BYKdb

Dataset for cluster tadcd of phylum firmicutes

[Download (right click)] [Edit] [Sequences] [Repertoires]

255 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


S3FFL2          ------------------------------------------------------------
A0A328M4V1      ------------------------------------------------------------
A0A6A8IF17      ------------------------------------------------------------
A0A3D5R4X5      --------------------------------------------MTREERYL--------
A0A1I4C3N6      -----------------------------------------------MFKIF--------
A0A3B9CIM7      -----------------------------------------------MFKTI--------
A0A1G9WHW8      -----------------------------------------------MFKII--------
A0A1H5VAA0      -----------------------------------------------MFKII--------
A0A3R6VK11      -----------------------------------------------MLETI--------
A0A3R6QUY7      -----------------------------------------------MLETI--------
A0A373K3P9      -----------------------------------------------MLETI--------
A0A3R6JRU5      -----------------------------------------------MLETI--------
A0A1C5MS04      -----------------------------------------------MLETI--------
A0A3C1J150      -----------------------------------------------MLETI--------
A0A416CXD7      -----------------------------------------------MLETI--------
A0A6N2X662      -----------------------------------------------MLETI--------
R6XBL9          -----------------------------------------------MLETI--------
A0A355W5Z7      -----------------------------------------------MLETI--------
A0A143WVN6      ------------------------------------------------MEFQ--------
W6RXP9          ------------------------------------------MEQ----EIL--------
W6S4G8          ------------------------------------------MEEVKVVEEF--------
A0A1G6BLB6      ----------------------------------------MQFEERNEEPVQ--------
A0A1C6G8M0      -------------------------------MGGVCDFMENKKAVAV-ENAA--------
A0A416MP73      --------------------------------------MESKEITAMGASAE--------
A0A3E4LL92      -----------------------------------------MSQESYKSQSL--------
A0A415D1L1      -----------------------------------------MSQEGYKSQSL--------
A0A0H5SF45      ------------------------------------------------------------
A0A1M6JRJ5      ------------------------------------------------------------
A0A1M7Y1S2      ------------------------------------------------------------
A0A7I8DMN1      ------------------------------------------------------------
A0A396G6S7      -------------------------------------------MEERIDNET--------
A0A3E5A223      -------------------------------------------MEERIDNET--------
R7D5E6          -------------------------------------------MEERIDNET--------
A0A415HQH5      -------------------------------------------MEERIDNET--------
A0A414W2C6      -------------------------------------------MEERIDNET--------
A5ZNE7          -------------------------------------------MEERIDNET--------
A0A395X821      -------------------------------------------MEERIDNET--------
A0A1C5PY68      -------------------------------------------MEERIDNET--------
A0A174CJF8      -------------------------------------------MEERIDNET--------
A0A564SRR2      -------------------------------------------MEERIDNET--------
A0A174R7V0      -------------------------------------------MEERIDNET--------
A0A373MWV2      ----------------------------------MRRFQMGEYDRTGNGQNG--------
A0A417CE88      ----------------------------------MRRFQMGEYDRTGNGQNG--------
A0A416Y441      ----------------------------------MRRFQMGEYDRTGNGQNG--------
A0A357GPJ7      ----------------------------------MRRFQMGEYDRTGNGQNG--------
A0A396PAC1      ----------------------------------MRRFQMGEYDRTGNGQNG--------
A0A416EYU4      ----------------------------------MRRFQMGEYDRTGNGQNG--------
A0A416SCQ2      ----------------------------------MRRFQMGEYDRTGNGQNG--------
A0A416TGN7      ----------------------------------MRRFQMGEYDRTGNGQNG--------
A0A417SMF6      ----------------------------------MRRFQMGEYDRTGNGQNG--------
A0A1Y4MW77      ---------------------------------------MEEKNIEQDEITI--------
R6UHV6          ---------------------------------MNNSQDDLKAQDDLKEQDA--------
A0A3R9Q621      ------------------------------------------------------------
A0A069RC75      ------------------------------------------------------------
A0A6S6R676      ------------------------------------------------------------
A0A174F2W5      ---------------------------------------MGEYDRTGNGQNG--------
A0A174S8E9      ---------------------------------------MREYDRTGNGQNG--------
A0A416ZL97      ---------------------------------------MGEYDRTGNGQSS--------
A0A174LSK1      ---------------------------------------MGEYDRTGNGQSS--------
A0A373GY92      ---------------------------------------MGEYDRTGNGQSS--------
A0A373NZQ6      ---------------------------------------MGEYDRTGNGQSS--------
A0A417I9B9      ---------------------------------------MGEYDRTGNGQSS--------
A0A417MP97      ---------------------------------------MGEYDRTGNGQSS--------
A0A417WQF8      ---------------------------------------MGEYDRTGNGQSS--------
A0A373RZ83      ---------------------------------------MGEYDRTGNGQSS--------
A0A416U6I1      ---------------------------------------MGEYDRTGNGQSS--------
R7JQZ9          ---------------------------------------MGEYDRTGNGQSS--------
A0A7C6SMH0      -----------------------------------------------MERNS--------
A0A3B8KKL6      -----------------------------------------------MERNN--------
A0A2K9E6R0      -----------------------------------------------MERNN--------
A0A2S8RBI0      -----------------------------------------------MERNN--------
A0A0L6JLG6      -----------------------------------------------MQDKD--------
G8LSN0          -----------------------------------------------MGKND--------
A0A1M5UYN6      -------------------------------------------------MQK--------
A0A176JBT8      ---------------------------------------------------M--------
A0A1I5HIC6      -----------------------------------------------MPNNN--------
A0A1Y3TC51      ---------------------------------------------MNGERFS--------
A0A1Y3T1N0      ---------------------------------------------MNRELFR--------
A0A1Y3Y8U8      ---------------------------------------------MNRELFR--------
A0A5B0BQY5      ---------------------------------------------------M--------
A6CLL4          ---------------------------------------------------M--------
A0A176U8D6      -----------------------------------MVFMNSDEVMIVNEDED--------
A0A1Q6KSQ5      ------------------------------MLGGVCDFMENKKAVAV-ENAA--------
A0A3D3U8B3      ------------------------------MLGGVCDFMENKKAVAV-ENAA--------
A0A3E5FRL7      ---------------------------------------------MNQDEIN--------
A0A1Y4QK93      ---------------------------------------------MNQDEIN--------
B1C232          ---------------------------------------------MNQDEIN--------
A0A401USI6      -------------------------------------------------MRE--------
A0A1V4IQ10      --------------------------------------------------MD--------
A0A1S8TRD2      --------------------------------------------------MD--------
G7M1U2          --------------------------------------------------MD--------
A0A2T6KJ75      ---------------------------------------------------M--------
A9KN92          ----------------------------------------------MQNNNN--------
A0A352MUJ1      ------------------------------------------------------------
R5YI67          ------------------------------------------------------------
A0A174DL89      ------------------------------------------------------------
A0A1Y0IQP5      ------------------------------------------------------------
A0A4R2R7B1      ------------------------------------------------------------
A0A1M6E8I2      ---------------------------------------------------M--------
A0A1Y4N105      -----------------------------------------------MMEFR--------
A0A1Y4QP75      -----------------------------------------------MMEFR--------
A0A3D4QRB5      ------------------------------------------------------------
A0A349DEH5      -------------------------------------------MRSEKKNQK--------
A0A3D4T7B4      -------------------------------------------MRSEKKNQK--------
A0A350XYC7      -----------------------------------------MKSYSDRKSSK--------
R6DNR8          -----------------------------------------MKSYSERKSSK--------
A0A355KUM5      -----------------------------------------MKSYSDRKNSK--------
R5YGY6          -----------------------------------------MKSYSDRKNSK--------
A0A0K8J554      ------------------------------------------------------------
A0A1I0RG99      ------------------------------------------------------------
A0A1I5G322      ------------------------------------------------------------
A0A7C6IYW8      ------------------------------------------------------------
A0A3N1XSX6      ------------------------------------------------------------
A0A7C6JZF1      ------------------------------------------------------------
A0A7G9WCY6      ------------------------------------------------MDSQ--------
A0A1C6G0U3      ---------------------------------------------------M--------
A0A3D4LLB3      -----------------------------------------------MYEEE--------
A0A0A5GPA9      ---------------------------------------------------M--------
A0A271M6M4      ---------------------------------------------------M--------
A0A7C7AD93      ------------------------------------------------MDQA--------
A0A2V3W8U6      ---------------------------------------------------M--------
A0A6N3BXA1      -------------------------------------------------MKD--------
A0A351SRI8      ------------------------------------------------------------
A0A1V5LU59      ----------------------------------------MEKGIGRMENND--------
A0A1E3BVC3      -----------------------------------------------MEKDD--------
A0A4Q0I6S0      -----------------------------------------------MEKDD--------
A3DF66          -----------------------------------------------MEKDD--------
W4V1T8          -----------------------------------------------MEKDD--------
A0A1C6ITD7      ------------------------------------------------------------
A0A381IX63      ---------------------------------------------------M--------
A0A1G9IUT4      ---------------------------------------------------M--------
A0A1M6RWV2      ------------------------------------------------MEAY--------
A0A143XPI5      ------------------------------------MKEEYSREPQRSEESI--------
A0A355G1X5      ------------------------------------------MNTNVNTTSAPK------
A0A0M6WXE3      ------------------------------------------MENNRENASAQT------
A0A348SAK2      ----------------------------------------MKMENNRENASAQT------
A0A1G9H5B9      --------------------------------------------MKKK------------
R5EFZ0          -----------------------------------------MENTSKSNMQSAR------
A0A1Y4H8L0      ------------------------------------------MNKDENFNEILQ------
A0A4B9BMD9      --------------------------------------------LEKDGVALT-------
A0A0M6WYQ8      ------------------------------------MDEMREKSGKEQQGEIEKI-----
A0A348SAK1      ------------------------------------MDEMREKSGKEQQGEIEKI-----
A0A252F281      --------------------------------------------MEEKRWSL--------
A0A1Y4QKE6      --------MMKFVIMIMVIVIMIIKTIGMKVGDIMDEQRLKESMLEDDNIEI--------
B1C231          --------------MTMVIVIMIIKPIDMKVGDIMDEQRLKESMMEDDSIEI--------
A0A1Y3TUL5      ------------------------------------------MNDE--------------
A0A1Y4JAX2      ------------------------------------------MNDE--------------
A0A1Y4T590      ------------------------------------------MNDE--------------
R5B467          ------------------------------------------MNEQRQGHTI--------
A0A1Y3T163      MLFTETGFPRVPDMDMIMETMGKTSGEETKEDKSMEDQRKEIENREDDEMEI--------
A0A1Y3YCA2      MLFTETGFPRVPDMDMIMETMGKTSGEETKEDKSMEDQRKEIENREDDEMEI--------
A0A1Y4L6N9      --------------------------------------MSELNHAETEEMEI--------
A0A173T644      ---------------------------------------MDERLEDREELEI--------
A0A1C5TSB8      ---------------------------------------MDERLEDREELEI--------
C0CIK6          -------------------------------------MTVDERLEDREELEI--------
A0A1Y3WEF6      --------------------------MAEQDRYGGNSQNLSRKIEEDD--AI--------
A0A417T0L2      --------------------------MAERDLYSKNNQNLSRRIDEDD--VI--------
A0A1H9EPU3      ------------------------------------------MSNQTDEKFFQDDIGQTP
A0A354IGV3      --------------------------------------------MEKKQSLGSAF-----
A0A417JMV2      ------------------------------------------MSSDKRNISVNDY-----
A0A415VWX5      ------------------------------------------MSSDKRNISVNDY-----
A0A173UY96      ------------------------------------------MSSDKRNISVNDY-----
B0P408          ------------------------------------------MSSDKRNISVNDY-----
D4MV82          ------------------------------------------MSSDKRNISVNDY-----
A0A173QTL1      ------------------------------------------MSSDKRNISVNDY-----
A0A174J359      ------------------------------------------MSSDKRNISVNDY-----
A0A174A3T7      ------------------------------------------MSSDKRNISVNDY-----
A0A417UUA3      ------------------------------------------MSSDKRNISVNDY-----
A0A6N2VB70      ------------------------------------------MSSDKRNISVNDY-----
A0A1C6EUV9      ------------------------------------------MSNEKHNISVNDY-----
A0A173Y645      ------------------------------------------MSNEKHNISVNDY-----
A0A374AVY6      ------------------------------------------MSNEKHNISVNDY-----
R7BXS4          ------------------------------------------MSNEKHNISVNDY-----
A0A143ZUX1      --------------------------------------------MYEQNTSA--------
A0A1W1Z4C3      ---------------------------------------------MNKQSGS--------
A0A239QN83      ---------------------------------------------MNKQGGS--------
A0A3R9WAA7      --------------------------------------MNYNDAAFGEVYTI--------
A0A1G6BLF1      -------------------------------------MAEYSSRQGTAPSAI--------
R6HZX3          --------------------------------------MQEHSYEHNTDQKV--------
A0A1W2CEA6      ----------------MKNKEKITGLTEEMTGISVRNTAPAAEGPAQEYYSG--------
R7FFK6          ---------------------------------------------MKKSYTI--------
A0A373MPB9      ---------------------------------------------MKKNYTI--------
A0A373L519      ---------------------------------------------MKKNYTI--------
A0A373W906      ---------------------------------------------MKKNYTI--------
A0A373VCW2      ---------------------------------------------MKKNYTI--------
W0U604          ---------------------------------------------MKKNYTI--------
A0A374B6G0      ---------------------------------------------MKKNYTI--------
A0A373VM36      ---------------------------------------------MKKNYTI--------
A0A1C5P379      ---------------------------------------------MKKNYTI--------
A0A373XXX0      ---------------------------------------------MKKNYTI--------
A0A5R9MJM9      ---------------------------------------------MKKNYTI--------
A0A356CW82      ---------------------------------------------MKKNYTI--------
R6T4X7          ---------------------------------------------MKKNYTI--------
A0A374HTV1      ---------------------------------------------MKKNYTI--------
A0A374GB66      ---------------------------------------------MKKNYTI--------
A0A374ECC6      ---------------------------------------------MKKNYTI--------
A0A374BM61      ---------------------------------------------MKKNYTI--------
A0A373UGZ4      ---------------------------------------------MKKNYTI--------
A0A373SA66      ---------------------------------------------MKKNYTI--------
A0A1C5X6X7      ---------------------------------------------MKKNYTI--------
A0A1C6JIH3      ---------------------------------------------MKKNYTI--------
A0A373PSC3      ---------------------------------------------MKKNYTI--------
A0A1K1WYK8      ---------------------------------------------MKNTYTI--------
A0A1H6IUB1      ---------------------------------------------MDNGYSI--------
A0A1M7L1F9      ---------------------------------------------MNNSYSI--------
A0A1C6B4L6      ---------------------------------------------MENSYTI--------
A0A1Q6T9P4      ---------------------------------------------MKNSYTI--------
A0A315Y4F9      ---------------------------------------------MNQSYSI--------
A0A354K620      ---------------------------------------------MNESYSI--------
A0A355G3J9      ------------------------------------------------------------
A0A3D2AD87      ------------------------------------------------------------
A0A143XN92      ----------------------------------------MQKYRDTNEMELK-------
A0A173ZYY6      -----------------------------------------MESSNRNDMPVFMDND---
A0A6L8RXB5      -----------------------------------------MESNNRNDMPAFMDTD---
A0A6N9JW85      -----------------------------------------MESNNRNDMPAFMDTD---
A0A173SMI2      -----------------------------------------MESNNRNDMPAFMDTD---
A0A174ASH7      -----------------------------------------MESNNRNDMPAFMDTD---
A6BH65          -----------------------------------------MESSNRNDMPVFMDND---
R7G0D7          -----------------------------------------MESSNRNDMPVFMDND---
A0A2T5IYJ6      -------------------------------------MEILDKNLSPQQEDS--------
A0A3C0QME1      ----------------------------------------------MNDS----------
A0A355FYK5      ------------------------------------------MQEDQRNSVNALLGNGLF
A0A357AQU0      -------------------------------------------MEQQKDEVE--------
A0A3C1YJQ7      -------------------------------------------MEQQKDEVE--------
A0A3D0JG38      -------------------------------------------MEQQKDEVE--------
A0A3C0IHX1      -----------------------------------MGTLNQKNKNKQDDETE--------
R5V506          -----------------------------------MGTLNQKNKNKQDDETE--------
A0A352TIU5      -----------------------------------MGTLNQKNKNKQDDETE--------
A0A3E5FSY5      ---------MIVIIMIMVIVIMIIKPIDMKVGDIMDEQRLKESMMEDDSIEI--------
A0A1V5S3C0      ---------------------------------MSGSDYNASVRDEEYGVSF--------
A0A1Y3TC98      -----------------------------------MQDQRNRIDEREDEMEI--------
A0A1Q6REE0      --------------------------------------MEIEKTEQQGRDTF--------
R5ETF9          --------------------------------------MEIEKTEQQGRDTF--------
R6VAT5          -----------------------------------MEKKFVPENSRSYTPVG--------
A0A1Q6S448      ----------------------------------------MDENNQGLQWSH--------
A0A351MYR0      ----------------------------------------MEEKNRGLQWSH--------
R6HPC1          ----------------------------------------MDEKNRGLQWSH--------
A0A3D4G5Z5      ----------------------------------------MDEKNRGLQWSH--------
A0A3D5ES03      ----------------------------------------MDEKNRGLQWSH--------
A0A0F2P7X6      -----------------------------------MEHQGLNNGVDRTEENE--------
A0A359B487      -----------------------------------MEHQGLNNGVNRTEENE--------
A0A348P5V4      -----------------------------------MNYNSEPKKDYEEGLSL--------
A0A356PT74      -----------------------------------MAYSSSGKTHAEESVNL--------
A0A3D5LL19      -----------------------------------MAYSSSGKTHAEESDNL--------
R5MNF0          -----------------------------------MAYSSSGKTHVEESDNL--------
A0A1Q9JSI0      ------------------------------------MSE--NKNTSINDYEM--------
A0A3D5TNI1      ------------------------------------MNRIVKKDTDSDGVEI--------
A0A358LJD0      ------------------------------------MSKIVRKDTDSDGVEV--------
R6I3L7          ------------------------------------MSKIVRKDTNSDGVEV--------
A0A3D1HXX0      ------------------------------------MSKIVRKDTDSDGVEV--------
A0A3D2QJB8      ------------------------------------MSKIVRKDTDSDGVEV--------
D4LC36          ---------------------------------------------MKKEYTI--------
R7MQJ4          ---------------------------------------------MESNYTI--------
A0A1V5GLC0      ---------------------------------------------MENTYSI--------
W7V182          -----------------------------------------MKNDGKDMLDL--------
                                                                            

S3FFL2          ---------MGVAPKQKGAFAGLPVQQAGDTPIIRQYMRIANRWRWVI-------LGIVA
A0A328M4V1      ------------------MTTRQTFSPRDDDVDLRALIGTLLDNKWLI-------GITTA
A0A6A8IF17      --------------------------------------MCLARWKWFV--------LSLA
A0A3D5R4X5      ----------------------------EEEIDIRQLFHILRKRLGWI-------ISITL
A0A1I4C3N6      ----------------------------FANLHLEKILWIIKSKILYI-------IMFAL
A0A3B9CIM7      ----------------------------LSNFHLEKIFWTLKKKALYI-------FLSTA
A0A1G9WHW8      ----------------------------VANFHLEKILWIIKKNLTYM-------VFCGL
A0A1H5VAA0      ----------------------------VANFHLEKILWIIKKNLTYM-------VFCGL
A0A3R6VK11      ----------------------------LNNFHLEKILWILQKRIAYI-------MILGV
A0A3R6QUY7      ----------------------------LNNFHLEKILWILQKRIAYI-------MILGV
A0A373K3P9      ----------------------------LNNFHLEKILWILQKRIAYI-------MILGV
A0A3R6JRU5      ----------------------------LNNFHLEKILWILQKRIAYI-------MILGV
A0A1C5MS04      ----------------------------LNNFHLEKILWILQKRIAYI-------MILGV
A0A3C1J150      ----------------------------LNNFHLEKILWILQKRIAYI-------MILGV
A0A416CXD7      ----------------------------LNNFHLEKILWILQKRIAYI-------MILGV
A0A6N2X662      ----------------------------LNNFHLEKILWILQKRIAYI-------MILGV
R6XBL9          ----------------------------LNNFHLEKILWILQKRIAYI-------MILGV
A0A355W5Z7      ----------------------------LNNFHLEKILWILQKRIAYI-------MILGV
A0A143WVN6      ----------------------------IDDIDFRSIVLDLIKNIWVI-------ILAVL
W6RXP9          ----------------------------EKEISISEIMEALQKRWKMI-------ALITL
W6S4G8          ----------------------------SNEISFSQIIFALKKRWKII-------FATTI
A0A1G6BLB6      ----------------------------LFRFNGYTVGRDIIKHMKMI-------IMISV
A0A1C6G8M0      ----------------------------EDTIDLLEIFRALYRRWVWI-------VFTAL
A0A416MP73      ----------------------------EDTIDLMEIFRALRKRWYWI-------VLLAI
A0A3E4LL92      ----------------------------DSQIDLRYIFRTLKKNAVFI-------LMCMC
A0A415D1L1      ----------------------------DSQIDLRYIFRTLKKNAVFI-------LMCVC
A0A0H5SF45      -----------------------------MELSIKDVLGIIYKRLIFI-------IACTF
A0A1M6JRJ5      -----------------------------MEFTVTDILHLLKKRFILI-------AACTL
A0A1M7Y1S2      -----------------------------MEFTVRDILYLIKKRFILI-------AACTF
A0A7I8DMN1      -----------------------------MEFTVRDILHLIKKRFLLI-------AFCTL
A0A396G6S7      ----------------------------VQQIDLISMLKDIGREWLTI-------LLLAI
A0A3E5A223      ----------------------------VQQIDLISMLKDIGREWLTI-------LLLAI
R7D5E6          ----------------------------VQQIDLISMLKDIGREWLTI-------LLLAI
A0A415HQH5      ----------------------------VQQIDLISMLKDIGREWLTI-------LLLAI
A0A414W2C6      ----------------------------VQQIDLISMLKDIGREWLTI-------LLLAI
A5ZNE7          ----------------------------VQQIDLISMLKDIGREWLTI-------LLLAI
A0A395X821      ----------------------------VQQIDLISMLKDIGREWMTI-------LLLAI
A0A1C5PY68      ----------------------------VQQIDLISMLKDIGREWLTI-------LLLAI
A0A174CJF8      ----------------------------VQQIDLISMLKDIGREWLTI-------LLLAI
A0A564SRR2      ----------------------------VQQIDLISMLKDIGREWLTI-------LLLAI
A0A174R7V0      ----------------------------VQQIDLISMLKDIGREWLTI-------LLLAI
A0A373MWV2      ----------------------------EADWDLRSILCDMAKNWWII-------LLIAC
A0A417CE88      ----------------------------EADWDLRSILCDMAKNWWII-------LLIAC
A0A416Y441      ----------------------------EADWDLRSILCDMAKNWWII-------LLIAC
A0A357GPJ7      ----------------------------EADWDLRSILCDMAKNWWII-------LLIAC
A0A396PAC1      ----------------------------EADWDLRSILCDMAKNWWII-------LLIAC
A0A416EYU4      ----------------------------EADWDLRSILCDMAKNWWII-------LLIAC
A0A416SCQ2      ----------------------------EADWDLRSILCDMAKNWWII-------LLIAC
A0A416TGN7      ----------------------------EADWDLRSILCDMAKNWWII-------LLIAC
A0A417SMF6      ----------------------------EADWDLRSILCDMAKNWWII-------LLIAC
A0A1Y4MW77      ----------------------------DLTVLFRDFIRGCIKFWWLI-------LALMV
R6UHV6          ----------------------------NYSFDLASTLQDLTKRWFVI-------LLSGI
A0A3R9Q621      -----------------------------MEFTLAQVIKLLYKRMLWI-------VLITA
A0A069RC75      -------------------------------MNGKKYIGIFKRRKWLF-------FMVLA
A0A6S6R676      -----------------------------MEFSFKEIAALMVKRFLLI-------SVCTF
A0A174F2W5      ----------------------------EADWDLRSILCDMAKNWWII-------LLIAC
A0A174S8E9      ----------------------------EADWDLRSILCDMAKNWWII-------LLIAC
A0A416ZL97      ----------------------------KTDWDLRSILCDIAKNWWVI-------LLIAC
A0A174LSK1      ----------------------------KTDWDLRSILCDIAKNWWVI-------LLIAC
A0A373GY92      ----------------------------KTDWDLRSILCDIAKNWWVI-------LLIAC
A0A373NZQ6      ----------------------------KTDWDLRSILCDIAKNWWVI-------LLIAC
A0A417I9B9      ----------------------------KTDWDLRSILCDIAKNWWVI-------LLIAC
A0A417MP97      ----------------------------KTDWDLRSILCDIAKNWWVI-------LLIAC
A0A417WQF8      ----------------------------KTDWDLRSILCDIAKNWWVI-------LLIAC
A0A373RZ83      ----------------------------KTDWDLRSILCDIAKNWWVI-------LLIAC
A0A416U6I1      ----------------------------KTDWDLRSILCDIAKNWWVI-------LLIAC
R7JQZ9          ----------------------------KTDWDLRSILCDIAKNWWVI-------LLIAC
A0A7C6SMH0      ----------------------------FEEIDVREIFFLLLRKWYII-------AACFI
A0A3B8KKL6      ----------------------------FEEIDVREIFFLLLRKWYVV-------AACFI
A0A2K9E6R0      ----------------------------FEEIDVREIFFLLLRKWYVV-------AACFI
A0A2S8RBI0      ----------------------------FEEIDVREIFFLLLRKWYVV-------AACFI
A0A0L6JLG6      ----------------------------FVEVDIRELILILLRKWYIL-------LICLV
G8LSN0          ----------------------------YIEIDIREILIVLLKRWYLI-------AICFI
A0A1M5UYN6      ----------------------------DDRLDLRDYLHIIKKKIMVI-------ITITF
A0A176JBT8      ----------------------------EKTFEIKDLLNILRKNKILI-------TSIPF
A0A1I5HIC6      ----------------------------DIEIDIGDLFFLLLHKMWFI-------LLWGI
A0A1Y3TC51      ----------------------------LAEISVRGLCMDLFRNAWMI-------LLAAA
A0A1Y3T1N0      ----------------------------LDEISIRGLCLELLQSLWMI-------LVIGV
A0A1Y3Y8U8      ----------------------------LDEISIRGLCLELLQSLWMI-------LVIGV
A0A5B0BQY5      ----------------------------KRTIDMTDLMQAVRRRWMIF-------FGIIL
A6CLL4          ----------------------------NQSLTLKELFQILQNHFWLI-------LSIIF
A0A176U8D6      ----------------------------EVTIDFFGIFHAIAKRWYIV-------LLAAV
A0A1Q6KSQ5      ----------------------------EDTIDLLEIFRALYRRWVWI-------VFAAL
A0A3D3U8B3      ----------------------------EDTIDLLEIFRALYRRWVWI-------VFAAL
A0A3E5FRL7      ----------------------------LDSINYRGIIRDLLKNWWII-------VLIVI
A0A1Y4QK93      ----------------------------LDSINYRGIIRDLLKNWWVI-------VLIVI
B1C232          ----------------------------LDSINYRGIIRDLLKNWWII-------VLIVI
A0A401USI6      ----------------------------ENDIEFNDYLNIIRKKIVVI-------LFIII
A0A1V4IQ10      ----------------------------SETISIEEIFQILKKKWKLV-------IILPL
A0A1S8TRD2      ----------------------------SETTSIEEIFQILKKKWKLV-------IILPL
G7M1U2          ----------------------------SETISIEEIFQILKKKWKLV-------IILPL
A0A2T6KJ75      ----------------------------NRTMEIRDFIRLFKKKKKVI-------LLVTF
A9KN92          ----------------------------DIEINLGEIFILLLHKIWII-------VLSSI
A0A352MUJ1      ----------------------------MEEIDLKELLKLFWKKKILI-------ILTTL
R5YI67          ----------------------------MEEIDLRDLLKLFWKRKAII-------LLTTM
A0A174DL89      -------------------------------MNKFKYFKLIKEKLSII-------ILITI
A0A1Y0IQP5      -----------------------------MEMGLAEMGRVIRQRVLLI-------VLVTL
A0A4R2R7B1      -----------------------------MEMGLAEMGRVLRQRVLLI-------VLVTL
A0A1M6E8I2      ----------------------------GEEWNLLELVQIVLKRKWIV-------VATTI
A0A1Y4N105      ----------------------------INDIDLRSIIVDMVRNCWMI-------ILVML
A0A1Y4QP75      ----------------------------INDIDLRSIIVDVIRNCWMI-------ILVML
A0A3D4QRB5      ----------------------------MEELDIRDIIHIIRKHFWII-------VLTIL
A0A349DEH5      ----------------------------GLEINVLAFFKELSKKLWIV-------LIVAL
A0A3D4T7B4      ----------------------------GLEINVLAFFKELSKKLWIV-------LIVAL
A0A350XYC7      ----------------------------GLEINIVAFFRELSKKIWIV-------LIIAV
R6DNR8          ----------------------------GLEINILAFFKELSKKLWIV-------AIVAF
A0A355KUM5      ----------------------------GIEINILAFFKELSKKLWIV-------AIIAV
R5YGY6          ----------------------------GIEINILAFFKELSKKLWIV-------AIIAV
A0A0K8J554      -----------------------------MELSLKEIIELIYKRLKLI-------IIFVL
A0A1I0RG99      -----------------------------MEFSFKEILEILAKRFVFI-------AICTF
A0A1I5G322      -----------------------------MEFTLKEIFEIFMKRIVFI-------TVCTI
A0A7C6IYW8      -----------------------------MEFTVKEIIDLILKRIIWV-------IIGLS
A0A3N1XSX6      -----------------------------MEFTVKEIIKLILKRLIWI-------ILCLF
A0A7C6JZF1      -----------------------------MEYSLTDVLAIMIKHFLLI-------VLCTF
A0A7G9WCY6      ----------------------------EYEIDLRQIFDILFKRLWII-------AAIVL
A0A1C6G0U3      ----------------------------KEKLDFIEVLKIINKRKIIV-------ISILS
A0A3D4LLB3      ----------------------------FNDIDLREIFQIIRKYLALI-------IIITI
A0A0A5GPA9      ----------------------------GQAFGLKEVYQVIRRRVVLL-------SVVTL
A0A271M6M4      ----------------------------NEAVGLREIFNIIKKEYLII-------IIITT
A0A7C7AD93      ----------------------------KAYIEYKDFIKILRKRILVI-------ILIVI
A0A2V3W8U6      ----------------------------DQTFQIRDFLQIFKKRIKFI-------ITVPL
A0A6N3BXA1      ----------------------------TMTISLRELFTIIKRKLWII-------VLVGI
A0A351SRI8      ----------------------------MEEFNILEFLKYYWNKILIV-------AIVTL
A0A1V5LU59      ----------------------------FVEIDLREIFFTILRKWYLI-------AICFI
A0A1E3BVC3      ----------------------------ILEIDIREMVYLLLKKWYLI-------VLCFV
A0A4Q0I6S0      ----------------------------ILEIDIREMVYLLLKKWYLI-------VLCFV
A3DF66          ----------------------------ILEIDLREIVYILLKKWYLI-------VLCFV
W4V1T8          ----------------------------ILEIDLREIVYILLKKWYFI-------VLCFV
A0A1C6ITD7      ------------------------------MKNILYYLDIIKKHLTLI-------IIITL
A0A381IX63      ----------------------------EQKIEIKEYLQLIRKRMKII-------VAIVI
A0A1G9IUT4      ----------------------------EEIINLRQCFQIIKKNISLI-------IIITC
A0A1M6RWV2      ----------------------------EYEIDLRELFEIILNKLWLI-------ILIVL
A0A143XPI5      ----------------------------DIFYLFNNVWKGIRQFYWIF-------LIIIS
A0A355G1X5      ----------------------------GLEINVLFLLKTVLKRWWIL-------LITTV
A0A0M6WXE3      ----------------------------ETEFEPISLVCDILKNWWVI-------LLGAL
A0A348SAK2      ----------------------------ETEFEPISLVCDILKNWWVI-------LFGAL
A0A1G9H5B9      ----------------------------ANQIDLVKMLFFILKHLWLL-------VLCAE
R5EFZ0          ----------------------------LLPFDPIVLVQDVLKRWLVV-------VLAAL
A0A1Y4H8L0      ----------------------------TSRLEPFTLVRDILVNWWVI-------LLGAL
A0A4B9BMD9      -------------------------------------------------------IADIK
A0A0M6WYQ8      ----------------------------DLIEFLRSFQYGIKKMWWLV-------LVLAL
A0A348SAK1      ----------------------------DLIEFLRSFQYGIKKMWWLV-------LVLAL
A0A252F281      -----------------------------ASINLHTMLRDVWKNLWMI-------VLVAA
A0A1Y4QKE6      ----------------------------DLSELIHGFLKILKDYWGLF-------LGTIV
B1C231          ----------------------------DLSELIHDFLKILKDYWGVF-------LGTIV
A0A1Y3TUL5      ----------------------------YITIRLSDFLHALIKNRGLIAATTIAGLAIGV
A0A1Y4JAX2      ----------------------------YITIRLSDFLHALIKNRGLIAATTIAGLAIGV
A0A1Y4T590      ----------------------------YITIRLSDFLHALIKNRGLIAATTIAGLAIGV
R5B467          ----------------------------DLAELLGRFARSLRRLWWLC-------LALIV
A0A1Y3T163      ----------------------------DLVLLFGAFWKSFTRLWWLV-------LILIL
A0A1Y3YCA2      ----------------------------DLVLLFGAFWKSFTRLWWLV-------LILIL
A0A1Y4L6N9      ----------------------------DIVSLIQNFISGIFRWWWLI-------VLLAL
A0A173T644      ----------------------------DLGILLWNFLQGLARFWWLV-------ILLAA
A0A1C5TSB8      ----------------------------DLGILLWNFLQGLARFWWLV-------ILLAA
C0CIK6          ----------------------------DLGILLWNFLQGLARFWWLV-------ILLAA
A0A1Y3WEF6      ----------------------------DLRTLFWNVIQGILKFWWLI-------LLLAA
A0A417T0L2      ----------------------------DLGALFWNVIQGILRFWWLI-------IFLAA
A0A1H9EPU3      GKILENAPVTPRKPAIINNNNIAKKTQDEETIDLRQIFGLLWVNKILI-------ILLGL
A0A354IGV3      ----------------------------LSSIDVSGALRAIVRNFWLV-------VLAAL
A0A417JMV2      ----------------------------ETNIDLYSILRDIWKYALVI-------MLLAA
A0A415VWX5      ----------------------------EMNIDLYSILRDIWKYALVI-------LLLAA
A0A173UY96      ----------------------------EMNIDLYSILRDIWKYALVI-------LLLAA
B0P408          ----------------------------EMNIDLYSILRDIWKYALVI-------LLLAA
D4MV82          ----------------------------EMNIDLYSILRDIWKYALVI-------LLLAA
A0A173QTL1      ----------------------------EMNIDLYSILRDIWKYAIVI-------LLLAA
A0A174J359      ----------------------------EMNIDLYSILRDIWKYAILI-------LLLAA
A0A174A3T7      ----------------------------EMNIDLYSILRDIWKYAIVI-------LLLAA
A0A417UUA3      ----------------------------EMNIDLYSILRDIWKYAIVI-------LLLAA
A0A6N2VB70      ----------------------------EMNIDLYSILRDIWKYAIVI-------LLLAA
A0A1C6EUV9      ----------------------------EMNIDLYSILRDISKYIVVI-------LLLAA
A0A173Y645      ----------------------------EMNIDLYSILRDISKYIVVI-------LLLAA
A0A374AVY6      ----------------------------EMNIDLYSILRDISKYIVVI-------LLLAA
R7BXS4          ----------------------------EMNIDLYSILRDISKYIVVI-------LLLAA
A0A143ZUX1      ----------------------------TPSPTTLRYFRQLKKSWWIP-------TILLV
A0A1W1Z4C3      ----------------------------IDLARLAVY---ILKRIWLV-------IICAA
A0A239QN83      ----------------------------IDLARLAVY---ILKRIWLV-------ILCAA
A0A3R9WAA7      ----------------------------DLSGIGRNFLRGLKKLFWLI-------PLLAV
A0A1G6BLF1      ----------------------------DLGTIVDDVWKGFWRIWWLL-------LVIIS
R6HZX3          ----------------------------DLELIFRNFLHVLKRTWWWV-------TLLAI
A0A1W2CEA6      ----------------------------IDWVSVLFR---LLEKIHWI-------VLAAL
R7FFK6          ----------------------------KDLIFL------FLGHIWWI-------ICAAV
A0A373MPB9      ----------------------------KDLLVL------LLGKVWYI-------VAASI
A0A373L519      ----------------------------KDLLVL------LLGKVWYI-------VAAAV
A0A373W906      ----------------------------KDLLVL------LLGKVWYI-------VAASI
A0A373VCW2      ----------------------------KDLLVL------LLGKVWYI-------VAASI
W0U604          ----------------------------KDLLVL------LLGKVWYI-------VAASI
A0A374B6G0      ----------------------------KDLLVL------LLGKVWYI-------VAASI
A0A373VM36      ----------------------------KDLLVL------LLGKVWYI-------VAASI
A0A1C5P379      ----------------------------KDLLVL------LLGKVWYI-------VAASI
A0A373XXX0      ----------------------------KDLLVL------LLGKVWYI-------VAASI
A0A5R9MJM9      ----------------------------KDLLVL------LLGKVWYI-------VAASI
A0A356CW82      ----------------------------KDLLVL------LLGKVWYI-------VAASI
R6T4X7          ----------------------------KDLLVL------LLGKVWYI-------VAASI
A0A374HTV1      ----------------------------KDLLVL------LLGKVWYI-------VAASI
A0A374GB66      ----------------------------KDLLVL------LLGKVWYI-------VAASI
A0A374ECC6      ----------------------------KDLLVL------LLGKVWYI-------VAASI
A0A374BM61      ----------------------------KDLLVL------LLGKVWYI-------VAASI
A0A373UGZ4      ----------------------------KDLLVL------LLGKVWYI-------VAASI
A0A373SA66      ----------------------------KDLLVL------LLGKVWYI-------VAASV
A0A1C5X6X7      ----------------------------KDLLVL------LLGKVWYI-------VAASI
A0A1C6JIH3      ----------------------------KDLLVL------LLGKVWYI-------VAASI
A0A373PSC3      ----------------------------KDLLVL------LLGKVWYI-------VAASI
A0A1K1WYK8      ----------------------------KDLLSL------LWNHLMLI-------IAITI
A0A1H6IUB1      ----------------------------KDIISL------LLSKLWLL-------IIVTI
A0A1M7L1F9      ----------------------------KDIINL------LLSKLWLL-------ILVTI
A0A1C6B4L6      ----------------------------KELIGL------FLNKIWII-------IIVTI
A0A1Q6T9P4      ----------------------------KELIGL------FLNKIWII-------IIVTI
A0A315Y4F9      ----------------------------KDIIRL------LLSHIWLI-------IVITV
A0A354K620      ----------------------------KDILRL------LLNHLWII-------IIIAI
A0A355G3J9      ------MR--------------------LTLKDIAMT---VWRSIGLI-------IVSSL
A0A3D2AD87      ----------------------------MQDISIMYLFHLAWRRIWAI-------VIAAC
A0A143XN92      ----------------------------IDIRTMIKD---VLRYSWLI-------VIMAI
A0A173ZYY6      ----------------------------LDPYTLVHD---IVSNWWVI-------ILGAI
A0A6L8RXB5      ----------------------------LDPYTLVHD---IVSNWWVI-------ILGAI
A0A6N9JW85      ----------------------------LDLYTLVHD---IVSNWWVI-------ILGAI
A0A173SMI2      ----------------------------LDPYTLVHD---IVSNWWVI-------ILGAI
A0A174ASH7      ----------------------------LDPYTLVHD---IVSNWWVI-------ILGAI
A6BH65          ----------------------------LDPYTLVHD---IVSNWWVI-------ILGAI
R7G0D7          ----------------------------LDPYTLVHD---IVSNWWVI-------ILGAI
A0A2T5IYJ6      ----------------------------IDLRHYWNV---VARFKWGI-------IGLAI
A0A3C0QME1      ----------------------------YTIKDIISL---LLSKLWLL-------ILLAV
A0A355FYK5      GNGGSGGG--------------------LDLFKLLRA---LLRRAWAI-------VMVGV
A0A357AQU0      ----------------------------IDLLELFWA---LLRKWWML-------TIAAV
A0A3C1YJQ7      ----------------------------IDLLELFWA---LLRKWWML-------TIAAV
A0A3D0JG38      ----------------------------IDLLELFWA---LLRKWWML-------TIAAV
A0A3C0IHX1      ----------------------------IDLGKLFKA---LMQRLPII-------LLVTL
R5V506          ----------------------------IDLGKLFKA---LMQRLPII-------LLVTL
A0A352TIU5      ----------------------------IDLGKLFKA---LVRRLPII-------LLVTL
A0A3E5FSY5      ----------------------------DLSELIHDFLKILKDYWGVF-------LGTIV
A0A1V5S3C0      ----------------------------ETILKLIRV---IASKWWVI-------LILVF
A0A1Y3TC98      ----------------------------DLGLLFAGMWKNIRRFWWLA-------LLLTV
A0A1Q6REE0      ----------------------------VLLDDFLHQ---AKRMWLLG-------LALVL
R5ETF9          ----------------------------VLLDDFLHQ---AKRMWLLG-------LALIL
R6VAT5          ----------------------------EYASKILTG---IKKHWYII-------AVLAG
A0A1Q6S448      ----------------------------IEPLCILRA---LARQLWML-------LLAAL
A0A351MYR0      ----------------------------IEPYCLLRT---LLRQLWML-------LMAGA
R6HPC1          ----------------------------IEPYCLVRT---LLRQLWML-------LLAAA
A0A3D4G5Z5      ----------------------------IEPYCLVRT---LLRQLWML-------LLAAA
A0A3D5ES03      ----------------------------IEPYCLVRT---LLRQLWML-------LLAAA
A0A0F2P7X6      ----------------------------ISLGEIISA---LFKWWWLV-------VLCTV
A0A359B487      ----------------------------ISLGEIISA---LFKWWWLV-------ILCTV
A0A348P5V4      ----------------------------DTALMYAKK---LMDKWFVI-------LLSAI
A0A356PT74      ----------------------------DSVVIYLKK---ILQHWKIV-------VISAV
A0A3D5LL19      ----------------------------DSVVIYLKK---ILQHWKIV-------VISAV
R5MNF0          ----------------------------DSVVIYLKK---ILQHWKIV-------VISAV
A0A1Q9JSI0      ----------------------------NIDLYS------ICKDIWKY-------ALVIL
A0A3D5TNI1      ----------------------------NI-MYVFGL---LIRRLWLL-------MLVGL
A0A358LJD0      ----------------------------NI-MYVFGL---LLRRLWLL-------ILVAL
R6I3L7          ----------------------------NI-MYAFGL---LLRRLWLL-------ILVAL
A0A3D1HXX0      ----------------------------NI-MYAFGL---LLRRLWLL-------ILVAL
A0A3D2QJB8      ----------------------------NI-MYAFGL---LLRRLWLL-------ILVAL
D4LC36          ----------------------------KD---LVYL---MLGRIWWI-------IGAAL
R7MQJ4          ----------------------------KK---LIQL---FLSKIYVI-------IILTI
A0A1V5GLC0      ----------------------------KD---LINL---FLSKLWLI-------ILLAV
W7V182          ----------------------------KS---MVAL---LLSKLWII-------ILAAV
                                                                            

