKY------------------GRYGNY-----------
R7G0D7          -------LVDSPVGHYY--GKYSKY------------------GRYGNY-----------
A0A396G6S7      ---------AGSGHYGY--GGH-----------------------YGKR-----------
A0A3E5A223      ---------AGSGHYGY--GGH-----------------------YGKR-----------
R7D5E6          ---------AGSGHYGY--GGH-----------------------YGKR-----------
A0A415HQH5      ---------AGSGHYGY--GGH-----------------------YGKR-----------
A0A414W2C6      ---------AGSGHYGC--GGH-----------------------YGKR-----------
A5ZNE7          ---------AGSGHYGC--GGH-----------------------YGKR-----------
A0A395X821      ---------AGSGHYGY--GGH-----------------------YGKR-----------
A0A1C5PY68      ---------AGSGHYGY--GGH-----------------------YGKR-----------
A0A174CJF8      ---------AGSGHYGY--GGH-----------------------YGKR-----------
A0A564SRR2      ---------AGSGHYGY--GGH-----------------------YGKR-----------
A0A174R7V0      ---------AGSGHYGY--GGH-----------------------YGKR-----------
A0A373MWV2      -------E-RIGGSYGY--GYG-----------------------YGAY-----------
A0A417CE88      -------E-RIGGSYGY--GYG-----------------------YGAY-----------
A0A416Y441      -------E-RIGGSYGY--GYG-----------------------YGAY-----------
A0A357GPJ7      -------E-RIGGSYGY--GYG-----------------------YGAY-----------
A0A396PAC1      -------E-RIGGSYGY--GYG-----------------------YGAY-----------
A0A416EYU4      -------E-RIGGSYGY--GYG-----------------------YGAY-----------
A0A416SCQ2      -------E-RIGGSYGY--GYG-----------------------YGAY-----------
A0A416TGN7      -------E-RIGGSYGY--GYG-----------------------YGAY-----------
A0A417SMF6      -------E-RIGGSYGY--GYG-----------------------YGAY-----------
A0A1Y4MW77      ---------TFRDYSRY--GYR-----------------------YYNK-----------
R6UHV6          -------VGRGSVYSDY--QYG-----------------------KYGY-----------
A0A3R9Q621      ---------KQGLKSKS--GYY-----------------------YRSK-----------
A0A069RC75      ---------RASEASSY--YSY-----------------------YGK------------
A0A174F2W5      -------E-RIGGSYGY--GYG-----------------------YGAY-----------
A0A174S8E9      -------E-RIGGSYGY--GYG-----------------------YGAY-----------
A0A416ZL97      -------E-RIGNSYGY--GYG-----------------------YGTY-----------
A0A174LSK1      -------E-RIGNSYGY--GYG-----------------------YGTY-----------
A0A373GY92      -------E-RIGNSYGY--GYG-----------------------YGTY-----------
A0A373NZQ6      -------E-RIGNSYGY--GYG-----------------------YGTY-----------
A0A417I9B9      -------E-RIGNSYGY--GYG-----------------------YGTY-----------
A0A417MP97      -------E-RIGNSYGY--GYG-----------------------YGTY-----------
A0A417WQF8      -------E-RIGNSYGY--GYG-----------------------YGTY-----------
A0A373RZ83      -------E-RIGNSYGY--GYG-----------------------YGTY-----------
A0A416U6I1      -------E-RIGNSYGY--GYG-----------------------YGTY-----------
R7JQZ9          -------E-RIGNSYGY--GYG-----------------------YGTY-----------
A0A3B8KKL6      ---------RKTSYYGY--SYS-----------------------YQYD-----------
A0A2K9E6R0      ---------RKTSYYGY--SYS-----------------------YQYD-----------
A0A2S8RBI0      ---------RKTSYYGY--SYS-----------------------YQYD-----------
A0A0L6JLG6      ---------RSAYYHYY--KYE--------------------------------------
G8LSN0          ---------GRARYYSY--NYE-----------------------YK-------------
A0A1M5UYN6      ---------SKGKGYWY--NYE-----------------------YYYS-----------
A0A176JBT8      ---------HKSNPHYY--YGG-----------------------YMG------------
A0A1I5HIC6      ---------KGYKKNYY--GKY-----------------------YGR------------
A0A1Y3TC51      -------RPAGRQEYSY--GRA-----------------------YRSQ-----------
A0A1Y3T1N0      -------SQSSGYGYDY-------------------------------------------
A0A1Y3Y8U8      -------SQSSGYGYDY-------------------------------------------
A0A5B0BQY5      ---------GLNRHS---------------------------------------------
A6CLL4          ---------EKSQTYYY-------------------------------------------
A0A174DL89      ---------DSSVNYYY--Q----------------------------------------
A0A176U8D6      -------S-SYYGKGNY--GYY-----------------------YGNY-----------
A0A1Q6KSQ5      -------S-SYYGKGNY--GYY--------------------------Y-----------
A0A3D3U8B3      -------S-SYY------------------------------------------------
A0A3E5FRL7      ---------NDSHHNDY--GYS-----------------------YYDY-----------
A0A1Y4QK93      ---------DEIRHNDY--GYS-----------------------YYDY-----------
B1C232          ---------DEIRHNDY--GYS-----------------------YYDY-----------
A0A401USI6      ---------RSFIGYGY--DYY-----------------------SYDK-----------
A0A1V4IQ10      ---------EYNKDTYY--YSS-----------------------HSSS-----------
A0A1S8TRD2      ---------EYNKDTYY--YRS-----------------------HGSS-----------
G7M1U2          ---------EYNKDTYY--YRS-----------------------HGSS-----------
A0A2T6KJ75      ---------KSKGSVRS--YSY-----------------------YN-------------
A9KN92          -------GYNKKYYGKY--YSH-----------------------VYAN-----------
A0A352MUJ1      ---------DKASKGNY--YYM-----------------------NESD-----------
R5YI67          ---------EKSSKGNY--YYM-----------------------NEED-----------
A0A1Y0IQP5      ---------KGKE--QT--YSY-----------------------YASP-----------
A0A4R2R7B1      ---------KRSE--PA--YSY-----------------------YAAP-----------
A0A1M6E8I2      ---------NHSKGYNS--YYY-----------------------YYEE-----------
A0A1Y4N105      ---------SIFSNDSY--SHY-----------------------GDYQ-----------
A0A1Y4QP75      ---------SIFSNDSY--SHY-----------------------GDYQ-----------
A0A3D4QRB5      ---------DTLVGYGS--YYY-----------------------YYGS-----------
A0A349DEH5      ---------NVSKTGRY--GKR-----------------------YGHY-----------
A0A3D4T7B4      ---------NVSKTGRY--GKR-----------------------YGHY-----------
A0A350XYC7      ---------NVSNSSRY--GRH-----------------------YGKK-----------
R6DNR8          ---------NLSKSSRY--GRR-----------------------YGHY-----------
A0A355KUM5      ---------NLSKTSRY--GRR-----------------------YG-------------
R5YGY6          ---------NLSKTSRY--GRR-----------------------YGGY-----------
A0A0K8J554      ---------KQGEKSKS--KYY-----------------------YNVN-----------
A0A3N1XSX6      ---------NQTKKSKY--YYY-----------------------QYGD-----------
A0A1C6G0U3      ---------KKGN--------Y-----------------------YY-------------
A0A3D4LLB3      ---------SKQNNYYY--YKS-----------------------YC-------------
A0A0A5GPA9      ---------ETNA-------HY-----------------------YY-------------
A0A271M6M4      ---------SKRT-------SY-----------------------YY-------------
A0A2V3W8U6      ---------RKND-INY--YHY-----------------------GTR------------
W1UFG0          ---------KSVSYYNY--SNY-----------------------SYYY-----------
A0A351SRI8      ---------NKSK---Y--YGH-----------------------YYQ------------
A0A1V5LU59      ---------GRGS---Y--YSY-----------------------KYK------------
A0A1E3BVC3      ---------ERTG---Y--YSY-----------------------KYE------------
A0A4Q0I6S0      ---------ERTG---Y--YSY-----------------------KYE------------
A3DF66          ---------ERTG--YY--YSY-----------------------KYE------------
W4V1T8          ---------ERTG---Y--YSY-----------------------KYD------------
A0A1I0RG99      ---------NQQERSKY--RYY-----------------------N--------------
A0A1I5G322      ---------NQEKKSKY--HYY-----------------------YYNN-----------
A0A1C6ITD7      ---------NSSS-------NY-----------------------YYKE-----------
A0A381IX63      ---------KNHNEYEY--YGY-----------------------YYSA-----------
A0A1G9IUT4      ---------YKSE--CY--YGY-----------------------YYEN-----------
A0A1M6RWV2      ---------EKRR--YQ--YYY-----------------------YYLE-----------
A0A143XPI5      -------SYGY-----YAYRYGYYHK-----GYRYYSINNKD-MELHNK-----------
A0A355G1X5      -------------------LLGLYSKS----SYGYKSYHSYG-YGYGFE-----------
A0A0M6WXE3      PVGDHYSRYS---------RYGRYGR-------------------YGKY-----------
A0A348SAK2      PVGDHYSRYS---------RYGRYGR-------------------YGKY-----------
A0A1G9H5B9      ---------GYYSRKYYRKYYKNYYSKRT--TRGSTLGSNLE-TARGST-----------
R5EFZ0          ----------YATQLSTGQSYGGYSKYSHYGHYG----------NYGSS-----------
A0A1Y4H8L0      TVGRYAGRYGYGYGYGYG-AYAQYAN-----DRG--------------------------
A0A0M6WYQ8      TGGGYGYGYGYYGRYRYG-RYGRYG------RYG----------GYRHY-----------
A0A348SAK1      TGGGYGYGYGYYGRYRYG-RYGRYG------RYG----------GYRHY-----------
A0A252F281      RLPIYGKYADY---YGYRGYYGNYGK-------------------YGKS-----------
A0A1Y4QKE6      -------------------EYGHHSY-----GYN-------R-YGYVK------------
B1C231          -------------------EYGHYSY-----GYN-------Q-YRYSKG-----------
A0A1Y3TUL5      TLGDKL-NNNY--------NYE---------SEGSASRRGRG-SSSGKS-----------
A0A1Y4JAX2      TLGDKL-NNNY--------NYE---------SEGSASRRGRG-SSSGKS-----------
