BYKdb

Dataset for cluster tadcd of phylum firmicutes

[Download (right click)] [Edit] [Sequences] [Repertoires]

250 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A0H5SF45      ------------------------------------------------------------
A0A1M6JRJ5      ------------------------------------------------------------
A0A1M7Y1S2      ------------------------------------------------------------
A0A3D5R4X5      --------------------------------------------MTREERYL--------
A0A1I4C3N6      -----------------------------------------------MFKIF--------
A0A3B9CIM7      -----------------------------------------------MFKTI--------
A0A1G9WHW8      -----------------------------------------------MFKII--------
A0A1H5VAA0      -----------------------------------------------MFKII--------
A0A3R6VK11      -----------------------------------------------MLETI--------
A0A3R6QUY7      -----------------------------------------------MLETI--------
A0A373K3P9      -----------------------------------------------MLETI--------
A0A3R6JRU5      -----------------------------------------------MLETI--------
A0A1C5MS04      -----------------------------------------------MLETI--------
A0A3C1J150      -----------------------------------------------MLETI--------
A0A416CXD7      -----------------------------------------------MLETI--------
R6XBL9          -----------------------------------------------MLETI--------
A0A355W5Z7      -----------------------------------------------MLETI--------
A0A143WVN6      ------------------------------------------------MEFQ--------
W6RXP9          ------------------------------------------MEQ----EIL--------
W6S4G8          ------------------------------------------MEEVKVVEEF--------
A0A1G6BLB6      ----------------------------------------MQFEERNEEPVQ--------
A0A1C6G8M0      -------------------------------MGGVCDFMENKKAVAV-ENAA--------
A0A416MP73      --------------------------------------MESKEITAMGASAE--------
A0A3E4LL92      -----------------------------------------MSQESYKSQSL--------
A0A415D1L1      -----------------------------------------MSQEGYKSQSL--------
A0A414P2K5      -----------------------------------------MIQEGYKSQSL--------
V8C417          -----------------------------------------MSQESYKSQSL--------
A0A143XN92      ------------------------------------------MQKYRDTNEM--------
A0A173ZYY6      ---------------------------------------MESSNRNDMPVFM--------
A0A4Q5EHM9      ---------------------------------------MESNNRNDMPAFM--------
A0A173SMI2      ---------------------------------------MESNNRNDMPAFM--------
A0A174ASH7      ---------------------------------------MESNNRNDMPAFM--------
A6BH65          ---------------------------------------MESSNRNDMPVFM--------
R7G0D7          ---------------------------------------MESSNRNDMPVFM--------
A0A396G6S7      -------------------------------------------MEERIDNET--------
A0A3E5A223      -------------------------------------------MEERIDNET--------
R7D5E6          -------------------------------------------MEERIDNET--------
A0A415HQH5      -------------------------------------------MEERIDNET--------
A0A414W2C6      -------------------------------------------MEERIDNET--------
A5ZNE7          -------------------------------------------MEERIDNET--------
A0A395X821      -------------------------------------------MEERIDNET--------
A0A1C5PY68      -------------------------------------------MEERIDNET--------
A0A174CJF8      -------------------------------------------MEERIDNET--------
A0A564SRR2      -------------------------------------------MEERIDNET--------
A0A174R7V0      -------------------------------------------MEERIDNET--------
A0A373MWV2      ----------------------------------MRRFQMGEYDRTGNGQNG--------
A0A417CE88      ----------------------------------MRRFQMGEYDRTGNGQNG--------
A0A416Y441      ----------------------------------MRRFQMGEYDRTGNGQNG--------
A0A357GPJ7      ----------------------------------MRRFQMGEYDRTGNGQNG--------
A0A396PAC1      ----------------------------------MRRFQMGEYDRTGNGQNG--------
A0A416EYU4      ----------------------------------MRRFQMGEYDRTGNGQNG--------
A0A416SCQ2      ----------------------------------MRRFQMGEYDRTGNGQNG--------
A0A416TGN7      ----------------------------------MRRFQMGEYDRTGNGQNG--------
A0A417SMF6      ----------------------------------MRRFQMGEYDRTGNGQNG--------
A0A1Y4MW77      ---------------------------------------MEEKNIEQDEITI--------
R6UHV6          ---------------------------------MNNSQDDLKAQDDLKEQDA--------
A0A3R9Q621      ------------------------------------------------------------
A0A069RC75      ------------------------------------------------------------
A0A174F2W5      ---------------------------------------MGEYDRTGNGQNG--------
A0A174S8E9      ---------------------------------------MREYDRTGNGQNG--------
A0A416ZL97      ---------------------------------------MGEYDRTGNGQSS--------
A0A174LSK1      ---------------------------------------MGEYDRTGNGQSS--------
A0A373GY92      ---------------------------------------MGEYDRTGNGQSS--------
A0A373NZQ6      ---------------------------------------MGEYDRTGNGQSS--------
A0A417I9B9      ---------------------------------------MGEYDRTGNGQSS--------
A0A417MP97      ---------------------------------------MGEYDRTGNGQSS--------
A0A417WQF8      ---------------------------------------MGEYDRTGNGQSS--------
A0A373RZ83      ---------------------------------------MGEYDRTGNGQSS--------
A0A416U6I1      ---------------------------------------MGEYDRTGNGQSS--------
R7JQZ9          ---------------------------------------MGEYDRTGNGQSS--------
A0A3B8KKL6      -----------------------------------------------MERNN--------
A0A2K9E6R0      -----------------------------------------------MERNN--------
A0A2S8RBI0      -----------------------------------------------MERNN--------
A0A0L6JLG6      -----------------------------------------------MQDKD--------
G8LSN0          -----------------------------------------------MGKND--------
A0A1M5UYN6      -------------------------------------------------MQK--------
A0A176JBT8      ---------------------------------------------------M--------
A0A1I5HIC6      -----------------------------------------------MPNNN--------
A0A1Y3TC51      ---------------------------------------------MNGERFS--------
A0A1Y3T1N0      ---------------------------------------------MNRELFR--------
A0A1Y3Y8U8      ---------------------------------------------MNRELFR--------
A0A5B0BQY5      ---------------------------------------------------M--------
A6CLL4          ---------------------------------------------------M--------
A0A174DL89      ------------------------------------------------------------
A0A176U8D6      -----------------------------------MVFMNSDEVMIVNEDED--------
A0A1Q6KSQ5      ------------------------------MLGGVCDFMENKKAVAV-ENAA--------
A0A3D3U8B3      ------------------------------MLGGVCDFMENKKAVAV-ENAA--------
A0A3E5FRL7      ---------------------------------------------MNQDEIN--------
A0A1Y4QK93      ---------------------------------------------MNQDEIN--------
B1C232          ---------------------------------------------MNQDEIN--------
A0A401USI6      -------------------------------------------------MRE--------
A0A1V4IQ10      --------------------------------------------------MD--------
A0A1S8TRD2      --------------------------------------------------MD--------
G7M1U2          --------------------------------------------------MD--------
A0A2T6KJ75      ---------------------------------------------------M--------
A9KN92          ----------------------------------------------MQNNNN--------
A0A352MUJ1      ------------------------------------------------------------
R5YI67          ------------------------------------------------------------
A0A1Y0IQP5      ------------------------------------------------------------
A0A4R2R7B1      ------------------------------------------------------------
A0A1M6E8I2      ---------------------------------------------------M--------
A0A1Y4N105      -----------------------------------------------MMEFR--------
A0A1Y4QP75      -----------------------------------------------MMEFR--------
A0A3D4QRB5      ------------------------------------------------------------
A0A349DEH5      -------------------------------------------MRSEKKNQK--------
A0A3D4T7B4      -------------------------------------------MRSEKKNQK--------
A0A350XYC7      -----------------------------------------MKSYSDRKSSK--------
R6DNR8          -----------------------------------------MKSYSERKSSK--------
A0A355KUM5      -----------------------------------------MKSYSDRKNSK--------
R5YGY6          -----------------------------------------MKSYSDRKNSK--------
A0A0K8J554      ------------------------------------------------------------
A0A3N1XSX6      ------------------------------------------------------------
A0A1C6G0U3      ---------------------------------------------------M--------
A0A3D4LLB3      -----------------------------------------------MYEEE--------
A0A0A5GPA9      ---------------------------------------------------M--------
A0A271M6M4      ---------------------------------------------------M--------
A0A2V3W8U6      ---------------------------------------------------M--------
W1UFG0          -------------------------------------------------MKD--------
A0A351SRI8      ------------------------------------------------------------
A0A1V5LU59      ----------------------------------------MEKGIGRMENND--------
A0A1E3BVC3      -----------------------------------------------MEKDD--------
A0A4Q0I6S0      -----------------------------------------------MEKDD--------
A3DF66          -----------------------------------------------MEKDD--------
W4V1T8          -----------------------------------------------MEKDD--------
A0A1I0RG99      ------------------------------------------------------------
A0A1I5G322      ------------------------------------------------------------
A0A1C6ITD7      ------------------------------------------------------------
A0A381IX63      ---------------------------------------------------M--------
A0A1G9IUT4      ---------------------------------------------------M--------
A0A1M6RWV2      ------------------------------------------------MEAY--------
A0A143XPI5      ------------------------------------MKEEYSREPQRSEESI--------
A0A355G1X5      ------------------------------------------MNTNVNTTSAPK------
A0A0M6WXE3      ------------------------------------------MENNRENASAQT------
A0A348SAK2      ----------------------------------------MKMENNRENASAQT------
A0A1G9H5B9      --------------------------------------------MKKK------------
R5EFZ0          -----------------------------------------MENTSKSNMQSAR------
A0A1Y4H8L0      ------------------------------------------MNKDENFNEILQ------
A0A4B9BMD9      --------------------------------------------LEKDGVALT-------
A0A0M6WYQ8      ------------------------------------MDEMREKSGKEQQGEIEKI-----
A0A348SAK1      ------------------------------------MDEMREKSGKEQQGEIEKI-----
A0A252F281      --------------------------------------------MEEKRWSL--------
A0A1Y4QKE6      --------MMKFVIMIMVIVIMIIKTIGMKVGDIMDEQRLKESMLEDDNIEI--------
B1C231          --------------MTMVIVIMIIKPIDMKVGDIMDEQRLKESMMEDDSIEI--------
A0A1Y3TUL5      ------------------------------------------MNDE--------------
A0A1Y4JAX2      ------------------------------------------MNDE--------------
A0A1Y4T590      ------------------------------------------MNDE--------------
R5B467          ------------------------------------------MNEQRQGHTI--------
A0A1Y3T163      MLFTETGFPRVPDMDMIMETMGKTSGEETKEDKSMEDQRKEIENREDDEMEI--------
A0A1Y3YCA2      MLFTETGFPRVPDMDMIMETMGKTSGEETKEDKSMEDQRKEIENREDDEMEI--------
A0A1Y4L6N9      --------------------------------------MSELNHAETEEMEI--------
A0A173T644      ---------------------------------------MDERLEDREELEI--------
A0A1C5TSB8      ---------------------------------------MDERLEDREELEI--------
C0CIK6          -------------------------------------MTVDERLEDREELEI--------
A0A1Y3WEF6      --------------------------MAEQDRYGGNSQNLSRKIEEDD--AI--------
A0A417T0L2      --------------------------MAERDLYSKNNQNLSRRIDEDD--VI--------
A0A1H9EPU3      ------------------------------------------MSNQTDEKFFQDDIGQTP
A0A354IGV3      --------------------------------------------MEKKQSLGSAF-----
A0A417JMV2      ------------------------------------------MSSDKRNISVNDY-----
B0P408          ------------------------------------------MSSDKRNISVNDY-----
D4MV82          ------------------------------------------MSSDKRNISVNDY-----
A0A415VWX5      ------------------------------------------MSSDKRNISVNDY-----
A0A173UY96      ------------------------------------------MSSDKRNISVNDY-----
A0A173QTL1      ------------------------------------------MSSDKRNISVNDY-----
A0A174A3T7      ------------------------------------------MSSDKRNISVNDY-----
A0A174J359      ------------------------------------------MSSDKRNISVNDY-----
A0A417UUA3      ------------------------------------------MSSDKRNISVNDY-----
A0A1C6EUV9      ------------------------------------------MSNEKHNISVNDY-----
A0A173Y645      ------------------------------------------MSNEKHNISVNDY-----
A0A374AVY6      ------------------------------------------MSNEKHNISVNDY-----
R7BXS4          ------------------------------------------MSNEKHNISVNDY-----
A0A143ZUX1      --------------------------------------------MYEQNTSA--------
S3FFL2          ----------------------------------MGVAPKQKGAFAGLPVQQ--------
A0A6A8IF17      ------------------------------------------------------------
A0A6C0V5C7      --------------------------------------MTEKTRPSAAPTSG--------
A0A6C0V5F7      -------------------------------------MSSSKSDKFGAATPQ--------
A0A328M4V1      --------------------------------------MTTRQTFSP----R--------
A0A5C8HCX2      --------------------------------------MTTKNMNTPPGSTQ--------
A0A1W1Z4C3      ---------------------------------------------MNKQSGS--------
A0A239QN83      ---------------------------------------------MNKQGGS--------
A0A3R9WAA7      --------------------------------------MNYNDAAFGEVYTI--------
A0A1G6BLF1      -------------------------------------MAEYSSRQGTAPSAI--------
R6HZX3          --------------------------------------MQEHSYEHNTDQKV--------
A0A1W2CEA6      ----------------MKNKEKITGLTEEMTGISVRNTAPAAEGPAQEYYSG--------
R7FFK6          ---------------------------------------------MKKSYTI--------
A0A373MPB9      ---------------------------------------------MKKNYTI--------
A0A373L519      ---------------------------------------------MKKNYTI--------
A0A373W906      ---------------------------------------------MKKNYTI--------
A0A373VCW2      ---------------------------------------------MKKNYTI--------
W0U604          ---------------------------------------------MKKNYTI--------
A0A374B6G0      ---------------------------------------------MKKNYTI--------
A0A373VM36      ---------------------------------------------MKKNYTI--------
A0A1C5P379      ---------------------------------------------MKKNYTI--------
A0A373XXX0      ---------------------------------------------MKKNYTI--------
A0A5R9MJM9      ---------------------------------------------MKKNYTI--------
A0A356CW82      ---------------------------------------------MKKNYTI--------
R6T4X7          ---------------------------------------------MKKNYTI--------
A0A374HTV1      ---------------------------------------------MKKNYTI--------
A0A374GB66      ---------------------------------------------MKKNYTI--------
A0A374ECC6      ---------------------------------------------MKKNYTI--------
A0A374BM61      ---------------------------------------------MKKNYTI--------
A0A373UGZ4      ---------------------------------------------MKKNYTI--------
A0A373SA66      ---------------------------------------------MKKNYTI--------
A0A1C5X6X7      ---------------------------------------------MKKNYTI--------
A0A1C6JIH3      ---------------------------------------------MKKNYTI--------
A0A373PSC3      ---------------------------------------------MKKNYTI--------
A0A1K1WYK8      ---------------------------------------------MKNTYTI--------
A0A1H6IUB1      ---------------------------------------------MDNGYSI--------
A0A1M7L1F9      ---------------------------------------------MNNSYSI--------
A0A1C6B4L6      ---------------------------------------------MENSYTI--------
A0A1Q6T9P4      ---------------------------------------------MKNSYTI--------
A0A315Y4F9      ---------------------------------------------MNQSYSI--------
A0A354K620      ---------------------------------------------MNESYSI--------
A0A355G3J9      ------------------------------------------------------------
A0A3D2AD87      ------------------------------------------------------------
A0A2T5IYJ6      -------------------------------------MEILDKNLSPQQEDS--------
A0A3C0QME1      ----------------------------------------------MNDS----------
A0A355FYK5      ------------------------------------------MQEDQRNSVNALLGNGLF
A0A357AQU0      -------------------------------------------MEQQKDEVE--------
A0A3C1YJQ7      -------------------------------------------MEQQKDEVE--------
A0A3D0JG38      -------------------------------------------MEQQKDEVE--------
A0A3C0IHX1      -----------------------------------MGTLNQKNKNKQDDETE--------
R5V506          -----------------------------------MGTLNQKNKNKQDDETE--------
A0A352TIU5      -----------------------------------MGTLNQKNKNKQDDETE--------
A0A3E5FSY5      ---------MIVIIMIMVIVIMIIKPIDMKVGDIMDEQRLKESMMEDDSIEI--------
A0A1V5S3C0      ---------------------------------MSGSDYNASVRDEEYGVSF--------
A0A1Y3TC98      -----------------------------------MQDQRNRIDEREDEMEI--------
A0A1Q6REE0      --------------------------------------MEIEKTEQQGRDTF--------
R5ETF9          --------------------------------------MEIEKTEQQGRDTF--------
R6VAT5          -----------------------------------MEKKFVPENSRSYTPVG--------
A0A1Q6S448      ----------------------------------------MDENNQGLQWSH--------
A0A351MYR0      ----------------------------------------MEEKNRGLQWSH--------
R6HPC1          ----------------------------------------MDEKNRGLQWSH--------
A0A3D4G5Z5      ----------------------------------------MDEKNRGLQWSH--------
A0A3D5ES03      ----------------------------------------MDEKNRGLQWSH--------
A0A0F2P7X6      -----------------------------------MEHQGLNNGVDRTEENE--------
A0A359B487      -----------------------------------MEHQGLNNGVNRTEENE--------
A0A348P5V4      -----------------------------------MNYNSEPKKDYEEGLSL--------
A0A356PT74      -----------------------------------MAYSSSGKTHAEESVNL--------
A0A3D5LL19      -----------------------------------MAYSSSGKTHAEESDNL--------
R5MNF0          -----------------------------------MAYSSSGKTHVEESDNL--------
A0A1Q9JSI0      ------------------------------------MSE--NKNTSINDYEM--------
A0A3D5TNI1      ------------------------------------MNRIVKKDTDSDGVEI--------
A0A358LJD0      ------------------------------------MSKIVRKDTDSDGVEV--------
R6I3L7          ------------------------------------MSKIVRKDTNSDGVEV--------
A0A3D1HXX0      ------------------------------------MSKIVRKDTDSDGVEV--------
A0A3D2QJB8      ------------------------------------MSKIVRKDTDSDGVEV--------
D4LC36          ---------------------------------------------MKKEYTI--------
R7MQJ4          ---------------------------------------------MESNYTI--------
A0A1V5GLC0      ---------------------------------------------MENTYSI--------
W7V182          -----------------------------------------MKNDGKDMLDL--------
                                                                            

A0A0H5SF45      -----------------------------MELSIKDVLGIIYK-RLIFI-------IACT
A0A1M6JRJ5      -----------------------------MEFTVTDILHLLKK-RFILI-------AACT
A0A1M7Y1S2      -----------------------------MEFTVRDILYLIKK-RFILI-------AACT
A0A3D5R4X5      ----------------------------EEEIDIRQLFHILRK-RLGWI-------ISIT
A0A1I4C3N6      ----------------------------FANLHLEKILWIIKS-KILYI-------IMFA
A0A3B9CIM7      ----------------------------LSNFHLEKIFWTLKK-KALYI-------FLST
A0A1G9WHW8      ----------------------------VANFHLEKILWIIKK-NLTYM-------VFCG
A0A1H5VAA0      ----------------------------VANFHLEKILWIIKK-NLTYM-------VFCG
A0A3R6VK11      ----------------------------LNNFHLEKILWILQK-RIAYI-------MILG
A0A3R6QUY7      ----------------------------LNNFHLEKILWILQK-RIAYI-------MILG
A0A373K3P9      ----------------------------LNNFHLEKILWILQK-RIAYI-------MILG
A0A3R6JRU5      ----------------------------LNNFHLEKILWILQK-RIAYI-------MILG
A0A1C5MS04      ----------------------------LNNFHLEKILWILQK-RIAYI-------MILG
A0A3C1J150      ----------------------------LNNFHLEKILWILQK-RIAYI-------MILG
A0A416CXD7      ----------------------------LNNFHLEKILWILQK-RIAYI-------MILG
R6XBL9          ----------------------------LNNFHLEKILWILQK-RIAYI-------MILG
A0A355W5Z7      ----------------------------LNNFHLEKILWILQK-RIAYI-------MILG
A0A143WVN6      ----------------------------IDDIDFRSIVLDLIK-NIWVI-------ILAV
W6RXP9          ----------------------------EKEISISEIMEALQK-RWKMI-------ALIT
W6S4G8          ----------------------------SNEISFSQIIFALKK-RWKII-------FATT
A0A1G6BLB6      ----------------------------LFRFNGYTVGRDIIK-HMKMI-------IMIS
A0A1C6G8M0      ----------------------------EDTIDLLEIFRALYR-RWVWI-------VFTA
A0A416MP73      ----------------------------EDTIDLMEIFRALRK-RWYWI-------VLLA
A0A3E4LL92      ----------------------------DSQIDLRYIFRTLKK-NAVFI-------LMCM
A0A415D1L1      ----------------------------DSQIDLRYIFRTLKK-NAVFI-------LMCV
A0A414P2K5      ----------------------------DSQIDLRYIFRTLKK-NAVFI-------LMCV
V8C417          ----------------------------DSQIDLRYIFRTLKK-NAVFI-------LMCV
A0A143XN92      ----------------------------ELKIDIRTMIKDVLR-YSWLI-------VIMA
A0A173ZYY6      ----------------------------DNDLDPYTLVHDIVS-NWWVI-------ILGA
A0A4Q5EHM9      ----------------------------DTDLDPYTLVHDIVS-NWWVI-------ILGA
A0A173SMI2      ----------------------------DTDLDPYTLVHDIVS-NWWVI-------ILGA
A0A174ASH7      ----------------------------DTDLDPYTLVHDIVS-NWWVI-------ILGA
A6BH65          ----------------------------DNDLDPYTLVHDIVS-NWWVI-------ILGA
R7G0D7          ----------------------------DNDLDPYTLVHDIVS-NWWVI-------ILGA
A0A396G6S7      ----------------------------VQQIDLISMLKDIGR-EWLTI-------LLLA
A0A3E5A223      ----------------------------VQQIDLISMLKDIGR-EWLTI-------LLLA
R7D5E6          ----------------------------VQQIDLISMLKDIGR-EWLTI-------LLLA
A0A415HQH5      ----------------------------VQQIDLISMLKDIGR-EWLTI-------LLLA
A0A414W2C6      ----------------------------VQQIDLISMLKDIGR-EWLTI-------LLLA
A5ZNE7          ----------------------------VQQIDLISMLKDIGR-EWLTI-------LLLA
A0A395X821      ----------------------------VQQIDLISMLKDIGR-EWMTI-------LLLA
A0A1C5PY68      ----------------------------VQQIDLISMLKDIGR-EWLTI-------LLLA
A0A174CJF8      ----------------------------VQQIDLISMLKDIGR-EWLTI-------LLLA
A0A564SRR2      ----------------------------VQQIDLISMLKDIGR-EWLTI-------LLLA
A0A174R7V0      ----------------------------VQQIDLISMLKDIGR-EWLTI-------LLLA
A0A373MWV2      ----------------------------EADWDLRSILCDMAK-NWWII-------LLIA
A0A417CE88      ----------------------------EADWDLRSILCDMAK-NWWII-------LLIA
A0A416Y441      ----------------------------EADWDLRSILCDMAK-NWWII-------LLIA
A0A357GPJ7      ----------------------------EADWDLRSILCDMAK-NWWII-------LLIA
A0A396PAC1      ----------------------------EADWDLRSILCDMAK-NWWII-------LLIA
A0A416EYU4      ----------------------------EADWDLRSILCDMAK-NWWII-------LLIA
A0A416SCQ2      ----------------------------EADWDLRSILCDMAK-NWWII-------LLIA
A0A416TGN7      ----------------------------EADWDLRSILCDMAK-NWWII-------LLIA
A0A417SMF6      ----------------------------EADWDLRSILCDMAK-NWWII-------LLIA
A0A1Y4MW77      ----------------------------DLTVLFRDFIRGCIK-FWWLI-------LALM
R6UHV6          ----------------------------NYSFDLASTLQDLTK-RWFVI-------LLSG
A0A3R9Q621      -----------------------------MEFTLAQVIKLLYK-RMLWI-------VLIT
A0A069RC75      -------------------------------MNGKKYIGIFKR-RKWLF-------FMVL
A0A174F2W5      ----------------------------EADWDLRSILCDMAK-NWWII-------LLIA
A0A174S8E9      ----------------------------EADWDLRSILCDMAK-NWWII-------LLIA
A0A416ZL97      ----------------------------KTDWDLRSILCDIAK-NWWVI-------LLIA
A0A174LSK1      ----------------------------KTDWDLRSILCDIAK-NWWVI-------LLIA
A0A373GY92      ----------------------------KTDWDLRSILCDIAK-NWWVI-------LLIA
A0A373NZQ6      ----------------------------KTDWDLRSILCDIAK-NWWVI-------LLIA
A0A417I9B9      ----------------------------KTDWDLRSILCDIAK-NWWVI-------LLIA
A0A417MP97      ----------------------------KTDWDLRSILCDIAK-NWWVI-------LLIA
A0A417WQF8      ----------------------------KTDWDLRSILCDIAK-NWWVI-------LLIA
A0A373RZ83      ----------------------------KTDWDLRSILCDIAK-NWWVI-------LLIA
A0A416U6I1      ----------------------------KTDWDLRSILCDIAK-NWWVI-------LLIA
R7JQZ9          ----------------------------KTDWDLRSILCDIAK-NWWVI-------LLIA
A0A3B8KKL6      ----------------------------FEEIDVREIFFLLLR-KWYVV-------AACF
A0A2K9E6R0      ----------------------------FEEIDVREIFFLLLR-KWYVV-------AACF
A0A2S8RBI0      ----------------------------FEEIDVREIFFLLLR-KWYVV-------AACF
A0A0L6JLG6      ----------------------------FVEVDIRELILILLR-KWYIL-------LICL
G8LSN0          ----------------------------YIEIDIREILIVLLK-RWYLI-------AICF
A0A1M5UYN6      ----------------------------DDRLDLRDYLHIIKK-KIMVI-------ITIT
A0A176JBT8      ----------------------------EKTFEIKDLLNILRK-NKILI-------TSIP
A0A1I5HIC6      ----------------------------DIEIDIGDLFFLLLH-KMWFI-------LLWG
A0A1Y3TC51      ----------------------------LAEISVRGLCMDLFR-NAWMI-------LLAA
A0A1Y3T1N0      ----------------------------LDEISIRGLCLELLQ-SLWMI-------LVIG
A0A1Y3Y8U8      ----------------------------LDEISIRGLCLELLQ-SLWMI-------LVIG
A0A5B0BQY5      ----------------------------KRTIDMTDLMQAVRR-RWMIF-------FGII
A6CLL4          ----------------------------NQSLTLKELFQILQN-HFWLI-------LSII
A0A174DL89      -------------------------------MNKFKYFKLIKE-KLSII-------ILIT
A0A176U8D6      ----------------------------EVTIDFFGIFHAIAK-RWYIV-------LLAA
A0A1Q6KSQ5      ----------------------------EDTIDLLEIFRALYR-RWVWI-------VFAA
A0A3D3U8B3      ----------------------------EDTIDLLEIFRALYR-RWVWI-------VFAA
A0A3E5FRL7      ----------------------------LDSINYRGIIRDLLK-NWWII-------VLIV
A0A1Y4QK93      ----------------------------LDSINYRGIIRDLLK-NWWVI-------VLIV
B1C232          ----------------------------LDSINYRGIIRDLLK-NWWII-------VLIV
A0A401USI6      ----------------------------ENDIEFNDYLNIIRK-KIVVI-------LFII
A0A1V4IQ10      ----------------------------SETISIEEIFQILKK-KWKLV-------IILP
A0A1S8TRD2      ----------------------------SETTSIEEIFQILKK-KWKLV-------IILP
G7M1U2          ----------------------------SETISIEEIFQILKK-KWKLV-------IILP
A0A2T6KJ75      ----------------------------NRTMEIRDFIRLFKK-KKKVI-------LLVT
A9KN92          ----------------------------DIEINLGEIFILLLH-KIWII-------VLSS
A0A352MUJ1      ----------------------------MEEIDLKELLKLFWK-KKILI-------ILTT
R5YI67          ----------------------------MEEIDLRDLLKLFWK-RKAII-------LLTT
A0A1Y0IQP5      -----------------------------MEMGLAEMGRVIRQ-RVLLI-------VLVT
A0A4R2R7B1      -----------------------------MEMGLAEMGRVLRQ-RVLLI-------VLVT
A0A1M6E8I2      ----------------------------GEEWNLLELVQIVLK-RKWIV-------VATT
A0A1Y4N105      ----------------------------INDIDLRSIIVDMVR-NCWMI-------ILVM
A0A1Y4QP75      ----------------------------INDIDLRSIIVDVIR-NCWMI-------ILVM
A0A3D4QRB5      ----------------------------MEELDIRDIIHIIRK-HFWII-------VLTI
A0A349DEH5      ----------------------------GLEINVLAFFKELSK-KLWIV-------LIVA
A0A3D4T7B4      ----------------------------GLEINVLAFFKELSK-KLWIV-------LIVA
A0A350XYC7      ----------------------------GLEINIVAFFRELSK-KIWIV-------LIIA
R6DNR8          ----------------------------GLEINILAFFKELSK-KLWIV-------AIVA
A0A355KUM5      ----------------------------GIEINILAFFKELSK-KLWIV-------AIIA
R5YGY6          ----------------------------GIEINILAFFKELSK-KLWIV-------AIIA
A0A0K8J554      -----------------------------MELSLKEIIELIYK-RLKLI-------IIFV
A0A3N1XSX6      -----------------------------MEFTVKEIIKLILK-RLIWI-------ILCL
A0A1C6G0U3      ----------------------------KEKLDFIEVLKIINK-RKIIV-------ISIL
A0A3D4LLB3      ----------------------------FNDIDLREIFQIIRK-YLALI-------IIIT
A0A0A5GPA9      ----------------------------GQAFGLKEVYQVIRR-RVVLL-------SVVT
A0A271M6M4      ----------------------------NEAVGLREIFNIIKK-EYLII-------IIIT
A0A2V3W8U6      ----------------------------DQTFQIRDFLQIFKK-RIKFI-------ITVP
W1UFG0          ----------------------------TMTISLRELFTIIKR-KLWII-------VLVG
A0A351SRI8      ----------------------------MEEFNILEFLKYYWN-KILIV-------AIVT
A0A1V5LU59      ----------------------------FVEIDLREIFFTILR-KWYLI-------AICF
A0A1E3BVC3      ----------------------------ILEIDIREMVYLLLK-KWYLI-------VLCF
A0A4Q0I6S0      ----------------------------ILEIDIREMVYLLLK-KWYLI-------VLCF
A3DF66          ----------------------------ILEIDLREIVYILLK-KWYLI-------VLCF
W4V1T8          ----------------------------ILEIDLREIVYILLK-KWYFI-------VLCF
A0A1I0RG99      -----------------------------MEFSFKEILEILAK-RFVFI-------AICT
A0A1I5G322      -----------------------------MEFTLKEIFEIFMK-RIVFI-------TVCT
A0A1C6ITD7      ------------------------------MKNILYYLDIIKK-HLTLI-------IIIT
A0A381IX63      ----------------------------EQKIEIKEYLQLIRK-RMKII-------VAIV
A0A1G9IUT4      ----------------------------EEIINLRQCFQIIKK-NISLI-------IIIT
A0A1M6RWV2      ----------------------------EYEIDLRELFEIILN-KLWLI-------ILIV
A0A143XPI5      ----------------------------DIFYLFNNVWKGIRQ-FYWIF-------LIII
A0A355G1X5      ----------------------------GLEINVLFLLKTVLK-RWWIL-------LITT
A0A0M6WXE3      ----------------------------ETEFEPISLVCDILK-NWWVI-------LLGA
A0A348SAK2      ----------------------------ETEFEPISLVCDILK-NWWVI-------LFGA
A0A1G9H5B9      ----------------------------ANQIDLVKMLFFILK-HLWLL-------VLCA
R5EFZ0          ----------------------------LLPFDPIVLVQDVLK-RWLVV-------VLAA
A0A1Y4H8L0      ----------------------------TSRLEPFTLVRDILV-NWWVI-------LLGA
A0A4B9BMD9      --------------------------------------------------------IADI
A0A0M6WYQ8      ----------------------------DLIEFLRSFQYGIKK-MWWLV-------LVLA
A0A348SAK1      ----------------------------DLIEFLRSFQYGIKK-MWWLV-------LVLA
A0A252F281      -----------------------------ASINLHTMLRDVWK-NLWMI-------VLVA
A0A1Y4QKE6      ----------------------------DLSELIHGFLKILKD-YWGLF-------LGTI
B1C231          ----------------------------DLSELIHDFLKILKD-YWGVF-------LGTI
A0A1Y3TUL5      ----------------------------YITIRLSDFLHALIK-NRGLIAATTIAGLAIG
A0A1Y4JAX2      ----------------------------YITIRLSDFLHALIK-NRGLIAATTIAGLAIG
A0A1Y4T590      ----------------------------YITIRLSDFLHALIK-NRGLIAATTIAGLAIG
R5B467          ----------------------------DLAELLGRFARSLRR-LWWLC-------LALI
A0A1Y3T163      ----------------------------DLVLLFGAFWKSFTR-LWWLV-------LILI
A0A1Y3YCA2      ----------------------------DLVLLFGAFWKSFTR-LWWLV-------LILI
A0A1Y4L6N9      ----------------------------DIVSLIQNFISGIFR-WWWLI-------VLLA
A0A173T644      ----------------------------DLGILLWNFLQGLAR-FWWLV-------ILLA
A0A1C5TSB8      ----------------------------DLGILLWNFLQGLAR-FWWLV-------ILLA
C0CIK6          ----------------------------DLGILLWNFLQGLAR-FWWLV-------ILLA
A0A1Y3WEF6      ----------------------------DLRTLFWNVIQGILK-FWWLI-------LLLA
A0A417T0L2      ----------------------------DLGALFWNVIQGILR-FWWLI-------IFLA
A0A1H9EPU3      GKILENAPVTPRKPAIINNNNIAKKTQDEETIDLRQIFGLLWV-NKILI-------ILLG
A0A354IGV3      ----------------------------LSSIDVSGALRAIVR-NFWLV-------VLAA
A0A417JMV2      ----------------------------ETNIDLYSILRDIWK-YALVI-------MLLA
B0P408          ----------------------------EMNIDLYSILRDIWK-YALVI-------LLLA
D4MV82          ----------------------------EMNIDLYSILRDIWK-YALVI-------LLLA
A0A415VWX5      ----------------------------EMNIDLYSILRDIWK-YALVI-------LLLA
A0A173UY96      ----------------------------EMNIDLYSILRDIWK-YALVI-------LLLA
A0A173QTL1      ----------------------------EMNIDLYSILRDIWK-YAIVI-------LLLA
A0A174A3T7      ----------------------------EMNIDLYSILRDIWK-YAIVI-------LLLA
A0A174J359      ----------------------------EMNIDLYSILRDIWK-YAILI-------LLLA
A0A417UUA3      ----------------------------EMNIDLYSILRDIWK-YAIVI-------LLLA
A0A1C6EUV9      ----------------------------EMNIDLYSILRDISK-YIVVI-------LLLA
A0A173Y645      ----------------------------EMNIDLYSILRDISK-YIVVI-------LLLA
A0A374AVY6      ----------------------------EMNIDLYSILRDISK-YIVVI-------LLLA
R7BXS4          ----------------------------EMNIDLYSILRDISK-YIVVI-------LLLA
A0A143ZUX1      ----------------------------TPSPTTLRYFRQLKK-SWWIP-------TILL
S3FFL2          ----------------------------AGDTPIIRQYMRIANRWRWVI-------LGIV
A0A6A8IF17      --------------------------------------MCLAR-WKWFV-------LSL-
A0A6C0V5C7      ----------------------------SDEIDIGRLVGTVIE-AKWWV-------LGIT
A0A6C0V5F7      ----------------------------NNEIDLIQLLAEMFD-HRIMI-------ACIT
A0A328M4V1      ----------------------------DDDVDLRALIGTLLD-NKWLI-------GITT
A0A5C8HCX2      ----------------------------ENEIDLLRLVGELWD-HRKFI-------ISVT
A0A1W1Z4C3      ----------------------------IDLARLAVY---ILK-RIWLV-------IICA
A0A239QN83      ----------------------------IDLARLAVY---ILK-RIWLV-------ILCA
A0A3R9WAA7      ----------------------------DLSGIGRNFLRGLKK-LFWLI-------PLLA
A0A1G6BLF1      ----------------------------DLGTIVDDVWKGFWR-IWWLL-------LVII
R6HZX3          ----------------------------DLELIFRNFLHVLKR-TWWWV-------TLLA
A0A1W2CEA6      ----------------------------IDWVSVLFR---LLE-KIHWI-------VLAA
R7FFK6          ----------------------------KDLIFL------FLG-HIWWI-------ICAA
A0A373MPB9      ----------------------------KDLLVL------LLG-KVWYI-------VAAS
A0A373L519      ----------------------------KDLLVL------LLG-KVWYI-------VAAA
A0A373W906      ----------------------------KDLLVL------LLG-KVWYI-------VAAS
A0A373VCW2      ----------------------------KDLLVL------LLG-KVWYI-------VAAS
W0U604          ----------------------------KDLLVL------LLG-KVWYI-------VAAS
A0A374B6G0      ----------------------------KDLLVL------LLG-KVWYI-------VAAS
A0A373VM36      ----------------------------KDLLVL------LLG-KVWYI-------VAAS
A0A1C5P379      ----------------------------KDLLVL------LLG-KVWYI-------VAAS
A0A373XXX0      ----------------------------KDLLVL------LLG-KVWYI-------VAAS
A0A5R9MJM9      ----------------------------KDLLVL------LLG-KVWYI-------VAAS
A0A356CW82      ----------------------------KDLLVL------LLG-KVWYI-------VAAS
R6T4X7          ----------------------------KDLLVL------LLG-KVWYI-------VAAS
A0A374HTV1      ----------------------------KDLLVL------LLG-KVWYI-------VAAS
A0A374GB66      ----------------------------KDLLVL------LLG-KVWYI-------VAAS
A0A374ECC6      ----------------------------KDLLVL------LLG-KVWYI-------VAAS
A0A374BM61      ----------------------------KDLLVL------LLG-KVWYI-------VAAS
A0A373UGZ4      ----------------------------KDLLVL------LLG-KVWYI-------VAAS
A0A373SA66      ----------------------------KDLLVL------LLG-KVWYI-------VAAS
A0A1C5X6X7      ----------------------------KDLLVL------LLG-KVWYI-------VAAS
A0A1C6JIH3      ----------------------------KDLLVL------LLG-KVWYI-------VAAS
A0A373PSC3      ----------------------------KDLLVL------LLG-KVWYI-------VAAS
A0A1K1WYK8      ----------------------------KDLLSL------LWN-HLMLI-------IAIT
A0A1H6IUB1      ----------------------------KDIISL------LLS-KLWLL-------IIVT
A0A1M7L1F9      ----------------------------KDIINL------LLS-KLWLL-------ILVT
A0A1C6B4L6      ----------------------------KELIGL------FLN-KIWII-------IIVT
A0A1Q6T9P4      ----------------------------KELIGL------FLN-KIWII-------IIVT
A0A315Y4F9      ----------------------------KDIIRL------LLS-HIWLI-------IVIT
A0A354K620      ----------------------------KDILRL------LLN-HLWII-------IIIA
A0A355G3J9      -----------------------------MRLTLKDIAMTVWR-SIGLI-------IVSS
A0A3D2AD87      ----------------------------MQDISIMYLFHLAWR-RIWAI-------VIAA
A0A2T5IYJ6      ----------------------------IDLRHYWNV---VAR-FKWGI-------IGLA
A0A3C0QME1      ----------------------------YTIKDIISL---LLS-KLWLL-------ILLA
A0A355FYK5      GNGGSGGG--------------------LDLFKLLRA---LLR-RAWAI-------VMVG
A0A357AQU0      ----------------------------IDLLELFWA---LLR-KWWML-------TIAA
A0A3C1YJQ7      ----------------------------IDLLELFWA---LLR-KWWML-------TIAA
A0A3D0JG38      ----------------------------IDLLELFWA---LLR-KWWML-------TIAA
A0A3C0IHX1      ----------------------------IDLGKLFKA---LMQ-RLPII-------LLVT
R5V506          ----------------------------IDLGKLFKA---LMQ-RLPII-------LLVT
A0A352TIU5      ----------------------------IDLGKLFKA---LVR-RLPII-------LLVT
A0A3E5FSY5      ----------------------------DLSELIHDFLKILKD-YWGVF-------LGTI
A0A1V5S3C0      ----------------------------ETILKLIRV---IAS-KWWVI-------LILV
A0A1Y3TC98      ----------------------------DLGLLFAGMWKNIRR-FWWLA-------LLLT
A0A1Q6REE0      ----------------------------VLLDDFLHQ---AKR-MWLLG-------LALV
R5ETF9          ----------------------------VLLDDFLHQ---AKR-MWLLG-------LALI
R6VAT5          ----------------------------EYASKILTG---IKK-HWYII-------AVLA
A0A1Q6S448      ----------------------------IEPLCILRA---LAR-QLWML-------LLAA
A0A351MYR0      ----------------------------IEPYCLLRT---LLR-QLWML-------LMAG
R6HPC1          ----------------------------IEPYCLVRT---LLR-QLWML-------LLAA
A0A3D4G5Z5      ----------------------------IEPYCLVRT---LLR-QLWML-------LLAA
A0A3D5ES03      ----------------------------IEPYCLVRT---LLR-QLWML-------LLAA
A0A0F2P7X6      ----------------------------ISLGEIISA---LFK-WWWLV-------VLCT
A0A359B487      ----------------------------ISLGEIISA---LFK-WWWLV-------ILCT
A0A348P5V4      ----------------------------DTALMYAKK---LMD-KWFVI-------LLSA
A0A356PT74      ----------------------------DSVVIYLKK---ILQ-HWKIV-------VISA
A0A3D5LL19      ----------------------------DSVVIYLKK---ILQ-HWKIV-------VISA
R5MNF0          ----------------------------DSVVIYLKK---ILQ-HWKIV-------VISA
A0A1Q9JSI0      ----------------------------NIDLYS------ICK-DIWKY-------ALVI
A0A3D5TNI1      ----------------------------NI-MYVFGL---LIR-RLWLL-------MLVG
A0A358LJD0      ----------------------------NI-MYVFGL---LLR-RLWLL-------ILVA
R6I3L7          ----------------------------NI-MYAFGL---LLR-RLWLL-------ILVA
A0A3D1HXX0      ----------------------------NI-MYAFGL---LLR-RLWLL-------ILVA
A0A3D2QJB8      ----------------------------NI-MYAFGL---LLR-RLWLL-------ILVA
D4LC36          ----------------------------KD---LVYL---MLG-RIWWI-------IGAA
R7MQJ4          ----------------------------KK---LIQL---FLS-KIYVI-------IILT
A0A1V5GLC0      ----------------------------KD---LINL---FLS-KLWLI-------ILLA
W7V182          ----------------------------KS---MVAL---LLS-KLWII-------ILAA
                                                                            

A0A0H5SF45      FFCAIMSYVYNK-FIKD-------PV----YTASVQFCV---------NTN-----DNSS
A0A1M6JRJ5      LGGLLLSFLYTS-YFVD-------KT----YTASTQFYV---------STA-----DSTA
A0A1M7Y1S2      FAGLLLSFLYTR-YFVD-------KT----YTASSQFYV---------STI-----ESTS
A0A3D5R4X5      LAFLIISALISF-FILT-------PI----YQSSTALMVNKTFSESEMLNQ---------
A0A1I4C3N6      LVGGAVGGAYAL-FMGQ-------DL----YRSEITMTA---FSNPDYAND-----SGIN
A0A3B9CIM7      AVLGMVAGAYAS-ITST-------SL----YMAQISFYV---YSNPDYITD-----SSVN
A0A1G9WHW8      LVAALLFGGYAY-ATRS-------SV----YQAKISFYA---YSDPDYASD-----TSVN
A0A1H5VAA0      LVAALLFGGYAY-ATRS-------SV----YQAKISFYA---YSDPDYASD-----TSVN
A0A3R6VK11      VLGGMAGGAYAY-LTNS-------TL----YRAEVSFYV---YSDPDYVYD-----SSVN
A0A3R6QUY7      VLGGMAGGAYAY-LTNS-------TL----YRAEVSFYV---YSDPDYVYD-----SSVN
A0A373K3P9      VLGGMAGGAYAY-LTNS-------TL----YRAEVSFYV---YSDPDYVYD-----SSVN
A0A3R6JRU5      VLGGMAGGAYAY-LTNS-------TL----YRAEVSFYV---YSDPDYVYD-----SSVN
A0A1C5MS04      VLGGMAGGAYAY-LTNS-------TL----YRAEVSFYV---YSDPDYVYD-----SSVN
A0A3C1J150      VLGGMAGGAYAY-LTNS-------TL----YRAEVSFYV---YSDPDYVYD-----SSVN
A0A416CXD7      VLGGMAGGAYAY-LTNS-------TL----YRAEVSFYV---YSDPDYVYD-----SSVN
R6XBL9          VLGGMAGGAYAY-LTNS-------TL----YRAEVSFYV---YSDPDYVYD-----SSVN
A0A355W5Z7      VLGGMAGGAYAY-LTNS-------TL----YRAEVSFYV---YSDPDYVYD-----SSVN
A0A143WVN6      LAVRMGISGYYE-LTYE-------PQ----YTSTATLAV---TARGSSNGS-----YS--
W6RXP9          LIFSVVAGVLSF-FVIK-------PT----YEAGTKLFI---GKEESQNST-----YDNN
W6S4G8          IFFTALVALITF-FFID-------PV----YEVHTKVFI---GKDAEVN-------YDNN
A0A1G6BLB6      VAAMLLMYAYLA-YTYA-------ET----YTMTTTFTV---VSASTENDA-----YT--
A0A1C6G8M0      LVFGIALGMYGK-FVVK-------DV----FQAEASMCI---IDSNKEVSI-----S---
A0A416MP73      IIFGAALGVYGK-FIVK-------DA----YQAEASMCI---IDSNKEVSM-----S---
A0A3E4LL92      CLTGMFSYVILD-HSLK-------DT----YTVSVNLCV---IPRDNTSEK-----L---
A0A415D1L1      CLTGMFSYVILD-HSLK-------DT----YTVSVNLCV---IPRDNTSEK-----L---
A0A414P2K5      CLTGMFSYVILD-HSLK-------DT----YTVSVNLCV---IPRDNTSEK-----L---
V8C417          CLTGMFSYVILD-HSLK-------DT----YTVSVNLCV---IPRDNTSEK-----L---
A0A143XN92      ISFSLIAYMIID-SSYK-------PK----YTSSTTFIV---TGKGLNNSI-----YD--
A0A173ZYY6      IAGALLTYVVVS-SRYV-------PE----YTTQATFVV---SSRGDANAY-----S---
A0A4Q5EHM9      IAGALLTYVVVS-SRYV-------PE----YTTQATFVV---ASRGDANAY-----S---
A0A173SMI2      IAGALLTYVVVS-SRYV-------PE----YTTQATFVV---ASRGDANAY-----S---
A0A174ASH7      IAGALLTYVVVS-SRYV-------PE----YTTQATFVV---SSRGDANAY-----S---
A6BH65          IAGALLTYVVVS-SRYV-------PE----YTTQATFVV---SSRGDANAY-----S---
R7G0D7          IAGALLTYVVVS-SRYV-------PE----YTTQATFVV---SSRGDANAY-----S---
A0A396G6S7      IAAALFADIWIC-ATYQ-------PE----YRTSTTFVV---TAKGMNNNI-----YQ--
A0A3E5A223      IAAALFADIWIC-ATYQ-------PE----YRTSTTFVV---TAKGMNNNI-----YQ--
R7D5E6          IAAALFADIWIC-ATYQ-------PE----YRTSTTFVV---TAKGMNNNI-----YQ--
A0A415HQH5      IAAALFADIWIC-ATYQ-------PE----YRTSTTFVV---TAKGMNNNI-----YQ--
A0A414W2C6      IAAALFADIWIC-ATYQ-------PE----YRTSTTFVV---TAKGMNNNI-----YQ--
A5ZNE7          IAAALFADIWIC-ATYQ-------PE----YRTSTTFVV---TAKGMNNNI-----YQ--
A0A395X821      IAAALFADIWIC-ATYQ-------PE----YRTSTTFVV---TAKGMNNNI-----YQ--
A0A1C5PY68      IAAALFADIWIC-ATYQ-------PE----YRTSTTFVV---TAKGMNNNI-----YQ--
A0A174CJF8      IAAALFADIWIC-ATYQ-------PE----YRTSTTFVV---TAKGMNNNI-----YQ--
A0A564SRR2      IAAALFADIWIC-ATYQ-------PE----YRTSTTFVV---TAKGMNNNI-----YQ--
A0A174R7V0      IAAALFADIWIC-ATYQ-------PE----YRTSTTFVV---TAKGMNNNI-----YQ--
A0A373MWV2      CSAAMITYTVLT-AVHR-------DQ----YTVKTTFAV---MGRGENANA-----AS--
A0A417CE88      CSAAMITYTVLT-AVHR-------DQ----YTVKTTFAV---MGRGENANA-----AS--
A0A416Y441      CSAAMITYTVLT-AVHR-------DQ----YTVKTTFAV---MGRGENANA-----AS--
A0A357GPJ7      CSAAMITYTVLT-AVHR-------DQ----YTVKTTFAV---MGRGENANA-----AS--
A0A396PAC1      CSAAMITYTVLT-AVHR-------DQ----YTVKTTFAV---MGRGENANA-----AS--
A0A416EYU4      CSAAMITYTVLT-AVHR-------DQ----YTVKTTFAV---MGRGENANA-----AS--
A0A416SCQ2      CSAAMITYTVLT-AVHR-------DQ----YTVKTTFAV---MGRGENANA-----AS--
A0A416TGN7      CSAAMITYTVLT-AVHR-------DQ----YTVKTTFAV---MGRGENANA-----AS--
A0A417SMF6      CSAAMITYTVLT-AVHR-------DQ----YTVKTTFAV---MGRGENANA-----AS--
A0A1Y4MW77      VAGGAIMFVTNI-QTYT-------PM----YQASATFTV---TTNTTTDQN-----NQSD
R6UHV6          IIAAIGCFITAT-QLYS-------PQ----YMTSTTLLV---QSKNNTESA-----YN--
A0A3R9Q621      ALALAATFAVNK-YLIS-------ES----YTASVQFYV---NTQDSQTQK-----IDLN
A0A069RC75      AVSVAVSAVMTF-YVSE-------PE----YSSYTTLMV---NKARGDNEN-----YIDY
A0A174F2W5      CSAAMITYTVLT-AVHR-------DQ----YTVKTTFAV---MGRGENANA-----AS--
A0A174S8E9      CSAAMITYTVLT-AVHR-------DQ----YTVKTTFAV---MGRGENANA-----AS--
A0A416ZL97      CSVAMITYTVLT-TVHK-------DR----YTVKTTFAV---MGRGVDANA-----AS--
A0A174LSK1      CSAAMITYTVMA-TVHK-------DR----YTVKTTFAV---MGRGVDANA-----AS--
A0A373GY92      CSAAMITYTVMA-TVHK-------DR----YTVKTTFAV---MGRGVDANA-----AS--
A0A373NZQ6      CSAAMITYTVMA-TVHK-------DR----YTVKTTFAV---MGRGVDANA-----AS--
A0A417I9B9      CSAAMITYTVMA-TVHK-------DR----YTVKTTFAV---MGRGVDANA-----AS--
A0A417MP97      CSAAMITYTVMA-TVHK-------DR----YTVKTTFAV---MGRGVDANA-----AS--
A0A417WQF8      CSAAMITYTVMA-TVHK-------DR----YTVKTTFAV---MGRGVDANA-----AS--
A0A373RZ83      CSAAMITYTVMA-TVHK-------DR----YTVKTTFAV---MGRGVDANA-----AS--
A0A416U6I1      CSAAMITYTVMA-TVHK-------DR----YTVKTTFAV---MGRGVDANA-----AS--
R7JQZ9          CSAAMITYTVMA-TVHK-------DR----YTVKTTFAV---MGRGVDANA-----AS--
A0A3B8KKL6      IFVTVSTFLITS-YYLT-------PI----YRSEATLFL---GKESGNVGG-----LSIG
A0A2K9E6R0      IFVTVSTFLITS-YYLT-------PI----YRSEATLFL---GKESGNVGG-----LSIG
A0A2S8RBI0      IFVTVSTFLITS-YYLT-------PI----YRSEATLFL---GKESGNVGG-----LSIG
A0A0L6JLG6      VVATGAAYTVTA-FYLK-------PV----YRAETTLFL---GKEKDKIGA-----LSLL
G8LSN0          ILATGSSFAITK-FYLK-------PV----YRAQTTLFL---GKESDKVAS-----LSIA
A0A1M5UYN6      FLTTLIGGIYSF-YVLK-------PT----YYSSMSVII---GKTVSVDGN-----ISMD
A0A176JBT8      FVCLLIGFIYTY-FIAS-------PI----YESKTDLLV---NTTPTANTA-----EPVS
A0A1I5HIC6      ILSAAAAIFISK-VFIT-------PV----YTSSTKLYI---INRQNKDTI-----TSS-
A0A1Y3TC51      AAVWLAATGWHN-LTYQ-------PE----YTSSATLVV---TVKGSSSTY-----S---
A0A1Y3T1N0      VSLWLGITGVHT-LIYE-------PA----YTSTATLVV---TVKGESSAY-----S---
A0A1Y3Y8U8      VSLWLGITGVHT-LIYE-------PV----YTSTATLVV---TVKGQTSAY-----S---
A0A5B0BQY5      LIATLIGGGIG--YTIP-------RT----YEAKTDLLV---NSMGKVEGN-----SAPT
A6CLL4          FLVTASGIILS--LSLP-------KE----YEAKVDLLV---NYSPENNQG-----SLSV
A0A174DL89      ISSIIISTIATL-FFIE-------PT----YESKISVII---GPNQSTSGD-----YSSS
A0A176U8D6      VACGVALGVYGR-FVVK-------DA----YESEASMCI---IDSNKEVSM-----S---
A0A1Q6KSQ5      LVFGIALGMYGK-FVVK-------DV----FQAEASMCI---IDSNKEVSI-----S---
A0A3D3U8B3      LVFGIALGMYGK-FVVK-------DV----FQAEASMCI---IDSNKEVSI-----S---
A0A3E5FRL7      ISLYLAATGIGK-LVYI-------PE----YTVSTTLVV---NAQGTSDTY-----T---
A0A1Y4QK93      ISLWLAATGIGK-LVYV-------PE----YTVSTTLVV---SAKGTSDTY-----T---
B1C232          ISLYLAATGIGK-LVYI-------PE----YTVSTTLVV---NAQGTSDTY-----T---
A0A401USI6      ICPTLIAGLLSF-YVIK-------PV----YEAKATVIV---GKDSTDKIT-----QS--
A0A1V4IQ10      LITTAISILYSF-YIVK-------PQ----YEASTKVFV---GKETGIEEK-----YNNN
A0A1S8TRD2      LITTAISIFYSF-YIVK-------PQ----YEACTKVFV---GKETADKEK-----YDNN
G7M1U2          LITTAISIFYSF-YIVK-------PQ----YEACTKVFV---GKETADKEK-----YDNN
A0A2T6KJ75      FYITLIGG-FSS-FAIP-------PK----FEAKTDVLV---NFTTANVVS-----SG--
A9KN92          IVCAVAAGLISK-FVMT-------PV----YTSDTKLYI---INRQNKD-T-----ITSS
A0A352MUJ1      LAFLFVGYIYNA-FITT-------PE----YKAATTLLL---VKSSEGTSS-----VTQA
R5YI67          MAFLFIGYVYNA-FVTT-------PQ----YKSATTLIL---VKAEN--SG-----TTTN
A0A1Y0IQP5      LLAVGLTGAGSF-LVLE-------PE----YEATTTLLV---QSKQAGN-V-----IAYN
A0A4R2R7B1      LLAVGLAGAGSF-LVLE-------PE----YEATTTLLV---QSKQTEK-G-----IAYN
A0A1M6E8I2      IFAAILAILVTM-VAIT-------PV----YESNTTLMV---NSSKTSSLG-----DIAS
A0A1Y4N105      LATYFAIAGVYR-LTYS-------PH----YTTTATMAV---TARGSQSGT-----YS--
A0A1Y4QP75      LATYFAIAGVYR-LTYS-------PQ----YTTTATMAV---TARGSQSGT-----YS--
A0A3D4QRB5      LLFASASGIISV-FFLD-------DV----YASSTTLIV---SKQNQNSNV-----NEIQ
A0A349DEH5      LIGAIIGAVVSE-ATKK-------ET----YTSTASFVV---NTSSDSE-K-----ASSN
A0A3D4T7B4      LIGAIIGAVVSE-ATKK-------ET----YTSTASFVV---NTSSDSE-K-----ASSN
A0A350XYC7      VIGAAIGGVAGE-ATKK-------ET----YTSTVSFVV---NSATENG-Q-----ASSG
R6DNR8          FIGAAIGGFVGH-ATRQ-------ET----YTSTVSFVV---NSATEAG-Q-----TSSG
A0A355KUM5      VIGATIGGVIGE-ATKS-------ET----YTSTVSFVV---NSATENG-Q-----VSSG
R5YGY6          VIGATIGGVIGE-ATKS-------ET----YTSTVSFVV---NSATENG-Q-----VSSG
A0A0K8J554      LIGAGLLFVVNR-FIRR-------PI----YTASVQLYV---NPNDTTP-A-----ANLN
A0A3N1XSX6      FAGLLISFIFSR-YIIN-------PS----YTAYVQLYV---IPDDTEA-S-----LNLN
A0A1C6G0U3      SIFIIVTAIFNF-YIIE-------PT----YVADTTIIV---SKSVTNT-N-----DTIS
A0A3D4LLB3      IVFAAAGAVVSI-YLIQ-------PV----YESSTTLIV---REDKDAEEK-----ISIS
A0A0A5GPA9      LLVVIIGIAIS--LLLP-------RT----YEGEGALLV---NFTSVKSDE-----DEIS
A0A271M6M4      TFMVFLGAAIS--YFMP-------PV----YQAKTDLLV---NFKAEGVES-----KDIS
A0A2V3W8U6      LLFALLAVIVNS-FIIK-------PV----YEARSDLLV---NNTVPMT-E-----ETLT
W1UFG0          IIFGLITAGVNQ-FLLK-------PV----YEANTTIIT---NKEVDEE-K-----VQMS
A0A351SRI8      LLGLILSIVYTA-KIQV-------PV----YEAKTSLVL---VNNMGENTT-----ITTT
A0A1V5LU59      ILAVGLSFVVSQ-YYLK-------PI----YKANATLFL---GKESDKIAS-----LSFA
A0A1E3BVC3      VLAAGSAFVVTQ-FYIK-------PI----YKAETTLFL---GKEKDQV-S-----LSFA
A0A4Q0I6S0      VLAAGSAFVVTQ-FYIK-------PI----YKAETTLFL---GKEKDQV-S-----LSFA
A3DF66          VLSAGTAFVVTQ-FYIK-------PV----YKAETTLFL---GKEKDQV-S-----LSFS
W4V1T8          VLAAGSAFVVTQ-FYIK-------PV----YKAETTLFL---GKEKDQV-S-----LSFA
A0A1I0RG99      FVGICSFFINSK-YIIK-------PT----YVASVQMYV---NPNETTY-S-----ADLN
A0A1I5G322      IGGLCVSFLYSK-YIIK-------PT----YIASVQMYV---NSNDSTS-S-----ADLN
A0A1C6ITD7      LISTILTAITTI-FFIE-------PT----YQANISIII---GQNQSTV-D-----EGTS
A0A381IX63      IASILIVSIKTF-FFTT-------PI----YEAQTTIII---NNLLG-K-S-----SQLT
A0A1G9IUT4      CITMFTSAGLSF-FVID-------PV----YEANTTLIV---NKVKEVN-T-----QDIT
A0A1M6RWV2      LITTITTSVVSF-FFLD-------KV----YEASTKLVL---VKGGD---------SDIQ
A0A143XPI5      SISTAAGYYYAKE-SYR-------PN----YEAYASFAV---DAGVSSYS----------
A0A355G1X5      VLCATIGWSVSFM-TTD-------PT----YTTNLSFTT---YNKAAADV----------
A0A0M6WXE3      LAGAMLFYVASSM-IYV-------PN----YRTQATFVI---TSRENANA----------
A0A348SAK2      LAGAMLFYVASSM-IYV-------PN----YRTQATFVI---TSRENANA----------
A0A1G9H5B9      ELGFGAFYMYMTR-RMP-------ET----YTATGTMYV---SSYNPEYI-------DDE
R5EFZ0          LAVGIGTYIYTDA-TYA-------PV----YRTTTTFVV---TTRGSSTS----------
A0A1Y4H8L0      LAAAMLAATVLSL-RWQ-------PA----YTTSATFAV---SSRVGASS----------
A0A4B9BMD9      KAKPGTQFVLSQRTELE-------AI----NALQETFTV---SERSKESG----------
A0A0M6WYQ8      LIFGLNSYIKARK-NYT-------PV----YTASATVAV---TTIDGSPA----------
A0A348SAK1      LIFGLNSYIKARK-NYT-------PV----YTASATVAV---TTIDGSPA----------
A0A252F281      ASAVMLTRVASET-IYK-------PE----YTSSVTMSV---TSKSGSNA----------
A0A1Y4QKE6      VICTIAFSTFRYL-TYT-------PI----YRCEATFTV---ATDSENTG---------S
B1C231          VICTIAFSTFRYL-TYT-------PI----YRCEATFTV---ATDSENTG---------S
A0A1Y3TUL5      VVLSIASYMRGEM---A-------KG----YSITSSIAV---TTQDAGGN-FT---TNTS
A0A1Y4JAX2      VVLSIASYMRGEM---A-------KG----YSITSSIAV---TTQDAGGN-FT---TNTS
A0A1Y4T590      VVLSIASYMRGEM---A-------KG----YSITSSIAV---TTQDAGGN-FT---TNTS
R5B467          VLCAAASGGYARL-SYR-------PQ----YTASMTFLV---NAGGTSQS----------
A0A1Y3T163      LAGAGGFYAFQNL-SYE-------PL----YASSATFTV---ATGDG---------ENGT
A0A1Y3YCA2      LAGAGGFYAFQNL-SYE-------PL----YASSATFTV---ATGDG---------ENGT
A0A1Y4L6N9      LIGGSIFYLRASR-FYT-------PM----YRAEAVFTV---MTSTQSNS--E---NSGS
A0A173T644      ALGSAAYYVKNSQ-FYT-------PM----YQSVASFTV---MTGGNSEN-GQ---EEGS
A0A1C5TSB8      ALGSAAYYVKNSQ-FYT-------PM----YQSVASFTV---MTGGNSEN-GQ---EEGS
C0CIK6          ALGSAAYYVKNSQ-FYT-------PM----YQSVASFTV---MTGGNSEN-GQ---EEGS
A0A1Y3WEF6      AVGAGAFYLRATRLFYT-------PM----YQSSATFTV---LTGGTMDT------ENST
A0A417T0L2      AVGAGAFYLRATSLFYT-------PM----YQSSATFTV---LTGGSTDS------ENST
A0A1H9EPU3      LCVAVIAFVYSKF-VIT-------PL----YSASTQILV---MNENSGTGNTT---TDGK
A0A354IGV3      LTGAMGAHVVLQT-IYK-------PQ----YTCSATYIV---SSKYSTVS----------
A0A417JMV2      ASMSLLSYVYVGR-NYH-------KQ----YESTSTFIV---SSKGSNNS----------
B0P408          ASMSLLSYVYVGR-NYH-------KQ----YESTSTFIV---SSKGSNNS----------
D4MV82          ASMSLLSYVYVGR-NYH-------KQ----YESTSTFIV---SSKGSNNS----------
A0A415VWX5      ASMSLLSYVYVGR-NYH-------KQ----YESTSTFIV---SSKGSNNS----------
A0A173UY96      ASMSLLSYVYVGR-NYH-------KQ----YESTSTFIV---SSKGSNNS----------
A0A173QTL1      ASMSLLSYVYVGR-SYH-------KQ----YESTSTFIV---SSKGSNNS----------
A0A174A3T7      ASMSLLSYVYVGR-NYH-------KQ----YESTSTFIV---SSKGSNNS----------
A0A174J359      ASMSLLSYVYVGR-NYH-------KQ----YESTSTFIV---SSKGSNNS----------
A0A417UUA3      ASMSLLSYVYVGR-NYH-------KQ----YESTSTFIV---SSKGSNNS----------
A0A1C6EUV9      ASMSLLAYVYVGR-SYH-------KQ----YESTSTFIV---SSKGSNNS----------
A0A173Y645      ASMSLLAYVYVGR-SYH-------KQ----YESTSTFIV---SSKGSNNS----------
A0A374AVY6      ASMSLLAYVYVGR-SYH-------KQ----YESTSTFIV---SSKGSNNS----------
R7BXS4          ASMSLLAYVYVGR-SYH-------KQ----YESTSTFIV---SSKGSNNS----------
A0A143ZUX1      VIFAVAGFLFAQ-LTYK-------PT----YSSIGSFWL---QIYSTNE-------NDQT
S3FFL2          AASLVAGLVIT--LLMT-------PQ----YTATAQIEI------SREGNQV----TNFQ
A0A6A8IF17      AVTIGAATAYL--LRTP-------AV----YTRTASVLI---KEDSKGKSVS----SDLE
A0A6C0V5C7      AVFAAAAVVYT--LFAT-------PI----YSADALVQI----EQNTGNSL-------VQ
A0A6C0V5F7      LLFTVCAGIYA--FSAT-------PV----YQADALVQV----EAKQDNSLL----KSLS
A0A328M4V1      AVFFALAVIYS--VLAT-------PI----YQSSAIVQV----ENTVPS--L----PGLE
A0A5C8HCX2      ALFTLIAVAYS--LLST-------PI----YQADTLVQV----EQKQGNAIL----SGLS
A0A1W1Z4C3      AIGFGFMYWRASKAIDT-------------YTASGTMFV---TNSNPNLVNY-------G
A0A239QN83      AIGFGVMYYRASKAPDT-------------YTASGTMFV---TNSNPNLVNY-------G
A0A3R9WAA7      VSVAMLVCVYAR-EKYS-------PR----YTAAVTFTV---NLD-----------LASD
A0A1G6BLF1      SICATLFYTHVK-MVYE-------PK----YTAEATYLV---TAAS----------YYGY
R6HZX3          ILVGALRYVQAQ-RSFV-------PQ----YTATASFSV---KSGYVGTT------DLVD
A0A1W2CEA6      LIGALIAWFYVT-RLVT-------PV----YQATSKIYI---AGSD-------------T
R7FFK6          VVGAAGTFLVSS-YVIP-------QQ----FQSNISMYV---KNSEKQN--Q----EQQ-
A0A373MPB9      IVCAILALFVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----DKT-
A0A373L519      VVCAVLALFVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----DKT-
A0A373W906      IVCAILALFVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----DKT-
A0A373VCW2      IVCAILALFVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSMGQ----DKT-
W0U604          IVCAILALFVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----DKT-
A0A374B6G0      IVCAILALFVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----DKT-
A0A373VM36      IVCAILALFVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----DKT-
A0A1C5P379      IVCAILALFVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----DKT-
A0A373XXX0      IVCAILALFVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----DKT-
A0A5R9MJM9      IVCAILALFVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----DKT-
A0A356CW82      IVCAILALFVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----DKT-
R6T4X7          IVCAILALFVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----DKT-
A0A374HTV1      IVCAILALFVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----DKT-
A0A374GB66      IVCAILALFVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----DKT-
A0A374ECC6      IVCAILALFVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----DKT-
A0A374BM61      IVCAILALFVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----DKT-
A0A373UGZ4      IVCAILALFVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----DKT-
A0A373SA66      VVCAILALFVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----DKT-
A0A1C5X6X7      IVCAILALFVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----DKT-
A0A1C6JIH3      IVCAILALFVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----DKT-
A0A373PSC3      IVCAILALFVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----DKT-
A0A1K1WYK8      IIGGIAAFSFSK-FVLP-------VK----YSSHITMYV---QS----YTGI----SENA
A0A1H6IUB1      IIGGAAAFCYSK-FVMP-------LK----YSSHISMYV---QS----YTGI----TEN-
A0A1M7L1F9      IIGGTAAFCYSK-FVMP-------LK----YSSHISMYV---QS----YTGI----SEN-
A0A1C6B4L6      IAGGILSFGFSK-MFLP-------FE----YSSHVSMYV---QS----YTGI----SDQ-
A0A1Q6T9P4      IAGGILSFGFSK-MFLP-------FE----YSSHVSMYV---QS----YTGI----SDQ-
A0A315Y4F9      VLGAGAAFGISK-FLLP-------LQ----YSSHITMYV---QS----YTGI----TEN-
A0A354K620      ILGGAAGFSVSR-FLLP-------LK----YSSHITMYV---QS----YTGI----TEN-
A0A355G3J9      LLGAMLLAGATW-ALIK-------PT----YTATAKLYV---YNEH----------STDT
A0A3D2AD87      CLCAAMTFAYCK-FVVN-------PK----YKAQSTIYV---TNGNINPGETVEEQEETD
A0A2T5IYJ6      IAITVATAFVVSTVRPV-------------YRATATLMI---EQKQ---GKT----LTSL
A0A3C0QME1      VLGGGGAYAYAH-FMMP-------NQ----YQSYTSMYV---RNSG----NI----LGDL
A0A355FYK5      VVFAAAGYFFAKASYVPIYTVSATIE----FTSTKYIKV---ADAT----GK----EELV
A0A357AQU0      VLCAAIGFSYAK-FYLP-------ET----FTSSIRMYV---KNLN----ST----ETVS
A0A3C1YJQ7      VLCAAIGFSYAK-FYLP-------ET----FTSSIRMYV---KNLN----ST----ETVS
A0A3D0JG38      VLCAAIGFSYAK-FYLP-------ET----FTSSIRMYV---KNLN----ST----ETVS
A0A3C0IHX1      LCFSAIGFSYGK-YYLP-------LE----YTSSTYMYV---KNGD----TS----EEKT
R5V506          LCFSAIGFSYGK-YYLP-------LE----YTSSTYMYV---KNGD----TS----EEKT
A0A352TIU5      LCFSAIGFSYGK-YYLP-------LE----YTSSTYMYV---KNGD----AS----EEKT
A0A3E5FSY5      VICTIAFSTFRY-LTYT-------PI----YRCEATFTV---ATDS-----E----NTGS
A0A1V5S3C0      FIFASAGFVFSR-VTYE-------ER----FSSKILFNA---SNKS-SDIAG----EAAK
A0A1Y3TC98      VAGAAGVTVYQR-VFHQ-------PM----YECSATFTV---ATGN-----S----ENGS
A0A1Q6REE0      LICAAGLTFVQR-RAYR-------PV----YEASASFTV---RVAN----------PLYA
R5ETF9          LICAAGLTFVQR-RAYR-------PV----YEASASFTV---RVAN----------PLYA
R6VAT5          GICCVGFTLYSY-AAYT-------PQ----YTAAATFTV---TPKG-----D----SLSA
A0A1Q6S448      LTCSMAAWIVLT-CFVT-------QQ----YTSSTTFSV---TTRT-------------S
A0A351MYR0      AACAMAAWIVLS-CFVT-------QQ----YTSSTTFAV---TARA-------------S
R6HPC1          AACAMAAWIVLS-CFVT-------RQ----YTSSTTFAV---TARA-------------S
A0A3D4G5Z5      AACAMAAWIVLS-CFVT-------RQ----YTSSTTFAV---TARA-------------S
A0A3D5ES03      AACAMAAWIVLS-CFVT-------RQ----YTSSTTFAV---TARA-------------S
A0A0F2P7X6      VLAALGAYFYTI-STYV-------PV----YTASASMVV---NSKQ---LKI----VGQE
A0A359B487      VLAALGAYFYTI-YTYV-------PV----YTASASMVV---NSKQ---LKI----VGQE
A0A348P5V4      ILCAGVGFGVAV-ARYT-------EH----YSSQIMFIA---SNRS----SA----ITVA
A0A356PT74      VVLAVLGFAVAK-LTYT-------PS----YSSKITFIA---NNKS----SA----LAVS
A0A3D5LL19      VVLAVLGFAVAK-LTYT-------PS----YSSKITFIA---NNKS----SA----LAVS
R5MNF0          VVLAVLGFAVAK-LTYT-------PS----YSSKITFIA---NNKS----SA----LAVS
A0A1Q9JSI0      LLLAASMSLLAY-VKVG-------RSYHKMYESTSTFIV---SGK------------GSN
A0A3D5TNI1      LIVGASCAGITK-LVEE-------PT----YTSSMTFIV---NNKSEKDLSS----SGDN
A0A358LJD0      LVVGASCAVVTK-AVEE-------PT----YTSSMTFIV---NNKSEKDLSS----SGDN
R6I3L7          LVVGASCAVITK-AVEE-------PT----YTLSMTFIV---NNKSEKDLSS----SGEN
A0A3D1HXX0      LVVGASCAVITK-AVEE-------PT----YTSSMTFIV---NNKSEKDLSS----SGDN
A0A3D2QJB8      LVVGASCAVITK-AVEE-------PT----YTLSMTFIV---NNKSEKDLSS----SGEN
D4LC36          LICGLGAFLISD-FAIP-------RK----YQSNVSMYV---RNKE----------DQKQ
R7MQJ4          IVGGAAAFGFSK-FFMP-------LK----YQSYTSMYV---KNNN----SV----TETD
A0A1V5GLC0      VIGGAAGFCYTK-FCMP-------LQ----YSSHMSMYV---QCYT----ST----SGPT
W7V182          VLGGTAAFCVSK-FLMP-------LK----YASHISMYI---QSYT----TF----NENP
                                                                            