S3FFL2          ASLVAGLVITLLMTPQ-------------YTATAQIEI---SREGNQVTNFQGVER----
A0A328M4V1      VFFALAVIYSVLATPI-------------YQSSAIVQV---ENTVPSLPGLEDLAQ----
A0A6A8IF17      VTIGAATAYLLRTPAV-------------YTRTASVLI---KEDSKGKSVSSDLESFSEF
A0A3D5R4X5      AFLIISALISF-FILT-------PI----YQSSTALMVNKTFSESEMLNQ----------
A0A1I4C3N6      VGGAVGGAYAL-FMGQ-------DL----YRSEITMTA---FSNPDYAND-----S-GIN
A0A3B9CIM7      VLGMVAGAYAS-ITST-------SL----YMAQISFYV---YSNPDYITD-----S-SVN
A0A1G9WHW8      VAALLFGGYAY-ATRS-------SV----YQAKISFYA---YSDPDYASD-----T-SVN
A0A1H5VAA0      VAALLFGGYAY-ATRS-------SV----YQAKISFYA---YSDPDYASD-----T-SVN
A0A3R6VK11      LGGMAGGAYAY-LTNS-------TL----YRAEVSFYV---YSDPDYVYD-----S-SVN
A0A3R6QUY7      LGGMAGGAYAY-LTNS-------TL----YRAEVSFYV---YSDPDYVYD-----S-SVN
A0A373K3P9      LGGMAGGAYAY-LTNS-------TL----YRAEVSFYV---YSDPDYVYD-----S-SVN
A0A3R6JRU5      LGGMAGGAYAY-LTNS-------TL----YRAEVSFYV---YSDPDYVYD-----S-SVN
A0A1C5MS04      LGGMAGGAYAY-LTNS-------TL----YRAEVSFYV---YSDPDYVYD-----S-SVN
A0A3C1J150      LGGMAGGAYAY-LTNS-------TL----YRAEVSFYV---YSDPDYVYD-----S-SVN
A0A416CXD7      LGGMAGGAYAY-LTNS-------TL----YRAEVSFYV---YSDPDYVYD-----S-SVN
A0A6N2X662      LGGMAGGAYAY-LTNS-------TL----YRAEVSFYV---YSDPDYVYD-----S-SVN
R6XBL9          LGGMAGGAYAY-LTNS-------TL----YRAEVSFYV---YSDPDYVYD-----S-SVN
A0A355W5Z7      LGGMAGGAYAY-LTNS-------TL----YRAEVSFYV---YSDPDYVYD-----S-SVN
A0A143WVN6      AVRMGISGYYE-LTYE-------PQ----YTSTATLAV---TARGSSNGS-----Y-S--
W6RXP9          IFSVVAGVLSF-FVIK-------PT----YEAGTKLFI---GKEESQNST-----Y-DNN
W6S4G8          FFTALVALITF-FFID-------PV----YEVHTKVFI---GKDAEVN-------Y-DNN
A0A1G6BLB6      AAMLLMYAYLA-YTYA-------ET----YTMTTTFTV---VSASTENDA-----Y-T--
A0A1C6G8M0      VFGIALGMYGK-FVVK-------DV----FQAEASMCI---IDSNKEVSI-----S----
A0A416MP73      IFGAALGVYGK-FIVK-------DA----YQAEASMCI---IDSNKEVSM-----S----
A0A3E4LL92      LTGMFSYVILD-HSLK-------DT----YTVSVNLCV---IPRDNTSEK-----L----
A0A415D1L1      LTGMFSYVILD-HSLK-------DT----YTVSVNLCV---IPRDNTSEK-----L----
A0A0H5SF45      FCAIMSYVYNK-FIKD-------PV----YTASVQFCV---NTNDNSSGN-----I-N--
A0A1M6JRJ5      GGLLLSFLYTS-YFVD-------KT----YTASTQFYV---STADSTAAN-----L-S--
A0A1M7Y1S2      AGLLLSFLYTR-YFVD-------KT----YTASSQFYV---STIESTSAN-----L-S--
A0A7I8DMN1      AGLLISFLFTR-YFVD-------RT----YTASTQFYV---STQNSTSTN-----L-S--
A0A396G6S7      AAALFADIWIC-ATYQ-------PE----YRTSTTFVV---TAKGMNNNI-----Y-Q--
A0A3E5A223      AAALFADIWIC-ATYQ-------PE----YRTSTTFVV---TAKGMNNNI-----Y-Q--
R7D5E6          AAALFADIWIC-ATYQ-------PE----YRTSTTFVV---TAKGMNNNI-----Y-Q--
A0A415HQH5      AAALFADIWIC-ATYQ-------PE----YRTSTTFVV---TAKGMNNNI-----Y-Q--
A0A414W2C6      AAALFADIWIC-ATYQ-------PE----YRTSTTFVV---TAKGMNNNI-----Y-Q--
A5ZNE7          AAALFADIWIC-ATYQ-------PE----YRTSTTFVV---TAKGMNNNI-----Y-Q--
A0A395X821      AAALFADIWIC-ATYQ-------PE----YRTSTTFVV---TAKGMNNNI-----Y-Q--
A0A1C5PY68      AAALFADIWIC-ATYQ-------PE----YRTSTTFVV---TAKGMNNNI-----Y-Q--
A0A174CJF8      AAALFADIWIC-ATYQ-------PE----YRTSTTFVV---TAKGMNNNI-----Y-Q--
A0A564SRR2      AAALFADIWIC-ATYQ-------PE----YRTSTTFVV---TAKGMNNNI-----Y-Q--
A0A174R7V0      AAALFADIWIC-ATYQ-------PE----YRTSTTFVV---TAKGMNNNI-----Y-Q--
A0A373MWV2      SAAMITYTVLT-AVHR-------DQ----YTVKTTFAV---MGRGENANA-----A-S--
A0A417CE88      SAAMITYTVLT-AVHR-------DQ----YTVKTTFAV---MGRGENANA-----A-S--
A0A416Y441      SAAMITYTVLT-AVHR-------DQ----YTVKTTFAV---MGRGENANA-----A-S--
A0A357GPJ7      SAAMITYTVLT-AVHR-------DQ----YTVKTTFAV---MGRGENANA-----A-S--
A0A396PAC1      SAAMITYTVLT-AVHR-------DQ----YTVKTTFAV---MGRGENANA-----A-S--
A0A416EYU4      SAAMITYTVLT-AVHR-------DQ----YTVKTTFAV---MGRGENANA-----A-S--
A0A416SCQ2      SAAMITYTVLT-AVHR-------DQ----YTVKTTFAV---MGRGENANA-----A-S--
A0A416TGN7      SAAMITYTVLT-AVHR-------DQ----YTVKTTFAV---MGRGENANA-----A-S--
A0A417SMF6      SAAMITYTVLT-AVHR-------DQ----YTVKTTFAV---MGRGENANA-----A-S--
A0A1Y4MW77      AGGAIMFVTNI-QTYT-------PM----YQASATFTV---TTNTTTDQN-----N-QSD
R6UHV6          IAAIGCFITAT-QLYS-------PQ----YMTSTTLLV---QSKNNTESA-----Y-N--
A0A3R9Q621      LALAATFAVNK-YLIS-------ES----YTASVQFYV---NTQDSQTQK-----I-DLN
A0A069RC75      VSVAVSAVMTF-YVSE-------PE----YSSYTTLMV---N-KARGDNE-----N-YID
A0A6S6R676      SGLFLFLLVSS-FIVQ-------PS----YTASVQLYV---NPNDKEATT-----A-TLS
A0A174F2W5      SAAMITYTVLT-AVHR-------DQ----YTVKTTFAV---MGRGENANA-----A-S--
A0A174S8E9      SAAMITYTVLT-AVHR-------DQ----YTVKTTFAV---MGRGENANA-----A-S--
A0A416ZL97      SVAMITYTVLT-TVHK-------DR----YTVKTTFAV---MGRGVDANA-----A-S--
A0A174LSK1      SAAMITYTVMA-TVHK-------DR----YTVKTTFAV---MGRGVDANA-----A-S--
A0A373GY92      SAAMITYTVMA-TVHK-------DR----YTVKTTFAV---MGRGVDANA-----A-S--
A0A373NZQ6      SAAMITYTVMA-TVHK-------DR----YTVKTTFAV---MGRGVDANA-----A-S--
A0A417I9B9      SAAMITYTVMA-TVHK-------DR----YTVKTTFAV---MGRGVDANA-----A-S--
A0A417MP97      SAAMITYTVMA-TVHK-------DR----YTVKTTFAV---MGRGVDANA-----A-S--
A0A417WQF8      SAAMITYTVMA-TVHK-------DR----YTVKTTFAV---MGRGVDANA-----A-S--
A0A373RZ83      SAAMITYTVMA-TVHK-------DR----YTVKTTFAV---MGRGVDANA-----A-S--
A0A416U6I1      SAAMITYTVMA-TVHK-------DR----YTVKTTFAV---MGRGVDANA-----A-S--
R7JQZ9          SAAMITYTVMA-TVHK-------DR----YTVKTTFAV---MGRGVDANA-----A-S--
A0A7C6SMH0      FVTVSTFLITS-YYLT-------PI----YRSEATLFL---GKESGNVGG-----L-SIG
A0A3B8KKL6      FVTVSTFLITS-YYLT-------PI----YRSEATLFL---GKESGNVGG-----L-SIG
A0A2K9E6R0      FVTVSTFLITS-YYLT-------PI----YRSEATLFL---GKESGNVGG-----L-SIG
A0A2S8RBI0      FVTVSTFLITS-YYLT-------PI----YRSEATLFL---GKESGNVGG-----L-SIG
A0A0L6JLG6      VATGAAYTVTA-FYLK-------PV----YRAETTLFL---GKEKDKIGA-----L-SLL
G8LSN0          LATGSSFAITK-FYLK-------PV----YRAQTTLFL---GKESDKVAS-----L-SIA
A0A1M5UYN6      LTTLIGGIYSF-YVLK-------PT----YYSSMSVII---GKTVSVDGN-----I-SMD
A0A176JBT8      VCLLIGFIYTY-FIAS-------PI----YESKTDLLV---NTTPTANTA-----E-PVS
A0A1I5HIC6      LSAAAAIFISK-VFIT-------PV----YTSSTKLYI---INRQNKDTI-----T-SS-
A0A1Y3TC51      AVWLAATGWHN-LTYQ-------PE----YTSSATLVV---TVKGSSSTY-----S----
A0A1Y3T1N0      SLWLGITGVHT-LIYE-------PA----YTSTATLVV---TVKGESSAY-----S----
A0A1Y3Y8U8      SLWLGITGVHT-LIYE-------PV----YTSTATLVV---TVKGQTSAY-----S----
A0A5B0BQY5      IATLIGGGIG--YTIP-------RT----YEAKTDLLV---NSMGKVEGN-----S-APT
A6CLL4          LVTASGIILS--LSLP-------KE----YEAKVDLLV---N-YSPENNQ-----G-SLS
A0A176U8D6      ACGVALGVYGR-FVVK-------DA----YESEASMCI---IDSNKEVSM-----S----
A0A1Q6KSQ5      VFGIALGMYGK-FVVK-------DV----FQAEASMCI---IDSNKEVSI-----S----
A0A3D3U8B3      VFGIALGMYGK-FVVK-------DV----FQAEASMCI---IDSNKEVSI-----S----
A0A3E5FRL7      SLYLAATGIGK-LVYI-------PE----YTVSTTLVV---NAQGTSDTY-----T----
A0A1Y4QK93      SLWLAATGIGK-LVYV-------PE----YTVSTTLVV---SAKGTSDTY-----T----
B1C232          SLYLAATGIGK-LVYI-------PE----YTVSTTLVV---NAQGTSDTY-----T----
A0A401USI6      CPTLIAGLLSF-YVIK-------PV----YEAKATVIV---GKDSTDKIT-----Q-S--
A0A1V4IQ10      ITTAISILYSF-YIVK-------PQ----YEASTKVFV---GKETGIEEK-----Y-NNN
A0A1S8TRD2      ITTAISIFYSF-YIVK-------PQ----YEACTKVFV---GKETADKEK-----Y-DNN
G7M1U2          ITTAISIFYSF-YIVK-------PQ----YEACTKVFV---GKETADKEK-----Y-DNN
A0A2T6KJ75      YITLIGG-FSS-FAIP-------PK----FEAKTDVLV---NFTTANVVS-----S-G--
A9KN92          VCAVAAGLISK-FVMT-------PV----YTSDTKLYI---I-NRQNKDT-----I-TSS
A0A352MUJ1      AFLFVGYIYNA-FITT-------PE----YKAATTLLL---VKSSEGTSS-----V-TQA
R5YI67          AFLFIGYVYNA-FVTT-------PQ----YKSATTLIL---VKAEN--SG-----T-TTN
A0A174DL89      SSIIISTIATL-FFIE-------PT----YESKISVII---G-PNQSTSG-----D-YSS
A0A1Y0IQP5      LAVGLTGAGSF-LVLE-------PE----YEATTTLLV---Q-SKQAGNV-----I-AYN
A0A4R2R7B1      LAVGLAGAGSF-LVLE-------PE----YEATTTLLV---Q-SKQTEKG-----I-AYN
A0A1M6E8I2      FAAILAILVTM-VAIT-------PV----YESNTTLMV---NSSKTSSLG-----D-IAS
A0A1Y4N105      ATYFAIAGVYR-LTYS-------PH----YTTTATMAV---TARGSQSGT-----Y-S--
A0A1Y4QP75      ATYFAIAGVYR-LTYS-------PQ----YTTTATMAV---TARGSQSGT-----Y-S--
A0A3D4QRB5      LFASASGIISV-FFLD-------DV----YASSTTLIV---SKQNQNSNV-----N-EIQ
A0A349DEH5      IGAIIGAVVSE-ATKK-------ET----YTSTASFVV---N-TSSDSEK-----A-SSN
A0A3D4T7B4      IGAIIGAVVSE-ATKK-------ET----YTSTASFVV---N-TSSDSEK-----A-SSN
A0A350XYC7      IGAAIGGVAGE-ATKK-------ET----YTSTVSFVV---N-SATENGQ-----A-SSG
R6DNR8          IGAAIGGFVGH-ATRQ-------ET----YTSTVSFVV---N-SATEAGQ-----T-SSG
A0A355KUM5      IGATIGGVIGE-ATKS-------ET----YTSTVSFVV---N-SATENGQ-----V-SSG
R5YGY6          IGATIGGVIGE-ATKS-------ET----YTSTVSFVV---N-SATENGQ-----V-SSG
A0A0K8J554      IGAGLLFVVNR-FIRR-------PI----YTASVQLYV---N-PNDTTPA-----A-NLN
A0A1I0RG99      VGICSFFINSK-YIIK-------PT----YVASVQMYV---N-PNETTYS-----A-DLN
A0A1I5G322      GGLCVSFLYSK-YIIK-------PT----YIASVQMYV---N-SNDSTSS-----A-DLN
A0A7C6IYW8      LGLFTLFICSK-FIIN-------PS----YTASVQLYV---I-PNDTETS-----V-NLN
A0A3N1XSX6      AGLLISFIFSR-YIIN-------PS----YTAYVQLYV---I-PDDTEAS-----L-NLN
A0A7C6JZF1      LGFLSFYLVNR-YVTE-------PS----YTAQVKMYV---N-PNEATGS-----G-DLN
A0A7G9WCY6      VTTTTSAVVSY-FFLD-------RV----YEASSSLVI---L---AKADS-----G-NIQ
A0A1C6G0U3      IFIIVTAIFNF-YIIE-------PT----YVADTTIIV---S-KSVTNTN-----D-TIS
A0A3D4LLB3      VFAAAGAVVSI-YLIQ-------PV----YESSTTLIV---R-EDKD-AE-----E-KIS
A0A0A5GPA9      LVVIIGIAIS--LLLP-------RT----YEGEGALLV---NFTSVKSDE-----D-EIS
A0A271M6M4      FMVFLGAAIS--YFMP-------PV----YQAKTDLLV---NFKAEGVES-----K-DIS
A0A7C7AD93      AILAIAVIYRT-QLSK-------PS----YEARVSLII---G-SVINNEK-----T-QFQ
A0A2V3W8U6      LFALLAVIVNS-FIIK-------PV----YEARSDLLV---N-NTVPMTE-----E-TLT
A0A6N3BXA1      IFGLITAGVNQ-FLLK-------PV----YEANTTIIT---N-KEVDEEK-----V-QMS
A0A351SRI8      LGLILSIVYTA-KIQV-------PV----YEAKTSLVL---V-NNMG-EN-----T-TIT
A0A1V5LU59      LAVGLSFVVSQ-YYLK-------PI----YKANATLFL---G-KESD-KI-----A-SLS
A0A1E3BVC3      LAAGSAFVVTQ-FYIK-------PI----YKAETTLFL---G-KEKD-QV-------SLS
A0A4Q0I6S0      LAAGSAFVVTQ-FYIK-------PI----YKAETTLFL---G-KEKD-QV-------SLS
A3DF66          LSAGTAFVVTQ-FYIK-------PV----YKAETTLFL---G-KEKD-QV-------SLS
W4V1T8          LAAGSAFVVTQ-FYIK-------PV----YKAETTLFL---G-KEKD-QV-------SLS
A0A1C6ITD7      ISTILTAITTI-FFIE-------PT----YQANISIII---G-QNQSTVD-----E-GTS
A0A381IX63      ASILIVSIKTF-FFTT-------PI----YEAQTTIII---N-NLLG-KS-----S-QLT
A0A1G9IUT4      ITMFTSAGLSF-FVID-------PV----YEANTTLIV---N-KVKEVNT-----Q-DIT
A0A1M6RWV2      ITTITTSVVSF-FFLD-------KV----YEASTKLVL---V-KGGD--------S-DIQ
A0A143XPI5      ISTAAGYYYAKE-SYR-------PN----YEAYASFAV---DAGVSSYS-----------
A0A355G1X5      LCATIGWSVSFM-TTD-------PT----YTTNLSFTT---YNKAAADV-----------
A0A0M6WXE3      AGAMLFYVASSM-IYV-------PN----YRTQATFVI---TSRENANA-----------
A0A348SAK2      AGAMLFYVASSM-IYV-------PN----YRTQATFVI---TSRENANA-----------
A0A1G9H5B9      LGFGAFYMYMTR-RMP-------ET----YTATGTMYV---SSYNPEYI--------DDE
R5EFZ0          AVGIGTYIYTDA-TYA-------PV----YRTTTTFVV---TTRGSSTS-----------
A0A1Y4H8L0      AAAMLAATVLSL-RWQ-------PA----YTTSATFAV---SSRVGASS-----------
A0A4B9BMD9      AKPGTQFVLSQRTELE-------AI----NALQETFTV---SERSKESG-----------
A0A0M6WYQ8      IFGLNSYIKARK-NYT-------PV----YTASATVAV---TTIDGSPA-----------
A0A348SAK1      IFGLNSYIKARK-NYT-------PV----YTASATVAV---TTIDGSPA-----------
A0A252F281      SAVMLTRVASET-IYK-------PE----YTSSVTMSV---TSKSGSNA-----------
A0A1Y4QKE6      ICTIAFSTFRYL-TYT-------PI----YRCEATFTV---ATDSENTG----------S
B1C231          ICTIAFSTFRYL-TYT-------PI----YRCEATFTV---ATDSENTG----------S
A0A1Y3TUL5      VLSIASYMRGEM---A-------KG----YSITSSIAV---TTQDAGGN-FT---T-NTS
A0A1Y4JAX2      VLSIASYMRGEM---A-------KG----YSITSSIAV---TTQDAGGN-FT---T-NTS
A0A1Y4T590      VLSIASYMRGEM---A-------KG----YSITSSIAV---TTQDAGGN-FT---T-NTS
R5B467          LCAAASGGYARL-SYR-------PQ----YTASMTFLV---NAGGTSQS-----------
A0A1Y3T163      AGAGGFYAFQNL-SYE-------PL----YASSATFTV---ATGDG---------E-NGT
A0A1Y3YCA2      AGAGGFYAFQNL-SYE-------PL----YASSATFTV---ATGDG---------E-NGT
A0A1Y4L6N9      IGGSIFYLRASR-FYT-------PM----YRAEAVFTV---MTSTQSNS--E---N-SGS
A0A173T644      LGSAAYYVKNSQ-FYT-------PM----YQSVASFTV---MTGGNSEN-GQ---E-EGS
A0A1C5TSB8      LGSAAYYVKNSQ-FYT-------PM----YQSVASFTV---MTGGNSEN-GQ---E-EGS
C0CIK6          LGSAAYYVKNSQ-FYT-------PM----YQSVASFTV---MTGGNSEN-GQ---E-EGS
A0A1Y3WEF6      VGAGAFYLRATRLFYT-------PM----YQSSATFTV---LTGGTMDT------E-NST
A0A417T0L2      VGAGAFYLRATSLFYT-------PM----YQSSATFTV---LTGGSTDS------E-NST
A0A1H9EPU3      CVAVIAFVYSKF-VIT-------PL----YSASTQILV---MNENSGTGNTT---T-DGK
A0A354IGV3      TGAMGAHVVLQT-IYK-------PQ----YTCSATYIV---SSKYSTVS-----------
A0A417JMV2      SMSLLSYVYVGR-NYH-------KQ----YESTSTFIV---SSKGSNNS-----------
A0A415VWX5      SMSLLSYVYVGR-NYH-------KQ----YESTSTFIV---SSKGSNNS-----------
A0A173UY96      SMSLLSYVYVGR-NYH-------KQ----YESTSTFIV---SSKGSNNS-----------
B0P408          SMSLLSYVYVGR-NYH-------KQ----YESTSTFIV---SSKGSNNS-----------
D4MV82          SMSLLSYVYVGR-NYH-------KQ----YESTSTFIV---SSKGSNNS-----------
A0A173QTL1      SMSLLSYVYVGR-SYH-------KQ----YESTSTFIV---SSKGSNNS-----------
A0A174J359      SMSLLSYVYVGR-NYH-------KQ----YESTSTFIV---SSKGSNNS-----------
A0A174A3T7      SMSLLSYVYVGR-NYH-------KQ----YESTSTFIV---SSKGSNNS-----------
A0A417UUA3      SMSLLSYVYVGR-NYH-------KQ----YESTSTFIV---SSKGSNNS-----------
A0A6N2VB70      SMSLLSYVYVGR-NYH-------KQ----YESTSTFIV---SSKGSNNS-----------
A0A1C6EUV9      SMSLLAYVYVGR-SYH-------KQ----YESTSTFIV---SSKGSNNS-----------
A0A173Y645      SMSLLAYVYVGR-SYH-------KQ----YESTSTFIV---SSKGSNNS-----------
A0A374AVY6      SMSLLAYVYVGR-SYH-------KQ----YESTSTFIV---SSKGSNNS-----------
R7BXS4          SMSLLAYVYVGR-SYH-------KQ----YESTSTFIV---SSKGSNNS-----------
A0A143ZUX1      IFAVAGFLFAQ-LTYK-------PT----YSSIGSFWL---QIYSTNE-------N-DQT
A0A1W1Z4C3      IGFGFMYWRASKAIDT-------------YTASGTMFV---TNSNPNLVNY--------G
A0A239QN83      IGFGVMYYRASKAPDT-------------YTASGTMFV---TNSNPNLVNY--------G
A0A3R9WAA7      SVAMLVCVYAR-EKYS-------PR----YTAAVTFTV---NLD-----------L-ASD
A0A1G6BLF1      ICATLFYTHVK-MVYE-------PK----YTAEATYLV---TAAS----------Y-YGY
R6HZX3          LVGALRYVQAQ-RSFV-------PQ----YTATASFSV---KSGYVGTT------D-LVD
A0A1W2CEA6      IGALIAWFYVT-RLVT-------PV----YQATSKIYI---AGSD--------------T
R7FFK6          VGAAGTFLVSS-YVIP-------QQ----FQSNISMYV---KNSEKQN--Q----E-QQ-
A0A373MPB9      VCAILALFVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----D-KT-
A0A373L519      VCAVLALFVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----D-KT-
A0A373W906      VCAILALFVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----D-KT-
A0A373VCW2      VCAILALFVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSMGQ----D-KT-
W0U604          VCAILALFVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----D-KT-
A0A374B6G0      VCAILALFVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----D-KT-
A0A373VM36      VCAILALFVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----D-KT-
A0A1C5P379      VCAILALFVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----D-KT-
A0A373XXX0      VCAILALFVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----D-KT-
A0A5R9MJM9      VCAILALFVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----D-KT-
A0A356CW82      VCAILALFVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----D-KT-
R6T4X7          VCAILALFVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----D-KT-
A0A374HTV1      VCAILALFVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----D-KT-
A0A374GB66      VCAILALFVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----D-KT-
A0A374ECC6      VCAILALFVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----D-KT-
A0A374BM61      VCAILALFVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----D-KT-
A0A373UGZ4      VCAILALFVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----D-KT-
A0A373SA66      VCAILALFVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----D-KT-
A0A1C5X6X7      VCAILALFVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----D-KT-
A0A1C6JIH3      VCAILALFVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----D-KT-
A0A373PSC3      VCAILALFVSK-FVMS-------KQ----YQSHVSMYV---KSADNQSTGQ----D-KT-
A0A1K1WYK8      IGGIAAFSFSK-FVLP-------VK----YSSHITMYV---QS----YTGI----S-ENA
A0A1H6IUB1      IGGAAAFCYSK-FVMP-------LK----YSSHISMYV---QS----YTGI----T-EN-
A0A1M7L1F9      IGGTAAFCYSK-FVMP-------LK----YSSHISMYV---QS----YTGI----S-EN-
A0A1C6B4L6      AGGILSFGFSK-MFLP-------FE----YSSHVSMYV---QS----YTGI----S-DQ-
A0A1Q6T9P4      AGGILSFGFSK-MFLP-------FE----YSSHVSMYV---QS----YTGI----S-DQ-
A0A315Y4F9      LGAGAAFGISK-FLLP-------LQ----YSSHITMYV---QS----YTGI----T-EN-
A0A354K620      LGGAAGFSVSR-FLLP-------LK----YSSHITMYV---QS----YTGI----T-EN-
A0A355G3J9      LGAMLLAGATW-ALIK-------PT----YTATAKLYV---YNEH----------S-TDT
A0A3D2AD87      LCAAMTFAYCK-FVVN-------PK----YKAQSTIYV---TNGNINPGETVEEQE-ETD
A0A143XN92      SFSLIAYMIID-SSYK-------PK----YTSSTTFIV---TGKG-------------LN
A0A173ZYY6      AGALLTYVVVS-SRYV-------PE----YTTQATFVV---SSRG--------------D
A0A6L8RXB5      AGALLTYVVVS-SRYV-------PE----YTTQATFVV---ASRG--------------D
A0A6N9JW85      AGALLTYVVVS-SRYV-------PE----YTTQATFVV---ASRG--------------D
A0A173SMI2      AGALLTYVVVS-SRYV-------PE----YTTQATFVV---ASRG--------------D
A0A174ASH7      AGALLTYVVVS-SRYV-------PE----YTTQATFVV---SSRG--------------D
A6BH65          AGALLTYVVVS-SRYV-------PE----YTTQATFVV---SSRG--------------D
R7G0D7          AGALLTYVVVS-SRYV-------PE----YTTQATFVV---SSRG--------------D
A0A2T5IYJ6      AITVATAFVVSTVRPV-------------YRATATLMI---EQKQ---GKT----L-TSL
A0A3C0QME1      LGGGGAYAYAH-FMMP-------NQ----YQSYTSMYV---RNSG----NI----L-GDL
A0A355FYK5      VFAAAGYFFAKASYVPIYTVSATIE----FTSTKYIKV---ADAT----GK----E-ELV
A0A357AQU0      LCAAIGFSYAK-FYLP-------ET----FTSSIRMYV---KNLN----ST----E-TVS
A0A3C1YJQ7      LCAAIGFSYAK-FYLP-------ET----FTSSIRMYV---KNLN----ST----E-TVS
A0A3D0JG38      LCAAIGFSYAK-FYLP-------ET----FTSSIRMYV---KNLN----ST----E-TVS
A0A3C0IHX1      CFSAIGFSYGK-YYLP-------LE----YTSSTYMYV---KNGD----TS----E-EKT
R5V506          CFSAIGFSYGK-YYLP-------LE----YTSSTYMYV---KNGD----TS----E-EKT
A0A352TIU5      CFSAIGFSYGK-YYLP-------LE----YTSSTYMYV---KNGD----AS----E-EKT
A0A3E5FSY5      ICTIAFSTFRY-LTYT-------PI----YRCEATFTV---ATDS-----E----N-TGS
A0A1V5S3C0      IFASAGFVFSR-VTYE-------ER----FSSKILFNA---SNKS-SDIAG----E-AAK
A0A1Y3TC98      AGAAGVTVYQR-VFHQ-------PM----YECSATFTV---ATGN-----S----E-NGS
A0A1Q6REE0      ICAAGLTFVQR-RAYR-------PV----YEASASFTV---RVAN----------P-LYA
R5ETF9          ICAAGLTFVQR-RAYR-------PV----YEASASFTV---RVAN----------P-LYA
R6VAT5          ICCVGFTLYSY-AAYT-------PQ----YTAAATFTV---TPKG-----D----S-LSA
A0A1Q6S448      TCSMAAWIVLT-CFVT-------QQ----YTSSTTFSV---TTRT--------------S
A0A351MYR0      ACAMAAWIVLS-CFVT-------QQ----YTSSTTFAV---TARA--------------S
R6HPC1          ACAMAAWIVLS-CFVT-------RQ----YTSSTTFAV---TARA--------------S
A0A3D4G5Z5      ACAMAAWIVLS-CFVT-------RQ----YTSSTTFAV---TARA--------------S
A0A3D5ES03      ACAMAAWIVLS-CFVT-------RQ----YTSSTTFAV---TARA--------------S
A0A0F2P7X6      LAALGAYFYTI-STYV-------PV----YTASASMVV---NSKQ---LKI----V-GQE
A0A359B487      LAALGAYFYTI-YTYV-------PV----YTASASMVV---NSKQ---LKI----V-GQE
A0A348P5V4      LCAGVGFGVAV-ARYT-------EH----YSSQIMFIA---SNRS----SA----I-TVA
A0A356PT74      VLAVLGFAVAK-LTYT-------PS----YSSKITFIA---NNKS----SA----L-AVS
A0A3D5LL19      VLAVLGFAVAK-LTYT-------PS----YSSKITFIA---NNKS----SA----L-AVS
R5MNF0          VLAVLGFAVAK-LTYT-------PS----YSSKITFIA---NNKS----SA----L-AVS
A0A1Q9JSI0      LLAASMSLLAY-VKVG-------RSYHKMYESTSTFIV---SGK-------------GSN
A0A3D5TNI1      IVGASCAGITK-LVEE-------PT----YTSSMTFIV---NNKSEKDLSS----S-GDN
A0A358LJD0      VVGASCAVVTK-AVEE-------PT----YTSSMTFIV---NNKSEKDLSS----S-GDN
R6I3L7          VVGASCAVITK-AVEE-------PT----YTLSMTFIV---NNKSEKDLSS----S-GEN
A0A3D1HXX0      VVGASCAVITK-AVEE-------PT----YTSSMTFIV---NNKSEKDLSS----S-GDN
A0A3D2QJB8      VVGASCAVITK-AVEE-------PT----YTLSMTFIV---NNKSEKDLSS----S-GEN
D4LC36          ICGLGAFLISD-FAIP-------RK----YQSNVSMYV---RNKE----------D-QKQ
R7MQJ4          VGGAAAFGFSK-FFMP-------LK----YQSYTSMYV---KNNN----SV----T-ETD
A0A1V5GLC0      IGGAAGFCYTK-FCMP-------LQ----YSSHMSMYV---QCYT----ST----S-GPT
W7V182          LGGTAAFCVSK-FLMP-------LK----YASHISMYI---QSYT----TF----N-ENP
                                                                            