A0A1Y4T590      TLGDKLNNNNY--------NYE---------SEGSASRRGRG-SSSGKS-----------
R5B467          ------GGYGYGFGYGYG-GYG-YGY-----GYG-----GYG-YGYGSG-----------
A0A1Y3T163      -------EYGYGR-YGYG-RYGRYGY-------G-------K-YGYGGG-----------
A0A1Y3YCA2      -------EYGYGR-YGYG-RYGRYGY-------G-------K-YGYGGG-----------
A0A1Y4L6N9      -------GYGYGYGYGYGYNYG-YGYR----RDG-------E-YGDEKY-----------
A0A173T644      -------RYGY---YGYG-RYG-YGY------YG-------K-YGYGEQ-----------
A0A1C5TSB8      -------RYGY---YGYG-RYG-YGY------YG-------K-YGYGEQ-----------
C0CIK6          -------RYGY---YGYG-RYG-YGY------YG-------K-YGYGEQ-----------
A0A1Y3WEF6      -------GYGY---YGYG-RYG-YGYY----GYG-------S-YGYGER-----------
A0A417T0L2      -------GYGY---YGYG-RYG-YGYY----GYG-------S-YGYGKK-----------
A0A1H9EPU3      MDKGKGYYGKYYGGY-YGGYYG-YGNY----SYG--------------------------
A0A354IGV3      LLDNDSYSYGYGDLHNYGRYRK-YGKYGKYGGYGRYGGYGRY-GDYGAA-----------
A0A417JMV2      TARNYGYKYAYGSGYGYGSKYG-YGNHGY--GYG----YGYG-YGYGYG-----------
B0P408          TARNYGYKYAYGSGYGYGNKYG-YGNHGY--GYG----YGYG-YGYGYG-----------
D4MV82          TARNYGYKYAYGSGYGYGNKYG-YGNHGY--GYG----YGYG-YGYGYG-----------
A0A415VWX5      TARNYGYKYAYGSGYGYGNKYG-YGNH----GYG----YGYG-YGYGYG-----------
A0A173UY96      TARNYGYKYAYGSGYGYGSKYG-YGNHGY--GYG----YGYG-YGYGYG-----------
A0A173QTL1      TARNYGYKYAYGSGYGYGSKYG-YGNHGY--GYG----YGYG-YGYGYG-----------
A0A174A3T7      TARNYGYKYAYGSGYGYGNKYG-YGNHGY--GYG----YGYG-YGYGYG-----------
A0A174J359      TARNYGYKYAYGSGYGYGSKYG-YGNH----GYG----YGYG-YGYGYG-----------
A0A417UUA3      TARNYGYKYAYGSGYGYGSKYG-YGNH----GYG----YGYG-YGYGYG-----------
A0A1C6EUV9      TARNYGYRYAYGSGSSYGYGYG-YGSK-Y--GYGGKYGYGYG-YGYGRS-----------
A0A173Y645      TARNYGYRYAYGSGSSYGYGYG-YGNK-Y--GYGGK--YGYG-YGYGRS-----------
A0A374AVY6      TARNYGYRYAYGSGSSYGYGYG-YGNK-Y--G------YGYG-YGYGRS-----------
R7BXS4          TARNYGYRYAYGSGSSYGYGYG-YGNK-Y--G------YGYG-YGYGRS-----------
A0A143ZUX1      -------LLGYGRYSSYYYDY---------------------------------------
S3FFL2          -------NSGYGYEYG---------------------------YGYGRD-----------
A0A328M4V1      -------AGYYAYAYY---------------------------T-YAAA-----------
A0A5C8HCX2      -------STAYSYGYN---------------------------Y-YGYS-----------
A0A1W1Z4C3      -------GRYYSKRSQRGYQY-------------------YNKYDTRIQ-----------
A0A239QN83      -------GKYYSKRSQRGYEY-------------------YNKYDTRSR-----------
A0A3R9WAA7      -------AGY---------------------GYGYGYYGKYGRKSYYGK-----------
A0A1G6BLF1      -------TGTGYSKSYSYARYGYG-------HGEKRYGYGYGGYGIKED-----------
R6HZX3          -------GRGYGYGYD---------------------RYGYGKYGYGTK-----------
A0A1W2CEA6      -------IGKSGYSYYYGGK-----------------------NGYGKQ-----------
R7FFK6          -------SAGYYSNYKYKYKY------------------KYD-YQYRTE-----------
A0A373MPB9      -------GSHYGYKYSYKYKY------------------DYS-YKYGGK-----------
A0A373L519      -------GSHYGYKYSYKYKY------------------DYS-YKYGGK-----------
A0A373W906      -------GSHYG----YKYKY------------------DYS-YKYGGK-----------
A0A373VCW2      -------GSHYGYKYSYKYKY------------------DYS-YKYGGK-----------
W0U604          -------GSHYGYKYSYKYKY------------------DYS-YKYGGK-----------
A0A374B6G0      -------GSHYGYKYSYKYKY------------------DYS-YKYGGK-----------
A0A373VM36      -------GSHYGYKYSYKYKY------------------DYS-YKYGGK-----------
A0A1C5P379      -------GSHYRYKYSYKYKY------------------DYS-YKYGGK-----------
A0A373XXX0      -------GSHYG----YKYKY------------------DYS-YKYGGK-----------
A0A5R9MJM9      -------GSHYGYKYNYKYKY------------------DYS-YKYGGK-----------
A0A356CW82      -------GSHYGYKYNYKYKY------------------DYS-YKYGGK-----------
R6T4X7          -------GSHYGYKYSYKYKY------------------DYS-YKYGGK-----------
A0A374HTV1      -------GSHYGYKYSYKYKY------------------DYS-YKYGGK-----------
A0A374GB66      -------GSHYGYKYSYKYKY------------------DYS-YKYGGK-----------
A0A374ECC6      -------GSHYGYKYSYKYKY------------------DYS-YKYGGK-----------
A0A374BM61      -------GSHYGYKYSYKYKY------------------DYS-YKYGGK-----------
A0A373UGZ4      -------GSHYGYKYSYKYKY------------------DYS-YKYGGK-----------
A0A373SA66      -------GSHYGYKYSYKYKY------------------DYS-YKYGGK-----------
A0A1C5X6X7      -------GSHYGYKYSYKYKY------------------DYS-YKYGGK-----------
A0A1C6JIH3      -------GSHYGYKYSYKYKY------------------DYS-YKYGGK-----------
A0A373PSC3      -------GSHYGYKYNYKYKY------------------DYS-YKYGGK-----------
A0A1K1WYK8      -------GANYYNY---KYKYKKY-------GYGYGSY-GYG-YTYGNN-----------
A0A1H6IUB1      -------SGYYSSKYKGKYYYKK--------GYGYGGYGGY----YGSK-----------
A0A1M7L1F9      -------AGYY-SKYKNKYYYKK--------GYGYGGY-GY----YGSK-----------
A0A1C6B4L6      -------SGRYYSKY--KYDYKR--------G--Y----GY----YGEK-----------
A0A1Q6T9P4      -------SGRYYSKY--KYDYKR--------G--Y----GY----YGEK-----------
A0A315Y4F9      -------AG-YYSK------YGK--------GKYY----GY----YGAK-----------
A0A354K620      -------AG-YYAKG--KYYYKK--------GYGY----GY----YGEK-----------
A0A355G3J9      -------EQYGRYKR-------------------------YGKYGYRSY-----------
A0A3D2AD87      -------KNKYIYRKY--SYG----------YYGSYYKYDYHKNGYNYD-----------
A0A2T5IYJ6      -------AAQYYGTYSSYYA--------------------YGDYVYGSS-----------
A0A3C0QME1      -------SGH-YYSYKYKYKY----------RY-KSYEYHYV-SHSEDSMTSTPKLSMRE
A0A355FYK5      -------RGRILNKGGSGSRY-------------YKRYYRYG-GKYGYG-----------
A0A357AQU0      -------TGYGYKKYGYKYGY----------KYGYKYGYRYG-YGYGNN-----------
A0A3C1YJQ7      -------TGYGYKKYGYKYGY----------KYGYKYGYRYG-YGYGNN-----------
A0A3D0JG38      -------TGYGYKKYGYKYGY----------KYGYKYGYRYG-YGYGNN-----------
A0A3C0IHX1      -------GGY-YKKYYKKGSY-----------------YTYG-NGNGNG-----------
R5V506          -------GGY-YKKYYKKGSY-----------------YTYG-NGNGNG-----------
A0A352TIU5      -------GGY-YKKYYKKGSY-----------------YTYG-NENGNG-----------
A0A3E5FSY5      -------SE-------------------------------YGHYSYGYN-----------
A0A1V5S3C0      -------LSMAGDTRGGYFSR----------SYSYSYSKSYG-ADYGQE-----------
A0A1Y3TC98      -------PEGPGEYGY--SRY----------GYG---RYGYGKYGYGRY-----------
A0A1Q6REE0      -------RRGLSGSKE--YGY----------GYGYGYGYGYG-YGYGSK-----------
R5ETF9          -------RKSLSGSKE--YGY----------GYGYGYGYGYG-YGYGSK-----------
R6VAT5          -------STRGYGRYG--YNS----------YGGYGSYGSYGRYGYGYG-----------
A0A1Q6S448      -----------AHLTA--YSA----------GYGYGCGY-YG-YGYGKK-----------
A0A351MYR0      -----------SHLTA--YSA----------GYGYGYGY-YG-YGYGKK-----------
R6HPC1          -----------AHLTA--YSA----------GYGYGYGY-YG-YGYGKK-----------
A0A3D4G5Z5      -----------VHLTA--YSA----------GYGYGYGY-YG-YGYGKK-----------
A0A3D5ES03      -----------AHLTA--YSA----------GYGYGYGY-YG-YGYGKK-----------
A0A0F2P7X6      -------LGAFYQSQN--YER----------FLG---DYYKD-YALTNK-----------
A0A359B487      -------LGAFYQSRN--YER----------FLG---DYYKN-YALTNK-----------
A0A348P5V4      -------SN------S--KIY----------GRK------YG-YGYGYG-----------
A0A356PT74      -------PKRFMSSYN--KKY----------GYG------YG-YGYGYG-----------
A0A3D5LL19      -------PKRFMSSYN--KKY----------GYG------YG-YGYGYG-----------
R5MNF0          -------PNRFMSSYN--KKY----------GYG------YG-YGYGYG-----------
A0A1Q9JSI0      --------DVFPGFAE--TAK----------AYGYKYGYGYG-YGYGYG-----------
A0A3D5TNI1      -------RGGYGSYSV--SRR----------RYGYGYGRHYG-YGYGKH-----------
A0A358LJD0      -------KGGYGNYSI--SRR----------RYG------YG-YSYGKR-----------
R6I3L7          -------KGGYGNYSI--SRR----------GYG------YG-YGYGKH-----------
A0A3D1HXX0      -------KGGYGNYSI--SRR----------RYG------YG-YGYGKH-----------
A0A3D2QJB8      -------KGGYGNYSI--SSR----------RYG------YG-YGYGKH-----------
D4LC36          -------KHGSGYYSN--YKY----------KYK------YK-YDYQYG-----------
R7MQJ4          -------GSYSKYGYN--YKS----------HYY------DS-YGYGEE-----------
A0A1V5GLC0      -------KKNGKYYSN--YK------------YR------SV-YGYGND-----------
W7V182          -------GRSGKYYSK--YR------------YD------KG-YGYGVK-----------
                                                                            

A0A0H5SF45      ------------------------------------------------------------
A0A1M6JRJ5      ------------------------------------------------------------
A0A1M7Y1S2      ------------------------------------------------------------
A0A3D5R4X5      ------------------------------------------------------------
A0A1I4C3N6      ------------------------------------------------------------
A0A3B9CIM7      ------------------------------------------------------------
A0A1G9WHW8      ------------------------------------------------------------
A0A1H5VAA0      ------------------------------------------------------------