A0A0H5SF45      GNIN-ELNYAQKVVSTYVNLLRT--------NTFYRQVLEATGL----------------
A0A1M6JRJ5      ANLS-ELDYAQKIAETYINFLNT--------RQFYAQVLELSRL----------------
A0A1M7Y1S2      ANLS-ELDYAQKIAETYINFLNT--------RQFYSQVLELSGL----------------
A0A3D5R4X5      IQLS-DINVNIRLAETYSEIIKS--------RRVASRVIDEMNL----------------
A0A1I4C3N6      INVS-DVQSAQQLITSYSSVLTS--------SIFLNDVLEASGL----------------
A0A3B9CIM7      IGSS-DITQAKNLITSYMQILKS--------RTFLEKVKEETGL----------------
A0A1G9WHW8      ITYS-EVNQAKNLISSYTQILKS--------NTFLEALKEETGL----------------
A0A1H5VAA0      ITYS-EVNQAKNLISSYTQILKS--------NTFLEALKEETGL----------------
A0A3R6VK11      ISNS-EFTQAKNLVQSYILILKS--------NTILQKVLEEAGL----------------
A0A3R6QUY7      ISNS-EFTQAKNLVQSYILILKS--------NTILQKVLEEAGL----------------
A0A373K3P9      ISNS-EFTQAKNLVQSYILILKS--------NTILQKVLEEAGL----------------
A0A3R6JRU5      ISNS-EFTQAKNLVQSYILILKS--------NTILQKVLEEAGL----------------
A0A1C5MS04      ISNS-EFTQAKNLVQSYILILKS--------NTILQKVLEEAGL----------------
A0A3C1J150      ISNS-EFTQAKNLVQSYILILKS--------NTILQKVLEEAGL----------------
A0A416CXD7      ISNS-EFTQAKNLVQSYILILKS--------NTILQKVLEEAGL----------------
R6XBL9          ISNS-EFTQAKNLVQSYILILKS--------NTILQKVLEEAGL----------------
A0A355W5Z7      ISNS-EFTQAKNLVQSYILILKS--------NTILQKVLEEAGL----------------
A0A143WVN6      -----SLTTAMNMADVFSEVFQS--------DALKKMIEADIGE----------------
W6RXP9          -----DIQMYQKLLKTYAEMIKN--------DELIEKAIREVNT----------------
W6S4G8          -----DVQMYQKLLLTYAQILKT--------EDLIGTALNNVDS----------------
A0A1G6BLB6      -----NIQSASTTATSFQTILSN--------SVVQEAVAKAAGM----------------
A0A1C6G8M0      -----DLQIGSALTNDYEGIIKS--------RVVLTKVISNLNL----------------
A0A416MP73      -----DVQLGSALTGDYEGIIKS--------RVVLNKVIENLKL----------------
A0A3E4LL92      -----AETNIENALERSVNVLNS--------DTMRDQIVKASGG----------------
A0A415D1L1      -----AETNIENALERSVNVLNS--------DTMRDQIMKASGS----------------
A0A414P2K5      -----AETNIENALERSVNVLNS--------DTMRDQIMKASGS----------------
V8C417          -----AETNIENALERSVNVLNS--------DTMRDQIMKASGS----------------
A0A143XN92      -----NLLTAQDMTNRFKNIIDS--------NILKEKIAEVLSM----------------
A0A173ZYY6      -----NLSSANTMAKTFEKILKS--------NIMEKKICEKLKV----------------
A0A4Q5EHM9      -----NLSSANTMAKTFEKILKS--------NIMEKKICEKLKV----------------
A0A173SMI2      -----NLSSANTMAKTFEKILKS--------NIMEKKICEKLKV----------------
A0A174ASH7      -----NLSSANTMAKTFEKILKS--------NIMEKKICEKLKV----------------
A6BH65          -----NLSSANTMAKTFEKILKS--------NIMEKKICEKLKV----------------
R7G0D7          -----NLSSANTMAKTFEKILKS--------NIMEKKICEKLKV----------------
A0A396G6S7      -----NLNSTKELAGQFTEILGS--------NVLKKKVAQDLGV----------------
A0A3E5A223      -----NLNSTKELAGQFTEILGS--------NVLKKKVAQDLGV----------------
R7D5E6          -----NLNSTKELAGQFTEILGS--------NVLKKKVAQDLGV----------------
A0A415HQH5      -----NLNSTKELAGQFTEILGS--------NVLKKKVAQDLGV----------------
A0A414W2C6      -----NLNSTKELAGQFTEILGS--------NVLKKKVAQDLGV----------------
A5ZNE7          -----NLNSTKELAGQFTEILGS--------NVLKKKVAQDLGV----------------
A0A395X821      -----NLNSTKELASQFTEILGS--------NVLKKKVAQDLGM----------------
A0A1C5PY68      -----NLNSTKELASQFTEILGS--------NVLKKKVAQDLGM----------------
A0A174CJF8      -----NLNSTKELASQFTEILGS--------NVLKKKVAQDLGM----------------
A0A564SRR2      -----NLNSTKELASQFTEILGS--------NVLKKKVAQDLGM----------------
A0A174R7V0      -----NLNSTKELASQFTEILGS--------NVLKKKVAQDLGM----------------
A0A373MWV2      -----SLSSTYEMTQKFQAILEN--------NILKKKVMEELGC----------------
A0A417CE88      -----SLSSTYEMTQKFQAILEN--------NILKKKVMEELGC----------------
A0A416Y441      -----SLSSTYEMTQKFQAILEN--------NILKKKVMEELGC----------------
A0A357GPJ7      -----SLSSTYEMTQKFQAILEN--------NILKKKVMEELGC----------------
A0A396PAC1      -----SLSSTYEMTQKFQAILEN--------NILKKKVMEELGC----------------
A0A416EYU4      -----SLSSTYEMTQKFQAILEN--------NILKKKVMEELGC----------------
A0A416SCQ2      -----SLSSTYEMTQKFQAILEN--------NILKKKVMEELGC----------------
A0A416TGN7      -----SLSSTYEMTQKFQAILEN--------NILKKKVMEELGC----------------
A0A417SMF6      -----SLSSTYEMTQKFQAILEN--------NILKKKVMEELGC----------------
A0A1Y4MW77      YNYYYDSSTAEQLSLTFPYILSS--------QILNDAIEADLGV----------------
R6UHV6          -----NLTATNKMAGVFKNILDS--------SQLQNSAARQLGY----------------
A0A3R9Q621      -----ELNYAQKVVNTYINFLKT--------KVFYNMLIEETRL----------------
A0A069RC75      E----SYIISQKLVDTYAVVAKS--------ETVMERTIKNLNL----------------
A0A174F2W5      -----SLSSTYEMTQKFQAILEN--------NILKKKVMEELGC----------------
A0A174S8E9      -----SLSATYEMTQKFQAILEN--------NILKKKVMEELGC----------------
A0A416ZL97      -----SLSATYEMAQKFEAILEN--------TILKKKVMEELSL----------------
A0A174LSK1      -----SLSATYEMAQKFEAILEN--------TILKKKVMEELSL----------------
A0A373GY92      -----SLSATYEMAQKFEAILEN--------TILKKKVMEELSL----------------
A0A373NZQ6      -----SLSATYEMAQKFEAILEN--------TILKKKVMEELSL----------------
A0A417I9B9      -----SLSATYEMAQKFEAILEN--------TILKKKVMEELSL----------------
A0A417MP97      -----SLSATYEMAQKFEAILEN--------TILKKKVMEELSL----------------
A0A417WQF8      -----SLSATYEMAQKFEAILEN--------TILKKKVMEELSL----------------
A0A373RZ83      -----SLSATYEMAQKFEAILEN--------TILKKKVMEELSL----------------
A0A416U6I1      -----SLSATYEMAQKFEAILEN--------TILKKKVMEELSL----------------
R7JQZ9          -----SLSATYEMAQKFEAILEN--------TILKKKVMEELSL----------------
A0A3B8KKL6      -----DIQLNNQLIADYRELLKS--------RTVAERVGEKLN-----------------
A0A2K9E6R0      -----DIQLNNQLIADYRELLKS--------RTVAERVGEKLN-----------------
A0A2S8RBI0      -----DIQLNNQLIADYRELLKS--------RTVAERVGEKLN-----------------
A0A0L6JLG6      -----DLQINSQLVVDYREILKS--------RLVAEKIQSQLG-----------------
G8LSN0          -----DIQVNNQLVSDYRELLKS--------NLVAESIEKKLG-----------------
A0A1M5UYN6      IN---DVTMYVKALETYIQIAKS--------EDVAEGARGILGD----------------
A0A176JBT8      PL---EIDASLKLIETYQYILKS--------QRMADLVIKDLDG----------------
A0A1I5HIC6      -----DLQTGSQLTQDYKILVLS--------RPVTEQVLSKLNL----------------
A0A1Y3TC51      -----SLSLTTQMADVFGQVFQS--------DALAEKIAEETG-----------------
A0A1Y3T1N0      -----SLSVTSQMADVFGEVFQS--------SALRSRIIEDVG-----------------
A0A1Y3Y8U8      -----SLSVTSQMADVFGEVFQS--------SALRSRIIEDVG-----------------
A0A5B0BQY5      MG---EIETNLRLIETYTDIFTS--------NRLVSEVKIVLGD----------------
A6CLL4          G----EVETNLRLISTYKYILKS--------PRVLEIVAERTEE----------------
A0A174DL89      QSSY-DVVMYQKMVKTYSELLTS--------KIVLQDVIENTGL----------------
A0A176U8D6      -----DLQVGSALTNDYEGIIKS--------RVVLTKAIANLKL----------------
A0A1Q6KSQ5      -----DLQIGSALTNDYEGIIKS--------RVVLTKVISNLNL----------------
A0A3D3U8B3      -----DLQIGSALTNDYEGIIKS--------RVVLTKVISNLNL----------------
A0A3E5FRL7      -----SLAMANEMADIIKEVFQS--------DVLLELVENEIG-----------------
A0A1Y4QK93      -----SLAMASEMADIIKEVFQS--------DVLLELVENEIG-----------------
B1C232          -----SLAMANEMADIIKEVFQS--------DVLLELVENEIG-----------------
A0A401USI6      -----EVMMYQDLIKTYSEIGKS--------RVVAENAIKNLKS----------------
A0A1V4IQ10      -----DVEMYQKLLKTYSELIKT--------NTLVSRALNRYDL----------------
A0A1S8TRD2      -----DVEMYQKLLKTYSELAKT--------NTLVSKALKEHNI----------------
G7M1U2          -----DVEMYQKLLKTYSELAKT--------NTLVSKALKEHNI----------------
A0A2T6KJ75      -----EIDANLRLIETYKYLMKS--------NRILTKVNGSLDE----------------
A9KN92          -----DLQTGSQLTQDFKVMVLS--------RPVTEQVISKLNL----------------
A0A352MUJ1      -----DVTLNQKLVYTYTELVKS--------DTVLNEVANRIQL----------------
R5YI67          -----DVTLNQKLVYTYSELVKS--------DSVLNEVISRVQL----------------
A0A1Y0IQP5      -----DLLTDQKLVTTYGEIFQS--------RMIAEAVIDRLSL----------------
A0A4R2R7B1      -----DLLTDQKLVTTYGEIFQS--------RMIAEAVIERLGL----------------
A0A1M6E8I2      GFDIGSINLSQKLVVTYSEIVKS--------RIVLEAVIDKIEL----------------
A0A1Y4N105      -----SLTTAMNMAEVFSEVFQS--------DTLKEKI----EA----------------
A0A1Y4QP75      -----SLTTAMNMAEVFSEVFQS--------DTLKEKI----KA----------------
A0A3D4QRB5      LS---DVNLSRNLVDTYSVIIKS--------NRVLENVVSDLGL----------------
A0A349DEH5      -----DIYVQINMAGTFRYILSS--------RVMKNAIVEKCTP----------------
A0A3D4T7B4      -----DIYVQINMAGTFRYILSS--------RVMKNAIVEKCTP----------------
A0A350XYC7      -----EINAQINMAGTFNYILSS--------PRMKEAIVEKCSE----------------
R6DNR8          -----EINAQINMAGTFSYILSS--------RALKEAIVEKCPE----------------
A0A355KUM5      -----EINAQINMAGTFSYILSS--------RALKEAIVEKCPE----------------
R5YGY6          -----EINAQINMAGTFSYILSS--------RALKEAIVEKCPE----------------
A0A0K8J554      -----ELNYAQKVVATYVNLLRT--------QKFYKKVLEETGL----------------
A0A3N1XSX6      -----ELNYAQKVVTTYINFLNT--------NVFYHDIQEESNL----------------
A0A1C6G0U3      SE---ELSVTKNLAITYANIIKS--------RAVLEKVINSMNL----------------
A0A3D4LLB3      -----DVNLSKSLVYTYAEMVKS--------HTVLDNTAKTLKI----------------
A0A0A5GPA9      SS---EIETNLRLIETYKSILIS--------PRIMDKVKAQYGS----------------
A0A271M6M4      TV---EIETNLRLIETYKYILNS--------TRIMEKVAEKTGS----------------
A0A2V3W8U6      AL---DIETNLRLIETYHFIIQS--------DRIIDLVVEELDE----------------
W1UFG0          TSD--DFTFSQRMAITYSKIITS--------DTVLNQVIDNLNL----------------
A0A351SRI8      -----DITINKNLVSTYREIIQS--------KLILNKTIENLNL----------------
A0A1V5LU59      -----DIQLNNQLVSDYRELLKS--------DLVAESV--KEKL----------------
A0A1E3BVC3      -----DIQVNNQLVVDYREILQS--------RRVAEII--NQKF----------------
A0A4Q0I6S0      -----DIQVNNQLVVDYREILQS--------RRVAEII--NQKF----------------
A3DF66          -----DIQVNNQLVVDYREILQS--------RRVAEII--NQKF----------------
W4V1T8          -----DIQVNNQLVVDYREILQS--------RRVAETI--NQKF----------------
A0A1I0RG99      -----ELNYAQKVVTTYINFLQT--------KVFYKQVIDESKL----------------
A0A1I5G322      -----ELNYAQKVVTTYISFLQT--------KKFYEQVIEESNL----------------
A0A1C6ITD7      YPGSYDVVMYQKMVKTYSEMITS--------RVVLEDVIENTGL----------------
A0A381IX63      KE---DISYSQLLGETYKPIVKS--------RKVAEEIKKNLNL----------------
A0A1G9IUT4      ND---DVLANQKLALTYGEIIKS--------RTVLDKVIKNLNI----------------
A0A1M6RWV2      YN---DVLLNQRLVKTYSEIASS--------RTIAEEVINNLKL----------------
A0A143XPI5      -SSYYNSTTIKQLSATFPYILTS--------GALRQIVMNDLGL----------------
A0A355G1X5      -VSSSDINSSIMMTNTFKYILEG--------RPMRETVAKSCSF----------------
A0A0M6WXE3      ---YNNLSSANSMAETFQKILES--------TIMKKTICEKLDM----------------
A0A348SAK2      ---YNNLSSANSMAETFQKILES--------TIMKKTICEKLDM----------------
A0A1G9H5B9      YTRPGDLSSASQLIKTLLVVVKR--------DSVMSKVADRVSE----------------
R5EFZ0          --VYSNLSSTSNLAGLFTELLNS--------SIMRKTILQETDI----------------
A0A1Y4H8L0      ---YADLNSASEMAGTFQKILQS--------SALNKILCEELEV----------------
A0A4B9BMD9      ---MLELTMTGDDPQLITRILNSIANNYLQQNIARQAAQDSQSL----------------
A0A0M6WYQ8      ---YQNNASAQQMADVFPYILTS--------GVLKDVVAKDMKL----------------
A0A348SAK1      ---YQNNASAQQMADVFPYILTS--------GVLKDVVAKDMKL----------------
A0A252F281      ---VADLNTTRQMASAFQGVLES--------DLLHETVAAAMGE----------------
A0A1Y4QKE6      YSYYYSQNTADQLSKTFPYILDS--------SYFRSILLEELGV----------------
B1C231          YSYYYSQNTADQLSKTFPYILDS--------SYFRSILLDELGV----------------
A0A1Y3TUL5      NPDSSDIQLAEDMVDAVIYVLKS--------DRTLKAAIQNIK-----------------
A0A1Y4JAX2      NPDSSDIQLAEDMVDAVIYVLKS--------DRTLKAAIQNIK-----------------
A0A1Y4T590      NPDSSDIQLAEDMVDAVIYVLKS--------DRTLKAAIQNIE-----------------
R5B467          -GSAASTATAAQMAKTFPYILTS--------GLLDSAVRADTGL----------------
A0A1Y3T163      YNFYYNRNTADQMSRTFPYILDS--------SFFRSALLERLGT----------------
A0A1Y3YCA2      YNFYYNSNTADQMSRTFPYILDS--------SFFRSALLERLGT----------------
A0A1Y4L6N9      YNFYYDSTTAGQLAKTFPYILSS--------NLLNEAIKEDLGI----------------
A0A173T644      YNFYYDTTTAGQLAKTFPYILGS--------SLLTDAIKEDLGV----------------
A0A1C5TSB8      YNFYYDTTTAGQLAKTFPYILGS--------SLLTDAIKEDLGV----------------
C0CIK6          YNFYYDTTTAGQLAKTFPYILGS--------SLLTDAIKEDLGV----------------
A0A1Y3WEF6      YNFYYDTNTVGQLAKTFPYILSS--------SLLTEAIEEDLGV----------------
A0A417T0L2      YNFYYDTTTAGQLAKTFPYILSS--------TLLTEAIEEDLGV----------------
A0A1H9EPU3      SVSVSDLQSSTFLVKDYTYMITS--------KPVMKSVIDEYGL----------------
A0A354IGV3      ---YSNISATSDTASLFSKLLDS--------QVLRKHAAEAIGV----------------
A0A417JMV2      --IYSDLSATSEMATKFSEILNS--------SILQKKVAKEMDM----------------
B0P408          --VYSDLSATSEMATKFSEILNS--------SILQKKVAKEMDM----------------
D4MV82          --VYSDLSATSEMATKFSEILNS--------SILQKKVAKEMDM----------------
A0A415VWX5      --VYSDLSATSEMATKFSEILNS--------SILQKKVAKEMDM----------------
A0A173UY96      --VYSDLSATSEMATKFSEILNS--------SILQKKVAKEMDM----------------
A0A173QTL1      --VYSDLSATSEMATKFSEILNS--------SILQKKVAKEMDM----------------
A0A174A3T7      --VYSDLSATSEMATKFSEILNS--------SILQKKVAKEMDM----------------
A0A174J359      --VYSDLSATSEMATKFSEILNS--------SILQKKVAKEMDM----------------
A0A417UUA3      --VYSDLSATSEMATKFSEILNS--------SILQKKVAKEMDM----------------
A0A1C6EUV9      --VYSDLGTTTEMATKFSEILNS--------SILQKKVAKEMNM----------------
A0A173Y645      --VYSDLSTTTEMATKFSEILNS--------SILQKKVAKEMNM----------------
A0A374AVY6      --VYSDLSTTTEMATKFSEILNS--------SILQKKVAKEMNM----------------
R7BXS4          --VYSDLSTTTEMATKFSEILNS--------SILQKKVAKEMNM----------------
A0A143ZUX1      KLVMSDIQAATGLAQTYQYFLTG--------ADTIDYVLEESGLD---------------
S3FFL2          GVERNSNQVDQEFYQTQYGLLRS--------RSLSERVATQLRL--VDDPGFFEMFGVGR
A0A6A8IF17      SFSEFGLFQSGTNVNNELITFRS--------PSLMTEVVKRLRLDMN-----YFVRGKFH
A0A6C0V5C7      DIGS-ALANKPPASDAEIQLIQS--------RLVLGKTVHDLGLDISVTKNTFPIFGAGW
A0A6C0V5F7      QFGS-DL---SPDVAPELLLLKS--------RMILGETVDQLGLTYHVKRRVLPVIGPVW
A0A328M4V1      DLAQ-TLGTSTSQAVTEIALLTS--------RTVVGGAIDNLKLEIESEPERFPVIGNFM
A0A5C8HCX2      DM----IPNSSPESAPEIQLLQS--------RMILGKTIAELNLRDIVEQKYFPIVGRGW
A0A1W1Z4C3      YTSTSDISSAVQLVNIYSEVVKS--------ETVMQKVLEYAIE----------------
A0A239QN83      YTSTSDISSAVQLVNIYSEVVKS--------ETVMQRVLEYAIE----------------
A0A3R9WAA7      GSIYEDSMRASQLSATFPYIVTS--------SILKNIIAEE-------------------
A0A1G6BLF1      TESYYNETTASGLATSLEYVLNS--------TVMQKTVAEA-------------------
R6HZX3          STQYYDNQAAEQVVSSFPYIICS--------EAMQERICLA-------------------
A0A1W2CEA6      TISLSDLQLGSTLATDYQEVFKI--------WHVHEMVDERLDL----------------
R7FFK6          GINNNDLTVSKSLVSTYIVILNN--------DVVMDEVGNQLAK----------------
A0A373MPB9      NVDLQDIDASKSLVQTYIVILTD--------DPVMNEVSDKLLE----------------
A0A373L519      NVDLQDINASKSLVQTYIVILTD--------DPVMNEVSDKLLE----------------
A0A373W906      NVDLQDINASKSLVQTYIVILTD--------DPVMNEVSDKLLE----------------
A0A373VCW2      NVDLQDIDASKSLVQTYIVILTD--------DPVMNEVSDKLLE----------------
W0U604          NVDLQDINASKSLVQTYIVILTD--------DPVMNEVSDKLLE----------------
A0A374B6G0      NVDLQDINASKSLVQTYIVILTD--------DPVMNEVSDKLLE----------------
A0A373VM36      NVDLQDINASKSLVQTYIVILTD--------DPVMNEVSDKLLE----------------
A0A1C5P379      NVDLQDINASKSLVQTYIVILTD--------DPVMNEVSDKLLE----------------
A0A373XXX0      NVDLQDINASKSLVQTYIVILTD--------DPVMNEVSDKLLE----------------
A0A5R9MJM9      NVDLQDINASKSLVQTYIVILTD--------DPVMNEVSDKLLE----------------
A0A356CW82      NVDLQDINASKSLVQTYIVILTD--------DPVMNEVSDKLLE----------------
R6T4X7          NVDLQDINASKSLVQTYIVILTD--------DPVMNEVSDKLLE----------------
A0A374HTV1      NVDLQDINASKSLVQTYIVILTD--------DPVMNEVSDKLLE----------------
A0A374GB66      NVDLQDINASKSLVQTYIVILTD--------DPVMNEVSDKLLE----------------
A0A374ECC6      NVDLQDINASKSLVQTYIVILTD--------DPVMNEVSDKLLE----------------
A0A374BM61      NVDLQDINASKSLVQTYIVILTD--------DPVMNEVSDKLLE----------------
A0A373UGZ4      NVDLQDINASKSLVQTYIVILTD--------DPVMNEVSDKLLE----------------
A0A373SA66      NVDLQDINASKSLVQTYIVILTD--------DPVMNEVSDKLLE----------------
A0A1C5X6X7      NVDLQDINASKSLVQTYIVILTD--------DPVMNEVSDKLLE----------------
A0A1C6JIH3      NVDLQDINASKSLVQTYIVILTD--------DPVMNEVSDKLLE----------------
A0A373PSC3      NVDLQDINASKSLVQTYIVILTD--------DPVMNEVSDKLLE----------------
A0A1K1WYK8      ANDVNNISNSKQLVNTYMEVLKD--------DEVMNAVSAKLLE----------------
A0A1H6IUB1      ANQQNNISNSKQLVNTYMEVLKD--------DAVMNAVGDKLLT----------------
A0A1M7L1F9      ANQQNNISNSKQLVNTYMEVLKD--------DAVMNSVGELLKK----------------
A0A1C6B4L6      MADQNNISNSKQLVNTYMEVLKD--------DAVMAAIGELLLE----------------
A0A1Q6T9P4      MADQNNISNSKQLVNTYMEVLKD--------DAVMAAIGELLLE----------------
A0A315Y4F9      ANSANNISNSKQLVNTYMEVLKD--------DAVMNAVAEKLSK----------------
A0A354K620      ANNVNNISNSKQLVNTYMEVLKD--------DAVMNAVAEKLAK----------------
A0A355G3J9      YITSSDLAVSKSLVDTYLIIIKS--------DPVLDKVQKDLAA----------------
A0A3D2AD87      GVKGTDVSASVSLSFTVVDILKQ--------PDIYREMVNTIEK----------------
A0A2T5IYJ6      DDVYGTDGGKEYYLQTQFEILKS--------RELATRVVTELNI----------------
A0A3C0QME1      DINISALNASRSLLDTYTVVLKS--------NYVMGEVAERLEM----------------
A0A355FYK5      TVV---VPYENNDINRYSTLMKS--------DAMIYALADKLNN----------------
A0A357AQU0      SVTTSDLNASKSLVMTYIVILKD--------PVVVGEVAETLAE----------------
A0A3C1YJQ7      SVTTSDLNASKSLVMTYIVILKD--------PVVVGEVAETLAE----------------
A0A3D0JG38      SVTTSDLNASKSLVMTYIVILKD--------PVVVGEVAETLAE----------------
A0A3C0IHX1      AINQQDLMASKSLVETYIVILKN--------DTVVKQVGMSLVS----------------
R5V506          AINQQDLMASKSLVETYIVILKN--------DTVVKQVGMSLVS----------------
A0A352TIU5      AINQQDLMASKSLVETYIVILKN--------DTVVKQVGMSLVS----------------
A0A3E5FSY5      YSYYYSQNTADQLSKTFPYILDS--------SYFRSILLDELG-----------------
A0A1V5S3C0      YTTASDVQASVTFATSFKFILTE--------TDYIYSLVKQAVK----------------
A0A1Y3TC98      YSFYYNSSTADQMSLTFPYILES--------NFFQSALMEELG-----------------
A0A1Q6REE0      SVSSYNEKTAQVMADTFPSILTS--------GLLQRRVMEELG-----------------
R5ETF9          SVSSYNEKTAQVMADTFPSILTS--------GLLQRRVMDELG-----------------
R6VAT5          YTSISSNASTQQLEKTFPYIITS--------APLTRVVAEDLG-----------------
A0A1Q6S448      NLYYTNITAAADVAASYSQLLQS--------RVLRQTMEQNLG-----------------
A0A351MYR0      TLYYTNITAAADMASSYTQLLQS--------RVLRQTMEQDLG-----------------
R6HPC1          TLYYTNITAAADMAASYSQLLQS--------RVLRQTMEQNLG-----------------
A0A3D4G5Z5      TLYYTNITAAADMAASYSQLLQS--------RVLRQTMEQNLG-----------------
A0A3D5ES03      TLYYTNITAAADMAASYSQLLQS--------RVLRQTMEQNLG-----------------
A0A0F2P7X6      AVLTNDVNLSAKLVNTYTAVLTS--------NRVMELVAGELD-----------------
A0A359B487      AVLTNDVNLSAKLVNTYTAVLTS--------NRVMELVAGELD-----------------
A0A348P5V4      GQSSSDINASVSLAESFKYVFTT--------TELATKVANSCGY----------------
A0A356PT74      GQTQSDLNASATLAESFKYVFTT--------TELSKRVADNSGF----------------
A0A3D5LL19      GQTQSDLNASATLAESFKYVFTT--------TELSKRVADNSGF----------------
R5MNF0          GQTQSDLNASATLAESFKYVFTT--------TELSKRVADNSGF----------------
A0A1Q9JSI0      NNVYSNLNTTAQMATKFSEILNS--------SILQKKVAKEMN-----------------
A0A3D5TNI1      SVSYNDMSASAYMANTFVHLMTG--------RTMCNAIAAECKT----------------
A0A358LJD0      SVSYNDMSASAYMANTFVHLMTG--------RTMCNAIASECKS----------------
R6I3L7          SVSYNDMSASAYMANTFVHLMTG--------RTMCNAIAAECKS----------------
A0A3D1HXX0      SVSYNDMSASAYMANTFVHLMTG--------RTMCNAIAAECKS----------------
A0A3D2QJB8      SVSYNDMSASAYMANTFVHLMTG--------RTMCNAIAAECKS----------------
D4LC36          DINNSDLSVSKSLVSTYIVILNN--------DAVMEQVGEQLLK----------------
R7MQJ4          GVNLNDLNASKSLVSTYIAVMQD--------DAVMEKVGSELLA----------------
A0A1V5GLC0      D--YNDISKSKQLINTYIEVLKD--------DAVMNAVGGKLMN----------------
W7V182          DQNFNNINNSKQLINTYMEVMKD--------DAVMNAVAEELRG----------------
                                                                            

A0A0H5SF45      ------------------------------------------------------------
A0A1M6JRJ5      ------------------------------------------------------------
A0A1M7Y1S2      ------------------------------------------------------------
A0A3D5R4X5      ------------------------------------------------------------
A0A1I4C3N6      ------------------------------------------------------------
A0A3B9CIM7      ------------------------------------------------------------
A0A1G9WHW8      ------------------------------------------------------------
A0A1H5VAA0      ------------------------------------------------------------
A0A3R6VK11      ------------------------------------------------------------
A0A3R6QUY7      ------------------------------------------------------------
A0A373K3P9      ------------------------------------------------------------
A0A3R6JRU5      ------------------------------------------------------------
A0A1C5MS04      ------------------------------------------------------------
A0A3C1J150      ------------------------------------------------------------
A0A416CXD7      ------------------------------------------------------------
R6XBL9          ------------------------------------------------------------
A0A355W5Z7      ------------------------------------------------------------
A0A143WVN6      ------------------------------------------------------------
W6RXP9          ------------------------------------------------------------
W6S4G8          ------------------------------------------------------------
A0A1G6BLB6      ------------------------------------------------------------
A0A1C6G8M0      ------------------------------------------------------------
A0A416MP73      ------------------------------------------------------------
A0A3E4LL92      ------------------------------------------------------------
A0A415D1L1      ------------------------------------------------------------
A0A414P2K5      ------------------------------------------------------------
V8C417          ------------------------------------------------------------
A0A143XN92      ------------------------------------------------------------
A0A173ZYY6      ------------------------------------------------------------
A0A4Q5EHM9      ------------------------------------------------------------
A0A173SMI2      ------------------------------------------------------------
A0A174ASH7      ------------------------------------------------------------
A6BH65          ------------------------------------------------------------
R7G0D7          ------------------------------------------------------------
A0A396G6S7      ------------------------------------------------------------
A0A3E5A223      ------------------------------------------------------------
R7D5E6          ------------------------------------------------------------
A0A415HQH5      ------------------------------------------------------------
A0A414W2C6      ------------------------------------------------------------
A5ZNE7          ------------------------------------------------------------
A0A395X821      ------------------------------------------------------------
A0A1C5PY68      ------------------------------------------------------------
A0A174CJF8      ------------------------------------------------------------
A0A564SRR2      ------------------------------------------------------------
A0A174R7V0      ------------------------------------------------------------
A0A373MWV2      ------------------------------------------------------------
A0A417CE88      ------------------------------------------------------------
A0A416Y441      ------------------------------------------------------------
A0A357GPJ7      ------------------------------------------------------------
A0A396PAC1      ------------------------------------------------------------
A0A416EYU4      ------------------------------------------------------------
A0A416SCQ2      ------------------------------------------------------------
A0A416TGN7      ------------------------------------------------------------
A0A417SMF6      ------------------------------------------------------------
A0A1Y4MW77      ------------------------------------------------------------
R6UHV6          ------------------------------------------------------------
A0A3R9Q621      ------------------------------------------------------------
A0A069RC75      ------------------------------------------------------------
A0A174F2W5      ------------------------------------------------------------
A0A174S8E9      ------------------------------------------------------------
A0A416ZL97      ------------------------------------------------------------
A0A174LSK1      ------------------------------------------------------------
A0A373GY92      ------------------------------------------------------------
A0A373NZQ6      ------------------------------------------------------------
A0A417I9B9      ------------------------------------------------------------
A0A417MP97      ------------------------------------------------------------
A0A417WQF8      ------------------------------------------------------------
A0A373RZ83      ------------------------------------------------------------
A0A416U6I1      ------------------------------------------------------------
R7JQZ9          ------------------------------------------------------------
A0A3B8KKL6      ------------------------------------------------------------
A0A2K9E6R0      ------------------------------------------------------------
A0A2S8RBI0      ------------------------------------------------------------
A0A0L6JLG6      ------------------------------------------------------------
G8LSN0          ------------------------------------------------------------
A0A1M5UYN6      ------------------------------------------------------------
A0A176JBT8      ------------------------------------------------------------
A0A1I5HIC6      ------------------------------------------------------------
A0A1Y3TC51      ------------------------------------------------------------
A0A1Y3T1N0      ------------------------------------------------------------
A0A1Y3Y8U8      ------------------------------------------------------------
A0A5B0BQY5      ------------------------------------------------------------
A6CLL4          ------------------------------------------------------------
A0A174DL89      ------------------------------------------------------------
A0A176U8D6      ------------------------------------------------------------
A0A1Q6KSQ5      ------------------------------------------------------------
A0A3D3U8B3      ------------------------------------------------------------
A0A3E5FRL7      ------------------------------------------------------------
A0A1Y4QK93      ------------------------------------------------------------
B1C232          ------------------------------------------------------------
A0A401USI6      ------------------------------------------------------------
A0A1V4IQ10      ------------------------------------------------------------
A0A1S8TRD2      ------------------------------------------------------------
G7M1U2          ------------------------------------------------------------
A0A2T6KJ75      ------------------------------------------------------------
A9KN92          ------------------------------------------------------------
A0A352MUJ1      ------------------------------------------------------------
R5YI67          ------------------------------------------------------------
A0A1Y0IQP5      ------------------------------------------------------------
A0A4R2R7B1      ------------------------------------------------------------
A0A1M6E8I2      ------------------------------------------------------------
A0A1Y4N105      ------------------------------------------------------------
A0A1Y4QP75      ------------------------------------------------------------
A0A3D4QRB5      ------------------------------------------------------------
A0A349DEH5      ------------------------------------------------------------
A0A3D4T7B4      ------------------------------------------------------------
A0A350XYC7      ------------------------------------------------------------
R6DNR8          ------------------------------------------------------------
A0A355KUM5      ------------------------------------------------------------
R5YGY6          ------------------------------------------------------------
A0A0K8J554      ------------------------------------------------------------
A0A3N1XSX6      ------------------------------------------------------------
A0A1C6G0U3      ------------------------------------------------------------
A0A3D4LLB3      ------------------------------------------------------------
A0A0A5GPA9      ------------------------------------------------------------
A0A271M6M4      ------------------------------------------------------------
A0A2V3W8U6      ------------------------------------------------------------
W1UFG0          ------------------------------------------------------------
A0A351SRI8      ------------------------------------------------------------
A0A1V5LU59      ------------------------------------------------------------
A0A1E3BVC3      ------------------------------------------------------------
A0A4Q0I6S0      ------------------------------------------------------------
A3DF66          ------------------------------------------------------------
W4V1T8          ------------------------------------------------------------
A0A1I0RG99      ------------------------------------------------------------
A0A1I5G322      ------------------------------------------------------------
A0A1C6ITD7      ------------------------------------------------------------
A0A381IX63      ------------------------------------------------------------
A0A1G9IUT4      ------------------------------------------------------------
A0A1M6RWV2      ------------------------------------------------------------
A0A143XPI5      ------------------------------------------------------------
A0A355G1X5      ------------------------------------------------------------
A0A0M6WXE3      ------------------------------------------------------------
A0A348SAK2      ------------------------------------------------------------
A0A1G9H5B9      ------------------------------------------------------------
R5EFZ0          ------------------------------------------------------------
A0A1Y4H8L0      ------------------------------------------------------------
A0A4B9BMD9      ------------------------------------------------------------
A0A0M6WYQ8      ------------------------------------------------------------
A0A348SAK1      ------------------------------------------------------------
A0A252F281      ------------------------------------------------------------
A0A1Y4QKE6      ------------------------------------------------------------
B1C231          ------------------------------------------------------------
A0A1Y3TUL5      ------------------------------------------------------------
A0A1Y4JAX2      ------------------------------------------------------------
A0A1Y4T590      ------------------------------------------------------------
R5B467          ------------------------------------------------------------
A0A1Y3T163      ------------------------------------------------------------
A0A1Y3YCA2      ------------------------------------------------------------
A0A1Y4L6N9      ------------------------------------------------------------
A0A173T644      ------------------------------------------------------------
A0A1C5TSB8      ------------------------------------------------------------
C0CIK6          ------------------------------------------------------------
A0A1Y3WEF6      ------------------------------------------------------------
A0A417T0L2      ------------------------------------------------------------
A0A1H9EPU3      ------------------------------------------------------------
A0A354IGV3      ------------------------------------------------------------
A0A417JMV2      ------------------------------------------------------------
B0P408          ------------------------------------------------------------
D4MV82          ------------------------------------------------------------
A0A415VWX5      ------------------------------------------------------------
A0A173UY96      ------------------------------------------------------------
A0A173QTL1      ------------------------------------------------------------
A0A174A3T7      ------------------------------------------------------------
A0A174J359      ------------------------------------------------------------
A0A417UUA3      ------------------------------------------------------------
A0A1C6EUV9      ------------------------------------------------------------
A0A173Y645      ------------------------------------------------------------
A0A374AVY6      ------------------------------------------------------------
R7BXS4          ------------------------------------------------------------
A0A143ZUX1      ------------------------------------------------------------
S3FFL2          E-------------------------------------------------DQGPFALVNN
A0A6A8IF17      R-QVAYGLTLPVDVTINDLPENESAGFTLEIQP--------DGTLYLSDFIRNGTDLEEK
A0A6C0V5C7      D-RLMGRSNDTVKVTDFVLPKGAG-----------------DQTFTLTVLGPKQYQLTSD
A0A6C0V5F7      E-QIRGRKSDEITIGALTIPLLEGE----------------PQTLLLTVQDQGRFHLEGK
A0A328M4V1      ARRYTPPVPGAVAPPFAGLSSYDWGGSSLDIYQLDVPRSLLDQQLYLDAGQNGTYTLSDD
A0A5C8HCX2      A-RLTKEKPGELAISWMHIPQLNGQ----------------DQQLTLTVGENGHYTLEGE
A0A1W1Z4C3      ------------------------------------------------------------
A0A239QN83      ------------------------------------------------------------
A0A3R9WAA7      ------------------------------------------------------------
A0A1G6BLF1      ------------------------------------------------------------
R6HZX3          ------------------------------------------------------------
A0A1W2CEA6      ------------------------------------------------------------
R7FFK6          ------------------------------------------------------------
A0A373MPB9      ------------------------------------------------------------
A0A373L519      ------------------------------------------------------------
A0A373W906      ------------------------------------------------------------
A0A373VCW2      ------------------------------------------------------------
W0U604          ------------------------------------------------------------
A0A374B6G0      ------------------------------------------------------------
A0A373VM36      ------------------------------------------------------------
A0A1C5P379      ------------------------------------------------------------
A0A373XXX0      ------------------------------------------------------------
A0A5R9MJM9      ------------------------------------------------------------
A0A356CW82      ------------------------------------------------------------
R6T4X7          ------------------------------------------------------------
A0A374HTV1      ------------------------------------------------------------
A0A374GB66      ------------------------------------------------------------
A0A374ECC6      ------------------------------------------------------------
A0A374BM61      ------------------------------------------------------------
A0A373UGZ4      ------------------------------------------------------------
A0A373SA66      ------------------------------------------------------------
A0A1C5X6X7      ------------------------------------------------------------
A0A1C6JIH3      ------------------------------------------------------------
A0A373PSC3      ------------------------------------------------------------
A0A1K1WYK8      ------------------------------------------------------------
A0A1H6IUB1      ------------------------------------------------------------
A0A1M7L1F9      ------------------------------------------------------------
A0A1C6B4L6      ------------------------------------------------------------
A0A1Q6T9P4      ------------------------------------------------------------
A0A315Y4F9      ------------------------------------------------------------
A0A354K620      ------------------------------------------------------------
A0A355G3J9      ------------------------------------------------------------
A0A3D2AD87      ------------------------------------------------------------
A0A2T5IYJ6      ------------------------------------------------------------
A0A3C0QME1      ------------------------------------------------------------
A0A355FYK5      ------------------------------------------------------------
A0A357AQU0      ------------------------------------------------------------
A0A3C1YJQ7      ------------------------------------------------------------
A0A3D0JG38      ------------------------------------------------------------
A0A3C0IHX1      ------------------------------------------------------------
R5V506          ------------------------------------------------------------
A0A352TIU5      ------------------------------------------------------------
A0A3E5FSY5      ------------------------------------------------------------
A0A1V5S3C0      ------------------------------------------------------------
A0A1Y3TC98      ------------------------------------------------------------
A0A1Q6REE0      ------------------------------------------------------------
R5ETF9          ------------------------------------------------------------
R6VAT5          ------------------------------------------------------------
A0A1Q6S448      ------------------------------------------------------------
A0A351MYR0      ------------------------------------------------------------
R6HPC1          ------------------------------------------------------------
A0A3D4G5Z5      ------------------------------------------------------------
A0A3D5ES03      ------------------------------------------------------------
A0A0F2P7X6      ------------------------------------------------------------
A0A359B487      ------------------------------------------------------------
A0A348P5V4      ------------------------------------------------------------
A0A356PT74      ------------------------------------------------------------
A0A3D5LL19      ------------------------------------------------------------
R5MNF0          ------------------------------------------------------------
A0A1Q9JSI0      ------------------------------------------------------------
A0A3D5TNI1      ------------------------------------------------------------
A0A358LJD0      ------------------------------------------------------------
R6I3L7          ------------------------------------------------------------
A0A3D1HXX0      ------------------------------------------------------------
A0A3D2QJB8      ------------------------------------------------------------
D4LC36          ------------------------------------------------------------
R7MQJ4          ------------------------------------------------------------
A0A1V5GLC0      ------------------------------------------------------------
W7V182          ------------------------------------------------------------
                                                                            

A0A0H5SF45      ---------------------------------------------NYSVQQ----LKAMT
A0A1M6JRJ5      ---------------------------------------------PYSMPD----LKKMT
A0A1M7Y1S2      ---------------------------------------------PYSVTD----LRNMT
A0A3D5R4X5      ---------------------------------------------DISYEG----LRNIT
A0A1I4C3N6      -------------------------------------------QDQYSVLA----LQRRI
A0A3B9CIM7      ---------------------------------------------GYSTDY----LKSQI
A0A1G9WHW8      ---------------------------------------------NYSTST----FKNII
A0A1H5VAA0      ---------------------------------------------NYSTST----FKNII
A0A3R6VK11      ---------------------------------------------DYGTEA----LSGRI
A0A3R6QUY7      ---------------------------------------------DYGTEA----LSGRI
A0A373K3P9      ---------------------------------------------DYGTEA----LSGRI
A0A3R6JRU5      ---------------------------------------------DYGTEA----LSGRI
A0A1C5MS04      ---------------------------------------------DYGTEA----LSGRI
A0A3C1J150      ---------------------------------------------DYGTEA----LSGRI
A0A416CXD7      ---------------------------------------------DYGTEA----LSGRI
R6XBL9          ---------------------------------------------DYGTEA----LSGRI
A0A355W5Z7      ---------------------------------------------DYGTEA----LSGRI
A0A143WVN6      -------------------------------------------------SN----IQGTI
W6RXP9          ---------------------------------------------TMTAEE----ILDSL
W6S4G8          ---------------------------------------------DMTMEE----VMKDI
A0A1G6BLB6      -------------------------------------------------DS----IPGTV
A0A1C6G8M0      ---------------------------------------------DIAYKS----LYNAV
A0A416MP73      ---------------------------------------------DLTYKQ----LYNIV
A0A3E4LL92      -------------------------------------------------SR----VQGNL
A0A415D1L1      -------------------------------------------------SR----VKGNL
A0A414P2K5      -------------------------------------------------SR----VKGNL
V8C417          -------------------------------------------------SR----VKGNL
A0A143XN92      -------------------------------------------------DS----FDAEA
A0A173ZYY6      -------------------------------------------------EE----LDADI
A0A4Q5EHM9      -------------------------------------------------EE----LDADI
A0A173SMI2      -------------------------------------------------EE----LDADI
A0A174ASH7      -------------------------------------------------EE----LDADI
A6BH65          -------------------------------------------------EE----LDADI
R7G0D7          -------------------------------------------------EE----LDADI
A0A396G6S7      -------------------------------------------------NS----LEVET
A0A3E5A223      -------------------------------------------------NS----LEVET
R7D5E6          -------------------------------------------------NS----LEVET
A0A415HQH5      -------------------------------------------------NS----LEVET
A0A414W2C6      -------------------------------------------------NS----LEVET
A5ZNE7          -------------------------------------------------NS----LEVET
A0A395X821      -------------------------------------------------NN----LNVET
A0A1C5PY68      -------------------------------------------------NN----LNVKT
A0A174CJF8      -------------------------------------------------NN----LNVKT
A0A564SRR2      -------------------------------------------------NN----LNVKT
A0A174R7V0      -------------------------------------------------NN----LNVKT
A0A373MWV2      -------------------------------------------------SS----FPADM
A0A417CE88      -------------------------------------------------SS----FPADM
A0A416Y441      -------------------------------------------------SS----FPADM
A0A357GPJ7      -------------------------------------------------SS----FPADM
A0A396PAC1      -------------------------------------------------SS----FPADM
A0A416EYU4      -------------------------------------------------SS----FPADM
A0A416SCQ2      -------------------------------------------------SS----FPADM
A0A416TGN7      -------------------------------------------------SS----FPADM
A0A417SMF6      -------------------------------------------------SS----FPADM
A0A1Y4MW77      -------------------------------------------------EA----INGSI
R6UHV6          -------------------------------------------------TS----FPGNL
A0A3R9Q621      ---------------------------------------------PYTVDM----LKDCI
A0A069RC75      ---------------------------------------------RVSPQK----LLKKV
A0A174F2W5      -------------------------------------------------SS----FPADM
A0A174S8E9      -------------------------------------------------SS----FPADM
A0A416ZL97      -------------------------------------------------SS----FPAKM
A0A174LSK1      -------------------------------------------------SS----FPAKM
A0A373GY92      -------------------------------------------------SS----FPAKM
A0A373NZQ6      -------------------------------------------------SS----FPAKM
A0A417I9B9      -------------------------------------------------SS----FPAKM
A0A417MP97      -------------------------------------------------SS----FPAKM
A0A417WQF8      -------------------------------------------------SS----FPAKM
A0A373RZ83      -------------------------------------------------SS----FPAKM
A0A416U6I1      -------------------------------------------------SS----FPAKM
R7JQZ9          -------------------------------------------------SS----FPAKM
A0A3B8KKL6      ----------------------------------------------VSPSK----LLSNV
A0A2K9E6R0      ----------------------------------------------VSPSK----LLSNV
A0A2S8RBI0      ----------------------------------------------VSPSK----LLSNV
A0A0L6JLG6      ----------------------------------------------VEAKA----FQNNV
G8LSN0          ----------------------------------------------VSAAK----FKRSV
A0A1M5UYN6      ---------------------------------------------RYSSGQ----LMGML
A0A176JBT8      ---------------------------------------------LLTEDE----FLDNV
A0A1I5HIC6      ---------------------------------------------DMTHEE----LVSNI
A0A1Y3TC51      -------------------------------------------------EE----IAGKI
A0A1Y3T1N0      -------------------------------------------------EE----ITGDI
A0A1Y3Y8U8      -------------------------------------------------EE----IAGDI
A0A5B0BQY5      ---------------------------------------------SYAKPE----VAKKV
A6CLL4          ---------------------------------------------NDNVQC----LNEQI
A0A174DL89      ---------------------------------------------DLNLES----LESMI
A0A176U8D6      ---------------------------------------------DIEYKD----LYNAV
A0A1Q6KSQ5      ---------------------------------------------NIAYKS----LYNAV
A0A3D3U8B3      ---------------------------------------------NIAYKS----LYNAV
A0A3E5FRL7      -------------------------------------------------KT----NQGTI
A0A1Y4QK93      -------------------------------------------------KT----NQGTI
B1C232          -------------------------------------------------KT----NQGTI
A0A401USI6      ---------------------------------------------GIVVKE----FMLDL
A0A1V4IQ10      ---------------------------------------------DSQSSA----VLSSL
A0A1S8TRD2      ---------------------------------------------DLQSSA----VLNTL
G7M1U2          ---------------------------------------------DLQSSA----VLNAL
A0A2T6KJ75      ---------------------------------------------TYKKGE----ISQKV
A9KN92          ---------------------------------------------NMTHDE----LVSNI
A0A352MUJ1      ---------------------------------------------NRSVGQ----LRKNV
R5YI67          ---------------------------------------------DKTTAQ----LRKNV
A0A1Y0IQP5      ---------------------------------------------NSTEQE----LLEKI
A0A4R2R7B1      ---------------------------------------------DLTEQE----LLENV
A0A1M6E8I2      ---------------------------------------------DMTYNE----LLEDI
A0A1Y4N105      ---------------------------------------------DLEVDN----LDYQI
A0A1Y4QP75      ---------------------------------------------DLEVDN----LDYQI
A0A3D4QRB5      ---------------------------------------------NISVNE----LKSKI
A0A349DEH5      ---------------------------------------------KVDFGT----VDRSI
A0A3D4T7B4      ---------------------------------------------KVDFGT----VDRSI
A0A350XYC7      ---------------------------------------------KVTYGL----VDRSI
R6DNR8          ---------------------------------------------KLNYST----VDKSI
A0A355KUM5      ---------------------------------------------KVNFGT----VDKSI
R5YGY6          ---------------------------------------------KVNFGT----VDKSI
A0A0K8J554      ---------------------------------------------NYSESQ----LKNMT
A0A3N1XSX6      ---------------------------------------------NYSINE----LKHMT
A0A1C6G0U3      ---------------------------------------------ENSYEE----VYSSI
A0A3D4LLB3      ---------------------------------------------D---KL----DDKSI
A0A0A5GPA9      ---------------------------------------------DLEMEE----LVQRF
A0A271M6M4      ---------------------------------------------KEKPEQ----LAKKI
A0A2V3W8U6      ---------------------------------------------PFTNNE----LQKKL
W1UFG0          ---------------------------------------------KMKAKK----LAKYI
A0A351SRI8      ---------------------------------------------DISYEE----LKKNV
A0A1V5LU59      ---------------------------------------------GVDIKK----FKSNV
A0A1E3BVC3      ---------------------------------------------GVGISE----FQNNV
A0A4Q0I6S0      ---------------------------------------------GVGISE----FQNNV
A3DF66          ---------------------------------------------GVGIQE----FQKNV
W4V1T8          ---------------------------------------------GVGIRE----FQNNV
A0A1I0RG99      ---------------------------------------------NYTPMQ----LKAMT
A0A1I5G322      ---------------------------------------------RLSREQ----LKNMT
A0A1C6ITD7      ---------------------------------------------DLNLAD----LESMI
A0A381IX63      ---------------------------------------------EEDYHA----ISNSI
A0A1G9IUT4      ---------------------------------------------DTDVKK----LSNDI
A0A1M6RWV2      ---------------------------------------------NMSYGE----FSNKV
A0A143XPI5      -------------------------------------------------EE----MNVNI
A0A355G1X5      -------------------------------------------------NISADQLRHYV
A0A0M6WXE3      -------------------------------------------------DK----LDADI
A0A348SAK2      -------------------------------------------------DK----LDADI
A0A1G9H5B9      -------------------------------------------------TH-----PGID
R5EFZ0          -------------------------------------------------SS----FDGTI
A0A1Y4H8L0      -------------------------------------------------DS----IDAAI
A0A4B9BMD9      -------------------------------------------------EFLQRQLPEVR
A0A0M6WYQ8      -------------------------------------------------DS----VPGSI
A0A348SAK1      -------------------------------------------------DS----VPGSI
A0A252F281      -------------------------------------------------TS----LPAQL
A0A1Y4QKE6      -------------------------------------------------NS----LNGTL
B1C231          -------------------------------------------------NS----LNGTL
A0A1Y3TUL5      -------------------------------------------------------LVGIV
A0A1Y4JAX2      -------------------------------------------------------LVGIA
A0A1Y4T590      -------------------------------------------------------LVGIA
R5B467          -------------------------------------------------AT----LP-AI
A0A1Y3T163      -------------------------------------------------DT----LNGTI
A0A1Y3YCA2      -------------------------------------------------DT----LNGTI
A0A1Y4L6N9      -------------------------------------------------SS----INGSI
A0A173T644      -------------------------------------------------DS----INGSI
A0A1C5TSB8      -------------------------------------------------DS----INGSI
C0CIK6          -------------------------------------------------DS----INGSI
A0A1Y3WEF6      -------------------------------------------------DA----VNGRI
A0A417T0L2      -------------------------------------------------DA----VNGSI
A0A1H9EPU3      -------------------------------------------------DLTYSGLASKV
A0A354IGV3      -------------------------------------------------EN----LPAQI
A0A417JMV2      -------------------------------------------------DY----FPGSA
B0P408          -------------------------------------------------DY----FPGSA
D4MV82          -------------------------------------------------DY----FPGSA
A0A415VWX5      -------------------------------------------------DY----FPGSA
A0A173UY96      -------------------------------------------------DY----FPGSA
A0A173QTL1      -------------------------------------------------DY----FPGSA
A0A174A3T7      -------------------------------------------------DY----FPGSA
A0A174J359      -------------------------------------------------DY----FPGSA
A0A417UUA3      -------------------------------------------------DY----FPGSA
A0A1C6EUV9      -------------------------------------------------DY----FPGTA
A0A173Y645      -------------------------------------------------DY----FPGTA
A0A374AVY6      -------------------------------------------------DY----FPGTA
R7BXS4          -------------------------------------------------DY----FPGTA
A0A143ZUX1      ----------------------------------------------LNPSQ----VKKMV
S3FFL2          R------------YTAA----------------------GRSERLRIAGDI----LRSHI
A0A6A8IF17      D----VKGSLLDSITTPLGKIIIHTTPNYVKGEAYTLYVGKSSLYNAVNSC----SSNLS
A0A6C0V5C7      A-GFSARGEVGQMLTKD-GVSMMVSAIHAQEGGEFTV--TKFSTLGMINNL----QNNLT
A0A6C0V5F7      T--LAVDGVVGKALVKD-GVSLLVTSLDSVPGTQFIL--KTVTKLEAINAI----QKRLT
A0A328M4V1      DDGVLLTGRVGDKVTAK-GITIQVKSMLANPGTRFDV--TRHGRLALITSL----QQALV
A0A5C8HCX2      E--FTVNGMVGQRLEKD-GVALTIADIKAKPGTQFVL--SQRTELEAINAL----QETFT
A0A1W1Z4C3      ---PAGENGNENDLLLSQKYPG------------------------LSTDF----IRNVI
A0A239QN83      ---PAGENGNEEDILLSQKYPG------------------------LTTDD----IRKVI
A0A3R9WAA7      ----------------------------------------------LGINE----LSEQI
A0A1G6BLF1      ----------------------------------------------LDMES----VPGTI
R6HZX3          ----------------------------------------------LNTSW----INGTV
A0A1W2CEA6      ---D------------------------------------------YSYSQ----LEKMV
R7FFK6          ---EYTEEELSRYFTLKN-GK-------------------------VTDTS----LKACF
A0A373MPB9      ---MYTPEQLAPYFTVTS-GR-------------------------VSNDD----LRNAY
A0A373L519      ---MYTPEQLAPYFTVTS-GR-------------------------VSNDG----LRNAY
A0A373W906      ---MYTPEQLAPYFTVTS-GR-------------------------VSNDG----LRNAY
A0A373VCW2      ---MYTPEQLAPYFTVTS-GR-------------------------VSNDD----LRNAY
W0U604          ---MYTPEQLAPYFTVTS-GR-------------------------VSNDD----LRNAY
A0A374B6G0      ---MYTPEQLAPYFTVTS-GR-------------------------VSNDG----LRNAY
A0A373VM36      ---MYTPEQLAPYFTVTS-GR-------------------------VSNDG----LRNAY
A0A1C5P379      ---MYTPEQLAPYFTVTS-GR-------------------------VSNDG----LRNAY
A0A373XXX0      ---MYTPEQLAPYFTVTS-GR-------------------------VSNDG----LRNAY
A0A5R9MJM9      ---MYTPEQLAPYFTVTS-GR-------------------------VSNDG----LRNAY
A0A356CW82      ---MYTPEQLAPYFTVTS-GR-------------------------VSNDG----LRNAY
R6T4X7          ---MYTPEQLAPYFTVTS-GR-------------------------VSNDG----LRNAY
A0A374HTV1      ---MYTPEQLAPYFTVTS-GR-------------------------VSNDG----LRNAY
A0A374GB66      ---MYTPEQLAPYFTVTS-GR-------------------------VSNDG----LRNAY
A0A374ECC6      ---MYTPEQLAPYFTVTS-GR-------------------------VSNDG----LRNAY
A0A374BM61      ---MYTPEQLAPYFTVTS-GR-------------------------VSNDG----LRNAY
A0A373UGZ4      ---MYTPEQLAPYFTVTS-GR-------------------------VSNDG----LRNAY
A0A373SA66      ---MYTPEQLAPYFTVTS-GR-------------------------VSNDG----LRNAY
A0A1C5X6X7      ---MYTPEQLAPYFTVTS-GR-------------------------VSNDG----LRNAY
A0A1C6JIH3      ---MYTPEQLAPYFTVTS-GR-------------------------VSNDG----LRNAY
A0A373PSC3      ---MYTPEQLAPYFTVTS-GR-------------------------VSNDG----LRNAY
A0A1K1WYK8      ---QYDEQDLRRVFSFDEDNK-------------------------IDPAS----IRSCL
A0A1H6IUB1      ---QFDADTLSKNFGMSD-GK-------------------------IAPAS----IRNCL
A0A1M7L1F9      ---QFDEDTLIKNFGMSE-GR-------------------------ISPSA----IRDCY
A0A1C6B4L6      ---QFDEVILSENFTFNMSGE-------------------------IETES----LRKCI
A0A1Q6T9P4      ---QFDEVILSENFTFNMSGE-------------------------IETES----LRKCI
A0A315Y4F9      ---QFEENVLSQNFTINDSGK-------------------------ITPAS----IRSCL
A0A354K620      ---QFEKNVLSQNFSLSESGK-------------------------IAPAS----IRSCL
A0A355G3J9      ---KYPS---------------------------------------LTAKQ----ILAML
A0A3D2AD87      ---YNDKN--------------------------------------YRLLK----NKISV
A0A2T5IYJ6      ---ANHPDYLPRSEAEKSWWQQIDWRQLLPRGHQSNPIPSDEEKLTLLVDR----FMANL
A0A3C0QME1      ---EYTTDELAGVFA----------------------M-NDGK---ISLSS----LRNKI
A0A355FYK5      ---DYNVV------------------------------------------E----LRNAV
A0A357AQU0      ---NHERDYLNRYFA----------------------LDENGC---PTTGS----ILNYV
A0A3C1YJQ7      ---NHERDYLNRYFA----------------------LDENGC---PTTGS----ILNYV
A0A3D0JG38      ---NHERDYLNRYFA----------------------LDENGC---PTTGS----ILNYV
A0A3C0IHX1      ---KFGVSEISKCFT----------------------V-KNGV---ISTSE----LKDAI
R5V506          ---KFGVSEISKCFT----------------------V-KNGV---ISTSE----LKDAI
A0A352TIU5      ---KFGVSEISKCFT----------------------V-KNGV---ISTSE----LKDAI
A0A3E5FSY5      ------------------------------------------------VNS----LNGTL
A0A1V5S3C0      ---AQSGQE-------------------------------------YSISQ----LKSCV
A0A1Y3TC98      ------------------------------------------------TDT----LNGEI
A0A1Q6REE0      -------------------------------------------------ID----EVPAM
R5ETF9          -------------------------------------------------ID----EVPDM
R6VAT5          ------------------------------------------------LSD----VPGTL
A0A1Q6S448      -------------------------------------------------MP----LNGTV
A0A351MYR0      -------------------------------------------------MP----LDGTV
R6HPC1          -------------------------------------------------MS----LDGTV
A0A3D4G5Z5      -------------------------------------------------MS----LDGTV
A0A3D5ES03      -------------------------------------------------MS----LDGTV
A0A0F2P7X6      ----------------------------------------------LPASA----ISPYV
A0A359B487      ----------------------------------------------LPAAA----ISPYV
A0A348P5V4      ---ANPDGSP------------------------------------ITASQ----IKRYV
A0A356PT74      ---KD-----------------------------------------ISVAD----IKSWV
A0A3D5LL19      ---KD-----------------------------------------ISVSD----IKSWV
R5MNF0          ---KD-----------------------------------------ISVLD----IKNWV
A0A1Q9JSI0      ------------------------------------------------MDY----FPGTA
A0A3D5TNI1      ---YP-----------------------------------------KTADE----VEEMI
A0A358LJD0      ---YP-----------------------------------------KTADQ----VSKMI
R6I3L7          ---YP-----------------------------------------KTADQ----VAKMI
A0A3D1HXX0      ---YP-----------------------------------------KTADQ----VAKMI
A0A3D2QJB8      ---YP-----------------------------------------KTADQ----VAKMI
D4LC36          ---QHTPEELSGNFT----------------------IKNGK----ITNES----LKSAF
R7MQJ4          ---EFDKDKLSKCFS----------------------IKDENGEESISAAS----IRNCL
A0A1V5GLC0      ---EFDEAVLAETFG----------------------SYQNR----ISPSS----IRNCM
W7V182          ---SFENDVLEQNFS----------------------VVNGR----ITPAS----LRSCI
                                                                            