S3FFL2          ----NSNQVDQEFYQTQYGLLRS--------RSLSERVATQLRLVDD-------------
A0A328M4V1      TLGTSTSQAVTEIA-----LLTS--------RTVVGGAIDNLKLEIESEPERFPVIGNFM
A0A6A8IF17      GLFQSGTNVNNELI-----TFRS--------PSLMTEVVKRLRLDMN----------YFV
A0A3D5R4X5      IQLS-DINVNIRLAETYSEIIKS--------RRVASRVIDEMNL--D-------------
A0A1I4C3N6      INVS-DVQSAQQLITSYSSVLTS--------SIFLNDVLEASGLQDQ-------------
A0A3B9CIM7      IGSS-DITQAKNLITSYMQILKS--------RTFLEKVKEETGL--G-------------
A0A1G9WHW8      ITYS-EVNQAKNLISSYTQILKS--------NTFLEALKEETGL--N-------------
A0A1H5VAA0      ITYS-EVNQAKNLISSYTQILKS--------NTFLEALKEETGL--N-------------
A0A3R6VK11      ISNS-EFTQAKNLVQSYILILKS--------NTILQKVLEEAGL--D-------------
A0A3R6QUY7      ISNS-EFTQAKNLVQSYILILKS--------NTILQKVLEEAGL--D-------------
A0A373K3P9      ISNS-EFTQAKNLVQSYILILKS--------NTILQKVLEEAGL--D-------------
A0A3R6JRU5      ISNS-EFTQAKNLVQSYILILKS--------NTILQKVLEEAGL--D-------------
A0A1C5MS04      ISNS-EFTQAKNLVQSYILILKS--------NTILQKVLEEAGL--D-------------
A0A3C1J150      ISNS-EFTQAKNLVQSYILILKS--------NTILQKVLEEAGL--D-------------
A0A416CXD7      ISNS-EFTQAKNLVQSYILILKS--------NTILQKVLEEAGL--D-------------
A0A6N2X662      ISNS-EFTQAKNLVQSYILILKS--------NTILQKVLEEAGL--D-------------
R6XBL9          ISNS-EFTQAKNLVQSYILILKS--------NTILQKVLEEAGL--D-------------
A0A355W5Z7      ISNS-EFTQAKNLVQSYILILKS--------NTILQKVLEEAGL--D-------------
A0A143WVN6      -----SLTTAMNMADVFSEVFQS--------DALKKMIEADIGE----------------
W6RXP9          -----DIQMYQKLLKTYAEMIKN--------DELIEKAIREVNT--T-------------
W6S4G8          -----DVQMYQKLLLTYAQILKT--------EDLIGTALNNVDS--D-------------
A0A1G6BLB6      -----NIQSASTTATSFQTILSN--------SVVQEAVAKAAGM----------------
A0A1C6G8M0      -----DLQIGSALTNDYEGIIKS--------RVVLTKVISNLNL--D-------------
A0A416MP73      -----DVQLGSALTGDYEGIIKS--------RVVLNKVIENLKL--D-------------
A0A3E4LL92      -----AETNIENALERSVNVLNS--------DTMRDQIVKASGG----------------
A0A415D1L1      -----AETNIENALERSVNVLNS--------DTMRDQIMKASGS----------------
A0A0H5SF45      -----ELNYAQKVVSTYVNLLRT--------NTFYRQVLEATGL--N-------------
A0A1M6JRJ5      -----ELDYAQKIAETYINFLNT--------RQFYAQVLELSRL--P-------------
A0A1M7Y1S2      -----ELDYAQKIAETYINFLNT--------RQFYSQVLELSGL--P-------------
A0A7I8DMN1      -----DLDYAQKIAETYINFLNT--------RQFYTEVLKMSGL--P-------------
A0A396G6S7      -----NLNSTKELAGQFTEILGS--------NVLKKKVAQDLGV----------------
A0A3E5A223      -----NLNSTKELAGQFTEILGS--------NVLKKKVAQDLGV----------------
R7D5E6          -----NLNSTKELAGQFTEILGS--------NVLKKKVAQDLGV----------------
A0A415HQH5      -----NLNSTKELAGQFTEILGS--------NVLKKKVAQDLGV----------------
A0A414W2C6      -----NLNSTKELAGQFTEILGS--------NVLKKKVAQDLGV----------------
A5ZNE7          -----NLNSTKELAGQFTEILGS--------NVLKKKVAQDLGV----------------
A0A395X821      -----NLNSTKELASQFTEILGS--------NVLKKKVAQDLGM----------------
A0A1C5PY68      -----NLNSTKELASQFTEILGS--------NVLKKKVAQDLGM----------------
A0A174CJF8      -----NLNSTKELASQFTEILGS--------NVLKKKVAQDLGM----------------
A0A564SRR2      -----NLNSTKELASQFTEILGS--------NVLKKKVAQDLGM----------------
A0A174R7V0      -----NLNSTKELASQFTEILGS--------NVLKKKVAQDLGM----------------
A0A373MWV2      -----SLSSTYEMTQKFQAILEN--------NILKKKVMEELGC----------------
A0A417CE88      -----SLSSTYEMTQKFQAILEN--------NILKKKVMEELGC----------------
A0A416Y441      -----SLSSTYEMTQKFQAILEN--------NILKKKVMEELGC----------------
A0A357GPJ7      -----SLSSTYEMTQKFQAILEN--------NILKKKVMEELGC----------------
A0A396PAC1      -----SLSSTYEMTQKFQAILEN--------NILKKKVMEELGC----------------
A0A416EYU4      -----SLSSTYEMTQKFQAILEN--------NILKKKVMEELGC----------------
A0A416SCQ2      -----SLSSTYEMTQKFQAILEN--------NILKKKVMEELGC----------------
A0A416TGN7      -----SLSSTYEMTQKFQAILEN--------NILKKKVMEELGC----------------
A0A417SMF6      -----SLSSTYEMTQKFQAILEN--------NILKKKVMEELGC----------------
A0A1Y4MW77      YNYYYDSSTAEQLSLTFPYILSS--------QILNDAIEADLGV----------------
R6UHV6          -----NLTATNKMAGVFKNILDS--------SQLQNSAARQLGY----------------
A0A3R9Q621      -----ELNYAQKVVNTYINFLKT--------KVFYNMLIEETRL--P-------------
A0A069RC75      YE---SYIISQKLVDTYAVVAKS--------ETVMERTIKNLNL--R-------------
A0A6S6R676      -----ELDYAQKVVTTYINFLKT--------KVFYKQVADRSRL--E-------------
A0A174F2W5      -----SLSSTYEMTQKFQAILEN--------NILKKKVMEELGC----------------
A0A174S8E9      -----SLSATYEMTQKFQAILEN--------NILKKKVMEELGC----------------
A0A416ZL97      -----SLSATYEMAQKFEAILEN--------TILKKKVMEELSL----------------
A0A174LSK1      -----SLSATYEMAQKFEAILEN--------TILKKKVMEELSL----------------
A0A373GY92      -----SLSATYEMAQKFEAILEN--------TILKKKVMEELSL----------------
A0A373NZQ6      -----SLSATYEMAQKFEAILEN--------TILKKKVMEELSL----------------
A0A417I9B9      -----SLSATYEMAQKFEAILEN--------TILKKKVMEELSL----------------
A0A417MP97      -----SLSATYEMAQKFEAILEN--------TILKKKVMEELSL----------------
A0A417WQF8      -----SLSATYEMAQKFEAILEN--------TILKKKVMEELSL----------------
A0A373RZ83      -----SLSATYEMAQKFEAILEN--------TILKKKVMEELSL----------------
A0A416U6I1      -----SLSATYEMAQKFEAILEN--------TILKKKVMEELSL----------------
R7JQZ9          -----SLSATYEMAQKFEAILEN--------TILKKKVMEELSL----------------
A0A7C6SMH0      -----DIQLNNQLIADYRELLKS--------RTVAERVGEKLNV----------------
A0A3B8KKL6      -----DIQLNNQLIADYRELLKS--------RTVAERVGEKLNV----------------
A0A2K9E6R0      -----DIQLNNQLIADYRELLKS--------RTVAERVGEKLNV----------------
A0A2S8RBI0      -----DIQLNNQLIADYRELLKS--------RTVAERVGEKLNV----------------
A0A0L6JLG6      -----DLQINSQLVVDYREILKS--------RLVAEKIQSQLGV----------------
G8LSN0          -----DIQVNNQLVSDYRELLKS--------NLVAESIEKKLGV----------------
A0A1M5UYN6      IN---DVTMYVKALETYIQIAKS--------EDVAEGARGILGD--R-------------
A0A176JBT8      PL---EIDASLKLIETYQYILKS--------QRMADLVIKDLDG--L-------------
A0A1I5HIC6      -----DLQTGSQLTQDYKILVLS--------RPVTEQVLSKLNL--D-------------
A0A1Y3TC51      -----SLSLTTQMADVFGQVFQS--------DALAEKIAEETG-----------------
A0A1Y3T1N0      -----SLSVTSQMADVFGEVFQS--------SALRSRIIEDVG-----------------
A0A1Y3Y8U8      -----SLSVTSQMADVFGEVFQS--------SALRSRIIEDVG-----------------
A0A5B0BQY5      MG---EIETNLRLIETYTDIFTS--------NRLVSEVKIVLGD--S-------------
A6CLL4          VG---EVETNLRLISTYKYILKS--------PRVLEIVAERTEE--N-------------
A0A176U8D6      -----DLQVGSALTNDYEGIIKS--------RVVLTKAIANLKL--D-------------
A0A1Q6KSQ5      -----DLQIGSALTNDYEGIIKS--------RVVLTKVISNLNL--N-------------
A0A3D3U8B3      -----DLQIGSALTNDYEGIIKS--------RVVLTKVISNLNL--N-------------
A0A3E5FRL7      -----SLAMANEMADIIKEVFQS--------DVLLELVENEIG-----------------
A0A1Y4QK93      -----SLAMASEMADIIKEVFQS--------DVLLELVENEIG-----------------
B1C232          -----SLAMANEMADIIKEVFQS--------DVLLELVENEIG-----------------
A0A401USI6      -----EVMMYQDLIKTYSEIGKS--------RVVAENAIKNLKS--G-------------
A0A1V4IQ10      -----DVEMYQKLLKTYSELIKT--------NTLVSRALNRYDL--D-------------
A0A1S8TRD2      -----DVEMYQKLLKTYSELAKT--------NTLVSKALKEHNI--D-------------
G7M1U2          -----DVEMYQKLLKTYSELAKT--------NTLVSKALKEHNI--D-------------
A0A2T6KJ75      -----EIDANLRLIETYKYLMKS--------NRILTKVNGSLDE--T-------------
A9KN92          -----DLQTGSQLTQDFKVMVLS--------RPVTEQVISKLNL--N-------------
A0A352MUJ1      -----DVTLNQKLVYTYTELVKS--------DTVLNEVANRIQL--N-------------
R5YI67          -----DVTLNQKLVYTYSELVKS--------DSVLNEVISRVQL--D-------------
A0A174DL89      SQSSYDVVMYQKMVKTYSELLTS--------KIVLQDVIENTGL--D-------------
A0A1Y0IQP5      -----DLLTDQKLVTTYGEIFQS--------RMIAEAVIDRLSL--N-------------
A0A4R2R7B1      -----DLLTDQKLVTTYGEIFQS--------RMIAEAVIERLGL--D-------------
A0A1M6E8I2      GFDIGSINLSQKLVVTYSEIVKS--------RIVLEAVIDKIEL--D-------------
A0A1Y4N105      -----SLTTAMNMAEVFSEVFQS--------DTLKEKIEADLEV----------------
A0A1Y4QP75      -----SLTTAMNMAEVFSEVFQS--------DTLKEKIKADLEV----------------
A0A3D4QRB5      LS---DVNLSRNLVDTYSVIIKS--------NRVLENVVSDLGL--N-------------
A0A349DEH5      -----DIYVQINMAGTFRYILSS--------RVMKNAIVEKCTP--K-------------
A0A3D4T7B4      -----DIYVQINMAGTFRYILSS--------RVMKNAIVEKCTP--K-------------
A0A350XYC7      -----EINAQINMAGTFNYILSS--------PRMKEAIVEKCSE--K-------------
R6DNR8          -----EINAQINMAGTFSYILSS--------RALKEAIVEKCPE--K-------------
A0A355KUM5      -----EINAQINMAGTFSYILSS--------RALKEAIVEKCPE--K-------------
R5YGY6          -----EINAQINMAGTFSYILSS--------RALKEAIVEKCPE--K-------------
A0A0K8J554      -----ELNYAQKVVATYVNLLRT--------QKFYKKVLEETGL--N-------------
A0A1I0RG99      -----ELNYAQKVVTTYINFLQT--------KVFYKQVIDESKL--N-------------
A0A1I5G322      -----ELNYAQKVVTTYISFLQT--------KKFYEQVIEESNL--R-------------
A0A7C6IYW8      -----ELNYAQKVVTTYINFLNT--------NVFYQKIQDDTNL--D-------------
A0A3N1XSX6      -----ELNYAQKVVTTYINFLNT--------NVFYHDIQEESNL--N-------------
A0A7C6JZF1      -----ELNYAQKVITTYINFLKT--------NRFYQEVAEGSGL--S-------------
A0A7G9WCY6      YN---DVLLNQRLVKTYSEIAKS--------RSVSTEVIRKLGL--N-------------
A0A1C6G0U3      SE---ELSVTKNLAITYANIIKS--------RAVLEKVINSMNL--E-------------
A0A3D4LLB3      IS---DVNLSKSLVYTYAEMVKS--------HTVLDNTAKTLKI--D-------------
A0A0A5GPA9      SS---EIETNLRLIETYKSILIS--------PRIMDKVKAQYGS--D-------------
A0A271M6M4      TV---EIETNLRLIETYKYILNS--------TRIMEKVAEKTGS--K-------------
A0A7C7AD93      ID---NVKETKEYMQTYIMILKT--------NVVAERTIERLGL--N-------------
A0A2V3W8U6      AL---DIETNLRLIETYHFIIQS--------DRIIDLVVEELDE--P-------------
A0A6N3BXA1      TSD--DFTFSQRMAITYSKIITS--------DTVLNQVIDNLNL--K-------------
A0A351SRI8      TT---DITINKNLVSTYREIIQS--------KLILNKTIENLNL--D-------------
A0A1V5LU59      FA---DIQLNNQLVSDYRELLKS--------DLVAESVKEKLGV----------------
A0A1E3BVC3      FA---DIQVNNQLVVDYREILQS--------RRVAEIINQKFGV----------------
A0A4Q0I6S0      FA---DIQVNNQLVVDYREILQS--------RRVAEIINQKFGV----------------
A3DF66          FS---DIQVNNQLVVDYREILQS--------RRVAEIINQKFGV----------------
W4V1T8          FA---DIQVNNQLVVDYREILQS--------RRVAETINQKFGV----------------
A0A1C6ITD7      YPGSYDVVMYQKMVKTYSEMITS--------RVVLEDVIENTGL--D-------------
A0A381IX63      KE---DISYSQLLGETYKPIVKS--------RKVAEEIKKNLNL--E-------------
A0A1G9IUT4      ND---DVLANQKLALTYGEIIKS--------RTVLDKVIKNLNI--D-------------
A0A1M6RWV2      YN---DVLLNQRLVKTYSEIASS--------RTIAEEVINNLKL--N-------------
A0A143XPI5      -SSYYNSTTIKQLSATFPYILTS--------GALRQIVMNDLGLE---------------
A0A355G1X5      -VSSSDINSSIMMTNTFKYILEG--------RPMRETVAKSCSFN---------------
A0A0M6WXE3      ---YNNLSSANSMAETFQKILES--------TIMKKTICEKLDMD---------------
A0A348SAK2      ---YNNLSSANSMAETFQKILES--------TIMKKTICEKLDMD---------------
A0A1G9H5B9      YTRPGDLSSASQLIKTLLVVVKR--------DSVMSKVADRVSET---------------
R5EFZ0          --VYSNLSSTSNLAGLFTELLNS--------SIMRKTILQETDIS---------------
A0A1Y4H8L0      ---YADLNSASEMAGTFQKILQS--------SALNKILCEELEVD---------------
A0A4B9BMD9      ---MLELTMTGDDPQLITRILNSIANNYLQQNIARQAAQDSQSLE---------------
A0A0M6WYQ8      ---YQNNASAQQMADVFPYILTS--------GVLKDVVAKDMKLD---------------
A0A348SAK1      ---YQNNASAQQMADVFPYILTS--------GVLKDVVAKDMKLD---------------
A0A252F281      ---VADLNTTRQMASAFQGVLES--------DLLHETVAAAMGET---------------
A0A1Y4QKE6      YSYYYSQNTADQLSKTFPYILDS--------SYFRSILLEELGVN---------------
B1C231          YSYYYSQNTADQLSKTFPYILDS--------SYFRSILLDELGVN---------------
A0A1Y3TUL5      NPDSSDIQLAEDMVDAVIYVLKS--------DRTLKAAIQNIK-----------------
A0A1Y4JAX2      NPDSSDIQLAEDMVDAVIYVLKS--------DRTLKAAIQNIK-----------------
A0A1Y4T590      NPDSSDIQLAEDMVDAVIYVLKS--------DRTLKAAIQNIE-----------------
R5B467          -GSAASTATAAQMAKTFPYILTS--------GLLDSAVRADTGLA---------------
A0A1Y3T163      YNFYYNRNTADQMSRTFPYILDS--------SFFRSALLERLGTD---------------
A0A1Y3YCA2      YNFYYNSNTADQMSRTFPYILDS--------SFFRSALLERLGTD---------------
A0A1Y4L6N9      YNFYYDSTTAGQLAKTFPYILSS--------NLLNEAIKEDLGIS---------------
A0A173T644      YNFYYDTTTAGQLAKTFPYILGS--------SLLTDAIKEDLGVD---------------
A0A1C5TSB8      YNFYYDTTTAGQLAKTFPYILGS--------SLLTDAIKEDLGVD---------------
C0CIK6          YNFYYDTTTAGQLAKTFPYILGS--------SLLTDAIKEDLGVD---------------
A0A1Y3WEF6      YNFYYDTNTVGQLAKTFPYILSS--------SLLTEAIEEDLGVD---------------
A0A417T0L2      YNFYYDTTTAGQLAKTFPYILSS--------TLLTEAIEEDLGVD---------------
A0A1H9EPU3      SVSVSDLQSSTFLVKDYTYMITS--------KPVMKSVIDEYGLD---------------
A0A354IGV3      ---YSNISATSDTASLFSKLLDS--------QVLRKHAAEAIGVE---------------
A0A417JMV2      --IYSDLSATSEMATKFSEILNS--------SILQKKVAKEMDMD---------------
A0A415VWX5      --VYSDLSATSEMATKFSEILNS--------SILQKKVAKEMDMD---------------
A0A173UY96      --VYSDLSATSEMATKFSEILNS--------SILQKKVAKEMDMD---------------
B0P408          --VYSDLSATSEMATKFSEILNS--------SILQKKVAKEMDMD---------------
D4MV82          --VYSDLSATSEMATKFSEILNS--------SILQKKVAKEMDMD---------------
A0A173QTL1      --VYSDLSATSEMATKFSEILNS--------SILQKKVAKEMDMD---------------
A0A174J359      --VYSDLSATSEMATKFSEILNS--------SILQKKVAKEMDMD---------------
A0A174A3T7      --VYSDLSATSEMATKFSEILNS--------SILQKKVAKEMDMD---------------
A0A417UUA3      --VYSDLSATSEMATKFSEILNS--------SILQKKVAKEMDMD---------------
A0A6N2VB70      --VYSDLSATSEMATKFSEILNS--------SILQKKVAKEMDMD---------------
A0A1C6EUV9      --VYSDLGTTTEMATKFSEILNS--------SILQKKVAKEMNMD---------------
A0A173Y645      --VYSDLSTTTEMATKFSEILNS--------SILQKKVAKEMNMD---------------
A0A374AVY6      --VYSDLSTTTEMATKFSEILNS--------SILQKKVAKEMNMD---------------
R7BXS4          --VYSDLSTTTEMATKFSEILNS--------SILQKKVAKEMNMD---------------
A0A143ZUX1      KLVMSDIQAATGLAQTYQYFLTG--------ADTIDYVLEESGLD---------------
A0A1W1Z4C3      YTSTSDISSAVQLVNIYSEVVKS--------ETVMQKVLEYAIEPAG-------------
A0A239QN83      YTSTSDISSAVQLVNIYSEVVKS--------ETVMQRVLEYAIEPAG-------------
A0A3R9WAA7      GSIYEDSMRASQLSATFPYIVTS--------SILKNIIAEELG-----------------
A0A1G6BLF1      TESYYNETTASGLATSLEYVLNS--------TVMQKTVAEA-------------------
R6HZX3          STQYYDNQAAEQVVSSFPYIICS--------EAMQERICLALNTSW--------------
A0A1W2CEA6      TISLSDLQLGSTLATDYQEVFKI--------WHVHEMVDERLDLD---------------
R7FFK6          GINNNDLTVSKSLVSTYIVILNN--------DVVMDEVGNQLAKEYT-------------
A0A373MPB9      NVDLQDIDASKSLVQTYIVILTD--------DPVMNEVSDKLLEMYT-------------
A0A373L519      NVDLQDINASKSLVQTYIVILTD--------DPVMNEVSDKLLEMYT-------------
A0A373W906      NVDLQDINASKSLVQTYIVILTD--------DPVMNEVSDKLLEMYT-------------
A0A373VCW2      NVDLQDIDASKSLVQTYIVILTD--------DPVMNEVSDKLLEMYT-------------
W0U604          NVDLQDINASKSLVQTYIVILTD--------DPVMNEVSDKLLEMYT-------------
A0A374B6G0      NVDLQDINASKSLVQTYIVILTD--------DPVMNEVSDKLLEMYT-------------
A0A373VM36      NVDLQDINASKSLVQTYIVILTD--------DPVMNEVSDKLLEMYT-------------
A0A1C5P379      NVDLQDINASKSLVQTYIVILTD--------DPVMNEVSDKLLEMYT-------------
A0A373XXX0      NVDLQDINASKSLVQTYIVILTD--------DPVMNEVSDKLLEMYT-------------
A0A5R9MJM9      NVDLQDINASKSLVQTYIVILTD--------DPVMNEVSDKLLEMYT-------------
A0A356CW82      NVDLQDINASKSLVQTYIVILTD--------DPVMNEVSDKLLEMYT-------------
R6T4X7          NVDLQDINASKSLVQTYIVILTD--------DPVMNEVSDKLLEMYT-------------
A0A374HTV1      NVDLQDINASKSLVQTYIVILTD--------DPVMNEVSDKLLEMYT-------------
A0A374GB66      NVDLQDINASKSLVQTYIVILTD--------DPVMNEVSDKLLEMYT-------------
A0A374ECC6      NVDLQDINASKSLVQTYIVILTD--------DPVMNEVSDKLLEMYT-------------
A0A374BM61      NVDLQDINASKSLVQTYIVILTD--------DPVMNEVSDKLLEMYT-------------
A0A373UGZ4      NVDLQDINASKSLVQTYIVILTD--------DPVMNEVSDKLLEMYT-------------
A0A373SA66      NVDLQDINASKSLVQTYIVILTD--------DPVMNEVSDKLLEMYT-------------
A0A1C5X6X7      NVDLQDINASKSLVQTYIVILTD--------DPVMNEVSDKLLEMYT-------------
A0A1C6JIH3      NVDLQDINASKSLVQTYIVILTD--------DPVMNEVSDKLLEMYT-------------
A0A373PSC3      NVDLQDINASKSLVQTYIVILTD--------DPVMNEVSDKLLEMYT-------------
A0A1K1WYK8      ANDVNNISNSKQLVNTYMEVLKD--------DEVMNAVSAKLLEQYD-------------
A0A1H6IUB1      ANQQNNISNSKQLVNTYMEVLKD--------DAVMNAVGDKLLTQFD-------------
A0A1M7L1F9      ANQQNNISNSKQLVNTYMEVLKD--------DAVMNSVGELLKKQFD-------------
A0A1C6B4L6      MADQNNISNSKQLVNTYMEVLKD--------DAVMAAIGELLLEQFD-------------
A0A1Q6T9P4      MADQNNISNSKQLVNTYMEVLKD--------DAVMAAIGELLLEQFD-------------
A0A315Y4F9      ANSANNISNSKQLVNTYMEVLKD--------DAVMNAVAEKLSKQFE-------------
A0A354K620      ANNVNNISNSKQLVNTYMEVLKD--------DAVMNAVAEKLAKQFE-------------
A0A355G3J9      YITSSDLAVSKSLVDTYLIIIKS--------DPVLDKVQKDLAAKYP-------------
A0A3D2AD87      GVKGTDVSASVSLSFTVVDILKQ--------PDIYREMVNTIEKYND-------------
A0A143XN92      NSIYDNLLTAQDMTNRFKNIIDS--------NILKEKIAEVLS-----------------
A0A173ZYY6      ANAYSNLSSANTMAKTFEKILKS--------NIMEKKICEKLK-----------------
A0A6L8RXB5      ANAYSNLSSANTMAKTFEKILKS--------NIMEKKICEKLK-----------------
A0A6N9JW85      ANAYSNLSSANTMAKTFEKILKS--------NIMEKKICEKLK-----------------
A0A173SMI2      ANAYSNLSSANTMAKTFEKILKS--------NIMEKKICEKLK-----------------
A0A174ASH7      ANAYSNLSSANTMAKTFEKILKS--------NIMEKKICEKLK-----------------
A6BH65          ANAYSNLSSANTMAKTFEKILKS--------NIMEKKICEKLK-----------------
R7G0D7          ANAYSNLSSANTMAKTFEKILKS--------NIMEKKICEKLK-----------------
A0A2T5IYJ6      DDVYGTDGGKEYYLQTQFEILKS--------RELATRVVTELNIANH-------------
A0A3C0QME1      DINISALNASRSLLDTYTVVLKS--------NYVMGEVAERLEMEYT-------------
A0A355FYK5      TVV---VPYENNDINRYSTLMKS--------DAMIYALADKLNNDYN-------------
A0A357AQU0      SVTTSDLNASKSLVMTYIVILKD--------PVVVGEVAETLAENHE-------------
A0A3C1YJQ7      SVTTSDLNASKSLVMTYIVILKD--------PVVVGEVAETLAENHE-------------
A0A3D0JG38      SVTTSDLNASKSLVMTYIVILKD--------PVVVGEVAETLAENHE-------------
A0A3C0IHX1      AINQQDLMASKSLVETYIVILKN--------DTVVKQVGMSLVSKFG-------------
R5V506          AINQQDLMASKSLVETYIVILKN--------DTVVKQVGMSLVSKFG-------------
A0A352TIU5      AINQQDLMASKSLVETYIVILKN--------DTVVKQVGMSLVSKFG-------------
A0A3E5FSY5      YSYYYSQNTADQLSKTFPYILDS--------SYFRSILLDELG-----------------
A0A1V5S3C0      YTTASDVQASVTFATSFKFILTE--------TDYIYSLVKQAVKAQS-------------
A0A1Y3TC98      YSFYYNSSTADQMSLTFPYILES--------NFFQSALMEELG-----------------
A0A1Q6REE0      SVSSYNEKTAQVMADTFPSILTS--------GLLQRRVMEELG-----------------
R5ETF9          SVSSYNEKTAQVMADTFPSILTS--------GLLQRRVMDELG-----------------
R6VAT5          YTSISSNASTQQLEKTFPYIITS--------APLTRVVAEDLG-----------------
A0A1Q6S448      NLYYTNITAAADVAASYSQLLQS--------RVLRQTMEQNLG-----------------
A0A351MYR0      TLYYTNITAAADMASSYTQLLQS--------RVLRQTMEQDLG-----------------
R6HPC1          TLYYTNITAAADMAASYSQLLQS--------RVLRQTMEQNLG-----------------
A0A3D4G5Z5      TLYYTNITAAADMAASYSQLLQS--------RVLRQTMEQNLG-----------------
A0A3D5ES03      TLYYTNITAAADMAASYSQLLQS--------RVLRQTMEQNLG-----------------
A0A0F2P7X6      AVLTNDVNLSAKLVNTYTAVLTS--------NRVMELVAGELD-----------------
A0A359B487      AVLTNDVNLSAKLVNTYTAVLTS--------NRVMELVAGELD-----------------
A0A348P5V4      GQSSSDINASVSLAESFKYVFTT--------TELATKVANSCGYANP-------------
A0A356PT74      GQTQSDLNASATLAESFKYVFTT--------TELSKRVADNSGFKD--------------
A0A3D5LL19      GQTQSDLNASATLAESFKYVFTT--------TELSKRVADNSGFKD--------------
R5MNF0          GQTQSDLNASATLAESFKYVFTT--------TELSKRVADNSGFKD--------------
A0A1Q9JSI0      NNVYSNLNTTAQMATKFSEILNS--------SILQKKVAKEMN-----------------
A0A3D5TNI1      SVSYNDMSASAYMANTFVHLMTG--------RTMCNAIAAECKTYP--------------
A0A358LJD0      SVSYNDMSASAYMANTFVHLMTG--------RTMCNAIASECKSYP--------------
R6I3L7          SVSYNDMSASAYMANTFVHLMTG--------RTMCNAIAAECKSYP--------------
A0A3D1HXX0      SVSYNDMSASAYMANTFVHLMTG--------RTMCNAIAAECKSYP--------------
A0A3D2QJB8      SVSYNDMSASAYMANTFVHLMTG--------RTMCNAIAAECKSYP--------------
D4LC36          DINNSDLSVSKSLVSTYIVILNN--------DAVMEQVGEQLLKQHT-------------
R7MQJ4          GVNLNDLNASKSLVSTYIAVMQD--------DAVMEKVGSELLAEFD-------------
A0A1V5GLC0      D--YNDISKSKQLINTYIEVLKD--------DAVMNAVGGKLMNEFD-------------
W7V182          DQNFNNINNSKQLINTYMEVMKD--------DAVMNAVAEELRGSFE-------------
                                                                            