A0A3R6VK11      ------------------------------------------------------------
A0A3R6QUY7      ------------------------------------------------------------
A0A373K3P9      ------------------------------------------------------------
A0A3R6JRU5      ------------------------------------------------------------
A0A1C5MS04      ------------------------------------------------------------
A0A3C1J150      ------------------------------------------------------------
A0A416CXD7      ------------------------------------------------------------
R6XBL9          ------------------------------------------------------------
A0A355W5Z7      ------------------------------------------------------------
A0A143WVN6      ------------------------------------------------------------
W6RXP9          ------------------------------------------------------------
W6S4G8          ------------------------------------------------------------
A0A1G6BLB6      ------------------------------------------------------------
B5CSZ7          ------------------------------------------------------------
A0A1C6G8M0      ------------------------------------------------------------
A0A416MP73      ------------------------------------------------------------
A0A3E4LL92      ------------------------------------------------------------
A0A415D1L1      ------------------------------------------------------------
A0A414P2K5      ------------------------------------------------------------
V8C417          ------------------------------------------------------------
A0A143XN92      ------------------------------------------------------------
A0A173ZYY6      ------------------------------------------------------------
A0A4Q5EHM9      ------------------------------------------------------------
A0A173SMI2      ------------------------------------------------------------
A0A174ASH7      ------------------------------------------------------------
A6BH65          ------------------------------------------------------------
R7G0D7          ------------------------------------------------------------
A0A396G6S7      ------------------------------------------------------------
A0A3E5A223      ------------------------------------------------------------
R7D5E6          ------------------------------------------------------------
A0A415HQH5      ------------------------------------------------------------
A0A414W2C6      ------------------------------------------------------------
A5ZNE7          ------------------------------------------------------------
A0A395X821      ------------------------------------------------------------
A0A1C5PY68      ------------------------------------------------------------
A0A174CJF8      ------------------------------------------------------------
A0A564SRR2      ------------------------------------------------------------
A0A174R7V0      ------------------------------------------------------------
A0A373MWV2      ------------------------------------------------------------
A0A417CE88      ------------------------------------------------------------
A0A416Y441      ------------------------------------------------------------
A0A357GPJ7      ------------------------------------------------------------
A0A396PAC1      ------------------------------------------------------------
A0A416EYU4      ------------------------------------------------------------
A0A416SCQ2      ------------------------------------------------------------
A0A416TGN7      ------------------------------------------------------------
A0A417SMF6      ------------------------------------------------------------
A0A1Y4MW77      ------------------------------------------------------------
R6UHV6          ------------------------------------------------------------
A0A3R9Q621      ------------------------------------------------------------
A0A069RC75      ------------------------------------------------------------
A0A174F2W5      ------------------------------------------------------------
A0A174S8E9      ------------------------------------------------------------
A0A416ZL97      ------------------------------------------------------------
A0A174LSK1      ------------------------------------------------------------
A0A373GY92      ------------------------------------------------------------
A0A373NZQ6      ------------------------------------------------------------
A0A417I9B9      ------------------------------------------------------------
A0A417MP97      ------------------------------------------------------------
A0A417WQF8      ------------------------------------------------------------
A0A373RZ83      ------------------------------------------------------------
A0A416U6I1      ------------------------------------------------------------
R7JQZ9          ------------------------------------------------------------
A0A3B8KKL6      ------------------------------------------------------------
A0A2K9E6R0      ------------------------------------------------------------
A0A2S8RBI0      ------------------------------------------------------------
A0A0L6JLG6      ------------------------------------------------------------
G8LSN0          ------------------------------------------------------------
A0A1M5UYN6      ------------------------------------------------------------
A0A176JBT8      ------------------------------------------------------------
A0A1I5HIC6      ------------------------------------------------------------
A0A1Y3TC51      ------------------------------------------------------------
A0A1Y3T1N0      ------------------------------------------------------------
A0A1Y3Y8U8      ------------------------------------------------------------
A0A5B0BQY5      ------------------------------------------------------------
A6CLL4          ------------------------------------------------------------
A0A174DL89      ------------------------------------------------------------
A0A176U8D6      ------------------------------------------------------------
A0A1Q6KSQ5      ------------------------------------------------------------
A0A3D3U8B3      ------------------------------------------------------------
A0A3E5FRL7      ------------------------------------------------------------
A0A1Y4QK93      ------------------------------------------------------------
B1C232          ------------------------------------------------------------
A0A401USI6      ------------------------------------------------------------
A0A1V4IQ10      ------------------------------------------------------------
A0A1S8TRD2      ------------------------------------------------------------
G7M1U2          ------------------------------------------------------------
A0A2T6KJ75      ------------------------------------------------------------
A9KN92          ------------------------------------------------------------
A0A352MUJ1      ------------------------------------------------------------
R5YI67          ------------------------------------------------------------
A0A1Y0IQP5      ------------------------------------------------------------
A0A4R2R7B1      ------------------------------------------------------------
A0A1M6E8I2      ------------------------------------------------------------
A0A1Y4N105      ------------------------------------------------------------
A0A1Y4QP75      ------------------------------------------------------------
A0A3D4QRB5      ------------------------------------------------------------
A0A349DEH5      ------------------------------------------------------------
A0A3D4T7B4      ------------------------------------------------------------
A0A350XYC7      ------------------------------------------------------------
R6DNR8          ------------------------------------------------------------
A0A355KUM5      ------------------------------------------------------------
R5YGY6          ------------------------------------------------------------
A0A0K8J554      ------------------------------------------------------------
A0A3N1XSX6      ------------------------------------------------------------
A0A1C6G0U3      ------------------------------------------------------------
A0A3D4LLB3      ------------------------------------------------------------
A0A0A5GPA9      ------------------------------------------------------------
A0A271M6M4      ------------------------------------------------------------
A0A2V3W8U6      ------------------------------------------------------------
W1UFG0          ------------------------------------------------------------
A0A351SRI8      ------------------------------------------------------------