A0A0H5SF45      QISS--------VNDTEIFQITLSSNSAD---DAYTLVEAMQKIAPQLIANI--------
A0A1M6JRJ5      EIKT--------VQNTEIFSITLTSKNPD---DSYRLVKSMETIAPKLIEKI--------
A0A1M7Y1S2      EIKA--------IQNTEIFSITLTSNNPN---DSYRLVKSMEMIVPKLIEKI--------
A0A3D5R4X5      EVSL--------VRDTEFINIKVQNPNPE---QARDIANKLAEVFQEEVVEI--------
A0A1I4C3N6      SARQ--------ITNTSMFVIYVVDPNPM---NAQLIANTIGEIAPTRLVGL--------
A0A3B9CIM7      SASA--------IENTAAFVVRVVDQNPV---NAMNIANAIGELAPNEIIRI--------
A0A1G9WHW8      STSA--------VEDTAVFYVYVVDSNPL---NAQKIANAIGELAPDMIVTL--------
A0A1H5VAA0      STSA--------VEDTAVFYVYVVDSNPL---NAQKIANAIGELAPDMIVTL--------
A0A3R6VK11      GTSV--------VENTAVFYVYTYDSDPY---RAMELANAIGRVAPKEIGRI--------
A0A3R6QUY7      GTSV--------VENTAVFYVYTYDSDPY---RAMELANAIGRVAPKEIGRI--------
A0A373K3P9      GTSV--------VENTAVFYVYTYDSDPY---RALELANAIGRVAPKEIGRI--------
A0A3R6JRU5      GTSV--------VENTAVFYVYTYDSDPY---RALELANAIGRVAPKEIGRI--------
A0A1C5MS04      GTSV--------VENTAVFYVYTYDSDPY---RAMELANAIGRVAPKEIGRI--------
A0A3C1J150      GTSV--------VENTAVFYVYTYDSDPY---RAMELANAIGRVAPKEISRI--------
A0A416CXD7      GTSV--------VENTAVFYVYTYDSDPY---RAMELANAIGRVAPKEIGRI--------
R6XBL9          GTSV--------VENTAVFYVYTYDSDPY---RAMELANAIGRVAPKEIGRI--------
A0A355W5Z7      GTSV--------VENTAVFYVYTYDSDPY---RAMELANAIGRVAPKEIGRI--------
A0A143WVN6      NSSI--------ISQTNLITLTVTSDTPA---HAYQMIQSALDNYSSVSDYL--------
W6RXP9          TVNP--------LTDTQILEIKLQGKKPK---EIAEILNGINNEFIFQANEL--------
W6S4G8          TVEP--------ITDTQILQIKLTGKNKD---DLAVVLESITEEFIKESKEI--------
A0A1G6BLB6      TTSL--------VENTNLMTLSVTESSPK---MTYAVMNAILDNYSSVSDKV--------
A0A1C6G8M0      SVDN--------PEATRIIRIRVVSGNKE---EAVDIANEILSVSIEEIPHV--------
A0A416MP73      SVEN--------PDSTRILKIYVTAGTVR---EAVNIANEILSVSVDEIPHV--------
A0A3E4LL92      SASV--------VTDTNIIRMSASGTNAE---SAYKLLKGALKQYPELSDYF--------
A0A415D1L1      SASV--------VADTNIIKMSASGTNAE---SAYKLLKGALQQYPELSDYF--------
A0A414P2K5      SASV--------VADTNIIRMSASGTNAE---SAYKLLKGALQQYPELSDYF--------
V8C417          SASV--------VADTNIIRMSASGTNAE---SAYKLLKGALQQYPELSDYY--------
A0A143XN92      EAEI--------VPETNLMVLRVTADTSK---KAFQILRAIMENYTVVSDYV--------
A0A173ZYY6      HAKV--------LEGTNMLVLSVTADTPK---DSIDIIRTVMDNYSSVSLYT--------
A0A4Q5EHM9      HAKV--------LEGTNMLVLSVTADTPK---DSIDIIRTVMDNYSSVSLYT--------
A0A173SMI2      HAKV--------LEGTNMLVLSVTADTPK---DSIDIIRTVMDNYSSVSLYT--------
A0A174ASH7      HAKV--------LEGTNMLVLSVTADTPK---ESIDIIRTVMDNYSSVSLYT--------
A6BH65          HAKV--------LEGTNMLVLSVTADTPK---ESIDIIRTVMDNYSSVSLYT--------
R7G0D7          HAKV--------LEGTNMLVLSVTADTPK---ESIDIIRTVMDNYSSVSLYT--------
A0A396G6S7      SVDL--------VPETNLITLSVKAGTAA---ESYRILQSVMENYNTVSDYA--------
A0A3E5A223      SVDL--------VPETNLITLSVKAGTAA---ESYRILQSVMENYNTVSDYA--------
R7D5E6          SVDL--------VPETNLITLSVKAGTAA---ESYRILQSVMENYNTVSDYA--------
A0A415HQH5      SVDL--------VSETNLITLSVKAGTAA---ESYRILQSVMENYNTVSDYA--------
A0A414W2C6      SVDL--------VPETNLITFSVKAGTAA---ESYRILQSVMENYNTVSDYA--------
A5ZNE7          SVDL--------VPETNLITLSVKAGTAA---ESYRILQSVMENYNTVSDYA--------
A0A395X821      SVDL--------VPETNLITLSVKAGTAA---ESYRVLQSVMENYNTVSDYA--------
A0A1C5PY68      SVDL--------VPETNLITLSVKAGTAA---ESYRVLQSVMENYNTVSDYA--------
A0A174CJF8      SVDL--------VPETNLITFSVKAGTAA---ESYRVLQSVMENYNTVSDYA--------
A0A564SRR2      SVDL--------VPETNLITFSVKAGTAA---ESYRVLQSVMENYNTVSDYA--------
A0A174R7V0      SVDL--------VPETNLITFSVKAETAA---ESYRVLQSVMENYNTVSDYA--------
A0A373MWV2      SASI--------VPESNLMELSVTADSPE---TAFRVLRSVLKNYTTISDYI--------
A0A417CE88      SASI--------VPESNLMELSVTADSPE---TAFRVLRSVLKNYTTISDYI--------
A0A416Y441      SASI--------VPESNLMELSVTADSPE---TAFRVLRSVLKNYTTISDYI--------
A0A357GPJ7      SASI--------VPESNLMELSVTADSPE---TAFRVLRSVLKNYTTISDYI--------
A0A396PAC1      SASI--------VPESNLMELSVTADSPE---TAFRVLRSVLKNYTTISDYI--------
A0A416EYU4      SASI--------VPESNLMELSVTADSPE---TAFRVLRSVLKNYTTISDYI--------
A0A416SCQ2      SASI--------VPESNLMELSVTADSPE---TAFRVLRSVLKNYTTISDYI--------
A0A416TGN7      SASI--------VPESNLMELSVTADSPE---TAFRVLRSVLKNYTTISDYI--------
A0A417SMF6      SASI--------VPESNLMELSVTADSPE---TAFRVLRSVLKNYTTISDYI--------
A0A1Y4MW77      SASI--------IPNSNMITMTVISSDPD---DAKEILESTIRVYPSVARFV--------
R6UHV6          SCSV--------IEETNILSFTVTSDSPI---KSYRLLKAVLECYPQFTKNV--------
A0A3R9Q621      RITV--------VSNTEIFQVSVTTNSAS---DSFELAKAIQNIAPDFIKSI--------
A0A069RC75      KIDQ--------VDETEVLKISASSTDPA---LAAAIANEIAQVFKEEIFRI--------
A0A174F2W5      SASI--------VPESNLMELSVTADSPE---TAFRVLRSVLKNYTTISDYI--------
A0A174S8E9      SASI--------VPESNLMELSVTADSPE---TAFRVLRSVLKNYTTISDYI--------
A0A416ZL97      NASI--------VPESNLMELSVTADSPE---MAFRILKSVLNNYTSISDYI--------
A0A174LSK1      NASI--------VPESNLMELSVTADSPE---MAFRILKSVLNNYTSISDYI--------
A0A373GY92      NASI--------VPESNLMELSVTADSPE---MAFRILKSVLNNYTSISDYI--------
A0A373NZQ6      NASI--------VPESNLMELSVTADSPE---MAFRILKSVLNNYTSISDYI--------
A0A417I9B9      NASI--------VPESNLMELSVTADSPE---MAFRILKSVLNNYTSISDYI--------
A0A417MP97      NASI--------VPESNLMELSVTADSPE---MAFRILKSVLNNYTSISDYI--------
A0A417WQF8      NASI--------VPESNLMELSVTADSPE---MAFRILKSVLNNYTSISDYI--------
A0A373RZ83      NDSI--------VPESNLMELSVTADSPE---MAFRILKSVLNNYTSISDYI--------
A0A416U6I1      NDSI--------VPESNLMELSVTADSPE---MAFRILKSVLNNYTSISDYI--------
R7JQZ9          NDSI--------VPESNLMELSVTADSPE---MAFRILKSVLNNYTSISDYI--------
A0A3B8KKL6      DVRT--------VKDSRIFKISYEDSNPT---LARDVVNELSNEIQELAADI--------
A0A2K9E6R0      DVRT--------VKDSRIFKISYEDSNPT---LARDVVNELSNEIQELAADI--------
A0A2S8RBI0      DVRT--------VKDSRIFKISYEDSNPT---LARDVVNELSNEIQELAADI--------
A0A0L6JLG6      DVMT--------IKDSRIFKISYEDYDPK---LAAKVVNELGTIIMQLASDI--------
G8LSN0          NVQT--------VKDSRIFSISYEDTDPK---LAADVVNELALVIKQLASDV--------
A0A1M5UYN6      SVGA--------QSNTQIMNITVQAGNEE---EAKEIVLAITQSFKENAEKL--------
A0A176JBT8      KAES--------NGNSQIISIIVENKNPD---DAALIANKTAVIFQSEIKKL--------
A0A1I5HIC6      TVKV--------PENTRILEISVQNPNPE---TAKQLADSIAEESAERMVSI--------
A0A1Y3TC51      SCTP--------IQETNLLVLSVTCRHPR---DAYLFINAALEHYGEVAGDV--------
A0A1Y3T1N0      TCTP--------ITDTNLLTLSVSSPDPR---QAYLFINSALENYEQVAQDV--------
A0A1Y3Y8U8      TCTP--------ITDTNLLTLSVSSPDPR---QAYLFINSALENYEQVAQDV--------
A0A5B0BQY5      KLET--------GNGSQIITITARDSTPE---KAANLANTYALTFQEEIRTL--------
A6CLL4          SVTS--------SSDSQIISITATALNPN---QAVDIVNNTAETFKEETYNL--------
A0A174DL89      KIKT--------TTESEFINITVEGKVPE---VTTLVANQLTLSLKNISSEI--------
A0A176U8D6      SIEN--------PDGTRIIKINVVSQDQK---EAVDIANEILQISIEEIPNV--------
A0A1Q6KSQ5      SVDN--------PEATRIIRIRVVSGNKE---EAVDIANEILSVSIEEIPHV--------
A0A3D3U8B3      SVDN--------PEATRIIRIRVVSGNKE---EAVDIANEILSVSIEEIPHV--------
A0A3E5FRL7      TCNQ--------IQETNLLVLNVTSKDPQ---NAYQFMNSALKHYDEVSDYV--------
A0A1Y4QK93      TCNQ--------IQETNLLVLNVTSKDPQ---NAYQFMNSALKHYNEVSDYV--------
B1C232          TCNQ--------IQETNLLVLNVTSKDPQ---NAYQFMNSALKHYDEVSDYV--------
A0A401USI6      SITP--------KIGTQIIEISYKSKNPE---IAAEGANALSQAFIEESQNL--------
A0A1V4IQ10      TTVP--------MANTQILEIKYKNLNKS---LAKDTVSAITNEFIKETQEL--------
A0A1S8TRD2      TTIP--------TANTQILEIRYINLNKS---LAKDTVSAITDEFIKETQEL--------
G7M1U2          TTIP--------TANTQILEIRYINLNKS---LAKDTVSAITDEFIKETQEL--------
A0A2T6KJ75      EIQS--------SINSQILTILAEEKTPE---KAAALANTLATTFQEEIKTL--------
A9KN92          NVKV--------PENTRILEITVQNQDPL---LAKQLADSIAEVASERMVSV--------
A0A352MUJ1      TIES--------VKNTEILKISVLDSNKD---DAATIANSIAEVFSEQVKEY--------
R5YI67          TIES--------VKNTEIIKISVQDSNKD---EAPIIANSIAEVFSEQIKEI--------
A0A1Y0IQP5      RVTT--------SGESLLTSVTVTDHDPK---QAVAIANAMAAVFMENLSRI--------
A0A4R2R7B1      RVRS--------SSESLLTAVTVTDHDPK---QAVTIANAMAAVFMENLGRI--------
A0A1M6E8I2      TSSP--------VGSTEILKISVKNTDPA---MASEIANTIADVFIKEVMRI--------
A0A1Y4N105      SASV--------ISETNLMTLTVTSNTPK---MTYQIMQSALDNYTSVSDYL--------
A0A1Y4QP75      SASV--------ISETNLMTLTVTSNTPK---MTYQIMQSALDNYTSVSDYL--------
A0A3D4QRB5      NVSA--------EGNTEILRITVEDLIPE---QARDIADSTAEVFISEVNKL--------
A0A349DEH5      SVSV--------VSSTNIIVMSVTTGNPQ---TSYAIAQTACEVYGDIVAEK--------
A0A3D4T7B4      SVSV--------VSSTNIIVMSVTTGNPQ---TSYAIAQTACEVYGDIVAEK--------
A0A350XYC7      SVRV--------VTSTNVIVMSVTTDNPK---TSYAIANTVVDVYGDIVSEI--------
R6DNR8          SVSV--------VSSTNVIVMSVTTGDPK---IAYAIASTVVDVYGDIVSER--------
A0A355KUM5      SVNV--------VSSTNVIVMSVTTGDPK---ISYAIASTVVDVYGDIVTER--------
R5YGY6          SVNV--------VSSTNVIVMSVTTGDPK---ISYAIASTVVDVYGDIVTER--------
A0A0K8J554      NIQS--------VGDTEIFKISVNSHSAS---DSYELVKAMEYIAPQIISEV--------
A0A3N1XSX6      TIKT--------INNTEIFQISVTSSSAR---DSYTLVETMQRIAPQLIKSI--------
A0A1C6G0U3      NVQS--------IEDTQIIKISVQNKSPE---IARDIANSIPEIFKEEVKRL--------
A0A3D4LLB3      TVSP--------VKDTQIIKVAVQNTDPV---LARDIADALVEEFTLEIQRI--------
A0A0A5GPA9      TIGT--------NAESQIITVQAVGPSKE---AASELVNVTLDTFQQEVESL--------
A0A271M6M4      EVIS--------NSDSQVITLKVEASSQK---QAVKLANSTAEIFKTEIKSL--------
A0A2V3W8U6      RVET--------NDNSQIISLYVKENDLD---TAVEIANLFATKSKEEISQL--------
W1UFG0          DVEN--------IQDTQIIKISVRNGNPK---TAAKICNEIPIVFEKEVKRI--------
A0A351SRI8      KVGN--------VEDTEIILIYVYNEDAR---LSRKIANEIASVFESEIVGI--------
A0A1V5LU59      NVQT--------VKDTRIFSISYEDTDPE---LAANVVNELSVVIKQMATDI--------
A0A1E3BVC3      NVKT--------VKDSRLFSISYEDTDPK---RAADVVNELASVIQKMADEI--------
A0A4Q0I6S0      NVKT--------VKDSRLFSISYEDTDPK---RAADVVNELASVIQKMADEI--------
A3DF66          NVKT--------VKDSRLFSISYEDTDPK---RAADIVNELATVIQKMADEI--------
W4V1T8          TVKT--------VKDSRLFSISYEDTDPK---RAADVVNELASVIQKMADEI--------
A0A1I0RG99      HIKA--------INNTEIFEISVTTTNPN---DAYKLVDAMKKIAPVLIKSI--------
A0A1I5G322      NIES--------INNTEIFEISVSSMNPN---HSFLLVKSMEKIAPELIKSI--------
A0A1C6ITD7      KIRT--------TTESEFISISIEGKIAK---DTATIANQLVLSLKNISSEL--------
A0A381IX63      DINS--------V-NGPVMNITVKNADPK---VAREIANEVPVVFGGELENI--------
A0A1G9IUT4      RVTT--------LTDTQIINVSVREDNPK---LANNIANEIASVFTSELSRI--------
A0A1M6RWV2      RVNS--------VRDTEVIEIKVQDTNPQ---LAARIANELSEVFIDRIHEF--------
A0A143XPI5      TASA--------VEETNLFRIETSGRDPE---LVYEVLESVIKNYPEVAEYI--------
A0A355G1X5      SVNT--------QADTNIIIVSVTTESPD---KSYEIASGIASHYQDIVDYA--------
A0A0M6WXE3      SANV--------VKGTNMLTLSVTAHSPK---DSIDIIKTVMDNYTSISYYT--------
A0A348SAK2      SANV--------VKGTNMLTLSVTAHSPK---DSIDIIKTVMDNYTSISYYT--------
A0A1G9H5B9      AGMVSSSLSMESVSETGVVAVKSTTLEAQ---LSADIANAVMEIAPEEIVRV--------
R5EFZ0          DTAV--------VPNTNLITMTVTDSDPR---MAFLAAQAIIEHHESLTYQV--------
A0A1Y4H8L0      TSNV--------IPNTNLLELSVSSSSPR---EAFDTIHAVMDNYAQVSYFS--------
A0A4B9BMD9      SELD--------QAEEKLNVYRQQRDSVDLNLEAKAVLEQIVNVDNQLNELT--------
A0A0M6WYQ8      SVKA--------EEGTNMLTISVSGTNAE---LSYKTLKSVIKNYPEVAQFV--------
A0A348SAK1      SVKA--------EEGTNMLTISVSGTNAE---LSYKTLKSVIKNYPEVAQFV--------
A0A252F281      ESSI--------IEGTNLLTISATADNAR---TAFLTVKAVMENYNTVSDQV--------
A0A1Y4QKE6      SAST--------VSESNIVTMSVESNSPQ---DAMSILTSAIEVYPDAARFV--------
B1C231          SAST--------VSESNIVTMGVESNSPQ---DAMSILTSAIEIYPDVARFV--------
A0A1Y3TUL5      ETDIYKNLYLTRYKETQIIEMDLTWRSAE---EGVEILNAINEVAPEILIET--------
A0A1Y4JAX2      ETDIYKNLYLTRYKETQIIEMDLTWRSAE---EGVEILNAINEVAPEILIET--------
A0A1Y4T590      ETDIYKNLLLTRYKETQIIEMDLTWRSAE---EGVEILNAINEVAPEILIET--------
R5B467          SATS--------EEGTNLCTLSVTGSDAQ---QCYDVLQSVIVHYPDVAELV--------
A0A1Y3T163      TSET--------VENSNMVTMRVESPDPE---DAREILDTALEIYPETARFV--------
A0A1Y3YCA2      TSET--------VENSNMVTMRVESPDPE---DARKILDTALEIYPETARFV--------
A0A1Y4L6N9      TASV--------VPDSNLITMSVVSMNAS---EAKTILESAIRVYPNISRFV--------
A0A173T644      SAQA--------VSDSNLITMTVTSSDPQ---DAKAILESAIKVYPEVSRFV--------
A0A1C5TSB8      SAQA--------VSDSNLITMTVTSSDPQ---DAKAILESAIKVYPEVSRFV--------
C0CIK6          SAQA--------VSDSNLITMTVTSSDPQ---DAKAILESAIKVYPEVSRFV--------
A0A1Y3WEF6      SAQA--------VSDSNMITMTVTSNSPE---DARAILESTIKVYPDVVRFV--------
A0A417T0L2      SAQA--------VSNSNMITMTVTSNSAE---DAKAILESAIKVYPDVARFV--------
A0A1H9EPU3      SVTS--------PTDTRILTITVTDPDPV---MSKNLADSIRDAAIKHIQGI--------
A0A354IGV3      KTEV--------AKDTNVLTLTSTADTAY---DAFICLKAVTENYNLISDNV--------
A0A417JMV2      SAEV--------VNETNLLVLKVQADSPE---MAFRLNKAIMNNYSVVTDQL--------
B0P408          SAEV--------VNETNLLVLKVQADSPE---MAFRLNKAIMNNYSVVTDQL--------
D4MV82          SAEV--------VNETNLLVLKVQADSPE---MAFRLNKAIMNNYSVVTDQL--------
A0A415VWX5      SAEV--------VNETNLLVLKVQADSPE---MAFRLNKAIMNNYSVVTDQL--------
A0A173UY96      SAEV--------VNETNLLVLKVQADSPE---MAFRLNKAIMNNYSVVTDQL--------
A0A173QTL1      SAEV--------VNETNLLVLKVQADSPE---MAFRLNKAIMNNYSVVTDQL--------
A0A174A3T7      SAEV--------VNETNLLVLKVQADSPE---MAFRLNKAIMNNYSVVTDQL--------
A0A174J359      SAEV--------VNETNLLVLKVQADSPE---MAFRLNKAIMNNYSVVTDQL--------
A0A417UUA3      SAEV--------VNETNLLVLKVQADSPE---MAFRLNKAIMNNYSVVTDQL--------
A0A1C6EUV9      SAEV--------VNETNLLVLKVQADSPE---MAFRLNKAIMNNYSVVTNQL--------
A0A173Y645      SAEV--------VNETNLLVLKVQADSPE---MAFSLNKAIMNNYSVVTNRL--------
A0A374AVY6      SAEV--------VNETNLLVLKVQADSPE---MAFSLNKAIMNNYSVVTNQL--------
R7BXS4          SAEV--------VNETNLLVLKVQADSPE---MAFSLNKAIMNNYSVVTNQL--------
A0A143ZUX1      SISQ--------ATGS-VLELKVTASDPE---TAYRLAVAYMGAIDIVVNPKDDS-----
S3FFL2          EISP--------ARLSRLVDLYFTSPDAS---FSARVVNAWADAYIQTNLERKSQATSYG
A0A6A8IF17      VSLN--------SEKASVIDLSFKDNSTQ---RAEDVLSMLISVYNENWVKDKNQIAVST
A0A6C0V5C7      VTEN--------GKDTGVLSMTFTGEDKD---QIRDILNSITRNYLEQNVERKSAEAAKS
A0A6C0V5F7      VAES--------AKQSGMIALTIAGEDPS---KIARVLNTIAENYLSQNIARQEAQDTRS
A0A328M4V1      ATEQ--------GKDSGIIELDYRNADPV---LATQLVDQISALYVRQNVDRNSAEAANS
A0A5C8HCX2      VSER--------SKESGMLELTMTGDDPQ---LITRILNSIANNYLQQNIARQAAQDSQS
A0A1W1Z4C3      SMNS--------VHETPMVRVSCTTPYPE---LSADICNSVLQVAPTAIKDV--------
A0A239QN83      SMNS--------IHETPMVQVSCTTTDPK---LSADICNSVLQVAPTAIKDV--------
A0A3R9WAA7      TADN--------VKDTNLFTIRVSSDNPT---RAYEVLQSVIKNYPKVAETV--------
A0A1G6BLF1      AVAV--------VEETNMITIKATADSAQ---MAYNILQAVIESYPIVAESV--------
R6HZX3          TASS--------IGETNIFTLTVTSTNPQ---DAYDILNAVIQNYPQVASFV--------
A0A1W2CEA6      SVSN--------PSGSHLLYIYVKSSVPE---EAKLLADTYAEVVQDYIANK--------
R7FFK6          SMTA--------VDETEVLKITTTTQNAE---LSASLCNIMADVAPQFLIRV--------
A0A373MPB9      SMIA--------VNQTEVLQITATTTNAK---LSSDLCNIMADVAPSFLIRV--------
A0A373L519      SMTA--------VNQTEVLQITATTTNAK---LSSDLCNIMADVAPSFLIRV--------
A0A373W906      SMTA--------VNQTEVLQITATTTNAK---LSSDLCNIMADVAPSFLIRV--------
A0A373VCW2      SMIA--------VNQTEVLQITATTTNAK---LSSDLCNIMADVAPSFLIRV--------
W0U604          SMIA--------VNQTEVLQITATTTNAK---LSSDLCNIMADVAPSFLIRV--------
A0A374B6G0      SMTA--------VNQTEVLQITATTTNAK---LSSDLCNIMADVAPSFLIRV--------
A0A373VM36      SMTA--------VNQTEVLQITATTTNAK---LSSDLCNIMADVAPSFLIRV--------
A0A1C5P379      SMTA--------VNQTEVLQITATTTNAK---LSSDLCNIMADVAPSFLIRV--------
A0A373XXX0      SMTA--------VNQTEVLQITATTTNAK---LSSDLCNIMADVAPSFLIRV--------
A0A5R9MJM9      SMTA--------VNQTEVLQITATTTNAK---LSSDLCNIMADVAPSFLIRV--------
A0A356CW82      SMTA--------VNQTEVLQITATTTNAK---LSSDLCNIMADVAPSFLIRV--------
R6T4X7          SMTA--------VNQTEVLQITATTTNAK---LSSDLCNIMADVAPSFLIRV--------
A0A374HTV1      SMTA--------VNQTEVLQITATTTNAK---LSSDLCNIMADVAPSFLIRV--------
A0A374GB66      SMTA--------VNQTEVLQITATTTNAK---LSSDLCNIMADVAPSFLIRV--------
A0A374ECC6      SMTA--------VNQTEVLQITATTTNAK---LSSDLCNIMADVAPSFLIRV--------
A0A374BM61      SMTA--------VNQTEVLQITATTTNAK---LSSDLCNIMADVAPSFLIRV--------
A0A373UGZ4      SMTA--------VNQTEVLQITATTTNAK---LSSDLCNIMADVAPSFLIRV--------
A0A373SA66      SMTA--------VNQTEVLQITATTTNAK---LSSDLCNIMADVAPSFLIRV--------
A0A1C5X6X7      SMTA--------VNQTEVLQITATTTNAK---LSSDLCNIMADVAPSFLIRV--------
A0A1C6JIH3      SMTA--------VNQTEVLQITATTTNAK---LSSDLCNIMADVAPSFLIRV--------
A0A373PSC3      SMTA--------VNQTEVLQITATTTNAK---LSSDLCNIMADVAPSFLIRV--------
A0A1K1WYK8      TISS--------VTDTSAVTITATTVNPN---LAADICNDITQVAPKYVEEA--------
A0A1H6IUB1      SISS--------VTDTSAVKIVSTTKNAE---VAAALCNDLTEVAPSYVEEA--------
A0A1M7L1F9      SISS--------VTDTSAVKIVATTKNAE---VAAALCNDLTEVAPDYVEEA--------
A0A1C6B4L6      ELST--------VTDTSAVKVIATAKNPE---IAASICNNLTSIAPEYVAKA--------
A0A1Q6T9P4      ELST--------VTDTSAVKVIATAKNPE---IAASICNNLTSIAPEYVAKA--------
A0A315Y4F9      AISS--------VTDTSAVKVNATAKNAE---VAAAICNDLTQVAPQYVEEA--------
A0A354K620      AISS--------VTDTSAVKVTATAENAE---VAAAICNDLTQVAPKYVEEA--------
A0A355G3J9      SGSA--------INETEAFYISAEHTNRQ---LATDVLTDIVKVAPQEIIRV--------
A0A3D2AD87      SRSE--------EERSMLIYISATSTDKN---EAIDLANDFAALCQTFIPNN--------
A0A2T5IYJ6      SIEP--------IRQTQLVKISFESHDRS---LTAAVANAMAKTYINSQMEARITLTQQA
A0A3C0QME1      TMSS--------VDETEVMKITANTTNPE---ISAAICNQIAESAEECLTRI--------
A0A355FYK5      VLGE--------TGVSGIFSLTVTNIYPE---FCSRTMDAVLDVFPDYMRTS--------
A0A357AQU0      SMGS--------VDNTEVLKVSATTPDAK---LSAEISNIFAEVAPDYLIRI--------
A0A3C1YJQ7      SMGS--------VDNTEVLKVSATTPDAK---LSAEISNIFAEVAPDYLIRI--------
A0A3D0JG38      SMGA--------VDNTEVLKVSATTPNAK---LSAEISNIFAEVAPDYLIRI--------
A0A3C0IHX1      SMSA--------DGDTEVLKISAQTKDPH---VSAEICDIYAEVAPTFLIRI--------
R5V506          SMSA--------DGDTEVLKISAQTKDPH---VSAEICDIYAEVAPTFLIRI--------
A0A352TIU5      SMSA--------DGDTEVLKISAQTKDPH---VSAEICDIYAEVAPTFLIRI--------
A0A3E5FSY5      SAST--------VSESNIVTMGVESNSPQ---DAMSILTSAIEIYPDVARFV--------
A0A1V5S3C0      SANV--------VTDTTMISVSVSTHDPD---MSYQIAKALTSVYSQVMEGS--------
A0A1Y3TC98      SSET--------ITDSNVVTMRVESPDPE---DARAILEAALAIYPETARFV--------
A0A1Q6REE0      SVSA--------TAHSSILTLKVRDTDPQ---RAYDVMSAVIACYPEVAEFV--------
R5ETF9          SVSA--------TAHSSILTLKVRDTDPQ---RAYDVMSAVIACYPEVAEFV--------
R6VAT5          TATA--------VEDTNLFTITVTSSNYE---TAYNVLKSVINNYPSVAEYV--------
A0A1Q6S448      SAQQ--------LGETNLIRVTVTADTPR---QALVLLQAVSDNYGSLSAHV--------
A0A351MYR0      TAQQ--------LGETNLIRVTVTADTPR---QALVLLKAVSDNYGSLSAHV--------
R6HPC1          SAQQ--------LGETNLIRVTVTADTPR---QALVLLKAVSDNYGTLSAHV--------
A0A3D4G5Z5      SAQQ--------LGETNLIRVTVTADTPR---QALVLLKAVSDNYGTLSAHV--------
A0A3D5ES03      SAQQ--------LGETNLIRVTVTADTPR---QALVLLKAVSDNYGTLSAHV--------
A0A0F2P7X6      SVAP--------VRDTEVLRIFVSNPDPL---LAAKICNSIMHVAPTAISST--------
A0A359B487      SVAP--------VRDTEVLRIFVSNPDPL---LAAKICNSIMHVAPTAISST--------
A0A348P5V4      SVQS--------IEETQIIYLTVTTTNPD---VSYGIAQAYVDNYNEAIATA--------
A0A356PT74      SVEA--------VEDTAIINLTVTTPNAD---VSYGIANAYVNNYESAINAA--------
A0A3D5LL19      SVEA--------VEDTAIINLTVTTPNAD---VSYGIANAYVNNYESAINAA--------
R5MNF0          SVEA--------VEDTAIINLTVTTPNAD---VSYGIANAYVNNYESAINAA--------
A0A1Q9JSI0      SSEV--------INETNLLVLKVQADSPE---LAFRLNKAIMNNYSVVSDEL--------
A0A3D5TNI1      AASR--------KTDSSIIDMTVTAGSPE---EAYELAQAVKDTYKDVVQVY--------
A0A358LJD0      AASR--------KTDSSIIDMTVTASSPE---EAYELAQAVKDTYKDVVQVY--------
R6I3L7          AVSR--------KTDSSIIDMTVTASSPE---EAYELAQAVKDTYKDVVRVY--------
A0A3D1HXX0      AASR--------KTDSSIIDMTVTASSPE---EAYELAQAVKDTYKDVVQVY--------
A0A3D2QJB8      AASR--------KTDSSIIDMTVTASSPE---EAYELAQAVKDTYKDVVQVY--------
D4LC36          TMAA--------VNNTEVLKITATTKNAA---LSAELCNIMADVAPEVLIRV--------
R7MQJ4          TMAA--------VGDTEVMKITAETADPE---VSAALCNIISNVTPDFLIRV--------
A0A1V5GLC0      RITS--------VTDTSVLTVSATTRSPE---VAAAICNDVAEVAPKFLDDA--------
W7V182          SISS--------VTDTSALKLSAVTKNPE---VSAAICNDIAKVAPDYLHDA--------
                                                                            

A0A0H5SF45      ------------------------------------------------------------
A0A1M6JRJ5      ------------------------------------------------------------
A0A1M7Y1S2      ------------------------------------------------------------
A0A3D5R4X5      ------------------------------------------------------------
A0A1I4C3N6      ------------------------------------------------------------
A0A3B9CIM7      ------------------------------------------------------------
A0A1G9WHW8      ------------------------------------------------------------
A0A1H5VAA0      ------------------------------------------------------------
A0A3R6VK11      ------------------------------------------------------------
A0A3R6QUY7      ------------------------------------------------------------
A0A373K3P9      ------------------------------------------------------------
A0A3R6JRU5      ------------------------------------------------------------
A0A1C5MS04      ------------------------------------------------------------
A0A3C1J150      ------------------------------------------------------------
A0A416CXD7      ------------------------------------------------------------
R6XBL9          ------------------------------------------------------------
A0A355W5Z7      ------------------------------------------------------------
A0A143WVN6      ------------------------------------------------------------
W6RXP9          ------------------------------------------------------------
W6S4G8          ------------------------------------------------------------
A0A1G6BLB6      ------------------------------------------------------------
A0A1C6G8M0      ------------------------------------------------------------
A0A416MP73      ------------------------------------------------------------
A0A3E4LL92      ------------------------------------------------------------
A0A415D1L1      ------------------------------------------------------------
A0A414P2K5      ------------------------------------------------------------
V8C417          ------------------------------------------------------------
A0A143XN92      ------------------------------------------------------------
A0A173ZYY6      ------------------------------------------------------------
A0A4Q5EHM9      ------------------------------------------------------------
A0A173SMI2      ------------------------------------------------------------
A0A174ASH7      ------------------------------------------------------------
A6BH65          ------------------------------------------------------------
R7G0D7          ------------------------------------------------------------
A0A396G6S7      ------------------------------------------------------------
A0A3E5A223      ------------------------------------------------------------
R7D5E6          ------------------------------------------------------------
A0A415HQH5      ------------------------------------------------------------
A0A414W2C6      ------------------------------------------------------------
A5ZNE7          ------------------------------------------------------------
A0A395X821      ------------------------------------------------------------
A0A1C5PY68      ------------------------------------------------------------
A0A174CJF8      ------------------------------------------------------------
A0A564SRR2      ------------------------------------------------------------
A0A174R7V0      ------------------------------------------------------------
A0A373MWV2      ------------------------------------------------------------
A0A417CE88      ------------------------------------------------------------
A0A416Y441      ------------------------------------------------------------
A0A357GPJ7      ------------------------------------------------------------
A0A396PAC1      ------------------------------------------------------------
A0A416EYU4      ------------------------------------------------------------
A0A416SCQ2      ------------------------------------------------------------
A0A416TGN7      ------------------------------------------------------------
A0A417SMF6      ------------------------------------------------------------
A0A1Y4MW77      ------------------------------------------------------------
R6UHV6          ------------------------------------------------------------
A0A3R9Q621      ------------------------------------------------------------
A0A069RC75      ------------------------------------------------------------
A0A174F2W5      ------------------------------------------------------------
A0A174S8E9      ------------------------------------------------------------
A0A416ZL97      ------------------------------------------------------------
A0A174LSK1      ------------------------------------------------------------
A0A373GY92      ------------------------------------------------------------
A0A373NZQ6      ------------------------------------------------------------
A0A417I9B9      ------------------------------------------------------------
A0A417MP97      ------------------------------------------------------------
A0A417WQF8      ------------------------------------------------------------
A0A373RZ83      ------------------------------------------------------------
A0A416U6I1      ------------------------------------------------------------
R7JQZ9          ------------------------------------------------------------
A0A3B8KKL6      ------------------------------------------------------------
A0A2K9E6R0      ------------------------------------------------------------
A0A2S8RBI0      ------------------------------------------------------------
A0A0L6JLG6      ------------------------------------------------------------
G8LSN0          ------------------------------------------------------------
A0A1M5UYN6      ------------------------------------------------------------
A0A176JBT8      ------------------------------------------------------------
A0A1I5HIC6      ------------------------------------------------------------
A0A1Y3TC51      ------------------------------------------------------------
A0A1Y3T1N0      ------------------------------------------------------------
A0A1Y3Y8U8      ------------------------------------------------------------
A0A5B0BQY5      ------------------------------------------------------------
A6CLL4          ------------------------------------------------------------
A0A174DL89      ------------------------------------------------------------
A0A176U8D6      ------------------------------------------------------------
A0A1Q6KSQ5      ------------------------------------------------------------
A0A3D3U8B3      ------------------------------------------------------------
A0A3E5FRL7      ------------------------------------------------------------
A0A1Y4QK93      ------------------------------------------------------------
B1C232          ------------------------------------------------------------
A0A401USI6      ------------------------------------------------------------
A0A1V4IQ10      ------------------------------------------------------------
A0A1S8TRD2      ------------------------------------------------------------
G7M1U2          ------------------------------------------------------------
A0A2T6KJ75      ------------------------------------------------------------
A9KN92          ------------------------------------------------------------
A0A352MUJ1      ------------------------------------------------------------
R5YI67          ------------------------------------------------------------
A0A1Y0IQP5      ------------------------------------------------------------
A0A4R2R7B1      ------------------------------------------------------------
A0A1M6E8I2      ------------------------------------------------------------
A0A1Y4N105      ------------------------------------------------------------
A0A1Y4QP75      ------------------------------------------------------------
A0A3D4QRB5      ------------------------------------------------------------
A0A349DEH5      ------------------------------------------------------------
A0A3D4T7B4      ------------------------------------------------------------
A0A350XYC7      ------------------------------------------------------------
R6DNR8          ------------------------------------------------------------
A0A355KUM5      ------------------------------------------------------------
R5YGY6          ------------------------------------------------------------
A0A0K8J554      ------------------------------------------------------------
A0A3N1XSX6      ------------------------------------------------------------
A0A1C6G0U3      ------------------------------------------------------------
A0A3D4LLB3      ------------------------------------------------------------
A0A0A5GPA9      ------------------------------------------------------------
A0A271M6M4      ------------------------------------------------------------
A0A2V3W8U6      ------------------------------------------------------------
W1UFG0          ------------------------------------------------------------
A0A351SRI8      ------------------------------------------------------------
A0A1V5LU59      ------------------------------------------------------------
A0A1E3BVC3      ------------------------------------------------------------
A0A4Q0I6S0      ------------------------------------------------------------
A3DF66          ------------------------------------------------------------
W4V1T8          ------------------------------------------------------------
A0A1I0RG99      ------------------------------------------------------------
A0A1I5G322      ------------------------------------------------------------
A0A1C6ITD7      ------------------------------------------------------------
A0A381IX63      ------------------------------------------------------------
A0A1G9IUT4      ------------------------------------------------------------
A0A1M6RWV2      ------------------------------------------------------------
A0A143XPI5      ------------------------------------------------------------
A0A355G1X5      ------------------------------------------------------------
A0A0M6WXE3      ------------------------------------------------------------
A0A348SAK2      ------------------------------------------------------------
A0A1G9H5B9      ------------------------------------------------------------
R5EFZ0          ------------------------------------------------------------
A0A1Y4H8L0      ------------------------------------------------------------
A0A4B9BMD9      ------------------------------------------------------------
A0A0M6WYQ8      ------------------------------------------------------------
A0A348SAK1      ------------------------------------------------------------
A0A252F281      ------------------------------------------------------------
A0A1Y4QKE6      ------------------------------------------------------------
B1C231          ------------------------------------------------------------
A0A1Y3TUL5      ------------------------------------------------------------
A0A1Y4JAX2      ------------------------------------------------------------
A0A1Y4T590      ------------------------------------------------------------
R5B467          ------------------------------------------------------------
A0A1Y3T163      ------------------------------------------------------------
A0A1Y3YCA2      ------------------------------------------------------------
A0A1Y4L6N9      ------------------------------------------------------------
A0A173T644      ------------------------------------------------------------
A0A1C5TSB8      ------------------------------------------------------------
C0CIK6          ------------------------------------------------------------
A0A1Y3WEF6      ------------------------------------------------------------
A0A417T0L2      ------------------------------------------------------------
A0A1H9EPU3      ------------------------------------------------------------
A0A354IGV3      ------------------------------------------------------------
A0A417JMV2      ------------------------------------------------------------
B0P408          ------------------------------------------------------------
D4MV82          ------------------------------------------------------------
A0A415VWX5      ------------------------------------------------------------
A0A173UY96      ------------------------------------------------------------
A0A173QTL1      ------------------------------------------------------------
A0A174A3T7      ------------------------------------------------------------
A0A174J359      ------------------------------------------------------------
A0A417UUA3      ------------------------------------------------------------
A0A1C6EUV9      ------------------------------------------------------------
A0A173Y645      ------------------------------------------------------------
A0A374AVY6      ------------------------------------------------------------
R7BXS4          ------------------------------------------------------------
A0A143ZUX1      ------------------------------------------------------------
S3FFL2          RNLLQRQLAQAKERLDESQRQLVNYASQQQIINLPAPSSGASGTTTSERSIVADNLATLN
A0A6A8IF17      SMFINERLGVIERELGNVDEDISSYKSEHLLPDVQA-----------ASSMYMAQSSQTN
A0A6C0V5C7      LAFLAKQLPEVRARLDDAENKLNAYRQDKDSVDLPL-----------EAKSVLDSMVNID
A0A6C0V5F7      LTFLQTQLPKISRELDEAEARLNAYREKRDSVDLSL-----------EAKSVLDQVVNVE
A0A328M4V1      LAFVKQQLPKVRLELEQATQAMNAFQTRAHSVDISM-----------QTKALLDQIVAID
A0A5C8HCX2      LEFLQRQLPEVRSELDQAEEKLNVYRQQRDSVDLNL-----------EAKAVLEQIVNVD
A0A1W1Z4C3      ------------------------------------------------------------
A0A239QN83      ------------------------------------------------------------
A0A3R9WAA7      ------------------------------------------------------------
A0A1G6BLF1      ------------------------------------------------------------
R6HZX3          ------------------------------------------------------------
A0A1W2CEA6      ------------------------------------------------------------
R7FFK6          ------------------------------------------------------------
A0A373MPB9      ------------------------------------------------------------
A0A373L519      ------------------------------------------------------------
A0A373W906      ------------------------------------------------------------
A0A373VCW2      ------------------------------------------------------------
W0U604          ------------------------------------------------------------
A0A374B6G0      ------------------------------------------------------------
A0A373VM36      ------------------------------------------------------------
A0A1C5P379      ------------------------------------------------------------
A0A373XXX0      ------------------------------------------------------------
A0A5R9MJM9      ------------------------------------------------------------
A0A356CW82      ------------------------------------------------------------
R6T4X7          ------------------------------------------------------------
A0A374HTV1      ------------------------------------------------------------
A0A374GB66      ------------------------------------------------------------
A0A374ECC6      ------------------------------------------------------------
A0A374BM61      ------------------------------------------------------------
A0A373UGZ4      ------------------------------------------------------------
A0A373SA66      ------------------------------------------------------------
A0A1C5X6X7      ------------------------------------------------------------
A0A1C6JIH3      ------------------------------------------------------------
A0A373PSC3      ------------------------------------------------------------
A0A1K1WYK8      ------------------------------------------------------------
A0A1H6IUB1      ------------------------------------------------------------
A0A1M7L1F9      ------------------------------------------------------------
A0A1C6B4L6      ------------------------------------------------------------
A0A1Q6T9P4      ------------------------------------------------------------
A0A315Y4F9      ------------------------------------------------------------
A0A354K620      ------------------------------------------------------------
A0A355G3J9      ------------------------------------------------------------
A0A3D2AD87      ------------------------------------------------------------
A0A2T5IYJ6      AEWLSSRLGVLKSNVEVSEKKLQAYREENNLVDSGNNFGVLGLSAGQLQQTNQRLIEAQF
A0A3C0QME1      ------------------------------------------------------------
A0A355FYK5      ------------------------------------------------------------
A0A357AQU0      ------------------------------------------------------------
A0A3C1YJQ7      ------------------------------------------------------------
A0A3D0JG38      ------------------------------------------------------------
A0A3C0IHX1      ------------------------------------------------------------
R5V506          ------------------------------------------------------------
A0A352TIU5      ------------------------------------------------------------
A0A3E5FSY5      ------------------------------------------------------------
A0A1V5S3C0      ------------------------------------------------------------
A0A1Y3TC98      ------------------------------------------------------------
A0A1Q6REE0      ------------------------------------------------------------
R5ETF9          ------------------------------------------------------------
R6VAT5          ------------------------------------------------------------
A0A1Q6S448      ------------------------------------------------------------
A0A351MYR0      ------------------------------------------------------------
R6HPC1          ------------------------------------------------------------
A0A3D4G5Z5      ------------------------------------------------------------
A0A3D5ES03      ------------------------------------------------------------
A0A0F2P7X6      ------------------------------------------------------------
A0A359B487      ------------------------------------------------------------
A0A348P5V4      ------------------------------------------------------------
A0A356PT74      ------------------------------------------------------------
A0A3D5LL19      ------------------------------------------------------------
R5MNF0          ------------------------------------------------------------
A0A1Q9JSI0      ------------------------------------------------------------
A0A3D5TNI1      ------------------------------------------------------------
A0A358LJD0      ------------------------------------------------------------
R6I3L7          ------------------------------------------------------------
A0A3D1HXX0      ------------------------------------------------------------
A0A3D2QJB8      ------------------------------------------------------------
D4LC36          ------------------------------------------------------------
R7MQJ4          ------------------------------------------------------------
A0A1V5GLC0      ------------------------------------------------------------
W7V182          ------------------------------------------------------------
                                                                            

A0A0H5SF45      ------------------------------------------------------------
A0A1M6JRJ5      ------------------------------------------------------------
A0A1M7Y1S2      ------------------------------------------------------------
A0A3D5R4X5      ------------------------------------------------------------
A0A1I4C3N6      ------------------------------------------------------------
A0A3B9CIM7      ------------------------------------------------------------
A0A1G9WHW8      ------------------------------------------------------------
A0A1H5VAA0      ------------------------------------------------------------
A0A3R6VK11      ------------------------------------------------------------
A0A3R6QUY7      ------------------------------------------------------------
A0A373K3P9      ------------------------------------------------------------
A0A3R6JRU5      ------------------------------------------------------------
A0A1C5MS04      ------------------------------------------------------------
A0A3C1J150      ------------------------------------------------------------
A0A416CXD7      ------------------------------------------------------------
R6XBL9          ------------------------------------------------------------
A0A355W5Z7      ------------------------------------------------------------
A0A143WVN6      ------------------------------------------------------------
W6RXP9          ------------------------------------------------------------
W6S4G8          ------------------------------------------------------------
A0A1G6BLB6      ------------------------------------------------------------
A0A1C6G8M0      ------------------------------------------------------------
A0A416MP73      ------------------------------------------------------------
A0A3E4LL92      ------------------------------------------------------------
A0A415D1L1      ------------------------------------------------------------
A0A414P2K5      ------------------------------------------------------------
V8C417          ------------------------------------------------------------
A0A143XN92      ------------------------------------------------------------
A0A173ZYY6      ------------------------------------------------------------
A0A4Q5EHM9      ------------------------------------------------------------
A0A173SMI2      ------------------------------------------------------------
A0A174ASH7      ------------------------------------------------------------
A6BH65          ------------------------------------------------------------
R7G0D7          ------------------------------------------------------------
A0A396G6S7      ------------------------------------------------------------
A0A3E5A223      ------------------------------------------------------------
R7D5E6          ------------------------------------------------------------
A0A415HQH5      ------------------------------------------------------------
A0A414W2C6      ------------------------------------------------------------
A5ZNE7          ------------------------------------------------------------
A0A395X821      ------------------------------------------------------------
A0A1C5PY68      ------------------------------------------------------------
A0A174CJF8      ------------------------------------------------------------
A0A564SRR2      ------------------------------------------------------------
A0A174R7V0      ------------------------------------------------------------
A0A373MWV2      ------------------------------------------------------------
A0A417CE88      ------------------------------------------------------------
A0A416Y441      ------------------------------------------------------------
A0A357GPJ7      ------------------------------------------------------------
A0A396PAC1      ------------------------------------------------------------
A0A416EYU4      ------------------------------------------------------------
A0A416SCQ2      ------------------------------------------------------------
A0A416TGN7      ------------------------------------------------------------
A0A417SMF6      ------------------------------------------------------------
A0A1Y4MW77      ------------------------------------------------------------
R6UHV6          ------------------------------------------------------------
A0A3R9Q621      ------------------------------------------------------------
A0A069RC75      ------------------------------------------------------------
A0A174F2W5      ------------------------------------------------------------
A0A174S8E9      ------------------------------------------------------------
A0A416ZL97      ------------------------------------------------------------
A0A174LSK1      ------------------------------------------------------------
A0A373GY92      ------------------------------------------------------------
A0A373NZQ6      ------------------------------------------------------------
A0A417I9B9      ------------------------------------------------------------
A0A417MP97      ------------------------------------------------------------
A0A417WQF8      ------------------------------------------------------------
A0A373RZ83      ------------------------------------------------------------
A0A416U6I1      ------------------------------------------------------------
R7JQZ9          ------------------------------------------------------------
A0A3B8KKL6      ------------------------------------------------------------
A0A2K9E6R0      ------------------------------------------------------------
A0A2S8RBI0      ------------------------------------------------------------
A0A0L6JLG6      ------------------------------------------------------------
G8LSN0          ------------------------------------------------------------
A0A1M5UYN6      ------------------------------------------------------------
A0A176JBT8      ------------------------------------------------------------
A0A1I5HIC6      ------------------------------------------------------------
A0A1Y3TC51      ------------------------------------------------------------
A0A1Y3T1N0      ------------------------------------------------------------
A0A1Y3Y8U8      ------------------------------------------------------------
A0A5B0BQY5      ------------------------------------------------------------
A6CLL4          ------------------------------------------------------------
A0A174DL89      ------------------------------------------------------------
A0A176U8D6      ------------------------------------------------------------
A0A1Q6KSQ5      ------------------------------------------------------------
A0A3D3U8B3      ------------------------------------------------------------
A0A3E5FRL7      ------------------------------------------------------------
A0A1Y4QK93      ------------------------------------------------------------
B1C232          ------------------------------------------------------------
A0A401USI6      ------------------------------------------------------------
A0A1V4IQ10      ------------------------------------------------------------
A0A1S8TRD2      ------------------------------------------------------------
G7M1U2          ------------------------------------------------------------
A0A2T6KJ75      ------------------------------------------------------------
A9KN92          ------------------------------------------------------------
A0A352MUJ1      ------------------------------------------------------------
R5YI67          ------------------------------------------------------------
A0A1Y0IQP5      ------------------------------------------------------------
A0A4R2R7B1      ------------------------------------------------------------
A0A1M6E8I2      ------------------------------------------------------------
A0A1Y4N105      ------------------------------------------------------------
A0A1Y4QP75      ------------------------------------------------------------
A0A3D4QRB5      ------------------------------------------------------------
A0A349DEH5      ------------------------------------------------------------
A0A3D4T7B4      ------------------------------------------------------------
A0A350XYC7      ------------------------------------------------------------
R6DNR8          ------------------------------------------------------------
A0A355KUM5      ------------------------------------------------------------
R5YGY6          ------------------------------------------------------------
A0A0K8J554      ------------------------------------------------------------
A0A3N1XSX6      ------------------------------------------------------------
A0A1C6G0U3      ------------------------------------------------------------
A0A3D4LLB3      ------------------------------------------------------------
A0A0A5GPA9      ------------------------------------------------------------
A0A271M6M4      ------------------------------------------------------------
A0A2V3W8U6      ------------------------------------------------------------
W1UFG0          ------------------------------------------------------------
A0A351SRI8      ------------------------------------------------------------
A0A1V5LU59      ------------------------------------------------------------
A0A1E3BVC3      ------------------------------------------------------------
A0A4Q0I6S0      ------------------------------------------------------------
A3DF66          ------------------------------------------------------------
W4V1T8          ------------------------------------------------------------
A0A1I0RG99      ------------------------------------------------------------
A0A1I5G322      ------------------------------------------------------------
A0A1C6ITD7      ------------------------------------------------------------
A0A381IX63      ------------------------------------------------------------
A0A1G9IUT4      ------------------------------------------------------------
A0A1M6RWV2      ------------------------------------------------------------
A0A143XPI5      ------------------------------------------------------------
A0A355G1X5      ------------------------------------------------------------
A0A0M6WXE3      ------------------------------------------------------------
A0A348SAK2      ------------------------------------------------------------
A0A1G9H5B9      ------------------------------------------------------------
R5EFZ0          ------------------------------------------------------------
A0A1Y4H8L0      ------------------------------------------------------------
A0A4B9BMD9      ------------------------------------------------------------
A0A0M6WYQ8      ------------------------------------------------------------
A0A348SAK1      ------------------------------------------------------------
A0A252F281      ------------------------------------------------------------
A0A1Y4QKE6      ------------------------------------------------------------
B1C231          ------------------------------------------------------------
A0A1Y3TUL5      ------------------------------------------------------------
A0A1Y4JAX2      ------------------------------------------------------------
A0A1Y4T590      ------------------------------------------------------------
R5B467          ------------------------------------------------------------
A0A1Y3T163      ------------------------------------------------------------
A0A1Y3YCA2      ------------------------------------------------------------
A0A1Y4L6N9      ------------------------------------------------------------
A0A173T644      ------------------------------------------------------------
A0A1C5TSB8      ------------------------------------------------------------
C0CIK6          ------------------------------------------------------------
A0A1Y3WEF6      ------------------------------------------------------------
A0A417T0L2      ------------------------------------------------------------
A0A1H9EPU3      ------------------------------------------------------------
A0A354IGV3      ------------------------------------------------------------
A0A417JMV2      ------------------------------------------------------------
B0P408          ------------------------------------------------------------
D4MV82          ------------------------------------------------------------
A0A415VWX5      ------------------------------------------------------------
A0A173UY96      ------------------------------------------------------------
A0A173QTL1      ------------------------------------------------------------
A0A174A3T7      ------------------------------------------------------------
A0A174J359      ------------------------------------------------------------
A0A417UUA3      ------------------------------------------------------------
A0A1C6EUV9      ------------------------------------------------------------
A0A173Y645      ------------------------------------------------------------
A0A374AVY6      ------------------------------------------------------------
R7BXS4          ------------------------------------------------------------
A0A143ZUX1      ------------------------------------------------------------
S3FFL2          AALTQATADRIQAEARYQQAGRAGASTEALRNSAISALRQQRAELA------ANYQKLMV
A0A6A8IF17      AQILALNNQLYMTRYIRNYLANDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVA
A0A6C0V5C7      AQLNELT---------------------------------------------FKEAEISK
A0A6C0V5F7      NQLNELT---------------------------------------------FREAEVSQ
A0A328M4V1      ASLQQLR---------------------------------------------MQMSDMQR
A0A5C8HCX2      NQLNELT---------------------------------------------FREAEISQ
A0A1W1Z4C3      ------------------------------------------------------------
A0A239QN83      ------------------------------------------------------------
A0A3R9WAA7      ------------------------------------------------------------
A0A1G6BLF1      ------------------------------------------------------------
R6HZX3          ------------------------------------------------------------
A0A1W2CEA6      ------------------------------------------------------------
R7FFK6          ------------------------------------------------------------
A0A373MPB9      ------------------------------------------------------------
A0A373L519      ------------------------------------------------------------
A0A373W906      ------------------------------------------------------------
A0A373VCW2      ------------------------------------------------------------
W0U604          ------------------------------------------------------------
A0A374B6G0      ------------------------------------------------------------
A0A373VM36      ------------------------------------------------------------
A0A1C5P379      ------------------------------------------------------------
A0A373XXX0      ------------------------------------------------------------
A0A5R9MJM9      ------------------------------------------------------------
A0A356CW82      ------------------------------------------------------------
R6T4X7          ------------------------------------------------------------
A0A374HTV1      ------------------------------------------------------------
A0A374GB66      ------------------------------------------------------------
A0A374ECC6      ------------------------------------------------------------
A0A374BM61      ------------------------------------------------------------
A0A373UGZ4      ------------------------------------------------------------
A0A373SA66      ------------------------------------------------------------
A0A1C5X6X7      ------------------------------------------------------------
A0A1C6JIH3      ------------------------------------------------------------
A0A373PSC3      ------------------------------------------------------------
A0A1K1WYK8      ------------------------------------------------------------
A0A1H6IUB1      ------------------------------------------------------------
A0A1M7L1F9      ------------------------------------------------------------
A0A1C6B4L6      ------------------------------------------------------------
A0A1Q6T9P4      ------------------------------------------------------------
A0A315Y4F9      ------------------------------------------------------------
A0A354K620      ------------------------------------------------------------
A0A355G3J9      ------------------------------------------------------------
A0A3D2AD87      ------------------------------------------------------------
A0A2T5IYJ6      KVAEISK-----------------------------------------------------
A0A3C0QME1      ------------------------------------------------------------
A0A355FYK5      ------------------------------------------------------------
A0A357AQU0      ------------------------------------------------------------
A0A3C1YJQ7      ------------------------------------------------------------
A0A3D0JG38      ------------------------------------------------------------
A0A3C0IHX1      ------------------------------------------------------------
R5V506          ------------------------------------------------------------
A0A352TIU5      ------------------------------------------------------------
A0A3E5FSY5      ------------------------------------------------------------
A0A1V5S3C0      ------------------------------------------------------------
A0A1Y3TC98      ------------------------------------------------------------
A0A1Q6REE0      ------------------------------------------------------------
R5ETF9          ------------------------------------------------------------
R6VAT5          ------------------------------------------------------------
A0A1Q6S448      ------------------------------------------------------------
A0A351MYR0      ------------------------------------------------------------
R6HPC1          ------------------------------------------------------------
A0A3D4G5Z5      ------------------------------------------------------------
A0A3D5ES03      ------------------------------------------------------------
A0A0F2P7X6      ------------------------------------------------------------
A0A359B487      ------------------------------------------------------------
A0A348P5V4      ------------------------------------------------------------
A0A356PT74      ------------------------------------------------------------
A0A3D5LL19      ------------------------------------------------------------
R5MNF0          ------------------------------------------------------------
A0A1Q9JSI0      ------------------------------------------------------------
A0A3D5TNI1      ------------------------------------------------------------
A0A358LJD0      ------------------------------------------------------------
R6I3L7          ------------------------------------------------------------
A0A3D1HXX0      ------------------------------------------------------------
A0A3D2QJB8      ------------------------------------------------------------
D4LC36          ------------------------------------------------------------
R7MQJ4          ------------------------------------------------------------
A0A1V5GLC0      ------------------------------------------------------------
W7V182          ------------------------------------------------------------
                                                                            