S3FFL2          --------------PGFFEMFGVGREDQGPFAL------------VNNRYT---------
A0A328M4V1      ARRYTPPVPGAVAPP----FAGLSSYDWGGSSLDIYQLDVPRSLLDQQLYL-DAGQNGTY
A0A6A8IF17      RGKFHRQVAYGLTLPVDVTINDLPENESAGFTLEIQP--------DGTLYLSDFIRNGTD
A0A3D5R4X5      ------------------------------------------------------------
A0A1I4C3N6      ------------------------------------------------------------
A0A3B9CIM7      ------------------------------------------------------------
A0A1G9WHW8      ------------------------------------------------------------
A0A1H5VAA0      ------------------------------------------------------------
A0A3R6VK11      ------------------------------------------------------------
A0A3R6QUY7      ------------------------------------------------------------
A0A373K3P9      ------------------------------------------------------------
A0A3R6JRU5      ------------------------------------------------------------
A0A1C5MS04      ------------------------------------------------------------
A0A3C1J150      ------------------------------------------------------------
A0A416CXD7      ------------------------------------------------------------
A0A6N2X662      ------------------------------------------------------------
R6XBL9          ------------------------------------------------------------
A0A355W5Z7      ------------------------------------------------------------
A0A143WVN6      ------------------------------------------------------------
W6RXP9          ------------------------------------------------------------
W6S4G8          ------------------------------------------------------------
A0A1G6BLB6      ------------------------------------------------------------
A0A1C6G8M0      ------------------------------------------------------------
A0A416MP73      ------------------------------------------------------------
A0A3E4LL92      ------------------------------------------------------------
A0A415D1L1      ------------------------------------------------------------
A0A0H5SF45      ------------------------------------------------------------
A0A1M6JRJ5      ------------------------------------------------------------
A0A1M7Y1S2      ------------------------------------------------------------
A0A7I8DMN1      ------------------------------------------------------------
A0A396G6S7      ------------------------------------------------------------
A0A3E5A223      ------------------------------------------------------------
R7D5E6          ------------------------------------------------------------
A0A415HQH5      ------------------------------------------------------------
A0A414W2C6      ------------------------------------------------------------
A5ZNE7          ------------------------------------------------------------
A0A395X821      ------------------------------------------------------------
A0A1C5PY68      ------------------------------------------------------------
A0A174CJF8      ------------------------------------------------------------
A0A564SRR2      ------------------------------------------------------------
A0A174R7V0      ------------------------------------------------------------
A0A373MWV2      ------------------------------------------------------------
A0A417CE88      ------------------------------------------------------------
A0A416Y441      ------------------------------------------------------------
A0A357GPJ7      ------------------------------------------------------------
A0A396PAC1      ------------------------------------------------------------
A0A416EYU4      ------------------------------------------------------------
A0A416SCQ2      ------------------------------------------------------------
A0A416TGN7      ------------------------------------------------------------
A0A417SMF6      ------------------------------------------------------------
A0A1Y4MW77      ------------------------------------------------------------
R6UHV6          ------------------------------------------------------------
A0A3R9Q621      ------------------------------------------------------------
A0A069RC75      ------------------------------------------------------------
A0A6S6R676      ------------------------------------------------------------
A0A174F2W5      ------------------------------------------------------------
A0A174S8E9      ------------------------------------------------------------
A0A416ZL97      ------------------------------------------------------------
A0A174LSK1      ------------------------------------------------------------
A0A373GY92      ------------------------------------------------------------
A0A373NZQ6      ------------------------------------------------------------
A0A417I9B9      ------------------------------------------------------------
A0A417MP97      ------------------------------------------------------------
A0A417WQF8      ------------------------------------------------------------
A0A373RZ83      ------------------------------------------------------------
A0A416U6I1      ------------------------------------------------------------
R7JQZ9          ------------------------------------------------------------
A0A7C6SMH0      ------------------------------------------------------------
A0A3B8KKL6      ------------------------------------------------------------
A0A2K9E6R0      ------------------------------------------------------------
A0A2S8RBI0      ------------------------------------------------------------
A0A0L6JLG6      ------------------------------------------------------------
G8LSN0          ------------------------------------------------------------
A0A1M5UYN6      ------------------------------------------------------------
A0A176JBT8      ------------------------------------------------------------
A0A1I5HIC6      ------------------------------------------------------------
A0A1Y3TC51      ------------------------------------------------------------
A0A1Y3T1N0      ------------------------------------------------------------
A0A1Y3Y8U8      ------------------------------------------------------------
A0A5B0BQY5      ------------------------------------------------------------
A6CLL4          ------------------------------------------------------------
A0A176U8D6      ------------------------------------------------------------
A0A1Q6KSQ5      ------------------------------------------------------------
A0A3D3U8B3      ------------------------------------------------------------
A0A3E5FRL7      ------------------------------------------------------------
A0A1Y4QK93      ------------------------------------------------------------
B1C232          ------------------------------------------------------------
A0A401USI6      ------------------------------------------------------------
A0A1V4IQ10      ------------------------------------------------------------
A0A1S8TRD2      ------------------------------------------------------------
G7M1U2          ------------------------------------------------------------
A0A2T6KJ75      ------------------------------------------------------------
A9KN92          ------------------------------------------------------------
A0A352MUJ1      ------------------------------------------------------------
R5YI67          ------------------------------------------------------------
A0A174DL89      ------------------------------------------------------------
A0A1Y0IQP5      ------------------------------------------------------------
A0A4R2R7B1      ------------------------------------------------------------
A0A1M6E8I2      ------------------------------------------------------------
A0A1Y4N105      ------------------------------------------------------------
A0A1Y4QP75      ------------------------------------------------------------
A0A3D4QRB5      ------------------------------------------------------------
A0A349DEH5      ------------------------------------------------------------
A0A3D4T7B4      ------------------------------------------------------------
A0A350XYC7      ------------------------------------------------------------
R6DNR8          ------------------------------------------------------------
A0A355KUM5      ------------------------------------------------------------
R5YGY6          ------------------------------------------------------------
A0A0K8J554      ------------------------------------------------------------
A0A1I0RG99      ------------------------------------------------------------
A0A1I5G322      ------------------------------------------------------------
A0A7C6IYW8      ------------------------------------------------------------
A0A3N1XSX6      ------------------------------------------------------------
A0A7C6JZF1      ------------------------------------------------------------
A0A7G9WCY6      ------------------------------------------------------------
A0A1C6G0U3      ------------------------------------------------------------
A0A3D4LLB3      ------------------------------------------------------------
A0A0A5GPA9      ------------------------------------------------------------
A0A271M6M4      ------------------------------------------------------------
A0A7C7AD93      ------------------------------------------------------------
A0A2V3W8U6      ------------------------------------------------------------
A0A6N3BXA1      ------------------------------------------------------------
A0A351SRI8      ------------------------------------------------------------
A0A1V5LU59      ------------------------------------------------------------
A0A1E3BVC3      ------------------------------------------------------------
A0A4Q0I6S0      ------------------------------------------------------------
A3DF66          ------------------------------------------------------------
W4V1T8          ------------------------------------------------------------
A0A1C6ITD7      ------------------------------------------------------------
A0A381IX63      ------------------------------------------------------------
A0A1G9IUT4      ------------------------------------------------------------
A0A1M6RWV2      ------------------------------------------------------------
A0A143XPI5      ------------------------------------------------------------
A0A355G1X5      ------------------------------------------------------------
A0A0M6WXE3      ------------------------------------------------------------
A0A348SAK2      ------------------------------------------------------------
A0A1G9H5B9      ------------------------------------------------------------
R5EFZ0          ------------------------------------------------------------
A0A1Y4H8L0      ------------------------------------------------------------
A0A4B9BMD9      ------------------------------------------------------------
A0A0M6WYQ8      ------------------------------------------------------------
A0A348SAK1      ------------------------------------------------------------
A0A252F281      ------------------------------------------------------------
A0A1Y4QKE6      ------------------------------------------------------------
B1C231          ------------------------------------------------------------
A0A1Y3TUL5      ------------------------------------------------------------
A0A1Y4JAX2      ------------------------------------------------------------
A0A1Y4T590      ------------------------------------------------------------
R5B467          ------------------------------------------------------------
A0A1Y3T163      ------------------------------------------------------------
A0A1Y3YCA2      ------------------------------------------------------------
A0A1Y4L6N9      ------------------------------------------------------------
A0A173T644      ------------------------------------------------------------
A0A1C5TSB8      ------------------------------------------------------------
C0CIK6          ------------------------------------------------------------
A0A1Y3WEF6      ------------------------------------------------------------
A0A417T0L2      ------------------------------------------------------------
A0A1H9EPU3      ------------------------------------------------------------
A0A354IGV3      ------------------------------------------------------------
A0A417JMV2      ------------------------------------------------------------
A0A415VWX5      ------------------------------------------------------------
A0A173UY96      ------------------------------------------------------------
B0P408          ------------------------------------------------------------
D4MV82          ------------------------------------------------------------
A0A173QTL1      ------------------------------------------------------------
A0A174J359      ------------------------------------------------------------
A0A174A3T7      ------------------------------------------------------------
A0A417UUA3      ------------------------------------------------------------
A0A6N2VB70      ------------------------------------------------------------
A0A1C6EUV9      ------------------------------------------------------------
A0A173Y645      ------------------------------------------------------------
A0A374AVY6      ------------------------------------------------------------
R7BXS4          ------------------------------------------------------------
A0A143ZUX1      ------------------------------------------------------------
A0A1W1Z4C3      ------------------------------------------------------------
A0A239QN83      ------------------------------------------------------------
A0A3R9WAA7      ------------------------------------------------------------
A0A1G6BLF1      ------------------------------------------------------------
R6HZX3          ------------------------------------------------------------
A0A1W2CEA6      ------------------------------------------------------------
R7FFK6          ------------------------------------------------------------
A0A373MPB9      ------------------------------------------------------------
A0A373L519      ------------------------------------------------------------
A0A373W906      ------------------------------------------------------------
A0A373VCW2      ------------------------------------------------------------
W0U604          ------------------------------------------------------------
A0A374B6G0      ------------------------------------------------------------
A0A373VM36      ------------------------------------------------------------
A0A1C5P379      ------------------------------------------------------------
A0A373XXX0      ------------------------------------------------------------
A0A5R9MJM9      ------------------------------------------------------------
A0A356CW82      ------------------------------------------------------------
R6T4X7          ------------------------------------------------------------
A0A374HTV1      ------------------------------------------------------------
A0A374GB66      ------------------------------------------------------------
A0A374ECC6      ------------------------------------------------------------
A0A374BM61      ------------------------------------------------------------
A0A373UGZ4      ------------------------------------------------------------
A0A373SA66      ------------------------------------------------------------
A0A1C5X6X7      ------------------------------------------------------------
A0A1C6JIH3      ------------------------------------------------------------
A0A373PSC3      ------------------------------------------------------------
A0A1K1WYK8      ------------------------------------------------------------
A0A1H6IUB1      ------------------------------------------------------------
A0A1M7L1F9      ------------------------------------------------------------
A0A1C6B4L6      ------------------------------------------------------------
A0A1Q6T9P4      ------------------------------------------------------------
A0A315Y4F9      ------------------------------------------------------------
A0A354K620      ------------------------------------------------------------
A0A355G3J9      ------------------------------------------------------------
A0A3D2AD87      ------------------------------------------------------------
A0A143XN92      ------------------------------------------------------------
A0A173ZYY6      ------------------------------------------------------------
A0A6L8RXB5      ------------------------------------------------------------
A0A6N9JW85      ------------------------------------------------------------
A0A173SMI2      ------------------------------------------------------------
A0A174ASH7      ------------------------------------------------------------
A6BH65          ------------------------------------------------------------
R7G0D7          ------------------------------------------------------------
A0A2T5IYJ6      ------------------------------------------------------------
A0A3C0QME1      ------------------------------------------------------------
A0A355FYK5      ------------------------------------------------------------
A0A357AQU0      ------------------------------------------------------------
A0A3C1YJQ7      ------------------------------------------------------------
A0A3D0JG38      ------------------------------------------------------------
A0A3C0IHX1      ------------------------------------------------------------
R5V506          ------------------------------------------------------------
A0A352TIU5      ------------------------------------------------------------
A0A3E5FSY5      ------------------------------------------------------------
A0A1V5S3C0      ------------------------------------------------------------
A0A1Y3TC98      ------------------------------------------------------------
A0A1Q6REE0      ------------------------------------------------------------
R5ETF9          ------------------------------------------------------------
R6VAT5          ------------------------------------------------------------
A0A1Q6S448      ------------------------------------------------------------
A0A351MYR0      ------------------------------------------------------------
R6HPC1          ------------------------------------------------------------
A0A3D4G5Z5      ------------------------------------------------------------
A0A3D5ES03      ------------------------------------------------------------
A0A0F2P7X6      ------------------------------------------------------------
A0A359B487      ------------------------------------------------------------
A0A348P5V4      ------------------------------------------------------------
A0A356PT74      ------------------------------------------------------------
A0A3D5LL19      ------------------------------------------------------------
R5MNF0          ------------------------------------------------------------
A0A1Q9JSI0      ------------------------------------------------------------
A0A3D5TNI1      ------------------------------------------------------------
A0A358LJD0      ------------------------------------------------------------
R6I3L7          ------------------------------------------------------------
A0A3D1HXX0      ------------------------------------------------------------
A0A3D2QJB8      ------------------------------------------------------------
D4LC36          ------------------------------------------------------------
R7MQJ4          ------------------------------------------------------------
A0A1V5GLC0      ------------------------------------------------------------
W7V182          ------------------------------------------------------------
                                                                            

S3FFL2          ---------------------------------------------AAGRSERLRIAGDIL
A0A328M4V1      TLSDDDDGVLLT------GRVGDKVTAKGITIQVKSMLANPGTRFDVTRHGRLALITSLQ
A0A6A8IF17      LEEKDVKGSLLDSITTPLGKIIIHTTPNYVKGEAYTLYVGKSSLYNA--------VNSCS
A0A3D5R4X5      ------------------------------------------------------ISYEGL
A0A1I4C3N6      ------------------------------------------------------YSVLAL
A0A3B9CIM7      ------------------------------------------------------YSTDYL
A0A1G9WHW8      ------------------------------------------------------YSTSTF
A0A1H5VAA0      ------------------------------------------------------YSTSTF
A0A3R6VK11      ------------------------------------------------------YGTEAL
A0A3R6QUY7      ------------------------------------------------------YGTEAL
A0A373K3P9      ------------------------------------------------------YGTEAL
A0A3R6JRU5      ------------------------------------------------------YGTEAL
A0A1C5MS04      ------------------------------------------------------YGTEAL
A0A3C1J150      ------------------------------------------------------YGTEAL
A0A416CXD7      ------------------------------------------------------YGTEAL
A0A6N2X662      ------------------------------------------------------YGTEAL
R6XBL9          ------------------------------------------------------YGTEAL
A0A355W5Z7      ------------------------------------------------------YGTEAL
A0A143WVN6      ---------------------------------------------------------SNI
W6RXP9          ------------------------------------------------------MTAEEI
W6S4G8          ------------------------------------------------------MTMEEV
A0A1G6BLB6      ---------------------------------------------------------DSI
A0A1C6G8M0      ------------------------------------------------------IAYKSL
A0A416MP73      ------------------------------------------------------LTYKQL
A0A3E4LL92      ---------------------------------------------------------SRV
A0A415D1L1      ---------------------------------------------------------SRV
A0A0H5SF45      ------------------------------------------------------YSVQQL
A0A1M6JRJ5      ------------------------------------------------------YSMPDL
A0A1M7Y1S2      ------------------------------------------------------YSVTDL
A0A7I8DMN1      ------------------------------------------------------YSMSEL
A0A396G6S7      ---------------------------------------------------------NSL
A0A3E5A223      ---------------------------------------------------------NSL
R7D5E6          ---------------------------------------------------------NSL
A0A415HQH5      ---------------------------------------------------------NSL
A0A414W2C6      ---------------------------------------------------------NSL
A5ZNE7          ---------------------------------------------------------NSL
A0A395X821      ---------------------------------------------------------NNL
A0A1C5PY68      ---------------------------------------------------------NNL
A0A174CJF8      ---------------------------------------------------------NNL
A0A564SRR2      ---------------------------------------------------------NNL
A0A174R7V0      ---------------------------------------------------------NNL
A0A373MWV2      ---------------------------------------------------------SSF
A0A417CE88      ---------------------------------------------------------SSF
A0A416Y441      ---------------------------------------------------------SSF
A0A357GPJ7      ---------------------------------------------------------SSF
A0A396PAC1      ---------------------------------------------------------SSF
A0A416EYU4      ---------------------------------------------------------SSF
A0A416SCQ2      ---------------------------------------------------------SSF
A0A416TGN7      ---------------------------------------------------------SSF
A0A417SMF6      ---------------------------------------------------------SSF
A0A1Y4MW77      ---------------------------------------------------------EAI
R6UHV6          ---------------------------------------------------------TSF
A0A3R9Q621      ------------------------------------------------------YTVDML
A0A069RC75      ------------------------------------------------------VSPQKL
A0A6S6R676      ------------------------------------------------------YTPEEI
A0A174F2W5      ---------------------------------------------------------SSF
A0A174S8E9      ---------------------------------------------------------SSF
A0A416ZL97      ---------------------------------------------------------SSF
A0A174LSK1      ---------------------------------------------------------SSF
A0A373GY92      ---------------------------------------------------------SSF
A0A373NZQ6      ---------------------------------------------------------SSF
A0A417I9B9      ---------------------------------------------------------SSF
A0A417MP97      ---------------------------------------------------------SSF
A0A417WQF8      ---------------------------------------------------------SSF
A0A373RZ83      ---------------------------------------------------------SSF
A0A416U6I1      ---------------------------------------------------------SSF
R7JQZ9          ---------------------------------------------------------SSF
A0A7C6SMH0      -------------------------------------------------------SPGKL
A0A3B8KKL6      -------------------------------------------------------SPSKL
A0A2K9E6R0      -------------------------------------------------------SPSKL
A0A2S8RBI0      -------------------------------------------------------SPSKL
A0A0L6JLG6      -------------------------------------------------------EAKAF
G8LSN0          -------------------------------------------------------SAAKF
A0A1M5UYN6      ------------------------------------------------------YSSGQL
A0A176JBT8      ------------------------------------------------------LTEDEF
A0A1I5HIC6      ------------------------------------------------------MTHEEL
A0A1Y3TC51      ---------------------------------------------------------EEI
A0A1Y3T1N0      ---------------------------------------------------------EEI
A0A1Y3Y8U8      ---------------------------------------------------------EEI
A0A5B0BQY5      ------------------------------------------------------YAKPEV
A6CLL4          ------------------------------------------------------DNVQCL
A0A176U8D6      ------------------------------------------------------IEYKDL
A0A1Q6KSQ5      ------------------------------------------------------IAYKSL
A0A3D3U8B3      ------------------------------------------------------IAYKSL
A0A3E5FRL7      ---------------------------------------------------------KTN
A0A1Y4QK93      ---------------------------------------------------------KTN
B1C232          ---------------------------------------------------------KTN
A0A401USI6      ------------------------------------------------------IVVKEF
A0A1V4IQ10      ------------------------------------------------------SQSSAV
A0A1S8TRD2      ------------------------------------------------------LQSSAV
G7M1U2          ------------------------------------------------------LQSSAV
A0A2T6KJ75      ------------------------------------------------------YKKGEI
A9KN92          ------------------------------------------------------MTHDEL
A0A352MUJ1      ------------------------------------------------------RSVGQL
R5YI67          ------------------------------------------------------KTTAQL
A0A174DL89      ------------------------------------------------------LNLESL
A0A1Y0IQP5      ------------------------------------------------------STEQEL
A0A4R2R7B1      ------------------------------------------------------LTEQEL
A0A1M6E8I2      ------------------------------------------------------MTYNEL
A0A1Y4N105      ---------------------------------------------------------DNL
A0A1Y4QP75      ---------------------------------------------------------DNL
A0A3D4QRB5      ------------------------------------------------------ISVNEL
A0A349DEH5      ------------------------------------------------------VDFGTV
A0A3D4T7B4      ------------------------------------------------------VDFGTV
A0A350XYC7      ------------------------------------------------------VTYGLV
R6DNR8          ------------------------------------------------------LNYSTV
A0A355KUM5      ------------------------------------------------------VNFGTV
R5YGY6          ------------------------------------------------------VNFGTV
A0A0K8J554      ------------------------------------------------------YSESQL
A0A1I0RG99      ------------------------------------------------------YTPMQL
A0A1I5G322      ------------------------------------------------------LSREQL
A0A7C6IYW8      ------------------------------------------------------YSINQL
A0A3N1XSX6      ------------------------------------------------------YSINEL
A0A7C6JZF1      ------------------------------------------------------YTADEL
A0A7G9WCY6      ------------------------------------------------------MSHGEF
A0A1C6G0U3      ------------------------------------------------------NSYEEV
A0A3D4LLB3      ---------------------------------------------------------KLD
A0A0A5GPA9      ------------------------------------------------------LEMEEL
A0A271M6M4      ------------------------------------------------------EKPEQL
A0A7C7AD93      ------------------------------------------------------MSVKEF
A0A2V3W8U6      ------------------------------------------------------FTNNEL
A0A6N3BXA1      ------------------------------------------------------MKAKKL
A0A351SRI8      ------------------------------------------------------ISYEEL
A0A1V5LU59      -------------------------------------------------------DIKKF
A0A1E3BVC3      -------------------------------------------------------GISEF
A0A4Q0I6S0      -------------------------------------------------------GISEF
A3DF66          -------------------------------------------------------GIQEF
W4V1T8          -------------------------------------------------------GIREF
A0A1C6ITD7      ------------------------------------------------------LNLADL
A0A381IX63      ------------------------------------------------------EDYHAI
A0A1G9IUT4      ------------------------------------------------------TDVKKL
A0A1M6RWV2      ------------------------------------------------------MSYGEF
A0A143XPI5      ------------------------------------------------------E----M
A0A355G1X5      ------------------------------------------------------ISADQL
A0A0M6WXE3      ------------------------------------------------------K----L
A0A348SAK2      ------------------------------------------------------K----L
A0A1G9H5B9      ------------------------------------------------------H-----
R5EFZ0          ------------------------------------------------------S----F
A0A1Y4H8L0      ------------------------------------------------------S----I
A0A4B9BMD9      ------------------------------------------------------FLQRQL
A0A0M6WYQ8      ------------------------------------------------------S----V
A0A348SAK1      ------------------------------------------------------S----V
A0A252F281      ------------------------------------------------------S----L
A0A1Y4QKE6      ------------------------------------------------------S----L
B1C231          ------------------------------------------------------S----L
A0A1Y3TUL5      -----------------------------------------------------------L
A0A1Y4JAX2      -----------------------------------------------------------L
A0A1Y4T590      -----------------------------------------------------------L
R5B467          ------------------------------------------------------T----L
A0A1Y3T163      ------------------------------------------------------T----L
A0A1Y3YCA2      ------------------------------------------------------T----L
A0A1Y4L6N9      ------------------------------------------------------S----I
A0A173T644      ------------------------------------------------------S----I
A0A1C5TSB8      ------------------------------------------------------S----I
C0CIK6          ------------------------------------------------------S----I
A0A1Y3WEF6      ------------------------------------------------------A----V
A0A417T0L2      ------------------------------------------------------A----V
A0A1H9EPU3      ------------------------------------------------------LTYSGL
A0A354IGV3      ------------------------------------------------------N----L
A0A417JMV2      ------------------------------------------------------Y----F
A0A415VWX5      ------------------------------------------------------Y----F
A0A173UY96      ------------------------------------------------------Y----F
B0P408          ------------------------------------------------------Y----F
D4MV82          ------------------------------------------------------Y----F
A0A173QTL1      ------------------------------------------------------Y----F
A0A174J359      ------------------------------------------------------Y----F
A0A174A3T7      ------------------------------------------------------Y----F
A0A417UUA3      ------------------------------------------------------Y----F
A0A6N2VB70      ------------------------------------------------------Y----F
A0A1C6EUV9      ------------------------------------------------------Y----F
A0A173Y645      ------------------------------------------------------Y----F
A0A374AVY6      ------------------------------------------------------Y----F
R7BXS4          ------------------------------------------------------Y----F
A0A143ZUX1      ------------------------------------------------------LNPSQV
A0A1W1Z4C3      --------------ENGNENDLLLSQKYPG------------------------LSTDFI
A0A239QN83      --------------ENGNEEDILLSQKYPG------------------------LTTDDI
A0A3R9WAA7      --------------------------------------------------------INEL
A0A1G6BLF1      ------------------------------------------------------LDMESV
R6HZX3          -----------------------------------------------------------I
A0A1W2CEA6      ------------------------------------------------------YSYSQL
R7FFK6          --------------EEELSRYFTLKN-GK-------------------------VTDTSL
A0A373MPB9      --------------PEQLAPYFTVTS-GR-------------------------VSNDDL
A0A373L519      --------------PEQLAPYFTVTS-GR-------------------------VSNDGL
A0A373W906      --------------PEQLAPYFTVTS-GR-------------------------VSNDGL
A0A373VCW2      --------------PEQLAPYFTVTS-GR-------------------------VSNDDL
W0U604          --------------PEQLAPYFTVTS-GR-------------------------VSNDDL
A0A374B6G0      --------------PEQLAPYFTVTS-GR-------------------------VSNDGL
A0A373VM36      --------------PEQLAPYFTVTS-GR-------------------------VSNDGL
A0A1C5P379      --------------PEQLAPYFTVTS-GR-------------------------VSNDGL
A0A373XXX0      --------------PEQLAPYFTVTS-GR-------------------------VSNDGL
A0A5R9MJM9      --------------PEQLAPYFTVTS-GR-------------------------VSNDGL
A0A356CW82      --------------PEQLAPYFTVTS-GR-------------------------VSNDGL
R6T4X7          --------------PEQLAPYFTVTS-GR-------------------------VSNDGL
A0A374HTV1      --------------PEQLAPYFTVTS-GR-------------------------VSNDGL
A0A374GB66      --------------PEQLAPYFTVTS-GR-------------------------VSNDGL
A0A374ECC6      --------------PEQLAPYFTVTS-GR-------------------------VSNDGL
A0A374BM61      --------------PEQLAPYFTVTS-GR-------------------------VSNDGL
A0A373UGZ4      --------------PEQLAPYFTVTS-GR-------------------------VSNDGL
A0A373SA66      --------------PEQLAPYFTVTS-GR-------------------------VSNDGL
A0A1C5X6X7      --------------PEQLAPYFTVTS-GR-------------------------VSNDGL
A0A1C6JIH3      --------------PEQLAPYFTVTS-GR-------------------------VSNDGL
A0A373PSC3      --------------PEQLAPYFTVTS-GR-------------------------VSNDGL
A0A1K1WYK8      --------------EQDLRRVFSFDEDNK-------------------------IDPASI
A0A1H6IUB1      --------------ADTLSKNFGMSD-GK-------------------------IAPASI
A0A1M7L1F9      --------------EDTLIKNFGMSE-GR-------------------------ISPSAI
A0A1C6B4L6      --------------EVILSENFTFNMSGE-------------------------IETESL
A0A1Q6T9P4      --------------EVILSENFTFNMSGE-------------------------IETESL
A0A315Y4F9      --------------ENVLSQNFTINDSGK-------------------------ITPASI
A0A354K620      --------------KNVLSQNFSLSESGK-------------------------IAPASI
A0A355G3J9      --------------S---------------------------------------LTAKQI
A0A3D2AD87      --------------KN--------------------------------------YRLLKN
A0A143XN92      --------------------------------------------------------MDSF
A0A173ZYY6      --------------------------------------------------------VEEL
A0A6L8RXB5      --------------------------------------------------------VEEL
A0A6N9JW85      --------------------------------------------------------VEEL
A0A173SMI2      --------------------------------------------------------VEEL
A0A174ASH7      --------------------------------------------------------VEEL
A6BH65          --------------------------------------------------------VEEL
R7G0D7          --------------------------------------------------------VEEL
A0A2T5IYJ6      --------------PDYLPRSEAEKSWWQQIDWRQLLPRGHQSNPIPSDEEKLTLLVDRF
A0A3C0QME1      --------------TDELAGVFA----------------------M-NDGK---ISLSSL
A0A355FYK5      --------------VV------------------------------------------EL
A0A357AQU0      --------------RDYLNRYFA----------------------LDENGC---PTTGSI
A0A3C1YJQ7      --------------RDYLNRYFA----------------------LDENGC---PTTGSI
A0A3D0JG38      --------------RDYLNRYFA----------------------LDENGC---PTTGSI
A0A3C0IHX1      --------------VSEISKCFT----------------------V-KNGV---ISTSEL
R5V506          --------------VSEISKCFT----------------------V-KNGV---ISTSEL
A0A352TIU5      --------------VSEISKCFT----------------------V-KNGV---ISTSEL
A0A3E5FSY5      --------------------------------------------------------VNSL
A0A1V5S3C0      --------------GQE-------------------------------------YSISQL
A0A1Y3TC98      --------------------------------------------------------TDTL
A0A1Q6REE0      ---------------------------------------------------------IDE
R5ETF9          ---------------------------------------------------------IDE
R6VAT5          --------------------------------------------------------LSDV
A0A1Q6S448      ---------------------------------------------------------MPL
A0A351MYR0      ---------------------------------------------------------MPL
R6HPC1          ---------------------------------------------------------MSL
A0A3D4G5Z5      ---------------------------------------------------------MSL
A0A3D5ES03      ---------------------------------------------------------MSL
A0A0F2P7X6      ------------------------------------------------------LPASAI
A0A359B487      ------------------------------------------------------LPAAAI
A0A348P5V4      --------------DGSP------------------------------------ITASQI
A0A356PT74      ------------------------------------------------------ISVADI
A0A3D5LL19      ------------------------------------------------------ISVSDI
R5MNF0          ------------------------------------------------------ISVLDI
A0A1Q9JSI0      --------------------------------------------------------MDYF
A0A3D5TNI1      ------------------------------------------------------KTADEV
A0A358LJD0      ------------------------------------------------------KTADQV
R6I3L7          ------------------------------------------------------KTADQV
A0A3D1HXX0      ------------------------------------------------------KTADQV
A0A3D2QJB8      ------------------------------------------------------KTADQV
D4LC36          --------------PEELSGNFT----------------------IKNGK----ITNESL
R7MQJ4          --------------KDKLSKCFS----------------------IKDENGEESISAASI
A0A1V5GLC0      --------------EAVLAETFG----------------------SYQNR----ISPSSI
W7V182          --------------NDVLEQNFS----------------------VVNGR----ITPASL
                                                                            