A0A1V5LU59      ------------------------------------------------------------
A0A1E3BVC3      ------------------------------------------------------------
A0A4Q0I6S0      ------------------------------------------------------------
A3DF66          ------------------------------------------------------------
W4V1T8          ------------------------------------------------------------
A0A1I0RG99      ------------------------------------------------------------
A0A1I5G322      ------------------------------------------------------------
A0A1C6ITD7      ------------------------------------------------------------
A0A381IX63      ------------------------------------------------------------
A0A1G9IUT4      ------------------------------------------------------------
A0A1M6RWV2      ------------------------------------------------------------
A0A143XPI5      ------------------------------------------------------------
A0A355G1X5      ------------------------------------------------------------
A0A0M6WXE3      ------------------------------------------------------------
A0A348SAK2      ------------------------------------------------------------
A0A1G9H5B9      ------------------------------------------------------------
R5EFZ0          ------------------------------------------------------------
A0A1Y4H8L0      ------------------------------------------------------------
A0A0M6WYQ8      ------------------------------------------------------------
A0A348SAK1      ------------------------------------------------------------
A0A252F281      ------------------------------------------------------------
A0A1Y4QKE6      ------------------------------------------------------------
B1C231          ------------------------------------------------------------
A0A1Y3TUL5      ------------------------------------------------------------
A0A1Y4JAX2      ------------------------------------------------------------
A0A1Y4T590      ------------------------------------------------------------
R5B467          ------------------------------------------------------------
A0A1Y3T163      ------------------------------------------------------------
A0A1Y3YCA2      ------------------------------------------------------------
A0A1Y4L6N9      ------------------------------------------------------------
A0A173T644      ------------------------------------------------------------
A0A1C5TSB8      ------------------------------------------------------------
C0CIK6          ------------------------------------------------------------
A0A1Y3WEF6      ------------------------------------------------------------
A0A417T0L2      ------------------------------------------------------------
A0A1H9EPU3      ------------------------------------------------------------
A0A354IGV3      ------------------------------------------------------------
A0A417JMV2      ------------------------------------------------------------
B0P408          ------------------------------------------------------------
D4MV82          ------------------------------------------------------------
A0A415VWX5      ------------------------------------------------------------
A0A173UY96      ------------------------------------------------------------
A0A173QTL1      ------------------------------------------------------------
A0A174A3T7      ------------------------------------------------------------
A0A174J359      ------------------------------------------------------------
A0A417UUA3      ------------------------------------------------------------
A0A1C6EUV9      ------------------------------------------------------------
A0A173Y645      ------------------------------------------------------------
A0A374AVY6      ------------------------------------------------------------
R7BXS4          ------------------------------------------------------------
A0A143ZUX1      ------------------------------------------------------------
S3FFL2          ------------------------------------------------------------
A0A328M4V1      ------------------------------------------------------------
A0A5C8HCX2      ------------------------------------------------------------
A0A1W1Z4C3      ------------------------------------------------------------
A0A239QN83      ------------------------------------------------------------
A0A3R9WAA7      ------------------------------------------------------------
A0A1G6BLF1      ------------------------------------------------------------
R6HZX3          ------------------------------------------------------------
A0A1W2CEA6      ------------------------------------------------------------
R7FFK6          ------------------------------------------------------------
A0A373MPB9      ------------------------------------------------------------
A0A373L519      ------------------------------------------------------------
A0A373W906      ------------------------------------------------------------
A0A373VCW2      ------------------------------------------------------------
W0U604          ------------------------------------------------------------
A0A374B6G0      ------------------------------------------------------------
A0A373VM36      ------------------------------------------------------------
A0A1C5P379      ------------------------------------------------------------
A0A373XXX0      ------------------------------------------------------------
A0A5R9MJM9      ------------------------------------------------------------
A0A356CW82      ------------------------------------------------------------
R6T4X7          ------------------------------------------------------------
A0A374HTV1      ------------------------------------------------------------
A0A374GB66      ------------------------------------------------------------
A0A374ECC6      ------------------------------------------------------------
A0A374BM61      ------------------------------------------------------------
A0A373UGZ4      ------------------------------------------------------------
A0A373SA66      ------------------------------------------------------------
A0A1C5X6X7      ------------------------------------------------------------
A0A1C6JIH3      ------------------------------------------------------------
A0A373PSC3      ------------------------------------------------------------
A0A1K1WYK8      ------------------------------------------------------------
A0A1H6IUB1      ------------------------------------------------------------
A0A1M7L1F9      ------------------------------------------------------------
A0A1C6B4L6      ------------------------------------------------------------
A0A1Q6T9P4      ------------------------------------------------------------
A0A315Y4F9      ------------------------------------------------------------
A0A354K620      ------------------------------------------------------------
A0A355G3J9      ------------------------------------------------------------
A0A3D2AD87      ------------------------------------------------------------
A0A2T5IYJ6      ------------------------------------------------------------
A0A3C0QME1      DAPQEVPAETKAVETTAPIEETPAEVVEESAPIEETPAEVVEESAPIEETPAEVVEESAP
A0A355FYK5      ------------------------------------------------------------
A0A357AQU0      ------------------------------------------------------------
A0A3C1YJQ7      ------------------------------------------------------------
A0A3D0JG38      ------------------------------------------------------------
A0A3C0IHX1      ------------------------------------------------------------
R5V506          ------------------------------------------------------------
A0A352TIU5      ------------------------------------------------------------
A0A3E5FSY5      ------------------------------------------------------------
A0A1V5S3C0      ------------------------------------------------------------
A0A1Y3TC98      ------------------------------------------------------------
A0A1Q6REE0      ------------------------------------------------------------
R5ETF9          ------------------------------------------------------------
R6VAT5          ------------------------------------------------------------
A0A1Q6S448      ------------------------------------------------------------
A0A351MYR0      ------------------------------------------------------------
R6HPC1          ------------------------------------------------------------
A0A3D4G5Z5      ------------------------------------------------------------
A0A3D5ES03      ------------------------------------------------------------