A0A0H5SF45      ------------------------------------------------------------
A0A1M6JRJ5      ------------------------------------------------------------
A0A1M7Y1S2      ------------------------------------------------------------
A0A3D5R4X5      ------------------------------------------------------------
A0A1I4C3N6      ------------------------------------------------------------
A0A3B9CIM7      ------------------------------------------------------------
A0A1G9WHW8      ------------------------------------------------------------
A0A1H5VAA0      ------------------------------------------------------------
A0A3R6VK11      ------------------------------------------------------------
A0A3R6QUY7      ------------------------------------------------------------
A0A373K3P9      ------------------------------------------------------------
A0A3R6JRU5      ------------------------------------------------------------
A0A1C5MS04      ------------------------------------------------------------
A0A3C1J150      ------------------------------------------------------------
A0A416CXD7      ------------------------------------------------------------
R6XBL9          ------------------------------------------------------------
A0A355W5Z7      ------------------------------------------------------------
A0A143WVN6      ------------------------------------------------------------
W6RXP9          ------------------------------------------------------------
W6S4G8          ------------------------------------------------------------
A0A1G6BLB6      ------------------------------------------------------------
A0A1C6G8M0      ------------------------------------------------------------
A0A416MP73      ------------------------------------------------------------
A0A3E4LL92      ------------------------------------------------------------
A0A415D1L1      ------------------------------------------------------------
A0A414P2K5      ------------------------------------------------------------
V8C417          ------------------------------------------------------------
A0A143XN92      ------------------------------------------------------------
A0A173ZYY6      ------------------------------------------------------------
A0A4Q5EHM9      ------------------------------------------------------------
A0A173SMI2      ------------------------------------------------------------
A0A174ASH7      ------------------------------------------------------------
A6BH65          ------------------------------------------------------------
R7G0D7          ------------------------------------------------------------
A0A396G6S7      ------------------------------------------------------------
A0A3E5A223      ------------------------------------------------------------
R7D5E6          ------------------------------------------------------------
A0A415HQH5      ------------------------------------------------------------
A0A414W2C6      ------------------------------------------------------------
A5ZNE7          ------------------------------------------------------------
A0A395X821      ------------------------------------------------------------
A0A1C5PY68      ------------------------------------------------------------
A0A174CJF8      ------------------------------------------------------------
A0A564SRR2      ------------------------------------------------------------
A0A174R7V0      ------------------------------------------------------------
A0A373MWV2      ------------------------------------------------------------
A0A417CE88      ------------------------------------------------------------
A0A416Y441      ------------------------------------------------------------
A0A357GPJ7      ------------------------------------------------------------
A0A396PAC1      ------------------------------------------------------------
A0A416EYU4      ------------------------------------------------------------
A0A416SCQ2      ------------------------------------------------------------
A0A416TGN7      ------------------------------------------------------------
A0A417SMF6      ------------------------------------------------------------
A0A1Y4MW77      ------------------------------------------------------------
R6UHV6          ------------------------------------------------------------
A0A3R9Q621      ------------------------------------------------------------
A0A069RC75      ------------------------------------------------------------
A0A174F2W5      ------------------------------------------------------------
A0A174S8E9      ------------------------------------------------------------
A0A416ZL97      ------------------------------------------------------------
A0A174LSK1      ------------------------------------------------------------
A0A373GY92      ------------------------------------------------------------
A0A373NZQ6      ------------------------------------------------------------
A0A417I9B9      ------------------------------------------------------------
A0A417MP97      ------------------------------------------------------------
A0A417WQF8      ------------------------------------------------------------
A0A373RZ83      ------------------------------------------------------------
A0A416U6I1      ------------------------------------------------------------
R7JQZ9          ------------------------------------------------------------
A0A3B8KKL6      ------------------------------------------------------------
A0A2K9E6R0      ------------------------------------------------------------
A0A2S8RBI0      ------------------------------------------------------------
A0A0L6JLG6      ------------------------------------------------------------
G8LSN0          ------------------------------------------------------------
A0A1M5UYN6      ------------------------------------------------------------
A0A176JBT8      ------------------------------------------------------------
A0A1I5HIC6      ------------------------------------------------------------
A0A1Y3TC51      ------------------------------------------------------------
A0A1Y3T1N0      ------------------------------------------------------------
A0A1Y3Y8U8      ------------------------------------------------------------
A0A5B0BQY5      ------------------------------------------------------------
A6CLL4          ------------------------------------------------------------
A0A174DL89      ------------------------------------------------------------
A0A176U8D6      ------------------------------------------------------------
A0A1Q6KSQ5      ------------------------------------------------------------
A0A3D3U8B3      ------------------------------------------------------------
A0A3E5FRL7      ------------------------------------------------------------
A0A1Y4QK93      ------------------------------------------------------------
B1C232          ------------------------------------------------------------
A0A401USI6      ------------------------------------------------------------
A0A1V4IQ10      ------------------------------------------------------------
A0A1S8TRD2      ------------------------------------------------------------
G7M1U2          ------------------------------------------------------------
A0A2T6KJ75      ------------------------------------------------------------
A9KN92          ------------------------------------------------------------
A0A352MUJ1      ------------------------------------------------------------
R5YI67          ------------------------------------------------------------
A0A1Y0IQP5      ------------------------------------------------------------
A0A4R2R7B1      ------------------------------------------------------------
A0A1M6E8I2      ------------------------------------------------------------
A0A1Y4N105      ------------------------------------------------------------
A0A1Y4QP75      ------------------------------------------------------------
A0A3D4QRB5      ------------------------------------------------------------
A0A349DEH5      ------------------------------------------------------------
A0A3D4T7B4      ------------------------------------------------------------
A0A350XYC7      ------------------------------------------------------------
R6DNR8          ------------------------------------------------------------
A0A355KUM5      ------------------------------------------------------------
R5YGY6          ------------------------------------------------------------
A0A0K8J554      ------------------------------------------------------------
A0A3N1XSX6      ------------------------------------------------------------
A0A1C6G0U3      ------------------------------------------------------------
A0A3D4LLB3      ------------------------------------------------------------
A0A0A5GPA9      ------------------------------------------------------------
A0A271M6M4      ------------------------------------------------------------
A0A2V3W8U6      ------------------------------------------------------------
W1UFG0          ------------------------------------------------------------
A0A351SRI8      ------------------------------------------------------------
A0A1V5LU59      ------------------------------------------------------------
A0A1E3BVC3      ------------------------------------------------------------
A0A4Q0I6S0      ------------------------------------------------------------
A3DF66          ------------------------------------------------------------
W4V1T8          ------------------------------------------------------------
A0A1I0RG99      ------------------------------------------------------------
A0A1I5G322      ------------------------------------------------------------
A0A1C6ITD7      ------------------------------------------------------------
A0A381IX63      ------------------------------------------------------------
A0A1G9IUT4      ------------------------------------------------------------
A0A1M6RWV2      ------------------------------------------------------------
A0A143XPI5      ------------------------------------------------------------
A0A355G1X5      ------------------------------------------------------------
A0A0M6WXE3      ------------------------------------------------------------
A0A348SAK2      ------------------------------------------------------------
A0A1G9H5B9      ------------------------------------------------------------
R5EFZ0          ------------------------------------------------------------
A0A1Y4H8L0      ------------------------------------------------------------
A0A4B9BMD9      ------------------------------------------------------------
A0A0M6WYQ8      ------------------------------------------------------------
A0A348SAK1      ------------------------------------------------------------
A0A252F281      ------------------------------------------------------------
A0A1Y4QKE6      ------------------------------------------------------------
B1C231          ------------------------------------------------------------
A0A1Y3TUL5      ------------------------------------------------------------
A0A1Y4JAX2      ------------------------------------------------------------
A0A1Y4T590      ------------------------------------------------------------
R5B467          ------------------------------------------------------------
A0A1Y3T163      ------------------------------------------------------------
A0A1Y3YCA2      ------------------------------------------------------------
A0A1Y4L6N9      ------------------------------------------------------------
A0A173T644      ------------------------------------------------------------
A0A1C5TSB8      ------------------------------------------------------------
C0CIK6          ------------------------------------------------------------
A0A1Y3WEF6      ------------------------------------------------------------
A0A417T0L2      ------------------------------------------------------------
A0A1H9EPU3      ------------------------------------------------------------
A0A354IGV3      ------------------------------------------------------------
A0A417JMV2      ------------------------------------------------------------
B0P408          ------------------------------------------------------------
D4MV82          ------------------------------------------------------------
A0A415VWX5      ------------------------------------------------------------
A0A173UY96      ------------------------------------------------------------
A0A173QTL1      ------------------------------------------------------------
A0A174A3T7      ------------------------------------------------------------
A0A174J359      ------------------------------------------------------------
A0A417UUA3      ------------------------------------------------------------
A0A1C6EUV9      ------------------------------------------------------------
A0A173Y645      ------------------------------------------------------------
A0A374AVY6      ------------------------------------------------------------
R7BXS4          ------------------------------------------------------------
A0A143ZUX1      ------------------------------------------------------------
S3FFL2          QFEPEYPAARALSAQIAQLDRSIAREESRVSGSQLADYREAQERERALKAQVDALKSSYL
A0A6A8IF17      NSSTENPLVVDMDQALASMRGAIIRSIDNQIVTLNSQIKSLRQTEQQTTSRIAANPTQAK
A0A6C0V5C7      LYTKRHP----------------------AYRTLLEKRRTLEEEKAKLNDRVTAMPKTQQ
A0A6C0V5F7      LFKKDHP----------------------TYRALREKKQTLEQERTRLNKRVSAMPSTQQ
A0A328M4V1      HFTPAHP----------------------SYKALQSQIGQMEGQKAALQKQVGQLPDIQQ
A0A5C8HCX2      LYKKDHP----------------------TYRALLEKRQTLEQERKRLNKRVSAMPSTQQ
A0A1W1Z4C3      ------------------------------------------------------------
A0A239QN83      ------------------------------------------------------------
A0A3R9WAA7      ------------------------------------------------------------
A0A1G6BLF1      ------------------------------------------------------------
R6HZX3          ------------------------------------------------------------
A0A1W2CEA6      ------------------------------------------------------------
R7FFK6          ------------------------------------------------------------
A0A373MPB9      ------------------------------------------------------------
A0A373L519      ------------------------------------------------------------
A0A373W906      ------------------------------------------------------------
A0A373VCW2      ------------------------------------------------------------
W0U604          ------------------------------------------------------------
A0A374B6G0      ------------------------------------------------------------
A0A373VM36      ------------------------------------------------------------
A0A1C5P379      ------------------------------------------------------------
A0A373XXX0      ------------------------------------------------------------
A0A5R9MJM9      ------------------------------------------------------------
A0A356CW82      ------------------------------------------------------------
R6T4X7          ------------------------------------------------------------
A0A374HTV1      ------------------------------------------------------------
A0A374GB66      ------------------------------------------------------------
A0A374ECC6      ------------------------------------------------------------
A0A374BM61      ------------------------------------------------------------
A0A373UGZ4      ------------------------------------------------------------
A0A373SA66      ------------------------------------------------------------
A0A1C5X6X7      ------------------------------------------------------------
A0A1C6JIH3      ------------------------------------------------------------
A0A373PSC3      ------------------------------------------------------------
A0A1K1WYK8      ------------------------------------------------------------
A0A1H6IUB1      ------------------------------------------------------------
A0A1M7L1F9      ------------------------------------------------------------
A0A1C6B4L6      ------------------------------------------------------------
A0A1Q6T9P4      ------------------------------------------------------------
A0A315Y4F9      ------------------------------------------------------------
A0A354K620      ------------------------------------------------------------
A0A355G3J9      ------------------------------------------------------------
A0A3D2AD87      ------------------------------------------------------------
A0A2T5IYJ6      -----------------------------RYGSKHPTLIQAELELNEAKKALEIAKADSL
A0A3C0QME1      ------------------------------------------------------------
A0A355FYK5      ------------------------------------------------------------
A0A357AQU0      ------------------------------------------------------------
A0A3C1YJQ7      ------------------------------------------------------------
A0A3D0JG38      ------------------------------------------------------------
A0A3C0IHX1      ------------------------------------------------------------
R5V506          ------------------------------------------------------------
A0A352TIU5      ------------------------------------------------------------
A0A3E5FSY5      ------------------------------------------------------------
A0A1V5S3C0      ------------------------------------------------------------
A0A1Y3TC98      ------------------------------------------------------------
A0A1Q6REE0      ------------------------------------------------------------
R5ETF9          ------------------------------------------------------------
R6VAT5          ------------------------------------------------------------
A0A1Q6S448      ------------------------------------------------------------
A0A351MYR0      ------------------------------------------------------------
R6HPC1          ------------------------------------------------------------
A0A3D4G5Z5      ------------------------------------------------------------
A0A3D5ES03      ------------------------------------------------------------
A0A0F2P7X6      ------------------------------------------------------------
A0A359B487      ------------------------------------------------------------
A0A348P5V4      ------------------------------------------------------------
A0A356PT74      ------------------------------------------------------------
A0A3D5LL19      ------------------------------------------------------------
R5MNF0          ------------------------------------------------------------
A0A1Q9JSI0      ------------------------------------------------------------
A0A3D5TNI1      ------------------------------------------------------------
A0A358LJD0      ------------------------------------------------------------
R6I3L7          ------------------------------------------------------------
A0A3D1HXX0      ------------------------------------------------------------
A0A3D2QJB8      ------------------------------------------------------------
D4LC36          ------------------------------------------------------------
R7MQJ4          ------------------------------------------------------------
A0A1V5GLC0      ------------------------------------------------------------
W7V182          ------------------------------------------------------------
                                                                            

A0A0H5SF45      --------------------------------------KENSKISVVDPVVY-P--A---
A0A1M6JRJ5      --------------------------------------KSDAVINVVDPVVY-Q--P---
A0A1M7Y1S2      --------------------------------------KTNSMIYVVDPVVC-P--T---
A0A3D5R4X5      --------------------------------------MNVDNVKILDKAVT-P--T---
A0A1I4C3N6      --------------------------------------VKSGGLQVLDEAKL-P--T---
A0A3B9CIM7      --------------------------------------VKSGGIEVLDEAEL-P--T---
A0A1G9WHW8      --------------------------------------VKAGGVQVLDSAEL-P--T---
A0A1H5VAA0      --------------------------------------VKAGGVQVLDSAEL-P--T---
A0A3R6VK11      --------------------------------------VKSGGIEVIDYATL-P--E---
A0A3R6QUY7      --------------------------------------VKSGGIEVIDYATL-P--E---
A0A373K3P9      --------------------------------------VKSGGIEVIDYATL-P--E---
A0A3R6JRU5      --------------------------------------VKSGGIEVIDYATL-P--E---
A0A1C5MS04      --------------------------------------VKSGGIEVIDYATL-P--E---
A0A3C1J150      --------------------------------------VKSGGIEVIDYATL-P--E---
A0A416CXD7      --------------------------------------VKSGGIEVIDYATL-P--E---
R6XBL9          --------------------------------------VKSGGIEVIDYATL-P--E---
A0A355W5Z7      --------------------------------------VKSGGIEVIDYATL-P--E---
A0A143WVN6      --------------------------------------FSNASLQMVREPNV-P--Y---
W6RXP9          --------------------------------------VPNGNVKVIREVRV-P--K---
W6S4G8          --------------------------------------VPNGNVKIIRHVKE-A--E---
A0A1G6BLB6      --------------------------------------LGSVIMTILDQSDI-P--T---
A0A1C6G8M0      --------------------------------------LGSNTPTVLDKADE-F--F---
A0A416MP73      --------------------------------------LGSSKPTILDKADD-L--F---
A0A3E4LL92      --------------------------------------ESGYVLQPLSSISA-N--N---
A0A415D1L1      --------------------------------------ESGYVLQPLSSISA-N--N---
A0A414P2K5      --------------------------------------ESGYVLQPLSSISA-N--N---
V8C417          --------------------------------------ESGYVLQPLSSISA-N--N---
A0A143XN92      --------------------------------------VSNVILEVLEEPQI-P--M---
A0A173ZYY6      --------------------------------------VGSAVMDVLEEPKV-P--Y---
A0A4Q5EHM9      --------------------------------------VGSAVMDVLEEPKV-P--Y---
A0A173SMI2      --------------------------------------VGSAVMDVLEEPKV-P--Y---
A0A174ASH7      --------------------------------------VGSAVMDVLEEPKI-P--Y---
A6BH65          --------------------------------------VGSAVMDVLEEPKI-P--Y---
R7G0D7          --------------------------------------VGSAVMDVLEEPKI-P--Y---
A0A396G6S7      --------------------------------------IKNVIIETIQQPSV-A--M---
A0A3E5A223      --------------------------------------IKNVIIETIQQPSV-A--M---
R7D5E6          --------------------------------------IKNVIIETIQQPSV-A--M---
A0A415HQH5      --------------------------------------IKNVIIETIQQPSV-A--M---
A0A414W2C6      --------------------------------------IKNVIIETIQQPSV-A--M---
A5ZNE7          --------------------------------------IKNVIIETIQQPSV-A--M---
A0A395X821      --------------------------------------IKNVIIETIQQPSV-A--M---
A0A1C5PY68      --------------------------------------IKNVIIETIQQPSV-A--M---
A0A174CJF8      --------------------------------------IKNVIIETIQQPSV-A--M---
A0A564SRR2      --------------------------------------IKNVIIETIQQPSV-A--M---
A0A174R7V0      --------------------------------------IKNVIIETIQQPSV-A--M---
A0A373MWV2      --------------------------------------IPNVVLETLQQPQV-S--D---
A0A417CE88      --------------------------------------IPNVVLETLQQPQV-S--G---
A0A416Y441      --------------------------------------IPNVVLETLQQPQV-S--G---
A0A357GPJ7      --------------------------------------IPNVVLETLQQPQV-S--D---
A0A396PAC1      --------------------------------------IPNVVLETLQQPQV-S--D---
A0A416EYU4      --------------------------------------IPNVVLETLQQPQV-S--D---
A0A416SCQ2      --------------------------------------IPNVVLETLQQPQV-S--D---
A0A416TGN7      --------------------------------------IPNVVLETLQQPQV-S--G---
A0A417SMF6      --------------------------------------IPNVVLETLQQPQV-S--G---
A0A1Y4MW77      --------------------------------------IGMTKFNMIENPSV-S--N---
R6UHV6          --------------------------------------VSSIVLQTLEEPVV-P--T---
A0A3R9Q621      --------------------------------------KNTTEISVVDPVVM-P--R---
A0A069RC75      --------------------------------------MNDENVRVIDYAKI-P--A---
A0A174F2W5      --------------------------------------IPNVVLETLQQPQV-S--G---
A0A174S8E9      --------------------------------------IPNVVLETLQQPQV-S--G---
A0A416ZL97      --------------------------------------IPNVVLETLQQPQV-S--G---
A0A174LSK1      --------------------------------------IPNVVLETLQQPQV-S--G---
A0A373GY92      --------------------------------------IPNVVLETLQQPQV-S--G---
A0A373NZQ6      --------------------------------------IPNVVLETLQQPQV-S--G---
A0A417I9B9      --------------------------------------IPNVVLETLQQPQV-S--G---
A0A417MP97      --------------------------------------IPNVVLETLQQPQV-S--G---
A0A417WQF8      --------------------------------------IPNVVLETLQQPQV-S--G---
A0A373RZ83      --------------------------------------IPNVVLETLQQPQV-S--G---
A0A416U6I1      --------------------------------------IPNVVLETLQQPQV-S--G---
R7JQZ9          --------------------------------------IPNVVLETLQQPQV-S--G---
A0A3B8KKL6      --------------------------------------IEVKNVMVVDEANM-P--N---
A0A2K9E6R0      --------------------------------------IEVKNVMVVDEANM-P--N---
A0A2S8RBI0      --------------------------------------IEVKNVMVVDEANM-P--N---
A0A0L6JLG6      --------------------------------------IEVKNVKVIDTAKD-P--K---
G8LSN0          --------------------------------------IQVKNVSIIDVAKV-P--E---
A0A1M5UYN6      --------------------------------------IPNGNIKIFQN----P--R---
A0A176JBT8      --------------------------------------MKIENVNILTIATP-Y--S---
A0A1I5HIC6      --------------------------------------LEMEKVNIVEEGDI-P--S---
A0A1Y3TC51      --------------------------------------FSNASLRTVQEPEV-P--S---
A0A1Y3T1N0      --------------------------------------FSNASLQILQEPQV-P--S---
A0A1Y3Y8U8      --------------------------------------FSNASLQILQEPQV-P--S---
A0A5B0BQY5      --------------------------------------MNLDNITILKEVIV-GTDT---
A6CLL4          --------------------------------------MQIDNIQILSYAQE-QDST---
A0A174DL89      --------------------------------------RGVDNVILVDSASI-P--E---
A0A176U8D6      --------------------------------------LGSSVPTVLDKAEL-S--F---
A0A1Q6KSQ5      --------------------------------------LGSNTPTVLDKADE-F--F---
A0A3D3U8B3      --------------------------------------LGSNTPTVLDKADE-F--F---
A0A3E5FRL7      --------------------------------------FTNATLQVLQEPSI-P--I---
A0A1Y4QK93      --------------------------------------FTNATLQVLQEPSI-P--T---
B1C232          --------------------------------------FTNATLQVLQEPSI-P--T---
A0A401USI6      --------------------------------------LPSGIAKIMDKALI-P--E---
A0A1V4IQ10      --------------------------------------IPNGIVKVIEDVVI-S--E---
A0A1S8TRD2      --------------------------------------IPDSTVKVIEDVVI-S--E---
G7M1U2          --------------------------------------IPDSTVKVIEDVVI-S--E---
A0A2T6KJ75      --------------------------------------MNLENVHILSQATV-NEDT---
A9KN92          --------------------------------------LEMEKVNIVEEGNI-P--T---
A0A352MUJ1      --------------------------------------YHMENIRVVDKAVA-P--S---
R5YI67          --------------------------------------YNMENIRVVDKAVA-P--S---
A0A1Y0IQP5      --------------------------------------MQVDNISILDTAKLTSDVQ---
A0A4R2R7B1      --------------------------------------MQVDNVSILDTAKLTSDVL---
A0A1M6E8I2      --------------------------------------LKVDNVEIIDEAIP-I--D---
A0A1Y4N105      --------------------------------------FSNASLQMVQDASV-P--M---
A0A1Y4QP75      --------------------------------------FSNASLQMVQDASV-P--M---
A0A3D4QRB5      --------------------------------------LNMENVQVIDTARV-S--Q---
A0A349DEH5      --------------------------------------YPYAQLNLLDTPVL-S--T---
A0A3D4T7B4      --------------------------------------YPYAQLNLLDTPVL-S--T---
A0A350XYC7      --------------------------------------YSNAKLTLCDRPVL-S--T---
R6DNR8          --------------------------------------YPNAKLTLCDKPVL-S--T---
A0A355KUM5      --------------------------------------YPNAKLTLCDTPVL-P--T---
R5YGY6          --------------------------------------YPNAKLTLCDTPVL-P--T---
A0A0K8J554      --------------------------------------KNNAKITVIDPVVF-P--T---
A0A3N1XSX6      --------------------------------------KPSAQISVVDPVSV-P--T---
A0A1C6G0U3      --------------------------------------TNTNKVEIIDKAIV-N--E---
A0A3D4LLB3      --------------------------------------TKTNNVAVVDYARL-P--L---
A0A0A5GPA9      --------------------------------------MNLNNVQILTRSNP-DAHE---
A0A271M6M4      --------------------------------------MKIDNVDILTGAKI-VNKG---
A0A2V3W8U6      --------------------------------------MNLENVNILTEAKV-EKHK---
W1UFG0          --------------------------------------TKASGVEVIDKATV-P--T---
A0A351SRI8      --------------------------------------FNIENISIIDEATV-G--E---
A0A1V5LU59      --------------------------------------IQVKNVKVIDIAKV-P--E---
A0A1E3BVC3      --------------------------------------IQVKNIKVIDTAKI-P--E---
A0A4Q0I6S0      --------------------------------------IQVKNIKVIDTAKI-P--E---
A3DF66          --------------------------------------IQVKNIKVIDTAKI-P--E---
W4V1T8          --------------------------------------IQVKNIKVIDTAKI-P--E---
A0A1I0RG99      --------------------------------------KETSQITVVDPPTL-P--T---
A0A1I5G322      --------------------------------------KDTAQISIVDPPAL-P--T---
A0A1C6ITD7      --------------------------------------RGVDNVIMVDTASI-P--E---
A0A381IX63      --------------------------------------SKVDGGQVIDEALL-P--T---
A0A1G9IUT4      --------------------------------------MKTNNVEIIDKSTI-P--D---
A0A1M6RWV2      --------------------------------------IKMENVRILDYAVV-P--S---
A0A143XPI5      --------------------------------------IGSTKLVIVDDSGVP---K---
A0A355G1X5      --------------------------------------YPNATLQIYEKPFKP---T---
A0A0M6WXE3      --------------------------------------VGTTVLDVLEDPKIP---Y---
A0A348SAK2      --------------------------------------VGTTVLDVLEDPKIP---Y---
A0A1G9H5B9      --------------------------------------VGVGNVDIMDYAVVP---V---
R5EFZ0          --------------------------------------IDDIGLEVLQYPAVP---T---
A0A1Y4H8L0      --------------------------------------LGNAVLEPLDEPEIP---L---
A0A4B9BMD9      --------------------------------------FREAEISQLYKKDHP---TYRA
A0A0M6WYQ8      --------------------------------------LGNTTLKILDETGVP---D---
A0A348SAK1      --------------------------------------LGNTTLKILDETGVP---D---
A0A252F281      --------------------------------------LSGAVFTVVREPQIA---R---
A0A1Y4QKE6      --------------------------------------LGQIQFHMINNPQLP---T---
B1C231          --------------------------------------LGQIQFHMINNPQLP---T---
A0A1Y3TUL5      --------------------------------------LKIGSVSVINEPKAT---Y---
A0A1Y4JAX2      --------------------------------------LKIGSVSVINEPKAT---Y---
A0A1Y4T590      --------------------------------------LKIGSVSVINEPKAT---Y---
R5B467          --------------------------------------VGPTELVMMDQTGVP---T---
A0A1Y3T163      --------------------------------------LGDIQFNYLNEPETP---T---
A0A1Y3YCA2      --------------------------------------LGDIQFNYLNEPETP---T---
A0A1Y4L6N9      --------------------------------------IGNTKFNMIDVPTEP---T---
A0A173T644      --------------------------------------IGETKFNMIDVPTAP---K---
A0A1C5TSB8      --------------------------------------IGETKFNMIDVPTAP---K---
C0CIK6          --------------------------------------IGETKFNMIDVPTAP---K---
A0A1Y3WEF6      --------------------------------------IGDTRFSMIDEPTTP---T---
A0A417T0L2      --------------------------------------IGDTKFNMIDEPSTP---T---
A0A1H9EPU3      --------------------------------------IGVDTVKAIDGDIGA---V---
A0A354IGV3      --------------------------------------FSSIVLTVIDGPYIP---T---
A0A417JMV2      --------------------------------------IGNVVLDVLQKPTVP---S---
B0P408          --------------------------------------IGNVVLDVLQKPTVP---S---
D4MV82          --------------------------------------IGNVVLDVLQKPTVP---S---
A0A415VWX5      --------------------------------------IGNVVLDVLQKPTVP---S---
A0A173UY96      --------------------------------------IGNVVLDVLQKPTVP---S---
A0A173QTL1      --------------------------------------IGNVVLDVLQKPTVP---S---
A0A174A3T7      --------------------------------------IGNVVLDVLQKPTVP---S---
A0A174J359      --------------------------------------IGNVVLDVLQKPTVP---S---
A0A417UUA3      --------------------------------------IGNVVLDVLQKPTVP---S---
A0A1C6EUV9      --------------------------------------IGTVVLDVLQNPTVP---S---
A0A173Y645      --------------------------------------IGTVVLDVLQNPTVP---S---
A0A374AVY6      --------------------------------------IGTVVLDVLQNPTVP---S---
R7BXS4          --------------------------------------IGTVVLDVLQNPTVP---S---
A0A143ZUX1      --------------------------------------SGSGTAFVNSVQKIQP--R---
S3FFL2          DLRRRSIQYNIYQQEVDTNRALYDGLLQRFKEIGVAGGVGINNIAVVDAADVP---Q---
A0A6A8IF17      YLLS-------VERQQKVKEALYLFLLQKREENELSQAFTAYNTRIVTPPHGS---M---
A0A6C0V5C7      EIVR-------LTRDVESGQQVYMQLLNKQQELKITEASTVGDVRIVDPAITQ---P---
A0A6C0V5F7      EILR-------LSRDVESGRTIYLQLLTRQQELNISRSSAIGNVRIIDPAVTQ---P---
A0A328M4V1      QMLR-------LARDVQVSNTTYTSLLNQAQQLNIARAGTVGNVRVIDRAATDT--A---
A0A5C8HCX2      EVLR-------LSRDVEAGRAVYLQLLNRQQELSISKSSAIGNVRIIDPAVTQ---P---
A0A1W1Z4C3      --------------------------------------VAAGEAKAQDYATIP---M---
A0A239QN83      --------------------------------------VTAGEAKAQDYAVVP---L---
A0A3R9WAA7      --------------------------------------VGTTHLNMIEESGIP---A---
A0A1G6BLF1      --------------------------------------IGSTTLEVMSESGVP---T---
R6HZX3          --------------------------------------IGGTQLSMIEEPQVP---T---
A0A1W2CEA6      --------------------------------------MELRKPQILEKARTP---I---
R7FFK6          --------------------------------------VGAGSVEKIGDAKIY---D---
A0A373MPB9      --------------------------------------IGAGSVEKIGDAEVY---N---
A0A373L519      --------------------------------------IGAGSVEKIGDAEVY---N---
A0A373W906      --------------------------------------IGAGSVEKIGDAEVY---N---
A0A373VCW2      --------------------------------------IGAGSVEKIGDAEVY---N---
W0U604          --------------------------------------IGAGSVEKIGDAEVY---N---
A0A374B6G0      --------------------------------------IGAGSVEKIGDAEVY---N---
A0A373VM36      --------------------------------------IGAGSVEKIGDAEVY---N---
A0A1C5P379      --------------------------------------IGAGSVEKIGDAEVY---N---
A0A373XXX0      --------------------------------------IGAGSVEKIGDAEVY---N---
A0A5R9MJM9      --------------------------------------IGAGSVEKIGDAEVY---N---
A0A356CW82      --------------------------------------IGAGSVEKIGDAEVY---N---
R6T4X7          --------------------------------------IGAGSVEKIGDAEVY---N---
A0A374HTV1      --------------------------------------IGAGSVEKIGDAEVY---N---
A0A374GB66      --------------------------------------IGAGSVEKIGDAEVY---N---
A0A374ECC6      --------------------------------------IGAGSVEKIGDAEVY---N---
A0A374BM61      --------------------------------------IGAGSVEKIGDAEVY---N---
A0A373UGZ4      --------------------------------------IGAGSVEKIGDAEVY---N---
A0A373SA66      --------------------------------------IGAGSVEKIGDAEVY---N---
A0A1C5X6X7      --------------------------------------IGAGSVEKIGDAEVY---N---
A0A1C6JIH3      --------------------------------------IGAGSVEKIGDAEVY---N---
A0A373PSC3      --------------------------------------IGAGSVEKIGDAEVY---N---
A0A1K1WYK8      --------------------------------------VGVGSINTIGKAKVY---K---
A0A1H6IUB1      --------------------------------------VGVGSINTIDRAKVY---N---
A0A1M7L1F9      --------------------------------------VGVGSINTIDVAKVY---N---
A0A1C6B4L6      --------------------------------------VGVGSINTIDKAKVY---E---
A0A1Q6T9P4      --------------------------------------VGVGSINTIDKAKVY---E---
A0A315Y4F9      --------------------------------------VGVGSINTIDTAKVY---N---
A0A354K620      --------------------------------------VGVGSINTIDTAKVY---K---
A0A355G3J9      --------------------------------------VKAASVEIIEEPKLP---T---
A0A3D2AD87      --------------------------------------VDKNIRVSTTNADST---S---
A0A2T5IYJ6      ELSKKEFKFKELQREVETNRNLYDTFFARIKQANDSLELDTANARVIDKAVVP---N---
A0A3C0QME1      --------------------------------------VGAGSVEVIDVAESV---Y---
A0A355FYK5      --------------------------------------ASTINVRLINYPSSP---A---
A0A357AQU0      --------------------------------------VGAGSVEIIGAAVPA---T---
A0A3C1YJQ7      --------------------------------------VGAGSVEIIGAAVPA---T---
A0A3D0JG38      --------------------------------------VGAGSVEIIGAAVPA---T---
A0A3C0IHX1      --------------------------------------IGAGSVEVIGDAEIP---Q---
R5V506          --------------------------------------IGAGSVEVIGDAEIP---Q---
A0A352TIU5      --------------------------------------IGAGSVEVIGDAEVP---Q---
A0A3E5FSY5      --------------------------------------LGQIQFHMINNPQLP---T---
A0A1V5S3C0      --------------------------------------FPNAKYTVVNDATEP---N---
A0A1Y3TC98      --------------------------------------LGDIQFNMLDGPETP---A---
A0A1Q6REE0      --------------------------------------VGSTVLVLLDESGMP---T---
R5ETF9          --------------------------------------VGSTVLVLLDESGMP---T---
R6VAT5          --------------------------------------VGATDLVLVVPPSAS---S---
A0A1Q6S448      --------------------------------------SSSAVLTQLNAPSLS---V---
A0A351MYR0      --------------------------------------SSTAVLSQLNSPSLS---V---
R6HPC1          --------------------------------------SSTAVLSQLNAPTLS---V---
A0A3D4G5Z5      --------------------------------------SSTAVLSQLNAPTLS---V---
A0A3D5ES03      --------------------------------------SSTAVLSQLNAPTLS---V---
A0A0F2P7X6      --------------------------------------VEVGSINVLDNAKVP---E---
A0A359B487      --------------------------------------VEVGSINVLDNAKVP---E---
A0A348P5V4      --------------------------------------FPNTALTVIDPPLKA---E---
A0A356PT74      --------------------------------------FPSTTLTVIDPPLLA---S---
A0A3D5LL19      --------------------------------------FPSTTLTVIDPPLLA---S---
R5MNF0          --------------------------------------FPSTTLTVIDPPLLA---S---
A0A1Q9JSI0      --------------------------------------MGNVVLDVLQNPTVP---S---
A0A3D5TNI1      --------------------------------------SGGSI-HLCDMPELP---T---
A0A358LJD0      --------------------------------------SGGSI-HLCDEPELP---T---
R6I3L7          --------------------------------------SGGSI-HLCDEPELP---T---
A0A3D1HXX0      --------------------------------------SGGSI-HLCDEPELP---T---
A0A3D2QJB8      --------------------------------------SGGSI-HLCDEPELP---T---
D4LC36          --------------------------------------VGAGSVEKIGDAKIY---E---
R7MQJ4          --------------------------------------VGAGSVEAIGTAKVN---N---
A0A1V5GLC0      --------------------------------------IGVGQINYIDTAKVY---P---
W7V182          --------------------------------------VGVGQINTIGTAEVY---N---
                                                                            

A0A0H5SF45      ------------------------------------------------------------
A0A1M6JRJ5      ------------------------------------------------------------
A0A1M7Y1S2      ------------------------------------------------------------
A0A3D5R4X5      ------------------------------------------------------------
A0A1I4C3N6      ------------------------------------------------------------
A0A3B9CIM7      ------------------------------------------------------------
A0A1G9WHW8      ------------------------------------------------------------
A0A1H5VAA0      ------------------------------------------------------------
A0A3R6VK11      ------------------------------------------------------------
A0A3R6QUY7      ------------------------------------------------------------
A0A373K3P9      ------------------------------------------------------------
A0A3R6JRU5      ------------------------------------------------------------
A0A1C5MS04      ------------------------------------------------------------
A0A3C1J150      ------------------------------------------------------------
A0A416CXD7      ------------------------------------------------------------
R6XBL9          ------------------------------------------------------------
A0A355W5Z7      ------------------------------------------------------------
A0A143WVN6      ------------------------------------------------------------
W6RXP9          ------------------------------------------------------------
W6S4G8          ------------------------------------------------------------
A0A1G6BLB6      ------------------------------------------------------------
A0A1C6G8M0      ------------------------------------------------------------
A0A416MP73      ------------------------------------------------------------
A0A3E4LL92      ------------------------------------------------------------
A0A415D1L1      ------------------------------------------------------------
A0A414P2K5      ------------------------------------------------------------
V8C417          ------------------------------------------------------------
A0A143XN92      ------------------------------------------------------------
A0A173ZYY6      ------------------------------------------------------------
A0A4Q5EHM9      ------------------------------------------------------------
A0A173SMI2      ------------------------------------------------------------
A0A174ASH7      ------------------------------------------------------------
A6BH65          ------------------------------------------------------------
R7G0D7          ------------------------------------------------------------
A0A396G6S7      ------------------------------------------------------------
A0A3E5A223      ------------------------------------------------------------
R7D5E6          ------------------------------------------------------------
A0A415HQH5      ------------------------------------------------------------
A0A414W2C6      ------------------------------------------------------------
A5ZNE7          ------------------------------------------------------------
A0A395X821      ------------------------------------------------------------
A0A1C5PY68      ------------------------------------------------------------
A0A174CJF8      ------------------------------------------------------------
A0A564SRR2      ------------------------------------------------------------
A0A174R7V0      ------------------------------------------------------------
A0A373MWV2      ------------------------------------------------------------
A0A417CE88      ------------------------------------------------------------
A0A416Y441      ------------------------------------------------------------
A0A357GPJ7      ------------------------------------------------------------
A0A396PAC1      ------------------------------------------------------------
A0A416EYU4      ------------------------------------------------------------
A0A416SCQ2      ------------------------------------------------------------
A0A416TGN7      ------------------------------------------------------------
A0A417SMF6      ------------------------------------------------------------
A0A1Y4MW77      ------------------------------------------------------------
R6UHV6          ------------------------------------------------------------
A0A3R9Q621      ------------------------------------------------------------
A0A069RC75      ------------------------------------------------------------
A0A174F2W5      ------------------------------------------------------------
A0A174S8E9      ------------------------------------------------------------
A0A416ZL97      ------------------------------------------------------------
A0A174LSK1      ------------------------------------------------------------
A0A373GY92      ------------------------------------------------------------
A0A373NZQ6      ------------------------------------------------------------
A0A417I9B9      ------------------------------------------------------------
A0A417MP97      ------------------------------------------------------------
A0A417WQF8      ------------------------------------------------------------
A0A373RZ83      ------------------------------------------------------------
A0A416U6I1      ------------------------------------------------------------
R7JQZ9          ------------------------------------------------------------
A0A3B8KKL6      ------------------------------------------------------------
A0A2K9E6R0      ------------------------------------------------------------
A0A2S8RBI0      ------------------------------------------------------------
A0A0L6JLG6      ------------------------------------------------------------
G8LSN0          ------------------------------------------------------------
A0A1M5UYN6      ------------------------------------------------------------
A0A176JBT8      ------------------------------------------------------------
A0A1I5HIC6      ------------------------------------------------------------
A0A1Y3TC51      ------------------------------------------------------------
A0A1Y3T1N0      ------------------------------------------------------------
A0A1Y3Y8U8      ------------------------------------------------------------
A0A5B0BQY5      ------------------------------------------------------------
A6CLL4          ------------------------------------------------------------
A0A174DL89      ------------------------------------------------------------
A0A176U8D6      ------------------------------------------------------------
A0A1Q6KSQ5      ------------------------------------------------------------
A0A3D3U8B3      ------------------------------------------------------------
A0A3E5FRL7      ------------------------------------------------------------
A0A1Y4QK93      ------------------------------------------------------------
B1C232          ------------------------------------------------------------
A0A401USI6      ------------------------------------------------------------
A0A1V4IQ10      ------------------------------------------------------------
A0A1S8TRD2      ------------------------------------------------------------
G7M1U2          ------------------------------------------------------------
A0A2T6KJ75      ------------------------------------------------------------
A9KN92          ------------------------------------------------------------
A0A352MUJ1      ------------------------------------------------------------
R5YI67          ------------------------------------------------------------
A0A1Y0IQP5      ------------------------------------------------------------
A0A4R2R7B1      ------------------------------------------------------------
A0A1M6E8I2      ------------------------------------------------------------
A0A1Y4N105      ------------------------------------------------------------
A0A1Y4QP75      ------------------------------------------------------------
A0A3D4QRB5      ------------------------------------------------------------
A0A349DEH5      ------------------------------------------------------------
A0A3D4T7B4      ------------------------------------------------------------
A0A350XYC7      ------------------------------------------------------------
R6DNR8          ------------------------------------------------------------
A0A355KUM5      ------------------------------------------------------------
R5YGY6          ------------------------------------------------------------
A0A0K8J554      ------------------------------------------------------------
A0A3N1XSX6      ------------------------------------------------------------
A0A1C6G0U3      ------------------------------------------------------------
A0A3D4LLB3      ------------------------------------------------------------
A0A0A5GPA9      ------------------------------------------------------------
A0A271M6M4      ------------------------------------------------------------
A0A2V3W8U6      ------------------------------------------------------------
W1UFG0          ------------------------------------------------------------
A0A351SRI8      ------------------------------------------------------------
A0A1V5LU59      ------------------------------------------------------------
A0A1E3BVC3      ------------------------------------------------------------
A0A4Q0I6S0      ------------------------------------------------------------
A3DF66          ------------------------------------------------------------
W4V1T8          ------------------------------------------------------------
A0A1I0RG99      ------------------------------------------------------------
A0A1I5G322      ------------------------------------------------------------
A0A1C6ITD7      ------------------------------------------------------------
A0A381IX63      ------------------------------------------------------------
A0A1G9IUT4      ------------------------------------------------------------
A0A1M6RWV2      ------------------------------------------------------------
A0A143XPI5      ------------------------------------------------------------
A0A355G1X5      ------------------------------------------------------------
A0A0M6WXE3      ------------------------------------------------------------
A0A348SAK2      ------------------------------------------------------------
A0A1G9H5B9      ------------------------------------------------------------
R5EFZ0          ------------------------------------------------------------
A0A1Y4H8L0      ------------------------------------------------------------
A0A4B9BMD9      LLEKRQTLEQERKRLNKRVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQQELSISKSSA
A0A0M6WYQ8      ------------------------------------------------------------
A0A348SAK1      ------------------------------------------------------------
A0A252F281      ------------------------------------------------------------
A0A1Y4QKE6      ------------------------------------------------------------
B1C231          ------------------------------------------------------------
A0A1Y3TUL5      ------------------------------------------------------------
A0A1Y4JAX2      ------------------------------------------------------------
A0A1Y4T590      ------------------------------------------------------------
R5B467          ------------------------------------------------------------
A0A1Y3T163      ------------------------------------------------------------
A0A1Y3YCA2      ------------------------------------------------------------
A0A1Y4L6N9      ------------------------------------------------------------
A0A173T644      ------------------------------------------------------------
A0A1C5TSB8      ------------------------------------------------------------
C0CIK6          ------------------------------------------------------------
A0A1Y3WEF6      ------------------------------------------------------------
A0A417T0L2      ------------------------------------------------------------
A0A1H9EPU3      ------------------------------------------------------------
A0A354IGV3      ------------------------------------------------------------
A0A417JMV2      ------------------------------------------------------------
B0P408          ------------------------------------------------------------
D4MV82          ------------------------------------------------------------
A0A415VWX5      ------------------------------------------------------------
A0A173UY96      ------------------------------------------------------------
A0A173QTL1      ------------------------------------------------------------
A0A174A3T7      ------------------------------------------------------------
A0A174J359      ------------------------------------------------------------
A0A417UUA3      ------------------------------------------------------------
A0A1C6EUV9      ------------------------------------------------------------
A0A173Y645      ------------------------------------------------------------
A0A374AVY6      ------------------------------------------------------------
R7BXS4          ------------------------------------------------------------
A0A143ZUX1      ------------------------------------------------------------
S3FFL2          ------------------------------------------------------------
A0A6A8IF17      ------------------------------------------------------------
A0A6C0V5C7      ------------------------------------------------------------
A0A6C0V5F7      ------------------------------------------------------------
A0A328M4V1      ------------------------------------------------------------
A0A5C8HCX2      ------------------------------------------------------------
A0A1W1Z4C3      ------------------------------------------------------------
A0A239QN83      ------------------------------------------------------------
A0A3R9WAA7      ------------------------------------------------------------
A0A1G6BLF1      ------------------------------------------------------------
R6HZX3          ------------------------------------------------------------
A0A1W2CEA6      ------------------------------------------------------------
R7FFK6          ------------------------------------------------------------
A0A373MPB9      ------------------------------------------------------------
A0A373L519      ------------------------------------------------------------
A0A373W906      ------------------------------------------------------------
A0A373VCW2      ------------------------------------------------------------
W0U604          ------------------------------------------------------------
A0A374B6G0      ------------------------------------------------------------
A0A373VM36      ------------------------------------------------------------
A0A1C5P379      ------------------------------------------------------------
A0A373XXX0      ------------------------------------------------------------
A0A5R9MJM9      ------------------------------------------------------------
A0A356CW82      ------------------------------------------------------------
R6T4X7          ------------------------------------------------------------
A0A374HTV1      ------------------------------------------------------------
A0A374GB66      ------------------------------------------------------------
A0A374ECC6      ------------------------------------------------------------
A0A374BM61      ------------------------------------------------------------
A0A373UGZ4      ------------------------------------------------------------
A0A373SA66      ------------------------------------------------------------
A0A1C5X6X7      ------------------------------------------------------------
A0A1C6JIH3      ------------------------------------------------------------
A0A373PSC3      ------------------------------------------------------------
A0A1K1WYK8      ------------------------------------------------------------
A0A1H6IUB1      ------------------------------------------------------------
A0A1M7L1F9      ------------------------------------------------------------
A0A1C6B4L6      ------------------------------------------------------------
A0A1Q6T9P4      ------------------------------------------------------------
A0A315Y4F9      ------------------------------------------------------------
A0A354K620      ------------------------------------------------------------
A0A355G3J9      ------------------------------------------------------------
A0A3D2AD87      ------------------------------------------------------------
A0A2T5IYJ6      ------------------------------------------------------------
A0A3C0QME1      ------------------------------------------------------------
A0A355FYK5      ------------------------------------------------------------
A0A357AQU0      ------------------------------------------------------------
A0A3C1YJQ7      ------------------------------------------------------------
A0A3D0JG38      ------------------------------------------------------------
A0A3C0IHX1      ------------------------------------------------------------
R5V506          ------------------------------------------------------------
A0A352TIU5      ------------------------------------------------------------
A0A3E5FSY5      ------------------------------------------------------------
A0A1V5S3C0      ------------------------------------------------------------
A0A1Y3TC98      ------------------------------------------------------------
A0A1Q6REE0      ------------------------------------------------------------
R5ETF9          ------------------------------------------------------------
R6VAT5          ------------------------------------------------------------
A0A1Q6S448      ------------------------------------------------------------
A0A351MYR0      ------------------------------------------------------------
R6HPC1          ------------------------------------------------------------
A0A3D4G5Z5      ------------------------------------------------------------
A0A3D5ES03      ------------------------------------------------------------
A0A0F2P7X6      ------------------------------------------------------------
A0A359B487      ------------------------------------------------------------
A0A348P5V4      ------------------------------------------------------------
A0A356PT74      ------------------------------------------------------------
A0A3D5LL19      ------------------------------------------------------------
R5MNF0          ------------------------------------------------------------
A0A1Q9JSI0      ------------------------------------------------------------
A0A3D5TNI1      ------------------------------------------------------------
A0A358LJD0      ------------------------------------------------------------
R6I3L7          ------------------------------------------------------------
A0A3D1HXX0      ------------------------------------------------------------
A0A3D2QJB8      ------------------------------------------------------------
D4LC36          ------------------------------------------------------------
R7MQJ4          ------------------------------------------------------------
A0A1V5GLC0      ------------------------------------------------------------
W7V182          ------------------------------------------------------------
                                                                            

A0A0H5SF45      -----------GPS---GPNIYLN-TILGA--VAGLVLAIAISFFWELIDVKIKSKEDLT
A0A1M6JRJ5      -----------SPS---GPNTILN-TLLGG--IICGFMAFFLSMVKEVLNLKVVSQEDLL
A0A1M7Y1S2      -----------SPS---GPNILLN-TLLGG--IVCGFLAFFLFVLKEILNLKVINQEDLL
A0A3D5R4X5      -----------SPI---KPNKMMNIAIAGV--LGLMLSVGLVFLIE-FLDKTIKTPEDIE
A0A1I4C3N6      -----------EPY---ESTSTILFALIGA--VGFGVMSAVGFLFFGLQDTRIRRKYEVE
A0A3B9CIM7      -----------VPY---QSTSVLKYAVLGA--AAGFLLAAAWFLLRSMLDTTVRRKYEIE
A0A1G9WHW8      -----------SPY---QQTNVPFTAILGF--FFGAILAFIFFILKGLLNTTIRKKYEIE
A0A1H5VAA0      -----------SPY---QQTNVPFTAILGF--FFGAILAFIFFILKGLLNTTIRKKYEIE
A0A3R6VK11      -----------APY---SSTSLVKYALVGF--AGCFGASFVLFLLAGLMDTTIRRRYELK
A0A3R6QUY7      -----------APY---SSTSLVKYALVGF--VGCFGASFVLFLLAGLMDTTIRRRYELK
A0A373K3P9      -----------APY---SSTSLVKYALVGF--AGCFGASFVLFLLAGLMDTTIRRRYELK
A0A3R6JRU5      -----------APY---SSTSLVKYALVGF--AGCFGASFVLFLLAGLMDTTIRRRYELK
A0A1C5MS04      -----------APY---SSTSLVKYALVGF--AGCFGASFVLFLLAGLMDTTIRRRYELK
A0A3C1J150      -----------APY---SSTSLVKYALVGF--AGCFGASFVLFLLAGLMDTTIRRRYELK
A0A416CXD7      -----------APY---SSTSLVKYALVGF--AGCFGASFVLFLLAGLMDTTIRRRYELK
R6XBL9          -----------APY---SSTSLVKYALVGF--AGCFGASFVLFLLAGLMDTTIRRRYELK
A0A355W5Z7      -----------APY---SSTSLVKYALVGF--AGCFGASFVLFLLAGLMDTTIRRRYELK
A0A143WVN6      -----------GPS---NYVNYLRIQRMAT--LAAGGLTAAVIVLVSILRPTVKRKSSAR
W6RXP9          -----------DPV---APNKVMNIA-IAF--LLGLMVGVGLTFLLEYLDNTFKTKESVE
W6S4G8          -----------API---SPNKKMNII-LGF--LIGLVSGMAIVFLIEYMNNTYKSKEEVE
A0A1G6BLB6      -----------QPD---AAFAPANAMVKMF--IIVFCLMLVIVAFGSTFQDAIRAENEVE
A0A1C6G8M0      -----------AEN---TRRSVVSYILIGL--MAGIVVSCGVIAISVITNTSIKNEEDIQ
A0A416MP73      -----------AEN---TRRSVLSYALIGI--LAGIVIACGIVAVSVITNTSIKSDEDIQ
A0A3E4LL92      -----------VQR---TEKATVKYSALLI--LLVLAGGVGATVCLCIFTDKIHSMEQAK
A0A415D1L1      -----------VQK---TEKATLRYSLLLI--LLVLAGGIGATVYLCIFTDKIHSMEQAK
A0A414P2K5      -----------VQK---TEKATLRYSLLLI--LLVLAGGIGATVCLCIFTDKIHSMEQAK
V8C417          -----------VQK---TEKATLRYSLLLI--FLVLAGGIGATVCLCIFTDKIHSMEQAK
A0A143XN92      -----------AAS---NANQAEDIAKKAF--WMSGTAVLALILFFSMKKDTIKSEEEFR
A0A173ZYY6      -----------TPD---NPLDAGGQAKKGG--LVAGALVIILLGLFSYMKNTIKQENEIE
A0A4Q5EHM9      -----------TPD---NPLDAGGQAKKGG--LVAGALVIILLGLFSYMKNTIKQENEIE
A0A173SMI2      -----------TPD---NPLDAGGQAKKGG--LVAGALVLILLGLFSYMKNTIKQENEIE
A0A174ASH7      -----------TPD---NPLDAGGQAKKGG--LVAGALVLILLGLFSYMKNTIKQENEIE
A6BH65          -----------TPD---NPLDAGRQAKKGG--LVAGALVLILLGMFSYMKNTIKQENEIE
R7G0D7          -----------TPD---NPLDAGRQAKKGG--LVAGALVLILLGMFSYMKNTIKQENEIE
A0A396G6S7      -----------API---NPLDEKRTVMKVF--AVAAGCLIALLAGISYIRDTIKNPGEVS
A0A3E5A223      -----------API---NPLDEKRTVMKVF--AVAAGCLIALLAGISYIRDTIKNPGEVS
R7D5E6          -----------API---NPLDEKRTVMKVF--AVAAGCLIALLAGISYIRDTIKNPGEVS
A0A415HQH5      -----------API---NPLDEKRTVMKVF--AVAAGCLIALLAGISYIRDTIKNPGEVS
A0A414W2C6      -----------API---NPLDEKRTVMKVF--VVAAGCLIALLAGISYIRDTIKNPGEVS
A5ZNE7          -----------API---NPLDEKRTVMKVF--AVAAGCLIALLAGISYIRDTIKNPGEVS
A0A395X821      -----------API---NPLDEKRTVMKVF--AVAAGCLIALLAGISYIRDTIKNPGEVS
A0A1C5PY68      -----------API---NPLDEKRTVMKVF--VVTAGCLIVLLAGISYIRDTIKNPGEVS
A0A174CJF8      -----------API---NPLDEKRTVMKVF--VVAAGCLIALLAGISYIRDTIKNPGEVS
A0A564SRR2      -----------API---NPLDEKRTVMKVF--VVAAGCLIALLAGISYIRDTIKNPGEVS
A0A174R7V0      -----------API---NPLDEKRTVMKVF--VVAAGCLIALLAGISYIRDTIKNPGEVS
A0A373MWV2      -----------NPS---NRIPTEKYAAMAF--LAAALGTAALVGFFSFLRDTVKNETEFG
A0A417CE88      -----------NPS---NRIPTEKYAAMAF--LAAALGTAALVGFFSFLRDTVKNETEFG
A0A416Y441      -----------NPS---NRIPTEKYAAMAF--LAAALGTAALVGFFSFLRDTVKNETEFG
A0A357GPJ7      -----------NPS---NRIPTEKYAAMAF--LAAALGTAALVGFFSFLRDTVKNETEFG
A0A396PAC1      -----------NPS---NRIPTEKYAAMAF--LAAALGTAALVGFFSFLRDTVKNETEFG
A0A416EYU4      -----------NPS---NRIPTEKYAAMAF--LAAALGTAALVGFFSFLRDTVKNETEFG
A0A416SCQ2      -----------NPS---NRIPTEKYAAMAF--LAAALGTAALVGFFSFLRDTVKNETEFG
A0A416TGN7      -----------NPS---NRIPTEKYAAMAF--LAAALGTAALVGFFSFLRDTVKNETEFG
A0A417SMF6      -----------NPS---NRIPTEKYAAMAF--LAAALGTAALVGFFSFLRDTVKNETEFG
A0A1Y4MW77      -----------VPY---NQLNYFNTVAKGA--LIGLAVGLVIIAIYAFFRKTVHKTQELE
R6UHV6          -----------EPT---NPSNALKLAVIGF--FAGAAAVVLIISVLSFYKDTVKKESDIN
A0A3R9Q621      -----------QPS---GPHVLLNTA-IGG--LMGFVLSVLLVFIWELIDVNVKDEEELK
A0A069RC75      -----------VPS---KPDKILNMA-AGV--FFGIMGGLLVVYVLEYFDNAVRSAEDIQ
A0A174F2W5      -----------NPS---NRIPTEKYAAMAF--LAAALGTAALVGFFSFLRDTVKNETEFG
A0A174S8E9      -----------NPS---NRIPTEKYAAMAF--LAAALGTAALVGFFSFLRDTVKNETEFG
A0A416ZL97      -----------VPS---NQIPTKKYAATAF--LAAALAMAALIGLFSFLRDTVKNEAEFT
A0A174LSK1      -----------VPS---NQIPTKKYAATAF--LAAALAMAALIGLFSFLRDTVKNEAEFT
A0A373GY92      -----------VPS---NQIPTKKYAATAF--LAAALAMAALIGLFSFLRDTVKNEAEFT
A0A373NZQ6      -----------VPS---NQIPTKKYAATAF--LAAALAMAALIGLFSFLRDTVKNEAEFT
A0A417I9B9      -----------VPS---NQIPTKKYAATAF--LAAALAMAALIGLFSFLRDTVKNEAEFT
A0A417MP97      -----------VPS---NQIPTKKYAATAF--LAAALAMAALIGLFSFLRDTVKNEAEFT
A0A417WQF8      -----------VPS---NQIPTKKYAATAF--LAAALAMAALIGLFSFLRDTVKNEAEFT
A0A373RZ83      -----------VPS---NQIPTKKYAATAF--LAAALAMAALIGLFSFLRDTVKNEAEFT
A0A416U6I1      -----------VPS---NQIPTKKYAATAF--LAAALAMAALIGLFSFLRDTVKNEAEFT
R7JQZ9          -----------VPS---NQIPTKKYAATAF--LAAALAMAALIGLFSFLRDTVKNEAEFT
A0A3B8KKL6      -----------SPV---KPNKKMNVA-VAG--LLGIVLGVGLILVLEFVDHTFKKPDEVE
A0A2K9E6R0      -----------SPV---KPNKKMNVA-VAG--LLGIVLGVGLILVLEFVDHTFKKPDEVE
A0A2S8RBI0      -----------SPV---KPNKKMNVA-VAG--LLGIVLGVGLILVLEFVDHTFKKPDEVE
A0A0L6JLG6      -----------DPV---KPNKKMNVG-LAG--FLGILLGVSLIYLLEFIDHTFKKPEDVE
G8LSN0          -----------RPV---GPSAKKNVG-IAG--ILGLALAAGLIYLLEIMDYTFKKPEDVE
A0A1M5UYN6      -----------SFQ---DSVNKIKIILYSF--ILGLLISITLVFLLDFLDNTIKTKEEVE
A0A176JBT8      -----------STS---KPILLFNLL-LSF--AAGLILATIFVLIKELKNKKFESKKGIT
A0A1I5HIC6      -----------FPT---SPSIIKNAI-LGS--LAGAFISTFIIILIHIIDDTVKDVEQIE
A0A1Y3TC51      -----------APS---NTSAAMRYRYPLM--AAGAAGMAALICLLYVMRFTVKNPLCAQ
A0A1Y3T1N0      -----------SPS---NTSWIMARRNLLT--AAGMLAMAAVICLFYLLRFTVKSPSSAS
A0A1Y3Y8U8      -----------SPS---NTSWIMARRNLLA--AAGMLAMAAVICLFYLLRFTVKSPSSAS
A0A5B0BQY5      -----------KMI---KPFTFYYLI-VSL--GIGFLISIAVVLIGEVYFTRLNTERKVE
A6CLL4          -----------TPV---KPSLILSAG-ISF--TIGIFLAILIVFIREAFFTKLNNQEKVE
A0A174DL89      -----------KPT---KPNIIINIS-LSF--ILGLIFSISLVVLINYLDQRIKDKDELK
A0A176U8D6      -----------TEN---TRHSILFYSVIGV--VVGLFLACGIIALMVITNVSVKTDEDVQ
A0A1Q6KSQ5      -----------AEN---TRRSVVSYILIGL--MAGIVVSCGVIAISVITNTSIKNEEDIQ
A0A3D3U8B3      -----------AEN---TRRSVVSYILIGL--MAGIVVSCGVIAISVITNTSIKNEEDIQ
A0A3E5FRL7      -----------TPS---NSSKLINYRNYIA--LLGGVAVTGIIICLYLFRHTLKSSKNAT
A0A1Y4QK93      -----------TPS---NSSRLINYRNYIA--LLGGIAVTGIIACLYLFRHTLKSSKNAG
B1C232          -----------TPS---NSSRLINYRNYIA--LLGGVAVAGIIVCLYLFRHTLKSSENAT
A0A401USI6      -----------LPI---TPKKKFNIS-IGF--IIGLILSLGLVLLINYLNNTIKSEDDVQ
A0A1V4IQ10      -----------TLT---SSKKKMYVA-IGF--MLGLMISIGIIFLIELLDYTFKNKEKLE
A0A1S8TRD2      -----------TLT---SSKKRMYVA-IGF--IIGLMLSLGIIFLIEFLDYTFKDKEKLE
G7M1U2          -----------TLT---SSKKRMYVA-IGF--IIGLMLSFGIIFLIEFLDYTFKDKEKLE
A0A2T6KJ75      -----------KSV---KPITALFFI-ISA--IIGFLASYSFILIQEMFFTLVDSSEKAE
A9KN92          -----------IPT---SPHIMKNTI-LSG--IIGALISAFVIIFIHIIDDSIKNAEQIE
A0A352MUJ1      -----------SPS---NINPVKYAG-IFA--VVGFVISVGVILVLNLFDSTVKNDKDIE
R5YI67          -----------APS---NINPVKYAG-VFA--VVGFALSIGVILILNLFDSTVKNDKDIE
A0A1Y0IQP5      -----------QPV---RPKPFLNMA-AAL--VLGAMAGAGLAFLLEFLNNTVKTEGEIE
A0A4R2R7B1      -----------EPV---RPKPYLNMA-VAL--VLGAMAGAGLALLLAFLNNTVQTEAEAE
A0A1M6E8I2      -----------HPV---NINLKFNGA-IGF--IVGIMTGLSIILMLEMLDGTIKTSDDIE
A0A1Y4N105      -----------SAS---NPLNYSRIQKLGT--LASGVVMIGIIALLSIFRQTVKRSKQAK
A0A1Y4QP75      -----------SAS---NPLNYSRIQKLGT--LASGVVMIGIIALLSIFRQTVKRSKQAK
A0A3D4QRB5      -----------IPI---RPTTVRNCI-IAA--FLGLMVGLGIIFLIEYLDNTIKTQEDAE
A0A349DEH5      -----------YPN---STKSAVSLAAIVG--FIGAVATCIIMFIIFLVKDTAKTADELS
A0A3D4T7B4      -----------YPN---STKSAVSLAAIVG--FIGAVAPCIIMFIIFLVKDTAKTADELS
A0A350XYC7      -----------APN---SNRSVFSLALMVG--FVAAVATCVVFFIMFLVKDTAKTADELS
R6DNR8          -----------APN---SNRSVVSLALMVG--FISAIACCVVFFIMFLVKDTAKTADELS
A0A355KUM5      -----------YPN---SNRSVVSLALMVG--FIAAVASCVVFFIMFLVKDTAKTADELS
R5YGY6          -----------YPN---SNRSVVSLALMIG--FIAAVASCVVFFIMFLVKDTAKTADELS
A0A0K8J554      -----------GPS---GPNILLNTM-IGA--LAGFFLAFTFAFLWELIDVKVKSKDDLM
A0A3N1XSX6      -----------KPS---SPNILKNTL-IGG--MLGLVLSIIFSFLWEIFDVNIKEKEELI
A0A1C6G0U3      -----------KPI---KPRKLINIA-IAS--IIGILISIAFAFILDYLDSKIKNKGDVE
A0A3D4LLB3      -----------APV---KPDIIMNTA-IAG--ILGAMVILLILFLKEYFDSTAKTEKDIE
A0A0A5GPA9      -----------TPI---KPNLLMNTI-LSL--LLGLFLALLLVFLKEVIFTRADSEEKVE
A0A271M6M4      -----------RPV---KPDPVIYMV-IFL--CIGVFLSFIIIFLKETIFTKFDSQEKIE
A0A2V3W8U6      -----------TPI---SPKLFFNTV-ISF--IIGFLFACTYAFLSAYFNTKISSKEDIE
W1UFG0          -----------KHI---RPRKTVNTI-IAT--LIGIILAITVILLREILDKTIKTTKDIE
A0A351SRI8      -----------EPY---NVHVLKQIV-LGT--GLGFVLSSIIIAICFYFDDTVKNESDAE
A0A1V5LU59      -----------TPI---SPNKKKNVA-LAG--IIGLALGAGLIYLLEMIDYTFKKPEQVE
A0A1E3BVC3      -----------NPI---KPNKKMNVG-AAG--LFGLVLGVGLIFLLELIDHTFKKPEEVE
A0A4Q0I6S0      -----------NPI---KPNKKMNVG-AAG--LFGLVLGVGLIFLLELIDHTFKKPEEVE
A3DF66          -----------NPI---KPNKKMNIC-VAG--LFGLVLGIGLIFLLELIDHTFKKPEEVE
W4V1T8          -----------NPI---KPNKKMNVG-AAG--LLGLVLGVGLIFLLELIDHTFKKPEEVE
A0A1I0RG99      -----------SPS---SPNILKNTL-VGG--MFGFVLSIAVSLLLVLFDLNVKNQDELL
A0A1I5G322      -----------SPS---SPNIFKNTL-IGG--MITFIITILISLLGEVMDVNVKNQDDLL
A0A1C6ITD7      -----------KPS---KPNIILNIG-LSF--LLGLMLSICLVILIDYLDQRIKDKSELK
A0A381IX63      -----------QPI---SPNKFRNLA-LGG--IIGVVIAIFVVLLLDYFDNKVKTPEELE
A0A1G9IUT4      -----------KPV---KPNKIMNTM-IGA--IIGLILGLIVTFVREYIDTKVKSSKDVE
A0A1M6RWV2      -----------NPI---KPRPMLNIA-IAL--VLGLMIGIGLVFLLEYLDNSFKGPDDVE
A0A143XPI5      -----------EPS---NQPNLKRMALNGC--LAGIVLSGILLAVYALTRNTICGDEDVK
A0A355G1X5      -----------AHD---PQLSLMRFAAIGG--AIGFALAFIVILIVNAARDTLMSSDDVQ
A0A0M6WXE3      -----------APV---NPPQNGEMAKKGF--FLGMAVCILLFAIWSYMHNTVKQEREVE
A0A348SAK2      -----------APV---NPPQNGEMAKKGF--FLGMAVCILLFAIWSYMHNTVKQEREVE
A0A1G9H5B9      -----------LPN---EKKAVFSSLKYGA--AAGAAFAVVLLALLYILNQKITDLRELK
R5EFZ0          -----------SPT---NQNFAFHQMKKAA--VIAALAATALLAILSYLRDAVRSGTEAR
A0A1Y4H8L0      -----------YPS---NPLNTSRAMKLAF--LAAAAALAALFGLLSFFRDTVKQEDDVE
A0A4B9BMD9      IGNVRIIDPAVTQP---QPVKPKKALNVVLGFILGLFISVGAVLARAMLRRGVEAPEQLE
A0A0M6WYQ8      -----------DTT---NQGVISSSWKRGA--LKGAIIGLVILSLYVLTRRTVKTGKEIK
A0A348SAK1      -----------DTT---KQGVISSSWKRGA--LKGAIIGLVILSLYVLTRRTVKTGKEIK
A0A252F281      -----------APS---NAMSLRSRLILAG--ALGALAMLAVVILMSCLRDTVKREEEVK
A0A1Y4QKE6      -----------SPY---NKLTFTNTVIVGG--IIGLVFGTVILGCMALFRKTVKNPEDMK
B1C231          -----------DPY---NKLTFTNTVLVGG--IIGLVSGTIILGCMALFRKTVKNPEDMK
A0A1Y3TUL5      -----------RIG---GNVNASMWLYMS---LLGLAVGIGFSFLKFLLLPTVVNTKDIE
A0A1Y4JAX2      -----------RIG---GNVNASMWLYMS---LLGLAVGIGFSFLKFLLLPTVVNTKDIE
A0A1Y4T590      -----------RIG---GNVNASMWLYMS---LLGLAVGIGFSFLKFLLLPTVVNTKDIE
R5B467          -----------QPS---NPFSWRHSLVRGA--LIGAVLSLLVLYLSGRARATVMNRDDLQ
A0A1Y3T163      -----------EPF---NHIGLRRTLALGG--GAGALAGILILGLTALFRRTARNPEEMQ
A0A1Y3YCA2      -----------EPF---NHIGLRRTLALGG--GAGALAGILILGLTALFRRTARNPEEMQ
A0A1Y4L6N9      -----------EPF---NKPNYVRTTVKGA--FLGVLAGLLLVVLYAFLKRTVQKPEELK
A0A173T644      -----------EPY---NQPNFVKKAVKGA--LLGAAAGIFLIVLYAFFRKTVQTPDELK
A0A1C5TSB8      -----------EPY---NQPNFVKKAVKGA--LLGAAAGIFLIVLYAFFRKTVQTPDELK
C0CIK6          -----------EPY---NQPNFVKKAVKGA--LLGAAAGIFLIVLYAFFRKTVQTPDELK
A0A1Y3WEF6      -----------EPY---NRPSYLDQILKGA--LFGAGSGFLLICLCALFKKTVQKPEELN
A0A417T0L2      -----------EPY---NRPSYRGQIKKGA--VYGAGAGFLLICLYAFFKKTVQKPEELK
A0A1H9EPU3      -----------TPT---SPSSPNVSRNTLLGMLIGIFIACAIVVLRFMLDDSIKTQEDVE
A0A354IGV3      -----------QPS---NQIDSRDLIRKTA--GICALIMIVLIALLTLVRDTIQTPTCIE
A0A417JMV2      -----------GPV---NKFQPTALMKKTF--LMTIVALCGLIAILSFLKDTVRKPKEVS
B0P408          -----------GPV---NKFQPTALMKKTF--FTTIVALCGLIAILSFLKDTVRKPKEVS
D4MV82          -----------GPV---NKFQPTALMKKTF--FTTIVALCGLIAILSFLKDTVRKPKEVS
A0A415VWX5      -----------GPV---NKFQPTALMKKTF--LMTIVALCGLIAILSFLKDTVRKPKEVS
A0A173UY96      -----------GPV---NKFQPTALMKKTF--FTTIVALCGLIAILSFLKDTVRKPKEVS
A0A173QTL1      -----------GPV---NKFQPTALMKKTF--FTTIVALCGLIAILSFLKDTVRKPKEVS
A0A174A3T7      -----------GPV---NKFQPTALMKKTF--FTTIVALCGLIAILSFLKDTVRKPKEVS
A0A174J359      -----------GPV---NKFQPTALMKKTF--SMTIVALCGLIAILSFLKDTVRKPKEVS
A0A417UUA3      -----------GPV---NKFQPTALMKKTF--FTTIVALCGLIAILSFLKDTVRKPKEVS
A0A1C6EUV9      -----------GPV---NEFQPAALMKKTF--VMTIIALCGLIAIVSFLKDTVRKPKEVS
A0A173Y645      -----------GPV---NEFQPAALMKKTF--VMTIVALCGLIAIISFLKDTVRKPKEVS
A0A374AVY6      -----------GPV---NEFQPAALMKKTF--VMTIVALCGLIAIISFLKDTVRKPKEVS
R7BXS4          -----------GPV---NEFQPAALMKKTF--VMTIVALCGLIAIISFLKDTVRKPKEVS
A0A143ZUX1      -----------MPQGPNTDYKKILYPAAGA--LLGLAVGLFLVWVLTRVSHTIQSEDDVY
S3FFL2          -----------KPS----RPRLLLNLAIAL--FVGLGLGVLVAFALEQMDEAIADPSEVE
A0A6A8IF17      -----------LPT----SPVHKNIFMVAF--ALGLLIPIVIIFMRENMNTRVRGRKDLE
A0A6C0V5C7      -----------GVL----KPKKALIVLGSI--ILGLMLSIVGVLLRSLFNRGIESPQALE
A0A6C0V5F7      -----------IPI----KPRKALIIVLGM--LMGLMLSTGTVFVRSAFKRGITSSEQLE
A0A328M4V1      -----------KPV----WPRKLLLVFGAT--VFGGLLAVGFVFLRQLLNRGVEDPAAIE
A0A5C8HCX2      -----------QPV----KPKKALNVVLGF--ILGLFISVGAVLARAMLRRGVEAPEQLE
A0A1W1Z4C3      -----------FAN----GRNDMKKGIIGA--LIGAVIACALLTLLFLMNHRVEKPAELT
A0A239QN83      -----------LAN----GRADMKKGFIGG--LAGAILACAFLTLLFMMNHQVEKPGEIT
A0A3R9WAA7      -----------FPS---NPVDYRRLIGSGA--AIGAAIALFFIVVYAFARKTIHKPDDLI
A0A1G6BLF1      -----------APS---NEDWSHGAAKTGI--LIGFVIDILVLFVYSMTKRTIRKEKDFA
R6HZX3          -----------VPV---NTFRGSRSAAKGV--AAGLLLGLALTLLMAIGRKTVRTADDLK
A0A1W2CEA6      -----------KPI----YPNVNATIAKGA--VLGGLGIMLIFLFIILLDDRIRSGEDIT
R7FFK6          -----------TPV----SPNVTKNTAIGF--AAGAMLAILVILVIDFFDNTIKDSSELG
A0A373MPB9      -----------TPV----SPNTTKNVALGF--VGGLMVAVLVILVIDFFDNTVKNSDELG
A0A373L519      -----------TPV----SPNTTKNVALGF--VGGLMVAVLVILVIDFFDNTVKNSDELG
A0A373W906      -----------TPV----SPNTTKNVALGF--VGGLMVAVLVILVIDFFDNTVKNSDELG
A0A373VCW2      -----------TPV----SPNTTKNVALGF--VGGLMVAVLVILVIDFFDNTVKNSDELG
W0U604          -----------TPV----SPNTTKNVALGF--VGGLMVAVLVILVIDFFDNTVKNSDELG
A0A374B6G0      -----------SPV----SPNTTKNVALGF--VGGLMVAVLVILVIDFFDNTVKNSDELG
A0A373VM36      -----------TPV----SPNTTKNVALGF--VGGLMVAVLVILVIDFFDNTVKNSDELG
A0A1C5P379      -----------TPV----SPNTTKNVALGF--VGGLMVAVLVILVIDFFDNTVKNSDELG
A0A373XXX0      -----------TPV----SPNTTKNVALGF--VGGLMVAVLVILVIDFFDNTVKNSDELG
A0A5R9MJM9      -----------TPV----SPNTTKNVALGF--VGGLMVAVLVILVIDFFDNTVKNSDELG
A0A356CW82      -----------TPV----SPNTTKNVALGF--VGGLMVAVLVILVIDFFDNTVKNSDELG
R6T4X7          -----------TPV----SPNTTKNVALGF--VGGLMVAVLVILVIDFFDNTVKNSDELG
A0A374HTV1      -----------TPV----SPNTTKNVALGF--VGGLMVAVLVILVIDFFDNTVKNSDELG
A0A374GB66      -----------TPV----SPNTTKNVALGF--VGGLMVAVLVILVIDFFDNTVKNSDELG
A0A374ECC6      -----------TPV----SPNTTKNVALGF--VGGLMVAVLVILVIDFFDNTVKNSDELG
A0A374BM61      -----------TPV----SPNTTKNVALGF--VGGLMVAVLVILVIDFFDNTVKNSDELG
A0A373UGZ4      -----------TPV----SPNTTKNVALGF--VGGLMVAVLVILVIDFFDNTVKNSDELG
A0A373SA66      -----------TPV----SPNTTKNVALGF--VGGLMVAVLVILVIDFFDNTVKNSDELG
A0A1C5X6X7      -----------TPV----SPNTTKNVALGF--VGGLMVAVLVILVIDFFDNTVKNSDELG
A0A1C6JIH3      -----------TPV----SPNTTKNVALGF--VGGLMVAVLVILVIDFFDNTVKNSDELG
A0A373PSC3      -----------TPV----SPNTTKNVALGF--VGGLMVAVLVILVIDFFDNTVKNSDELG
A0A1K1WYK8      -----------KPV----APNNTKNGILGM--AAAFLIVVMVILIIDYFDNTIKESEKIA
A0A1H6IUB1      -----------SPV----APNMKKNAVLGA--MAALMLTCMIIFLIDFFDNTVKDTDSVA
A0A1M7L1F9      -----------NPV----APNMKKNAVLGA--MAALMLTCMIIFLVDFFDNTVRDTDAVG
A0A1C6B4L6      -----------TPV----APNVIKNTLLGM--AAALLIVVTIILITDYFDNTVKDVALLE
A0A1Q6T9P4      -----------TPV----APNVIKNTLLGM--AAALLIVVTIILITDYFDNTVKDVALLE
A0A315Y4F9      -----------TPV----APNIMKNTMIGA--VAGFMLIVLIIFLIDFFDNTIKDTDALG
A0A354K620      -----------HPV----APNTMKNTALGA--AAGFMLIVLIIFLIDFFDTTIKDTDDLG
A0A355G3J9      -----------EDE---SEWPIVGNIAIGF--ALGLVLSVAYVLLSNALDTTIYGRKEIE
A0A3D2AD87      -----------VVY-----PRTVMSTAIAF--LVGAVLAFAISFIIDISDQSIRGEDEFV
A0A2T5IYJ6      -----------APT----KPRKTLIIGISL--VLSLLFGAALAFLLDYLDSTFKNAEDVE
A0A3C0QME1      -----------KPV----SPNKPKMALIGA--MAGLILAAFIVLMIDFFDNSVRSSEMLT
A0A355FYK5      -----------ISN----SDNSVKIAFLAF--MAGALLIALIVVLVEIFSDTIKDIDDIR
A0A357AQU0      -----------VKS----GPSVSRYTIMGF--LIGFILVAAAIVIRTITDNTFRDAEDIN
A0A3C1YJQ7      -----------VKS----GPSVSRYTIMGF--LIGFILVAAAIVIRTITDNTFRDAEDIN
A0A3D0JG38      -----------VKS----GPSVSRYTIMGF--LIGFILVAAAIVIRTITDNTFRDAEDIN
A0A3C0IHX1      -----------SPS----APDVKKITMMAA--AAGFVLSAGVAVLIYLLDRTIKGEDDI-
R5V506          -----------SPS----APDVKKITMMAA--AAGFVLSAGVAVLIYLLDRTIKGEDDI-
A0A352TIU5      -----------SPS----APDVKKITMMAA--AAGFVLSAGVAVLIYMLDRTIKGEDDI-
A0A3E5FSY5      -----------DPY---NKLTFTNTVLVGG--IIGLVSGTIILGCMALFRKTVKNPEDMK
A0A1V5S3C0      -----------SPD---ADYSGFLYTFIGA--VSGAIVAFAIILISNRIKNLVQTSDDIR
A0A1Y3TC98      -----------APF---NQMSVRRCLLLGG--AGGAAVSLLIFLLMSLFWKAVCSPEDMK
A0A1Q6REE0      -----------APV---AEFNYRYYITCGA--VVGAAVWCVILAFLVLMKNTVHNEDELR
R5ETF9          -----------APV---AEFNYRYYITCGA--VVGAAVWCVILAFLVLMKNTVHNEDELR
R6VAT5          -----------TPI---NPISYREKALIGT--AVGALLGLLIVFFLENLNHTVRHPDEIR
A0A1Q6S448      -----------SAA---RSYNVPRTCLIAA--AAGAALTAAAVVWAAVFSGTVQTLEGAR
A0A351MYR0      -----------APS---RSYNVPRICLIAA--IAGAALTALGVAWASVSSGTVQTQEGAR
R6HPC1          -----------APS---RSYNVPKICLLAG--VIGAGLTAAAVAWASVTSGTVQTQEGAR
A0A3D4G5Z5      -----------APS---RSYNVPKICLLAG--VIGAGLTAAAVAWASVTSGTVQTQEGAR
A0A3D5ES03      -----------APS---RSYNVPKICLLAG--VIGAGLTAAAVAWASVTSGTVQTQEGAR
A0A0F2P7X6      -----------FPN----APATFRNVGVGA--VLGLMLGLGIVFMLMFFDRTIKSGDDVK
A0A359B487      -----------FPN----APATFRNVGVGA--VLGLMLGLGIVFMLMFFDRTIKSGDDVK
A0A348P5V4      -----------APN---GDNTKLLYPMLGF--VLGFFAACLCIIVAVVFKDTIKNSDEVT
A0A356PT74      -----------APN---RDASARNYTIVGF--AAGLVISIFAIVLAVIAKDTVKTADDVK
A0A3D5LL19      -----------APN---RDASARNYTIVGF--AAGLVISIFAIVLAVIAKDTVKTADDVK
R5MNF0          -----------APN---RDASARNYTIVGF--AAGLVISIFAIVLAVIAKDTVKTADDVK
A0A1Q9JSI0      -----------GPVNKFQPTALMKKTFVYT--L--IFLCGLIGII-SFLKDTVRKPKEVS
A0A3D5TNI1      -----------EPD---KSVGITRNAIIGA--LAGAVICALIIIIRDSARNTVRSQEDIQ
A0A358LJD0      -----------KPD---KSVGTVRNTIIGA--LAGAVICALIIIIRDSARNTVRSQEDIQ
R6I3L7          -----------KPD---KSVGTVRNAIIGA--LAGAVICALIIIIRDSARNTVRSQEDIQ
A0A3D1HXX0      -----------KPD---KSVGTVRNAIIGA--LAGAVICALIIIIRDSARNTVRSQEDIQ
A0A3D2QJB8      -----------KPD---KSVGTVRNAIIGA--LAGAVICALIIIIRDSARNTVRSQEDIQ
D4LC36          -----------AAV----SPSVTKNTAIGF--AGGALLAILVILLIDFFDNTVRGTEELR
R7MQJ4          -----------NPV----SPNFLKMAVIGA--FAGMLLAALIILVIDFFDNTVKDKEEIA
A0A1V5GLC0      -----------NPV----GPNIKKNTALGA--IAGAMLMALIILVIDFFDNTFKDPEALR
W7V182          -----------SPV----APNVKKNTMLGL--MAAAMLAACIIVVIDFFDNTVKDAGRLG
                                                                            