S3FFL2          RSHIEISP--------ARLSRLVDLYFTSPDAS---FSARVVNAWADAYIQTNLERKSQA
A0A328M4V1      QALVATEQ--------GKDSGIIELDYRNADPV---LATQLVDQISALYVRQNVDRNSAE
A0A6A8IF17      SNLSVSLN--------SEKASVIDLSFKDNSTQ---RAEDVLSMLISVYNENWVKDKNQI
A0A3D5R4X5      RNITEVSL--------VRDTEFINIKVQNPNPE---QARDIANKLAEVFQEEVVEI----
A0A1I4C3N6      QRRISARQ--------ITNTSMFVIYVVDPNPM---NAQLIANTIGEIAPTRLVGL----
A0A3B9CIM7      KSQISASA--------IENTAAFVVRVVDQNPV---NAMNIANAIGELAPNEIIRI----
A0A1G9WHW8      KNIISTSA--------VEDTAVFYVYVVDSNPL---NAQKIANAIGELAPDMIVTL----
A0A1H5VAA0      KNIISTSA--------VEDTAVFYVYVVDSNPL---NAQKIANAIGELAPDMIVTL----
A0A3R6VK11      SGRIGTSV--------VENTAVFYVYTYDSDPY---RAMELANAIGRVAPKEIGRI----
A0A3R6QUY7      SGRIGTSV--------VENTAVFYVYTYDSDPY---RAMELANAIGRVAPKEIGRI----
A0A373K3P9      SGRIGTSV--------VENTAVFYVYTYDSDPY---RALELANAIGRVAPKEIGRI----
A0A3R6JRU5      SGRIGTSV--------VENTAVFYVYTYDSDPY---RALELANAIGRVAPKEIGRI----
A0A1C5MS04      SGRIGTSV--------VENTAVFYVYTYDSDPY---RAMELANAIGRVAPKEIGRI----
A0A3C1J150      SGRIGTSV--------VENTAVFYVYTYDSDPY---RAMELANAIGRVAPKEISRI----
A0A416CXD7      SGRIGTSV--------VENTAVFYVYTYDSDPY---RAMELANAIGRVAPKEIGRI----
A0A6N2X662      SGRIGTSV--------VENTAVFYVYTYDSDPY---RAMELANAIGRVAPKEIGRI----
R6XBL9          SGRIGTSV--------VENTAVFYVYTYDSDPY---RAMELANAIGRVAPKEIGRI----
A0A355W5Z7      SGRIGTSV--------VENTAVFYVYTYDSDPY---RAMELANAIGRVAPKEIGRI----
A0A143WVN6      QGTINSSI--------ISQTNLITLTVTSDTPA---HAYQMIQSALDNYSSVSDYL----
W6RXP9          LDSLTVNP--------LTDTQILEIKLQGKKPK---EIAEILNGINNEFIFQANEL----
W6S4G8          MKDITVEP--------ITDTQILQIKLTGKNKD---DLAVVLESITEEFIKESKEI----
A0A1G6BLB6      PGTVTTSL--------VENTNLMTLSVTESSPK---MTYAVMNAILDNYSSVSDKV----
A0A1C6G8M0      YNAVSVDN--------PEATRIIRIRVVSGNKE---EAVDIANEILSVSIEEIPHV----
A0A416MP73      YNIVSVEN--------PDSTRILKIYVTAGTVR---EAVNIANEILSVSVDEIPHV----
A0A3E4LL92      QGNLSASV--------VTDTNIIRMSASGTNAE---SAYKLLKGALKQYPELSDYF----
A0A415D1L1      KGNLSASV--------VADTNIIKMSASGTNAE---SAYKLLKGALQQYPELSDYF----
A0A0H5SF45      KAMTQISS--------VNDTEIFQITLSSNSAD---DAYTLVEAMQKIAPQLIANI----
A0A1M6JRJ5      KKMTEIKT--------VQNTEIFSITLTSKNPD---DSYRLVKSMETIAPKLIEKI----
A0A1M7Y1S2      RNMTEIKA--------IQNTEIFSITLTSNNPN---DSYRLVKSMEMIVPKLIEKI----
A0A7I8DMN1      RSMTEIKT--------VRNTEIFSITVNTKSPE---DSYELVKNMEILAPKLIEDI----
A0A396G6S7      EVETSVDL--------VPETNLITLSVKAGTAA---ESYRILQSVMENYNTVSDYA----
A0A3E5A223      EVETSVDL--------VPETNLITLSVKAGTAA---ESYRILQSVMENYNTVSDYA----
R7D5E6          EVETSVDL--------VPETNLITLSVKAGTAA---ESYRILQSVMENYNTVSDYA----
A0A415HQH5      EVETSVDL--------VSETNLITLSVKAGTAA---ESYRILQSVMENYNTVSDYA----
A0A414W2C6      EVETSVDL--------VPETNLITFSVKAGTAA---ESYRILQSVMENYNTVSDYA----
A5ZNE7          EVETSVDL--------VPETNLITLSVKAGTAA---ESYRILQSVMENYNTVSDYA----
A0A395X821      NVETSVDL--------VPETNLITLSVKAGTAA---ESYRVLQSVMENYNTVSDYA----
A0A1C5PY68      NVKTSVDL--------VPETNLITLSVKAGTAA---ESYRVLQSVMENYNTVSDYA----
A0A174CJF8      NVKTSVDL--------VPETNLITFSVKAGTAA---ESYRVLQSVMENYNTVSDYA----
A0A564SRR2      NVKTSVDL--------VPETNLITFSVKAGTAA---ESYRVLQSVMENYNTVSDYA----
A0A174R7V0      NVKTSVDL--------VPETNLITFSVKAETAA---ESYRVLQSVMENYNTVSDYA----
A0A373MWV2      PADMSASI--------VPESNLMELSVTADSPE---TAFRVLRSVLKNYTTISDYI----
A0A417CE88      PADMSASI--------VPESNLMELSVTADSPE---TAFRVLRSVLKNYTTISDYI----
A0A416Y441      PADMSASI--------VPESNLMELSVTADSPE---TAFRVLRSVLKNYTTISDYI----
A0A357GPJ7      PADMSASI--------VPESNLMELSVTADSPE---TAFRVLRSVLKNYTTISDYI----
A0A396PAC1      PADMSASI--------VPESNLMELSVTADSPE---TAFRVLRSVLKNYTTISDYI----
A0A416EYU4      PADMSASI--------VPESNLMELSVTADSPE---TAFRVLRSVLKNYTTISDYI----
A0A416SCQ2      PADMSASI--------VPESNLMELSVTADSPE---TAFRVLRSVLKNYTTISDYI----
A0A416TGN7      PADMSASI--------VPESNLMELSVTADSPE---TAFRVLRSVLKNYTTISDYI----
A0A417SMF6      PADMSASI--------VPESNLMELSVTADSPE---TAFRVLRSVLKNYTTISDYI----
A0A1Y4MW77      NGSISASI--------IPNSNMITMTVISSDPD---DAKEILESTIRVYPSVARFV----
R6UHV6          PGNLSCSV--------IEETNILSFTVTSDSPI---KSYRLLKAVLECYPQFTKNV----
A0A3R9Q621      KDCIRITV--------VSNTEIFQVSVTTNSAS---DSFELAKAIQNIAPDFIKSI----
A0A069RC75      LKKVKIDQ--------VDETEVLKISASSTDPA---LAAAIANEIAQVFKEEIFRI----
A0A6S6R676      RNMTNIYA--------VNNTEIFQVSVTSHSPD---DSYQLVRVMQEVAPRLIKSI----
A0A174F2W5      PADMSASI--------VPESNLMELSVTADSPE---TAFRVLRSVLKNYTTISDYI----
A0A174S8E9      PADMSASI--------VPESNLMELSVTADSPE---TAFRVLRSVLKNYTTISDYI----
A0A416ZL97      PAKMNASI--------VPESNLMELSVTADSPE---MAFRILKSVLNNYTSISDYI----
A0A174LSK1      PAKMNASI--------VPESNLMELSVTADSPE---MAFRILKSVLNNYTSISDYI----
A0A373GY92      PAKMNASI--------VPESNLMELSVTADSPE---MAFRILKSVLNNYTSISDYI----
A0A373NZQ6      PAKMNASI--------VPESNLMELSVTADSPE---MAFRILKSVLNNYTSISDYI----
A0A417I9B9      PAKMNASI--------VPESNLMELSVTADSPE---MAFRILKSVLNNYTSISDYI----
A0A417MP97      PAKMNASI--------VPESNLMELSVTADSPE---MAFRILKSVLNNYTSISDYI----
A0A417WQF8      PAKMNASI--------VPESNLMELSVTADSPE---MAFRILKSVLNNYTSISDYI----
A0A373RZ83      PAKMNDSI--------VPESNLMELSVTADSPE---MAFRILKSVLNNYTSISDYI----
A0A416U6I1      PAKMNDSI--------VPESNLMELSVTADSPE---MAFRILKSVLNNYTSISDYI----
R7JQZ9          PAKMNDSI--------VPESNLMELSVTADSPE---MAFRILKSVLNNYTSISDYI----
A0A7C6SMH0      LSNVDVRT--------VKDSRIFKISYEDSNPA---LAKEVVNELSNEIQELAADI----
A0A3B8KKL6      LSNVDVRT--------VKDSRIFKISYEDSNPT---LARDVVNELSNEIQELAADI----
A0A2K9E6R0      LSNVDVRT--------VKDSRIFKISYEDSNPT---LARDVVNELSNEIQELAADI----
A0A2S8RBI0      LSNVDVRT--------VKDSRIFKISYEDSNPT---LARDVVNELSNEIQELAADI----
A0A0L6JLG6      QNNVDVMT--------IKDSRIFKISYEDYDPK---LAAKVVNELGTIIMQLASDI----
G8LSN0          KRSVNVQT--------VKDSRIFSISYEDTDPK---LAADVVNELALVIKQLASDV----
A0A1M5UYN6      MGMLSVGA--------QSNTQIMNITVQAGNEE---EAKEIVLAITQSFKENAEKL----
A0A176JBT8      LDNVKAES--------NGNSQIISIIVENKNPD---DAALIANKTAVIFQSEIKKL----
A0A1I5HIC6      VSNITVKV--------PENTRILEISVQNPNPE---TAKQLADSIAEESAERMVSI----
A0A1Y3TC51      AGKISCTP--------IQETNLLVLSVTCRHPR---DAYLFINAALEHYGEVAGDV----
A0A1Y3T1N0      TGDITCTP--------ITDTNLLTLSVSSPDPR---QAYLFINSALENYEQVAQDV----
A0A1Y3Y8U8      AGDITCTP--------ITDTNLLTLSVSSPDPR---QAYLFINSALENYEQVAQDV----
A0A5B0BQY5      AKKVKLET--------GNGSQIITITARDSTPE---KAANLANTYALTFQEEIRTL----
A6CLL4          NEQISVTS--------SSDSQIISITATALNPN---QAVDIVNNTAETFKEETYNL----
A0A176U8D6      YNAVSIEN--------PDGTRIIKINVVSQDQK---EAVDIANEILQISIEEIPNV----
A0A1Q6KSQ5      YNAVSVDN--------PEATRIIRIRVVSGNKE---EAVDIANEILSVSIEEIPHV----
A0A3D3U8B3      YNAVSVDN--------PEATRIIRIRVVSGNKE---EAVDIANEILSVSIEEIPHV----
A0A3E5FRL7      QGTITCNQ--------IQETNLLVLNVTSKDPQ---NAYQFMNSALKHYDEVSDYV----
A0A1Y4QK93      QGTITCNQ--------IQETNLLVLNVTSKDPQ---NAYQFMNSALKHYNEVSDYV----
B1C232          QGTITCNQ--------IQETNLLVLNVTSKDPQ---NAYQFMNSALKHYDEVSDYV----
A0A401USI6      MLDLSITP--------KIGTQIIEISYKSKNPE---IAAEGANALSQAFIEESQNL----
A0A1V4IQ10      LSSLTTVP--------MANTQILEIKYKNLNKS---LAKDTVSAITNEFIKETQEL----
A0A1S8TRD2      LNTLTTIP--------TANTQILEIRYINLNKS---LAKDTVSAITDEFIKETQEL----
G7M1U2          LNALTTIP--------TANTQILEIRYINLNKS---LAKDTVSAITDEFIKETQEL----
A0A2T6KJ75      SQKVEIQS--------SINSQILTILAEEKTPE---KAAALANTLATTFQEEIKTL----
A9KN92          VSNINVKV--------PENTRILEITVQNQDPL---LAKQLADSIAEVASERMVSV----
A0A352MUJ1      RKNVTIES--------VKNTEILKISVLDSNKD---DAATIANSIAEVFSEQVKEY----
R5YI67          RKNVTIES--------VKNTEIIKISVQDSNKD---EAPIIANSIAEVFSEQIKEI----
A0A174DL89      ESMIKIKT--------TTESEFINITVEGKVPE---VTTLVANQLTLSLKNISSEI----
A0A1Y0IQP5      LEKIRVTT--------SGESLLTSVTVTDHDPK---QAVAIANAMAAVFMENLSRI----
A0A4R2R7B1      LENVRVRS--------SSESLLTAVTVTDHDPK---QAVTIANAMAAVFMENLGRI----
A0A1M6E8I2      LEDITSSP--------VGSTEILKISVKNTDPA---MASEIANTIADVFIKEVMRI----
A0A1Y4N105      DYQISASV--------ISETNLMTLTVTSNTPK---MTYQIMQSALDNYTSVSDYL----
A0A1Y4QP75      DYQISASV--------ISETNLMTLTVTSNTPK---MTYQIMQSALDNYTSVSDYL----
A0A3D4QRB5      KSKINVSA--------EGNTEILRITVEDLIPE---QARDIADSTAEVFISEVNKL----
A0A349DEH5      DRSISVSV--------VSSTNIIVMSVTTGNPQ---TSYAIAQTACEVYGDIVAEK----
A0A3D4T7B4      DRSISVSV--------VSSTNIIVMSVTTGNPQ---TSYAIAQTACEVYGDIVAEK----
A0A350XYC7      DRSISVRV--------VTSTNVIVMSVTTDNPK---TSYAIANTVVDVYGDIVSEI----
R6DNR8          DKSISVSV--------VSSTNVIVMSVTTGDPK---IAYAIASTVVDVYGDIVSER----
A0A355KUM5      DKSISVNV--------VSSTNVIVMSVTTGDPK---ISYAIASTVVDVYGDIVTER----
R5YGY6          DKSISVNV--------VSSTNVIVMSVTTGDPK---ISYAIASTVVDVYGDIVTER----
A0A0K8J554      KNMTNIQS--------VGDTEIFKISVNSHSAS---DSYELVKAMEYIAPQIISEV----
A0A1I0RG99      KAMTHIKA--------INNTEIFEISVTTTNPN---DAYKLVDAMKKIAPVLIKSI----
A0A1I5G322      KNMTNIES--------INNTEIFEISVSSMNPN---HSFLLVKSMEKIAPELIKSI----
A0A7C6IYW8      RNMTSVKS--------VNNTEIFQISVTSPSAK---DSYSLAESMERIAPQLIKTI----
A0A3N1XSX6      KHMTTIKT--------INNTEIFQISVTSSSAR---DSYTLVETMQRIAPQLIKSI----
A0A7C6JZF1      KRMTTIQS--------VDNTEIFEISVTSNDPM---DSYLLAGTMQEITPGFIKNI----
A0A7G9WCY6      AGKVQVNS--------VRDTEVIEIRVQDTDPQ---RAARIADELSSVFMSKIVNF----
A0A1C6G0U3      YSSINVQS--------IEDTQIIKISVQNKSPE---IARDIANSIPEIFKEEVKRL----
A0A3D4LLB3      DKSITVSP--------VKDTQIIKVAVQNTDPV---LARDIADALVEEFTLEIQRI----
A0A0A5GPA9      VQRFTIGT--------NAESQIITVQAVGPSKE---AASELVNVTLDTFQQEVESL----
A0A271M6M4      AKKIEVIS--------NSDSQVITLKVEASSQK---QAVKLANSTAEIFKTEIKSL----
A0A7C7AD93      KKHIQAEH--------TSGTQFMEIKVRWDSPD---MAFSVLENITEIFSEEAIRI----
A0A2V3W8U6      QKKLRVET--------NDNSQIISLYVKENDLD---TAVEIANLFATKSKEEISQL----
A0A6N3BXA1      AKYIDVEN--------IQDTQIIKISVRNGNPK---TAAKICNEIPIVFEKEVKRI----
A0A351SRI8      KKNVKVGN--------VEDTEIILIYVYNEDAR---LSRKIANEIASVFESEIVGI----
A0A1V5LU59      KSNVNVQT--------VKDTRIFSISYEDTDPE---LAANVVNELSVVIKQMATDI----
A0A1E3BVC3      QNNVNVKT--------VKDSRLFSISYEDTDPK---RAADVVNELASVIQKMADEI----
A0A4Q0I6S0      QNNVNVKT--------VKDSRLFSISYEDTDPK---RAADVVNELASVIQKMADEI----
A3DF66          QKNVNVKT--------VKDSRLFSISYEDTDPK---RAADIVNELATVIQKMADEI----
W4V1T8          QNNVTVKT--------VKDSRLFSISYEDTDPK---RAADVVNELASVIQKMADEI----
A0A1C6ITD7      ESMIKIRT--------TTESEFISISIEGKIAK---DTATIANQLVLSLKNISSEL----
A0A381IX63      SNSIDINS--------V-NGPVMNITVKNADPK---VAREIANEVPVVFGGELENI----
A0A1G9IUT4      SNDIRVTT--------LTDTQIINVSVREDNPK---LANNIANEIASVFTSELSRI----
A0A1M6RWV2      SNKVRVNS--------VRDTEVIEIKVQDTNPQ---LAARIANELSEVFIDRIHEF----
A0A143XPI5      NVNITASA--------VEETNLFRIETSGRDPE---LVYEVLESVIKNYPEVAEYI----
A0A355G1X5      RHYVSVNT--------QADTNIIIVSVTTESPD---KSYEIASGIASHYQDIVDYA----
A0A0M6WXE3      DADISANV--------VKGTNMLTLSVTAHSPK---DSIDIIKTVMDNYTSISYYT----
A0A348SAK2      DADISANV--------VKGTNMLTLSVTAHSPK---DSIDIIKTVMDNYTSISYYT----
A0A1G9H5B9      PGIDAGMVSSSLSMESVSETGVVAVKSTTLEAQ---LSADIANAVMEIAPEEIVRV----
R5EFZ0          DGTIDTAV--------VPNTNLITMTVTDSDPR---MAFLAAQAIIEHHESLTYQV----
A0A1Y4H8L0      DAAITSNV--------IPNTNLLELSVSSSSPR---EAFDTIHAVMDNYAQVSYFS----
A0A4B9BMD9      PEVRSELD--------QAEEKLNVYRQQRDSVDLNLEAKAVLEQIVNVDNQLNELT----
A0A0M6WYQ8      PGSISVKA--------EEGTNMLTISVSGTNAE---LSYKTLKSVIKNYPEVAQFV----
A0A348SAK1      PGSISVKA--------EEGTNMLTISVSGTNAE---LSYKTLKSVIKNYPEVAQFV----
A0A252F281      PAQLESSI--------IEGTNLLTISATADNAR---TAFLTVKAVMENYNTVSDQV----
A0A1Y4QKE6      NGTLSAST--------VSESNIVTMSVESNSPQ---DAMSILTSAIEVYPDAARFV----
B1C231          NGTLSAST--------VSESNIVTMGVESNSPQ---DAMSILTSAIEIYPDVARFV----
A0A1Y3TUL5      VGIVETDIYKNLYLTRYKETQIIEMDLTWRSAE---EGVEILNAINEVAPEILIET----
A0A1Y4JAX2      VGIAETDIYKNLYLTRYKETQIIEMDLTWRSAE---EGVEILNAINEVAPEILIET----
A0A1Y4T590      VGIAETDIYKNLLLTRYKETQIIEMDLTWRSAE---EGVEILNAINEVAPEILIET----
R5B467          P-AISATS--------EEGTNLCTLSVTGSDAQ---QCYDVLQSVIVHYPDVAELV----
A0A1Y3T163      NGTITSET--------VENSNMVTMRVESPDPE---DAREILDTALEIYPETARFV----
A0A1Y3YCA2      NGTITSET--------VENSNMVTMRVESPDPE---DARKILDTALEIYPETARFV----
A0A1Y4L6N9      NGSITASV--------VPDSNLITMSVVSMNAS---EAKTILESAIRVYPNISRFV----
A0A173T644      NGSISAQA--------VSDSNLITMTVTSSDPQ---DAKAILESAIKVYPEVSRFV----
A0A1C5TSB8      NGSISAQA--------VSDSNLITMTVTSSDPQ---DAKAILESAIKVYPEVSRFV----
C0CIK6          NGSISAQA--------VSDSNLITMTVTSSDPQ---DAKAILESAIKVYPEVSRFV----
A0A1Y3WEF6      NGRISAQA--------VSDSNMITMTVTSNSPE---DARAILESTIKVYPDVVRFV----
A0A417T0L2      NGSISAQA--------VSNSNMITMTVTSNSAE---DAKAILESAIKVYPDVARFV----
A0A1H9EPU3      ASKVSVTS--------PTDTRILTITVTDPDPV---MSKNLADSIRDAAIKHIQGI----
A0A354IGV3      PAQIKTEV--------AKDTNVLTLTSTADTAY---DAFICLKAVTENYNLISDNV----
A0A417JMV2      PGSASAEV--------VNETNLLVLKVQADSPE---MAFRLNKAIMNNYSVVTDQL----
A0A415VWX5      PGSASAEV--------VNETNLLVLKVQADSPE---MAFRLNKAIMNNYSVVTDQL----
A0A173UY96      PGSASAEV--------VNETNLLVLKVQADSPE---MAFRLNKAIMNNYSVVTDQL----
B0P408          PGSASAEV--------VNETNLLVLKVQADSPE---MAFRLNKAIMNNYSVVTDQL----
D4MV82          PGSASAEV--------VNETNLLVLKVQADSPE---MAFRLNKAIMNNYSVVTDQL----
A0A173QTL1      PGSASAEV--------VNETNLLVLKVQADSPE---MAFRLNKAIMNNYSVVTDQL----
A0A174J359      PGSASAEV--------VNETNLLVLKVQADSPE---MAFRLNKAIMNNYSVVTDQL----
A0A174A3T7      PGSASAEV--------VNETNLLVLKVQADSPE---MAFRLNKAIMNNYSVVTDQL----
A0A417UUA3      PGSASAEV--------VNETNLLVLKVQADSPE---MAFRLNKAIMNNYSVVTDQL----
A0A6N2VB70      PGSASAEV--------VNETNLLVLKVQADSPE---MAFRLNKAIMNNYSVVTDQL----
A0A1C6EUV9      PGTASAEV--------VNETNLLVLKVQADSPE---MAFRLNKAIMNNYSVVTNQL----
A0A173Y645      PGTASAEV--------VNETNLLVLKVQADSPE---MAFSLNKAIMNNYSVVTNRL----
A0A374AVY6      PGTASAEV--------VNETNLLVLKVQADSPE---MAFSLNKAIMNNYSVVTNQL----
R7BXS4          PGTASAEV--------VNETNLLVLKVQADSPE---MAFSLNKAIMNNYSVVTNQL----
A0A143ZUX1      KKMVSISQ--------ATGS-VLELKVTASDPE---TAYRLAVAYMGAIDIVVNPK----
A0A1W1Z4C3      RNVISMNS--------VHETPMVRVSCTTPYPE---LSADICNSVLQVAPTAIKDV----
A0A239QN83      RKVISMNS--------IHETPMVQVSCTTTDPK---LSADICNSVLQVAPTAIKDV----
A0A3R9WAA7      SEQITADN--------VKDTNLFTIRVSSDNPT---RAYEVLQSVIKNYPKVAETV----
A0A1G6BLF1      PGTIAVAV--------VEETNMITIKATADSAQ---MAYNILQAVIESYPIVAESV----
R6HZX3          NGTVTASS--------IGETNIFTLTVTSTNPQ---DAYDILNAVIQNYPQVASFV----
A0A1W2CEA6      EKMVSVSN--------PSGSHLLYIYVKSSVPE---EAKLLADTYAEVVQDYIANK----
R7FFK6          KACFSMTA--------VDETEVLKITTTTQNAE---LSASLCNIMADVAPQFLIRV----
A0A373MPB9      RNAYSMIA--------VNQTEVLQITATTTNAK---LSSDLCNIMADVAPSFLIRV----
A0A373L519      RNAYSMTA--------VNQTEVLQITATTTNAK---LSSDLCNIMADVAPSFLIRV----
A0A373W906      RNAYSMTA--------VNQTEVLQITATTTNAK---LSSDLCNIMADVAPSFLIRV----
A0A373VCW2      RNAYSMIA--------VNQTEVLQITATTTNAK---LSSDLCNIMADVAPSFLIRV----
W0U604          RNAYSMIA--------VNQTEVLQITATTTNAK---LSSDLCNIMADVAPSFLIRV----
A0A374B6G0      RNAYSMTA--------VNQTEVLQITATTTNAK---LSSDLCNIMADVAPSFLIRV----
A0A373VM36      RNAYSMTA--------VNQTEVLQITATTTNAK---LSSDLCNIMADVAPSFLIRV----
A0A1C5P379      RNAYSMTA--------VNQTEVLQITATTTNAK---LSSDLCNIMADVAPSFLIRV----
A0A373XXX0      RNAYSMTA--------VNQTEVLQITATTTNAK---LSSDLCNIMADVAPSFLIRV----
A0A5R9MJM9      RNAYSMTA--------VNQTEVLQITATTTNAK---LSSDLCNIMADVAPSFLIRV----
A0A356CW82      RNAYSMTA--------VNQTEVLQITATTTNAK---LSSDLCNIMADVAPSFLIRV----
R6T4X7          RNAYSMTA--------VNQTEVLQITATTTNAK---LSSDLCNIMADVAPSFLIRV----
A0A374HTV1      RNAYSMTA--------VNQTEVLQITATTTNAK---LSSDLCNIMADVAPSFLIRV----
A0A374GB66      RNAYSMTA--------VNQTEVLQITATTTNAK---LSSDLCNIMADVAPSFLIRV----
A0A374ECC6      RNAYSMTA--------VNQTEVLQITATTTNAK---LSSDLCNIMADVAPSFLIRV----
A0A374BM61      RNAYSMTA--------VNQTEVLQITATTTNAK---LSSDLCNIMADVAPSFLIRV----
A0A373UGZ4      RNAYSMTA--------VNQTEVLQITATTTNAK---LSSDLCNIMADVAPSFLIRV----
A0A373SA66      RNAYSMTA--------VNQTEVLQITATTTNAK---LSSDLCNIMADVAPSFLIRV----
A0A1C5X6X7      RNAYSMTA--------VNQTEVLQITATTTNAK---LSSDLCNIMADVAPSFLIRV----
A0A1C6JIH3      RNAYSMTA--------VNQTEVLQITATTTNAK---LSSDLCNIMADVAPSFLIRV----
A0A373PSC3      RNAYSMTA--------VNQTEVLQITATTTNAK---LSSDLCNIMADVAPSFLIRV----
A0A1K1WYK8      RSCLTISS--------VTDTSAVTITATTVNPN---LAADICNDITQVAPKYVEEA----
A0A1H6IUB1      RNCLSISS--------VTDTSAVKIVSTTKNAE---VAAALCNDLTEVAPSYVEEA----
A0A1M7L1F9      RDCYSISS--------VTDTSAVKIVATTKNAE---VAAALCNDLTEVAPDYVEEA----
A0A1C6B4L6      RKCIELST--------VTDTSAVKVIATAKNPE---IAASICNNLTSIAPEYVAKA----
A0A1Q6T9P4      RKCIELST--------VTDTSAVKVIATAKNPE---IAASICNNLTSIAPEYVAKA----
A0A315Y4F9      RSCLAISS--------VTDTSAVKVNATAKNAE---VAAAICNDLTQVAPQYVEEA----
A0A354K620      RSCLAISS--------VTDTSAVKVTATAENAE---VAAAICNDLTQVAPKYVEEA----
A0A355G3J9      LAMLSGSA--------INETEAFYISAEHTNRQ---LATDVLTDIVKVAPQEIIRV----
A0A3D2AD87      KISVSRSE--------EERSMLIYISATSTDKN---EAIDLANDFAALCQTFIPNN----
A0A143XN92      DAEAEAEI--------VPETNLMVLRVTADTSK---KAFQILRAIMENYTVVSDYV----
A0A173ZYY6      DADIHAKV--------LEGTNMLVLSVTADTPK---DSIDIIRTVMDNYSSVSLYT----
A0A6L8RXB5      DADIHAKV--------LEGTNMLVLSVTADTPK---DSIDIIRTVMDNYSSVSLYT----
A0A6N9JW85      DADIHAKV--------LEGTNMLVLSVTADTPK---DSIDIIRTVMDNYSSVSLYT----
A0A173SMI2      DADIHAKV--------LEGTNMLVLSVTADTPK---DSIDIIRTVMDNYSSVSLYT----
A0A174ASH7      DADIHAKV--------LEGTNMLVLSVTADTPK---ESIDIIRTVMDNYSSVSLYT----
A6BH65          DADIHAKV--------LEGTNMLVLSVTADTPK---ESIDIIRTVMDNYSSVSLYT----
R7G0D7          DADIHAKV--------LEGTNMLVLSVTADTPK---ESIDIIRTVMDNYSSVSLYT----
A0A2T5IYJ6      MANLSIEP--------IRQTQLVKISFESHDRS---LTAAVANAMAKTYINSQMEARITL
A0A3C0QME1      RNKITMSS--------VDETEVMKITANTTNPE---ISAAICNQIAESAEECLTRI----
A0A355FYK5      RNAVVLGE--------TGVSGIFSLTVTNIYPE---FCSRTMDAVLDVFPDYMRTS----
A0A357AQU0      LNYVSMGS--------VDNTEVLKVSATTPDAK---LSAEISNIFAEVAPDYLIRI----
A0A3C1YJQ7      LNYVSMGS--------VDNTEVLKVSATTPDAK---LSAEISNIFAEVAPDYLIRI----
A0A3D0JG38      LNYVSMGA--------VDNTEVLKVSATTPNAK---LSAEISNIFAEVAPDYLIRI----
A0A3C0IHX1      KDAISMSA--------DGDTEVLKISAQTKDPH---VSAEICDIYAEVAPTFLIRI----
R5V506          KDAISMSA--------DGDTEVLKISAQTKDPH---VSAEICDIYAEVAPTFLIRI----
A0A352TIU5      KDAISMSA--------DGDTEVLKISAQTKDPH---VSAEICDIYAEVAPTFLIRI----
A0A3E5FSY5      NGTLSAST--------VSESNIVTMGVESNSPQ---DAMSILTSAIEIYPDVARFV----
A0A1V5S3C0      KSCVSANV--------VTDTTMISVSVSTHDPD---MSYQIAKALTSVYSQVMEGS----
A0A1Y3TC98      NGEISSET--------ITDSNVVTMRVESPDPE---DARAILEAALAIYPETARFV----
A0A1Q6REE0      VPAMSVSA--------TAHSSILTLKVRDTDPQ---RAYDVMSAVIACYPEVAEFV----
R5ETF9          VPDMSVSA--------TAHSSILTLKVRDTDPQ---RAYDVMSAVIACYPEVAEFV----
R6VAT5          PGTLTATA--------VEDTNLFTITVTSSNYE---TAYNVLKSVINNYPSVAEYV----
A0A1Q6S448      NGTVSAQQ--------LGETNLIRVTVTADTPR---QALVLLQAVSDNYGSLSAHV----
A0A351MYR0      DGTVTAQQ--------LGETNLIRVTVTADTPR---QALVLLKAVSDNYGSLSAHV----
R6HPC1          DGTVSAQQ--------LGETNLIRVTVTADTPR---QALVLLKAVSDNYGTLSAHV----
A0A3D4G5Z5      DGTVSAQQ--------LGETNLIRVTVTADTPR---QALVLLKAVSDNYGTLSAHV----
A0A3D5ES03      DGTVSAQQ--------LGETNLIRVTVTADTPR---QALVLLKAVSDNYGTLSAHV----
A0A0F2P7X6      SPYVSVAP--------VRDTEVLRIFVSNPDPL---LAAKICNSIMHVAPTAISST----
A0A359B487      SPYVSVAP--------VRDTEVLRIFVSNPDPL---LAAKICNSIMHVAPTAISST----
A0A348P5V4      KRYVSVQS--------IEETQIIYLTVTTTNPD---VSYGIAQAYVDNYNEAIATA----
A0A356PT74      KSWVSVEA--------VEDTAIINLTVTTPNAD---VSYGIANAYVNNYESAINAA----
A0A3D5LL19      KSWVSVEA--------VEDTAIINLTVTTPNAD---VSYGIANAYVNNYESAINAA----
R5MNF0          KNWVSVEA--------VEDTAIINLTVTTPNAD---VSYGIANAYVNNYESAINAA----
A0A1Q9JSI0      PGTASSEV--------INETNLLVLKVQADSPE---LAFRLNKAIMNNYSVVSDEL----
A0A3D5TNI1      EEMIAASR--------KTDSSIIDMTVTAGSPE---EAYELAQAVKDTYKDVVQVY----
A0A358LJD0      SKMIAASR--------KTDSSIIDMTVTASSPE---EAYELAQAVKDTYKDVVQVY----
R6I3L7          AKMIAVSR--------KTDSSIIDMTVTASSPE---EAYELAQAVKDTYKDVVRVY----
A0A3D1HXX0      AKMIAASR--------KTDSSIIDMTVTASSPE---EAYELAQAVKDTYKDVVQVY----
A0A3D2QJB8      AKMIAASR--------KTDSSIIDMTVTASSPE---EAYELAQAVKDTYKDVVQVY----
D4LC36          KSAFTMAA--------VNNTEVLKITATTKNAA---LSAELCNIMADVAPEVLIRV----
R7MQJ4          RNCLTMAA--------VGDTEVMKITAETADPE---VSAALCNIISNVTPDFLIRV----
A0A1V5GLC0      RNCMRITS--------VTDTSVLTVSATTRSPE---VAAAICNDVAEVAPKFLDDA----
W7V182          RSCISISS--------VTDTSALKLSAVTKNPE---VSAAICNDIAKVAPDYLHDA----
                                                                            