A0A0F2P7X6      ------------------------------------------------------------
A0A359B487      ------------------------------------------------------------
A0A348P5V4      ------------------------------------------------------------
A0A356PT74      ------------------------------------------------------------
A0A3D5LL19      ------------------------------------------------------------
R5MNF0          ------------------------------------------------------------
A0A1Q9JSI0      ------------------------------------------------------------
A0A3D5TNI1      ------------------------------------------------------------
A0A358LJD0      ------------------------------------------------------------
R6I3L7          ------------------------------------------------------------
A0A3D1HXX0      ------------------------------------------------------------
A0A3D2QJB8      ------------------------------------------------------------
D4LC36          ------------------------------------------------------------
R7MQJ4          ------------------------------------------------------------
A0A1V5GLC0      ------------------------------------------------------------
W7V182          ------------------------------------------------------------
                                                                            

A0A0H5SF45      ------------------------------------------------------------
A0A1M6JRJ5      -----------------------------------------------------NGIVH--
A0A1M7Y1S2      ------------------------------------------------------------
A0A3D5R4X5      -----------------------------------------------------SRKKRKK
A0A1I4C3N6      -----------------------------------------------------SAKVVSA
A0A3B9CIM7      ------------------------------------------------------------
A0A1G9WHW8      -----------------------------------------------------LKYSASK
A0A1H5VAA0      -----------------------------------------------------LKYSASK
A0A3R6VK11      -----------------------------------------------------NGEAV--
A0A3R6QUY7      -----------------------------------------------------NGEAV--
A0A373K3P9      -----------------------------------------------------NGEAV--
A0A3R6JRU5      -----------------------------------------------------NGEAV--
A0A1C5MS04      -----------------------------------------------------NGEAV--
A0A3C1J150      -----------------------------------------------------NGEAV--
A0A416CXD7      -----------------------------------------------------NGEAV--
R6XBL9          -----------------------------------------------------NGEAV--
A0A355W5Z7      -----------------------------------------------------NGEAV--
A0A143WVN6      -----------------------------------------------------VRKAEE-
W6RXP9          ------------------------------------------------------------
W6S4G8          -----------------------------------------------------HKKKGDK
A0A1G6BLB6      -----------------------------------------------------HQYDHSE
B5CSZ7          -----------------------------------------------------AKIENAG
A0A1C6G8M0      -----------------------------------------------------QNKK---
A0A416MP73      -----------------------------------------------------GNNQNKN
A0A3E4LL92      -----------------------------------------------------AK-KNAG
A0A415D1L1      -----------------------------------------------------AKIENAG
A0A414P2K5      -----------------------------------------------------AKIENAG
V8C417          -----------------------------------------------------AKIENAG
A0A143XN92      ------------------------------------------------------------
A0A173ZYY6      -----------------------------------------------------GRSKGM-
A0A4Q5EHM9      -----------------------------------------------------GRSKGM-
A0A173SMI2      -----------------------------------------------------GRSKGM-
A0A174ASH7      -----------------------------------------------------GRSKGM-
A6BH65          -----------------------------------------------------GRSKGM-
R7G0D7          -----------------------------------------------------GRSKGM-
A0A396G6S7      -----------------------------------------------------A------
A0A3E5A223      -----------------------------------------------------A------
R7D5E6          -----------------------------------------------------A------
A0A415HQH5      -----------------------------------------------------A------
A0A414W2C6      -----------------------------------------------------A------
A5ZNE7          -----------------------------------------------------A------
A0A395X821      -----------------------------------------------------A------
A0A1C5PY68      -----------------------------------------------------A------
A0A174CJF8      -----------------------------------------------------A------
A0A564SRR2      -----------------------------------------------------A------
A0A174R7V0      -----------------------------------------------------A------
A0A373MWV2      -----------------------------------------------------SRAER--
A0A417CE88      -----------------------------------------------------SRAER--
A0A416Y441      -----------------------------------------------------SRAER--
A0A357GPJ7      -----------------------------------------------------SRAER--
A0A396PAC1      -----------------------------------------------------SRAER--
A0A416EYU4      -----------------------------------------------------SRAER--
A0A416SCQ2      -----------------------------------------------------SRAER--
A0A416TGN7      -----------------------------------------------------SRAER--
A0A417SMF6      -----------------------------------------------------SRAER--
A0A1Y4MW77      -----------------------------------------------------YGYRHYS
R6UHV6          -----------------------------------------------------GKYGKYG
A0A3R9Q621      -----------------------------------------------------DD-----
A0A069RC75      ------------------------------------------------------------
A0A174F2W5      -----------------------------------------------------SRAER--
A0A174S8E9      -----------------------------------------------------SRAER--
A0A416ZL97      -----------------------------------------------------SRAER--
A0A174LSK1      -----------------------------------------------------SRAER--
A0A373GY92      -----------------------------------------------------SRAER--
A0A373NZQ6      -----------------------------------------------------SRAER--
A0A417I9B9      -----------------------------------------------------SRAER--
A0A417MP97      -----------------------------------------------------SRAER--
A0A417WQF8      -----------------------------------------------------SRAER--
A0A373RZ83      -----------------------------------------------------SRAER--
A0A416U6I1      -----------------------------------------------------SRAER--
R7JQZ9          -----------------------------------------------------SRAER--
A0A3B8KKL6      ------------------------------------------------------------
A0A2K9E6R0      ------------------------------------------------------------
A0A2S8RBI0      ------------------------------------------------------------
A0A0L6JLG6      ------------------------------------------------------------
G8LSN0          ------------------------------------------------------------
A0A1M5UYN6      -----------------------------------------------------YGSSNKH
A0A176JBT8      ------------------------------------------------------------
A0A1I5HIC6      ------------------------------------------------------------
A0A1Y3TC51      -----------------------------------------------------DMPGEGL
A0A1Y3T1N0      ------------------------------------------------------------
A0A1Y3Y8U8      ------------------------------------------------------------
A0A5B0BQY5      ------------------------------------------------------------
A6CLL4          ------------------------------------------------------------
A0A174DL89      ------------------------------------------------------------
A0A176U8D6      -----------------------------------------------------GNNQNKK
A0A1Q6KSQ5      -----------------------------------------------------GNNQNKK
A0A3D3U8B3      ------------------------------------------------------------
A0A3E5FRL7      -----------------------------------------------------KTHRHES
A0A1Y4QK93      -----------------------------------------------------KNHRHES
B1C232          -----------------------------------------------------KTHRHES
A0A401USI6      -----------------------------------------------------EKSSRLR
A0A1V4IQ10      -----------------------------------------------------SNTIKSL
A0A1S8TRD2      -----------------------------------------------------NKITRSL