A0A0H5SF45      KRYQIPIL----------GVIPDFG-----------VKMPKR---YLLMQKLPFKNRLNE
A0A1M6JRJ5      KHYNIPLL----------GAIPDFA-----------AEDNSR--------DKSIPARLKK
A0A1M7Y1S2      KHYDTPLL----------GCIPDFS-----------PVNSSR--------KNKILLELKG
A0A3D5R4X5      RYLNLSII----------GAIPHNE-----------KAEKR-------------------
A0A1I4C3N6      DMFNIPII----------GTVPLVE-----------STDK--------------------
A0A3B9CIM7      DLFTIPIL----------GDVPQME-----------PAAKG-------------------
A0A1G9WHW8      DMFTIPIL----------GDVPEIE-----------TEEAKG------------------
A0A1H5VAA0      DMFTIPIL----------GDVPEIE-----------TEETKG------------------
A0A3R6VK11      LAFRIPVL----------GDIPQIQ-----------ASDRK-------------------
A0A3R6QUY7      LAFRIPVL----------GDIPQIQ-----------APDRK-------------------
A0A373K3P9      LAFRIPVL----------GDIPQIQ-----------APDRK-------------------
A0A3R6JRU5      LAFRIPVL----------GDIPQIQ-----------APDRK-------------------
A0A1C5MS04      LAFRIPVL----------GDIPQIQ-----------APDRK-------------------
A0A3C1J150      LAFRIPVL----------GDIPQIQ-----------APDRK-------------------
A0A416CXD7      LAFRIPVL----------GDIPQIQ-----------APDRK-------------------
R6XBL9          LAFRIPVL----------GDIPQIQ-----------APDRK-------------------
A0A355W5Z7      LAFRIPVL----------GDIPQIQ-----------APDRK-------------------
A0A143WVN6      RQLDGRIL----------ATIPYER-----------KYKSIH------------------
W6RXP9          GALNIPVM----------GVIPQMS-----------NSSKPG------------------
W6S4G8          RNLKLPVL----------GVIPKFG-----------RK----------------------
A0A1G6BLB6      KKIDTKRL----------GTLYHEK-----------KYKTFT------------------
A0A1C6G8M0      KCSGLSVL----------GTIPDYK-----------GGKKRK------------------
A0A416MP73      KCTGLSVL----------GAIPDYK-----------G--KKQ------------------
A0A3E4LL92      RLLDIPMI----------GSLDYVK-----------KKSGQK------------------
A0A415D1L1      RLLDIPMI----------GSLDHVK-----------KKSGQK------------------
A0A414P2K5      RLLDIPMI----------GSLDYVK-----------KKSGQK------------------
V8C417          RLLDIPMI----------GSLDYVK-----------KKSGQK------------------
A0A143XN92      KKLDIRYL----------GTIYHER-----------KHKTIR------------------
A0A173ZYY6      KKLDARSL----------GAISYEW-----------KYKTIR------------------
A0A4Q5EHM9      KKLDARSL----------GAISYEW-----------KYKTIR------------------
A0A173SMI2      KKLDARSL----------GAISYEW-----------KYKTIR------------------
A0A174ASH7      KKLDARSL----------GAISYEW-----------KYKTIR------------------
A6BH65          KKLDARSL----------GAISYEW-----------KYKTIR------------------
R7G0D7          KKLDARSL----------GAISYEW-----------KYKTIR------------------
A0A396G6S7      TKLDTRLL----------GTIAYEK-----------KSKALS------------------
A0A3E5A223      TKLDTRLL----------GTIAYEK-----------KSKALS------------------
R7D5E6          TKLDTRLL----------GTIAYEK-----------KSKALS------------------
A0A415HQH5      TKLDTRLL----------GTIAYEK-----------KSKALS------------------
A0A414W2C6      TKLDTRLL----------GTIAYEK-----------KSKALS------------------
A5ZNE7          TKLDTRLL----------GTIAYEK-----------KSKALS------------------
A0A395X821      TKLDTRLL----------GTIAYEK-----------KSKALS------------------
A0A1C5PY68      TKLDTRLL----------GTIAYEK-----------KSKALS------------------
A0A174CJF8      TKLDTRLL----------GTIAYEK-----------KSKALS------------------
A0A564SRR2      TKLDTRLL----------GTIAYEK-----------KSKALS------------------
A0A174R7V0      TKLDTRLL----------GTIAYEK-----------KSKALS------------------
A0A373MWV2      RKIDADLL----------GTVYHEK-----------KRKNSS------------------
A0A417CE88      RKIDADLL----------GTVYHEK-----------KRKNSS------------------
A0A416Y441      RKIDADLL----------GTVYHEK-----------KRKNSS------------------
A0A357GPJ7      RKIDADLL----------GTVYHEK-----------KRKNSS------------------
A0A396PAC1      RKIDADLL----------GTVYHEK-----------KRKNSS------------------
A0A416EYU4      RKIDADLL----------GTVYHEK-----------KRKNSS------------------
A0A416SCQ2      RKIDADLL----------GTVYHEK-----------KRKNSS------------------
A0A416TGN7      RKIDADLL----------GTVYHEK-----------KRKNSS------------------
A0A417SMF6      RKIDADLL----------GTVYHEK-----------KRKNSS------------------
A0A1Y4MW77      EVTNIKCL----------ATVPYLK-----------QKKRSR------------------
R6UHV6          KKLITQRL----------VSIPTQK-----------KRLSVR------------------
A0A3R9Q621      QRYNKPVI----------GNIPSYQ-----------GNDAVR-----EKLRRILPGRNKN
A0A069RC75      NGIGISVI----------GSVPKLK-----------MSGEKG------------------
A0A174F2W5      RKIDADLL----------GTVYHEK-----------KRKNSS------------------
A0A174S8E9      RKIDADLL----------GTVYHEK-----------KRKNSS------------------
A0A416ZL97      RKIDADLL----------GVVYHEK-----------KKKNSS------------------
A0A174LSK1      RKIDADLL----------GVVYHEK-----------KKKNSS------------------
A0A373GY92      RKIDADLL----------GVVYHEK-----------KKKNSS------------------
A0A373NZQ6      RKIDADLL----------GVVYHEK-----------KKKNSS------------------
A0A417I9B9      RKIDADLL----------GVVYHEK-----------KKKNSS------------------
A0A417MP97      RKIDADLL----------GVVYHEK-----------KKKNSS------------------
A0A417WQF8      RKIDADLL----------GVVYHEK-----------KKKNSS------------------
A0A373RZ83      RKIDADLL----------GVVYHEK-----------KKKNSS------------------
A0A416U6I1      RKIDADLL----------GVVYHEK-----------KKKNSS------------------
R7JQZ9          RKIDADLL----------GVVYHEK-----------KKKNSS------------------
A0A3B8KKL6      RYLSLNVV----------GTIPKFK-----------GGKRGK--------------SKAK
A0A2K9E6R0      RYLSLNVV----------GTIPKFK-----------GGKRGK--------------SKAK
A0A2S8RBI0      RYLSLNVV----------GTIPKFK-----------GGKRGK--------------SKAK
A0A0L6JLG6      HHLGLNVI----------GTVPAFE-----------GGKRGN--------------KKAK
G8LSN0          RQMELTVI----------GAVPKFE-----------GGKRGK--------------NEKK
A0A1M5UYN6      KFIGLPVI----------GLIPKIT-----------EKVYLI------------------
A0A176JBT8      DLLGIPYL----------GEIPAII-----------PQGPTN------------------
A0A1I5HIC6      KYLGLTVL----------GTIPLET-----------KYAGKI-----------KNKKKAI
A0A1Y3TC51      RQLDGKVR----------GVIPFEQ-----------KGTALR------------------
A0A1Y3T1N0      RLLDGTVR----------GIIPFES-----------KG--IL------------------
A0A1Y3Y8U8      RLLDGTVR----------GIIPFES-----------KG--IL------------------
A0A5B0BQY5      RSLGIPFL----------GSILMKK-----------EKKGKS------------------
A6CLL4          RMLNAPYL----------GSVPKLP-----------PQSNLN------------------
A0A174DL89      ELITFPIL----------GEIPDFS-----------SVNINN------------------
A0A176U8D6      KCTGLSVL----------GAIPDYK-----------G--KKQ------------------
A0A1Q6KSQ5      KCSGLSVL----------GTIPDYK-----------GGKKRK------------------
A0A3D3U8B3      KCSGLSVL----------GTIPDYK-----------GGKKRK------------------
A0A3E5FRL7      KLLDGRVV----------GVIPYEK-----------KKRDKH------------------
A0A1Y4QK93      KLLDGRVV----------GIIPYEK-----------KKRNKH------------------
B1C232          KLLDGRVV----------GVIPYEK-----------KKRNKH------------------
A0A401USI6      RYLNLPMV----------GIIPKQN-----------KMVNLI------------------
A0A1V4IQ10      RIVQLPTF----------GLIPDDT-----------KIRKTK------------------
A0A1S8TRD2      RIVQLPTF----------GIIPDDT-----------KVRKIK------------------
G7M1U2          RIVQLPTF----------GIIPDDT-----------KVRKIK------------------
A0A2T6KJ75      KALALPVI----------GLVPPGE-----------GKLIHD------------------
A9KN92          KYLGLTVL----------GTIPLEL-----------KNSNKR-------------GKNKK
A0A352MUJ1      KTLNIKTL----------ASFAKNQ-----------NARPGV------------------
R5YI67          KALNIKTL----------ATFARNP-----------NIKQGL------------------
A0A1Y0IQP5      QLLQLPAL----------GAITAYD-----------NKGRAG------------------
A0A4R2R7B1      QLLQLPAL----------GAIPFFE-----------QKGSSG------------------
A0A1M6E8I2      KHIGLPVI----------GSIFEFN-----------SESEGI------------------
A0A1Y4N105      YQLDGRII----------TTIPYER-----------KYHSLQ------------------
A0A1Y4QP75      YQLDGRII----------TTIPYER-----------KYHSLQ------------------
A0A3D4QRB5      EFLKLPVI----------GRIPNFD-----------TKKSKK------------------
A0A349DEH5      DKLDVHIL----------GSVQQIT-----------NKNKAA------------------
A0A3D4T7B4      DKLDVHIL----------GSVQQIT-----------NKNKAA------------------
A0A350XYC7      EKLDVHIL----------GSVQQIT-----------NKNKTA------------------
R6DNR8          EKLDVHIL----------GSVQQIT-----------NKNKTA------------------
A0A355KUM5      EKLDVHIL----------GSVQQIT-----------NKNKTA------------------
R5YGY6          EKLDVHIL----------GSVQQIT-----------NKNKTA------------------
A0A0K8J554      EKYQIPIL----------GAIPSFN-----------DMIPRK------------NVLLQK
A0A3N1XSX6      TNYQLPVL----------GEIPNFN-----------GYKEKQ-------------LYKRY
A0A1C6G0U3      KYLDLPII----------GGIPM-------------------------------------
A0A3D4LLB3      NLLGLSII----------GAVPNFN-----------HGSKTA------------------
A0A0A5GPA9      KVFRLSSL----------GVVPIIS-----------DEWNQK------------------
A0A271M6M4      QAFKLPSL----------GVIPVIS-----------DKPKRS------------------
A0A2V3W8U6      KYLGLSFL----------GEVGIIS-----------KNRKNR------------------
W1UFG0          KYFDFNIL----------GVVSK-------------------------------------
A0A351SRI8      RELGVPIL----------GAVPKYK-----------EKVSSG------------------
A0A1V5LU59      KQLGLNLI----------GVVPKFE-----------GGKRGK--------------SKNK
A0A1E3BVC3      RTLGINVI----------GTIPEFE-----------GGKRGK--------------KKAK
A0A4Q0I6S0      RTLGINVI----------GTIPEFE-----------GGKRGK--------------KKAK
A3DF66          KMLGINVI----------GTIPAFD-----------GGKRGK--------------KKAK
W4V1T8          RILGINVI----------GTIPAFE-----------GGKRGK--------------KKAK
A0A1I0RG99      KRYQLPIL----------GTIPNFN-----------VNIKRK-FVLKKTILTDLLHKKV-
A0A1I5G322      RKYQVPIL----------GVIPNYK-----------NNKKKKVLLIKLTSIAKRLNKKID
A0A1C6ITD7      ELIHLPIL----------GEIPNFS-----------SININN------------------
A0A381IX63      DILDTSLL----------GVIPFEN-----------EEERKK------------------
A0A1G9IUT4      EKLNLQII----------GNIPNEN-----------NLDS--------------------
A0A1M6RWV2      KRLNLPVL----------GAVPAVE-----------NENSLR------------------
A0A143XPI5      KIMQIKSL----------GTLPTVK-------------------------------M---
A0A355G1X5      IKLDAKLL----------GTVYTVR-------------------------------N---
A0A0M6WXE3      KKLDARSL----------GAISYEW-------------------------------KYKT
A0A348SAK2      KKLDARSL----------GAISYEW-------------------------------KYKT
A0A1G9H5B9      ENYKLPIL----------AEIK--------------------------------------
R5EFZ0          EKLDCSYL----------GEISHER-------------------------------KYKT
A0A1Y4H8L0      AKLDTRSL----------GALVYEP-------------------------------KAKN
A0A4B9BMD9      EH-GISVYATIPMSEWLDKRTRLRK-------------------------------KNLF
A0A0M6WYQ8      THLNLVDL----------GTLPEVH-------------------------------VK--
A0A348SAK1      THLNLVDL----------GTLPEVH-------------------------------VK--
A0A252F281      EKLDTHLI----------ASVPHEK-------------------------------RP--
A0A1Y4QKE6      RITNLNCM----------ATIPRVK-------------------------------I---
B1C231          RITNLNCM----------ATIPQVK-------------------------------F---
A0A1Y3TUL5      NTLGLEVL----------GEIPENV-------------------------------EY--
A0A1Y4JAX2      NTLGLEVL----------GEIPENV-------------------------------EY--
A0A1Y4T590      NTLGLEVL----------GEIPENV-------------------------------EY--
R5B467          QATSARYL----------GALPAVR-------------------------------V---
A0A1Y3T163      KITSLRCL----------AMIPQVR-------------------------------F---
A0A1Y3YCA2      KITSLRCL----------AMIPQVR-------------------------------F---
A0A1Y4L6N9      KVSNLKCL----------AKIPNVR-------------------------------Q---
A0A173T644      NVMSLPCL----------GNLPEMK-------------------------------Q---
A0A1C5TSB8      NVMSLPCL----------GNLPEMK-------------------------------Q---
C0CIK6          NVMSLPCL----------GNLPEMK-------------------------------Q---
A0A1Y3WEF6      SVMSLSCI----------ANIPEVS-------------------------------K---
A0A417T0L2      SVMSLSCI----------ANIPEVS-------------------------------R---
A0A1H9EPU3      NKIGLSVLANMPYKENIEEGLYEND-------------------------------PEKK
A0A354IGV3      RKLDIKRF----------GVIYHER-------------------------------KNRT
A0A417JMV2      RKLDAKLL----------QTLYHEK-------------------------------IYKT
B0P408          RKLDAKLL----------QTLYHEK-------------------------------IYKT
D4MV82          RKLDAKLL----------QTLYHEK-------------------------------IYKT
A0A415VWX5      RKLDAKLL----------QTLYHEK-------------------------------IYKT
A0A173UY96      RKLDAKLL----------QTLYHEK-------------------------------IYKT
A0A173QTL1      RKLDAKLL----------QTLYHEK-------------------------------IYKT
A0A174A3T7      RKLDAKLL----------QTLYHEK-------------------------------IYKT
A0A174J359      RKLDAKLL----------QTLYHEK-------------------------------IYKT
A0A417UUA3      RKLDAKLL----------QTLYHEK-------------------------------IYKT
A0A1C6EUV9      KKLDGTLL----------QTLYHER-------------------------------IYKS
A0A173Y645      KKLDGTLL----------QTLYHER-------------------------------LYKS
A0A374AVY6      KKLDGTLL----------QTLYHER-------------------------------SYKS
R7BXS4          KKLDGTLL----------QTLYHER-------------------------------SYKS
A0A143ZUX1      DFLPVKLF----------ASIPTIG-----------------------------------
S3FFL2          RQFGLPLL----------GSVP--------------------------------------
A0A6A8IF17      NL-TIPFI----------GEIPLFT---------------------RKKKGIL-------
A0A6C0V5C7      ES-GINVY----------ASIPLSE---------------------WQKSRDSVKTI---
A0A6C0V5F7      MQ-GIPLL----------ATLPRSV---------------------WLWKKTHLRRRNLF
A0A328M4V1      RL-GLPVY----------VSIPRSE---------------------LQRERTLLRVR---
A0A5C8HCX2      EH-GISVY----------ATIPMSE---------------------WLDKRTRLRKKNLF
A0A1W1Z4C3      DNYTPPIL----------SYIRRAK-----------------------------------
A0A239QN83      DHYTPPIL----------SYIRRAK-----------------------------------
A0A3R9WAA7      QITNVKLL----------GLLPHLR---------------------------------ER
A0A1G6BLF1      KILNVKCI----------AAIPHVR--------------------------------FKK
R6HZX3          RSTSVPCM----------GTIPAIQ-----------------------------VKRRRK
A0A1W2CEA6      KAVDLPVF----------GAVTRQN---------------------MERNAAELGADMPR
R7FFK6          EHFQKPMI----------GEIQSIG-----------------------------GKVKKK
A0A373MPB9      DIYQKPIV----------GEIMNIG-----------------------------GKTSKK
A0A373L519      DIYQKPIV----------GEIMNIG-----------------------------GKTSKK
A0A373W906      DIYQKPIV----------GEIMNIG-----------------------------GKTSKK
A0A373VCW2      DIYQKPIV----------GEIMNIG-----------------------------GKTSKK
W0U604          DIYQKPIV----------GEIMNIG-----------------------------GKTSKK
A0A374B6G0      DIYQKPIV----------GEIMNIG-----------------------------GKTSKK
A0A373VM36      DIYQKPIV----------GEIMNIG-----------------------------GKTSKK
A0A1C5P379      DIYQKPIV----------GEIMNIG-----------------------------GKTSKK
A0A373XXX0      DIYQKPIV----------GEIMNIG-----------------------------GKTSKK
A0A5R9MJM9      DIYQKPIV----------GEIMNIG-----------------------------GKTSKK
A0A356CW82      DIYQKPIV----------GEIMNIG-----------------------------GKTSKK
R6T4X7          DIYQKPIV----------GEIMNIG-----------------------------GKTSKK
A0A374HTV1      DIYQKPIV----------GEIMNIG-----------------------------GKTSKK
A0A374GB66      DIYQKPIV----------GEIMNIG-----------------------------GKTSKK
A0A374ECC6      DIYQKPIV----------GEIMNIG-----------------------------GKTSKK
A0A374BM61      DIYQKPIV----------GEIMNIG-----------------------------GKTSKK
A0A373UGZ4      DIYQKPIV----------GEIMNIG-----------------------------GKTSKK
A0A373SA66      DIYQKPIV----------GEIMNIG-----------------------------GKTSKK
A0A1C5X6X7      EIYQKPIV----------GEIMNIG-----------------------------GKTSKK
A0A1C6JIH3      EIYQKPIV----------GEIMNIG-----------------------------GKTSKK
A0A373PSC3      EIYQKPIV----------GEIMNIG-----------------------------GKTSKK
A0A1K1WYK8      KKYDKAII----------GEIQQFG-------------------------------EGKK
A0A1H6IUB1      DKFKKPII----------GEIAAFG-------------------------------VEKK
A0A1M7L1F9      KEFKKPII----------GEIASFG-------------------------------IEKK
A0A1C6B4L6      KKYKKAII----------GEIQEFA-------------------------------AERN
A0A1Q6T9P4      KKYKKAII----------GEIQEFA-------------------------------AERN
A0A315Y4F9      KKYNKAII----------GDIQAFG-------------------------------DSKK
A0A354K620      KKYNKAII----------GEIQAFG-------------------------------DSKK
A0A355G3J9      NAFTLPII----------ATIPIQG-----------------EGK------------PNG
A0A3D2AD87      NQYEIPLL----------GSIPDFDNIVSSPNYKGYYGKASYRSR----------LKKHL
A0A2T5IYJ6      DKLGISML----------GMVPLIK-----------------KRK---------------
A0A3C0QME1      TKYEKAVF----------GEIVNFS-----------------DGNSK--------KVQSE
A0A355FYK5      NKTNVPII----------GSIPYVG-----------------KSTGL--------INKKP
A0A357AQU0      KKFGLSVL----------GEVMDYG-----------------TKKDK--------KKRRN
A0A3C1YJQ7      KKFGLSVL----------GEVMDYG-----------------TKKDK--------KKRRN
A0A3D0JG38      KKFGLSVL----------GEVMDYG-----------------TKKDK--------KKRRN
A0A3C0IHX1      QSFSISYL----------GEVPEMV-----------------EARSG--------KRKRR
R5V506          QSFSISYL----------GEVPEMV-----------------EARSG--------KRKRR
A0A352TIU5      QSFSISYL----------GEVPEMV-----------------EARSG--------KRKRR
A0A3E5FSY5      RITNLNCM----------ATIPQVK-----------------FKA----------RKIHK
A0A1V5S3C0      KRYNLNII----------AVVSKLD-----------------LKR----------RK---
A0A1Y3TC98      KITSLRCL----------AFIPHVR-----------------FKA--------------R
A0A1Q6REE0      ETLNAPCL----------GQIPAVK-----------------ISR----------KR---
R5ETF9          ETLNAPCL----------GQIPAVK-----------------ISR----------KR---
R6VAT5          KLLNNQRL----------GSIVKVV-----------------KKK---------------
A0A1Q6S448      SGLDARII----------SSVPHEG-----------------RRTRKLLGWFDDRRRERR
A0A351MYR0      SDLDAKII----------STVPHEG-----------------RRTRKLLGWMDD-RRERQ
R6HPC1          SDLDAKLI----------STVPHEG-----------------RRTRKLLGWMDD-RWERR
A0A3D4G5Z5      SDLDAKLI----------STVPHEG-----------------RRTRKLLGWMDD-RRERR
A0A3D5ES03      SDLDAKLI----------STVPHEG-----------------RQTRKLLGWMDD-RRERR
A0A0F2P7X6      NKLGLTLL----------GSIPYLS-----------------PKA----------RKGQG
A0A359B487      NKLGLTLL----------GSIPYLS-----------------PKA----------RK---
A0A348P5V4      NKLGMKLL----------GVIGRVY-----------------R-K----------NK--K
A0A356PT74      DKLGVDVI----------GMVAHVN-----------------RKK----------KK--K
A0A3D5LL19      DKLGVDVI----------GMVAHVN-----------------RKK----------KK--K
R5MNF0          DKLGVDVI----------GMVAHVN-----------------RKK----------KK--K
A0A1Q9JSI0      RKLDGKLL----------ETLYHEK-----------------RYK----------TW--K
A0A3D5TNI1      NKLQLNVI----------GEVSQVP-----------------GGE----------RF--Y
A0A358LJD0      NKLQLNVI----------GEVSQVP-----------------GGE----------RF--Y
R6I3L7          NKLQLNVI----------GEVSQVP-----------------SGE----------RF--Y
A0A3D1HXX0      NKLQLNVI----------GEVSQVP-----------------SGE----------RF--Y
A0A3D2QJB8      NKLQLNVI----------GEVSQVP-----------------SGE----------RF--Y
D4LC36          EHFSKPII----------AEIQSIG-----------------GKA----------KK--K
R7MQJ4          QKYEKAII----------GEIPEFI-----------------DDK----------KK--K
A0A1V5GLC0      EKYKKAVV----------GEIQDFT-----------------IGR----------KK--K
W7V182          ESYKKAII----------GEIQQFD-----------------ESK----------KR--K
                                                                            

A0A0H5SF45      IIKDKVEF---NQVKN--QEANFLVNEAYKALRTNLLYTI-R--KN--G-CKKILVNSPN
A0A1M6JRJ5      LIRKGYGEDLNQGLIT---QDSFLVTESYKALRTNLRFSI-R--KE--E-CKKILITSPS
A0A1M7Y1S2      ILIKGENFMKPEKIQN--RQNSFLVAESYKTLRTNLRFSI-R--KE--G-CKKILITSPS
A0A3D5R4X5      -----------KVVTF--EDPKSPVAEAYRSLRTNLKFAS-L--DK--E-IKSIVVTSTI
A0A1I4C3N6      --------VKKSPILG--ENSSFEMREAYNEIRTFLTFSK-R--DE--K-CPVYGILSAD
A0A3B9CIM7      --------EKVNKILH--KESPFAVRESYNSIRAKLLFTG-K--GE--K-CPVYAITSAD
A0A1G9WHW8      ---VIKNSSYNPKVLN--EDSTFTITEAYNSIRTKLLYTA-K--DQ--K-CPIYGITSAD
A0A1H5VAA0      ---VIKNSSYNPKVLN--EDSTFTITEAYNSIRTKLLYTA-K--DQ--K-CPIYGITSAD
A0A3R6VK11      --------SKPVLVLG--ENSSFAVKESYNTIRANLLFTG-K--GE--R-CPVYAVTSAD
A0A3R6QUY7      --------SKPVLVLG--ENSSFAVKESYNTIRANLLFTG-K--GE--R-CPVYAVTSAD
A0A373K3P9      --------SKPVLVLG--ENSSFAVKESYNTIRANLLFTG-K--GE--R-CPVYAVTSAD
A0A3R6JRU5      --------SKPVLVLG--ENSSFAVKESYNTIRANLLFTG-K--GE--R-CPVYAVTSAD
A0A1C5MS04      --------SKPVLVLG--ENSSFAVKESYNTIRANLLFTG-K--GE--R-CPVYAVTSAD
A0A3C1J150      --------SKPVLVLG--ENSSFAVKESYNTIRANLLFTG-K--GE--H-CPVYAVTSAD
A0A416CXD7      --------SKPVLVLG--ENSSFAVKESYNTIRANLLFTG-K--GE--H-CPVYAVTSAD
R6XBL9          --------SKPVLVLG--ENSSFAVKESYNTIRANLLFTG-K--GE--R-CPVYAVTSAD
A0A355W5Z7      --------SKPVLVLG--ENSSFAVKESYNTIRANLLFTG-K--GE--R-CPVYAVTSAD
A0A143WVN6      --EYLHKPKKSVLISS--RLLSMSFTESNRKLATLIERHM-T--RH--Q-QKVLLVCSVA
W6RXP9          ---------KKYFVVE--DDPKAVASESYRTLKTNIQYSS-F--DE--K-HRVMVVTSST
W6S4G8          ---------REKLVME--EEPRSLEAECYRTMVTNIQYSS-I--DS--R-CKTIVVTSSQ
A0A1G6BLB6      --RRSKKKKRSILITD--PTVSFSYSEAVRRMVSRVRNKM-N--HR--N-SKVLMVTSVL
A0A1C6G8M0      ----------EKIIWP--DELPFSAAEAIYQLRTAILYSS-K--D-----VKMIAVTSAF
A0A416MP73      ----------KKIMWP--EDLPFNASEAIYQLRTGILYSS-K--D-----VKTIVVTSAF
A0A3E4LL92      ----------ALLISD--QDTDHVYEEAVDRIVTSIGSEM-S--AE--G-YKTLMVGSIK
A0A415D1L1      ----------ALLISD--QDTDHVYEEAVDRIVTSIRSEM-S--AE--G-YKTLMVGSVK
A0A414P2K5      ----------ALLISD--QDTDHVYEEAVDRIVTSIRSEM-S--AE--G-YKTLMVGSIK
V8C417          ----------ALLISD--QDTDHVYEEAVDRIVTSIRSEM-S--AE--G-YKTLMVGSIK
A0A143XN92      --SAIKRESVNMLITN--PILSRKYINSIEITAAKVRNRM-D--AK--R-IKTVMITSMM
A0A173ZYY6      --DIFRRKKKAILVDD--PVASFRFVESYKKLAAKVEYRM-A--KN--E-QKVLVVTSVS
A0A4Q5EHM9      --DIFRRKKKAILVDD--PVASFRFVESYKKLAAKVEYRM-A--KN--E-QKVLVVTSVS
A0A173SMI2      --DIFRRKKKAILVDD--PVASFRFVESYKKLAAKVEYRM-A--KN--E-QKVLVVTSVS
A0A174ASH7      --DIFRRKKKAILVDD--PVASFRFVESYKKLAAKVEYRM-A--KN--E-QKVLVVTSVS
A6BH65          --DIFRRKKKAILVDD--PVASFRFVESYKKLAAKVEYRM-A--KN--E-QKVLVVTSVS
R7G0D7          --DIFRRKKKAILVDD--PVASFRFVESYKKLAAKVEYRM-A--KN--E-QKVLVVTSVS
A0A396G6S7      --MKRKKDYLSMLIQN--PLRSFAYVESSKMAASRVRSYM-D--KE--D-AKVLLVTSVM
A0A3E5A223      --MKRKKDYLSMLIQN--PLRSFAYVESSKMAASRVRSYM-D--KE--D-AKVLLVTSVM
R7D5E6          --MKRKKDYLSMLIQN--PLRSFAYVESSKMAASRVRSYM-D--KE--D-AKVLLVTSVM
A0A415HQH5      --MKRKKDYLSMLIQN--PLRSFAYVESSKMAASRVRSYM-D--KE--D-AKVLLVTSVM
A0A414W2C6      --MKRKKDYLSMLIQN--PLRSFAYVESSKMAASRVRSYM-D--KE--D-AKVLLVTSVM
A5ZNE7          --MKRKKDYLSMLIQN--PLRSFAYVESSKMAASRVRSYM-D--KE--D-AKVLLVTSVM
A0A395X821      --MKRKKDYLSMLIQN--PLRSFAYVESSKMAASRVRSYM-D--KE--D-AKVLLVTSVM
A0A1C5PY68      --MKRKKDYLSMLIQN--PLRSFAYVESSKMAASRVRSYM-D--KE--D-AKVLLVTSVM
A0A174CJF8      --MKRKKDYLSMLIQN--PLRSFAYVESSKMAASRVRSYM-D--KE--D-AKVLLVTSVM
A0A564SRR2      --MKRKKDYLSMLIQN--PLRSFAYVESSKMAASRVRSYM-D--KE--D-AKVLLVTSVM
A0A174R7V0      --MKRKKDYLSMLIQN--PLRSFAYVESSKMAASRVRSYM-D--KE--D-AKVLLVTSVM
A0A373MWV2      -----------MLITN--PARSFPYVESLKRIASRVRGRL-D--RR--G-GKVLLVTSVA
A0A417CE88      -----------MLITN--PARSFPYVESLKRIASRVRGRL-D--RR--G-GKVLLVTSVA
A0A416Y441      -----------MLITN--PARSFPYVESLKRIASRVRGRL-D--RR--G-GKVLLVTSVA
A0A357GPJ7      -----------MLITN--PARSFPYVESLKRIASRVRGRL-D--RR--G-GKVLLVTSVA
A0A396PAC1      -----------MLITN--PARSFPYVESLKRIASRVRGRL-D--RR--G-GKVLLVTSVA
A0A416EYU4      -----------MLITN--PARSFPYVESLKRIASRVRGRL-D--RR--G-GKVLLVTSVA
A0A416SCQ2      -----------MLITN--PARSFPYVESLKRIASRVRGRL-D--RR--G-GKVLLVTSVA
A0A416TGN7      -----------MLITN--PARSFPYVESLKRIASRVRGRL-D--RR--G-GKVLLVTSVA
A0A417SMF6      -----------MLITN--PARSFPYVESLKRIASRVRGRL-D--RR--G-GKVLLVTSVA
A0A1Y4MW77      --------GKTIMPSILNLQTNPLFLENIESLHIRLAKEL-A--DI--N-GKTLIFTSTV
R6UHV6          --EKVKGIKRPLSITN--PVISFEFREAFKRLRQKIVSDS-K--TH--H-NKVYAVTSSL
A0A3R9Q621      RQAGRGKAKSGGLDKIIDENTKFIITEAYRALRSNLRYTL-R--KD--G-CKIIMINSPM
A0A069RC75      ----------AELVIK--TSPKSPGAEAFRSIRTNMQFAN-I--DQ--N-IKTILFTSSI
A0A174F2W5      -----------MLITN--PARSFPYVESLKRIASRVRGRL-D--RR--G-GKVLLVTSVA
A0A174S8E9      -----------MLITN--PARSFPYVESLKRIASRVRGRL-D--RR--G-GKVLLVTSVA
A0A416ZL97      -----------MLITN--PARSFLYVESLKRIASRVRGRL-N--RK--G-GKVLLVTSVA
A0A174LSK1      -----------MLITN--PARSFLYVESLKRIASRVRGRL-D--RK--G-GKVLLVTSVA
A0A373GY92      -----------MLITN--PARSFLYVESLKRIASRVRGRL-D--RK--G-GKVLLVTSVA
A0A373NZQ6      -----------MLITN--PARSFLYVESLKRIASRVRGRL-D--RK--G-GKVLLVTSVA
A0A417I9B9      -----------MLITN--PARSFLYVESLKRIASRVRGRL-D--RK--G-GKVLLVTSVA
A0A417MP97      -----------MLITN--PARSFLYVESLKRIASRVRGRL-D--RK--G-GKVLLVTSVA
A0A417WQF8      -----------MLITN--PARSFLYVESLKRIASRVRGRL-D--RK--G-GKVLLVTSVA
A0A373RZ83      -----------MLITN--PARSFLYVESLKRIASRVRGRL-D--RK--G-GKVLLVTSVA
A0A416U6I1      -----------MLITN--PARSFLYVESLKRIASRVRGRL-D--RK--G-GKVLLVTSVA
R7JQZ9          -----------MLITN--PARSFLYVESLKRIASRVRGRL-D--RK--G-GKVLLVTSVA
A0A3B8KKL6      NRRELEKEHLKNLITI--NDPKAAATEAFRELRTNLHYIN-I--DK--E-VKTMVVTSPS
A0A2K9E6R0      NRRELEKEYLKNLITK--NDPKAAATEAFRELRTNLHYIN-I--DK--E-VKTMVVTSPS
A0A2S8RBI0      NRRELEKEYLKNLITK--NDPKAAATEAFRELRTNLHYIN-I--DK--E-VKTMVVTSPS
A0A0L6JLG6      DEKQLEEEYLKNLITA--NDPKAAASEAYRELRTNLQYKS-V--DK--D-MKVILLTSPS
G8LSN0          DSKENERDYLKNLITK--NDPKAPASEAFREIRTNLHYKS-V--DK--E-LKTIVITSPA
A0A1M5UYN6      ----------------VKSNPSSIAAEGFRTLRTNIQYSS-I--DK--K-IRTIVVTSAG
A0A176JBT8      ---KYLDERYNKLVAH--TEPHSSSSEAYRSVRANLDILR-Q--SK--Q-PVTILVTSTS
A0A1I5HIC6      KKRKKEENIYPEGISIEKASLEFSVNEAYKTLRTNIQFCG-K--D-----IKTICITSSL
A0A1Y3TC51      ---QKKNPKEALLLDS--PVVSMGFAEAGRRTAARVEYHM-R--RH--R-QKMLLVSSIA
A0A1Y3T1N0      ---GRKNTKKALLLNS--PLVSMDFAEASRRAEAKVEYHM-R--RN--D-QKILLVTSIS
A0A1Y3Y8U8      ---GRKNAKKALLLNS--PLVSMDFAEASRRAEAKVEYHM-R--RN--D-QKILLVTSIS
A0A5B0BQY5      -----RNYNSDFESVTPRVQFPKAEKEDFNKLAATIHYFI-K--QK--K-VKTIMMTSSG
A6CLL4          NKHSPNNTYSKFLISS--SEANSPAMELYREIRTNIQFLL-K--KE--K-TKVLLVTSSG
A0A174DL89      --------KGNYLFVN--ESPKSLPSEAINILRTNLQFCN-V--NY--N-LKKILITSSS
A0A176U8D6      ----------KKIMWP--ENLPFNASEAIYQLRTGILYSS-K--D-----VKTIAVTSAF
A0A1Q6KSQ5      ----------EKIIWP--DELPFSAAEAIYQLRTAILYSS-K--D-----VKMIAVTSAF
A0A3D3U8B3      ----------EKIIWP--DELPFSAAEAIYQLRTAILYSS-K--D-----VKMIAVTSAF
A0A3E5FRL7      ----LKKLKQSLLISS--PIASMNFVEANGRMSSRIEYHL-N--RY--N-YQVLLVTGIS
A0A1Y4QK93      ----LKKSKQSLLITS--PIASMNFVEANGRMSSRIEHHF-D--KH--N-FKVLLVTGIG
B1C232          ----LKKSKQSLLISS--PIASMNFVEANGRMSSRIEHNF-D--KH--N-FKVLLVTGTG
A0A401USI6      ----------------VEREPKSPVTEAFKSMRTNLLFSM-E--NR--G-IKTLMVCSPG
A0A1V4IQ10      ----------NHITLIVEQKPKSIVAEAYRTLITNILYSE-S--EK--N-IKTILITSSK
A0A1S8TRD2      ----------NHIALIVEKKPKSIVAEAYRTLITNILYSE-S--EK--T-IKTILVTSSK
G7M1U2          ----------NHITLIVEKKPKSIVAEAYRTLITNILYSE-S--EK--T-IKTILVTSSK
A0A2T6KJ75      ------------------LPTFDVFTEMFRSIRANLLYVL-S--KN--N-AKTLLVTSAE
A9KN92          AYKRKKGDTNNEHSSIQKATLEFTINEAYKSLRTNIQFCG-K--D-----IKTICITSSL
A0A352MUJ1      ----------------IDLDPKSQIAEGFKSLRTNLQFMK-G--SD--GDLKSVLITSSL
R5YI67          ----------------IDLDPKSQCAEGFKSLRTNLQFMN-G--SE--G-LKSVLITSAL
A0A1Y0IQP5      ----------HRLAVR--QDPRSAEAEAFRTLRTNIQYDE-A--GQ--H-VKVLMVTSTA
A0A4R2R7B1      ----------YRVVVR--QDPRSAVAEAFRTLRTNIQYDE-A--GK--H-VKVLIVTSTL
A0A1M6E8I2      -------------IVH--ENPKSPISEAYRSLRTNINFAN-L--DN--N-MKTILITSAT
A0A1Y4N105      --ELKKKPKKSVLINS--PLLSMPYSEANRKLGALIERHM-R--RR--N-QQVLLVTSVA
A0A1Y4QP75      --ELKKKPKKSVLINS--PLLSMPYSEANRKLGALIERHM-R--RR--N-QQVLLVTSVA
A0A3D4QRB5      ----KSADRSPRLATG--AATRAPVTEAYKTLRTNIQFSN-V--DN--N-LKVLMVTSTS
A0A349DEH5      ---------KGLLVTD--RKNGFSFIETYKSIRTKIENNS-A--RT--G-NKVFLITSAC
A0A3D4T7B4      ---------KGLLVTD--RKNGFSFIETYKSIRTKIENNS-A--RT--G-NKVFLITSAC
A0A350XYC7      ---------KGLLVTD--RKNGFSFIETYKAIRTKIENNS-T--RT--G-NKVFLVTSAC
R6DNR8          ---------KGLLVTD--RKNGFSFIETYKAIRTKIENNS-T--KT--G-NKVYLVTSAC
A0A355KUM5      ---------KGLLVTD--RKNGFSFIETYKAIRTKIENNS-T--RT--G-NKVFLVTSAC
R5YGY6          ---------KGLLVTD--RKNGFSFIETYKSIRTKIENNS-T--RT--G-NKVFLVTSAC
A0A0K8J554      MSFLNRKKKKSNLNQMINEQANFIITEAYKALRINLLYTI-R--KQ--G-CKKILINSPN
A0A3N1XSX6      FPFLLKYKKFSKTERELMDNSKFIITESYKSLRTNLRFTL-L--KD--Q-CKKIIVSSPV
A0A1C6G0U3      ------DKMLKKEVTNTLISNEGPILEAYRSIRTNIEFFN-I--DK--T-IKVIMVTSSQ
A0A3D4LLB3      ---------YGNFLIK--DNPSSPTAEAYRKITTNIEFSN-V--DN--V-IKTIMITSAK
A0A0A5GPA9      KEDLMQNDRYFKLLPR--LGTYSPITEAYRSIRTNLQYTL-N--QK--S-AKTVLFTSTH
A0A271M6M4      NGLFDREDRFNKMLPQ--LNPYSAVTEAYRAVRTNVQYTI-S--QE--D-AQTILITSSH
A0A2V3W8U6      -LNSNKKEDLHSILTSRKGPMSTPVLEAYRSIRTNLQFQL-M--DK--S-LKTILVTSTS
W1UFG0          --------QKEKLMYVKDLDRKNLVQEEFIKIRTNIQYAN-I--DN--E-MKVILFTSTH
A0A351SRI8      --------KASDLIIC--KDSKSGISEAIRTLRTNLQFSS-I--DR--K-IKTILVTSSV
A0A1V5LU59      DQKQLEQDYLKNLITK--NDPKAPASEAFREIRTNLHYTS-V--DK--E-LKTIVVTSPT
A0A1E3BVC3      DEKELQEQYLKNLIVH--NNPKATSAEAFRELRTNLYYSS-V--DR--E-IKTIVVTSPT
A0A4Q0I6S0      DEKELQEQYLKNLIVH--NNPKATSAEAFRELRTNLYYSS-V--DR--E-IKTIVVTSPT
A3DF66          DEKELQEQYLKNLIVH--NNPKSATAEAFRELRTNLYYSS-V--DS--E-VKTIVVTSPT
W4V1T8          DEKELQEEYLKNLIVH--NNPKSASAEAFRELRTNLHYSS-V--DR--E-VKTIVVTSPT
A0A1I0RG99      --------KRNNISKN--KDTEFVIAEAYKSLRSNLNFTL-R--FN--G-CKKIIISSPV
A0A1I5G322      SKENKKAGKSENIKENAEKDTQFIITEAYNSLRTNLKFTL-R--HQ--G-CKKIVISSSL
A0A1C6ITD7      --------EDNYLFAN--VSPKSLPSEAINILRTNLQFCN-V--NS--N-LKKILITSSS
A0A381IX63      --------YEGNVTII--GNSKSSVSEAYRNTRTNIQFSN-L--DE--N-LNVIAITSSK
A0A1G9IUT4      ------------------KNMKSILDENYKNIRTNIEFSN-V--DK--N-IKSIVITSSQ
A0A1M6RWV2      ------------LITM--KDPKSPISEAYRILRTNIQFSN-L--DN--K-LKTILVTSSG
A0A143XPI5      -KKRRKDKNMEVSLLNQK--LSPSFMEGIRTLRIRVDAAL-Q--EV--S-AKTILVNSAI
A0A355G1X5      -KSGKKNQHPVLMITDRS--LGFSFIESYKAIRTRVETLC-T--RK--D-YKTILVTSAG
A0A0M6WXE3      IKEWIKHRKKAVLVDNPL--ASFRFVESFKMLAARVEYHM-S--KI--N-GKVLVVTSVC
A0A348SAK2      IKEWIKHRKKAVLVDNPL--ASFRFVESFKMLAARVEYHM-S--KI--N-GKVLVVTSVC
A0A1G9H5B9      -RLDSAKKDPEAFLLTNR--SPLEVSENYAKLRMNLFYTL-V--DK--E-QKIVVITSSV
R5EFZ0          VFALLRRKKTSILITNPV--TSFRFVESIRKLRRRVEQHM-D------G-GKVLIVTSLL
A0A1Y4H8L0      LRELFQKQKKALLVSQPL--AGFGFVESYRKFVSKLEYQM-E--KH--H-SKVLVVSSVS
A0A4B9BMD9      SNQQRHRTKNIPFLAVDN--PADSAVEAVRALRTSLHFAM-M--ET--E-NNILMITGAT
A0A0M6WYQ8      -KRNKESFYNSVNVLNKR--IPQGYLEAFRKVGIKVMKQM-E--EE--E-FKTLLVTSSV
A0A348SAK1      -KRNKESFYNSVNVLNKR--IPQGYLEAFRKVGIKVMKQM-E--EE--E-FKTLLVTSSV
A0A252F281      -DGKNKKEKHSFLITHTV--ISFAFEESIRQIRTRLEYAA-K--QD--G-AKVFLISSFG
A0A1Y4QKE6      -KARKIHKQTRISINDRR--IPFAFKENMRSLQMRLERVF-K--KE--E-HKVIVVTSTA
B1C231          -KARKIHKQTRISINDRR--ISFAFKENMRSLQIRLERVF-K--KE--E-HKVIVVTSTA
A0A1Y3TUL5      ----FRRKKSLLVEDDDP--IGAEVRESFVSAAHILHNRL-G--VG--E-HQCIYITSAE
A0A1Y4JAX2      ----FRRKKSLLVEDDDP--MGAEVRESFVSAAHILHNRL-G--VG--E-HQCIYITSAE
A0A1Y4T590      ----FRRKKSLLVEDDDP--MGAEVRESFVSAAHILHNRL-G--VG--E-HQCIYITSAE
R5B467          --KKRSRTTPAALPEEMA--RSSAYCEAMRIVAMRVDKAM-Q--HH--A-YRTLLVSSAA
A0A1Y3T163      -KARKKQKKKKISVLDKR--LSFGYRESLRALEIRLENMM-A--KE--G-GKVLLISSTA
A0A1Y3YCA2      -KARKKQKKKKISVLDKR--LSFGYRESLRALEIRLENMM-A--KE--G-GKVLLISSTA
A0A1Y4L6N9      -KARKKRIESRITVFDSR--VGAGFRENIKGLQMRVKREM-E--RI--D-GKVLLVTSTV
A0A173T644      -KARKKKRRRDISILNKE--FSQRFKESLLSIELKAEREL-Q--DK--N-GKILLVTSTI
A0A1C5TSB8      -KARKKKRRRDISILNKE--FSQRFKESLLSIELKAEREL-Q--DK--N-GKILLVTSTI
C0CIK6          -KARKKKRRRDISILNKE--FSQRFKESLLSIELKAEREL-Q--DK--N-GKILLVTSTI
A0A1Y3WEF6      -KLRKKQDTRWIQMQDSR--TPQAFRENIQSLQIRISREL-E--EK--G-GKVLVLTSTL
A0A417T0L2      -KLRKKQTTRWIQMQDSR--TPQAFRENIQSLQIRISREL-E--EK--G-GKVLVLTSTM
A0A1H9EPU3      EKNKLKLRQNGQVIPT-N--KDIRISKNISEAYKKLRSNI-QFSGR--H-VRVIGITSTV
A0A354IGV3      LRDSLHKVNRSVLLTNPV--ASFPFTETISKMCTRLEYAA-T--RH--G-RKVILITSVG
A0A417JMV2      WKARIHRKKSPVLLTNPG--TSFQYVEDMKKLARKVSSKM-K--EK--N-AKTLLVASVE
B0P408          WKARIHRKKSPVLLTNPG--TSFQYVEDMKKLARKVSSKM-K--EK--N-AKTLLVASVE
D4MV82          WKARIHRKKSPVLLTNPG--TSFQYVEDMKKLARKVSSKM-K--EK--N-AKTLLVASVE
A0A415VWX5      WKARIHRKKSPVLLTNPG--TSFQYVEDMKKLARKVSSKM-K--EK--N-AKTLLVASVE
A0A173UY96      WKARIHRKKSPVLLTNPG--TSFQYVEDMKKLARKVSSKM-K--EK--N-AKTLLVASVE
A0A173QTL1      WKARIHRKKSPVLLTNPG--TSFQYVEDMKKLARKVSSKM-K--EK--N-AKTLLVASVE
A0A174A3T7      WKARIHRKKSPVLLTNPG--TSFQYVEDMKKLARKVSSKM-K--EK--N-AKTLLVASVE
A0A174J359      WKARIHRKKSPVLLTNPG--TSFQYVEDMKKLARKVSSKM-K--EK--N-AKTLLVASVE
A0A417UUA3      WKARIHRKKSPVLLTNPG--TSFQYVEDMKKLARKVSSKM-K--EK--N-AKTLLVASVE
A0A1C6EUV9      WKARIHRKKSSVLLTNPG--TSFQYVEDMKKLARKVSSKM-K--DK--Q-AKTLLVASVE
A0A173Y645      WKARIHRKKSSVLLTNPG--TSFQYVEDMKKLARKVSSKM-K--DK--Q-AKTLLVASVE
A0A374AVY6      WKARIHRKKSSVLLTNPG--TSFQYVEDMKKLARKVSSKM-K--DK--Q-AKTLLVASVE
R7BXS4          WKARIHRKKSSVLLTNPG--TSFQYVEDMKKLARKVSSKM-K--DK--Q-AKTLLVASVE
A0A143ZUX1      -SRSRSRKGNSSLLISPR--SDFSYVEAYKSLRVRVESLA-A--ER--G-YKKFIVTSTL
S3FFL2          ----KVTDGRSPRDVLFD--RKSDMVDAYLAVQTNLGFTT-A--HG--V-PRTFAVTSTR
A0A6A8IF17      ---GKKPQEVKAVIVKEG--NRDIINEAFRVLRTNLEFMTGK--DK--T-SNVIIMTSFN
A0A6C0V5C7      --KGVKRYKQSQLLAVGN--PTDLAIEAIRSLRTSLHFAM-M--QA--K-NNVLMLTGVS
A0A6C0V5F7      ASHWKHRTSNVPFLPVDR--PTDMFIEAVRGLRTSLHFTM-M--DA--T-NRIVVVSGPT
A0A328M4V1      ---HRRTVGRQNLLAAGA--PTDLAVEALRSLRTSLHFAR-L--EA--K-NNLLLISSSS
A0A5C8HCX2      SNQQRHRTKNIPFLAVDN--PADSAVEAVRALRTSLHFAM-M--ET--E-NNILMITGAT
A0A1W1Z4C3      ----GEEKDAGVFLLNDK--TDMDMVESYAKLRMNLLYTM-S--EK--M-RRTVLVTSAI
A0A239QN83      ----GSEKDAGAYLLNEK--SDMDLVEGYAKLRMNLLYTL-S--EK--M-HRTVLVTSAI
A0A3R9WAA7      KKNIIGDVRKRAQTDR----MALGYMDDMYKIRTRLNKII-T--NR--D-IKTLLITSAI
A0A1G6BLF1      RGKNASKNVELVLMDNFR--VPPGFVEAMRSVRRRIENHS-L--DT--K-KNIYLVTSAL
R6HZX3          AAGSG------VSILNPH--LGDTLSVPIGALQVRLLRSQ-P--AGG-T-GRIILITSTM
A0A1W2CEA6      NPAFADGKHQAVFRGNLK--LDYAGEEAINAVCSSMSFTG-K------N-LKRVLVSSCG
R7FFK6          DRGTSADRKRKLIYHNSD--LPFSILETYKALRSSLNFLV-S--TS--E-NKIVAVTSAS
A0A373MPB9      DEGSSADRKKQLLFNNKD--IPFNIVENYKTMRTNLMFTL-S--TT--R-NKIVVVSSPN
A0A373L519      DEGSSADRKKQLLFNNKD--IPFNIVENYKTMRTNLMFTL-S--TT--R-NKIVVVSSPN
A0A373W906      DEGSSADRKKQLLFNNKD--IPFNIVENYKTMRTNLMFTL-S--TT--R-NKIVVVSSPN
A0A373VCW2      DEGSSADRKKQLLFNNKD--IPFNIVENYKTMRTNLMFTL-S--TT--R-NKIVVVSSPN
W0U604          DEGSSADRKKQLLFNNKD--IPFNIVENYKTMRTNLMFTL-S--TT--R-NKIVVVSSPN
A0A374B6G0      DEGSSADRKKQLLFNNKD--IPFNIVENYKTMRTNLMFTL-S--TT--R-NKIVVVSSPN
A0A373VM36      DEGSSADRKKQLLFNNKD--IPFNIVENYKTMRTNLMFTL-S--TT--R-NKIVVVSSPN
A0A1C5P379      DEGSSADRKKQLLFNNKD--IPFNIVENYKTMRTNLMFTL-S--TT--R-NKIVVVSSPN
A0A373XXX0      DEGSSADRKKQLLFNNKD--IPFNIVENYKTMRTNLMFTL-S--TT--R-NKIVVVSSPN
A0A5R9MJM9      DEGSSADRKKQLLFNNKD--IPFNIVENYKTMRTNLMFTL-S--TT--R-NKIVVVSSPN
A0A356CW82      DEGSSADRKKQLLFNNKD--IPFNIVENYKTMRTNLMFTL-S--TT--R-NKIVVVSSPN
R6T4X7          DEGSSADRKKQLLFNNKD--IPFNIVENYKTMRTNLMFTL-S--TT--R-NKIVVVSSPN
A0A374HTV1      DEGSSADRKKQLLFNNKD--IPFNVVENYKTMRTNLMFTL-S--TT--R-NKIVVVSSPN
A0A374GB66      DEGSSADRKKQLLFNNKD--IPFNIVENYKTMRTNLMFTL-S--TT--R-NKIVVVSSPN
A0A374ECC6      DEGSSADRKKQLLFNNKD--IPFNIVENYKTMRTNLMFTL-S--TT--R-NKIVVVSSPN
A0A374BM61      DEGSSADRKKQLLFNNKD--IPFNIVENYKTMRTNLMFTL-S--TT--R-NKIVVVSSPN
A0A373UGZ4      DEGSSADRKKQLLFNNKD--IPFNIVENYKTMRTNLMFTL-S--TT--R-NKIVVVSSPN
A0A373SA66      DEGSSADRKKQLLFNNKD--IPFNIVENYKTMRTNLMFTL-S--TT--R-NKIVVVSSPN
A0A1C5X6X7      DEGSSADRKKQLLFNNKD--IPFNIVENYKTMRTNLMFTL-S--TT--R-NKIVVVSSPN
A0A1C6JIH3      DEGSSADRKKQLLFNNKD--IPFNIVENYKTMRTNLMFTL-S--TT--R-NKIVVVSSPN
A0A373PSC3      DEGSSADRKKQLLFNNKD--IPFNIVENYKTMRTNLMFTL-S--TT--R-NKIVVVSSPN
A0A1K1WYK8      KKKGKHRTEPRGLLTDKD--VPFNIVESYKTIRANILFTA-A--DS--D-KKVIAVSSPN
A0A1H6IUB1      KKDSDEDEHVK--LTDKS--VPFNVVESYKSIRTNISFAL-S--TV--D-KKIFAVSSAN
A0A1M7L1F9      KKDQDEDAHVK--LTDKN--VPFTVVESYKSIRTNVSFAL-S--TV--D-KKIFAVSSSN
A0A1C6B4L6      DKSSK-DNYSK--LTDKD--IPFYIVERYKSIRTNVNFSL-A--TS--D-KKIFAVSSAN
A0A1Q6T9P4      DKSSK-DNYSK--LTDKD--IPFYIVERYKSIRTNVNFSL-A--TS--D-KKIFAVSSAN
A0A315Y4F9      KRDAD-DVHLK--LTDKD--APFYIIESYKSIRTNLSFAL-S--TV--E-KKTFVVSSAN
A0A354K620      KKDAD-DDYVK--LTDKE--TPFHIIESYKSIRTNLSFAL-S--TF--D-KKVFAVSSAN
A0A355G3J9      KRNSFDNAVEQQVILSED--TPFSVKEAYHKARSNILYLP-S--DEENG-CKTLVITSAL
A0A3D2AD87      TDSNNADDSKESVLEKKQ--IPFVIVESYKNIRTGVAYLL-S--RE--E-KSSFTITSAN
A0A2T5IYJ6      -----KDTSAIYFLDSKQ----NGYAEAMRTVRTSVVLSG-I--DK--P-HKVVMLTSSV
A0A3C0QME1      HR----------TILDEK--MDFNIVENYKSIRSNIMFAF-S--TM--P-RKILAVSSAN
A0A355FYK5      L-------FTGGLLITDEDKVSFAFIECVKAIRTKLENLS-A--NK--G-FKTFMVTSTY
A0A357AQU0      VDPSKKNNFSFETILNKE--IPFSVVESFKSIRTNIMFAV-A--TQ--G-KKVIAVTSAN
A0A3C1YJQ7      VDPSKKNNFSFETILNKD--IPFSVVESFKSIRTNIMFAV-A--TQ--G-KKVIAVTSAN
A0A3D0JG38      VDPSKKNNFSFETILNKE--IPFSVVESFKSIRTNIMFAV-A--TQ--G-KKVIAVTSAN
A0A3C0IHX1      KKKNSPSALRNMLLCAKD--IPFPCSEAYRSIRTNLMFAL-A--PQ--E-HKIVAVTSPN
R5V506          KKKNSPSALRNMLLCAKD--IPFPCSEAYRSIRTNLMFAL-A--PQ--E-HKIVAVTSPN
A0A352TIU5      KKKNSPSALRNMLLCAKD--IPFPCSEAYRSIRTNLMFAL-A--PQ--E-HKIVAVTSPN
A0A3E5FSY5      QTR--------ISINDRR--ISFAFKENMRSLQIRLERVF-K--KE--E-HKVIVVTSTA
A0A1V5S3C0      -----NSPKKGLLIIDKT--VGLPFIETFKLIRTKIENAS-F--KK--G-YKVFAVTSSA
A0A1Y3TC98      KKLDDTR----LSLLNEK--LPFGYRESIRSLQKRVVKNL-E--HM--D-GKILMVTSST
A0A1Q6REE0      ---------PYPLLHRYR--SESGFSESVRLLRLRVEKAM-Q--EN--G-QKILLVSSAI
R5ETF9          ---------PYPLLHRYR--SESGFSESVRLLRLRVEKAM-Q--EN--G-QKILLVSSAI
R6VAT5          ----SSHSTGSLTIDDAH--TDPRFKESVFSIRNKIIKLC-A--DQ--K-INSVMVASTT
A0A1Q6S448      ARRGGKRLRRNLNISSPA--ISFAFTESIHRIAEKFQHEH-A--K---G-RRVFLFSSVS
A0A351MYR0      ARRGGKRLRRNLNISSPA--ISFAFTESIHRIAEKFQHEH-A--R---G-RRVFLFSSVS
R6HPC1          SRRGGKRLRRNLNISSPA--ISFAFTESIHRIAEKFQHEH-A--K---G-RRVFLFSSVS
A0A3D4G5Z5      SRRGGRRLRRNLNISSPA--ISFAFTESIHRIAEKFQHEH-A--K---G-RRVFLFSSVS
A0A3D5ES03      SRRGGKRLRRNLNISSPA--ISFAFTESIHRIAEKFQHEH-A--K---G-RRVFLFSSVS
A0A0F2P7X6      QSQGQGQGQGAPLVTSDQ--VGFGFVESYKAAGTNLRFAS-A--VT--S-AKKLLVTSIL
A0A359B487      ---DQGQGQGAPLVNSDQ--VGFGFVESYKAAGTNLRFAS-A--VT--N-AKKLLVTSIL
A0A348P5V4      GESKQG-----ILITDKK--SGFGFIESYKLIRTKIEHAA-S--RQ--D-YKAIIVTSTM
A0A356PT74      GEDYKP-----LLISDRR--SGFPFIETFKIIRTKIEHTA-Q--RE--K-YKTFVVTSTA
A0A3D5LL19      GEDYKP-----LLISDRR--SGFPFIETFKIIRTKIEHTA-Q--RE--K-YKTFVVTSTA
R5MNF0          GEDYKP-----LLISDSR--SGFPFIETFKIIRTKIEHTA-Q--RE--K-YKTFVVTSTA
A0A1Q9JSI0      ARLHRKKNP--VLLTNPG--TSFRYVENMKKLARRVSSQM-Q--DH--N-AKTLMVTSAV
A0A3D5TNI1      KKSAHGDRE--LLITDKA--CGFAFIETYKAMRTKLELLN-G--RR--G-YKSFVISSAG
A0A358LJD0      KKSAHGGRE--LLITDKA--CGFAFVETYKAMRTKLELLN-G--RR--G-YKSFVVSSAG
R6I3L7          KKSAHGDRE--LLITDKA--CGFAFVETYKAMRTKLELLN-G--RR--G-YKSFVVSSTG
A0A3D1HXX0      KKSTHGDRE--LLITDKA--CGFAFVETYKAMRTKLELLN-G--RR--G-YKSFVVSSAG
A0A3D2QJB8      KKSAHGDRE--LLITDKA--CGFAFVETYKAMRTKLELLN-G--RR--G-YKSFVVSSAG
D4LC36          NRGTDADRKTRLLFGNEN--IPFSTVEAYKSFRTALSFVI-S--TC--D-SRIVAMTSAN
R7MQJ4          KDSNDYD----LLLTQKG--IPFTIKESYKSMRTNVMFSL-S--VS--E-KKVIVVSSAN
A0A1V5GLC0      G--EDDH----FKLTDGN--IPFYITESYKSLRTNITFAL-A--TS--D-KKIFAISSAN
W7V182          KDVDDNH----VKLTDKN--VPFAVVESYKSIRTNITFAL-S--TS--E-KKIFTVSSAN
                                                                       . .  