S3FFL2          TSYGRNLLQRQLAQAKERLDESQRQLVNYASQQQIINLPAPSSGASGTTTSERSIVADNL
A0A328M4V1      AANSLAFVKQQLPKVRLELEQATQAMNAFQTRAHSVDISMQT-----------KALLDQI
A0A6A8IF17      AVSTSMFINERLGVIERELGNVDEDISSYKSEHLLPDVQAAS-----------SMYMAQS
A0A3D5R4X5      ------------------------------------------------------------
A0A1I4C3N6      ------------------------------------------------------------
A0A3B9CIM7      ------------------------------------------------------------
A0A1G9WHW8      ------------------------------------------------------------
A0A1H5VAA0      ------------------------------------------------------------
A0A3R6VK11      ------------------------------------------------------------
A0A3R6QUY7      ------------------------------------------------------------
A0A373K3P9      ------------------------------------------------------------
A0A3R6JRU5      ------------------------------------------------------------
A0A1C5MS04      ------------------------------------------------------------
A0A3C1J150      ------------------------------------------------------------
A0A416CXD7      ------------------------------------------------------------
A0A6N2X662      ------------------------------------------------------------
R6XBL9          ------------------------------------------------------------
A0A355W5Z7      ------------------------------------------------------------
A0A143WVN6      ------------------------------------------------------------
W6RXP9          ------------------------------------------------------------
W6S4G8          ------------------------------------------------------------
A0A1G6BLB6      ------------------------------------------------------------
A0A1C6G8M0      ------------------------------------------------------------
A0A416MP73      ------------------------------------------------------------
A0A3E4LL92      ------------------------------------------------------------
A0A415D1L1      ------------------------------------------------------------
A0A0H5SF45      ------------------------------------------------------------
A0A1M6JRJ5      ------------------------------------------------------------
A0A1M7Y1S2      ------------------------------------------------------------
A0A7I8DMN1      ------------------------------------------------------------
A0A396G6S7      ------------------------------------------------------------
A0A3E5A223      ------------------------------------------------------------
R7D5E6          ------------------------------------------------------------
A0A415HQH5      ------------------------------------------------------------
A0A414W2C6      ------------------------------------------------------------
A5ZNE7          ------------------------------------------------------------
A0A395X821      ------------------------------------------------------------
A0A1C5PY68      ------------------------------------------------------------
A0A174CJF8      ------------------------------------------------------------
A0A564SRR2      ------------------------------------------------------------
A0A174R7V0      ------------------------------------------------------------
A0A373MWV2      ------------------------------------------------------------
A0A417CE88      ------------------------------------------------------------
A0A416Y441      ------------------------------------------------------------
A0A357GPJ7      ------------------------------------------------------------
A0A396PAC1      ------------------------------------------------------------
A0A416EYU4      ------------------------------------------------------------
A0A416SCQ2      ------------------------------------------------------------
A0A416TGN7      ------------------------------------------------------------
A0A417SMF6      ------------------------------------------------------------
A0A1Y4MW77      ------------------------------------------------------------
R6UHV6          ------------------------------------------------------------
A0A3R9Q621      ------------------------------------------------------------
A0A069RC75      ------------------------------------------------------------
A0A6S6R676      ------------------------------------------------------------
A0A174F2W5      ------------------------------------------------------------
A0A174S8E9      ------------------------------------------------------------
A0A416ZL97      ------------------------------------------------------------
A0A174LSK1      ------------------------------------------------------------
A0A373GY92      ------------------------------------------------------------
A0A373NZQ6      ------------------------------------------------------------
A0A417I9B9      ------------------------------------------------------------
A0A417MP97      ------------------------------------------------------------
A0A417WQF8      ------------------------------------------------------------
A0A373RZ83      ------------------------------------------------------------
A0A416U6I1      ------------------------------------------------------------
R7JQZ9          ------------------------------------------------------------
A0A7C6SMH0      ------------------------------------------------------------
A0A3B8KKL6      ------------------------------------------------------------
A0A2K9E6R0      ------------------------------------------------------------
A0A2S8RBI0      ------------------------------------------------------------
A0A0L6JLG6      ------------------------------------------------------------
G8LSN0          ------------------------------------------------------------
A0A1M5UYN6      ------------------------------------------------------------
A0A176JBT8      ------------------------------------------------------------
A0A1I5HIC6      ------------------------------------------------------------
A0A1Y3TC51      ------------------------------------------------------------
A0A1Y3T1N0      ------------------------------------------------------------
A0A1Y3Y8U8      ------------------------------------------------------------
A0A5B0BQY5      ------------------------------------------------------------
A6CLL4          ------------------------------------------------------------
A0A176U8D6      ------------------------------------------------------------
A0A1Q6KSQ5      ------------------------------------------------------------
A0A3D3U8B3      ------------------------------------------------------------
A0A3E5FRL7      ------------------------------------------------------------
A0A1Y4QK93      ------------------------------------------------------------
B1C232          ------------------------------------------------------------
A0A401USI6      ------------------------------------------------------------
A0A1V4IQ10      ------------------------------------------------------------
A0A1S8TRD2      ------------------------------------------------------------
G7M1U2          ------------------------------------------------------------
A0A2T6KJ75      ------------------------------------------------------------
A9KN92          ------------------------------------------------------------
A0A352MUJ1      ------------------------------------------------------------
R5YI67          ------------------------------------------------------------
A0A174DL89      ------------------------------------------------------------
A0A1Y0IQP5      ------------------------------------------------------------
A0A4R2R7B1      ------------------------------------------------------------
A0A1M6E8I2      ------------------------------------------------------------
A0A1Y4N105      ------------------------------------------------------------
A0A1Y4QP75      ------------------------------------------------------------
A0A3D4QRB5      ------------------------------------------------------------
A0A349DEH5      ------------------------------------------------------------
A0A3D4T7B4      ------------------------------------------------------------
A0A350XYC7      ------------------------------------------------------------
R6DNR8          ------------------------------------------------------------
A0A355KUM5      ------------------------------------------------------------
R5YGY6          ------------------------------------------------------------
A0A0K8J554      ------------------------------------------------------------
A0A1I0RG99      ------------------------------------------------------------
A0A1I5G322      ------------------------------------------------------------
A0A7C6IYW8      ------------------------------------------------------------
A0A3N1XSX6      ------------------------------------------------------------
A0A7C6JZF1      ------------------------------------------------------------
A0A7G9WCY6      ------------------------------------------------------------
A0A1C6G0U3      ------------------------------------------------------------
A0A3D4LLB3      ------------------------------------------------------------
A0A0A5GPA9      ------------------------------------------------------------
A0A271M6M4      ------------------------------------------------------------
A0A7C7AD93      ------------------------------------------------------------
A0A2V3W8U6      ------------------------------------------------------------
A0A6N3BXA1      ------------------------------------------------------------
A0A351SRI8      ------------------------------------------------------------
A0A1V5LU59      ------------------------------------------------------------
A0A1E3BVC3      ------------------------------------------------------------
A0A4Q0I6S0      ------------------------------------------------------------
A3DF66          ------------------------------------------------------------
W4V1T8          ------------------------------------------------------------
A0A1C6ITD7      ------------------------------------------------------------
A0A381IX63      ------------------------------------------------------------
A0A1G9IUT4      ------------------------------------------------------------
A0A1M6RWV2      ------------------------------------------------------------
A0A143XPI5      ------------------------------------------------------------
A0A355G1X5      ------------------------------------------------------------
A0A0M6WXE3      ------------------------------------------------------------
A0A348SAK2      ------------------------------------------------------------
A0A1G9H5B9      ------------------------------------------------------------
R5EFZ0          ------------------------------------------------------------
A0A1Y4H8L0      ------------------------------------------------------------
A0A4B9BMD9      ------------------------------------------------------------
A0A0M6WYQ8      ------------------------------------------------------------
A0A348SAK1      ------------------------------------------------------------
A0A252F281      ------------------------------------------------------------
A0A1Y4QKE6      ------------------------------------------------------------
B1C231          ------------------------------------------------------------
A0A1Y3TUL5      ------------------------------------------------------------
A0A1Y4JAX2      ------------------------------------------------------------
A0A1Y4T590      ------------------------------------------------------------
R5B467          ------------------------------------------------------------
A0A1Y3T163      ------------------------------------------------------------
A0A1Y3YCA2      ------------------------------------------------------------
A0A1Y4L6N9      ------------------------------------------------------------
A0A173T644      ------------------------------------------------------------
A0A1C5TSB8      ------------------------------------------------------------
C0CIK6          ------------------------------------------------------------
A0A1Y3WEF6      ------------------------------------------------------------
A0A417T0L2      ------------------------------------------------------------
A0A1H9EPU3      ------------------------------------------------------------
A0A354IGV3      ------------------------------------------------------------
A0A417JMV2      ------------------------------------------------------------
A0A415VWX5      ------------------------------------------------------------
A0A173UY96      ------------------------------------------------------------
B0P408          ------------------------------------------------------------
D4MV82          ------------------------------------------------------------
A0A173QTL1      ------------------------------------------------------------
A0A174J359      ------------------------------------------------------------
A0A174A3T7      ------------------------------------------------------------
A0A417UUA3      ------------------------------------------------------------
A0A6N2VB70      ------------------------------------------------------------
A0A1C6EUV9      ------------------------------------------------------------
A0A173Y645      ------------------------------------------------------------
A0A374AVY6      ------------------------------------------------------------
R7BXS4          ------------------------------------------------------------
A0A143ZUX1      ------------------------------------------------------------
A0A1W1Z4C3      ------------------------------------------------------------
A0A239QN83      ------------------------------------------------------------
A0A3R9WAA7      ------------------------------------------------------------
A0A1G6BLF1      ------------------------------------------------------------
R6HZX3          ------------------------------------------------------------
A0A1W2CEA6      ------------------------------------------------------------
R7FFK6          ------------------------------------------------------------
A0A373MPB9      ------------------------------------------------------------
A0A373L519      ------------------------------------------------------------
A0A373W906      ------------------------------------------------------------
A0A373VCW2      ------------------------------------------------------------
W0U604          ------------------------------------------------------------
A0A374B6G0      ------------------------------------------------------------
A0A373VM36      ------------------------------------------------------------
A0A1C5P379      ------------------------------------------------------------
A0A373XXX0      ------------------------------------------------------------
A0A5R9MJM9      ------------------------------------------------------------
A0A356CW82      ------------------------------------------------------------
R6T4X7          ------------------------------------------------------------
A0A374HTV1      ------------------------------------------------------------
A0A374GB66      ------------------------------------------------------------
A0A374ECC6      ------------------------------------------------------------
A0A374BM61      ------------------------------------------------------------
A0A373UGZ4      ------------------------------------------------------------
A0A373SA66      ------------------------------------------------------------
A0A1C5X6X7      ------------------------------------------------------------
A0A1C6JIH3      ------------------------------------------------------------
A0A373PSC3      ------------------------------------------------------------
A0A1K1WYK8      ------------------------------------------------------------
A0A1H6IUB1      ------------------------------------------------------------
A0A1M7L1F9      ------------------------------------------------------------
A0A1C6B4L6      ------------------------------------------------------------
A0A1Q6T9P4      ------------------------------------------------------------
A0A315Y4F9      ------------------------------------------------------------
A0A354K620      ------------------------------------------------------------
A0A355G3J9      ------------------------------------------------------------
A0A3D2AD87      ------------------------------------------------------------
A0A143XN92      ------------------------------------------------------------
A0A173ZYY6      ------------------------------------------------------------
A0A6L8RXB5      ------------------------------------------------------------
A0A6N9JW85      ------------------------------------------------------------
A0A173SMI2      ------------------------------------------------------------
A0A174ASH7      ------------------------------------------------------------
A6BH65          ------------------------------------------------------------
R7G0D7          ------------------------------------------------------------
A0A2T5IYJ6      TQQAAEWLSSRLGVLKSNVEVSEKKLQAYREENNLVDSGNNF------------------
A0A3C0QME1      ------------------------------------------------------------
A0A355FYK5      ------------------------------------------------------------
A0A357AQU0      ------------------------------------------------------------
A0A3C1YJQ7      ------------------------------------------------------------
A0A3D0JG38      ------------------------------------------------------------
A0A3C0IHX1      ------------------------------------------------------------
R5V506          ------------------------------------------------------------
A0A352TIU5      ------------------------------------------------------------
A0A3E5FSY5      ------------------------------------------------------------
A0A1V5S3C0      ------------------------------------------------------------
A0A1Y3TC98      ------------------------------------------------------------
A0A1Q6REE0      ------------------------------------------------------------
R5ETF9          ------------------------------------------------------------
R6VAT5          ------------------------------------------------------------
A0A1Q6S448      ------------------------------------------------------------
A0A351MYR0      ------------------------------------------------------------
R6HPC1          ------------------------------------------------------------
A0A3D4G5Z5      ------------------------------------------------------------
A0A3D5ES03      ------------------------------------------------------------
A0A0F2P7X6      ------------------------------------------------------------
A0A359B487      ------------------------------------------------------------
A0A348P5V4      ------------------------------------------------------------
A0A356PT74      ------------------------------------------------------------
A0A3D5LL19      ------------------------------------------------------------
R5MNF0          ------------------------------------------------------------
A0A1Q9JSI0      ------------------------------------------------------------
A0A3D5TNI1      ------------------------------------------------------------
A0A358LJD0      ------------------------------------------------------------
R6I3L7          ------------------------------------------------------------
A0A3D1HXX0      ------------------------------------------------------------
A0A3D2QJB8      ------------------------------------------------------------
D4LC36          ------------------------------------------------------------
R7MQJ4          ------------------------------------------------------------
A0A1V5GLC0      ------------------------------------------------------------
W7V182          ------------------------------------------------------------
                                                                            

S3FFL2          ATLNAALTQATADRIQAEARYQQAGRAGASTEALRNSAISALRQQRA----ELAANYQKL
A0A328M4V1      VAIDASLQQ-----LRMQM------------SDMQRHFTPAHPSYKA-------------
A0A6A8IF17      SQTNAQILA-----LNNQLYMTRYIRNYLANDANRTQLLPANSGIESANIESQIAEYNKQ
A0A3D5R4X5      ------------------------------------------------------------
A0A1I4C3N6      ------------------------------------------------------------
A0A3B9CIM7      ------------------------------------------------------------
A0A1G9WHW8      ------------------------------------------------------------
A0A1H5VAA0      ------------------------------------------------------------
A0A3R6VK11      ------------------------------------------------------------
A0A3R6QUY7      ------------------------------------------------------------
A0A373K3P9      ------------------------------------------------------------
A0A3R6JRU5      ------------------------------------------------------------
A0A1C5MS04      ------------------------------------------------------------
A0A3C1J150      ------------------------------------------------------------
A0A416CXD7      ------------------------------------------------------------
A0A6N2X662      ------------------------------------------------------------
R6XBL9          ------------------------------------------------------------
A0A355W5Z7      ------------------------------------------------------------
A0A143WVN6      ------------------------------------------------------------
W6RXP9          ------------------------------------------------------------
W6S4G8          ------------------------------------------------------------
A0A1G6BLB6      ------------------------------------------------------------
A0A1C6G8M0      ------------------------------------------------------------
A0A416MP73      ------------------------------------------------------------
A0A3E4LL92      ------------------------------------------------------------
A0A415D1L1      ------------------------------------------------------------
A0A0H5SF45      ------------------------------------------------------------
A0A1M6JRJ5      ------------------------------------------------------------
A0A1M7Y1S2      ------------------------------------------------------------
A0A7I8DMN1      ------------------------------------------------------------
A0A396G6S7      ------------------------------------------------------------
A0A3E5A223      ------------------------------------------------------------
R7D5E6          ------------------------------------------------------------
A0A415HQH5      ------------------------------------------------------------
A0A414W2C6      ------------------------------------------------------------
A5ZNE7          ------------------------------------------------------------
A0A395X821      ------------------------------------------------------------
A0A1C5PY68      ------------------------------------------------------------
A0A174CJF8      ------------------------------------------------------------
A0A564SRR2      ------------------------------------------------------------
A0A174R7V0      ------------------------------------------------------------
A0A373MWV2      ------------------------------------------------------------
A0A417CE88      ------------------------------------------------------------
A0A416Y441      ------------------------------------------------------------
A0A357GPJ7      ------------------------------------------------------------
A0A396PAC1      ------------------------------------------------------------
A0A416EYU4      ------------------------------------------------------------
A0A416SCQ2      ------------------------------------------------------------
A0A416TGN7      ------------------------------------------------------------
A0A417SMF6      ------------------------------------------------------------
A0A1Y4MW77      ------------------------------------------------------------
R6UHV6          ------------------------------------------------------------
A0A3R9Q621      ------------------------------------------------------------
A0A069RC75      ------------------------------------------------------------
A0A6S6R676      ------------------------------------------------------------
A0A174F2W5      ------------------------------------------------------------
A0A174S8E9      ------------------------------------------------------------
A0A416ZL97      ------------------------------------------------------------
A0A174LSK1      ------------------------------------------------------------
A0A373GY92      ------------------------------------------------------------
A0A373NZQ6      ------------------------------------------------------------
A0A417I9B9      ------------------------------------------------------------
A0A417MP97      ------------------------------------------------------------
A0A417WQF8      ------------------------------------------------------------
A0A373RZ83      ------------------------------------------------------------
A0A416U6I1      ------------------------------------------------------------
R7JQZ9          ------------------------------------------------------------
A0A7C6SMH0      ------------------------------------------------------------
A0A3B8KKL6      ------------------------------------------------------------
A0A2K9E6R0      ------------------------------------------------------------
A0A2S8RBI0      ------------------------------------------------------------
A0A0L6JLG6      ------------------------------------------------------------
G8LSN0          ------------------------------------------------------------
A0A1M5UYN6      ------------------------------------------------------------
A0A176JBT8      ------------------------------------------------------------
A0A1I5HIC6      ------------------------------------------------------------
A0A1Y3TC51      ------------------------------------------------------------
A0A1Y3T1N0      ------------------------------------------------------------
A0A1Y3Y8U8      ------------------------------------------------------------
A0A5B0BQY5      ------------------------------------------------------------
A6CLL4          ------------------------------------------------------------
A0A176U8D6      ------------------------------------------------------------
A0A1Q6KSQ5      ------------------------------------------------------------
A0A3D3U8B3      ------------------------------------------------------------
A0A3E5FRL7      ------------------------------------------------------------
A0A1Y4QK93      ------------------------------------------------------------
B1C232          ------------------------------------------------------------
A0A401USI6      ------------------------------------------------------------
A0A1V4IQ10      ------------------------------------------------------------
A0A1S8TRD2      ------------------------------------------------------------
G7M1U2          ------------------------------------------------------------
A0A2T6KJ75      ------------------------------------------------------------
A9KN92          ------------------------------------------------------------
A0A352MUJ1      ------------------------------------------------------------
R5YI67          ------------------------------------------------------------
A0A174DL89      ------------------------------------------------------------
A0A1Y0IQP5      ------------------------------------------------------------
A0A4R2R7B1      ------------------------------------------------------------
A0A1M6E8I2      ------------------------------------------------------------
A0A1Y4N105      ------------------------------------------------------------
A0A1Y4QP75      ------------------------------------------------------------
A0A3D4QRB5      ------------------------------------------------------------
A0A349DEH5      ------------------------------------------------------------
A0A3D4T7B4      ------------------------------------------------------------
A0A350XYC7      ------------------------------------------------------------
R6DNR8          ------------------------------------------------------------
A0A355KUM5      ------------------------------------------------------------
R5YGY6          ------------------------------------------------------------
A0A0K8J554      ------------------------------------------------------------
A0A1I0RG99      ------------------------------------------------------------
A0A1I5G322      ------------------------------------------------------------
A0A7C6IYW8      ------------------------------------------------------------
A0A3N1XSX6      ------------------------------------------------------------
A0A7C6JZF1      ------------------------------------------------------------
A0A7G9WCY6      ------------------------------------------------------------
A0A1C6G0U3      ------------------------------------------------------------
A0A3D4LLB3      ------------------------------------------------------------
A0A0A5GPA9      ------------------------------------------------------------
A0A271M6M4      ------------------------------------------------------------
A0A7C7AD93      ------------------------------------------------------------
A0A2V3W8U6      ------------------------------------------------------------
A0A6N3BXA1      ------------------------------------------------------------
A0A351SRI8      ------------------------------------------------------------
A0A1V5LU59      ------------------------------------------------------------
A0A1E3BVC3      ------------------------------------------------------------
A0A4Q0I6S0      ------------------------------------------------------------
A3DF66          ------------------------------------------------------------
W4V1T8          ------------------------------------------------------------
A0A1C6ITD7      ------------------------------------------------------------
A0A381IX63      ------------------------------------------------------------
A0A1G9IUT4      ------------------------------------------------------------
A0A1M6RWV2      ------------------------------------------------------------
A0A143XPI5      ------------------------------------------------------------
A0A355G1X5      ------------------------------------------------------------
A0A0M6WXE3      ------------------------------------------------------------
A0A348SAK2      ------------------------------------------------------------
A0A1G9H5B9      ------------------------------------------------------------
R5EFZ0          ------------------------------------------------------------
A0A1Y4H8L0      ------------------------------------------------------------
A0A4B9BMD9      ------------------------------------------------------------
A0A0M6WYQ8      ------------------------------------------------------------
A0A348SAK1      ------------------------------------------------------------
A0A252F281      ------------------------------------------------------------
A0A1Y4QKE6      ------------------------------------------------------------
B1C231          ------------------------------------------------------------
A0A1Y3TUL5      ------------------------------------------------------------
A0A1Y4JAX2      ------------------------------------------------------------
A0A1Y4T590      ------------------------------------------------------------
R5B467          ------------------------------------------------------------
A0A1Y3T163      ------------------------------------------------------------
A0A1Y3YCA2      ------------------------------------------------------------
A0A1Y4L6N9      ------------------------------------------------------------
A0A173T644      ------------------------------------------------------------
A0A1C5TSB8      ------------------------------------------------------------
C0CIK6          ------------------------------------------------------------
A0A1Y3WEF6      ------------------------------------------------------------
A0A417T0L2      ------------------------------------------------------------
A0A1H9EPU3      ------------------------------------------------------------
A0A354IGV3      ------------------------------------------------------------
A0A417JMV2      ------------------------------------------------------------
A0A415VWX5      ------------------------------------------------------------
A0A173UY96      ------------------------------------------------------------
B0P408          ------------------------------------------------------------
D4MV82          ------------------------------------------------------------
A0A173QTL1      ------------------------------------------------------------
A0A174J359      ------------------------------------------------------------
A0A174A3T7      ------------------------------------------------------------
A0A417UUA3      ------------------------------------------------------------
A0A6N2VB70      ------------------------------------------------------------
A0A1C6EUV9      ------------------------------------------------------------
A0A173Y645      ------------------------------------------------------------
A0A374AVY6      ------------------------------------------------------------
R7BXS4          ------------------------------------------------------------
A0A143ZUX1      ------------------------------------------------------------
A0A1W1Z4C3      ------------------------------------------------------------
A0A239QN83      ------------------------------------------------------------
A0A3R9WAA7      ------------------------------------------------------------
A0A1G6BLF1      ------------------------------------------------------------
R6HZX3          ------------------------------------------------------------
A0A1W2CEA6      ------------------------------------------------------------
R7FFK6          ------------------------------------------------------------
A0A373MPB9      ------------------------------------------------------------
A0A373L519      ------------------------------------------------------------
A0A373W906      ------------------------------------------------------------
A0A373VCW2      ------------------------------------------------------------
W0U604          ------------------------------------------------------------
A0A374B6G0      ------------------------------------------------------------
A0A373VM36      ------------------------------------------------------------
A0A1C5P379      ------------------------------------------------------------
A0A373XXX0      ------------------------------------------------------------
A0A5R9MJM9      ------------------------------------------------------------
A0A356CW82      ------------------------------------------------------------
R6T4X7          ------------------------------------------------------------
A0A374HTV1      ------------------------------------------------------------
A0A374GB66      ------------------------------------------------------------
A0A374ECC6      ------------------------------------------------------------
A0A374BM61      ------------------------------------------------------------
A0A373UGZ4      ------------------------------------------------------------
A0A373SA66      ------------------------------------------------------------
A0A1C5X6X7      ------------------------------------------------------------
A0A1C6JIH3      ------------------------------------------------------------
A0A373PSC3      ------------------------------------------------------------
A0A1K1WYK8      ------------------------------------------------------------
A0A1H6IUB1      ------------------------------------------------------------
A0A1M7L1F9      ------------------------------------------------------------
A0A1C6B4L6      ------------------------------------------------------------
A0A1Q6T9P4      ------------------------------------------------------------
A0A315Y4F9      ------------------------------------------------------------
A0A354K620      ------------------------------------------------------------
A0A355G3J9      ------------------------------------------------------------
A0A3D2AD87      ------------------------------------------------------------
A0A143XN92      ------------------------------------------------------------
A0A173ZYY6      ------------------------------------------------------------
A0A6L8RXB5      ------------------------------------------------------------
A0A6N9JW85      ------------------------------------------------------------
A0A173SMI2      ------------------------------------------------------------
A0A174ASH7      ------------------------------------------------------------
A6BH65          ------------------------------------------------------------
R7G0D7          ------------------------------------------------------------
A0A2T5IYJ6      ------------------------------------------------------------
A0A3C0QME1      ------------------------------------------------------------
A0A355FYK5      ------------------------------------------------------------
A0A357AQU0      ------------------------------------------------------------
A0A3C1YJQ7      ------------------------------------------------------------
A0A3D0JG38      ------------------------------------------------------------
A0A3C0IHX1      ------------------------------------------------------------
R5V506          ------------------------------------------------------------
A0A352TIU5      ------------------------------------------------------------
A0A3E5FSY5      ------------------------------------------------------------
A0A1V5S3C0      ------------------------------------------------------------
A0A1Y3TC98      ------------------------------------------------------------
A0A1Q6REE0      ------------------------------------------------------------
R5ETF9          ------------------------------------------------------------
R6VAT5          ------------------------------------------------------------
A0A1Q6S448      ------------------------------------------------------------
A0A351MYR0      ------------------------------------------------------------
R6HPC1          ------------------------------------------------------------
A0A3D4G5Z5      ------------------------------------------------------------
A0A3D5ES03      ------------------------------------------------------------
A0A0F2P7X6      ------------------------------------------------------------
A0A359B487      ------------------------------------------------------------
A0A348P5V4      ------------------------------------------------------------
A0A356PT74      ------------------------------------------------------------
A0A3D5LL19      ------------------------------------------------------------
R5MNF0          ------------------------------------------------------------
A0A1Q9JSI0      ------------------------------------------------------------
A0A3D5TNI1      ------------------------------------------------------------
A0A358LJD0      ------------------------------------------------------------
R6I3L7          ------------------------------------------------------------
A0A3D1HXX0      ------------------------------------------------------------
A0A3D2QJB8      ------------------------------------------------------------
D4LC36          ------------------------------------------------------------
R7MQJ4          ------------------------------------------------------------
A0A1V5GLC0      ------------------------------------------------------------
W7V182          ------------------------------------------------------------
                                                                            