G7M1U2          -----------------------------------------------------NKTTRSL
A0A2T6KJ75      ------------------------------------------------------------
A9KN92          -----------------------------------------------------DYDENGN
A0A352MUJ1      -----------------------------------------------------IKRRKTR
R5YI67          -----------------------------------------------------IKRKKRK
A0A1Y0IQP5      -----------------------------------------------------AGDRDD-
A0A4R2R7B1      -----------------------------------------------------EGDPHD-
A0A1M6E8I2      -----------------------------------------------------SET----
A0A1Y4N105      -----------------------------------------------------RRTTSNL
A0A1Y4QP75      -----------------------------------------------------RRTTSNL
A0A3D4QRB5      -----------------------------------------------------DSDGKGK
A0A349DEH5      -----------------------------------------------------GKSGR--
A0A3D4T7B4      -----------------------------------------------------GKSGR--
A0A350XYC7      -----------------------------------------------------GT-----
R6DNR8          -----------------------------------------------------GKSGRYG
A0A355KUM5      ------------------------------------------------------------
R5YGY6          -----------------------------------------------------GK--RYG
A0A0K8J554      -----------------------------------------------------QDD----
A0A3N1XSX6      -----------------------------------------------------SND----
A0A1C6G0U3      ------------------------------------------------------------
A0A3D4LLB3      ------------------------------------------------------------
A0A0A5GPA9      ------------------------------------------------------------
A0A271M6M4      ------------------------------------------------------------
A0A2V3W8U6      ------------------------------------------------------------
W1UFG0          -----------------------------------------------------GE-----
A0A351SRI8      ------------------------------------------------------------
A0A1V5LU59      ------------------------------------------------------------
A0A1E3BVC3      ------------------------------------------------------------
A0A4Q0I6S0      ------------------------------------------------------------
A3DF66          ------------------------------------------------------------
W4V1T8          ------------------------------------------------------------
A0A1I0RG99      ------------------------------------------------------------
A0A1I5G322      -----------------------------------------------------YND----
A0A1C6ITD7      ------------------------------------------------------------
A0A381IX63      -----------------------------------------------------EGNKRKK
A0A1G9IUT4      -----------------------------------------------------E------
A0A1M6RWV2      -----------------------------------------------------D------
A0A143XPI5      -----------------------------------------------------STSQEK-
A0A355G1X5      -----------------------------------------------------DDEESAG
A0A0M6WXE3      -----------------------------------------------------TNNKEV-
A0A348SAK2      -----------------------------------------------------ANNKEV-
A0A1G9H5B9      -----------------------------------------------------LQTNQGS
R5EFZ0          -----------------------------------------------------GSRK---
A0A1Y4H8L0      ------------------------------------------------------------
A0A0M6WYQ8      -----------------------------------------------------SRYEKQF
A0A348SAK1      -----------------------------------------------------SRYEKQL
A0A252F281      -----------------------------------------------------SRKREG-
A0A1Y4QKE6      -----------------------------------------------------DEYKE--
B1C231          -----------------------------------------------------GEYKE--
A0A1Y3TUL5      -----------------------------------------------------SSRH---
A0A1Y4JAX2      -----------------------------------------------------SSRH---
A0A1Y4T590      -----------------------------------------------------SSRH---
R5B467          -----------------------------------------------------ENRERNG
A0A1Y3T163      -----------------------------------------------------SYRQPYG
A0A1Y3YCA2      -----------------------------------------------------SYRQPYG
A0A1Y4L6N9      -----------------------------------------------------ANREK--
A0A173T644      -----------------------------------------------------DEETQS-
A0A1C5TSB8      -----------------------------------------------------DEETQS-
C0CIK6          -----------------------------------------------------DEETQS-
A0A1Y3WEF6      -----------------------------------------------------KNRERIS
A0A417T0L2      -----------------------------------------------------QESKKKN
A0A1H9EPU3      ------------------------------------------------------------
A0A354IGV3      -----------------------------------------------------AQAEAEN
A0A417JMV2      -----------------------------------------------------SRTKKGN
B0P408          -----------------------------------------------------SRTKKGN
D4MV82          -----------------------------------------------------SRTKKGN
A0A415VWX5      -----------------------------------------------------SRTKKGN
A0A173UY96      -----------------------------------------------------SRTKKGN
A0A173QTL1      -----------------------------------------------------SRTKKGN
A0A174A3T7      -----------------------------------------------------SRTKKGN
A0A174J359      -----------------------------------------------------SRTKKGN
A0A417UUA3      -----------------------------------------------------SRTKKGN
A0A1C6EUV9      -----------------------------------------------------SRQSQKE
A0A173Y645      -----------------------------------------------------SRQSKQE
A0A374AVY6      -----------------------------------------------------SRQSKQE
R7BXS4          -----------------------------------------------------SRQSKQE
A0A143ZUX1      -----------------------------------------------------RESDSSQ
S3FFL2          -----------------------------------------------------EKAGD--
A0A328M4V1      -----------------------------------------------------KS-----
A0A5C8HCX2      -----------------------------------------------------YSEKE--
A0A1W1Z4C3      -----------------------------------------------------ASSQKLS
A0A239QN83      -----------------------------------------------------VIG----
A0A3R9WAA7      -----------------------------------------------------NTGIAAN
A0A1G6BLF1      -----------------------------------------------------EEKKSEN
R6HZX3          -----------------------------------------------------YGYGKNG
A0A1W2CEA6      -----------------------------------------------------ETKAGRH
R7FFK6          -----------------------------------------------------PSETEST
A0A373MPB9      -----------------------------------------------------DTSAES-
A0A373L519      -----------------------------------------------------DTSAES-
A0A373W906      -----------------------------------------------------DTSAES-
A0A373VCW2      -----------------------------------------------------DASAES-
W0U604          -----------------------------------------------------DASAES-
A0A374B6G0      -----------------------------------------------------DASAES-
A0A373VM36      -----------------------------------------------------DASAES-
A0A1C5P379      -----------------------------------------------------DTSAES-
A0A373XXX0      -----------------------------------------------------DASAES-
A0A5R9MJM9      -----------------------------------------------------DTSAES-
A0A356CW82      -----------------------------------------------------DTSAES-
R6T4X7          -----------------------------------------------------DTSAES-
A0A374HTV1      -----------------------------------------------------DTSAES-
A0A374GB66      -----------------------------------------------------DTSAES-
A0A374ECC6      -----------------------------------------------------DASAES-
A0A374BM61      -----------------------------------------------------DASAES-
A0A373UGZ4      -----------------------------------------------------DTSAES-
A0A373SA66      -----------------------------------------------------DTSAES-
A0A1C5X6X7      -----------------------------------------------------DTSAES-
A0A1C6JIH3      -----------------------------------------------------DASAES-
A0A373PSC3      -----------------------------------------------------DASAES-
A0A1K1WYK8      -----------------------------------------------------PTE----
A0A1H6IUB1      -----------------------------------------------------PET-DDD
A0A1M7L1F9      -----------------------------------------------------PETSDDD
A0A1C6B4L6      -----------------------------------------------------TDK----