A0A0H5SF45      PRDGKSTTCTNIAIALAKT-GARVLLIDCDLRKG---RLHVPFN--LNSTP-GVTNLLSG
A0A1M6JRJ5      PEDGKSTTSINLSIAISQA-GYKVLLIDCDLRKG---RLHHYFK--AKSQP-GLSDLLSH
A0A1M7Y1S2      PEDGKSTISINLSIAIAHA-GYKVLLIDCDLRKG---RIHHHFK--GKSQP-GLSDFLSN
A0A3D5R4X5      AGEGKSLTTSNLATAIAQT-GNKVLLVDTDFRKP---SIHKIAR--KPNAD-GLADVLIN
A0A1I4C3N6      KGEGKTVSALNIASSLANT-GKKILFIDADLRES---RTAEVLG--MSGT--GLSEYLGS
A0A3B9CIM7      PGEGKTLTCINLASAYAQL-GKKILLIDADMRKS---NLKSLLD--IEGKE-GLSEYLAG
A0A1G9WHW8      SGEGKSLNSMNLAISYSFL-GKKVLLIDGDLRKS---GISRVLK--TTSRQ-GLSQYLAG
A0A1H5VAA0      SGEGKSLNSMNLAISYSFL-GKKVLLIDGDLRKS---GISRVLK--TTSRQ-GLSQYLAG
A0A3R6VK11      KDEGKTLNSVNIAISYAQL-GKKVLLIDGDMRNM---SVASLLK--LRGRL-GLSQYLAG
A0A3R6QUY7      KDEGKTLNSVNIAISYAQL-GKKVLLIDGDMRNM---SVASLLK--LRGRL-GLSQYLAG
A0A373K3P9      KDEGKTLNSVNIAISYAQL-GKKVLLIDGDMRNM---SVASLLK--LRGRL-GLSQYLAG
A0A3R6JRU5      KDEGKTLNSVNIAISYAQL-GKKVLLIDGDMRNM---SVASLLK--LRGRL-GLSQYLAG
A0A1C5MS04      KDEGKTLNSVNIAISYAQL-GKKVLLIDGDMRNM---AVASLLK--LRGRL-GLSQYLAG
A0A3C1J150      KDEGKTLNSVNIAISYAQL-GKKVLLIDGDMRNM---SVASLLK--LRGRL-GLSQYLAG
A0A416CXD7      KDEGKTLNSVNIAISYAQL-GKKVLLIDGDMRNM---SVASLLK--LRGRL-GLSQYLAG
R6XBL9          KDEGKTLNSVNIAISYAQL-GKKVLLIDGDMRNM---SVASLLK--LRGRL-GLSQYLAG
A0A355W5Z7      KDEGKTLNSVNIAISYAQL-GKKVLLIDGDMRNM---SVASLLK--LRGRL-GLSQYLAG
A0A143WVN6      ENEGKSSVASNIALALADR-HKKVLLVDGDLRKP---ALHRIFDLHDQVKY-SLSEYLLG
W6RXP9          PGEGKSTTTGNLALALAEG-EAKVILIDCDMRKP---TVHKKFH--ISNDK-GLSDVLIG
W6S4G8          KGEGKTTISGNLALSLAGW-GNRVVLIDCDIRRA---ALHKAFN--ISNSK-GLTDVLVN
A0A1G6BLB6      ENEGKSTVAVNLALELVEE-EQKVLLIDGDFRKP---ALYKVLQIDPKEVT-DLGEVLNH
A0A1C6G8M0      ENQGKSFISFHLAYSLSQV-GKRVLLVDTDMRKS---VLQRRMG--LEGVKLGLSEYLSG
A0A416MP73      ENQGKSFISFHLAYSLSQV-GKRVLLVDTDMRKS---VLQRRMG--LDGVKLGLSEYLSG
A0A3E4LL92      ENDGKSTVTANMVLDLARR-GKKVVLVDCDMRHP---SLAKIFDAAVDPKE-QLSEYLLG
A0A415D1L1      ENDGKSTVTANIALNLARR-GKKVVLVDCDMRHP---SLAKIFDATVDPKE-QFSEYLLG
A0A414P2K5      ENDGKSTVTANIALNLARR-GKKVVLVDCDMRHP---SLAKIFDATVDPKE-QFSEYLLG
V8C417          ENDGKSTVTANIALNLARR-GKKVVLVDCDMRHP---SLAKIFDATVDPKE-QFSEYLLG
A0A143XN92      ENEGKSTVAANLALEFAKM-GKNVLLIDLDLRKP---AQHDIFGRKGEQFV-GIAEWLEN
A0A173ZYY6      ENEGKSTVAANLAITLAEQ-SKRVLLVDGDIRRP---SQFLIFGMEPKEEN-ELGEYLRG
A0A4Q5EHM9      ENEGKSTVAANLAITLAEQ-SKRVLLVDGDIRRP---SQFLIFGMEPKEEN-ELGEYLKG
A0A173SMI2      ENEGKSTVAANLAITLAEQ-SKRVLLVDGDIRRP---SQFLIFGMEPKEEN-ELGEYLRG
A0A174ASH7      ENEGKSTVAANLAITLAEQ-SKRVLLVDGDIRRP---SQFLIFGMEPKEEN-ELGEYLRG
A6BH65          ENEGKSTVAANLAITLAEQ-SKRVLLVDGDIRRP---SQFLIFGMEPKEEN-ELGEYLRG
R7G0D7          ENEGKSTVAANLAITLAEQ-SKRVLLVDGDIRRP---SQFLIFGMEPKEEN-ELGEYLKG
A0A396G6S7      ENEGKSTVAANLALSLAQG-GSRVMLIDCDFRKP---AQYKIFNVRDNEEK-DLGDVLIN
A0A3E5A223      ENEGKSTVAANLALSLAQE-GSRVMLIDCDFRKP---AQYKIFNVRDNEET-DLGDVLIN
R7D5E6          ENEGKSTVAANLALSLAQG-GSRVMLIDCDFRKP---AQYKIFNVRDNEEK-DLGDVLIN
A0A415HQH5      ENEGKSTVAANLALSLAQG-GSRVMLIDCDFRKP---AQYKIFNVRDNEEK-DLGDVLIN
A0A414W2C6      ENEGKSTVAANLALSLAQE-GSRVMLIDCDFRKP---AQYKIFNVRDNEET-DLGDVLIN
A5ZNE7          ENEGKSTVAANLALSLAQE-GSRVMLIDCDFRKP---AQYKIFNVRDNEET-DLGDVLIN
A0A395X821      ENEGKSTVAANLALSLAQG-GSRVMLIDCDFRKP---AQYKIFNVRDNEEK-DLGDVLIN
A0A1C5PY68      ENEGKSTVAANLALSLAQG-GSRVMLIDCDFRKP---AQYKIFNVRDNEET-DLGDVLIN
A0A174CJF8      ENEGKSTVAANLALSLAQG-GSRVMLIDCDFRKP---AQYKIFNVRDNEET-DLGDVLIN
A0A564SRR2      ENEGKSTVAANLALSLAQE-GSRVMLIDCDFRKP---AQYKIFNVRDNEET-DLGDVLIN
A0A174R7V0      ENEGKSTVAANLALSLAQG-GSRVMLIDCDFRKP---AQYKIFNVRDNEEK-DLGDVLIN
A0A373MWV2      ENEGKSTLAANLALALSEE-QNRVLLLDCDFRQP---ALYKIFELPQKAGK-DFGQVAAG
A0A417CE88      ENEGKSTLAANLALALSEE-QNRVLLLDCDFRQP---ALYKIFELPQKAGK-DFGQVAVG
A0A416Y441      ENEGKSTLAANLALAISEE-QNRVLLLDCDFRQP---ALYKIFELPQKAGK-DFGQVAVG
A0A357GPJ7      ENEGKSTLAANLALALSEE-QNRVLLLDCDFRQP---ALYKIFELPQKAGK-DFGQVAVG
A0A396PAC1      ENEGKSTLAANLALALSEE-QNRVLLLDCDFRQP---ALYKIFELPQKAGK-DFGQVAVG
A0A416EYU4      ENEGKSTLAANLALALSEE-QNRVLLLDCDFRQP---ALYKIFELPQKAGK-DFGQVAVG
A0A416SCQ2      ENEGKSTLAANLALALSEE-QNRVLLLDCDFRQP---ALYKIFELPQKAGK-DFGQVAVG
A0A416TGN7      ENEGKSTLAANLALALSEE-QNRVLLLDCDFRQP---ALYKIFELPQKAGK-DFGQVAVG
A0A417SMF6      ENEGKSTLAANLALALSEE-QNRVLLLDCDFRQP---ALYKIFELPQKAGK-DFGQVAVG
A0A1Y4MW77      AKEGKSTIATNVAYALAKN-NKKVLLIDADLRKQ---DLSKQMN--LTTNGVGLSSIKYG
R6UHV6          ENEGKTTVAVNLALSLAKM-DYKVLLIDGDLRKP---AVAKFLEAKITNGK-SIIDFLRG
A0A3R9Q621      PEDGKSTTCANLGITMAQT-GARVLLVDCDLRKG---KLHRFFN--FKSMP-GLSDILSG
A0A069RC75      PGEGKTLVSANMATALCGI-GKKVMLFDCDFRKP---RLAKVFG--LSNTV-GITDALMS
A0A174F2W5      ENEGKSTLAANLALALSEE-QNRVLLLDCDFRQP---ALYKIFELPQKAGK-DFGQVAAG
A0A174S8E9      ENEGKSTLAANLALALSEE-QNRVLLLDCDFRQP---ALYKIFELPQKAGK-DFGQVAVG
A0A416ZL97      ENEGKSTLAANLALALAEE-QNRVLLLDCDFRQP---ALHKIFEIPEKDGK-DFGKVVLG
A0A174LSK1      ENEGKSTLAANLALALAEE-QNRVLLLDCDFRQP---ALHKIFEIPEKDGK-DFGKVVLG
A0A373GY92      ENEGKSTLAANLALALAEE-QNRVLLLDCDFRQP---ALHKIFEIPEKDGK-DFGKVVLG
A0A373NZQ6      ENEGKSTLAANLALALAEE-QNRVLLLDCDFRQP---ALHKIFEIPEKDGK-DFGKVVLG
A0A417I9B9      ENEGKSTLAANLALALAEE-QNRVLLLDCDFRQP---ALHKIFEIPEKDGK-DFGKVVLG
A0A417MP97      ENEGKSTLAANLALALAEE-QNRVLLLDCDFRQP---ALHKIFEIPEKDGK-DFGKVVLG
A0A417WQF8      ENEGKSTLAANLALALAEE-QNRVLLLDCDFRQP---ALHKIFEIPEKDGK-DFGKVVLG
A0A373RZ83      ENEGKSTLAANLALALAEE-QNRVLLLDCDFRQP---ALHKIFEIPEKDGK-DFGKVVLG
A0A416U6I1      ENEGKSTLAANLALALAEE-QNRVLLLDCDFRQP---ALHKIFEIPEKDGK-DFGKVVLG
R7JQZ9          ENEGKSTLAANLALALAEE-QNRVLLLDCDFRQP---ALHKIFEIPEKDGK-DFGKVVLG
A0A3B8KKL6      MGDGKSVTAANLAVILAKS-GKRVLIVDADLRKP---KVHHYFG--VKNNI-GLTSILTD
A0A2K9E6R0      MGDGKSVTAANLAVILAKS-GKRVLIVDADLRKP---KVHHYFG--VKNNI-GLTSILTD
A0A2S8RBI0      MGDGKSVTAANLAVTLAKS-GKRVLIVDADLRKP---KVHHYFG--VKNNI-GLTSILTD
A0A0L6JLG6      LGDGKTVTTVNLAITLAQS-GKKVLVIDADLRKP---KVHHYFG--VKNTE-GLTNILAT
G8LSN0          LGDGKTVTSVNMAVTLAKS-GKKVLLIDSDLRKP---KVHLYFG--IPNEK-GLTNIIKG
A0A1M5UYN6      QGEGKTQVSGNLALTMANL-EKKTIIIDCDMRRP---NVHRKFR--ISNEI-GLSDILSE
A0A176JBT8      AGDGKSLTCGNLAVTLAKD-NKKVVFVDSDMRKP---NGHSLFN--LHNRC-GLTNYLTG
A0A1I5HIC6      PDEGKTVVAFRLATALSES-GKKVLFIDADLRKS---VIVNRLK--ISNGANGLSQYLSG
A0A1Y3TC51      ENEGKSTVAANLALALAEK-HKKVLLVDGDLRRP---AQHKVFEEKGKERF-SFSQVLKG
A0A1Y3T1N0      ENEGKSTVAANIALALAEK-HQKVLLVDGDLRQP---AQYKVFEEKSAGRT-SVEQVFTG
A0A1Y3Y8U8      ENEGKSTVAANIALALAEK-HQKVLLVDGDLRQP---AQYKVFEEKSAGRT-SVEQVFRG
A0A5B0BQY5      AGEGKTFIGSNLAVKLAMD-GQKTLFIDADFRKS---DGRLLFN--LPERK-GLTSVISG
A6CLL4          ASEGKSLTTGNLAISMAMD-GVKTVVIDMDLRKG---VGSQLFH--LPSKK-GISNYLHG
A0A174DL89      PSEGKSTIISNLGISMALT-NKKVIIIDCDMRKP---KIHRIFS--LSNII-GLSHILSN
A0A176U8D6      ENQGKSFISFHLAYSLSQV-GKRVLLVDTDMRKS---VLQRRMG--LDGVKLGLSEYLSG
A0A1Q6KSQ5      ENQGKSFISFHLAYSLSQV-GKRVLLVDTDMRKS---VLQRRMG--LEGVKLGLSEYLSG
A0A3D3U8B3      ENQGKSFISFHLAYSLSQV-GKRVLLVDTDMRKS---VLQRRMG--LEGVKLGLSEYLSG
A0A3E5FRL7      ENEGKSTVAANICLSFVEK-NKKVLLIDGDFRKP---AQYKIFDKEVLDTN-PLQDVITG
A0A1Y4QK93      ENDGKSTVAANICLLFVEK-NKKVLLIDGDFRKP---AQYKIFDKEVLDTN-PLQDVITE
B1C232          ENEGKSTVAANICLSFVEK-NKKVLLIDGDFRKP---AQYKIFDKEVLDTN-PLQDVITG
A0A401USI6      PKDGKTSVSTNIASTIAQT-GKSILLIDCDLRKP---CIHRHFN--ITNNAKGLVDIVLQ
A0A1V4IQ10      LQEGKSTVAGNLALSFAEN-DNKVIIVDCDLRKP---SLHQKFN--IPNTS-GLSDVILK
A0A1S8TRD2      LQEGKSTVAGNLALSFAEN-DKKVIIVDCDLRKP---SLHEKFN--ISNTS-GLSDVILK
G7M1U2          LQEGKSTVAGNLALSFAEN-DKKVIIVDCDLRKP---SLHEKFN--ISNTS-GLSDVILK
A0A2T6KJ75      SGDGKSFVSANLSIVFAMD-QKKTVFIDADLRRG---TGRNLFH--LPKRI-GITSYLAG
A9KN92          PNEGKTVVSFRLATAFADS-GKKVLFIDADLRKS---VIISKLK--IDNAVNGLSQYISG
A0A352MUJ1      PGEGKSWVATNLAITFARG-GYRTILVDADMRKG---VQHKKFR--LKQVP-GLSDFLNS
R5YI67          PGAGKSWVATNLAITFARG-GYRTILVDADMRKG---IQHKKFR--LNQVP-GLSDFLSS
A0A1Y0IQP5      AGEGKTTVIANLAVTMAQA-GKKVLLIDGDLRKP---TLHHVFH--LGGQK-GLTEVLCE
A0A4R2R7B1      AGEGKSMVLANLAVTMAQA-GKRVLLIDGDLRKP---TLHHVFH--LGGQI-GLTEVLCE
A0A1M6E8I2      PGEGKTQTVMNLAVAMAQN-DKKVIVVDCDMRKP---RIHKILN--ISNTS-GIAEYLMD
A0A1Y4N105      ENEGKSSTAGNIALSMVDR-GKKVVIIDCDFRKP---ALYKVFE--LKELKNGLSDYLDG
A0A1Y4QP75      ENEGKSSIAGNIALSMVDR-GKKVVIIDCDFRKP---ALYKVFE--LKELKNCLSDYLDG
A0A3D4QRB5      KDEGKSSTAANLAVSIAQS-NKKVLLIDCDLRSS---IVHRIFH--LLNEK-GLTNILVG
A0A349DEH5      ENEGKTTSCVNIALSLAQN-GKKVLIIDADLRKP---SVSKLLS--LPDTDCGLSDVILG
A0A3D4T7B4      ENEGKTTSCVNIALSLAQN-GKKVLIIDADLRKP---SVSKLLS--LPDTDCGLSDVILG
A0A350XYC7      ENEGKTTVCVNVALSLAQN-GKNVLIIDADLRKP---SVGKMLS--LKENDRGLSDVILG
R6DNR8          ENEGKTTSCVNIALSLAQN-GKNVLIIDADLRKP---SVSKMLS--LQDTEEGLSDVILG
A0A355KUM5      ENEGKTTSCVNIALSIAQN-GKNVLIIDADLRKP---SVSKMLS--LPATEYGLSDVILG
R5YGY6          ENEGKTTSCVNIALSIAQN-GKNVLIIDADLRKP---SVSKMLS--LPTTEYGLSDVILG
A0A0K8J554      PEEGKSTTCLNIGIALANA-GAKVLLIDCDLRKG---RLHKPLN--VKSTP-GLSNVLSV
A0A3N1XSX6      PEEGKSTTSINLGITISQT-GSKVLLIDCDLRKG---KIHNYFN--LKYKP-GLSDVLSG
A0A1C6G0U3      PGEGKSTFISNISKVFATLDDKKILLIDCDFRRP---KIHKIFK--ISNTQ-GLTNILVK
A0A3D4LLB3      QDEGKTTTICNLAMVMTEL-KKNILLIDLDLRKP---TVHKQFK--LSNKT-GLTDLLMK
A0A0A5GPA9      SSEGKSITAANIAYSMAMD-HVNTVFVDLDLRKG---VGNHLFN--NPVRK-GATNYLEG
A0A271M6M4      PGEGKSLTAANLAICLAMD-HMETIFVDLDLRKG---VGRQLFH--IPLRK-GVTTYLEG
A0A2V3W8U6      KNEGKTITCSNLAMMMAID-NKKTVVIDADLRKE---KMGM-----SNGQI-GLTHYLAG
W1UFG0          KDEGKSILSLNTAYKFSELEETKVLLIDCDLRNP---TINKILN--KPNQK-GVMDILLG
A0A351SRI8      PGEGKSFVASNLAVALANS-GQRVLLVDCDIRKG---RQHRIFG--SPNKK-GLSNLLLE
A0A1V5LU59      LGDGKTVTAVNMAVTIAKS-GKKVLIIDTDLRKP---KVHLYFG--IKNAE-GVTNMLSS
A0A1E3BVC3      LGDGKTVTAVNLAVTLARS-GKKVLVIDADLRKP---KVHHYFG--VKNKE-GLTNILTD
A0A4Q0I6S0      LGDGKTVTAVNLAVTLARS-GKKVLVIDADLRKP---KVHHYFG--VKNKE-GLTNILTD
A3DF66          LGDGKTVTAVNLAITLARS-GKKVLVIDADLRKP---KVHHYFG--VKNKE-GLTNLLTD
W4V1T8          LGDGKTVTAVNLATTLARS-GKKVLVIDADLRKP---KVHHYFG--VKNKE-GLTNLLTE
A0A1I0RG99      PQDGKSTTITNVGISIAQT-GAKVLLMDCDLRKG---RLHRLFN--IQLIP-GVSDALSS
A0A1I5G322      PEDGKSTITTNLGIVIGQT-GSKVLLVDCDLRKG---RLHNFFN--IKSSP-GVTNVLSN
A0A1C6ITD7      PSEGKSTIISNLGISIALT-NKKVVIIDCDMRKP---RIHRLFS--LSNII-GLSHILSN
A0A381IX63      PSEGKSTMISNIGAAFGNLENKKVLIIDCDLRNP---SIHRMFG--LSNAI-GLTDVLIG
A0A1G9IUT4      KNEGKTTIVSSLGSSFAQL-DKKILIIDCDFRNP---SIHKVFD--ISNKQ-GIADVLLN
A0A1M6RWV2      PAEGKSTTISNLAVTMVNM-GHKVLLIDADFRKP---QIHKIFN--LSNDV-GMTNILMG
A0A143XPI5      QGEGKTTIAVNLALVRALR-GEKVLLIDADLRNP---SVSQVLHLDTNK--KEIADVLEG
A0A355G1X5      ANEGKTTFSLNLALSLSQN-GKSVLLIDADMRKP---TLYRFLNLNIPRG-NDLASVICG
A0A0M6WXE3      ENEGKSSVAGNLAITLAKK-GKRIILIDGDIRCP---AQYLLLGMSPKKE-NELGEFLNG
A0A348SAK2      ENEGKSSVAGNLAITLAKK-GKRIILIDGDIRCP---AQYLLLGMSPKKE-NELGEFLEG
A0A1G9H5B9      SGEGKSTISANLAISCAMS-GNKVILVDSDMRRS---SQSEIFKYETDK--EGLSDVLAG
R5EFZ0          ENEGKSTVTVNLALAMEQK-GKRVLLIDCDLRKP----ACGMVLGQSKFT-YGLNDILGG
A0A1Y4H8L0      ENEGKSTVAANIAISLVQR-GKKVLLIDGDLRRP---SQFLILGIETQDK-NELGEYLKS
A0A4B9BMD9      PDSGKTFVSSTLAAVIAQS-DQKVLFIDADLRRG---YSHNL--FTVSNE-HGLSEYLAG
A0A0M6WYQ8      PEEGKTAFSVNLAIIEAKL-GKNVILVDCDMRRP---SVAKAM-NQEGEF-PGLQAVLQG
A0A348SAK1      PEEGKTAFSVNLAIIEAKL-GKNVILVDCDMRRP---SVSKAM-NQEGEF-PGLQAVLQG
A0A252F281      ENEGKSTISANSALSLAEK-GYHVLLIDADFRKP---AQYKVLNRDVDEA-NCLGEYLRG
A0A1Y4QKE6      ANEGKTTLTINLAETFATN-GKRVLLIDADLRRQ---SIASI--LHCKDN-QGLIDVYLQ
B1C231          ANEGKTTLTINLAETFAAN-GKRVLLIDADLRRQ---SIAKI--LKCDNN-EGLVDLYLQ
A0A1Y3TUL5      QDEGKTHVAANLAVQLSDL-EHKVLLIDLDVRNP---SLGGLFLDKVDYA-HSLNALYRG
A0A1Y4JAX2      QDEGKTHVAANLAVQLSDL-EHKVLLIDLDVRNP---SLGGLFLDKVDYA-HSLNALYRG
A0A1Y4T590      QDEGKTHVAANLAVQLSDL-EHKVLLIDLDVRNP---SLGGLFLDKVDYA-HSLNALYRG
R5B467          PGEGKTTFVCQLALALVRQ-GRHVLVIDCDLRNP---SVHKT--LGRPAQ-TGLAEYLAG
A0A1Y3T163      SGEGKSTLAVNLSELLASR-GKRVLLIDGDLRKQ---DDAGI--IGIRDG-AGLADIVKG
A0A1Y3YCA2      SGEGKSTLAVNLSELLASR-GKRVLLIDGDLRKQ---DDAGI--IGIRDS-AGLADIVKG
A0A1Y4L6N9      AEEGKTTVAVNLAFSLAEY-GYKVLLLDGDMRKQ---TDWKY--IEGVKG-KGLYEVLRK
A0A173T644      SGEGKSTVALNMAYAAALH-EKKVLFIDADLRKQ---TDRRC--LTETEG-KGLYGVVTG
A0A1C5TSB8      SGEGKSTVALNMAYAAALH-EKKVLFIDADLRKQ---TDRRC--LTETEG-KGLYGVVTG
C0CIK6          SGEGKSTVALNMAYAAALH-EKKVLFIDADLRKQ---TDRRC--LTETEG-KGLYGVVTG
A0A1Y3WEF6      PGEGKSTLAYNLAIAAASH-GVKVLFVDADLRKK---ADRKH--LTEEKG-RGLASVVTG
A0A417T0L2      PGEGKSTLAYNLAIAAASH-GVKVLFIDADLRKQ---ADRKH--LTEEKG-RGLASVVAG
A0A1H9EPU3      PNEGKSVLSLNLAISLAEL-GKRVIFIDADLRKSVLVGRYKI----SKQV-KGLTHYLSG
A0A354IGV3      ENEGKSTIAANLALGLAQR-HSKVLLIDGDLRKP---AVYKLLQLRLQPE-QALSHYLSD
A0A417JMV2      ENEGKSTVAANLALALAEE-SEKVLLIDADLRKP---SQYKIFGLDQEEI-QQFGEVLNG
B0P408          ENEGKSTVAANLALALAEE-SEKVLLIDADLRKP---SQYKIFGLNQEEI-QQFGEVLNG
D4MV82          ENEGKSTVAANLALALAEE-SEKVLLIDADLRKP---SQYKIFGLNQEEI-QQFGEVLNG
A0A415VWX5      ENEGKSTVAANLALALAEE-SEKVLLIDADLRKP---SQYKIFGLDQEEI-QQFGEVLNG
A0A173UY96      ENEGKSTVAANLALALAEE-SEKVLLIDADLRKP---SQYKIFGLDQEEI-QQFGEVLNG
A0A173QTL1      ENEGKSTVAANLALALAEE-SEKVLLIDADLRKP---SQYKIFGLDQEEI-QQFGEVLNG
A0A174A3T7      ENEGKSTVAANLALALAEE-SEKVLLIDADLRKP---SQYKIFGLDQEEI-QQFGEVLNG
A0A174J359      ENEGKSTVAANLALALAEE-SEKVLLIDADLRKP---SQYKIFGLDQEEI-QQFGEVLNG
A0A417UUA3      ENEGKSTVAANLALALAEE-SEKVLLIDADLRKP---SQYKIFGLDQEEI-QQFGEVLNG
A0A1C6EUV9      ENEGKSTVAANLALALAEE-SEKVLLIDADLRKP---SQYKIFGLAPEEV-QEFGEVLNG
A0A173Y645      ENEGKSTVAANLALALAEE-SEKVLLIDADLRKP---SQYKIFGLAPEEV-QEFGEVLNG
A0A374AVY6      ENEGKSTVAANLALALAEE-SEKVLLIDADLRKP---SQYKIFGLAPEEV-QEFGEVLNG
R7BXS4          ENEGKSTVAANLALALAEE-SEKVLLIDADLRKP---SQYKIFGLAPEEV-QEFGEVLNG
A0A143ZUX1      ADEGKSTVAANLAIALAQK-GKKVLLIDVDLRRP---TQHNLFQQTTYRN-KGLSDILTG
S3FFL2          PGEGKSTTALALATMLSRA-QRRVILIDGDMRSP---SVHHLGGVD--HN-RGLSNFLAG
A0A6A8IF17      PGSGKSFLTMNIAVSLAIK-GKKVLVIDGDLRHA---SASSYID-S--PD-KGLSDYLGG
A0A6C0V5C7      PSIGKTFVCANLAAVVSQT-NKRVLLIDCDMRKG---YTHELLGTN--NV-NGLSEILLG
A0A6C0V5F7      QDCGKTLVSTSLASIAAQA-GQRVLFIDADMRKG---YVHNIFKLN--NH-LGLSSVLGG
A0A328M4V1      PGVGKSFVASNLAAVIAQA-GQRVLLIDADMRKG---TLHKIVGGN--PE-RGLSELISG
A0A5C8HCX2      PDSGKTFVSSTLAAVIAQS-DQKVLFIDADLRRG---YSHNLFTVS--NE-HGLSEYLAG
A0A1W1Z4C3      SGEGKSTIAANLAVSLALS-GKKVLLVDGDMRRA---CQSEMFYYD--PNSPGLSDILTS
A0A239QN83      SGEGKSTIAANLAVSLAMS-GKKILLVDADMRRA---CQSEIFYYD--PNASGLADILTG
A0A3R9WAA7      PAEGKSTFAFNLATAMAEL-DRKVILVDCDFRRP---SIMKMLPYS--AGTVCLNDVLKE
A0A1G6BLF1      PEEGKSTVAANIALSLALK-GEKVVIVDMDLRNP---SLADSFALESVK--CGTIDVLKG
R6HZX3          PGEGKTTVSFNLAASLAQS-GKRVILVDADLRHQ---VVKARFGITTPS--AGLLE-LSR
A0A1W2CEA6      ANEGKTFATIQIAIGMTRR-GARVLLIDADLRLS---VMKEKYDIHFGGQPTGLAHLLSG
R7FFK6          PNEGKSVTVANLATAISET-DKTVLLIDADMRKP---VQHKNFQVS--NK-LGLSNVITD
A0A373MPB9      PSEGKSVTVANLAASMAET-ENKVLLIDADMRKP---VQHRNFKLK--NN-VGLSTILSG
A0A373L519      PSEGKSVTVANLAASMAET-ENRVLLIDADMRKP---VQHRNFKLK--NN-VGLSTILSG
A0A373W906      PSEGKSVTVANLAASMAET-ENKVLLIDADMRRP---VQHRNFKLK--NN-VGLSTILSG
A0A373VCW2      PSEGKSVTVANLAASMAET-ENKVLLIDADMRRP---VQHRNFKLK--NN-VGLSTILSG
W0U604          PSEGKSVTVANLAASMAET-ENKVLLIDADMRRP---VQHRNFKLK--NN-VGLSTILSG
A0A374B6G0      PSEGKSVTVANLAASMAET-ENKVLLIDADMRKP---VQHRNFKLK--NN-VGLSTILSG
A0A373VM36      PSEGKSVTVANLAASMAET-ENKVLLIDADMRRP---VQHRNFKLK--NN-VGLSTILSG
A0A1C5P379      PSEGKSVTVANLAASMAET-ENKVLLIDADMRRP---VQHRNFKLK--NN-VGLSTILSG
A0A373XXX0      PSEGKSVTVANLAASMAET-ENKVLLIDADMRRP---VQHRNFKLK--NN-VGLSTILSG
A0A5R9MJM9      PSEGKSVTVANLAASMAET-ENKVLLIDADMRRP---VQHRNFKLK--NN-VGLSTILSG
A0A356CW82      PSEGKSVTVANLAASMAET-ENKVLLIDADMRRP---VQHRNFKLK--NN-VGLSTILSG
R6T4X7          PSEGKSVTVANLAASMAET-ENKVLLIDADMRRP---VQHRNFKLK--NN-VGLSTILSG
A0A374HTV1      PSEGKSVTVANLAASMAET-ENKVLLIDADMRRP---VQHRNFKLK--NN-VGLSTILSG
A0A374GB66      PSEGKSVTVANLAASMAET-ENKVLLIDADMRRP---VQHRNFKLK--NN-VGLSTILSG
A0A374ECC6      PSEGKSVTVANLAASMAET-ENKVLLIDADMRRP---VQHRNFKLK--NN-VGLSTILSG
A0A374BM61      PSEGKSVTVANLAASMAET-ENKVLLIDADMRRP---VQHRNFKLK--NN-VGLSTILSG
A0A373UGZ4      PSEGKSVTVANLAASMAET-ENKVLLIDADMRRP---VQHRNFKLK--NN-VGLSTILSG
A0A373SA66      PSEGKSVTVANLAASMAET-ENKVLLIDADMRRP---VQHRNFKLK--NN-VGLSTILSG
A0A1C5X6X7      PSEGKSVTVANLAASMAET-ENKVLLIDADMRRP---VQHRNFKLK--NN-VGLSTILSG
A0A1C6JIH3      PSEGKSVTVANLAASMAET-ENKVLLIDADMRRP---VQHRNFKLK--NN-VGLSTILSG
A0A373PSC3      PSEGKSVTVANLAASMAET-ENKVLLIDADMRRP---VQHRNFKLK--NN-VGLSTILSG
A0A1K1WYK8      PGEGKSTSAANLAIALAQT-GSAVLLIDADMRKP---VQHRTFKIK--ND-EGLSTLIIK
A0A1H6IUB1      PREGKSTTSSNIAIALAQG-GNKILLIDADMRKA---VQHKVFGLK--NK-KGLSSAISK
A0A1M7L1F9      PREGKSTTSANIAIALAQG-GNKILLIDADMRKA---VQHKIFGLK--NK-KGLSSAISK
A0A1C6B4L6      PSEGKSIISANIAIALAQG-GNKALLIDADMRKA---VQHKIFEIK--NK-KGLSTAISK
A0A1Q6T9P4      PSEGKSIISANIAIALAQG-GNKALLIDADMRKA---VQHKIFEIK--NK-KGLSTAISK
A0A315Y4F9      PGEGKSTTSANIAIAIAQS-GSHVLLIDADMRKS---VQHKIFELV--NK-KGLSTAVSK
A0A354K620      PGEGKSTTSANIAVAIAQS-GSHVLLIDADMRRS---VQHKIFELV--NK-KGLSTAVSK
A0A355G3J9      VSEGKSTFSVNLAITLAKS-GNKVLLIDGDLRKP---KVSLYLDLY--GK-YGLSEYLAN
A0A3D2AD87      AGEGKSTTAANLAVAFSQL-GKTVLLVDADLRRA---SLHKKFKLE--NG-KGLADVLTG
A0A2T5IYJ6      PSEGKSTSAINLAVALAQM--ERVLLIDGDMRKP---TIAKVLGLPP-NS-PGLSNVVAG
A0A3C0QME1      PGEGKSTTASNIAIAFAQM-ESKVLLIDADMRKP---VQHKVFELS--NK-KGLSTAIGH
A0A355FYK5      ENEGKTTVAINIATSLAQK-GKSVLLIDADLRKP---AVLRTIGVKYDDK-SGLIPIIKG
A0A357AQU0      PSEGKSSTTTNIAIAMAMA-NEKVLLIDGDLRKP---VQHKIYNIK--ND-SGLSNIVSK
A0A3C1YJQ7      PSEGKSSTTTNIAIAMAMA-NEKVLLIDGDLRKP---VQHKIYNIK--ND-SGLSNIVSK
A0A3D0JG38      PSEGKSSTTTNIAIAMAMA-NEKVLLIDGDLRKP---VQHKIYNIK--ND-SGLSNIVSK
A0A3C0IHX1      AADGKSLTAANIAMAMAMM-NKKVLFIDADLRKP---VQHQRLKLE--NK-VGLSEVLGH
R5V506          AADGKSLTAANIAMAMAMM-NKKVLFIDADLRKP---VQHQRLKLE--NK-VGLSEVLGH
A0A352TIU5      AADGKSLTAANIAMAMAMM-NKKVLFIDADLRKP---VQHQRLKLE--NK-VGLSEVLGH
A0A3E5FSY5      ANEGKTTLTINLAETFAAN-GKRVLLIDADLRRQ---SIAKILKCDN--N-EGLVDLYLQ
A0A1V5S3C0      ENEGKTTVAVNTALSLAKS-GKSVLLIDCDIRKP---AVYKVLGVPVGGD-KGIYDIVRG
A0A1Y3TC98      AGEGKTTVAVNLAQMLAAD-GSRVLLIDGDLRKH---GSAGLLGVSG--K-YSLKDVAGM
A0A1Q6REE0      PGEGKTTVSVNLAVSLAQK-GRRVLLIDCDFRNP---SVAKTLSSKSHPL-DEGRNLTNF
R5ETF9          PGEGKTTVSVNLAVSLAQK-GRRVLLIDCDFRNP---SVAKTLSSKSHPL-DEGRNLTNF
R6VAT5          TNEGKTTVAANLAIALAKK-HYRTVIIDCDLRNP---TVRQQLNIPESCS-LGIVDVITG
A0A1Q6S448      AAEGKSTLAANTAISLASR-GVSVLFIDLDLRRP---VQSEMLGLSVKQK-NELGTLLTE
A0A351MYR0      AAEGKSTLAANTAISLASR-GVSVLFIDLDLRRP---VQSEMLGLSVKQK-NELGTLLTE
R6HPC1          AAEGKSTLAANTAISLASR-GVSVLFIDLDLRRP---VQSEMLGLPVKQK-NELGTLLSE
A0A3D4G5Z5      AAEGKSTLAANTAISLASR-GVSVLFIDLDLRRP---VQSEMLGLSVKQK-NELGTLLSE
A0A3D5ES03      AAEGKSTLAANTAISLASR-GVSVLFIDLDLRRP---VQSEMLGLSVKQK-NELGTLLSE
A0A0F2P7X6      TGEGKSTVAVNLAITIART-GKSVLLVDCDLRKS---NMHGVLELDLEDH-QGLAAVLNG
A0A359B487      TGEGKSTVAVNLAITIAHT-GKSVLLVDCDLRKS---NMHGVLELDLEDN-QGLAAVLNG
A0A348P5V4      ENEGKTTSATNIALSLAQN-GKSVLLIDADLRKP---SVAKTLGFSASDD-EGICGIVSG
A0A356PT74      ENEGKTTSAVNIALALAQN-GKSVLLVDGDLRKP---AVAKLLGINASED-GGVYGVING
A0A3D5LL19      ENEGKTTSAVNIALALAQN-GKSVLLVDGDLRKP---AVAKLLGINASED-GGVYGVING
R5MNF0          ENEGKTTSAVNIALALAQN-GKSVLLVDGDLRKP---AVAKLLGINASED-GGVYGVING
A0A1Q9JSI0      ENEGKSTVAANLALAMAEE-SAKVLLIDADLRKP---SQYKIFGIDKEEI-KQFGEVLNG
A0A3D5TNI1      ANEGKTTVAVNLSLALAQN-GYSVLLIDADLRKP---SVLKNLGITNISG-NGIADVVGR
A0A358LJD0      ANEGKTTVAVNLSLALAQN-GYSVLLVDADLRKP---SVLKNLGISNLSG-NGIADVVNG
R6I3L7          ANEGKTTVAVNLSLALAQN-GYSVLLVDADLRKP---SVLKNLGISNLSG-NGIADVVNG
A0A3D1HXX0      ANEGKTTVAVNLSLALAQN-GYSVLLVDADLRKP---SVLKNLGISNLSG-NGIADVVNG
A0A3D2QJB8      ANEGKTTVAVNLSLALAQN-GYSVLLVDADLRKP---SVLKNLGISNLSG-NGIADVVNG
D4LC36          PSEGKSVTVANLAVAVAQT-DKKVLLIDADMRKP---VQHKCFRLSN--K-VGLSDVITG
R7MQJ4          PGEGKSTTAANLAITFSQM-EHKVLLIDADMRKP---VQHKIFGLKN--K-KGLSSIIGK
A0A1V5GLC0      PSEGKSTVSANTAIALAQG-GNKVLLVDADMRKS---VQHKIFDLKN--K-KGLSTAVSK
W7V182          PSEGKSTTSANIAIALAQG-GNKVLLIDGDLRKS---CQHKIFGIKN--K-KGLSTAISK
                   **:                  :..* *.*                            

A0A0H5SF45      M-----N-----TEKET--IQYTSYNN------LQIIPCGSI-APNPTELLSSIQMEELI
A0A1M6JRJ5      I-----N-----SLKEC--LYITPYEN------LHMMPMGST-PPNPSELLGSKQMELLI
A0A1M7Y1S2      I-----N-----SLKEC--LYITPYDN------LHIMPMGSI-PPNPSELLGSRQMELLI
A0A3D5R4X5      K-----S-----DYRSS--VKQSRTKN------LDLMFSGLI-PPNPSELLGSKSMLEFI
A0A1I4C3N6      D-----E-----AELNI--QR--SGRG------FDVILAGAK-PSNAADLLAGGKIRELI
A0A3B9CIM7      I-----T-----KELKV--YK--RAEN------LYVAMAGEV-PPNPAELLSGERWSELL
A0A1G9WHW8      I-----N-----KDYEL--FN--YNNN------LDILFAGEI-PPNPMELLSSEKCKNLL
A0A1H5VAA0      I-----N-----KDYDL--FN--YNNN------LDILFAGEI-PPNPMELLSSEKCKNLL
A0A3R6VK11      L-----R-----ETPQI--VE--YRQN------LDVLVGGEN-PPNPSELLGGERMKELL
A0A3R6QUY7      L-----R-----ETPQI--VE--YRQN------LDVLVGGEN-PPNPSELLGGERMKELL
A0A373K3P9      L-----R-----ETPQI--VE--YRQN------LDVLVGGEN-PPNPSELLGGERMKELL
A0A3R6JRU5      L-----R-----ETPQI--VE--YRQN------LDVLVGGEN-PPNPSELLGGERMKELL
A0A1C5MS04      L-----R-----ETPQI--VE--YRQN------LDVLVGGEN-PPNPSELLGGERMKELL
A0A3C1J150      L-----R-----ETPQI--VE--YRQN------LDVLVGGEN-PPNPSELLGGERMKELL
A0A416CXD7      L-----R-----ETPQI--VE--YRQN------LDVLVGGEN-PPNPSELLGGERMKELL
R6XBL9          L-----R-----ETPQI--VE--YRQN------LDVLVGGEN-PPNPSELLGGERMKELL
A0A355W5Z7      L-----R-----ETPQI--VE--YRQN------LDVLVGGEN-PPNPSELLGGERMKELL
A0A143WVN6      Q-----C-----SFEQV---ITEVPNG------LQIICQTRG-LNNSTKYIMSKNMLDFI
W6RXP9          K-----V-----DIMEA---AHKYNKN------LLILTAGKI-PPNPSEMLGSKTMKELL
W6S4G8          Q-----A-----SLKDV---AVGIKET------LLLIPAGRV-SPNPTELLNSKAMELLL
A0A1G6BLB6      K-----I-----SPKNM--IYQKENSN------LHLLLNTVI-YPNSTELLSQGLLERII
A0A1C6G8M0      N-----A-----EVGQV--IYDVGIPN------MHVLFSGKL-VTNASALLSAKWLRTLC
A0A416MP73      N-----A-----ELGQV--IYDVGLPN------MHVLFSGKL-VPNASALLSAKWLENLC
A0A3E4LL92      K-----C-----ELDKVLKRTEVQAHP------IYCLWQKKA-VARPYRLLESERFASLI
A0A415D1L1      K-----C-----ELDQVLKQTEVQAHP------MGCIWQKKA-VAKPYRLLGSERFISLI
A0A414P2K5      K-----C-----ELDQVLKQTEVQAHP------MDCIWQKKA-VAKPYRLLGSERFISLI
V8C417          K-----C-----ELDQVLKQTEVQAHP------MDCIWQKKA-VAKPYRLLGSERFISLI
A0A143XN92      K-----I-----DLKEK--IVRINNSN------LFILFNSQP-LQNSLELMDYSSWKDWI
A0A173ZYY6      N-----G-----SLADV--MVPCTRKH------MLFMGGKNC-YSSSTEMLNSESFFKLM
A0A4Q5EHM9      N-----R-----ALADV--MVPCTRKH------MLFMGGKNC-YSSSTEMLNSDSFYKLM
A0A173SMI2      N-----G-----SLADV--MVPCTRKH------MLFMGGKNC-YSSSTEMLNSESFFKLM
A0A174ASH7      N-----G-----SLADV--MVPCTRKH------MLFMGGKNC-YSSSTEMLNSDSFYKLM
A6BH65          N-----G-----SLADV--MVPCTRKH------MLFMGGKNC-YSSSTEMLNSDSFYKLM
R7G0D7          N-----R-----ALADV--MVPCTRKH------MLFMGGKNC-YSSSTEMLNSDSFYKLM
A0A396G6S7      H-----A-----STEKI--IRNWNNSG------LYMILNKTS-SNAIETLLKSMTLKQII
A0A3E5A223      H-----A-----STEKI--IRNWNNSG------LYMILNKTS-SNAIETLLKSMTLKQII
R7D5E6          H-----A-----STEKI--IRNWNNSG------LYMILNKTS-SNAIETLLKSMTLKQII
A0A415HQH5      H-----A-----STEKI--IRNWNNSG------LYMILNKTS-SNAIETLLKSMTLKQII
A0A414W2C6      H-----A-----STEKI--IRNWNNSG------LYMILNKTS-SNAIETLLKSMTLKQII
A5ZNE7          H-----A-----STEKI--IRNWNNSG------LYMILNKTS-SNAIETLLKSMTLKQII
A0A395X821      H-----A-----STEKI--IRNWNNSG------LYMILNKTS-LNAIETLLKSMTLKQII
A0A1C5PY68      H-----A-----STEKI--IRNWNNSG------LYMILNKTS-SNAIETLLKSMTLKQII
A0A174CJF8      H-----A-----STEKI--IRNWNNSG------LYMILNKTS-SNAIETLLKSMTLKQII
A0A564SRR2      H-----A-----STEKI--IRNWNNSG------LYMILNKTS-SNAIETLLKSMTLKQII
A0A174R7V0      H-----A-----STEKI--IRNWNNSG------LYMILNKTS-SNAIETLLKSMTLKQII
A0A373MWV2      K-----E-----PASSV--FEKYKDTN------VYMGICRER-LEEPSEAVGGEIFRRIL
A0A417CE88      K-----E-----SASSV--FEKYKDTN------VYMGICRER-LEEPSEAVGGKIFRRIL
A0A416Y441      K-----E-----SASSV--FEKYKDTN------VYMGICRER-LEEPSEAVGGEIFRRIL
A0A357GPJ7      K-----E-----SASSV--FEKYKDTN------VYMGICRER-LEEPSEAVGGEIFRRIL
A0A396PAC1      K-----E-----SASSV--FEKYKDTN------VYMGICRER-LEEPSEAVGGEIFRRIL
A0A416EYU4      K-----E-----SASSV--FEKYKDTN------VYMGICRER-LEEPSEAVGGEIFRRIL
A0A416SCQ2      K-----E-----SASSV--FEKYKDTN------VYMGICRER-LEEPSEAVGGEIFRRIL
A0A416TGN7      K-----E-----SASSV--FEKYKDTN------VYMGICRER-LEEPSEAVGGEIFRRIL
A0A417SMF6      K-----E-----SASSV--FEKYKDTN------VYMGICRER-LEEPSEAVGGEIFRRIL
A0A1Y4MW77      S-----D-----VVEDA--IVYLEKQN------LYFLGGNST-IDDLTAVLTNPNMEQFM
R6UHV6          K-----A-----RLSEI--ASYDEINN------ITIMGSNKG-TQQANELITGEKMDYLI
A0A3R9Q621      L-----A-----SETEV--IHSTAYKN------LHVLPMGSK-PPNPAEMLASVHMEELI
A0A069RC75      K-----R-----DYREF--VKETHIEN------LHIMTAGNS-VQNPAELLQSERIRELI
A0A174F2W5      K-----E-----PASSV--FEKYKDTN------VYMGICRER-LEEPSEAVGGEIFRRIL
A0A174S8E9      K-----E-----SASSV--FEKYKDTN------VYMGICRER-LEEPSEAVGGEIFRRIL
A0A416ZL97      K-----E-----SASGV--FEKHKDTN------VYTGICRNR-LEEPSLAIGGEIFHRIL
A0A174LSK1      K-----E-----SASGV--FEKHKDTN------VYTGICRNR-LEEPSLAIGGEIFHRIL
A0A373GY92      K-----E-----SASGV--FEKHKDTN------VYTGICRNR-LEEPSLAIGGEIFHRIL
A0A373NZQ6      K-----E-----SASGV--FEKHKDTN------VYTGICRNR-LEEPSLAIGGEIFHRIL
A0A417I9B9      K-----E-----SASGV--FEKHKDTN------VYTGICRNR-LEEPSLAIGGEIFHRIL
A0A417MP97      K-----E-----SASGV--FEKHKDTN------VYTGICRNR-LEEPSLAIGGEIFHRIL
A0A417WQF8      K-----E-----SASGV--FEKHKDTN------VYTGICRNR-LEEPSLAIGGEIFHRIL
A0A373RZ83      K-----E-----SASGV--FEKHKDTN------VYTGICRNR-LEEPSLAIGGEIFHRIL
A0A416U6I1      K-----E-----SASGV--FEKHKDTN------VYTGICRNR-LEEPSLAIGGEIFHRIL
R7JQZ9          K-----E-----SASGV--FEKHKDTN------VYTGICRNR-LEEPSLAIGGEIFHRIL
A0A3B8KKL6      T-----K-----EDIKAKAIEKTEISN------LDIITSGPV-PPNPYEMLSSNKMQSFV
A0A2K9E6R0      T-----K-----EDIKAKAIEKTEISN------LDIITSGPV-PPNPYEMLSSNKMQSFV
A0A2S8RBI0      T-----K-----EDIKAKAIEKTEISN------LDIITSGPV-PPNPYEMLSSNKMQSFV
A0A0L6JLG6      E-----K-----ELKKSMIQNKEGIEN------LFIIPSGPI-PPNPSEILSSDKMRQLV
G8LSN0          D-----I-----EDKDINVLELKDIPN------LSVITSGPI-PPNPAEILSSNKMQNLL
A0A1M5UYN6      Q-----A-----EFEEV---VHSYDKH------LCVIPSGPM-PPNPAEMLNSIKMKFFI
A0A176JBT8      F-----S-----SSDEI--IQSTAIPK------LSFISAGPI-SPNPHELIISKKMDLLI
A0A1I5HIC6      M-----S-----TLEEV--IHKTNVEN------VDIIFTGIL-PPHPSEMLGNEEFKDLV
A0A1Y3TC51      E-----A-----DWKDA--AFYNKRSD------IWELFQFRA-VREPARILREEKLEGLA
A0A1Y3T1N0      K-----A-----SWKEN--LYYNKAAG------IWELFQFSG-AKDPAAVFAEAPMKTLA
A0A1Y3Y8U8      K-----A-----SWKEN--LYYNKAAG------IWELFQFSG-AKDPAAVFAEAPMKTLA
A0A5B0BQY5      F-----Y-----ELDTI--IQETGIEN------LSFIGTGPL-PLNPVKFILADGMDKLL
A6CLL4          I-----T-----PLNEI--IQRTDIPK------LFFISAGPL-PPNPTELLSSDRLSSMI
A0A174DL89      Q-----A-----ELEEC--LQSSGINN------LSILTAGVI-PPNPSELISSNGMKILL
A0A176U8D6      N-----A-----ELGQV--IYDVGLPN------MHVLFSGKL-VPNASALLSAKWLENLC
A0A1Q6KSQ5      N-----A-----EVGQV--IYDVGIPN------MHVLFSGKL-VTNASALLSAKWLRTLC
A0A3D3U8B3      N-----A-----EVGQV--IYDVGIPN------MHVLFSGKL-VTNASALLSAKWLRTLC
A0A3E5FRL7      K-----T-----TLKES--IYFNKKSN------IYELFLYHA-IDDPSKLMNAVTLKKIM
A0A1Y4QK93      K-----K-----SLKDS--IYFNKKSN------IYELFLYHA-IDDPSKLMNVVTLKKIM
B1C232          K-----A-----TLKES--IYFNKKSN------IYELFLYHA-VDDPSKLMDVITLKKII
A0A401USI6      E-----R-----KIEEI---SIGIDDK------FDVLTAGKA-NYNPSELLSSQKMKDFI
A0A1V4IQ10      K-----E-----SLDKV---IQKHNEN------LYLMSSGKF-TGKPASMLASQEMDNIL
A0A1S8TRD2      R-----D-----SLDNV---IQKHNKN------LYVISSGKF-TEKPASMLASQTMDDIL
G7M1U2          R-----D-----SLDNV---IQKHNKN------LYVISSGKF-TEKPASMLASQTMDDIL
A0A2T6KJ75      Q-----C-----TLHEI--IQSTEVPN------LSFISAGPV-PPNPTELLSSTKFVQLL
A9KN92          M-----N-----SLEEV--IHKSNVEN------RDIIFTGIL-PPNPSEMLGSEEFKNLV
A0A352MUJ1      R-----IEDYENELPKY--VQPTELDN------LCVLPCGSI-TYDSSELLLSNRIIKTV
R5YI67          S-----SENLEEELQKC--IQPTELDN------LCVLTCGSI-TYDSSELLLSNKIIKAV
A0A1Y0IQP5      E-----T-----PLEDV---IVPSAAG------PDVITAGAI-PSNPSELLGSPKLRAAL
A0A4R2R7B1      G-----V-----APEEV---ILPSAAG------PDVIPAGAI-PANPSELLGSPKLRGLL
A0A1M6E8I2      G-----R-----NIDDY--INRMYNLD------IDVMTSGKL-PGNPSELLQSNVMKKMV
A0A1Y4N105      N-----C-----KYEDI----ITYQNN------LAIISQKDS-KKNSSNYFLTAQFTQFI
A0A1Y4QP75      N-----C-----KYEDI----ITYQNN------LAIISQKDS-KKNSSNYFLTTQFAQFI
A0A3D4QRB5      E-----A-----EPSSI--VNSGGISN------LHIISAGPK-PPNPSELLGSTRMQAFL
A0A349DEH5      N-----A-----TLNQA--IKLVNNFN------VCILADQKS-VPNPSELLSTDKMEAII
A0A3D4T7B4      N-----A-----TLNQA--IKLVNNFN------VCILADQKS-VPNPSELLSTDKMEAII
A0A350XYC7      K-----V-----ELNKA--IKSVNTFN------VCVLADQNG-VNNPSELLSTEKMEHII
R6DNR8          K-----A-----DLGKA--IKSVNSFN------VCVLADQKG-VNNPSELLSTEKMESII
A0A355KUM5      N-----V-----ELNQA--IKRVTSFN------VCVLADQKG-VNNPSELLSTEKMESII
R5YGY6          N-----V-----ELNQA--IKRVTSFN------VCVLADQKG-VNNPSELLSTEKMESII
A0A0K8J554      M-----K-----TDEEV--VQDTDYEN------LQLIACGTI-APNPTELLSSIQMEELL
A0A3N1XSX6      M-----A-----ELTNV--IRKTSYEN------LNIITIGSI-SPNPSELLSSSHMEELI
A0A1C6G0U3      N-----I-----HISEC----INTVSG------LNIITSGTK-PINPSDILASKKMINFI
A0A3D4LLB3      K-----D-----DYKAY---LQNIYPG------LDVLTTGMI-PANPAEIINSRALKELI
A0A0A5GPA9      Y-----A-----SIDEV--VSRTDIPH------LSYVAKGPM-PKNPAEVLSSDKINTML
A0A271M6M4      M-----A-----TIEEI--IVKTNVSN------LSFIGTGPL-SANPAELLSSEKIDIML
A0A2V3W8U6      N-----R-----SVQDI--LLDTFTPN------LQSITCGPI-PPNPAELLSSERMDQLL
W1UFG0          K-----K-----DIKNS--IEKVN-DK------FDILFTGKI-PQNPTEILASKKMKNLI
A0A351SRI8      D-----V-----AQVYRTYINESDVPN------LYLMFKGVT-PPNPSELLNSDKNKKLV
A0A1V5LU59      D-----K-----GNNKVKPTKIEGISN------LDIIPSGPI-PPNPAELLSSKRMNQLL
A0A1E3BVC3      S-----K-----EDIKVKPTEKSDISN------LYIITSGPI-PPNPAEMLNSNRMKKLL
A0A4Q0I6S0      S-----K-----EDIKVKPTEKSDISN------LYIITSGPI-PPNPAEMLNSNRMKKLL
A3DF66          S-----K-----EEVKIKTTERSDISN------LYIITSGPI-PPNPAEMLNSNRMKSLL
W4V1T8          S-----K-----EEIKIKTTEKSDISN------LYIITSGPI-PPNPAEMLNSNRMKSLL
A0A1I0RG99      T-----M-----DVKKS--IYKTSYDN------LYVMPMGTI-PPNPSELLASIQMEELL
A0A1I5G322      M-----I-----DIENA--IQKTTYDN------LYVLPLGTI-PPNPSELMASSQMEELL
A0A1C6ITD7      Q-----A-----ELEEC--LQSSGIEN------LSILTAGVI-PPNPSELISSNGMKMLL
A0A381IX63      N-----K-----TFNQC--VQNTEVKN------LKVLTTGNI-PNNPAEILNSNRMRSFV
A0A1G9IUT4      K-----V-----NLKDC--VHEISSEN------LNVLTCGSI-PSNPSELLSSHKMQKLL
A0A1M6RWV2      E-----------KLEDV--IHTVGGLK------LDIITTGPI-PPNPSEILGSNAMKKFI
A0A143XPI5      K-----LS-WKSALISE--Q----ETG------LQLLAGTYR-RDNSAKLMESTYMEQLL
A0A355G1X5      K-----TD-LSDAIKYV--E----KYK------LFILSSIEP-NSEPTEILASQQMNKII
A0A0M6WXE3      R-----TG-ANNILLNT--E----RKR------LGFIGGKVS-YSASTEMLGNRQLPVLI
A0A348SAK2      R-----ID-ANHILLNT--E----RKR------LGFIGGKVS-YSASTEMLGNRQLPVLI
A0A1G9H5B9      R-----CQ-WQNVIMKD--V----AQK------VDLLPAGHL-PPNPAELLESARMQQLL
R5EFZ0          K-----EN-LSECFLRY--Q----NSD------MYMLLAKRG-EQNTGDLLISPRMNALL
A0A1Y4H8L0      G-----RF-SDEIITKT--D----IGG------LYFMGGRNC-YSMSTDMLQSGNIEKLL
A0A4B9BMD9      K-----DE-LNKVIQHF--G----KGG------FDVITRGQV-PPNPSELLMRDRMRQLL
A0A0M6WYQ8      K-----VK-ISEAMTTV--ELEKCPGS------LQILYGKTT-EGSSSDLLESKQMERLI
A0A348SAK1      K-----VK-ISEAMTTV--ELEKCPGS------LQILYGGTK-EGSSSDLLESKQMERLI
A0A252F281      T-----CS-VDKIIQTN--A----EVN------LYEMFGKNY-YSDSVELLGSARMKKLL
A0A1Y4QKE6      K-----GD-VLKNIRKL--D----DSK------LWFIGNDNP-VDNPVSVLSHPDLKEFI
B1C231          K-----GD-VLKNIRKL--D----NSK------FWFIGNDKP-INNPVSVLSHPDFKKFI
A0A1Y3TUL5      D-----AS-PEDVITHL--T----G----------YLDLLPS-ILEPKEIPLSDALLTLI
A0A1Y4JAX2      D-----AS-PEDVITHL--T----G----------YLDLLPS-ILEPKEIPLSDALLTLI
A0A1Y4T590      D-----AS-PEDVITHL--T----G----------YLDLLPS-ILEPKEIPLSDALLTLI
R5B467          T-----AK-PGQIVTAL--G----KDK------PDVIFAGRR-AGAQTEQLGSAAFHTLL
A0A1Y3T163      E-----KT-IREGLRKL--K----KSG------IWFLGSRRI-VKQPASVLSSPRTGELI
A0A1Y3YCA2      E-----KT-IREGLRKL--K----KSG------IWFLGSRRT-VKQPASVLSSPRTGELI
A0A1Y4L6N9      E-----CT-VKDAIFHD--E----ESG------VYFLGGKEP-IKEVTQTLNSSNLLDVM
A0A173T644      K-----CS-LEKAVEKD--G----RSG------ISFLCGSLP-VRNVPAVLNRPEFQETL
A0A1C5TSB8      K-----CS-LEKAVEKD--G----RSG------ISFLCGSLP-VRNVPAVLNRPEFQETL
C0CIK6          K-----CS-LEKAVEKD--G----RSG------ISFLCGSLP-VRNVPAVLNRPEFQETL
A0A1Y3WEF6      K-----CS-LQEAVYRE--E----ETG------VDFLGGSKP-VKGVQQILNHSSFHEVI
A0A417T0L2      K-----CT-LKEAVYRE--K----ETG------VDFLGGNKP-VKGVQQILNHSHFHEVM
A0A1H9EPU3      V-----NS-FDEVVCET--N----VKN------LHMVFSGIV-PPNPAELLESVYFRELV
A0A354IGV3      DSVRLSDF-VSSAVMQE--E----KTG------LYVIAGDHS-VPMSSELVSSARMQALL
A0A417JMV2      N-----EQ-IDNLVTDL--P----KSE------LLLIAGSMI-YPNSTEMIASPIFQKIV
B0P408          N-----EQ-IDNLVTDL--P----KSE------LLLIAGSMI-YPNSTEMIASPIFQKIV
D4MV82          N-----EQ-IDNLVTDL--P----KSE------LLLIAGSMI-YPNSTEMIASPIFQKIV
A0A415VWX5      N-----EQ-IDNLVTDL--P----KSE------LLLIAGSMI-YPNSTEMIASPIFQKIV
A0A173UY96      N-----EQ-IDNLVTDL--P----KSE------LLLIAGSMI-YPNSTEMIASPIFQKIV
A0A173QTL1      N-----EQ-IDNLVTDL--P----KSE------LLLIAGSMI-YPNSTEMIASPIFQKIV
A0A174A3T7      N-----EQ-IDNLVTDL--P----KSE------LLLIAGSMI-YPNSTEMIASPIFQKIV
A0A174J359      N-----EQ-IDNLVTDL--P----KSE------LLLIAGSMI-YPNSTEMIASPIFQKIV
A0A417UUA3      N-----EQ-IDNLVTDL--P----KSE------LLLIAGSMI-YPNSTEMIASPIFQKIV
A0A1C6EUV9      N-----EK-ADHLVHAL--A----KSE------LLLVTGTMI-YPNSTEMIASDMFYKIV
A0A173Y645      N-----EK-SDHLVHAL--A----KSE------LLLVTGTMI-YPNSTEMIASDMFYKIV
A0A374AVY6      N-----EK-SDHLVHAL--A----KSE------LLLVTGTMI-YPNSTEMIASDMFYKIV
R7BXS4          N-----EK-SDHLVHAL--A----KSE------LLLVTGTMI-YPNSTEMIASDMFYKIV
A0A143ZUX1      S-----VY-PMDAIHHN---EK---YG------VYILYSGKP-TDQASELLGNDLMNEFF
S3FFL2          E-----ND-IASLTFSM---SE---LN------FTAMSAGPI-PPNAAELLTGDRFGVLL
A0A6A8IF17      R-----IDNLDEIIVPD--PKH---KS------MDILPVGTI-PPNPTELLFDERLKQTI
A0A6C0V5C7      Q-----GE-ISQSAKPT---SI---PR------FDLIPRGQI-PPNPSELLMSERFSQLI
A0A6C0V5F7      N-----VE-WQDAVQRF---EK---GG------FDVLTCGPR-PSHPVDLLMSERFQAVM
A0A328M4V1      Q-----AE-LPEVLRNV--DGI---SK------LFFISRGKI-PPNPSELLMHARFTSLL
A0A5C8HCX2      K-----DE-LNKVIQHF---GK---GG------FDVITRGQV-PPNPSELLMRDRMRQLL
A0A1W1Z4C3      N-----IK-VEQAILNS---TW---DN------LDVLPAGAV-PTNPCELLESPAMQELL
A0A239QN83      S-----TT-AKKAIVST---VW---EN------LDILPAGSM-PSNPCELLESPTMAKLI
A0A3R9WAA7      K-----EK-LTDAIRYY---DE---YK------IAVLACSKQ-LEESSEILGKRAIGSIL
A0A1G6BLF1      R-----KE-IQDALVQY---KD---TS------LEILPGGKA-ISKTSRVLSSEKVGNLI
R6HZX3          A-----AK-PDIARVLI---PVPGVAN------LSLLAGDTR-MTSPMGILDSPKMRSLL
A0A1W2CEA6      Q-----CA-LEDAIYHT---NI---PG------LDLLPDGAS-IKTPLALLTSAEFDSLM
R7FFK6          A-----SL-LDEALHQN---VT---GT------LDLLTAGTI-PPNPSELLASKQMAELL
A0A373MPB9      E-----ST-FDKCVHET---KN---GN------FAVLTSGVL-PPNPSELLASEKMRELL
A0A373L519      E-----ST-FDKCVHET---KN---GN------FAVLTSGVL-PPNPSELLASEKMRELL
A0A373W906      E-----ST-FDKCVHET---KN---GN------FAVLTSGVL-PPNPSELLASEKMRELL
A0A373VCW2      E-----ST-FDKCVHET---KN---GN------FAVLTSGVL-PPNPSELLASEKMRELL
W0U604          E-----ST-FDKCVHET---KN---GN------FAVLTSGVL-PPNPSELLASEKMRELL
A0A374B6G0      E-----ST-FDKCVHET---KN---GN------FAVLTSGVL-PPNPSELLASEKMRELL
A0A373VM36      E-----ST-FDKCVHET---KN---GN------FAVLTSGVL-PPNPSELLASEKMRELL
A0A1C5P379      E-----ST-FDKCVHET---KN---GN------FAVLTSGVL-PPNPSELLASEKMRELL
A0A373XXX0      E-----ST-FDKCVHET---KN---GN------FAVLTSGVL-PPNPSELLASEKMRELL
A0A5R9MJM9      E-----ST-FDKCVHET---KN---GN------FAVLTSGVL-PPNPSELLASEKMRELL
A0A356CW82      E-----ST-FDKCVHET---KN---GN------FAVLTSGVL-PPNPSELLASEKMRELL
R6T4X7          E-----ST-FDKCVHET---KN---GN------FAVLTSGVL-PPNPSELLASEKMRELL
A0A374HTV1      E-----ST-FDKCVHET---KN---GN------FAVLTSGVL-PPNPSELLASEKMRELL
A0A374GB66      E-----ST-FDKCVHET---KN---GN------FAVLTSGVL-PPNPSELLASEKMRELL
A0A374ECC6      E-----ST-FDKCVHET---KN---GN------FAVLTSGVL-PPNPSELLASEKMRELL
A0A374BM61      E-----ST-FDKCVHET---KN---GN------FAVLTSGVL-PPNPSELLASEKMRELL
A0A373UGZ4      E-----ST-FDKCVHET---KN---GN------FAVLTSGVL-PPNPSELLASEKMRELL
A0A373SA66      E-----ST-FDKCVHET---KN---GN------FAVLTSGVL-PPNPSELLASEKMRELL
A0A1C5X6X7      E-----ST-FDKCVHET---KN---GN------FAVLTSGVL-PPNPSELLASEKMRELL
A0A1C6JIH3      E-----ST-FDKCVHET---KN---GN------FAVLTSGVL-PPNPSELLASEKMRELL
A0A373PSC3      E-----ST-FDKCVHET---KN---GN------FAVLTSGVL-PPNPSELLASEKMRELL
A0A1K1WYK8      K-----SS-MAKSVKSN---VI---NN------LDLLPSGPL-PPNPSELLASENFKKLL
A0A1H6IUB1      M-----CS-LEECIHKN---VM---EN------LDVMTAGPV-PPNPSELLASDNMGAIL
A0A1M7L1F9      M-----SK-LEECIQKD---VM---EN------LDVMTAGPV-PPNPSELLASDNMGAIL
A0A1C6B4L6      M-----NK-LDECIQKN---VM---EN------LDVMTSGPL-PPNPSELLASENMLAIL
A0A1Q6T9P4      M-----NK-LDECIQKN---VM---EN------LDVMTSGPL-PPNPSELLASENMLAIL
A0A315Y4F9      M-----HT-PDECIQKN---VM---EN------LDVMTAGPI-PPNPSELLASEMMEQML
A0A354K620      M-----HS-PDKCIQKN---VM---EN------LDIMTAGPI-PPNPSELLASDTMEQML
A0A355G3J9      L-----TD-ELCPMNYS---EN-----------LDVITSGKC-TSYAADLLSTTRAKESI
A0A3D2AD87      T-----AT-LDEAIVTI---K----PG------LNILTAGFI-PPNPSELLDSVNFEETM
A0A2T5IYJ6      T-----SV-LDDCILHV---ED---AN------IDVLTAGLV-PPNPLELLSSQKFMDLI
A0A3C0QME1      M-----NP-LEESVHKG---VY---KH------LDVMPSGPI-PPNPSEMLASQQFSDIL
A0A355FYK5      E-----ST-YQESIKYV---KS---LG------LFILPSGGI-TQKSSEVLDADKVRHVI
A0A357AQU0      Q-----KK-FDAVVHKA---VY---KDKDCDGFVDLLTAGTI-PPNPSEILASEALKNLI
A0A3C1YJQ7      Q-----KK-FDAVVHKA---VY---KDKDCDGFVDLLTAGTI-PPNPSEILASEALKNLI
A0A3D0JG38      Q-----KK-FDAVVHKA---VY---KDKDCDGFVDLLTAGTI-PPNPSEILASEALKNLI
A0A3C0IHX1      M-----TT-WQVARHLA---PL---PN------MDVLTAGTC-PPNPSELLASPAMKKLL
R5V506          M-----TT-WQVARHLA---PL---PN------MDVLTAGTC-PPNPSELLASPAMKKLL
A0A352TIU5      M-----TT-WQVARHLA---PL---PN------MDVLTAGTC-PPNPSELLASPAMKKLL
A0A3E5FSY5      K-----GD-VLKNIRKL---DN---SK------FWFIGNDKP-INNPVSVLSHPDFKKFI
A0A1V5S3C0      K-----ST-FEEAIKYV---EK---YN------MYLLISGEP-VSDPSEVLASSITQETI
A0A1Y3TC98      D-----TK-KVKAGELL---ERIPGST------MWLLGNNEV-VKQPAPVLSSRMVKLFI
A0A1Q6REE0      T-----GS-GEAAGALA---QATDVEG------LFVIVGNADGKADYFDAPTQARLTKLI
R5ETF9          T-----GS-GEAAGALA---QATDVEG------LFVIVGNADGKADYFDVPTQARLTKLI
R6VAT5          T-----CS-LQDAIVKT---KK---NG------LYVLPGTIP-VNNASELMGSKQLADLV
A0A1Q6S448      S-----AA-PEKILAAA---VTDPATG------LHSLLSTKS-YTDVIELLASDQLAKVV
A0A351MYR0      S-----AA-PEKILSAV---VTDPATG------LHSLLSTKS-YTDVIELLASAQLAKVV
R6HPC1          S-----AA-PEKILSAA---VTDPSTG------LHSLLSTKS-YTDVIELLASDQLAKVV
A0A3D4G5Z5      S-----AA-PEKILSAA---VTDPSTG------LHSLLSTKS-YTDVIELLASDQLAKVV
A0A3D5ES03      S-----AD-PEKILSAA---VTDPSTG------LHSLLSTKS-YTDVIELLASDQLAKVV
A0A0F2P7X6      A-----CA-AEEGIVFA---AE---QG------IYVMPNGYI-VPNPSELLGSEKMAALL
A0A359B487      A-----CA-AEECIVFA---TE---QG------IHVMPNGYI-VPNPSELLGSEKMAALL
A0A348P5V4      K-----KT-LKESIKYS---EK---YQ------LFVLVSGVA-VENSTEILSSPKMEEIV
A0A356PT74      E-----KT-LAEAIKYS---EK---YN------LFLLVSGKP-VFDPSELLSTDAMSDII
A0A3D5LL19      E-----KT-LAEAIKYS---EK---YN------LFLLVSGKP-VFDPSELLSTDAMSDII
R5MNF0          E-----KT-LAEAIKYS---EK---YN------LFLLVSGKP-VFDPSELLSTDAMSDII
A0A1Q9JSI0      N-----EN-AENLVLPI---AN---SD------LLLVADSMI-YPNSTEMIARPLFQKVL
A0A3D5TNI1      V-----KN-SSDAIKYI---EK---YK------IFVLAGDEC-IADPTEVLSNAKTGEFI
A0A358LJD0      A-----KN-SSDAIKYI---EK---YK------IFVLAGDES-IADPTEVLSNAKTGEFL
R6I3L7          E-----KN-SSDAIKYI---EK---YK------MFVLAGDES-ITDPTEMLSNAKTGEFI
A0A3D1HXX0      A-----KN-SSDAIKYI---EK---YK------IFVLAGDES-ITDPTEVLSNAKTGEFI
A0A3D2QJB8      A-----KN-SSDAIKYI---EK---YK------IFVLAGDES-ITDPTEVLSNAKTGEFI
D4LC36          D-----KP-LDKALNRN---VT---GS------LDVLTSGTI-PPNPSELLASRQMKELL
R7MQJ4          M-----NK-FDECVNKN---VV---KS------LDILTSGTK-PANPSELLASEQAAELL
A0A1V5GLC0      M-----NS-VEECIIRN---VE---DN------LDVMCAGPI-PPNPSELLASENMSQML
W7V182          M-----AA-LDECISKD---VM---ED------LDIMTAGPI-PPNPSELLASSNMENIL
                                                                            