S3FFL2          MVQFEPEYPAARALSAQIAQLDRSIAREESRVSGSQLADYREAQERERALKAQVDALKSS
A0A328M4V1      ------------------------------------------LQSQIGQMEGQKAALQKQ
A0A6A8IF17      LLQRNSLVANSSTENPLVVDMDQALASMRGAIIRSIDNQIVTLNSQIKSLRQTEQQTTSR
A0A3D5R4X5      ------------------------------------------------------------
A0A1I4C3N6      ------------------------------------------------------------
A0A3B9CIM7      ------------------------------------------------------------
A0A1G9WHW8      ------------------------------------------------------------
A0A1H5VAA0      ------------------------------------------------------------
A0A3R6VK11      ------------------------------------------------------------
A0A3R6QUY7      ------------------------------------------------------------
A0A373K3P9      ------------------------------------------------------------
A0A3R6JRU5      ------------------------------------------------------------
A0A1C5MS04      ------------------------------------------------------------
A0A3C1J150      ------------------------------------------------------------
A0A416CXD7      ------------------------------------------------------------
A0A6N2X662      ------------------------------------------------------------
R6XBL9          ------------------------------------------------------------
A0A355W5Z7      ------------------------------------------------------------
A0A143WVN6      ------------------------------------------------------------
W6RXP9          ------------------------------------------------------------
W6S4G8          ------------------------------------------------------------
A0A1G6BLB6      ------------------------------------------------------------
A0A1C6G8M0      ------------------------------------------------------------
A0A416MP73      ------------------------------------------------------------
A0A3E4LL92      ------------------------------------------------------------
A0A415D1L1      ------------------------------------------------------------
A0A0H5SF45      ------------------------------------------------------------
A0A1M6JRJ5      ------------------------------------------------------------
A0A1M7Y1S2      ------------------------------------------------------------
A0A7I8DMN1      ------------------------------------------------------------
A0A396G6S7      ------------------------------------------------------------
A0A3E5A223      ------------------------------------------------------------
R7D5E6          ------------------------------------------------------------
A0A415HQH5      ------------------------------------------------------------
A0A414W2C6      ------------------------------------------------------------
A5ZNE7          ------------------------------------------------------------
A0A395X821      ------------------------------------------------------------
A0A1C5PY68      ------------------------------------------------------------
A0A174CJF8      ------------------------------------------------------------
A0A564SRR2      ------------------------------------------------------------
A0A174R7V0      ------------------------------------------------------------
A0A373MWV2      ------------------------------------------------------------
A0A417CE88      ------------------------------------------------------------
A0A416Y441      ------------------------------------------------------------
A0A357GPJ7      ------------------------------------------------------------
A0A396PAC1      ------------------------------------------------------------
A0A416EYU4      ------------------------------------------------------------
A0A416SCQ2      ------------------------------------------------------------
A0A416TGN7      ------------------------------------------------------------
A0A417SMF6      ------------------------------------------------------------
A0A1Y4MW77      ------------------------------------------------------------
R6UHV6          ------------------------------------------------------------
A0A3R9Q621      ------------------------------------------------------------
A0A069RC75      ------------------------------------------------------------
A0A6S6R676      ------------------------------------------------------------
A0A174F2W5      ------------------------------------------------------------
A0A174S8E9      ------------------------------------------------------------
A0A416ZL97      ------------------------------------------------------------
A0A174LSK1      ------------------------------------------------------------
A0A373GY92      ------------------------------------------------------------
A0A373NZQ6      ------------------------------------------------------------
A0A417I9B9      ------------------------------------------------------------
A0A417MP97      ------------------------------------------------------------
A0A417WQF8      ------------------------------------------------------------
A0A373RZ83      ------------------------------------------------------------
A0A416U6I1      ------------------------------------------------------------
R7JQZ9          ------------------------------------------------------------
A0A7C6SMH0      ------------------------------------------------------------
A0A3B8KKL6      ------------------------------------------------------------
A0A2K9E6R0      ------------------------------------------------------------
A0A2S8RBI0      ------------------------------------------------------------
A0A0L6JLG6      ------------------------------------------------------------
G8LSN0          ------------------------------------------------------------
A0A1M5UYN6      ------------------------------------------------------------
A0A176JBT8      ------------------------------------------------------------
A0A1I5HIC6      ------------------------------------------------------------
A0A1Y3TC51      ------------------------------------------------------------
A0A1Y3T1N0      ------------------------------------------------------------
A0A1Y3Y8U8      ------------------------------------------------------------
A0A5B0BQY5      ------------------------------------------------------------
A6CLL4          ------------------------------------------------------------
A0A176U8D6      ------------------------------------------------------------
A0A1Q6KSQ5      ------------------------------------------------------------
A0A3D3U8B3      ------------------------------------------------------------
A0A3E5FRL7      ------------------------------------------------------------
A0A1Y4QK93      ------------------------------------------------------------
B1C232          ------------------------------------------------------------
A0A401USI6      ------------------------------------------------------------
A0A1V4IQ10      ------------------------------------------------------------
A0A1S8TRD2      ------------------------------------------------------------
G7M1U2          ------------------------------------------------------------
A0A2T6KJ75      ------------------------------------------------------------
A9KN92          ------------------------------------------------------------
A0A352MUJ1      ------------------------------------------------------------
R5YI67          ------------------------------------------------------------
A0A174DL89      ------------------------------------------------------------
A0A1Y0IQP5      ------------------------------------------------------------
A0A4R2R7B1      ------------------------------------------------------------
A0A1M6E8I2      ------------------------------------------------------------
A0A1Y4N105      ------------------------------------------------------------
A0A1Y4QP75      ------------------------------------------------------------
A0A3D4QRB5      ------------------------------------------------------------
A0A349DEH5      ------------------------------------------------------------
A0A3D4T7B4      ------------------------------------------------------------
A0A350XYC7      ------------------------------------------------------------
R6DNR8          ------------------------------------------------------------
A0A355KUM5      ------------------------------------------------------------
R5YGY6          ------------------------------------------------------------
A0A0K8J554      ------------------------------------------------------------
A0A1I0RG99      ------------------------------------------------------------
A0A1I5G322      ------------------------------------------------------------
A0A7C6IYW8      ------------------------------------------------------------
A0A3N1XSX6      ------------------------------------------------------------
A0A7C6JZF1      ------------------------------------------------------------
A0A7G9WCY6      ------------------------------------------------------------
A0A1C6G0U3      ------------------------------------------------------------
A0A3D4LLB3      ------------------------------------------------------------
A0A0A5GPA9      ------------------------------------------------------------
A0A271M6M4      ------------------------------------------------------------
A0A7C7AD93      ------------------------------------------------------------
A0A2V3W8U6      ------------------------------------------------------------
A0A6N3BXA1      ------------------------------------------------------------
A0A351SRI8      ------------------------------------------------------------
A0A1V5LU59      ------------------------------------------------------------
A0A1E3BVC3      ------------------------------------------------------------
A0A4Q0I6S0      ------------------------------------------------------------
A3DF66          ------------------------------------------------------------
W4V1T8          ------------------------------------------------------------
A0A1C6ITD7      ------------------------------------------------------------
A0A381IX63      ------------------------------------------------------------
A0A1G9IUT4      ------------------------------------------------------------
A0A1M6RWV2      ------------------------------------------------------------
A0A143XPI5      ------------------------------------------------------------
A0A355G1X5      ------------------------------------------------------------
A0A0M6WXE3      ------------------------------------------------------------
A0A348SAK2      ------------------------------------------------------------
A0A1G9H5B9      ------------------------------------------------------------
R5EFZ0          ------------------------------------------------------------
A0A1Y4H8L0      ------------------------------------------------------------
A0A4B9BMD9      ------------------------------------------------------------
A0A0M6WYQ8      ------------------------------------------------------------
A0A348SAK1      ------------------------------------------------------------
A0A252F281      ------------------------------------------------------------
A0A1Y4QKE6      ------------------------------------------------------------
B1C231          ------------------------------------------------------------
A0A1Y3TUL5      ------------------------------------------------------------
A0A1Y4JAX2      ------------------------------------------------------------
A0A1Y4T590      ------------------------------------------------------------
R5B467          ------------------------------------------------------------
A0A1Y3T163      ------------------------------------------------------------
A0A1Y3YCA2      ------------------------------------------------------------
A0A1Y4L6N9      ------------------------------------------------------------
A0A173T644      ------------------------------------------------------------
A0A1C5TSB8      ------------------------------------------------------------
C0CIK6          ------------------------------------------------------------
A0A1Y3WEF6      ------------------------------------------------------------
A0A417T0L2      ------------------------------------------------------------
A0A1H9EPU3      ------------------------------------------------------------
A0A354IGV3      ------------------------------------------------------------
A0A417JMV2      ------------------------------------------------------------
A0A415VWX5      ------------------------------------------------------------
A0A173UY96      ------------------------------------------------------------
B0P408          ------------------------------------------------------------
D4MV82          ------------------------------------------------------------
A0A173QTL1      ------------------------------------------------------------
A0A174J359      ------------------------------------------------------------
A0A174A3T7      ------------------------------------------------------------
A0A417UUA3      ------------------------------------------------------------
A0A6N2VB70      ------------------------------------------------------------
A0A1C6EUV9      ------------------------------------------------------------
A0A173Y645      ------------------------------------------------------------
A0A374AVY6      ------------------------------------------------------------
R7BXS4          ------------------------------------------------------------
A0A143ZUX1      ------------------------------------------------------------
A0A1W1Z4C3      ------------------------------------------------------------
A0A239QN83      ------------------------------------------------------------
A0A3R9WAA7      ------------------------------------------------------------
A0A1G6BLF1      ------------------------------------------------------------
R6HZX3          ------------------------------------------------------------
A0A1W2CEA6      ------------------------------------------------------------
R7FFK6          ------------------------------------------------------------
A0A373MPB9      ------------------------------------------------------------
A0A373L519      ------------------------------------------------------------
A0A373W906      ------------------------------------------------------------
A0A373VCW2      ------------------------------------------------------------
W0U604          ------------------------------------------------------------
A0A374B6G0      ------------------------------------------------------------
A0A373VM36      ------------------------------------------------------------
A0A1C5P379      ------------------------------------------------------------
A0A373XXX0      ------------------------------------------------------------
A0A5R9MJM9      ------------------------------------------------------------
A0A356CW82      ------------------------------------------------------------
R6T4X7          ------------------------------------------------------------
A0A374HTV1      ------------------------------------------------------------
A0A374GB66      ------------------------------------------------------------
A0A374ECC6      ------------------------------------------------------------
A0A374BM61      ------------------------------------------------------------
A0A373UGZ4      ------------------------------------------------------------
A0A373SA66      ------------------------------------------------------------
A0A1C5X6X7      ------------------------------------------------------------
A0A1C6JIH3      ------------------------------------------------------------
A0A373PSC3      ------------------------------------------------------------
A0A1K1WYK8      ------------------------------------------------------------
A0A1H6IUB1      ------------------------------------------------------------
A0A1M7L1F9      ------------------------------------------------------------
A0A1C6B4L6      ------------------------------------------------------------
A0A1Q6T9P4      ------------------------------------------------------------
A0A315Y4F9      ------------------------------------------------------------
A0A354K620      ------------------------------------------------------------
A0A355G3J9      ------------------------------------------------------------
A0A3D2AD87      ------------------------------------------------------------
A0A143XN92      ------------------------------------------------------------
A0A173ZYY6      ------------------------------------------------------------
A0A6L8RXB5      ------------------------------------------------------------
A0A6N9JW85      ------------------------------------------------------------
A0A173SMI2      ------------------------------------------------------------
A0A174ASH7      ------------------------------------------------------------
A6BH65          ------------------------------------------------------------
R7G0D7          ------------------------------------------------------------
A0A2T5IYJ6      --GVLGLSAGQLQQTNQRLIEAQFKVAEISKRYGSKHPTLIQAELELNEAKKALEIAKAD
A0A3C0QME1      ------------------------------------------------------------
A0A355FYK5      ------------------------------------------------------------
A0A357AQU0      ------------------------------------------------------------
A0A3C1YJQ7      ------------------------------------------------------------
A0A3D0JG38      ------------------------------------------------------------
A0A3C0IHX1      ------------------------------------------------------------
R5V506          ------------------------------------------------------------
A0A352TIU5      ------------------------------------------------------------
A0A3E5FSY5      ------------------------------------------------------------
A0A1V5S3C0      ------------------------------------------------------------
A0A1Y3TC98      ------------------------------------------------------------
A0A1Q6REE0      ------------------------------------------------------------
R5ETF9          ------------------------------------------------------------
R6VAT5          ------------------------------------------------------------
A0A1Q6S448      ------------------------------------------------------------
A0A351MYR0      ------------------------------------------------------------
R6HPC1          ------------------------------------------------------------
A0A3D4G5Z5      ------------------------------------------------------------
A0A3D5ES03      ------------------------------------------------------------
A0A0F2P7X6      ------------------------------------------------------------
A0A359B487      ------------------------------------------------------------
A0A348P5V4      ------------------------------------------------------------
A0A356PT74      ------------------------------------------------------------
A0A3D5LL19      ------------------------------------------------------------
R5MNF0          ------------------------------------------------------------
A0A1Q9JSI0      ------------------------------------------------------------
A0A3D5TNI1      ------------------------------------------------------------
A0A358LJD0      ------------------------------------------------------------
R6I3L7          ------------------------------------------------------------
A0A3D1HXX0      ------------------------------------------------------------
A0A3D2QJB8      ------------------------------------------------------------
D4LC36          ------------------------------------------------------------
R7MQJ4          ------------------------------------------------------------
A0A1V5GLC0      ------------------------------------------------------------
W7V182          ------------------------------------------------------------
                                                                            

S3FFL2          YLDLRRRSIQYNIYQQEVDTNRALYDGLLQRFKEIGVAGGVGINNIAVVD---AADVP--
A0A328M4V1      VGQLPDIQQQMLRLARDVQVSNTTYTSLLNQAQQLNIARAGTVGNVRVID--RAATDT--
A0A6A8IF17      IAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAYNTRIVT---PPHGS--
A0A3D5R4X5      ----------------------------------------MNVDNVKILD--KAVTPT--
A0A1I4C3N6      ----------------------------------------VKSGGLQVLD--EAKLPT--
A0A3B9CIM7      ----------------------------------------VKSGGIEVLD--EAELPT--
A0A1G9WHW8      ----------------------------------------VKAGGVQVLD--SAELPT--
A0A1H5VAA0      ----------------------------------------VKAGGVQVLD--SAELPT--
A0A3R6VK11      ----------------------------------------VKSGGIEVID--YATLPE--
A0A3R6QUY7      ----------------------------------------VKSGGIEVID--YATLPE--
A0A373K3P9      ----------------------------------------VKSGGIEVID--YATLPE--
A0A3R6JRU5      ----------------------------------------VKSGGIEVID--YATLPE--
A0A1C5MS04      ----------------------------------------VKSGGIEVID--YATLPE--
A0A3C1J150      ----------------------------------------VKSGGIEVID--YATLPE--
A0A416CXD7      ----------------------------------------VKSGGIEVID--YATLPE--
A0A6N2X662      ----------------------------------------VKSGGIEVID--YATLPE--
R6XBL9          ----------------------------------------VKSGGIEVID--YATLPE--
A0A355W5Z7      ----------------------------------------VKSGGIEVID--YATLPE--
A0A143WVN6      ----------------------------------------FSNASLQMVR--EPNVPY--
W6RXP9          ----------------------------------------VPNGNVKVIR--EVRVPK--
W6S4G8          ----------------------------------------VPNGNVKIIR--HVKEAE--
A0A1G6BLB6      ----------------------------------------LGSVIMTILD--QSDIPT--
A0A1C6G8M0      ----------------------------------------LGSNTPTVLD--KADEFF--
A0A416MP73      ----------------------------------------LGSSKPTILD--KADDLF--
A0A3E4LL92      ----------------------------------------ESGYVLQPLS--SISANN--
A0A415D1L1      ----------------------------------------ESGYVLQPLS--SISANN--
A0A0H5SF45      ----------------------------------------KENSKISVVD--PVVYPA--
A0A1M6JRJ5      ----------------------------------------KSDAVINVVD--PVVYQP--
A0A1M7Y1S2      ----------------------------------------KTNSMIYVVD--PVVCPT--
A0A7I8DMN1      ----------------------------------------KSDAVISVVD--PVIYQG--
A0A396G6S7      ----------------------------------------IKNVIIETIQ--QPSVAM--
A0A3E5A223      ----------------------------------------IKNVIIETIQ--QPSVAM--
R7D5E6          ----------------------------------------IKNVIIETIQ--QPSVAM--
A0A415HQH5      ----------------------------------------IKNVIIETIQ--QPSVAM--
A0A414W2C6      ----------------------------------------IKNVIIETIQ--QPSVAM--
A5ZNE7          ----------------------------------------IKNVIIETIQ--QPSVAM--
A0A395X821      ----------------------------------------IKNVIIETIQ--QPSVAM--
A0A1C5PY68      ----------------------------------------IKNVIIETIQ--QPSVAM--
A0A174CJF8      ----------------------------------------IKNVIIETIQ--QPSVAM--
A0A564SRR2      ----------------------------------------IKNVIIETIQ--QPSVAM--
A0A174R7V0      ----------------------------------------IKNVIIETIQ--QPSVAM--
A0A373MWV2      ----------------------------------------IPNVVLETLQ--QPQVSD--
A0A417CE88      ----------------------------------------IPNVVLETLQ--QPQVSG--
A0A416Y441      ----------------------------------------IPNVVLETLQ--QPQVSG--
A0A357GPJ7      ----------------------------------------IPNVVLETLQ--QPQVSD--
A0A396PAC1      ----------------------------------------IPNVVLETLQ--QPQVSD--
A0A416EYU4      ----------------------------------------IPNVVLETLQ--QPQVSD--
A0A416SCQ2      ----------------------------------------IPNVVLETLQ--QPQVSD--
A0A416TGN7      ----------------------------------------IPNVVLETLQ--QPQVSG--
A0A417SMF6      ----------------------------------------IPNVVLETLQ--QPQVSG--
A0A1Y4MW77      ----------------------------------------IGMTKFNMIE--NPSVSN--
R6UHV6          ----------------------------------------VSSIVLQTLE--EPVVPT--
A0A3R9Q621      ----------------------------------------KNTTEISVVD--PVVMPR--
A0A069RC75      ----------------------------------------MNDENVRVID--YAKIPA--
A0A6S6R676      ----------------------------------------KDTAEISVVD--PVVLPT--
A0A174F2W5      ----------------------------------------IPNVVLETLQ--QPQVSG--
A0A174S8E9      ----------------------------------------IPNVVLETLQ--QPQVSG--
A0A416ZL97      ----------------------------------------IPNVVLETLQ--QPQVSG--
A0A174LSK1      ----------------------------------------IPNVVLETLQ--QPQVSG--
A0A373GY92      ----------------------------------------IPNVVLETLQ--QPQVSG--
A0A373NZQ6      ----------------------------------------IPNVVLETLQ--QPQVSG--
A0A417I9B9      ----------------------------------------IPNVVLETLQ--QPQVSG--
A0A417MP97      ----------------------------------------IPNVVLETLQ--QPQVSG--
A0A417WQF8      ----------------------------------------IPNVVLETLQ--QPQVSG--
A0A373RZ83      ----------------------------------------IPNVVLETLQ--QPQVSG--
A0A416U6I1      ----------------------------------------IPNVVLETLQ--QPQVSG--
R7JQZ9          ----------------------------------------IPNVVLETLQ--QPQVSG--
A0A7C6SMH0      ----------------------------------------IEVKNVMVVD--EASAPV--
A0A3B8KKL6      ----------------------------------------IEVKNVMVVD--EANMPN--
A0A2K9E6R0      ----------------------------------------IEVKNVMVVD--EANMPN--
A0A2S8RBI0      ----------------------------------------IEVKNVMVVD--EANMPN--
A0A0L6JLG6      ----------------------------------------IEVKNVKVID--TAKDPK--
G8LSN0          ----------------------------------------IQVKNVSIID--VAKVPE--
A0A1M5UYN6      ----------------------------------------IPNGNIKIFQ--NPRSFQ--
A0A176JBT8      ----------------------------------------MKIENVNILT--IATPYS--
A0A1I5HIC6      ----------------------------------------LEMEKVNIVE--EGDIPS--
A0A1Y3TC51      ----------------------------------------FSNASLRTVQ--EPEVPS--
A0A1Y3T1N0      ----------------------------------------FSNASLQILQ--EPQVPS--
A0A1Y3Y8U8      ----------------------------------------FSNASLQILQ--EPQVPS--
A0A5B0BQY5      ----------------------------------------MNLDNITILK--EVIVGT--
A6CLL4          ----------------------------------------MQIDNIQILS--YAQEQD--
A0A176U8D6      ----------------------------------------LGSSVPTVLD--KAELSF--
A0A1Q6KSQ5      ----------------------------------------LGSNTPTVLD--KADEFF--
A0A3D3U8B3      ----------------------------------------LGSNTPTVLD--KADEFF--
A0A3E5FRL7      ----------------------------------------FTNATLQVLQ--EPSIPI--
A0A1Y4QK93      ----------------------------------------FTNATLQVLQ--EPSIPT--
B1C232          ----------------------------------------FTNATLQVLQ--EPSIPT--
A0A401USI6      ----------------------------------------LPSGIAKIMD--KALIPE--
A0A1V4IQ10      ----------------------------------------IPNGIVKVIE--DVVISE--
A0A1S8TRD2      ----------------------------------------IPDSTVKVIE--DVVISE--
G7M1U2          ----------------------------------------IPDSTVKVIE--DVVISE--
A0A2T6KJ75      ----------------------------------------MNLENVHILS--QATVNE--
A9KN92          ----------------------------------------LEMEKVNIVE--EGNIPT--
A0A352MUJ1      ----------------------------------------YHMENIRVVD--KAVAPS--
R5YI67          ----------------------------------------YNMENIRVVD--KAVAPS--
A0A174DL89      ----------------------------------------RGVDNVILVD--SASIPE--
A0A1Y0IQP5      ----------------------------------------MQVDNISILD--TAKLTS--
A0A4R2R7B1      ----------------------------------------MQVDNVSILD--TAKLTS--
A0A1M6E8I2      ----------------------------------------LKVDNVEIID--EAIPID--
A0A1Y4N105      ----------------------------------------FSNASLQMVQ--DASVPM--
A0A1Y4QP75      ----------------------------------------FSNASLQMVQ--DASVPM--
A0A3D4QRB5      ----------------------------------------LNMENVQVID--TARVSQ--
A0A349DEH5      ----------------------------------------YPYAQLNLLD--TPVLST--
A0A3D4T7B4      ----------------------------------------YPYAQLNLLD--TPVLST--
A0A350XYC7      ----------------------------------------YSNAKLTLCD--RPVLST--
R6DNR8          ----------------------------------------YPNAKLTLCD--KPVLST--
A0A355KUM5      ----------------------------------------YPNAKLTLCD--TPVLPT--
R5YGY6          ----------------------------------------YPNAKLTLCD--TPVLPT--
A0A0K8J554      ----------------------------------------KNNAKITVID--PVVFPT--
A0A1I0RG99      ----------------------------------------KETSQITVVD--PPTLPT--
A0A1I5G322      ----------------------------------------KDTAQISIVD--PPALPT--
A0A7C6IYW8      ----------------------------------------KPSAKISVVD--PVDFPT--
A0A3N1XSX6      ----------------------------------------KPSAQISVVD--PVSVPT--
A0A7C6JZF1      ----------------------------------------KDSSEISIVD--PVVLPE--
A0A7G9WCY6      ----------------------------------------LNIDNIQILD--RASVPT--
A0A1C6G0U3      ----------------------------------------TNTNKVEIID--KAIVNE--
A0A3D4LLB3      ----------------------------------------TKTNNVAVVD--YARLPL--
A0A0A5GPA9      ----------------------------------------MNLNNVQILT--RSNPDA--
A0A271M6M4      ----------------------------------------MKIDNVDILT--GAKIVN--
A0A7C7AD93      ----------------------------------------YPSYSIKTLE--MVG-----
A0A2V3W8U6      ----------------------------------------MNLENVNILT--EAKVEK--
A0A6N3BXA1      ----------------------------------------TKASGVEVID--KATVPT--
A0A351SRI8      ----------------------------------------FNIENISIID--EATVGE--
A0A1V5LU59      ----------------------------------------IQVKNVKVID--IAKVPE--
A0A1E3BVC3      ----------------------------------------IQVKNIKVID--TAKIPE--
A0A4Q0I6S0      ----------------------------------------IQVKNIKVID--TAKIPE--
A3DF66          ----------------------------------------IQVKNIKVID--TAKIPE--
W4V1T8          ----------------------------------------IQVKNIKVID--TAKIPE--
A0A1C6ITD7      ----------------------------------------RGVDNVIMVD--TASIPE--
A0A381IX63      ----------------------------------------SKVDGGQVID--EALLPT--
A0A1G9IUT4      ----------------------------------------MKTNNVEIID--KSTIPD--
A0A1M6RWV2      ----------------------------------------IKMENVRILD--YAVVPS--
A0A143XPI5      ----------------------------------------IGSTKLVIVD--DSGVPK--
A0A355G1X5      ----------------------------------------YPNATLQIYE--KPFKPT--
A0A0M6WXE3      ----------------------------------------VGTTVLDVLE--DPKIPY--
A0A348SAK2      ----------------------------------------VGTTVLDVLE--DPKIPY--
A0A1G9H5B9      ----------------------------------------VGVGNVDIMD--YAVVPV--
R5EFZ0          ----------------------------------------IDDIGLEVLQ--YPAVPT--
A0A1Y4H8L0      ----------------------------------------LGNAVLEPLD--EPEIPL--
A0A4B9BMD9      ----------------------------------------FREAEISQLY--KKDHPTYR
A0A0M6WYQ8      ----------------------------------------LGNTTLKILD--ETGVPD--
A0A348SAK1      ----------------------------------------LGNTTLKILD--ETGVPD--
A0A252F281      ----------------------------------------LSGAVFTVVR--EPQIAR--
A0A1Y4QKE6      ----------------------------------------LGQIQFHMIN--NPQLPT--
B1C231          ----------------------------------------LGQIQFHMIN--NPQLPT--
A0A1Y3TUL5      ----------------------------------------LKIGSVSVIN--EPKATY--
A0A1Y4JAX2      ----------------------------------------LKIGSVSVIN--EPKATY--
A0A1Y4T590      ----------------------------------------LKIGSVSVIN--EPKATY--
R5B467          ----------------------------------------VGPTELVMMD--QTGVPT--
A0A1Y3T163      ----------------------------------------LGDIQFNYLN--EPETPT--
A0A1Y3YCA2      ----------------------------------------LGDIQFNYLN--EPETPT--
A0A1Y4L6N9      ----------------------------------------IGNTKFNMID--VPTEPT--
A0A173T644      ----------------------------------------IGETKFNMID--VPTAPK--
A0A1C5TSB8      ----------------------------------------IGETKFNMID--VPTAPK--
C0CIK6          ----------------------------------------IGETKFNMID--VPTAPK--
A0A1Y3WEF6      ----------------------------------------IGDTRFSMID--EPTTPT--
A0A417T0L2      ----------------------------------------IGDTKFNMID--EPSTPT--
A0A1H9EPU3      ----------------------------------------IGVDTVKAID--GDIGAV--
A0A354IGV3      ----------------------------------------FSSIVLTVID--GPYIPT--
A0A417JMV2      ----------------------------------------IGNVVLDVLQ--KPTVPS--
A0A415VWX5      ----------------------------------------IGNVVLDVLQ--KPTVPS--
A0A173UY96      ----------------------------------------IGNVVLDVLQ--KPTVPS--
B0P408          ----------------------------------------IGNVVLDVLQ--KPTVPS--
D4MV82          ----------------------------------------IGNVVLDVLQ--KPTVPS--
A0A173QTL1      ----------------------------------------IGNVVLDVLQ--KPTVPS--
A0A174J359      ----------------------------------------IGNVVLDVLQ--KPTVPS--
A0A174A3T7      ----------------------------------------IGNVVLDVLQ--KPTVPS--
A0A417UUA3      ----------------------------------------IGNVVLDVLQ--KPTVPS--
A0A6N2VB70      ----------------------------------------IGNVVLDVLQ--KPTVPS--
A0A1C6EUV9      ----------------------------------------IGTVVLDVLQ--NPTVPS--
A0A173Y645      ----------------------------------------IGTVVLDVLQ--NPTVPS--
A0A374AVY6      ----------------------------------------IGTVVLDVLQ--NPTVPS--
R7BXS4          ----------------------------------------IGTVVLDVLQ--NPTVPS--
A0A143ZUX1      -----------------------------------DDSSGSGTAFVNSVQKIQPRMPQ--
A0A1W1Z4C3      ----------------------------------------VAAGEAKAQD--YATIPM--
A0A239QN83      ----------------------------------------VTAGEAKAQD--YAVVPL--
A0A3R9WAA7      ----------------------------------------VGTTHLNMIE--ESGIPA--
A0A1G6BLF1      ----------------------------------------IGSTTLEVMS--ESGVPT--
R6HZX3          ----------------------------------------IGGTQLSMIE--EPQVPT--
A0A1W2CEA6      ----------------------------------------MELRKPQILE--KARTPI--
R7FFK6          ----------------------------------------VGAGSVEKIG--DAKIYD--
A0A373MPB9      ----------------------------------------IGAGSVEKIG--DAEVYN--
A0A373L519      ----------------------------------------IGAGSVEKIG--DAEVYN--
A0A373W906      ----------------------------------------IGAGSVEKIG--DAEVYN--
A0A373VCW2      ----------------------------------------IGAGSVEKIG--DAEVYN--
W0U604          ----------------------------------------IGAGSVEKIG--DAEVYN--
A0A374B6G0      ----------------------------------------IGAGSVEKIG--DAEVYN--
A0A373VM36      ----------------------------------------IGAGSVEKIG--DAEVYN--
A0A1C5P379      ----------------------------------------IGAGSVEKIG--DAEVYN--
A0A373XXX0      ----------------------------------------IGAGSVEKIG--DAEVYN--
A0A5R9MJM9      ----------------------------------------IGAGSVEKIG--DAEVYN--
A0A356CW82      ----------------------------------------IGAGSVEKIG--DAEVYN--
R6T4X7          ----------------------------------------IGAGSVEKIG--DAEVYN--
A0A374HTV1      ----------------------------------------IGAGSVEKIG--DAEVYN--
A0A374GB66      ----------------------------------------IGAGSVEKIG--DAEVYN--
A0A374ECC6      ----------------------------------------IGAGSVEKIG--DAEVYN--
A0A374BM61      ----------------------------------------IGAGSVEKIG--DAEVYN--
A0A373UGZ4      ----------------------------------------IGAGSVEKIG--DAEVYN--
A0A373SA66      ----------------------------------------IGAGSVEKIG--DAEVYN--
A0A1C5X6X7      ----------------------------------------IGAGSVEKIG--DAEVYN--
A0A1C6JIH3      ----------------------------------------IGAGSVEKIG--DAEVYN--
A0A373PSC3      ----------------------------------------IGAGSVEKIG--DAEVYN--
A0A1K1WYK8      ----------------------------------------VGVGSINTIG--KAKVYK--
A0A1H6IUB1      ----------------------------------------VGVGSINTID--RAKVYN--
A0A1M7L1F9      ----------------------------------------VGVGSINTID--VAKVYN--
A0A1C6B4L6      ----------------------------------------VGVGSINTID--KAKVYE--
A0A1Q6T9P4      ----------------------------------------VGVGSINTID--KAKVYE--
A0A315Y4F9      ----------------------------------------VGVGSINTID--TAKVYN--
A0A354K620      ----------------------------------------VGVGSINTID--TAKVYK--
A0A355G3J9      ----------------------------------------VKAASVEIIE--EPKLPT--
A0A3D2AD87      ----------------------------------------VDKNIRVSTT--NADSTS--
A0A143XN92      ----------------------------------------VSNVILEVLE--EPQIPM--
A0A173ZYY6      ----------------------------------------VGSAVMDVLE--EPKVPY--
A0A6L8RXB5      ----------------------------------------VGSAVMDVLE--EPKVPY--
A0A6N9JW85      ----------------------------------------VGSAVMDVLE--EPKIPY--
A0A173SMI2      ----------------------------------------VGSAVMDVLE--EPKVPY--
A0A174ASH7      ----------------------------------------VGSAVMDVLE--EPKIPY--
A6BH65          ----------------------------------------VGSAVMDVLE--EPKIPY--
R7G0D7          ----------------------------------------VGSAVMDVLE--EPKIPY--
A0A2T5IYJ6      SLELSKKEFKFKELQREVETNRNLYDTFFARIKQANDSLELDTANARVID--KAVVPN--
A0A3C0QME1      ----------------------------------------VGAGSVEVID--VAESVY--
A0A355FYK5      ----------------------------------------ASTINVRLIN--YPSSPA--
A0A357AQU0      ----------------------------------------VGAGSVEIIG--AAVPAT--
A0A3C1YJQ7      ----------------------------------------VGAGSVEIIG--AAVPAT--
A0A3D0JG38      ----------------------------------------VGAGSVEIIG--AAVPAT--
A0A3C0IHX1      ----------------------------------------IGAGSVEVIG--DAEIPQ--
R5V506          ----------------------------------------IGAGSVEVIG--DAEIPQ--
A0A352TIU5      ----------------------------------------IGAGSVEVIG--DAEVPQ--
A0A3E5FSY5      ----------------------------------------LGQIQFHMIN--NPQLPT--
A0A1V5S3C0      ----------------------------------------FPNAKYTVVN--DATEPN--
A0A1Y3TC98      ----------------------------------------LGDIQFNMLD--GPETPA--
A0A1Q6REE0      ----------------------------------------VGSTVLVLLD--ESGMPT--
R5ETF9          ----------------------------------------VGSTVLVLLD--ESGMPT--
R6VAT5          ----------------------------------------VGATDLVLVV--PPSASS--
A0A1Q6S448      ----------------------------------------SSSAVLTQLN--APSLSV--
A0A351MYR0      ----------------------------------------SSTAVLSQLN--SPSLSV--
R6HPC1          ----------------------------------------SSTAVLSQLN--APTLSV--
A0A3D4G5Z5      ----------------------------------------SSTAVLSQLN--APTLSV--
A0A3D5ES03      ----------------------------------------SSTAVLSQLN--APTLSV--
A0A0F2P7X6      ----------------------------------------VEVGSINVLD--NAKVPE--
A0A359B487      ----------------------------------------VEVGSINVLD--NAKVPE--
A0A348P5V4      ----------------------------------------FPNTALTVID--PPLKAE--
A0A356PT74      ----------------------------------------FPSTTLTVID--PPLLAS--
A0A3D5LL19      ----------------------------------------FPSTTLTVID--PPLLAS--
R5MNF0          ----------------------------------------FPSTTLTVID--PPLLAS--
A0A1Q9JSI0      ----------------------------------------MGNVVLDVLQ--NPTVPS--
A0A3D5TNI1      ----------------------------------------SGGSI-HLCD--MPELPT--
A0A358LJD0      ----------------------------------------SGGSI-HLCD--EPELPT--
R6I3L7          ----------------------------------------SGGSI-HLCD--EPELPT--
A0A3D1HXX0      ----------------------------------------SGGSI-HLCD--EPELPT--
A0A3D2QJB8      ----------------------------------------SGGSI-HLCD--EPELPT--
D4LC36          ----------------------------------------VGAGSVEKIG--DAKIYE--
R7MQJ4          ----------------------------------------VGAGSVEAIG--TAKVNN--
A0A1V5GLC0      ----------------------------------------IGVGQINYID--TAKVYP--
W7V182          ----------------------------------------VGVGQINTIG--TAEVYN--
                                                                            