A0A1Q6T9P4      -----------------------------------------------------TDT----
A0A315Y4F9      -----------------------------------------------------PEL----
A0A354K620      -----------------------------------------------------PEP----
A0A355G3J9      -----------------------------------------------------RYSKEYG
A0A3D2AD87      ------------------------------------------------------------
A0A2T5IYJ6      -----------------------------------------------------KKKD---
A0A3C0QME1      IEETPAEVVEESAPIEETPAELLEAENLLEEIPLQDAEEAPVKSAIEEAPVALTEETAVE
A0A355FYK5      -----------------------------------------------------DGKYGYG
A0A357AQU0      -----------------------------------------------------NEKKA--
A0A3C1YJQ7      -----------------------------------------------------NEKKA--
A0A3D0JG38      -----------------------------------------------------NEKKA--
A0A3C0IHX1      -----------------------------------------------------SKKKSHS
R5V506          -----------------------------------------------------SKKKSHS
A0A352TIU5      -----------------------------------------------------SKKKSHS
A0A3E5FSY5      -----------------------------------------------------Q------
A0A1V5S3C0      -----------------------------------------------------SNTRRK-
A0A1Y3TC98      ---------------------------------------------------------GYG
A0A1Q6REE0      -----------------------------------------------------SRQEKK-
R5ETF9          -----------------------------------------------------SRQEKK-
R6VAT5          -----------------------------------------------------Q------
A0A1Q6S448      -----------------------------------------------------Y------
A0A351MYR0      -----------------------------------------------------Y------
R6HPC1          -----------------------------------------------------Y------
A0A3D4G5Z5      -----------------------------------------------------Y------
A0A3D5ES03      -----------------------------------------------------Y------
A0A0F2P7X6      -----------------------------------------------------PAQEAAA
A0A359B487      -----------------------------------------------------PAQEAAA
A0A348P5V4      ------------------------------------------------------------
A0A356PT74      -----------------------------------------------------SNQK---
A0A3D5LL19      -----------------------------------------------------SNQK---
R5MNF0          -----------------------------------------------------SNQK---
A0A1Q9JSI0      -------------------------------------------------------YGSYG
A0A3D5TNI1      -------------------------------------------------------YG---
A0A358LJD0      -----------------------------------------------------YGYG---
R6I3L7          -------------------------------------------------------YG---
A0A3D1HXX0      -------------------------------------------------------YG---
A0A3D2QJB8      -------------------------------------------------------YG---
D4LC36          -----------------------------------------------------SAKQAE-
R7MQJ4          -----------------------------------------------------TSEDKD-
A0A1V5GLC0      -----------------------------------------------------PEQDDDD
W7V182          -----------------------------------------------------YEEDSD-
                                                                            

A0A0H5SF45      ---------------------------------------
A0A1M6JRJ5      ---------------------------------------
A0A1M7Y1S2      ---------------------------------------
A0A3D5R4X5      RSDVID---------------------------------
A0A1I4C3N6      KKKVAAR--------------------------------
A0A3B9CIM7      ---------------------------------------
A0A1G9WHW8      ---------------------------------------
A0A1H5VAA0      ---------------------------------------
A0A3R6VK11      ---------------------------------------
A0A3R6QUY7      ---------------------------------------
A0A373K3P9      ---------------------------------------
A0A3R6JRU5      ---------------------------------------
A0A1C5MS04      ---------------------------------------
A0A3C1J150      ---------------------------------------
A0A416CXD7      ---------------------------------------
R6XBL9          ---------------------------------------
A0A355W5Z7      ---------------------------------------
A0A143WVN6      ---------------------------------------
W6RXP9          ---------------------------------------
W6S4G8          VS-------------------------------------
A0A1G6BLB6      REGE-----------------------------------
B5CSZ7          E--------------------------------------
A0A1C6G8M0      ---------------------------------------
A0A416MP73      KFTKAIVN-------------------------------
A0A3E4LL92      E--------------------------------------
A0A415D1L1      E--------------------------------------
A0A414P2K5      E--------------------------------------
V8C417          E--------------------------------------
A0A143XN92      ---------------------------------------
A0A173ZYY6      ---------------------------------------
A0A4Q5EHM9      ---------------------------------------
A0A173SMI2      ---------------------------------------
A0A174ASH7      ---------------------------------------
A6BH65          ---------------------------------------
R7G0D7          ---------------------------------------
A0A396G6S7      ---------------------------------------
A0A3E5A223      ---------------------------------------
R7D5E6          ---------------------------------------
A0A415HQH5      ---------------------------------------
A0A414W2C6      ---------------------------------------
A5ZNE7          ---------------------------------------
A0A395X821      ---------------------------------------
A0A1C5PY68      ---------------------------------------
A0A174CJF8      ---------------------------------------
A0A564SRR2      ---------------------------------------
A0A174R7V0      ---------------------------------------
A0A373MWV2      ---------------------------------------
A0A417CE88      ---------------------------------------
A0A416Y441      ---------------------------------------
A0A357GPJ7      ---------------------------------------
A0A396PAC1      ---------------------------------------
A0A416EYU4      ---------------------------------------
A0A416SCQ2      ---------------------------------------
A0A416TGN7      ---------------------------------------
A0A417SMF6      ---------------------------------------
A0A1Y4MW77      YYNNEKKAAK-----------------------------
R6UHV6          STAE-----------------------------------
A0A3R9Q621      ---------------------------------------
A0A069RC75      ---------------------------------------
A0A174F2W5      ---------------------------------------
A0A174S8E9      ---------------------------------------
A0A416ZL97      ---------------------------------------
A0A174LSK1      ---------------------------------------
A0A373GY92      ---------------------------------------
A0A373NZQ6      ---------------------------------------
A0A417I9B9      ---------------------------------------
A0A417MP97      ---------------------------------------
A0A417WQF8      ---------------------------------------
A0A373RZ83      ---------------------------------------
A0A416U6I1      ---------------------------------------
R7JQZ9          ---------------------------------------
A0A3B8KKL6      ---------------------------------------
A0A2K9E6R0      ---------------------------------------
A0A2S8RBI0      ---------------------------------------
A0A0L6JLG6      ---------------------------------------
G8LSN0          ---------------------------------------
A0A1M5UYN6      KNTKSKRLKQKSI--------------------------
A0A176JBT8      ---------------------------------------
A0A1I5HIC6      ---------------------------------------
A0A1Y3TC51      TGRSGEHTARGE-RG------------------------
A0A1Y3T1N0      -GNYGKNIRRGDQRG------------------------
A0A1Y3Y8U8      -GDYGKNIRRGDQRG------------------------
A0A5B0BQY5      ---------------------------------------
A6CLL4          ---------------------------------------
A0A174DL89      ---------------------------------------
A0A176U8D6      ---------------------------------------
A0A1Q6KSQ5      ---------------------------------------
A0A3D3U8B3      ---------------------------------------
A0A3E5FRL7      R--------------------------------------
A0A1Y4QK93      R--------------------------------------
B1C232          R--------------------------------------
A0A401USI6      NKSGRKKRNNNEKPNPINI--------------------
A0A1V4IQ10      LG-------------------------------------
A0A1S8TRD2      LG-------------------------------------
G7M1U2          LG-------------------------------------