A0A0H5SF45      KKLEQNYDYIIIDTAPVNLVADALSLAKMVDGVLMVVREKSTTYPHVETALNKY-ELIGG
A0A1M6JRJ5      KELETEYDYIVLDTPPVNVVADSLSFIKSTDGAILVTRENKTTYSDIDNALMKY-HYAKA
A0A1M7Y1S2      KELEAEYDYIILDTPPINIVADSLSFIKSTDGAILVVRENKTTYTDIDNALMKY-RYARA
A0A3D5R4X5      EKVKEEYDYVIFDTPPVALVTDAAILANEVDGVILVTSFGMVDYQIAKRAVELL-KNANA
A0A1I4C3N6      NAQKENYDMIIVDLAPAGRVIDGLELADCLTSYVLVVREMVTKFEREEMIIRNI-EELKG
A0A3B9CIM7      EKCKEEYDCIFVDLPPAGIVADALVLAATATAYILVVREGVTKFDREQMVVQML-EPVGA
A0A1G9WHW8      ESLKETYDVIFIDFPPVGEVADALALADSVTSFVLVVRENHTKFDKEENVIRTI-EPLGA
A0A1H5VAA0      ESLKETYDVIFIDFPPVGEVADALALADSVTSFVLVVRENHTKFDKEENVIRTI-EPLGA
A0A3R6VK11      TTLRSRYDCIIIDLPPVGIVTDALLLSHEVTAYLLVVRAGVSHMSREKSAVTLL-EQVDA
A0A3R6QUY7      TTLRSRYDCIIIDLPPVGIVTDALLLSHEVTAYLLVVRAGVSHMSREKAAVTLL-EQVDA
A0A373K3P9      TTLRSRYDCIIIDLPPVGIVTDALLLSHEVTAYLLVVRAGVSHMSREKSAVTLL-EQVDA
A0A3R6JRU5      TTLRSRYDCIIIDLPPVGIVTDALLLSHEVTAYLLVVRAGVSHMSREKSAVTLL-EQVDA
A0A1C5MS04      TTLRSRYDCIIIDLPPVGIVTDALLLSHEVTAYLLVVRAGVSHMSREKSAVTLL-EQVDA
A0A3C1J150      TTLRSRYDCIIIDLPPVGIVTDALLLSHEVTAYLLVVRAGVSHMSREKSAVTLL-EQVDA
A0A416CXD7      TTLRSRYDCIIIDLPPVGIVTDALLLSHEVTAYLLVVRAGVSHMSREKSAVTLL-EQVDA
R6XBL9          TTLRSRYDCIIIDLPPVGIVTDALLLSHEVTAYLLVVRAGVSHMSREKSAVTLL-EQVDA
A0A355W5Z7      TTLRSRYDCIIIDLPPVGIVTDALLLSHEVTAYLLVVRAGVSHMSREKAAVTLL-EQVDA
A0A143WVN6      LKCRENYDLIVLDTPPIGAGVDVEAILNYGDTSIMTVRQDWSEIGAINDFSDLL-KQNDK
W6RXP9          DRLKEVVDYIILDTPPVQAVADAQILSTRADGTLLVIKAGETKKEATENAINLL-NKVNA
W6S4G8          EELKETCDYVILDTAPVEAVADAQILSAKADGTLVVIKSGDTRINVIQDALNLL-NKVRG
A0A1G6BLB6      GELKREYDYIIIDCSPMALVADAEEMLNMVDNTLLVVRQHYANVRDINDAIDII-NSRKE
A0A1C6G8M0      DSVKDSYDYIIFDTPPVGVVGDAAIVSSVCDGTLLVIENGVTKKKTLCQIAAEL-EKIDT
A0A416MP73      AEVRDSYDYVIFDTPPICVVGDAAIVASFCDGALLVIENGVTKKKTLAQMKFEM-DKVGA
A0A3E4LL92      HQLKEQFDYVVMDTPPLELIRDAEIISETADAMLMVMCQDEVHAVAVNDAVDLL-EENGV
A0A415D1L1      DQLKEQFDYVVMDTPPLELIRDAEIISETADAMLMVMRQDEVHAVAVNDTVDLL-EENGV
A0A414P2K5      NQLKEQFDYVVMDTPPLELIRDAEIISETADAMLMVMRQDEVHAVAVNDTVDLL-EENGV
V8C417          NQLKEQFDYVVMDTPPLELIRDAEIISETADAMLMVMRQDEVHAVAVNDTVDLL-EENGV
A0A143XN92      KKMEQEMDYILIDTSPVALTSDGESLAHIIKDTILVVRYDTMLAADLNEVADTL-NEAGS
A0A173ZYY6      AACRKFVDYVIIDTPPAGIIGDAQIFAHCADAVMIVSKQNYMLAEDINEVMDDF-RDKEG
A0A4Q5EHM9      TACRKFVDYVIIDTPPAGIIGDAQIFAHCADAVMIVSKQNYMLAEDINEVMDAF-RDKEG
A0A173SMI2      AASRKFVDYVIIDTPPAGIIGDAQIFAHCADAVMIVAKQNYMLAEDINEVMDAF-RDKEG
A0A174ASH7      TACRKFVDYVIIDTPPAGIIGDAQIFAHCADAVMIVAKQNYMLAEDINEVMDAF-RDKEG
A6BH65          TACRKFVDYVIIDTPPAGIIGDAQIFAHCADAVMIVAKQNYMLAEDINEVMDAF-RDKEG
R7G0D7          TACRKFVDYVIIDTPPAGIIGDAQIFAHCADAVMIVSKQNYMLAEDINEVMDAF-RDKEG
A0A396G6S7      AFCREKMDYVVIDTSPLALVADTEELAQMTDASVLVVRQDTVLTKDINDAIDIL-NNTRG
A0A3E5A223      AFCREKMDYVVIDTSPLALVADTEELAQMTDASVLVVRQDTVLTKDINDAIDIL-NNTRG
R7D5E6          AFCREKMDYVVIDTSPLALVADTEELAQMTDASVLVVRQDTVLTKDINDAIDIL-NNTRG
A0A415HQH5      AFCREKMDYVVIDTSPLALVADTEELAQMTDASVLVVRQDTVLTKDINDAIDIL-NNTRG
A0A414W2C6      AFCREKMDYVVIDTSPLALVADTEELAQMTDASVLVVRQDTVLTKDINDAIDIL-NNTRG
A5ZNE7          AFCREKMDYVVIDTSPLALVADTEELAQMTDASVLVVRQDTVLTKDINDAIDIL-NNTRG
A0A395X821      AFCREKMDYVVIDTSPLALVADTEELAQMTDASVLVVRQDTVLTKDINDAIDIL-NNTRG
A0A1C5PY68      AFCREKMDYVVIDTSPLALVADTEELAQMTDASVLVVRQDTVLTKDINDAIDIL-NNTRG
A0A174CJF8      AFCREKMDYVVIDTSPLALVADTEELAQMTDASVLVVRQDTVLTKDINDAIDIL-NNTRG
A0A564SRR2      AFCREKMDYVVIDTSPLALVADTEELAQMTDASVLVVRQDTVLTKDINDAIDIL-NNTRG
A0A174R7V0      AFCREKMDYVVIDTSPLALVADTEELAQMTDASVLVVRQDTVLTKDINDAIDIL-NNTRG
A0A373MWV2      DMCRTNMDYIILDTPPMGAAADAEELVELADGAVLAVRQDGVLTRDINDAIDAL-NQKEE
A0A417CE88      DTCRTNMDYIILDTPPMGAAADAEELVELADGAVLAVRQDGVLTRDINDAIDAL-NQKEE
A0A416Y441      DTCRTNMDYIILDTPPMGAAADAEELVELADGAVLAVRQDGVLTRDINDAIDAL-NQKEE
A0A357GPJ7      DTCRTNMDYIILDTPPMGAAADAEELVELADGAVLAVRQDGVLTRDINDAIDAL-NQKEE
A0A396PAC1      DTCRTNMDYIILDTPPMGAAADAEELVELADGAVLAVRQDGVLTRDINDAIDAL-NQKEE
A0A416EYU4      DTCRTNMDYIILDTPPMGAAADAEELVELADGAVLAVRQDGVLTRDINDAIDAL-NQKEE
A0A416SCQ2      DTCRTNMDYIILDTPPMGAAADAEELVELADGAVLAVRQDGVLTRDINDAIDAL-NQKEE
A0A416TGN7      DTCRTNMDYIILDTPPMGAAADAEELVELADGAVLAVRQDGVLTRDINDAIDAL-NQKEE
A0A417SMF6      DTCRTNMDYIILDTPPMGAAADAEELVELADGAVLAVRQDGVLTRDINDAIDAL-NQKEE
A0A1Y4MW77      NDMRQKMDYIIFDAPPCEAFEDVFLLEKYGDAFVYVIKQDFVQRPRIVDCIGTL-ADSEL
R6UHV6          SAAREQYDYIIIDTPPLCFVSDAEDILTLSDSSLIVVRRNVANALSINDTIDII-LASGV
A0A3R9Q621      AKLAKSYDYIIIDTPPINVVSDVIGLVKLVDGMLIVVRQAVTSHPNIAGALSKY-ELVNA
A0A069RC75      RKIENDYDYIIVDTPPATAVTDASIVSTFSDAAVIVCSSGIVDIDELKRAKAQL-EGVNA
A0A174F2W5      DMCRTNMDYIILDTPPMGAAADAEELVELADGAVLAVRQDGVLTRDINDAIDAL-NQKEE
A0A174S8E9      DTCRTNMDYIILDTPPMGAAADAEELVELADGAVLAVRQDGVLTRDINDAIDAL-NQKEE
A0A416ZL97      ETCRTNMDYIILDTPPMGMTADAEELAEYADAAVLSVRQDGALTRDINDAIDAL-NQKEE
A0A174LSK1      ETCRTNMDYIILDTPPMGMTADAEELAEYADAAVLSVRQDGVLTRDINDAIDAL-NQKEE
A0A373GY92      ETCRTNMDYIILDTPPMGMTADAEELAEYADAAVLSVRQDGVLTRDINDAIDAL-NQKEE
A0A373NZQ6      ETCRTNMDYIILDTPPMGMTADAEELAEYADAAVLSVRQDGVLTRDINDAIDAL-NQKEE
A0A417I9B9      ETCRTNMDYIILDTPPMGMTADAEELAEYADAAVLSVRQDGVLTRDINDAIDAL-NQKEE
A0A417MP97      ETCRTNMDYIILDTPPMGMTADAEELAEYADAAVLSVRQDGVLTRDINDAIDAL-NQKEE
A0A417WQF8      ETCRTNMDYIILDTPPMGMTADAEELAEYADAAVLSVRQDGVLTRDINDAIDAL-NQKEE
A0A373RZ83      ETCRTNMDYIILDTPPMGMTADAEELAEYADAAVLSVRQDGALTRDINDAIDAL-NQKEE
A0A416U6I1      ETCRTNMDYIILDTPPMGMTADAEELAEYADAAVLSVRQDGALTRDINDAIDAL-NQKEE
R7JQZ9          ETCRTNMDYIILDTPPMGMTADAEELAEYADAAVLSVRQDGALTRDINDAIDAL-NQKEE
A0A3B8KKL6      EKVKGEYDIVIFDTPPVGQVTDAAILAGLADGTILVLACAGTRIDMAKRACKAL-EGVNA
A0A2K9E6R0      EKVKGEYDIVIFDTPPVGQVTDAAILAGLADGTILVLACAGTRIDMAKRACKAL-EGVNA
A0A2S8RBI0      EKVKGEYDIVIFDTPPVGQVTDAAILAGLADGTILVLACAGTRIDMAKRACKAL-EGVNA
A0A0L6JLG6      EKLKSEYDVIFIDTPPVGQVTDAAILTGIADGSIVVVAGGQTRIDMAKRAKKAL-TAINA
G8LSN0          EDLRGNYDFILLDTPPVGQVTDAAILAGIADGTIMVFACSQTRIDMAKRAKKAL-ESVGS
A0A1M5UYN6      EKLKNDFDYIILDTPPVIPVTDAQVIANEADGVILVVASNEADKDAVVRAKELL-LKVRA
A0A176JBT8      DRLKQKFDVILFDSSPL-LVSDSILLSGKMDGCIYVLNARKTNRDDANEKIELL-KRSSN
A0A1I5HIC6      RSQREIYDYIIIDTPPLGVVIDSANVAEICDGTILVIESGKISYRLIQRVLKQL-ITGKS
A0A1Y3TC51      EEWKREMDYIIIDCSPVAVSADAEVWVSVADSVLLVVREDWADVRVINDAVDMI-SQNGT
A0A1Y3T1N0      REWKQEMDYIIIDCPPTAVSTDAEVWMEAADTVLLVVREDWSDVRIVNDTVDMI-WQSGC
A0A1Y3Y8U8      REWKQEMDYIIIDCPPTAVSTDAEVWMEAADTVLLVVREDWSDVRIVNDTVDMI-WQSGC
A0A5B0BQY5      DDIKILFDVVIIDSPPL-TVADGISLIQAVDGCIYVTHVKKTTEDNALKYLEYL-KNVNA
A6CLL4          NTLKKEVDLILIDTPPL-IVSDAAVLSSRVDGCLFLINARKTRMETAKKNLNKL-NRVGA
A0A174DL89      DRLTSNFDFILIDSPPLPLVADSQALSTFVDGTIIITKLGYTTKSALLNTKEIL-DGLKT
A0A176U8D6      AEVRDSYDYVIFDTPPICVVGDAAIVASFCDGALLVIENGVTKKKTLAQMKSEM-DKVGA
A0A1Q6KSQ5      DSVKDSYDYIIFDTPPVGVVGDAAIVSSVCDGTLLVIENGVTKKKTLCQIAAEL-EKIDT
A0A3D3U8B3      DSVKDSYDYIIFDTPPVGVVGDAAIVSSVCDGTLLVIENGVTKKKTLCQIAAEL-EKIDT
A0A3E5FRL7      EQLKEHFDYIVIDCSPVAVSVDAEVWMEVVDSTILVIRQDWTDIRVVNDTVDLI-WQSNC
A0A1Y4QK93      DQLKKHFDYIVIDCSPVAVSVDAEVWMEVVDSTILLVRQDWTDIRMVNDTVDLI-WQSGC
B1C232          DQLKEQFDYIIIDCSPISVSVDAEVWMEVVDSTILLVRQDWTDIRIINDTVDLI-WQSDC
A0A401USI6      KDMEKKYDYVILDTPPIIAFADALTLATEKIGVILVIGSEESTIENCKKSKQLL-LNINA
A0A1V4IQ10      TELKKNFDIILLDSPPVQAVTDAQILSTKVDCTLVVIRSGVTNAKSVLETKSLL-TKING
A0A1S8TRD2      TELKQKYDIILLDSPPAQAVTDAQILSSKVDCTLIVIRSGLTNAKSVLETKNLL-IKVNG
G7M1U2          TELNQKYDIILLDSPPAQAVTDAQILSSKVDCTLIVIRSGLTNAKSVLETKSLL-TKVSG
A0A2T6KJ75      EELKNQFDIIIVDTPPL-LVADTLHISANVDGCLYVVNAESSKVEQAIYSIELL-KQVQA
A9KN92          KNLRDEYDYIIIDTPPLGVVIDSANVADICDGTIMVIESNKISYRFAQRVLKQL-ITEKS
A0A352MUJ1      ETLKKNCDIVIFDATPSNLVTDAVVLSRLVDTSFIVTEHEKTQIDDIAKIKTQI-EDVGG
R5YI67          EILKKNCDIVIFDATPSNLVTDAIVLSRLVDTSFIVTEHEKTQIEDIEKIKTQI-EDVGG
A0A1Y0IQP5      ADVRTRYDLVLIDSPPLLPVTDGQVLSTLCDGVLLVVRSGAVTRDHLQQAKALL-DRVGA
A0A4R2R7B1      SDLRIRYDLVLIDSPPLLPVTDGQVLSTLCDGVLFVVRSGEVARDQLQQAKGLL-ERVGA
A0A1M6E8I2      EFLEKKYDYVLFDSPPVVPVTDAVVMTRYIEGAILVVASGNVGVDMVKKAKKSL-EFSGV
A0A1Y4N105      KKCRSNFDYIIIDTPPMGACVDVEAIINHSDSSVMVVREDWSEIGAINDLCDVL-KQNDQ
A0A1Y4QP75      KKCRSNFDYIIIDTPPMGACVDVEAIINHSDSSVMVVREDWSEIGAINDLCDVL-KQNDQ
A0A3D4QRB5      QQAAEIYDMIILDAPPIMPVSDALVLSKYTDGVVYVVGYGDIAREMVIRAKTDL-EKVGA
A0A349DEH5      DEVRKNFDYVLIDTAPASVVTDTSVIAGFVDAAIIVVREDFSPYSRIRMSIEDI-DANGA
A0A3D4T7B4      DEVRKNFDYVLIDTAPASVVTDTSVIAGFVDAAIIVVREDFSPYSRIRMSIEDI-DANGA
A0A350XYC7      EEVRNAFDYVLIDTAPASVVTDTAVIAGFADAAIIVVREDFAPYSRIRMSIEDI-DSNGA
R6DNR8          EEVRKAFDFVLIDTAPASVVTDTSVIAGFVDAAIVVVREDFAPYSRIRMSIEDI-DSNGA
A0A355KUM5      EEARKEFDYVLIDTAPASVVTDTSVIAGFVDAAIIVVREDFSPYSRIRMSIEDI-DSNGA
R5YGY6          EEARKEFDYVLIDTAPASVVTDTSVIAGFVDAAIIVVREDFSPYSRIRMSIEDI-DSNGA
A0A0K8J554      LRLEKRYDYIILDSAPVNLVADALSLAKLVDGILMVVRENGTTYPNIDSALNKY-ELIDG
A0A3N1XSX6      NVLEKDYDYIIFDTPPVNVLSDSLSLVKLSDGLIIVVREGVTSHPNVSNALEKF-RLSQG
A0A1C6G0U3      KQIRNEYDYIFIDSPPVNIVSDSEVLSRIVDGVIVVIGCNEVDRNSVKQCKEKL-NNLNA
A0A3D4LLB3      KEVSADYDYILLDVPPVMLVSDPIIISTFSNAVILAIEHGKTEKELAKKAVNSL-KQVDA
A0A0A5GPA9      AELKEHFDLVIIDTPPL-VVADAVALSTRVDGCVFVVNAQKTNTEQVSKSLQRL-NKVKA
A0A271M6M4      ETLQESYDLVIIDTPPL-VVSDAVVLSTKVDGCIFIVNAQKTKVDQTVKSIQKL-KKVEA
A0A2V3W8U6      QELKEHFDRIIIDSPPL-FFSDAAILATKVDGCLLVVQSDTTKVTHIQQGLGQL-TNVNA
W1UFG0          DYLKNDYDYIFIDTPPAGVVSDCSILSRYSDGLVYIMASKESEIDYIKDSIKGL-QGI--
A0A351SRI8      SSLSNNFDIIIFDSAPINGLADSLVMSTLVDGVIIVTACKETSKTLLKTVKKDL-ENVGA
A0A1V5LU59      EELKNEYDVIIIDTPPVGQVTDAAIIAGITDGVLLVFASSQTRIDIAKRAKKAL-ESVNS
A0A1E3BVC3      EKMKEEYDIIIIDTPPVGQVTDAAIVAGITDGVMLVLASGQTRIEMAKRATKSL-ESVKA
A0A4Q0I6S0      EKMKEEYDIIIIDTPPVGQVTDAAIVAGITDGVMLVLASGQTRIEMAKRATKSL-ESVKA
A3DF66          EKVREEYDIVIIDTPPVGQVTDAAILAGITDGVILVLASGQTRIEMAKRAFKSL-ESVKA
W4V1T8          EKVKEEYDIIVIDTPPVGQVTDAAVIAGITDGVMLVLASGQTRIEMAKRAYKSL-ESVKA
A0A1I0RG99      SQLNNEYEYILIDTPPVKVVSDALNLVKMVDGVLIVVREGVTSHPCVSSVITKF-QFLNA
A0A1I5G322      KKLEREYDYIIIDTPPVRVVSDALILMKAADGVLIVVREEVTSHSDITNFLSKC-KYMEI
A0A1C6ITD7      DRLSSNFDFILIDSPPLPLVADSQVLSTFVDGTIIVTKFGYTTKSALINTKEIL-DGLNT
A0A381IX63      EETKEHFDYVFIDTPPIGIVSDAGIVSTYSDGIILVAASNEVDDNVIKLSKDRL-VKVNA
A0A1G9IUT4      EELKNEYDYIFIDSPPIGRVTDAGVISNYVDSTIIVIAENEVNIDDVKVAKKKL-QQVNA
A0A1M6RWV2      EQCKEYYDIILIDSPPAGIVTDAAVLSKITDGTLFVVAAGQTTIELAQKAKDML-DKVQA
A0A143XPI5      EEAKEQFDCVIVDAPPCTILSDAIILAKKLDSVIMVIRYDYARVNQILRGSESL-ADTGI
A0A355G1X5      KAAKKEFDYVIIDTAPAAVVTDATILSNFADACIMVVRENFSDVSRIRSVISDL-ESYKA
A0A0M6WXE3      EACSKIVDYVIIDTPPSGMIGDAQIFAQHADAVMVVARQNVTLAEDINEMMDDF-RDNHT
A0A348SAK2      EACSKIVDYVIIDTPPSGMIGDAQIFAQHADAVMVVARQNVTLAEDINEMMDDF-RDNHT
A0A1G9H5B9      LELNDAYDLVLLDMPPVDIVADPLAVSAHVAGCILMVRQHFTTHQDLRKALNAA-EMTDM
R5EFZ0          DWARECFDFIVLDLPPMSAASDAEGMADLADASLLVVRQNAAAAPALNNAVASL-DGHKA
A0A1Y4H8L0      KTCRRLVDYVVIDTPPAGPLGDAELFARYADEVLLVVRQNYMLAEDINDVLDHF-REVGC
A0A4B9BMD9      EWANDHYDLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRL-EQAGV
A0A0M6WYQ8      SILKKKADLVIFDTAPSEMLADAPVLARYLDAAVYVIRYDYAKMRQIRMGVENI-SMSGI
A0A348SAK1      SILKKKADLVIFDTAPSEMLADAPVLARYLDAAVYVIRYDYAKMRQIRMGVENL-SMSGI
A0A252F281      EVSRQKMDFIIIDSPPMSALSDTEVLAELVDATVLVVREDTSAVPDLNESIMIL-NESKS
A0A1Y4QKE6      EKMKKEFDYVIIDTPPCGIFQDVTLIQKYADALLYVVKYDFLPYQKIQNGLSIL-KE-DC
B1C231          EKMKKEFDYVIIDTPPCGIFQDVTLIQEYSDALLYVVKYDFLPYQKIQNGLSIL-KE-DC
A0A1Y3TUL5      KDLSQNYDYVLMDSAPVGRVAETLSLNRIAKSALFVIRFDYSNMNTIRDSLERL-DKSGI
A0A1Y4JAX2      KDLSQNYDYVLMDSAPVGRVAETLSLNRIAKSALFVIRFDYSNMNTIRDSLERL-DKSGI
A0A1Y4T590      KDLSQNYDYVLMDSAPVGRVAETLSLNRIAKSALFVIRFDYSNMNTIRDSLERL-DKSGI
R5B467          HDLREHYDVVLLDTPPCAVMTDALETGAATDCALLVVRQDASSRVSVINSLAAL-DALGV
A0A1Y3T163      QALKKEMDYIIIDTPPCEMFQDAGMLSDYADGILYVVKYDFIPQRRIWEGLSFL-GGRSA
A0A1Y3YCA2      QALKKEMDYIIIDTPPCETFQDAGMLSDYADGILYVVKYDFIPQRRIWEGLSFL-GGRSA
A0A1Y4L6N9      ESLRKEMDYVIIDAPPSEMFEDAAVLSEYADGILYVVRYDFVQRRRVLDGLAEL-DGVHT
A0A173T644      RRVRGEYDLVILDSPPAEMFEDASLMAEFSDGICYVIRHDFVQKRRILESLAGL-ESSGT
A0A1C5TSB8      RRVRGEYDLVILDSPPAEMFEDASLMAEFSDGICYVIRHDFVQKRRILESLAGL-ESSGT
C0CIK6          RRVRGEYDLVILDSPPAEMFEDASLMAEFSDGICYVIRHDFVQKRRILESLAGL-ESSGT
A0A1Y3WEF6      KEMKAQWDLILLDAPPTEMFEDASILAEQADGILYVIRYDQVQKRRILDSISGL-EDSSA
A0A417T0L2      EEMKAQWDLILLDAPPVEMFEDASILAEQSDGILYVIRYDQVQKRRILDSISGL-EDSKA
A0A1H9EPU3      KQLRQAYDYVVIDTPPVGTVIDGAIIGKECDGVVMVVGSGDISYKLVERAKEQL-ETSGS
A0A354IGV3      AHFREEMDFILIDSPPMALFSDAEALANLSDASVMVIRQSRSLAQEINTAADTL-ESGHS
A0A417JMV2      EFFKTKLDYIIIDTPPMSQAADAEELVDLADASILVVRQHTALVKDINETIGIL-NSAEG
B0P408          EFFKTKLDYIIIDTPPMSQAADAEELVDLADASILVVRQHTALVKDINETISIL-NSAEG
D4MV82          EFFKTKLDYIIIDTPPMSQAADAEELVDLADASILVVRQHTALVKDINETISIL-NSAEG
A0A415VWX5      EFFKTKLDYIIIDTPPMSQAADAEELVDLADASILVVRQHTALVKDINETISIL-NSAEG
A0A173UY96      EFFKTKLDYIIIDTPPMSQAADAEELVELADASILVVRQHTALVKDINETIGIL-NSAEG
A0A173QTL1      EFFKTKLDYIIIDTPPMSQAADAEELVDLADASILVVRQHTALVKDINETIGIL-NSAEG
A0A174A3T7      EFFKTKLDYIIIDTPPMSQAADAEELVDLADASILVVRQHTALVKDINETISIL-NSAEG
A0A174J359      EFFKTKLDYIIIDTPPMSQAADAEELVDLADASILVVRQHTALVKDINETISIL-NSAEG
A0A417UUA3      EFFKTKLDYIIIDTPPMSQAADAEELVDLADASILVVRQHTALVKDINETISIL-NSAEG
A0A1C6EUV9      DFFKDRLDYVIIDTPPMSQAADAEELVDYADASILVVRQHTALVKDINEAISVL-NSGDG
A0A173Y645      DFFKERLDYVIIDTPPMSQAADAEELVDYADASILVVRQHTALVKDINEAISIL-NSGEG
A0A374AVY6      DFFKERLDYVIIDTPPMSQAADAEELVDYADASILVVRQHTALVKDINEAISIL-NSGEG
R7BXS4          DFFKERLDYVIIDTPPMSQAADAEELVDYADASILVVRQHTALVKDINEAISIL-NSGEG
A0A143ZUX1      KIVEPNFDFIIIDTPPAHVVSDAMTIRRFVDATILVVRQDFTPASTIRHTLEDL-DSEET
S3FFL2          TRLLDQYDHVVVDSPPVMGLADAPLIASRVEGVIYAIESHGIRATLVKTALGRL-LNANV
A0A6A8IF17      DTVREQYDYVLIDCPPVELVADTQIIEKLADRTVFVVRAGLLERSMLAELEKIY-EEKKY
A0A6C0V5C7      EWASKHYDLVLIDTPPILAVTDAAVVGRHAGTTLMVARYAVNTLKEVETSLSRF-EQNGI
A0A6C0V5F7      SRIDTLYDIVIIDTPPVLAVTDALLITRAAATTLLVARFGKTSGKEVEHSLKRL-RQTGV
A0A328M4V1      EGLKSRFDLIIIDTPPILAVTDAAVIGHHVGTSLLVVQFGLNQPREIALAKQRF-EQNGV
A0A5C8HCX2      EWANDHYDLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRL-EQAGV
A0A1W1Z4C3      KELEEKYDLILMDVPPINIVSDPLALSGQCAGALFVVRQNFSDHREIRRALISA-EMTGL
A0A239QN83      QELEEQYDLVLMDVPPINIVSDPLALSSQAAGTLFVVRQEFSDHREIRRALVSC-EMTGL
A0A3R9WAA7      EQLKEEYDYIILDSAPSAVISDTIELAKYADGVIYVIRQDYSRVRQIQQGMEHIVESSRA
A0A1G6BLF1      RTLQKEYDYVILDTPPCALLNDATMVASQAQAAIFVVRQDYARVDRIYEGIENL-AETGV
R6HZX3          ERTRTLADYVIIDAPPAGLLADAAVLCRSADQVLYVVRYDSFARNQVADAMHSV-SGRGA
A0A1W2CEA6      ATVGRDYDFVIVDTPPLGVVVDAAEISRRCDGSLLVLEYNRTHGKALKEAVRLL-RRTGT
R7FFK6          DKLKEKYDIILIDCAPVNVVSDVAGMANSIAGVVMVVHYGTTTYAETEDAVKQL-ELANC
A0A373MPB9      EYVQHKYDYVIIDGTPLLPVTDVMSLADEVAGVLLIARYGRTTYQEIEESMKKL-EIGDC
A0A373L519      EYVQHKYDYVIVDGTPLLPVTDVMSLADEVAGVLLIARYGRTTYQEIEESMKKL-EIGDC
A0A373W906      EYVQHKYDYVIVDGTPLLPVTDVMSLADEVAGVLLIARYGRTTYQEIEESMKKL-EIGDC
A0A373VCW2      EYVQHKYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKL-EIGDC
W0U604          EYVQHKYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKL-EIGDC
A0A374B6G0      EYVQHKYDYVIVDGTPLLPVTDVMSLADEVAGVLLIARYGRTTYQEIEESMKKL-EIGDC
A0A373VM36      EYVQHKYDYVIIDGTPLLPVTDVMSLADEVAGVLLIARYGRTTYQEIEESMKKL-EIGDC
A0A1C5P379      EYVQHKYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKL-EIGDC
A0A373XXX0      EYVQHKYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKL-EIGDC
A0A5R9MJM9      EYVQHKYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKL-EIGDC
A0A356CW82      EYVQHKYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKL-EIGDC
R6T4X7          EYVQHKYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKL-EIGDC
A0A374HTV1      EYVQHKYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKL-EIGDC
A0A374GB66      EYVQHKYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKL-EIGDC
A0A374ECC6      EYVQHKYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKL-EIGDC
A0A374BM61      EYVQHKYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKL-EIGDC
A0A373UGZ4      EYVQHKYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKL-EIGDC
A0A373SA66      EYVQHKYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKL-EIGDC
A0A1C5X6X7      EYVQHKYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKL-EIGDC
A0A1C6JIH3      EYVQHKYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKL-EIGDC
A0A373PSC3      EYVQHKYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKL-EIGDC
A0A1K1WYK8      EQFATNYDYVIIDTPPVNVVSDAMVMKDSISGIMLVIRYAMTTYEELANCMKQI-ELAKV
A0A1H6IUB1      EKLSEEYSMILIDTPPVNVVTDAMELAKYVSGIVLVLRYGVTTNEDAEDAIKKI-EFAKM
A0A1M7L1F9      EQLSSEYSMILIDTPPVNVVTDAMELAKYISGIIVVLRYGVTTNEDVDAAIKKV-EFAQM
A0A1C6B4L6      DELNKKYQIIIIDTPPVNVVTDAMELAKCVSGIVVVLCYGRTTTEDIEAVVKKM-EFSKV
A0A1Q6T9P4      DELNKKYQIIIIDTPPVNVVTDAMELAKCVSGIVVVLRYGRTTTEDIEAVVKKM-DFSKV
A0A315Y4F9      NELSEKYDAILIDTPPVNVVTDAMELAKSVSGIVLVVRYGRTTDEDVDNVFKRV-ELANM
A0A354K620      HDLSEKYDVILIDTPPVNVVTDAMELAKMISGIVLVVRYGKTTDEDVENVFKRI-ELAKM
A0A355G3J9      SAFRKDYDYIIIDSPPINEVSDAMTLVDVVNGYIMCSIAGYSDAEETKQAVLSL-EQIGA
A0A3D2AD87      KLLNEQYDYVIVDTPPLNVVTDSMIIAPQTGGVILIVRDGYTPHYSIKKVLGDM-DFANI
A0A2T5IYJ6      AKLSETYDRIVIDSPPTLLVSDSLVMSKAVDAVLYVIRSDTTAQNAARTGVNRL-RAAKA
A0A3C0QME1      DELEPQYDYIIIDTPPINVVSDTLVMGKILSGLLLVVKYGQTTFEELQDAINHA-NLSEL
A0A355FYK5      EQARKEFDFIIIDTPPSRVVSDSMVMSSLADSLVFVIRKDHAKIADINETLEEI-AGTNI
A0A357AQU0      TEASEQYTVILIDTPPVNMVSDVYGLSDSIAGIVLVAEFEGTTSYDIKHALEGA-KLSNV
A0A3C1YJQ7      TEASEQYTVILIDTPPVNMVSDVYGLSDSIAGIVLVAEFEGTTSYDIKHALEGA-KLSNV
A0A3D0JG38      TEASEQYTVILIDTPPVNMVSDVYGLSDSIAGIVLVAEFEGTTSYDIKHALEGA-KLSNV
A0A3C0IHX1      EEAEQQYDYIIIDTPPVNVVSDALGLSDCIGGILMVARYYVTTTKELETALQAI-SVTGA
R5V506          EEAEQQYDYIIIDTPPVNVVSDALGLSDCIGGILMVARYYVTTTKELETALQAI-SVTGA
A0A352TIU5      EEAEQQYDYIIIDTPPVNVVSDALGLSDCIGGILMVARYYVTTTKELETALQAI-SVTGA
A0A3E5FSY5      EKMKKEFDYVIIDTPPCGIFQDVTLIQEYSDALLYVVKYDFLPYQKIQNGLSIL-KE-DC
A0A1V5S3C0      NEAKKNFDFVIIDCAPAGVVADATIVSNYCDAVLFVVAENKTSLREIEYAVSDL-STTKA
A0A1Y3TC98      REMRRKMDYVIIDSPPCTMFQDAGILADHADAVLYVVKYDELPLQKIQEGLSFL-GSQRT
A0A1Q6REE0      RYARDKYDYVILDTPPCSLLTDAAEAAEAAEAGLMVIRQDYASRDQILDGAQRL-SDSRL
R5ETF9          RYARDKYDYVILDTPPCSLLTDAAEAAEAAEAGLMVIRQDYASRDQILDGAQRL-SDSRL
R6VAT5          AALEKIFDYVVIDAPPVGIVSDALEMKDYVGGLVFVVRQDYAKVSKILDSISLF-GYSKI
A0A1Q6S448      ALARERYDYVIIDSPPLGFFSDSELLSDLSDASVLVVRQDTVPAPEINDAIDAL-RAGKA
A0A351MYR0      ALARERYDYVIIDSPPLGFFSDSELLSDLSDASVLVVRQDTVPAPEINDAIDAL-RAGKA
R6HPC1          ALAREQYDYVIIDSPPLGFFSDSELLSDLSDASVLVVRQDTVPAPEINDAIDAL-RAGKA
A0A3D4G5Z5      ALAREQYDYVIIDSPPLGFFSDSELLSDLSDASVLVVRQDTVPAPEINDAIDAL-RAGKA
A0A3D5ES03      ALAREQYDYVIIDSPPLGFFSDSELLSDLSDASVLVVRQDTVPAPEINDAIDAL-RAGKA
A0A0F2P7X6      AALEKQYDYIILDTPPSYLLTDAVALSVYADGVILVVKQGCAKVDVINSAQAAF-ENAGV
A0A359B487      AALEKQYDYIILDTPPAYLLTDAVALSVYANGVILVVKQGCAKVDVINSAQAAF-ENAGV
A0A348P5V4      EAAKKEFDYVIIDTAPCGIIADASILAGYADTIVLVVKQDYASARRIKRAVDNF-ENSGT
A0A356PT74      KSAEKEFDYIIIDTAPCGVVADASILSSYADGILLVVRNDMVASRRIKRAVENL-ENSGT
A0A3D5LL19      KSAEKEFDYIIIDTAPCGVVADASILSSYADGILLVVRNDMVASRRIKRAVENL-ENSGT
R5MNF0          KSAEKEFDYIIIDTAPCGVVADASILSSYADGILLVVRNDMVASRRIKRAVENL-ENSGT
A0A1Q9JSI0      DFFKERLDYIIIDTPPMSQAADAEEMVDLVDASILVVKQHTALVKDINEAIAIL-KSGEG
A0A3D5TNI1      AAAKEKFDYIIIDTPPAGIVADAAICAKYTDSSIFVIREDRFPVPAILEAVSDL-TQGGT
A0A358LJD0      AAAREKFDYIIIDTPPVGIVADAAICAKYTDSSIFVIREDVFPVPAILEAVSDL-TQGGS
R6I3L7          AAAREKFDYIIIDTPPIGIVADAAICAKYTDSSIFVIREDVFPVPAILEAVSDL-TQGGT
A0A3D1HXX0      AAAREKFDYIIIDTPPVGIVADAAICAKYTDSSIFVIREDVFPVPAILEAVSDL-TQGGT
A0A3D2QJB8      AAAREKFDYIIIDTPPVGIVADAAICAKYTDSSIFVIREDVFPVPAILEAVSDL-TQGGT
D4LC36          ETLKERYDMILIDCAPINVVSDVAGLSQEIAGVVMVVHYGFTTYPELDDAVNRL-ALANC
R7MQJ4          NTLSEAYDYIIVDTPPVNIVSDAMGLSNSIAGILMVLRYGRTTFDDLDNAMKKI-ELADV
A0A1V5GLC0      EKLSAEYSAIVIDTPPINVVTDAMELARNISGIILVTSYGKTTVDDMDSAMKKI-EFANM
W7V182          DQLSERYSVIIIDTPPVNVVTDAMELANKVSGIIMVARYAKTTTDDIDNAMKKI-EFAKM
                         :..* .*     :                                      

A0A0H5SF45      NILGFVLNGSA-----------------LTQENKSK--SSYYYYQRNND-----------
A0A1M6JRJ5      NILGFVLNGIS-----------------EKELGGHK--SKYYYSTKKNKNNGIVH-----
A0A1M7Y1S2      NILGVVLNGIS-----------------ERDLGGYK--SKYYYYNPDNK-----------
A0A3D5R4X5      NILGSVLNKIP-----------------MGRGGYSYYKYYSSYYGEYEKTSRKKRKKRSD
A0A1I4C3N6      DICGFIYNGIS-----------------TKSEDYNY--KKAAEKYGFVDTSAKVVSAKKK
A0A3B9CIM7      NICGFVFNGIS-----------------MKSQDYHY--K--HYAKDYKY-----------
A0A1G9WHW8      DICGFIYNGIA-----------------VNSREYKY--NTKKYGKEYGYGLKYSASK---
A0A1H5VAA0      DICGFIYNGIA-----------------VNSREYKY--NTKKYGKEYGYGLKYSASK---
A0A3R6VK11      DICGILFNGLP-----------------PKSKDCNY--RLQQYWQEYKQQNGEAV-----
A0A3R6QUY7      DICGILFNGLP-----------------PKSKDCNY--RLQQYWQEYKQQNGEAV-----
A0A373K3P9      DICGILFNGLP-----------------PKSKDCNY--RLQQYWQEYKQQNGEAV-----
A0A3R6JRU5      DICGILFNGLP-----------------PKSKDCNY--RLQQYWQEYKQQNGEAV-----
A0A1C5MS04      DICGILFNGLP-----------------PKSKDCNY--RLQQYWQEYKQQNGEAV-----
A0A3C1J150      DICGILFNGLP-----------------PKSKDCNY--RLQQYWQEYKQQNGEAV-----
A0A416CXD7      DICGILFNGLP-----------------PKSKDCNY--RLQQYWQEYKQQNGEAV-----
R6XBL9          DICGILFNGLP-----------------PKSKDCNY--RLQQYWQEYKQQNGEAV-----
A0A355W5Z7      DICGILFNGLP-----------------PKSKDCNY--RLQQYWQEYKQQNGEAV-----
A0A143WVN6      EFMGFVLNAFHENIL-----------IEKSYGQYPY--QNY-----QSRSVRKAEE----
W6RXP9          NVIGGILNGAED----------------RKNKTYYY----------YGE-----------
W6S4G8          KILGVVLNATEDG---------------RLSKMYQY----------YGEEHKKKGDKVS-
A0A1G6BLB6      KLIGCVFNNVGGNRV-----------S-LTHGGQGY--GEYGNYG-YGRYHQYDHSEREG
A0A1C6G8M0      NILGVVQNMVGSKKD-----------S-SYYGKGNY--GYY-----YGNNQNKK------
A0A416MP73      NVIGVVQNMVGSKKD-----------S-SYYGKGNY--GYY-----YGNYGNNQNKNKFT
A0A3E4LL92      TVIGGVLNMTKGERN-------------ISKDRESY--GKY-----YNENAK-KNAGE--
A0A415D1L1      TVIGGVLNMTKGERD-------------TSKDRYGY--SKY-----YKENAKIENAGE--
A0A414P2K5      TVIGGVLNMTKGERD-------------TSKDRDGY--RKY-----YNENAKIENAGE--
V8C417          TVIGGVLNMTKGERD-------------TSKDRDGY--RKY-----YNENAKIENAGE--
A0A143XN92      RVIGGIFNNAYSNIL-----------ERIGMEQYGR--KTS-----Y-------------
A0A173ZYY6      KVLGVVLNGVRSFSG-----------LVDSPVGHYY--GKYSKYGRYGNYGRSKGM----
A0A4Q5EHM9      KVLGVVLNGVRSFSG-----------LVDSPVGHYY--GKYSKYGRYGNYGRSKGM----
A0A173SMI2      KVLGVVLNGVRSFSG-----------LVDSPVGHYY--GKYSKYGRYGNYGRSKGM----
A0A174ASH7      KVLGVVLNGVRSFSG-----------LVDSPVGHYY--GKYSKYGRYGNYGRSKGM----
A6BH65          KVLGVVLNGVRSFSG-----------LVDSPVGHYY--GKYSKYGRYGNYGRSKGM----
R7G0D7          KVLGVVLNGVRSFSG-----------LVDSPVGHYY--GKYSKYGRYGNYGRSKGM----
A0A396G6S7      KVLGCILNGVTSQNM-------------AGSGHYGY--GGH-----YGKRA---------
A0A3E5A223      KVLGCILNGVTSQNM-------------AGSGHYGY--GGH-----YGKRA---------
R7D5E6          KVLGCILNGVTSQNM-------------AGSGHYGY--GGH-----YGKRA---------
A0A415HQH5      KVLGCILNGVTSQNM-------------AGSGHYGY--GGH-----YGKRA---------
A0A414W2C6      KVLGCILNGVTSQNM-------------AGSGHYGC--GGH-----YGKRA---------
A5ZNE7          KVLGCILNGVTSQNM-------------AGSGHYGC--GGH-----YGKRA---------
A0A395X821      KVLGCILNGVTSQNM-------------AGSGHYGY--GGH-----YGKRA---------
A0A1C5PY68      KVLGCILNGVTSQNM-------------AGSGHYGY--GGH-----YGKRA---------
A0A174CJF8      KVLGCILNGVTSQNM-------------AGSGHYGY--GGH-----YGKRA---------
A0A564SRR2      KVLGCILNGVTSQNM-------------AGSGHYGY--GGH-----YGKRA---------
A0A174R7V0      KVLGCILNGVTSQNM-------------AGSGHYGY--GGH-----YGKRA---------
A0A373MWV2      KVIGCVFGNVYPGFG-----------E-RIGGSYGY--GYG-----YGAYSRAER-----
A0A417CE88      KVIGCVFGNVYPGFG-----------E-RIGGSYGY--GYG-----YGAYSRAER-----
A0A416Y441      KVIGCVFGNVYPGFG-----------E-RIGGSYGY--GYG-----YGAYSRAER-----
A0A357GPJ7      KVIGCVFGNVYPGFG-----------E-RIGGSYGY--GYG-----YGAYSRAER-----
A0A396PAC1      KVIGCVFGNVYPGFG-----------E-RIGGSYGY--GYG-----YGAYSRAER-----
A0A416EYU4      KVIGCVFGNVYPGFG-----------E-RIGGSYGY--GYG-----YGAYSRAER-----
A0A416SCQ2      KVIGCVFGNVYPGFG-----------E-RIGGSYGY--GYG-----YGAYSRAER-----
A0A416TGN7      KVIGCVFGNVYPGFG-----------E-RIGGSYGY--GYG-----YGAYSRAER-----
A0A417SMF6      KVIGCVFGNVYPGFG-----------E-RIGGSYGY--GYG-----YGAYSRAER-----
A0A1Y4MW77      PLLGYVFNGDSF----------------TFRDYSRY--GYR-----YYNKYGYRHYSYYN
R6UHV6          KLMGCVYNDAENVSI-----------VGRGSVYSDY--QYG-----KYGYGKYGKYGSTA
A0A3R9Q621      NILGFVLNGVIR----------------KQGLKSKS--GYY-----YRSKDD--------
A0A069RC75      RIMGAIFN--------------------RASEASSY--YSY-----YGK-----------
A0A174F2W5      KVIGCVFGNVYPGFG-----------E-RIGGSYGY--GYG-----YGAYSRAER-----
A0A174S8E9      KVIGCVFGNVYPGFG-----------E-RIGGSYGY--GYG-----YGAYSRAER-----
A0A416ZL97      KVIGCVFGNVYPGFG-----------E-RIGNSYGY--GYG-----YGTYSRAER-----
A0A174LSK1      KVIGCVFGNVYPGFG-----------E-RIGNSYGY--GYG-----YGTYSRAER-----
A0A373GY92      KVIGCVFGNVYPGFG-----------E-RIGNSYGY--GYG-----YGTYSRAER-----
A0A373NZQ6      KVIGCVFGNVYPGFG-----------E-RIGNSYGY--GYG-----YGTYSRAER-----
A0A417I9B9      KVIGCVFGNVYPGFG-----------E-RIGNSYGY--GYG-----YGTYSRAER-----
A0A417MP97      KVIGCVFGNVYPGFG-----------E-RIGNSYGY--GYG-----YGTYSRAER-----
A0A417WQF8      KVIGCVFGNVYPGFG-----------E-RIGNSYGY--GYG-----YGTYSRAER-----
A0A373RZ83      KVIGCVFGNVYPGFG-----------E-RIGNSYGY--GYG-----YGTYSRAER-----
A0A416U6I1      KVIGCVFGNVYPGFG-----------E-RIGNSYGY--GYG-----YGTYSRAER-----
R7JQZ9          KVIGCVFGNVYPGFG-----------E-RIGNSYGY--GYG-----YGTYSRAER-----
A0A3B8KKL6      NMIGAVLTKIDF----------------RKTSYYGY--SYS-----YQYD----------
A0A2K9E6R0      NMIGAVLTKIDF----------------RKTSYYGY--SYS-----YQYD----------
A0A2S8RBI0      NMIGAVLTKIDF----------------RKTSYYGY--SYS-----YQYD----------
A0A0L6JLG6      NIIGIVMTKIDS----------------RSAYYHYY--KYE-------------------
G8LSN0          NILGTVLTKLDI----------------GRARYYSY--NYE-----YK------------
A0A1M5UYN6      NILGVVLNKIEF----------------SKGKGYWY--NYE-----YYYSYGSSNKHKNT
A0A176JBT8      ELIGAILNEKKT----------------HKSNPHYY--YGG-----YMG-----------
A0A1I5HIC6      RVLGAVLNKANIYG--------------KGYKKNYY--GKY-----YGR-----------
A0A1Y3TC51      DFTGFVLNAFHREWS-----------RPAGRQEYSY--GRA-----YRSQDMPGEGLTGR
A0A1Y3T1N0      DFSGFILNAFHRDWI-----------SQSSGYGYDY----------------------GN
A0A1Y3Y8U8      DFSGFILNAFHRDWI-----------SQSSGYGYDY----------------------GD
A0A5B0BQY5      TVLGSVLNGNKK----------------GLNRHS--------------------------
A6CLL4          NIIGVILNKTKK----------------EKSQTYYY------------------------
A0A174DL89      NVIGVVLNNSPL----------------DSSVNYYY--Q---------------------
A0A176U8D6      NVIGVVQNMVGSKKD-----------S-SYYGKGNY--GYY-----YGNYGNNQNKK---
A0A1Q6KSQ5      NILGVVQNMVGSKKD-----------S-SYYGKGNY--GYY--------YGNNQNKK---
A0A3D3U8B3      NILGVVQNMVGSKKD-----------S-SYY-----------------------------
A0A3E5FRL7      NFTGFALNMFID----------------NDSHHNDY--GYS-----YYDYKTHRHESR--
A0A1Y4QK93      DFTGFALNMFID----------------DEIRHNDY--GYS-----YYDYKNHRHESR--
B1C232          DFIGFALNMFID----------------DEIRHNDY--GYS-----YYDYKTHRHESR--
A0A401USI6      TIIGIVLNKVDK----------------RSFIGYGY--DYY-----SYDKEKSSRLRNKS
A0A1V4IQ10      LVIGTVLHRT------------------EYNKDTYY--YSS-----HSSSSNTIKSLLG-
A0A1S8TRD2      LVIGTVLHRT------------------EYNKDTYY--YRS-----HGSSNKITRSLLG-
G7M1U2          LVIGTVLHRT------------------EYNKDTYY--YRS-----HGSSNKTTRSLLG-
A0A2T6KJ75      PLIGTIIN--------------------KSKGSVRS--YSY-----YN------------
A9KN92          KVLGAVLNKANIYGV-----------GYNKKYYGKY--YSH-----VYANDYDENGN---
A0A352MUJ1      NIAGIVINKVQD----------------DKASKGNY--YYM-----NESDIKRRKTRSRR
R5YI67          NIAGIVINKVQD----------------EKSSKGNY--YYM-----NEEDIKRKKRKRSE
A0A1Y0IQP5      QVIGAVLNGKKR----------------KGKE--QT--YSY-----YASPAGDRDD----
A0A4R2R7B1      QVIGAVLNGKQR----------------KRSE--PA--YSY-----YAAPEGDPHD----
A0A1M6E8I2      KLIGSVLNIIPT----------------NHSKGYNS--YYY-----YYEESET-------
A0A1Y4N105      DFIGFILNAFHR----------------SIFSNDSY--SHY-----GDYQRRTTSNLHK-
A0A1Y4QP75      DFIGFILNAFHR----------------SIFSNDSY--SHY-----GDYQRRTTSNLHK-
A0A3D4QRB5      KILGSVINDIPL----------------DTLVGYGS--YYY-----YYGSDSDGKGKKSR
A0A349DEH5      EIIGCIFNADTS----------------NVSKTGRY--GKR-----YGHYGKSGR--YGY
A0A3D4T7B4      EIIGCIFNADTS----------------NVSKTGRY--GKR-----YGHYGKSGR--YGY
A0A350XYC7      EIIGCVFNADTS----------------NVSNSSRY--GRH-----YGKKGT-----YGY
R6DNR8          EIIGCIFNADTS----------------NLSKSSRY--GRR-----YGHYGKSGRYGYGY
A0A355KUM5      EIIGCIFNADTS----------------NLSKTSRY--GRR-----YG------------
R5YGY6          EIIGCIFNADTS----------------NLSKTSRY--GRR-----YGGYGK--RYGYGS
A0A0K8J554      KLLGFVINGITF----------------KQGEKSKS--KYY-----YNVNQDD-------
A0A3N1XSX6      NILGFVINGVSI----------------NQTKKSKY--YYY-----QYGDSND-------
A0A1C6G0U3      NILGCIVNKENI----------------KKGN--------Y-----YY------------
A0A3D4LLB3      NIIGAVFNNIPV----------------SKQNNYYY--YKS-----YC------------
A0A0A5GPA9      TIFGVVLNRGVK----------------ETNA-------HY-----YY------------
A0A271M6M4      NILGVVLNSGKE----------------SKRT-------SY-----YY------------
A0A2V3W8U6      TILGAIINKKKE----------------RKND-INY--YHY-----GTR-----------
W1UFG0          KIIGCILNKFDA----------------KSVSYYNY--SNY-----SYYYGE--------
A0A351SRI8      NILGIVLNRTDT----------------NKSK---Y--YGH-----YYQ-----------
A0A1V5LU59      NIIGAILTKLNT----------------GRGS---Y--YSY-----KYK-----------
A0A1E3BVC3      RFVGAVLTKLDT----------------ERTG---Y--YSY-----KYE-----------
A0A4Q0I6S0      RFVGAVLTKLDT----------------ERTG---Y--YSY-----KYE-----------
A3DF66          RFIGAVLTKLDT----------------ERTG--YY--YSY-----KYE-----------
W4V1T8          QFVGAVLTKLDT----------------ERTG---Y--YSY-----KYD-----------
A0A1I0RG99      NILGFVLNGISL----------------NQQERSKY--RYY-----N-------------
A0A1I5G322      KVLGFILNGISL----------------NQEKKSKY--HYY-----YYNNYND-------
A0A1C6ITD7      NVIGVLLNNSPI----------------NSSS-------NY-----YYKE----------
A0A381IX63      NIIGCILNKFDY----------------KNHNEYEY--YGY-----YYSAEGNKRKKRKN
A0A1G9IUT4      NILGSIFNKSSL----------------YKSE--CY--YGY-----YYENE---------
A0A1M6RWV2      KVIGVLVNKVNI----------------EKRR--YQ--YYY-----YYLED---------
A0A143XPI5      SMIGYVLNAVESGIM-----------SYGY-----Y--AYR-----YGYYHK-----GYR
A0A355G1X5      ELIGCVYNNTANRDG-------------------------L-----LGLYSKS----SYG
A0A0M6WXE3      KVLGVVLNGVMTFQSIADSPVGDHYSRYS-----------R-----YGRYGR--------
A0A348SAK2      KVLGVVLNGVMTFQSIADSPVGDHYSRYS-----------R-----YGRYGR--------
A0A1G9H5B9      NVLGFVFYGEHMHES-------------GYYSRKYY--RKY-----YKNYYSKRT--TRG
R5EFZ0          KVLGCVLNNV-------------------YATQLST--GQS-----YGGYSKYSHYGHYG
A0A1Y4H8L0      HVVGVVLNRVQSFENLTAQTVGRYAGRYGYGYGYGY--G-A-----YAQYAND-------
A0A4B9BMD9      NIKGAILNGVIKRAS----------------TAYSY--GYN-----Y-------------
A0A0M6WYQ8      HMLGYVLNRDR-------STGGGYGYGYGYYGRYRY--G-R-----YGRYG------RYG
A0A348SAK1      HMLGYVLNRDR-------STGGGYGYGYGYYGRYRY--G-R-----YGRYG------RYG
A0A252F281      RLLGCVYNDKHTSPL---SRLPIYGKYADY---YGY--RGY-----YGNYGK--------
A0A1Y4QKE6      CFMGYVFNIYTKKSS-------------------------E-----YGHHSY-----GYN
B1C231          CFMGYVFNIYTKKSS-------------------------E-----YGHYSY-----GYN
A0A1Y3TUL5      NPLGCIVNRV--------KTLGDKL-NNNY----------N-----YE---------SEG
A0A1Y4JAX2      NPLGCIVNRV--------KTLGDKL-NNNY----------N-----YE---------SEG
A0A1Y4T590      NPLGCIVNRV--------KTLGDKLNNNNY----------N-----YE---------SEG
R5B467          PVLGYTLNACAGRSH----------GGYGYGFGYGY--G-G-----YG-YGY-----GYG
A0A1Y3T163      RILGYVFNSYPESVS-----------EYGYGR-YGY--G-R-----YGRYGY-------G
A0A1Y3YCA2      RILGYVFNSYPESVS-----------EYGYGR-YGY--G-R-----YGRYGY-------G
A0A1Y4L6N9      RLLGYVFNGIKVGHS-----------GYGYGYGYGY--GYN-----YG-YGYR----RDG
A0A173T644      TILGYAFNGVPLHKG-----------RYGY---YGY--G-R-----YG-YGY------YG
A0A1C5TSB8      TILGYAFNGVPLHKG-----------RYGY---YGY--G-R-----YG-YGY------YG
C0CIK6          TILGYAFNGVPLHKG-----------RYGY---YGY--G-R-----YG-YGY------YG
A0A1Y3WEF6      PLLGYVFNGVPVHRG-----------GYGY---YGY--G-R-----YG-YGYY----GYG
A0A417T0L2      PLLGYVFNGVPVHRG-----------GYGY---YGY--G-R-----YG-YGYY----GYG
A0A1H9EPU3      RILGVALNKV--------PMDKGKGYYGKYYGGY-Y--GGY-----YG-YGNY----SYG
A0A354IGV3      ELLGCILNDVY-GMPFPLSLLDNDSYSYGYGDLHNY--GRY-----RK-YGKYGKYGGYG
A0A417JMV2      TMLGCVYNDVFHGVA---QTARNYGYKYAYGSGYGY--GSK-----YG-YGNHGY--GYG
B0P408          TMLGCVYNDVFHGVA---QTARNYGYKYAYGSGYGY--GNK-----YG-YGNHGY--GYG
D4MV82          TMLGCVYNDVFHGVA---QTARNYGYKYAYGSGYGY--GNK-----YG-YGNHGY--GYG
A0A415VWX5      TMLGCVYNDVFHGVA---QTARNYGYKYAYGSGYGY--GNK-----YG-YGNH----GYG
A0A173UY96      TMLGCVYNDVFHGVA---QTARNYGYKYAYGSGYGY--GSK-----YG-YGNHGY--GYG
A0A173QTL1      TMLGCVYNDVFHGVA---QTARNYGYKYAYGSGYGY--GSK-----YG-YGNHGY--GYG
A0A174A3T7      TMLGCVYNDVFHGVA---QTARNYGYKYAYGSGYGY--GNK-----YG-YGNHGY--GYG
A0A174J359      TMLGCVYNDVFHGVA---QTARNYGYKYAYGSGYGY--GSK-----YG-YGNH----GYG
A0A417UUA3      TMLGCVYNDVFHGVA---QTARNYGYKYAYGSGYGY--GSK-----YG-YGNH----GYG
A0A1C6EUV9      TMLGCVYNDVFHGIA---QTARNYGYRYAYGSGSSY--GYG-----YG-YGSK-Y--GYG
A0A173Y645      TMLGCVYNDVFHGIA---QTARNYGYRYAYGSGSSY--GYG-----YG-YGNK-Y--GYG
A0A374AVY6      TMLGCVYNDVFHGIA---QTARNYGYRYAYGSGSSY--GYG-----YG-YGNK-Y--G--
R7BXS4          TMLGCVYNDVFHGIA---QTARNYGYRYAYGSGSSY--GYG-----YG-YGNK-Y--G--
A0A143ZUX1      PVIGCVFNGVARPNR-----------LLGYGRYSSY--YYD-----Y-------------
S3FFL2          HIFGGVLTKFEATKS-----------NSGYGYEY------G-----Y-------------
A0A6A8IF17      KNMSLILNGTEGSGG-----------RYGYRYGYRY--GYH-----Y-------------
A0A6C0V5C7      EVKGVILNSIFRRAT-----------GY-QDYGY-----YE-----Y-------------
A0A6C0V5F7      QVNGAILNDIVKSAA-----------LY-YNSGY-----SH-----Y-------------
A0A328M4V1      PIKGAIFNLVEKRSA-----------GY-YAYAY-----YT-----Y-------------
A0A5C8HCX2      NIKGAILNGVIKRAS-----------TA-YSYGY-----NY-----Y-------------
A0A1W1Z4C3      EVLGFVFYGENIHQG-----------RY-YSKRSQR--GYQ-----Y-------------
A0A239QN83      EVLGFVFYGEKLHQG-----------KY-YSKRSQR--GYE-----Y-------------
A0A3R9WAA7      EIIGCVLNNVRHMPA-----------GY-----------------------------GYG
A0A1G6BLF1      DIMGCLLNGAEVGLT-----------GT-GYSKSYS--YAR-----YGYG-------HGE
R6HZX3          ELTGYVINGRPTRRG-----------RG-YGYGYD-------------------------
A0A1W2CEA6      PVLGCILNKTAVSRI-----------GK-SGYSYYY--GGK-------------------
R7FFK6          NVLGFVLNEVVHKHS-----------AG-YYSNYKY--KYK-----Y-------------
A0A373MPB9      NLLGFVLNDISAKNG-----------SH-YGYKYSY--KYK-----Y-------------
A0A373L519      NLLGFVLNDISAKNG-----------SH-YGYKYSY--KYK-----Y-------------
A0A373W906      NLLGFVLNDISAKNG-----------SH-YG----Y--KYK-----Y-------------
A0A373VCW2      NLLGFVLNDISAKNG-----------SH-YGYKYSY--KYK-----Y-------------
W0U604          NLLGFVLNDISAKNG-----------SH-YGYKYSY--KYK-----Y-------------
A0A374B6G0      NLLGFVLNDISAKNG-----------SH-YGYKYSY--KYK-----Y-------------
A0A373VM36      NLLGFVLNDISAKNG-----------SH-YGYKYSY--KYK-----Y-------------
A0A1C5P379      NLLGFVLNDISAKNG-----------SH-YRYKYSY--KYK-----Y-------------
A0A373XXX0      NLLGFVLNDISAKNG-----------SH-YG----Y--KYK-----Y-------------
A0A5R9MJM9      NLLGFVLNDISAKNG-----------SH-YGYKYNY--KYK-----Y-------------
A0A356CW82      NLLGFVLNDISTKNG-----------SH-YGYKYNY--KYK-----Y-------------
R6T4X7          NLLGFVLNDISAKNG-----------SH-YGYKYSY--KYK-----Y-------------
A0A374HTV1      NLLGFVLNDISAKNG-----------SH-YGYKYSY--KYK-----Y-------------
A0A374GB66      NLLGFVLNDISAKNG-----------SH-YGYKYSY--KYK-----Y-------------
A0A374ECC6      NLLGFVLNDISAKNG-----------SH-YGYKYSY--KYK-----Y-------------
A0A374BM61      NLLGFVLNDISAKNG-----------SH-YGYKYSY--KYK-----Y-------------
A0A373UGZ4      NLLGFVLNDISAKNG-----------SH-YGYKYSY--KYK-----Y-------------
A0A373SA66      NLLGFVLNDISAKNG-----------SH-YGYKYSY--KYK-----Y-------------
A0A1C5X6X7      NLLGFVLNDISAKNG-----------SH-YGYKYSY--KYK-----Y-------------
A0A1C6JIH3      NLLGFVLNDISAKNG-----------SH-YGYKYSY--KYK-----Y-------------
A0A373PSC3      NLLGFVLNDISAKNG-----------SH-YGYKYNY--KYK-----Y-------------
A0A1K1WYK8      NMLGFVLNDVHHNHG-----------AN-YYNY-----KYK-----YKKY-------GYG
A0A1H6IUB1      NMLGFIMNDIKMKKS-----------GY-YSSKYKG--KYY-----YKK--------GYG
A0A1M7L1F9      NMLGFIMNDVKIKKA-----------GY-Y-SKYKN--KYY-----YKK--------GYG
A0A1C6B4L6      NMLGFILNSIKNKRS-----------GR-YYSKY----KYD-----YKR--------G--
A0A1Q6T9P4      NMLGFILNGIKNKRS-----------GR-YYSKY----KYD-----YKR--------G--
A0A315Y4F9      NLLGFILNGVKSKHA-----------G--YYSK-------------YGK--------GKY
A0A354K620      NLLGFIMNGINTKRA-----------G--YYAKG----KYY-----YKK--------GYG
A0A355G3J9      KIFGFVVIGVDFKVE-----------QY-GRYKR--------------------------
A0A3D2AD87      NILGAVMNGSHPKNK-----------NK-YIYRKY----SY-----G----------YYG
A0A2T5IYJ6      PLIGVILNKVNMKRA-----------AQ-YYGTYSS--YYA-------------------
A0A3C0QME1      NVIGFVVNNISRKGS-----------GH--YYSYKY--KYK-----Y----------RY-
A0A355FYK5      DIAGAVFTMNDEESR-----------GR-ILNKGGS--GSR-----Y-------------
A0A357AQU0      NVLGVILNAVAGSST-----------GY-GYKKYGY--KYG-----Y----------KYG
A0A3C1YJQ7      NVLGVILNAVAGSST-----------GY-GYKKYGY--KYG-----Y----------KYG
A0A3D0JG38      NVLGVILNAVAGSST-----------GY-GYKKYGY--KYG-----Y----------KYG
A0A3C0IHX1      TVLGLVLTEVDFKQG-----------GY--YKKYYK--KGS-----Y-------------
R5V506          TVLGLVLTEVDFKQG-----------GY--YKKYYK--KGS-----Y-------------
A0A352TIU5      TVLGLVLTEVDFKQG-----------GY--YKKYYK--KGS-----Y-------------
A0A3E5FSY5      CFMGYVFNIYTKKSS-----------E---------------------------------
A0A1V5S3C0      EVFGCIYNNARRGIL-----------SM-AGDTRGG--YFS-----R----------SYS
A0A1Y3TC98      PFTGYVFNNF----P-----------EG-PGEYGY----SR-----Y----------GYG
A0A1Q6REE0      PIIGCALNNV----R-----------RG-LSGSKE----YG-----Y----------GYG
R5ETF9          PIIGCALNNV----R-----------KS-LSGSKE----YG-----Y----------GYG
R6VAT5          KILGCIFNMASGVLS-----------TR-GYGRYG----YN-----S----------YGG
A0A1Q6S448      EFLGCILNDM--------------------AHLTA----YS-----A----------GYG
A0A351MYR0      EFLGCILNDM--------------------SHLTA----YS-----A----------GYG
R6HPC1          EFLGCILNDM--------------------AHLTA----YS-----A----------GYG
A0A3D4G5Z5      EFLGCILNDM--------------------VHLTA----YS-----A----------GYG
A0A3D5ES03      EFLGCILNDM--------------------AHLTA----YS-----A----------GYG
A0A0F2P7X6      RIIGCILNGIKYNQL-----------GA-FYQSQN----YE-----R----------FLG
A0A359B487      RIIGCILNGIKYNQL-----------GA-FYQSRN----YE-----R----------FLG
A0A348P5V4      EIIGCIFNNSENGMS-----------N-------S----KI-----Y----------GRK
A0A356PT74      KLVGCIYNDTESGMP-----------KR-FMSSYN----KK-----Y----------GYG
A0A3D5LL19      KLVGCIYNDTESGMP-----------KR-FMSSYN----KK-----Y----------GYG
R5MNF0          KLVGCIYNDTESGMP-----------NR-FMSSYN----KK-----Y----------GYG
A0A1Q9JSI0      TMLGCVYN------------------DV-FPGFAE----TA-----K----------AYG
A0A3D5TNI1      DLAGCVYNISTDRSR-----------GG-YGSYSV----SR-----R----------RYG
A0A358LJD0      DLAGCVYNISTDRSK-----------GG-YGNYSI----SR-----R----------RYG
R6I3L7          DLAGCVYNISTDRSK-----------GG-YGNYSI----SR-----R----------GYG
A0A3D1HXX0      DLAGCVYNISTDRSK-----------GG-YGNYSI----SR-----R----------RYG
A0A3D2QJB8      DLAGCVYNISTDRSK-----------GG-YGNYSI----SS-----R----------RYG
D4LC36          NVLGFAVNEV--SSK-----------HG-SGYYSN----YK-----Y----------KYK
R7MQJ4          KMLGFILNDISKKHG-----------SY-SKYGYN----YK-----S----------HYY
A0A1V5GLC0      NLLGFILNGI--KIK-----------KN-GKYYSN----YK-----------------YR
W7V182          NMLGFILNDI--KTG-----------RS-GKYYSK----YR-----------------YD
                   .                                                        