A0A2T6KJ75      ---------------------------------------
A9KN92          ---------------------------------------
A0A352MUJ1      SRR------------------------------------
R5YI67          RSEHH----------------------------------
A0A1Y0IQP5      ---------------------------------------
A0A4R2R7B1      ---------------------------------------
A0A1M6E8I2      ---------------------------------------
A0A1Y4N105      HK-------------------------------------
A0A1Y4QP75      HK-------------------------------------
A0A3D4QRB5      KSRNKKRRAQHSA--------------------------
A0A349DEH5      YGYGSYGYGYGQSKK------------------------
A0A3D4T7B4      YGYGSYGYGYGQSKK------------------------
A0A350XYC7      YGYGGYG-GYGQSSK------------------------
R6DNR8          YGYGSYGYGYGQSKK------------------------
A0A355KUM5      ---------------------------------------
R5YGY6          YGSYGYGYGQSSSKK------------------------
A0A0K8J554      ---------------------------------------
A0A3N1XSX6      ---------------------------------------
A0A1C6G0U3      ---------------------------------------
A0A3D4LLB3      ---------------------------------------
A0A0A5GPA9      ---------------------------------------
A0A271M6M4      ---------------------------------------
A0A2V3W8U6      ---------------------------------------
W1UFG0          ---------------------------------------
A0A351SRI8      ---------------------------------------
A0A1V5LU59      ---------------------------------------
A0A1E3BVC3      ---------------------------------------
A0A4Q0I6S0      ---------------------------------------
A3DF66          ---------------------------------------
W4V1T8          ---------------------------------------
A0A1I0RG99      ---------------------------------------
A0A1I5G322      ---------------------------------------
A0A1C6ITD7      ---------------------------------------
A0A381IX63      RKNK-----------------------------------
A0A1G9IUT4      ---------------------------------------
A0A1M6RWV2      ---------------------------------------
A0A143XPI5      ---------------------------------------
A0A355G1X5      ------------------------------------NEE
A0A0M6WXE3      ---------------------------------------
A0A348SAK2      ---------------------------------------
A0A1G9H5B9      TQGSNLETTRGSTHINTQETENESADHRSVDK-------
R5EFZ0          ---------------------------------------
A0A1Y4H8L0      ------------------------------------EQQ
A0A0M6WYQ8      -----------------DEPEEETGAVNQKEVFTETKEN
A0A348SAK1      -----------------DEPVAETGAVNQKEVFTETKET
A0A252F281      ---------------------------------------
A0A1Y4QKE6      ---------------------------------------
B1C231          ---------------------------------------
A0A1Y3TUL5      ---------------------------------------
A0A1Y4JAX2      ---------------------------------------
A0A1Y4T590      ---------------------------------------
R5B467          -------------------------------------AD
A0A1Y3T163      -------------------------QKNAYEEEEAENG-
A0A1Y3YCA2      -------------------------QKNAY-EEEAGNG-
A0A1Y4L6N9      ---------------------------------------
A0A173T644      ---------------------------------------
A0A1C5TSB8      ---------------------------------------
C0CIK6          ---------------------------------------
A0A1Y3WEF6      -------------------------AEEDRGRNRRAKDD
A0A417T0L2      -------------------------DTEELQS-------
A0A1H9EPU3      ---------------------------SYENEEASKDKK
A0A354IGV3      ------------------------VSATDKEPEVK----
A0A417JMV2      ---------------------EDKTQESKTERQVKKDHE
B0P408          ---------------------EDKTQESKTERQVKKDHE
D4MV82          ---------------------EDKTQESKTERQVKKDHE
A0A415VWX5      ---------------------EDKTQESKTERQVKKDHE
A0A173UY96      ---------------------EDKTQESKTERQVKKDHE
A0A173QTL1      ---------------------EDKTQESKTERQVKKDHE
A0A174A3T7      ---------------------EDKTQESKTERQVKKDHE
A0A174J359      ---------------------EDKTQESKTERQVKKDHE
A0A417UUA3      ---------------------EDKTQESKTERQVKKDHE
A0A1C6EUV9      DQKEEHQKEQYKKEDHNKEQKEQHNKDSVTERQVKKEDE
A0A173Y645      ------------------EQKEQHNKDSVTERQVKKEDE
A0A374AVY6      ------------------EQKEQHNKDSVTERQVKKEDE
R7BXS4          ------------------EQKEQHNKDSVTERQVKKEDE
A0A143ZUX1      SQSSKKKQRITRNG-------------------------
S3FFL2          ---------------------------------------
A0A328M4V1      ---------------------------------------
A0A5C8HCX2      ---------------------------------------
A0A1W1Z4C3      QNDNRNQETRNNRRGNKE---------------------
A0A239QN83      -------DPDNPKKKQKQ---------------------
A0A3R9WAA7      QVD------------------------------------
A0A1G6BLF1      NK-------------------------------------
R6HZX3          SRKQDNAHRSSGDLGRG----------------------
A0A1W2CEA6      PVRIKKGN-------------------------------
R7FFK6          ETVAAEAEADAKHIEGEKQA-------------------
A0A373MPB9      ---------------------------------------
A0A373L519      ---------------------------------------
A0A373W906      ---------------------------------------
A0A373VCW2      ---------------------------------------
W0U604          ---------------------------------------
A0A374B6G0      ---------------------------------------
A0A373VM36      ---------------------------------------
A0A1C5P379      ---------------------------------------
A0A373XXX0      ---------------------------------------
A0A5R9MJM9      ---------------------------------------
A0A356CW82      ---------------------------------------
R6T4X7          ---------------------------------------
A0A374HTV1      ---------------------------------------
A0A374GB66      ---------------------------------------
A0A374ECC6      ---------------------------------------
A0A374BM61      ---------------------------------------
A0A373UGZ4      ---------------------------------------
A0A373SA66      ---------------------------------------
A0A1C5X6X7      ---------------------------------------
A0A1C6JIH3      ---------------------------------------
A0A373PSC3      ---------------------------------------
A0A1K1WYK8      --------------------------ETKENENAD----
A0A1H6IUB1      TAEEVKEETAKKETVKKESPSTKTNKNSKNKNAKKKGKK
A0A1M7L1F9      TDVEEKEETVKKEAAPKKT-NNNSNNKSKKSNGKKKGKK
A0A1C6B4L6      --------------------------NETKNEKK-----
A0A1Q6T9P4      --------------------------NETKNEKK-----
A0A315Y4F9      --------------------------DTVEAKAETQGKD
A0A354K620      --------------------------DTEESKAETQEKN
A0A355G3J9      YKKKYDRSYESYDREKAQTKKRKHNKKKI----------
A0A3D2AD87      --------YTSKPESQKETGEQ-----------------
A0A2T5IYJ6      ---------------------------------------
A0A3C0QME1      ESSEQADIETTKVDLSKESDKKESE--------------
A0A355FYK5      SGGSGYGSGSGGYGYGYGSGGYG----------------
A0A357AQU0      -----EEALAAKKEQEKATDKKS----------------
A0A3C1YJQ7      -----EEALAAKKEQEKATDKKS----------------
A0A3D0JG38      -----EEALAAKKEQEKATDKKS----------------
A0A3C0IHX1      HSTQQSEPVSTTTDTDSDKQPVS----------------
R5V506          HSTQQSEPVSTTTDTDSDKQPVS----------------
A0A352TIU5      HSTQQSEPVSTTTDTDSDKQPVS----------------
A0A3E5FSY5      ----YRYSKGGEYKE------------------------
A0A1V5S3C0      ---------------------------------------
A0A1Y3TC98      KYGYGRYGYGSDGDETETEEQED----------------
A0A1Q6REE0      ---------------------------------------
R5ETF9          ---------------------------------------
R6VAT5          ----YGDYYGNEENSQAEEASYTDSDSADED--------
A0A1Q6S448      ----DKYGCGHRSGQKQQ---------------------
A0A351MYR0      ----DKYGYGHRSGRKQQ---------------------
R6HPC1          ----DKYGYGHRSGQKQQ---------------------
A0A3D4G5Z5      ----DKYGYGHRSGQKQQ---------------------
A0A3D5ES03      ----DKYGYGHRSGQKQQ---------------------
A0A0F2P7X6      ASDKN----------------------------------
A0A359B487      ASDKN----------------------------------
A0A348P5V4      ---------------------------------------
A0A356PT74      ---------------------------------------
A0A3D5LL19      ---------------------------------------
R5MNF0          ---------------------------------------
A0A1Q9JSI0      YGGKYGYGYGKRDQKKSERSKLKTDKSKSDF--------
A0A3D5TNI1      ----YGYGYGGHAGSRDKKDK------------------
A0A358LJD0      ----YGYGYGGHSGSNDKNSRSK----------------
R6I3L7          ----YGYGYGSHSGSHGKNSK------------------
A0A3D1HXX0      ----YGYGYGSHSGSHGKNSK------------------
A0A3D2QJB8      ----YGYGYGSHSGSHGKNSK------------------
D4LC36          -----------------------EKEKAGSAC-------
R7MQJ4          ---------------ESKKDKSDNKVKKEKK--------
A0A1V5GLC0      SSDSDKNNKSDSKENDKKDSKNNKKGKKGGK--------
W7V182          ----EDKTETPEKSEKKTEEKNQSKKKKGGK--------
                                                       

© 1998-2020Legal notice