A0A0H5SF45      ------------------------------------------------------------
A0A1M6JRJ5      ------------------------------------------------------------
A0A1M7Y1S2      ------------------------------------------------------------
A0A3D5R4X5      VID---------------------------------------------------------
A0A1I4C3N6      VAAR--------------------------------------------------------
A0A3B9CIM7      ------------------------------------------------------------
A0A1G9WHW8      ------------------------------------------------------------
A0A1H5VAA0      ------------------------------------------------------------
A0A3R6VK11      ------------------------------------------------------------
A0A3R6QUY7      ------------------------------------------------------------
A0A373K3P9      ------------------------------------------------------------
A0A3R6JRU5      ------------------------------------------------------------
A0A1C5MS04      ------------------------------------------------------------
A0A3C1J150      ------------------------------------------------------------
A0A416CXD7      ------------------------------------------------------------
R6XBL9          ------------------------------------------------------------
A0A355W5Z7      ------------------------------------------------------------
A0A143WVN6      ------------------------------------------------------------
W6RXP9          ------------------------------------------------------------
W6S4G8          ------------------------------------------------------------
A0A1G6BLB6      E-----------------------------------------------------------
A0A1C6G8M0      ------------------------------------------------------------
A0A416MP73      KAIVN-------------------------------------------------------
A0A3E4LL92      ------------------------------------------------------------
A0A415D1L1      ------------------------------------------------------------
A0A414P2K5      ------------------------------------------------------------
V8C417          ------------------------------------------------------------
A0A143XN92      ------------------------------------------------------------
A0A173ZYY6      ------------------------------------------------------------
A0A4Q5EHM9      ------------------------------------------------------------
A0A173SMI2      ------------------------------------------------------------
A0A174ASH7      ------------------------------------------------------------
A6BH65          ------------------------------------------------------------
R7G0D7          ------------------------------------------------------------
A0A396G6S7      ------------------------------------------------------------
A0A3E5A223      ------------------------------------------------------------
R7D5E6          ------------------------------------------------------------
A0A415HQH5      ------------------------------------------------------------
A0A414W2C6      ------------------------------------------------------------
A5ZNE7          ------------------------------------------------------------
A0A395X821      ------------------------------------------------------------
A0A1C5PY68      ------------------------------------------------------------
A0A174CJF8      ------------------------------------------------------------
A0A564SRR2      ------------------------------------------------------------
A0A174R7V0      ------------------------------------------------------------
A0A373MWV2      ------------------------------------------------------------
A0A417CE88      ------------------------------------------------------------
A0A416Y441      ------------------------------------------------------------
A0A357GPJ7      ------------------------------------------------------------
A0A396PAC1      ------------------------------------------------------------
A0A416EYU4      ------------------------------------------------------------
A0A416SCQ2      ------------------------------------------------------------
A0A416TGN7      ------------------------------------------------------------
A0A417SMF6      ------------------------------------------------------------
A0A1Y4MW77      NEKKAAK-----------------------------------------------------
R6UHV6          E-----------------------------------------------------------
A0A3R9Q621      ------------------------------------------------------------
A0A069RC75      ------------------------------------------------------------
A0A174F2W5      ------------------------------------------------------------
A0A174S8E9      ------------------------------------------------------------
A0A416ZL97      ------------------------------------------------------------
A0A174LSK1      ------------------------------------------------------------
A0A373GY92      ------------------------------------------------------------
A0A373NZQ6      ------------------------------------------------------------
A0A417I9B9      ------------------------------------------------------------
A0A417MP97      ------------------------------------------------------------
A0A417WQF8      ------------------------------------------------------------
A0A373RZ83      ------------------------------------------------------------
A0A416U6I1      ------------------------------------------------------------
R7JQZ9          ------------------------------------------------------------
A0A3B8KKL6      ------------------------------------------------------------
A0A2K9E6R0      ------------------------------------------------------------
A0A2S8RBI0      ------------------------------------------------------------
A0A0L6JLG6      ------------------------------------------------------------
G8LSN0          ------------------------------------------------------------
A0A1M5UYN6      KSKRLKQKSI--------------------------------------------------
A0A176JBT8      ------------------------------------------------------------
A0A1I5HIC6      ------------------------------------------------------------
A0A1Y3TC51      SGEHTARGE-RG------------------------------------------------
A0A1Y3T1N0      YGKNIRRGDQRG------------------------------------------------
A0A1Y3Y8U8      YGKNIRRGDQRG------------------------------------------------
A0A5B0BQY5      ------------------------------------------------------------
A6CLL4          ------------------------------------------------------------
A0A174DL89      ------------------------------------------------------------
A0A176U8D6      ------------------------------------------------------------
A0A1Q6KSQ5      ------------------------------------------------------------
A0A3D3U8B3      ------------------------------------------------------------
A0A3E5FRL7      ------------------------------------------------------------
A0A1Y4QK93      ------------------------------------------------------------
B1C232          ------------------------------------------------------------
A0A401USI6      GRKKRNNNEKPNPINI--------------------------------------------
A0A1V4IQ10      ------------------------------------------------------------
A0A1S8TRD2      ------------------------------------------------------------
G7M1U2          ------------------------------------------------------------
A0A2T6KJ75      ------------------------------------------------------------
A9KN92          ------------------------------------------------------------
A0A352MUJ1      ------------------------------------------------------------
R5YI67          HH----------------------------------------------------------
A0A1Y0IQP5      ------------------------------------------------------------
A0A4R2R7B1      ------------------------------------------------------------
A0A1M6E8I2      ------------------------------------------------------------
A0A1Y4N105      ------------------------------------------------------------
A0A1Y4QP75      ------------------------------------------------------------
A0A3D4QRB5      NKKRRAQHSA--------------------------------------------------
A0A349DEH5      GSYGYGYGQSKK------------------------------------------------
A0A3D4T7B4      GSYGYGYGQSKK------------------------------------------------
A0A350XYC7      GGYG-GYGQSSK------------------------------------------------
R6DNR8          GSYGYGYGQSKK------------------------------------------------
A0A355KUM5      ------------------------------------------------------------
R5YGY6          YGYGYGQSSSKK------------------------------------------------
A0A0K8J554      ------------------------------------------------------------
A0A3N1XSX6      ------------------------------------------------------------
A0A1C6G0U3      ------------------------------------------------------------
A0A3D4LLB3      ------------------------------------------------------------
A0A0A5GPA9      ------------------------------------------------------------
A0A271M6M4      ------------------------------------------------------------
A0A2V3W8U6      ------------------------------------------------------------
W1UFG0          ------------------------------------------------------------
A0A351SRI8      ------------------------------------------------------------
A0A1V5LU59      ------------------------------------------------------------
A0A1E3BVC3      ------------------------------------------------------------
A0A4Q0I6S0      ------------------------------------------------------------
A3DF66          ------------------------------------------------------------
W4V1T8          ------------------------------------------------------------
A0A1I0RG99      ------------------------------------------------------------
A0A1I5G322      ------------------------------------------------------------
A0A1C6ITD7      ------------------------------------------------------------
A0A381IX63      K-----------------------------------------------------------
A0A1G9IUT4      ------------------------------------------------------------
A0A1M6RWV2      ------------------------------------------------------------
A0A143XPI5      YYSINNKD-MELHNK---------------------------------------------
A0A355G1X5      YKSYHSYG-YGYGFE---------------------------------------------
A0A0M6WXE3      -----------YGKY---------------------------------------------
A0A348SAK2      -----------YGKY---------------------------------------------
A0A1G9H5B9      STLGSNLE-TARGST---------------------------------------------
R5EFZ0          ----------NYGSS---------------------------------------------
A0A1Y4H8L0      ------------------------------------------------------------
A0A4B9BMD9      ---------YGYSYS---------------------------------------------
A0A0M6WYQ8      ----------GYRHY---------------------------------------------
A0A348SAK1      ----------GYRHY---------------------------------------------
A0A252F281      -----------YGKS---------------------------------------------
A0A1Y4QKE6      -------R-YGYVK----------------------------------------------
B1C231          -------Q-YRYSKG---------------------------------------------
A0A1Y3TUL5      SASRRGRG-SSSGKS---------------------------------------------
A0A1Y4JAX2      SASRRGRG-SSSGKS---------------------------------------------
A0A1Y4T590      SASRRGRG-SSSGKS---------------------------------------------
R5B467          -----GYG-YGYGSG---------------------------------------------
A0A1Y3T163      -------K-YGYGGG---------------------------------------------
A0A1Y3YCA2      -------K-YGYGGG---------------------------------------------
A0A1Y4L6N9      -------E-YGDEKY---------------------------------------------
A0A173T644      -------K-YGYGEQ---------------------------------------------
A0A1C5TSB8      -------K-YGYGEQ---------------------------------------------
C0CIK6          -------K-YGYGEQ---------------------------------------------
A0A1Y3WEF6      -------S-YGYGER---------------------------------------------
A0A417T0L2      -------S-YGYGKK---------------------------------------------
A0A1H9EPU3      ------------------------------------------------------------
A0A354IGV3      RYGGYGRY-GDYGAA---------------------------------------------
A0A417JMV2      ----YGYG-YGYGYG---------------------------------------------
B0P408          ----YGYG-YGYGYG---------------------------------------------
D4MV82          ----YGYG-YGYGYG---------------------------------------------
A0A415VWX5      ----YGYG-YGYGYG---------------------------------------------
A0A173UY96      ----YGYG-YGYGYG---------------------------------------------
A0A173QTL1      ----YGYG-YGYGYG---------------------------------------------
A0A174A3T7      ----YGYG-YGYGYG---------------------------------------------
A0A174J359      ----YGYG-YGYGYG---------------------------------------------
A0A417UUA3      ----YGYG-YGYGYG---------------------------------------------
A0A1C6EUV9      GKYGYGYG-YGYGRS---------------------------------------------
A0A173Y645      GK--YGYG-YGYGRS---------------------------------------------
A0A374AVY6      ----YGYG-YGYGRS---------------------------------------------
R7BXS4          ----YGYG-YGYGRS---------------------------------------------
A0A143ZUX1      ------------------------------------------------------------
S3FFL2          -----GYGRDEKAGD---------------------------------------------
A0A6A8IF17      -----GYGSGYH------------------------------------------------
A0A6C0V5C7      -----EYKSDSK------------------------------------------------
A0A6C0V5F7      -----DYGYTQE------------------------------------------------
A0A328M4V1      -----AAAKS--------------------------------------------------
A0A5C8HCX2      -----GYSYSEKE-----------------------------------------------
A0A1W1Z4C3      ------YNKYDTRIQ---------------------------------------------
A0A239QN83      ------YNKYDTRSR---------------------------------------------
A0A3R9WAA7      YGYYGKYGRKSYYGK---------------------------------------------
A0A1G6BLF1      KRYGYGYGGYGIKED---------------------------------------------
R6HZX3          ---RYGYGKYGYGTK---------------------------------------------
A0A1W2CEA6      ---------NGYGKQ---------------------------------------------
R7FFK6          -----KYD-YQYRTE---------------------------------------------
A0A373MPB9      -----DYS-YKYGGK---------------------------------------------
A0A373L519      -----DYS-YKYGGK---------------------------------------------
A0A373W906      -----DYS-YKYGGK---------------------------------------------
A0A373VCW2      -----DYS-YKYGGK---------------------------------------------
W0U604          -----DYS-YKYGGK---------------------------------------------
A0A374B6G0      -----DYS-YKYGGK---------------------------------------------
A0A373VM36      -----DYS-YKYGGK---------------------------------------------
A0A1C5P379      -----DYS-YKYGGK---------------------------------------------
A0A373XXX0      -----DYS-YKYGGK---------------------------------------------
A0A5R9MJM9      -----DYS-YKYGGK---------------------------------------------
A0A356CW82      -----DYS-YKYGGK---------------------------------------------
R6T4X7          -----DYS-YKYGGK---------------------------------------------
A0A374HTV1      -----DYS-YKYGGK---------------------------------------------
A0A374GB66      -----DYS-YKYGGK---------------------------------------------
A0A374ECC6      -----DYS-YKYGGK---------------------------------------------
A0A374BM61      -----DYS-YKYGGK---------------------------------------------
A0A373UGZ4      -----DYS-YKYGGK---------------------------------------------
A0A373SA66      -----DYS-YKYGGK---------------------------------------------
A0A1C5X6X7      -----DYS-YKYGGK---------------------------------------------
A0A1C6JIH3      -----DYS-YKYGGK---------------------------------------------
A0A373PSC3      -----DYS-YKYGGK---------------------------------------------
A0A1K1WYK8      YGSY-GYG-YTYGNN---------------------------------------------
A0A1H6IUB1      YGGYGGY----YGSK---------------------------------------------
A0A1M7L1F9      YGGY-GY----YGSK---------------------------------------------
A0A1C6B4L6      Y----GY----YGEK---------------------------------------------
A0A1Q6T9P4      Y----GY----YGEK---------------------------------------------
A0A315Y4F9      Y----GY----YGAK---------------------------------------------
A0A354K620      Y----GY----YGEK---------------------------------------------
A0A355G3J9      ------YGKYGYRSY---------------------------------------------
A0A3D2AD87      SYYKYDYHKNGYNYD---------------------------------------------
A0A2T5IYJ6      ------YGDYVYGSS---------------------------------------------
A0A3C0QME1      KSYEYHYV-SHSEDSMTSTPKLSMREDAPQEVPAETKAVETTAPIEETPAEVVEESAPIE
A0A355FYK5      YKRYYRYG-GKYGYG---------------------------------------------
A0A357AQU0      YKYGYRYG-YGYGNN---------------------------------------------
A0A3C1YJQ7      YKYGYRYG-YGYGNN---------------------------------------------
A0A3D0JG38      YKYGYRYG-YGYGNN---------------------------------------------
A0A3C0IHX1      ----YTYG-NGNGNG---------------------------------------------
R5V506          ----YTYG-NGNGNG---------------------------------------------
A0A352TIU5      ----YTYG-NENGNG---------------------------------------------
A0A3E5FSY5      ------YGHYSYGYN---------------------------------------------
A0A1V5S3C0      YSYSKSYG-ADYGQE---------------------------------------------
A0A1Y3TC98      ---RYGYGKYGYGRY---------------------------------------------
A0A1Q6REE0      YGYGYGYG-YGYGSK---------------------------------------------
R5ETF9          YGYGYGYG-YGYGSK---------------------------------------------
R6VAT5          YGSYGSYGRYGYGYG---------------------------------------------
A0A1Q6S448      YGCGY-YG-YGYGKK---------------------------------------------
A0A351MYR0      YGYGY-YG-YGYGKK---------------------------------------------
R6HPC1          YGYGY-YG-YGYGKK---------------------------------------------
A0A3D4G5Z5      YGYGY-YG-YGYGKK---------------------------------------------
A0A3D5ES03      YGYGY-YG-YGYGKK---------------------------------------------
A0A0F2P7X6      ---DYYKD-YALTNK---------------------------------------------
A0A359B487      ---DYYKN-YALTNK---------------------------------------------
A0A348P5V4      ------YG-YGYGYG---------------------------------------------
A0A356PT74      ------YG-YGYGYG---------------------------------------------
A0A3D5LL19      ------YG-YGYGYG---------------------------------------------
R5MNF0          ------YG-YGYGYG---------------------------------------------
A0A1Q9JSI0      YKYGYGYG-YGYGYG---------------------------------------------
A0A3D5TNI1      YGYGRHYG-YGYGKH---------------------------------------------
A0A358LJD0      ------YG-YSYGKR---------------------------------------------
R6I3L7          ------YG-YGYGKH---------------------------------------------
A0A3D1HXX0      ------YG-YGYGKH---------------------------------------------
A0A3D2QJB8      ------YG-YGYGKH---------------------------------------------
D4LC36          ------YK-YDYQYG---------------------------------------------
R7MQJ4          ------DS-YGYGEE---------------------------------------------
A0A1V5GLC0      ------SV-YGYGND---------------------------------------------
W7V182          ------KG-YGYGVK---------------------------------------------
                                                                            

A0A0H5SF45      ------------------------------------------------------------
A0A1M6JRJ5      ------------------------------------------------------------
A0A1M7Y1S2      ------------------------------------------------------------
A0A3D5R4X5      ------------------------------------------------------------
A0A1I4C3N6      ------------------------------------------------------------
A0A3B9CIM7      ------------------------------------------------------------
A0A1G9WHW8      ------------------------------------------------------------
A0A1H5VAA0      ------------------------------------------------------------
A0A3R6VK11      ------------------------------------------------------------
A0A3R6QUY7      ------------------------------------------------------------
A0A373K3P9      ------------------------------------------------------------
A0A3R6JRU5      ------------------------------------------------------------
A0A1C5MS04      ------------------------------------------------------------
A0A3C1J150      ------------------------------------------------------------
A0A416CXD7      ------------------------------------------------------------
R6XBL9          ------------------------------------------------------------
A0A355W5Z7      ------------------------------------------------------------
A0A143WVN6      ------------------------------------------------------------
W6RXP9          ------------------------------------------------------------
W6S4G8          ------------------------------------------------------------
A0A1G6BLB6      ------------------------------------------------------------
A0A1C6G8M0      ------------------------------------------------------------
A0A416MP73      ------------------------------------------------------------
A0A3E4LL92      ------------------------------------------------------------
A0A415D1L1      ------------------------------------------------------------
A0A414P2K5      ------------------------------------------------------------
V8C417          ------------------------------------------------------------
A0A143XN92      ------------------------------------------------------------
A0A173ZYY6      ------------------------------------------------------------
A0A4Q5EHM9      ------------------------------------------------------------
A0A173SMI2      ------------------------------------------------------------
A0A174ASH7      ------------------------------------------------------------
A6BH65          ------------------------------------------------------------
R7G0D7          ------------------------------------------------------------
A0A396G6S7      ------------------------------------------------------------
A0A3E5A223      ------------------------------------------------------------
R7D5E6          ------------------------------------------------------------
A0A415HQH5      ------------------------------------------------------------
A0A414W2C6      ------------------------------------------------------------
A5ZNE7          ------------------------------------------------------------
A0A395X821      ------------------------------------------------------------
A0A1C5PY68      ------------------------------------------------------------
A0A174CJF8      ------------------------------------------------------------
A0A564SRR2      ------------------------------------------------------------
A0A174R7V0      ------------------------------------------------------------
A0A373MWV2      ------------------------------------------------------------
A0A417CE88      ------------------------------------------------------------
A0A416Y441      ------------------------------------------------------------
A0A357GPJ7      ------------------------------------------------------------
A0A396PAC1      ------------------------------------------------------------
A0A416EYU4      ------------------------------------------------------------
A0A416SCQ2      ------------------------------------------------------------
A0A416TGN7      ------------------------------------------------------------
A0A417SMF6      ------------------------------------------------------------
A0A1Y4MW77      ------------------------------------------------------------
R6UHV6          ------------------------------------------------------------
A0A3R9Q621      ------------------------------------------------------------
A0A069RC75      ------------------------------------------------------------
A0A174F2W5      ------------------------------------------------------------
A0A174S8E9      ------------------------------------------------------------
A0A416ZL97      ------------------------------------------------------------
A0A174LSK1      ------------------------------------------------------------
A0A373GY92      ------------------------------------------------------------
A0A373NZQ6      ------------------------------------------------------------
A0A417I9B9      ------------------------------------------------------------
A0A417MP97      ------------------------------------------------------------
A0A417WQF8      ------------------------------------------------------------
A0A373RZ83      ------------------------------------------------------------
A0A416U6I1      ------------------------------------------------------------
R7JQZ9          ------------------------------------------------------------
A0A3B8KKL6      ------------------------------------------------------------
A0A2K9E6R0      ------------------------------------------------------------
A0A2S8RBI0      ------------------------------------------------------------
A0A0L6JLG6      ------------------------------------------------------------
G8LSN0          ------------------------------------------------------------
A0A1M5UYN6      ------------------------------------------------------------
A0A176JBT8      ------------------------------------------------------------
A0A1I5HIC6      ------------------------------------------------------------
A0A1Y3TC51      ------------------------------------------------------------
A0A1Y3T1N0      ------------------------------------------------------------
A0A1Y3Y8U8      ------------------------------------------------------------
A0A5B0BQY5      ------------------------------------------------------------
A6CLL4          ------------------------------------------------------------
A0A174DL89      ------------------------------------------------------------
A0A176U8D6      ------------------------------------------------------------
A0A1Q6KSQ5      ------------------------------------------------------------
A0A3D3U8B3      ------------------------------------------------------------
A0A3E5FRL7      ------------------------------------------------------------
A0A1Y4QK93      ------------------------------------------------------------
B1C232          ------------------------------------------------------------
A0A401USI6      ------------------------------------------------------------
A0A1V4IQ10      ------------------------------------------------------------
A0A1S8TRD2      ------------------------------------------------------------
G7M1U2          ------------------------------------------------------------
A0A2T6KJ75      ------------------------------------------------------------
A9KN92          ------------------------------------------------------------
A0A352MUJ1      ------------------------------------------------------------
R5YI67          ------------------------------------------------------------
A0A1Y0IQP5      ------------------------------------------------------------
A0A4R2R7B1      ------------------------------------------------------------
A0A1M6E8I2      ------------------------------------------------------------
A0A1Y4N105      ------------------------------------------------------------
A0A1Y4QP75      ------------------------------------------------------------
A0A3D4QRB5      ------------------------------------------------------------
A0A349DEH5      ------------------------------------------------------------
A0A3D4T7B4      ------------------------------------------------------------
A0A350XYC7      ------------------------------------------------------------
R6DNR8          ------------------------------------------------------------
A0A355KUM5      ------------------------------------------------------------
R5YGY6          ------------------------------------------------------------
A0A0K8J554      ------------------------------------------------------------
A0A3N1XSX6      ------------------------------------------------------------
A0A1C6G0U3      ------------------------------------------------------------
A0A3D4LLB3      ------------------------------------------------------------
A0A0A5GPA9      ------------------------------------------------------------
A0A271M6M4      ------------------------------------------------------------
A0A2V3W8U6      ------------------------------------------------------------
W1UFG0          ------------------------------------------------------------
A0A351SRI8      ------------------------------------------------------------
A0A1V5LU59      ------------------------------------------------------------
A0A1E3BVC3      ------------------------------------------------------------
A0A4Q0I6S0      ------------------------------------------------------------
A3DF66          ------------------------------------------------------------
W4V1T8          ------------------------------------------------------------
A0A1I0RG99      ------------------------------------------------------------
A0A1I5G322      ------------------------------------------------------------
A0A1C6ITD7      ------------------------------------------------------------
A0A381IX63      ------------------------------------------------------------
A0A1G9IUT4      ------------------------------------------------------------
A0A1M6RWV2      ------------------------------------------------------------
A0A143XPI5      ------------------------------------------------------------
A0A355G1X5      ------------------------------------------------------------
A0A0M6WXE3      ------------------------------------------------------------
A0A348SAK2      ------------------------------------------------------------
A0A1G9H5B9      ------------------------------------------------------------
R5EFZ0          ------------------------------------------------------------
A0A1Y4H8L0      ------------------------------------------------------------
A0A4B9BMD9      ------------------------------------------------------------
A0A0M6WYQ8      ------------------------------------------------------------
A0A348SAK1      ------------------------------------------------------------
A0A252F281      ------------------------------------------------------------
A0A1Y4QKE6      ------------------------------------------------------------
B1C231          ------------------------------------------------------------
A0A1Y3TUL5      ------------------------------------------------------------
A0A1Y4JAX2      ------------------------------------------------------------
A0A1Y4T590      ------------------------------------------------------------
R5B467          ------------------------------------------------------------
A0A1Y3T163      ------------------------------------------------------------
A0A1Y3YCA2      ------------------------------------------------------------
A0A1Y4L6N9      ------------------------------------------------------------
A0A173T644      ------------------------------------------------------------
A0A1C5TSB8      ------------------------------------------------------------
C0CIK6          ------------------------------------------------------------
A0A1Y3WEF6      ------------------------------------------------------------
A0A417T0L2      ------------------------------------------------------------
A0A1H9EPU3      ------------------------------------------------------------
A0A354IGV3      ------------------------------------------------------------
A0A417JMV2      ------------------------------------------------------------
B0P408          ------------------------------------------------------------
D4MV82          ------------------------------------------------------------
A0A415VWX5      ------------------------------------------------------------
A0A173UY96      ------------------------------------------------------------
A0A173QTL1      ------------------------------------------------------------
A0A174A3T7      ------------------------------------------------------------
A0A174J359      ------------------------------------------------------------
A0A417UUA3      ------------------------------------------------------------
A0A1C6EUV9      ------------------------------------------------------------
A0A173Y645      ------------------------------------------------------------
A0A374AVY6      ------------------------------------------------------------
R7BXS4          ------------------------------------------------------------
A0A143ZUX1      ------------------------------------------------------------
S3FFL2          ------------------------------------------------------------
A0A6A8IF17      ------------------------------------------------------------
A0A6C0V5C7      ------------------------------------------------------------
A0A6C0V5F7      ------------------------------------------------------------
A0A328M4V1      ------------------------------------------------------------
A0A5C8HCX2      ------------------------------------------------------------
A0A1W1Z4C3      ------------------------------------------------------------
A0A239QN83      ------------------------------------------------------------
A0A3R9WAA7      ------------------------------------------------------------
A0A1G6BLF1      ------------------------------------------------------------
R6HZX3          ------------------------------------------------------------
A0A1W2CEA6      ------------------------------------------------------------
R7FFK6          ------------------------------------------------------------
A0A373MPB9      ------------------------------------------------------------
A0A373L519      ------------------------------------------------------------
A0A373W906      ------------------------------------------------------------
A0A373VCW2      ------------------------------------------------------------
W0U604          ------------------------------------------------------------
A0A374B6G0      ------------------------------------------------------------
A0A373VM36      ------------------------------------------------------------
A0A1C5P379      ------------------------------------------------------------
A0A373XXX0      ------------------------------------------------------------
A0A5R9MJM9      ------------------------------------------------------------
A0A356CW82      ------------------------------------------------------------
R6T4X7          ------------------------------------------------------------
A0A374HTV1      ------------------------------------------------------------
A0A374GB66      ------------------------------------------------------------
A0A374ECC6      ------------------------------------------------------------
A0A374BM61      ------------------------------------------------------------
A0A373UGZ4      ------------------------------------------------------------
A0A373SA66      ------------------------------------------------------------
A0A1C5X6X7      ------------------------------------------------------------
A0A1C6JIH3      ------------------------------------------------------------
A0A373PSC3      ------------------------------------------------------------
A0A1K1WYK8      ------------------------------------------------------------
A0A1H6IUB1      ------------------------------------------------------------
A0A1M7L1F9      ------------------------------------------------------------
A0A1C6B4L6      ------------------------------------------------------------
A0A1Q6T9P4      ------------------------------------------------------------
A0A315Y4F9      ------------------------------------------------------------
A0A354K620      ------------------------------------------------------------
A0A355G3J9      ------------------------------------------------------------
A0A3D2AD87      ------------------------------------------------------------
A0A2T5IYJ6      ------------------------------------------------------------
A0A3C0QME1      ETPAEVVEESAPIEETPAEVVEESAPIEETPAEVVEESAPIEETPAELLEAENLLEEIPL
A0A355FYK5      ------------------------------------------------------------
A0A357AQU0      ------------------------------------------------------------
A0A3C1YJQ7      ------------------------------------------------------------
A0A3D0JG38      ------------------------------------------------------------
A0A3C0IHX1      ------------------------------------------------------------
R5V506          ------------------------------------------------------------
A0A352TIU5      ------------------------------------------------------------
A0A3E5FSY5      ------------------------------------------------------------
A0A1V5S3C0      ------------------------------------------------------------
A0A1Y3TC98      ------------------------------------------------------------
A0A1Q6REE0      ------------------------------------------------------------
R5ETF9          ------------------------------------------------------------
R6VAT5          ------------------------------------------------------------
A0A1Q6S448      ------------------------------------------------------------
A0A351MYR0      ------------------------------------------------------------
R6HPC1          ------------------------------------------------------------
A0A3D4G5Z5      ------------------------------------------------------------
A0A3D5ES03      ------------------------------------------------------------
A0A0F2P7X6      ------------------------------------------------------------
A0A359B487      ------------------------------------------------------------
A0A348P5V4      ------------------------------------------------------------
A0A356PT74      ------------------------------------------------------------
A0A3D5LL19      ------------------------------------------------------------
R5MNF0          ------------------------------------------------------------
A0A1Q9JSI0      ------------------------------------------------------------
A0A3D5TNI1      ------------------------------------------------------------
A0A358LJD0      ------------------------------------------------------------
R6I3L7          ------------------------------------------------------------
A0A3D1HXX0      ------------------------------------------------------------
A0A3D2QJB8      ------------------------------------------------------------
D4LC36          ------------------------------------------------------------
R7MQJ4          ------------------------------------------------------------
A0A1V5GLC0      ------------------------------------------------------------
W7V182          ------------------------------------------------------------
                                                                            

A0A0H5SF45      ------------------------------------------------------------
A0A1M6JRJ5      ------------------------------------------------------------
A0A1M7Y1S2      ------------------------------------------------------------
A0A3D5R4X5      ------------------------------------------------------------
A0A1I4C3N6      ------------------------------------------------------------
A0A3B9CIM7      ------------------------------------------------------------
A0A1G9WHW8      ------------------------------------------------------------
A0A1H5VAA0      ------------------------------------------------------------
A0A3R6VK11      ------------------------------------------------------------
A0A3R6QUY7      ------------------------------------------------------------
A0A373K3P9      ------------------------------------------------------------
A0A3R6JRU5      ------------------------------------------------------------
A0A1C5MS04      ------------------------------------------------------------
A0A3C1J150      ------------------------------------------------------------
A0A416CXD7      ------------------------------------------------------------
R6XBL9          ------------------------------------------------------------
A0A355W5Z7      ------------------------------------------------------------
A0A143WVN6      ------------------------------------------------------------
W6RXP9          ------------------------------------------------------------
W6S4G8          ------------------------------------------------------------
A0A1G6BLB6      ------------------------------------------------------------
A0A1C6G8M0      ------------------------------------------------------------
A0A416MP73      ------------------------------------------------------------
A0A3E4LL92      ------------------------------------------------------------
A0A415D1L1      ------------------------------------------------------------
A0A414P2K5      ------------------------------------------------------------
V8C417          ------------------------------------------------------------
A0A143XN92      ------------------------------------------------------------
A0A173ZYY6      ------------------------------------------------------------
A0A4Q5EHM9      ------------------------------------------------------------
A0A173SMI2      ------------------------------------------------------------
A0A174ASH7      ------------------------------------------------------------
A6BH65          ------------------------------------------------------------
R7G0D7          ------------------------------------------------------------
A0A396G6S7      ------------------------------------------------------------
A0A3E5A223      ------------------------------------------------------------
R7D5E6          ------------------------------------------------------------
A0A415HQH5      ------------------------------------------------------------
A0A414W2C6      ------------------------------------------------------------
A5ZNE7          ------------------------------------------------------------
A0A395X821      ------------------------------------------------------------
A0A1C5PY68      ------------------------------------------------------------
A0A174CJF8      ------------------------------------------------------------
A0A564SRR2      ------------------------------------------------------------
A0A174R7V0      ------------------------------------------------------------
A0A373MWV2      ------------------------------------------------------------
A0A417CE88      ------------------------------------------------------------
A0A416Y441      ------------------------------------------------------------
A0A357GPJ7      ------------------------------------------------------------
A0A396PAC1      ------------------------------------------------------------
A0A416EYU4      ------------------------------------------------------------
A0A416SCQ2      ------------------------------------------------------------
A0A416TGN7      ------------------------------------------------------------
A0A417SMF6      ------------------------------------------------------------
A0A1Y4MW77      ------------------------------------------------------------
R6UHV6          ------------------------------------------------------------
A0A3R9Q621      ------------------------------------------------------------
A0A069RC75      ------------------------------------------------------------
A0A174F2W5      ------------------------------------------------------------
A0A174S8E9      ------------------------------------------------------------
A0A416ZL97      ------------------------------------------------------------
A0A174LSK1      ------------------------------------------------------------
A0A373GY92      ------------------------------------------------------------
A0A373NZQ6      ------------------------------------------------------------
A0A417I9B9      ------------------------------------------------------------
A0A417MP97      ------------------------------------------------------------
A0A417WQF8      ------------------------------------------------------------
A0A373RZ83      ------------------------------------------------------------
A0A416U6I1      ------------------------------------------------------------
R7JQZ9          ------------------------------------------------------------
A0A3B8KKL6      ------------------------------------------------------------
A0A2K9E6R0      ------------------------------------------------------------
A0A2S8RBI0      ------------------------------------------------------------
A0A0L6JLG6      ------------------------------------------------------------
G8LSN0          ------------------------------------------------------------
A0A1M5UYN6      ------------------------------------------------------------
A0A176JBT8      ------------------------------------------------------------
A0A1I5HIC6      ------------------------------------------------------------
A0A1Y3TC51      ------------------------------------------------------------
A0A1Y3T1N0      ------------------------------------------------------------
A0A1Y3Y8U8      ------------------------------------------------------------
A0A5B0BQY5      ------------------------------------------------------------
A6CLL4          ------------------------------------------------------------
A0A174DL89      ------------------------------------------------------------
A0A176U8D6      ------------------------------------------------------------
A0A1Q6KSQ5      ------------------------------------------------------------
A0A3D3U8B3      ------------------------------------------------------------
A0A3E5FRL7      ------------------------------------------------------------
A0A1Y4QK93      ------------------------------------------------------------
B1C232          ------------------------------------------------------------
A0A401USI6      ------------------------------------------------------------
A0A1V4IQ10      ------------------------------------------------------------
A0A1S8TRD2      ------------------------------------------------------------
G7M1U2          ------------------------------------------------------------
A0A2T6KJ75      ------------------------------------------------------------
A9KN92          ------------------------------------------------------------
A0A352MUJ1      ------------------------------------------------------------
R5YI67          ------------------------------------------------------------
A0A1Y0IQP5      ------------------------------------------------------------
A0A4R2R7B1      ------------------------------------------------------------
A0A1M6E8I2      ------------------------------------------------------------
A0A1Y4N105      ------------------------------------------------------------
A0A1Y4QP75      ------------------------------------------------------------
A0A3D4QRB5      ------------------------------------------------------------
A0A349DEH5      ------------------------------------------------------------
A0A3D4T7B4      ------------------------------------------------------------
A0A350XYC7      ------------------------------------------------------------
R6DNR8          ------------------------------------------------------------
A0A355KUM5      ------------------------------------------------------------
R5YGY6          ------------------------------------------------------------
A0A0K8J554      ------------------------------------------------------------
A0A3N1XSX6      ------------------------------------------------------------
A0A1C6G0U3      ------------------------------------------------------------
A0A3D4LLB3      ------------------------------------------------------------
A0A0A5GPA9      ------------------------------------------------------------
A0A271M6M4      ------------------------------------------------------------
A0A2V3W8U6      ------------------------------------------------------------
W1UFG0          ------------------------------------------------------------
A0A351SRI8      ------------------------------------------------------------
A0A1V5LU59      ------------------------------------------------------------
A0A1E3BVC3      ------------------------------------------------------------
A0A4Q0I6S0      ------------------------------------------------------------
A3DF66          ------------------------------------------------------------
W4V1T8          ------------------------------------------------------------
A0A1I0RG99      ------------------------------------------------------------
A0A1I5G322      ------------------------------------------------------------
A0A1C6ITD7      ------------------------------------------------------------
A0A381IX63      ------------------------------------------------------------
A0A1G9IUT4      ------------------------------------------------------------
A0A1M6RWV2      ------------------------------------------------------------
A0A143XPI5      -------------------STSQEK-----------------------------------
A0A355G1X5      -------------------DDEESAG----------------------------------
A0A0M6WXE3      -------------------TNNKEV-----------------------------------
A0A348SAK2      -------------------ANNKEV-----------------------------------
A0A1G9H5B9      -------------------LQTNQGSTQGSNLETTRGSTHINTQETENESADHRSVDK--
R5EFZ0          -------------------GSRK-------------------------------------
A0A1Y4H8L0      ------------------------------------------------------------
A0A4B9BMD9      -------------------EKE--------------------------------------
A0A0M6WYQ8      -------------------SRYEKQF-----------------DEPEEETGAVNQKEVFT
A0A348SAK1      -------------------SRYEKQL-----------------DEPVAETGAVNQKEVFT
A0A252F281      -------------------SRKREG-----------------------------------
A0A1Y4QKE6      -------------------DEYKE------------------------------------
B1C231          -------------------GEYKE------------------------------------
A0A1Y3TUL5      -------------------SSRH-------------------------------------
A0A1Y4JAX2      -------------------SSRH-------------------------------------
A0A1Y4T590      -------------------SSRH-------------------------------------
R5B467          -------------------ENRERNG----------------------------------
A0A1Y3T163      -------------------SYRQPYG-------------------------QKNAYEEEE
A0A1Y3YCA2      -------------------SYRQPYG-------------------------QKNAY-EEE
A0A1Y4L6N9      -------------------ANREK------------------------------------
A0A173T644      -------------------DEETQS-----------------------------------
A0A1C5TSB8      -------------------DEETQS-----------------------------------
C0CIK6          -------------------DEETQS-----------------------------------
A0A1Y3WEF6      -------------------KNRERIS-------------------------AEEDRGRNR
A0A417T0L2      -------------------QESKKKN-------------------------DTEELQS--
A0A1H9EPU3      -----------------------------------------------------SYENEEA
A0A354IGV3      -------------------AQAEAEN------------------------VSATDKEPEV
A0A417JMV2      -------------------SRTKKGN---------------------EDKTQESKTERQV
B0P408          -------------------SRTKKGN---------------------EDKTQESKTERQV
D4MV82          -------------------SRTKKGN---------------------EDKTQESKTERQV
A0A415VWX5      -------------------SRTKKGN---------------------EDKTQESKTERQV
A0A173UY96      -------------------SRTKKGN---------------------EDKTQESKTERQV
A0A173QTL1      -------------------SRTKKGN---------------------EDKTQESKTERQV
A0A174A3T7      -------------------SRTKKGN---------------------EDKTQESKTERQV
A0A174J359      -------------------SRTKKGN---------------------EDKTQESKTERQV
A0A417UUA3      -------------------SRTKKGN---------------------EDKTQESKTERQV
A0A1C6EUV9      -------------------SRQSQKEDQKEEHQKEQYKKEDHNKEQKEQHNKDSVTERQV
A0A173Y645      -------------------SRQSKQE------------------EQKEQHNKDSVTERQV
A0A374AVY6      -------------------SRQSKQE------------------EQKEQHNKDSVTERQV
R7BXS4          -------------------SRQSKQE------------------EQKEQHNKDSVTERQV
A0A143ZUX1      -------------------RESDSSQSQSSKKKQRITRNG--------------------
S3FFL2          ------------------------------------------------------------
A0A6A8IF17      ------------------------------------------------------------
A0A6C0V5C7      ------------------------------------------------------------
A0A6C0V5F7      ------------------------------------------------------------
A0A328M4V1      ------------------------------------------------------------
A0A5C8HCX2      ------------------------------------------------------------
A0A1W1Z4C3      -------------------ASSQKLSQNDNRNQETRNNRRGNKE----------------
A0A239QN83      -------------------VIG-----------DPDNPKKKQKQ----------------
A0A3R9WAA7      -------------------NTGIAANQVD-------------------------------
A0A1G6BLF1      -------------------EEKKSENNK--------------------------------
R6HZX3          -------------------YGYGKNGSRKQDNAHRSSGDLGRG-----------------
A0A1W2CEA6      -------------------ETKAGRHPVRIKKGN--------------------------
R7FFK6          -------------------PSETESTETVAAEAEADAKHIEGEKQA--------------
A0A373MPB9      -------------------DTSAES-----------------------------------
A0A373L519      -------------------DTSAES-----------------------------------
A0A373W906      -------------------DTSAES-----------------------------------
A0A373VCW2      -------------------DASAES-----------------------------------
W0U604          -------------------DASAES-----------------------------------
A0A374B6G0      -------------------DASAES-----------------------------------
A0A373VM36      -------------------DASAES-----------------------------------
A0A1C5P379      -------------------DTSAES-----------------------------------
A0A373XXX0      -------------------DASAES-----------------------------------
A0A5R9MJM9      -------------------DTSAES-----------------------------------
A0A356CW82      -------------------DTSAES-----------------------------------
R6T4X7          -------------------DTSAES-----------------------------------
A0A374HTV1      -------------------DTSAES-----------------------------------
A0A374GB66      -------------------DTSAES-----------------------------------
A0A374ECC6      -------------------DASAES-----------------------------------
A0A374BM61      -------------------DASAES-----------------------------------
A0A373UGZ4      -------------------DTSAES-----------------------------------
A0A373SA66      -------------------DTSAES-----------------------------------
A0A1C5X6X7      -------------------DTSAES-----------------------------------
A0A1C6JIH3      -------------------DASAES-----------------------------------
A0A373PSC3      -------------------DASAES-----------------------------------
A0A1K1WYK8      -------------------PTE------------------------------ETKENENA
A0A1H6IUB1      -------------------PET-DDDTAEEVKEETAKKETVKKESPSTKTNKNSKNKNAK
A0A1M7L1F9      -------------------PETSDDDTDVEEKEETVKKEAAPKKT-NNNSNNKSKKSNGK
A0A1C6B4L6      -------------------TDK------------------------------NETKNEKK
A0A1Q6T9P4      -------------------TDT------------------------------NETKNEKK
A0A315Y4F9      -------------------PEL------------------------------DTVEAKAE
A0A354K620      -------------------PEP------------------------------DTEESKAE
A0A355G3J9      -------------------RYSKEYGYKKKYDRSYESYDREKAQTKKRKHNKKKI-----
A0A3D2AD87      ----------------------------------YTSKPESQKETGEQ------------
A0A2T5IYJ6      -------------------KKKD-------------------------------------
A0A3C0QME1      QDAEEAPVKSAIEEAPVALTEETAVEESSEQADIETTKVDLSKESDKKESE---------
A0A355FYK5      -------------------DGKYGYGSGGSGYGSGSGGYGYGYGSGGYG-----------
A0A357AQU0      -------------------NEKKA-------EEALAAKKEQEKATDKKS-----------
A0A3C1YJQ7      -------------------NEKKA-------EEALAAKKEQEKATDKKS-----------
A0A3D0JG38      -------------------NEKKA-------EEALAAKKEQEKATDKKS-----------
A0A3C0IHX1      -------------------SKKKSHSHSTQQSEPVSTTTDTDSDKQPVS-----------
R5V506          -------------------SKKKSHSHSTQQSEPVSTTTDTDSDKQPVS-----------
A0A352TIU5      -------------------SKKKSHSHSTQQSEPVSTTTDTDSDKQPVS-----------
A0A3E5FSY5      -------------------Q----------YRYSKGGEYKE-------------------
A0A1V5S3C0      -------------------SNTRRK-----------------------------------
A0A1Y3TC98      -----------------------GYGKYGYGRYGYGSDGDETETEEQED-----------
A0A1Q6REE0      -------------------SRQEKK-----------------------------------
R5ETF9          -------------------SRQEKK-----------------------------------
R6VAT5          -------------------Q----------YGDYYGNEENSQAEEASYTDSDSADED---
A0A1Q6S448      -------------------Y----------DKYGCGHRSGQKQQ----------------
A0A351MYR0      -------------------Y----------DKYGYGHRSGRKQQ----------------
R6HPC1          -------------------Y----------DKYGYGHRSGQKQQ----------------
A0A3D4G5Z5      -------------------Y----------DKYGYGHRSGQKQQ----------------
A0A3D5ES03      -------------------Y----------DKYGYGHRSGQKQQ----------------
A0A0F2P7X6      -------------------PAQEAAAASDKN-----------------------------
A0A359B487      -------------------PAQEAAAASDKN-----------------------------
A0A348P5V4      ------------------------------------------------------------
A0A356PT74      -------------------SNQK-------------------------------------
A0A3D5LL19      -------------------SNQK-------------------------------------
R5MNF0          -------------------SNQK-------------------------------------
A0A1Q9JSI0      ---------------------YGSYGYGGKYGYGYGKRDQKKSERSKLKTDKSKSDF---
A0A3D5TNI1      ---------------------YG-------YGYGYGGHAGSRDKKDK-------------
A0A358LJD0      -------------------YGYG-------YGYGYGGHSGSNDKNSRSK-----------
R6I3L7          ---------------------YG-------YGYGYGSHSGSHGKNSK-------------
A0A3D1HXX0      ---------------------YG-------YGYGYGSHSGSHGKNSK-------------
A0A3D2QJB8      ---------------------YG-------YGYGYGSHSGSHGKNSK-------------
D4LC36          -------------------SAKQAE------------------------EKEKAGSAC--
R7MQJ4          -------------------TSEDKD----------------ESKKDKSDNKVKKEKK---
A0A1V5GLC0      -------------------PEQDDDDSSDSDKNNKSDSKENDKKDSKNNKKGKKGGK---
W7V182          -------------------YEEDSD-----EDKTETPEKSEKKTEEKNQSKKKKGGK---
                                                                            

A0A0H5SF45      -----
A0A1M6JRJ5      -----
A0A1M7Y1S2      -----
A0A3D5R4X5      -----
A0A1I4C3N6      -----
A0A3B9CIM7      -----
A0A1G9WHW8      -----
A0A1H5VAA0      -----
A0A3R6VK11      -----
A0A3R6QUY7      -----
A0A373K3P9      -----
A0A3R6JRU5      -----
A0A1C5MS04      -----
A0A3C1J150      -----
A0A416CXD7      -----
R6XBL9          -----
A0A355W5Z7      -----
A0A143WVN6      -----
W6RXP9          -----
W6S4G8          -----
A0A1G6BLB6      -----
A0A1C6G8M0      -----
A0A416MP73      -----
A0A3E4LL92      -----
A0A415D1L1      -----
A0A414P2K5      -----
V8C417          -----
A0A143XN92      -----
A0A173ZYY6      -----
A0A4Q5EHM9      -----
A0A173SMI2      -----
A0A174ASH7      -----
A6BH65          -----
R7G0D7          -----
A0A396G6S7      -----
A0A3E5A223      -----
R7D5E6          -----
A0A415HQH5      -----
A0A414W2C6      -----
A5ZNE7          -----
A0A395X821      -----
A0A1C5PY68      -----
A0A174CJF8      -----
A0A564SRR2      -----
A0A174R7V0      -----
A0A373MWV2      -----
A0A417CE88      -----
A0A416Y441      -----
A0A357GPJ7      -----
A0A396PAC1      -----
A0A416EYU4      -----
A0A416SCQ2      -----
A0A416TGN7      -----
A0A417SMF6      -----
A0A1Y4MW77      -----
R6UHV6          -----
A0A3R9Q621      -----
A0A069RC75      -----
A0A174F2W5      -----
A0A174S8E9      -----
A0A416ZL97      -----
A0A174LSK1      -----
A0A373GY92      -----
A0A373NZQ6      -----
A0A417I9B9      -----
A0A417MP97      -----
A0A417WQF8      -----
A0A373RZ83      -----
A0A416U6I1      -----
R7JQZ9          -----
A0A3B8KKL6      -----
A0A2K9E6R0      -----
A0A2S8RBI0      -----
A0A0L6JLG6      -----
G8LSN0          -----
A0A1M5UYN6      -----
A0A176JBT8      -----
A0A1I5HIC6      -----
A0A1Y3TC51      -----
A0A1Y3T1N0      -----
A0A1Y3Y8U8      -----
A0A5B0BQY5      -----
A6CLL4          -----
A0A174DL89      -----
A0A176U8D6      -----
A0A1Q6KSQ5      -----
A0A3D3U8B3      -----
A0A3E5FRL7      -----
A0A1Y4QK93      -----
B1C232          -----
A0A401USI6      -----
A0A1V4IQ10      -----
A0A1S8TRD2      -----
G7M1U2          -----
A0A2T6KJ75      -----
A9KN92          -----
A0A352MUJ1      -----
R5YI67          -----
A0A1Y0IQP5      -----
A0A4R2R7B1      -----
A0A1M6E8I2      -----
A0A1Y4N105      -----
A0A1Y4QP75      -----
A0A3D4QRB5      -----
A0A349DEH5      -----
A0A3D4T7B4      -----
A0A350XYC7      -----
R6DNR8          -----
A0A355KUM5      -----
R5YGY6          -----
A0A0K8J554      -----
A0A3N1XSX6      -----
A0A1C6G0U3      -----
A0A3D4LLB3      -----
A0A0A5GPA9      -----
A0A271M6M4      -----
A0A2V3W8U6      -----
W1UFG0          -----
A0A351SRI8      -----
A0A1V5LU59      -----
A0A1E3BVC3      -----
A0A4Q0I6S0      -----
A3DF66          -----
W4V1T8          -----
A0A1I0RG99      -----
A0A1I5G322      -----
A0A1C6ITD7      -----
A0A381IX63      -----
A0A1G9IUT4      -----
A0A1M6RWV2      -----
A0A143XPI5      -----
A0A355G1X5      --NEE
A0A0M6WXE3      -----
A0A348SAK2      -----
A0A1G9H5B9      -----
R5EFZ0          -----
A0A1Y4H8L0      RGEQQ
A0A4B9BMD9      -----
A0A0M6WYQ8      ETKEN
A0A348SAK1      ETKET
A0A252F281      -----
A0A1Y4QKE6      -----
B1C231          -----
A0A1Y3TUL5      -----
A0A1Y4JAX2      -----
A0A1Y4T590      -----
R5B467          ---AD
A0A1Y3T163      AENG-
A0A1Y3YCA2      AGNG-
A0A1Y4L6N9      -----
A0A173T644      -----
A0A1C5TSB8      -----
C0CIK6          -----
A0A1Y3WEF6      RAKDD
A0A417T0L2      -----
A0A1H9EPU3      SKDKK
A0A354IGV3      K----
A0A417JMV2      KKDHE
B0P408          KKDHE
D4MV82          KKDHE
A0A415VWX5      KKDHE
A0A173UY96      KKDHE
A0A173QTL1      KKDHE
A0A174A3T7      KKDHE
A0A174J359      KKDHE
A0A417UUA3      KKDHE
A0A1C6EUV9      KKEDE
A0A173Y645      KKEDE
A0A374AVY6      KKEDE
R7BXS4          KKEDE
A0A143ZUX1      -----
S3FFL2          -----
A0A6A8IF17      -----
A0A6C0V5C7      -----
A0A6C0V5F7      -----
A0A328M4V1      -----
A0A5C8HCX2      -----
A0A1W1Z4C3      -----
A0A239QN83      -----
A0A3R9WAA7      -----
A0A1G6BLF1      -----
R6HZX3          -----
A0A1W2CEA6      -----
R7FFK6          -----
A0A373MPB9      -----
A0A373L519      -----
A0A373W906      -----
A0A373VCW2      -----
W0U604          -----
A0A374B6G0      -----
A0A373VM36      -----
A0A1C5P379      -----
A0A373XXX0      -----
A0A5R9MJM9      -----
A0A356CW82      -----
R6T4X7          -----
A0A374HTV1      -----
A0A374GB66      -----
A0A374ECC6      -----
A0A374BM61      -----
A0A373UGZ4      -----
A0A373SA66      -----
A0A1C5X6X7      -----
A0A1C6JIH3      -----
A0A373PSC3      -----
A0A1K1WYK8      D----
A0A1H6IUB1      KKGKK
A0A1M7L1F9      KKGKK
A0A1C6B4L6      -----
A0A1Q6T9P4      -----
A0A315Y4F9      TQGKD
A0A354K620      TQEKN
A0A355G3J9      -----
A0A3D2AD87      -----
A0A2T5IYJ6      -----
A0A3C0QME1      -----
A0A355FYK5      -----
A0A357AQU0      -----
A0A3C1YJQ7      -----
A0A3D0JG38      -----
A0A3C0IHX1      -----
R5V506          -----
A0A352TIU5      -----
A0A3E5FSY5      -----
A0A1V5S3C0      -----
A0A1Y3TC98      -----
A0A1Q6REE0      -----
R5ETF9          -----
R6VAT5          -----
A0A1Q6S448      -----
A0A351MYR0      -----
R6HPC1          -----
A0A3D4G5Z5      -----
A0A3D5ES03      -----
A0A0F2P7X6      -----
A0A359B487      -----
A0A348P5V4      -----
A0A356PT74      -----
A0A3D5LL19      -----
R5MNF0          -----
A0A1Q9JSI0      -----
A0A3D5TNI1      -----
A0A358LJD0      -----
R6I3L7          -----
A0A3D1HXX0      -----
A0A3D2QJB8      -----
D4LC36          -----
R7MQJ4          -----
A0A1V5GLC0      -----
W7V182          -----
                     

© 1998-2021Legal notice