S3FFL2          ------------------------------------------------------------
A0A328M4V1      ------------------------------------------------------------
A0A6A8IF17      ------------------------------------------------------------
A0A3D5R4X5      ------------------------------------------------------------
A0A1I4C3N6      ------------------------------------------------------------
A0A3B9CIM7      ------------------------------------------------------------
A0A1G9WHW8      ------------------------------------------------------------
A0A1H5VAA0      ------------------------------------------------------------
A0A3R6VK11      ------------------------------------------------------------
A0A3R6QUY7      ------------------------------------------------------------
A0A373K3P9      ------------------------------------------------------------
A0A3R6JRU5      ------------------------------------------------------------
A0A1C5MS04      ------------------------------------------------------------
A0A3C1J150      ------------------------------------------------------------
A0A416CXD7      ------------------------------------------------------------
A0A6N2X662      ------------------------------------------------------------
R6XBL9          ------------------------------------------------------------
A0A355W5Z7      ------------------------------------------------------------
A0A143WVN6      ------------------------------------------------------------
W6RXP9          ------------------------------------------------------------
W6S4G8          ------------------------------------------------------------
A0A1G6BLB6      ------------------------------------------------------------
A0A1C6G8M0      ------------------------------------------------------------
A0A416MP73      ------------------------------------------------------------
A0A3E4LL92      ------------------------------------------------------------
A0A415D1L1      ------------------------------------------------------------
A0A0H5SF45      ------------------------------------------------------------
A0A1M6JRJ5      ------------------------------------------------------------
A0A1M7Y1S2      ------------------------------------------------------------
A0A7I8DMN1      ------------------------------------------------------------
A0A396G6S7      ------------------------------------------------------------
A0A3E5A223      ------------------------------------------------------------
R7D5E6          ------------------------------------------------------------
A0A415HQH5      ------------------------------------------------------------
A0A414W2C6      ------------------------------------------------------------
A5ZNE7          ------------------------------------------------------------
A0A395X821      ------------------------------------------------------------
A0A1C5PY68      ------------------------------------------------------------
A0A174CJF8      ------------------------------------------------------------
A0A564SRR2      ------------------------------------------------------------
A0A174R7V0      ------------------------------------------------------------
A0A373MWV2      ------------------------------------------------------------
A0A417CE88      ------------------------------------------------------------
A0A416Y441      ------------------------------------------------------------
A0A357GPJ7      ------------------------------------------------------------
A0A396PAC1      ------------------------------------------------------------
A0A416EYU4      ------------------------------------------------------------
A0A416SCQ2      ------------------------------------------------------------
A0A416TGN7      ------------------------------------------------------------
A0A417SMF6      ------------------------------------------------------------
A0A1Y4MW77      ------------------------------------------------------------
R6UHV6          ------------------------------------------------------------
A0A3R9Q621      ------------------------------------------------------------
A0A069RC75      ------------------------------------------------------------
A0A6S6R676      ------------------------------------------------------------
A0A174F2W5      ------------------------------------------------------------
A0A174S8E9      ------------------------------------------------------------
A0A416ZL97      ------------------------------------------------------------
A0A174LSK1      ------------------------------------------------------------
A0A373GY92      ------------------------------------------------------------
A0A373NZQ6      ------------------------------------------------------------
A0A417I9B9      ------------------------------------------------------------
A0A417MP97      ------------------------------------------------------------
A0A417WQF8      ------------------------------------------------------------
A0A373RZ83      ------------------------------------------------------------
A0A416U6I1      ------------------------------------------------------------
R7JQZ9          ------------------------------------------------------------
A0A7C6SMH0      ------------------------------------------------------------
A0A3B8KKL6      ------------------------------------------------------------
A0A2K9E6R0      ------------------------------------------------------------
A0A2S8RBI0      ------------------------------------------------------------
A0A0L6JLG6      ------------------------------------------------------------
G8LSN0          ------------------------------------------------------------
A0A1M5UYN6      ------------------------------------------------------------
A0A176JBT8      ------------------------------------------------------------
A0A1I5HIC6      ------------------------------------------------------------
A0A1Y3TC51      ------------------------------------------------------------
A0A1Y3T1N0      ------------------------------------------------------------
A0A1Y3Y8U8      ------------------------------------------------------------
A0A5B0BQY5      ------------------------------------------------------------
A6CLL4          ------------------------------------------------------------
A0A176U8D6      ------------------------------------------------------------
A0A1Q6KSQ5      ------------------------------------------------------------
A0A3D3U8B3      ------------------------------------------------------------
A0A3E5FRL7      ------------------------------------------------------------
A0A1Y4QK93      ------------------------------------------------------------
B1C232          ------------------------------------------------------------
A0A401USI6      ------------------------------------------------------------
A0A1V4IQ10      ------------------------------------------------------------
A0A1S8TRD2      ------------------------------------------------------------
G7M1U2          ------------------------------------------------------------
A0A2T6KJ75      ------------------------------------------------------------
A9KN92          ------------------------------------------------------------
A0A352MUJ1      ------------------------------------------------------------
R5YI67          ------------------------------------------------------------
A0A174DL89      ------------------------------------------------------------
A0A1Y0IQP5      ------------------------------------------------------------
A0A4R2R7B1      ------------------------------------------------------------
A0A1M6E8I2      ------------------------------------------------------------
A0A1Y4N105      ------------------------------------------------------------
A0A1Y4QP75      ------------------------------------------------------------
A0A3D4QRB5      ------------------------------------------------------------
A0A349DEH5      ------------------------------------------------------------
A0A3D4T7B4      ------------------------------------------------------------
A0A350XYC7      ------------------------------------------------------------
R6DNR8          ------------------------------------------------------------
A0A355KUM5      ------------------------------------------------------------
R5YGY6          ------------------------------------------------------------
A0A0K8J554      ------------------------------------------------------------
A0A1I0RG99      ------------------------------------------------------------
A0A1I5G322      ------------------------------------------------------------
A0A7C6IYW8      ------------------------------------------------------------
A0A3N1XSX6      ------------------------------------------------------------
A0A7C6JZF1      ------------------------------------------------------------
A0A7G9WCY6      ------------------------------------------------------------
A0A1C6G0U3      ------------------------------------------------------------
A0A3D4LLB3      ------------------------------------------------------------
A0A0A5GPA9      ------------------------------------------------------------
A0A271M6M4      ------------------------------------------------------------
A0A7C7AD93      ------------------------------------------------------------
A0A2V3W8U6      ------------------------------------------------------------
A0A6N3BXA1      ------------------------------------------------------------
A0A351SRI8      ------------------------------------------------------------
A0A1V5LU59      ------------------------------------------------------------
A0A1E3BVC3      ------------------------------------------------------------
A0A4Q0I6S0      ------------------------------------------------------------
A3DF66          ------------------------------------------------------------
W4V1T8          ------------------------------------------------------------
A0A1C6ITD7      ------------------------------------------------------------
A0A381IX63      ------------------------------------------------------------
A0A1G9IUT4      ------------------------------------------------------------
A0A1M6RWV2      ------------------------------------------------------------
A0A143XPI5      ------------------------------------------------------------
A0A355G1X5      ------------------------------------------------------------
A0A0M6WXE3      ------------------------------------------------------------
A0A348SAK2      ------------------------------------------------------------
A0A1G9H5B9      ------------------------------------------------------------
R5EFZ0          ------------------------------------------------------------
A0A1Y4H8L0      ------------------------------------------------------------
A0A4B9BMD9      ALLEKRQTLEQERKRLNKRVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQQELSISKSS
A0A0M6WYQ8      ------------------------------------------------------------
A0A348SAK1      ------------------------------------------------------------
A0A252F281      ------------------------------------------------------------
A0A1Y4QKE6      ------------------------------------------------------------
B1C231          ------------------------------------------------------------
A0A1Y3TUL5      ------------------------------------------------------------
A0A1Y4JAX2      ------------------------------------------------------------
A0A1Y4T590      ------------------------------------------------------------
R5B467          ------------------------------------------------------------
A0A1Y3T163      ------------------------------------------------------------
A0A1Y3YCA2      ------------------------------------------------------------
A0A1Y4L6N9      ------------------------------------------------------------
A0A173T644      ------------------------------------------------------------
A0A1C5TSB8      ------------------------------------------------------------
C0CIK6          ------------------------------------------------------------
A0A1Y3WEF6      ------------------------------------------------------------
A0A417T0L2      ------------------------------------------------------------
A0A1H9EPU3      ------------------------------------------------------------
A0A354IGV3      ------------------------------------------------------------
A0A417JMV2      ------------------------------------------------------------
A0A415VWX5      ------------------------------------------------------------
A0A173UY96      ------------------------------------------------------------
B0P408          ------------------------------------------------------------
D4MV82          ------------------------------------------------------------
A0A173QTL1      ------------------------------------------------------------
A0A174J359      ------------------------------------------------------------
A0A174A3T7      ------------------------------------------------------------
A0A417UUA3      ------------------------------------------------------------
A0A6N2VB70      ------------------------------------------------------------
A0A1C6EUV9      ------------------------------------------------------------
A0A173Y645      ------------------------------------------------------------
A0A374AVY6      ------------------------------------------------------------
R7BXS4          ------------------------------------------------------------
A0A143ZUX1      ------------------------------------------------------------
A0A1W1Z4C3      ------------------------------------------------------------
A0A239QN83      ------------------------------------------------------------
A0A3R9WAA7      ------------------------------------------------------------
A0A1G6BLF1      ------------------------------------------------------------
R6HZX3          ------------------------------------------------------------
A0A1W2CEA6      ------------------------------------------------------------
R7FFK6          ------------------------------------------------------------
A0A373MPB9      ------------------------------------------------------------
A0A373L519      ------------------------------------------------------------
A0A373W906      ------------------------------------------------------------
A0A373VCW2      ------------------------------------------------------------
W0U604          ------------------------------------------------------------
A0A374B6G0      ------------------------------------------------------------
A0A373VM36      ------------------------------------------------------------
A0A1C5P379      ------------------------------------------------------------
A0A373XXX0      ------------------------------------------------------------
A0A5R9MJM9      ------------------------------------------------------------
A0A356CW82      ------------------------------------------------------------
R6T4X7          ------------------------------------------------------------
A0A374HTV1      ------------------------------------------------------------
A0A374GB66      ------------------------------------------------------------
A0A374ECC6      ------------------------------------------------------------
A0A374BM61      ------------------------------------------------------------
A0A373UGZ4      ------------------------------------------------------------
A0A373SA66      ------------------------------------------------------------
A0A1C5X6X7      ------------------------------------------------------------
A0A1C6JIH3      ------------------------------------------------------------
A0A373PSC3      ------------------------------------------------------------
A0A1K1WYK8      ------------------------------------------------------------
A0A1H6IUB1      ------------------------------------------------------------
A0A1M7L1F9      ------------------------------------------------------------
A0A1C6B4L6      ------------------------------------------------------------
A0A1Q6T9P4      ------------------------------------------------------------
A0A315Y4F9      ------------------------------------------------------------
A0A354K620      ------------------------------------------------------------
A0A355G3J9      ------------------------------------------------------------
A0A3D2AD87      ------------------------------------------------------------
A0A143XN92      ------------------------------------------------------------
A0A173ZYY6      ------------------------------------------------------------
A0A6L8RXB5      ------------------------------------------------------------
A0A6N9JW85      ------------------------------------------------------------
A0A173SMI2      ------------------------------------------------------------
A0A174ASH7      ------------------------------------------------------------
A6BH65          ------------------------------------------------------------
R7G0D7          ------------------------------------------------------------
A0A2T5IYJ6      ------------------------------------------------------------
A0A3C0QME1      ------------------------------------------------------------
A0A355FYK5      ------------------------------------------------------------
A0A357AQU0      ------------------------------------------------------------
A0A3C1YJQ7      ------------------------------------------------------------
A0A3D0JG38      ------------------------------------------------------------
A0A3C0IHX1      ------------------------------------------------------------
R5V506          ------------------------------------------------------------
A0A352TIU5      ------------------------------------------------------------
A0A3E5FSY5      ------------------------------------------------------------
A0A1V5S3C0      ------------------------------------------------------------
A0A1Y3TC98      ------------------------------------------------------------
A0A1Q6REE0      ------------------------------------------------------------
R5ETF9          ------------------------------------------------------------
R6VAT5          ------------------------------------------------------------
A0A1Q6S448      ------------------------------------------------------------
A0A351MYR0      ------------------------------------------------------------
R6HPC1          ------------------------------------------------------------
A0A3D4G5Z5      ------------------------------------------------------------
A0A3D5ES03      ------------------------------------------------------------
A0A0F2P7X6      ------------------------------------------------------------
A0A359B487      ------------------------------------------------------------
A0A348P5V4      ------------------------------------------------------------
A0A356PT74      ------------------------------------------------------------
A0A3D5LL19      ------------------------------------------------------------
R5MNF0          ------------------------------------------------------------
A0A1Q9JSI0      ------------------------------------------------------------
A0A3D5TNI1      ------------------------------------------------------------
A0A358LJD0      ------------------------------------------------------------
R6I3L7          ------------------------------------------------------------
A0A3D1HXX0      ------------------------------------------------------------
A0A3D2QJB8      ------------------------------------------------------------
D4LC36          ------------------------------------------------------------
R7MQJ4          ------------------------------------------------------------
A0A1V5GLC0      ------------------------------------------------------------
W7V182          ------------------------------------------------------------
                                                                            

S3FFL2          ------------Q--------KPSRPRLLLNLAIAL--FVGLGLGVLVAFALEQMDEAIA
A0A328M4V1      ------------A--------KPVWPRKLLLVFGAT--VFGGLLAVGFVFLRQLLNRGVE
A0A6A8IF17      ------------M--------LPTSPVHKNIFMVAF--ALGLLIPIVIIFMRENMNTRVR
A0A3D5R4X5      ------------S---PI---KPNKMMNIA--IAGV--LGLMLSVGLVFLIE-FLDKTIK
A0A1I4C3N6      ------------E---PY---ESTSTILFA--LIGA--VGFGVMSAVGFLFFGLQDTRIR
A0A3B9CIM7      ------------V---PY---QSTSVLKYA--VLGA--AAGFLLAAAWFLLRSMLDTTVR
A0A1G9WHW8      ------------S---PY---QQTNVPFTA--ILGF--FFGAILAFIFFILKGLLNTTIR
A0A1H5VAA0      ------------S---PY---QQTNVPFTA--ILGF--FFGAILAFIFFILKGLLNTTIR
A0A3R6VK11      ------------A---PY---SSTSLVKYA--LVGF--AGCFGASFVLFLLAGLMDTTIR
A0A3R6QUY7      ------------A---PY---SSTSLVKYA--LVGF--VGCFGASFVLFLLAGLMDTTIR
A0A373K3P9      ------------A---PY---SSTSLVKYA--LVGF--AGCFGASFVLFLLAGLMDTTIR
A0A3R6JRU5      ------------A---PY---SSTSLVKYA--LVGF--AGCFGASFVLFLLAGLMDTTIR
A0A1C5MS04      ------------A---PY---SSTSLVKYA--LVGF--AGCFGASFVLFLLAGLMDTTIR
A0A3C1J150      ------------A---PY---SSTSLVKYA--LVGF--AGCFGASFVLFLLAGLMDTTIR
A0A416CXD7      ------------A---PY---SSTSLVKYA--LVGF--AGCFGASFVLFLLAGLMDTTIR
A0A6N2X662      ------------A---PY---SSTSLVNYA--LVGF--AGCFGASFVLFLLAGLMDTTIR
R6XBL9          ------------A---PY---SSTSLVKYA--LVGF--AGCFGASFVLFLLAGLMDTTIR
A0A355W5Z7      ------------A---PY---SSTSLVKYA--LVGF--AGCFGASFVLFLLAGLMDTTIR
A0A143WVN6      ------------G---PS---NYVNYLRIQ--RMAT--LAAGGLTAAVIVLVSILRPTVK
W6RXP9          ------------D---PV---APNKVMNI---AIAF--LLGLMVGVGLTFLLEYLDNTFK
W6S4G8          ------------A---PI---SPNKKMNI---ILGF--LIGLVSGMAIVFLIEYMNNTYK
A0A1G6BLB6      ------------Q---PD---AAFAPANAM--VKMF--IIVFCLMLVIVAFGSTFQDAIR
A0A1C6G8M0      ------------A---EN---TRRSVVSYI--LIGL--MAGIVVSCGVIAISVITNTSIK
A0A416MP73      ------------A---EN---TRRSVLSYA--LIGI--LAGIVIACGIVAVSVITNTSIK
A0A3E4LL92      ------------V---QR---TEKATVKYS--ALLI--LLVLAGGVGATVCLCIFTDKIH
A0A415D1L1      ------------V---QK---TEKATLRYS--LLLI--LLVLAGGIGATVYLCIFTDKIH
A0A0H5SF45      ------------G---PS---GPNIYLNT---ILGA--VAGLVLAIAISFFWELIDVKIK
A0A1M6JRJ5      ------------S---PS---GPNTILNT---LLGG--IICGFMAFFLSMVKEVLNLKVV
A0A1M7Y1S2      ------------S---PS---GPNILLNT---LLGG--IVCGFLAFFLFVLKEILNLKVI
A0A7I8DMN1      ------------A---PT---GPNILLNT---LLGG--ISFGLLSFFVFVLKEVMNLKVA
A0A396G6S7      ------------A---PI---NPLDEKRTV--MKVF--AVAAGCLIALLAGISYIRDTIK
A0A3E5A223      ------------A---PI---NPLDEKRTV--MKVF--AVAAGCLIALLAGISYIRDTIK
R7D5E6          ------------A---PI---NPLDEKRTV--MKVF--AVAAGCLIALLAGISYIRDTIK
A0A415HQH5      ------------A---PI---NPLDEKRTV--MKVF--AVAAGCLIALLAGISYIRDTIK
A0A414W2C6      ------------A---PI---NPLDEKRTV--MKVF--VVAAGCLIALLAGISYIRDTIK
A5ZNE7          ------------A---PI---NPLDEKRTV--MKVF--AVAAGCLIALLAGISYIRDTIK
A0A395X821      ------------A---PI---NPLDEKRTV--MKVF--AVAAGCLIALLAGISYIRDTIK
A0A1C5PY68      ------------A---PI---NPLDEKRTV--MKVF--VVTAGCLIVLLAGISYIRDTIK
A0A174CJF8      ------------A---PI---NPLDEKRTV--MKVF--VVAAGCLIALLAGISYIRDTIK
A0A564SRR2      ------------A---PI---NPLDEKRTV--MKVF--VVAAGCLIALLAGISYIRDTIK
A0A174R7V0      ------------A---PI---NPLDEKRTV--MKVF--VVAAGCLIALLAGISYIRDTIK
A0A373MWV2      ------------N---PS---NRIPTEKYA--AMAF--LAAALGTAALVGFFSFLRDTVK
A0A417CE88      ------------N---PS---NRIPTEKYA--AMAF--LAAALGTAALVGFFSFLRDTVK
A0A416Y441      ------------N---PS---NRIPTEKYA--AMAF--LAAALGTAALVGFFSFLRDTVK
A0A357GPJ7      ------------N---PS---NRIPTEKYA--AMAF--LAAALGTAALVGFFSFLRDTVK
A0A396PAC1      ------------N---PS---NRIPTEKYA--AMAF--LAAALGTAALVGFFSFLRDTVK
A0A416EYU4      ------------N---PS---NRIPTEKYA--AMAF--LAAALGTAALVGFFSFLRDTVK
A0A416SCQ2      ------------N---PS---NRIPTEKYA--AMAF--LAAALGTAALVGFFSFLRDTVK
A0A416TGN7      ------------N---PS---NRIPTEKYA--AMAF--LAAALGTAALVGFFSFLRDTVK
A0A417SMF6      ------------N---PS---NRIPTEKYA--AMAF--LAAALGTAALVGFFSFLRDTVK
A0A1Y4MW77      ------------V---PY---NQLNYFNTV--AKGA--LIGLAVGLVIIAIYAFFRKTVH
R6UHV6          ------------E---PT---NPSNALKLA--VIGF--FAGAAAVVLIISVLSFYKDTVK
A0A3R9Q621      ------------Q---PS---GPHVLLNT---AIGG--LMGFVLSVLLVFIWELIDVNVK
A0A069RC75      ------------V---PS---KPDKILNM---AAGV--FFGIMGGLLVVYVLEYFDNAVR
A0A6S6R676      ------------S---PS---EPNILLNA---LIGG--FLGFIISVAASFIWEIIDVNVK
A0A174F2W5      ------------N---PS---NRIPTEKYA--AMAF--LAAALGTAALVGFFSFLRDTVK
A0A174S8E9      ------------N---PS---NRIPTEKYA--AMAF--LAAALGTAALVGFFSFLRDTVK
A0A416ZL97      ------------V---PS---NQIPTKKYA--ATAF--LAAALAMAALIGLFSFLRDTVK
A0A174LSK1      ------------V---PS---NQIPTKKYA--ATAF--LAAALAMAALIGLFSFLRDTVK
A0A373GY92      ------------V---PS---NQIPTKKYA--ATAF--LAAALAMAALIGLFSFLRDTVK
A0A373NZQ6      ------------V---PS---NQIPTKKYA--ATAF--LAAALAMAALIGLFSFLRDTVK
A0A417I9B9      ------------V---PS---NQIPTKKYA--ATAF--LAAALAMAALIGLFSFLRDTVK
A0A417MP97      ------------V---PS---NQIPTKKYA--ATAF--LAAALAMAALIGLFSFLRDTVK
A0A417WQF8      ------------V---PS---NQIPTKKYA--ATAF--LAAALAMAALIGLFSFLRDTVK
A0A373RZ83      ------------V---PS---NQIPTKKYA--ATAF--LAAALAMAALIGLFSFLRDTVK
A0A416U6I1      ------------V---PS---NQIPTKKYA--ATAF--LAAALAMAALIGLFSFLRDTVK
R7JQZ9          ------------V---PS---NQIPTKKYA--ATAF--LAAALAMAALIGLFSFLRDTVK
A0A7C6SMH0      ------------S---PV---KPNKKTNV---GIAG--MLGLMLGVGLILLLEFVDHTFK
A0A3B8KKL6      ------------S---PV---KPNKKMNV---AVAG--LLGIVLGVGLILVLEFVDHTFK
A0A2K9E6R0      ------------S---PV---KPNKKMNV---AVAG--LLGIVLGVGLILVLEFVDHTFK
A0A2S8RBI0      ------------S---PV---KPNKKMNV---AVAG--LLGIVLGVGLILVLEFVDHTFK
A0A0L6JLG6      ------------D---PV---KPNKKMNV---GLAG--FLGILLGVSLIYLLEFIDHTFK
G8LSN0          ------------R---PV---GPSAKKNV---GIAG--ILGLALAAGLIYLLEIMDYTFK
A0A1M5UYN6      ------------D---SV---NKIKII-----LYSF--ILGLLISITLVFLLDFLDNTIK
A0A176JBT8      ------------S---TS---KPILLFNL---LLSF--AAGLILATIFVLIKELKNKKFE
A0A1I5HIC6      ------------F---PT---SPSIIKNA---ILGS--LAGAFISTFIIILIHIIDDTVK
A0A1Y3TC51      ------------A---PS---NTSAAMRYR--YPLM--AAGAAGMAALICLLYVMRFTVK
A0A1Y3T1N0      ------------S---PS---NTSWIMARR--NLLT--AAGMLAMAAVICLFYLLRFTVK
A0A1Y3Y8U8      ------------S---PS---NTSWIMARR--NLLA--AAGMLAMAAVICLFYLLRFTVK
A0A5B0BQY5      ------------D-TKMI---KPFTFYYL---IVSL--GIGFLISIAVVLIGEVYFTRLN
A6CLL4          ------------S-TTPV---KPSLILSA---GISF--TIGIFLAILIVFIREAFFTKLN
A0A176U8D6      ------------T---EN---TRHSILFYS--VIGV--VVGLFLACGIIALMVITNVSVK
A0A1Q6KSQ5      ------------A---EN---TRRSVVSYI--LIGL--MAGIVVSCGVIAISVITNTSIK
A0A3D3U8B3      ------------A---EN---TRRSVVSYI--LIGL--MAGIVVSCGVIAISVITNTSIK
A0A3E5FRL7      ------------T---PS---NSSKLINYR--NYIA--LLGGVAVTGIIICLYLFRHTLK
A0A1Y4QK93      ------------T---PS---NSSRLINYR--NYIA--LLGGIAVTGIIACLYLFRHTLK
B1C232          ------------T---PS---NSSRLINYR--NYIA--LLGGVAVAGIIVCLYLFRHTLK
A0A401USI6      ------------L---PI---TPKKKFNI---SIGF--IIGLILSLGLVLLINYLNNTIK
A0A1V4IQ10      ------------T---LT---SSKKKMYV---AIGF--MLGLMISIGIIFLIELLDYTFK
A0A1S8TRD2      ------------T---LT---SSKKRMYV---AIGF--IIGLMLSLGIIFLIEFLDYTFK
G7M1U2          ------------T---LT---SSKKRMYV---AIGF--IIGLMLSFGIIFLIEFLDYTFK
A0A2T6KJ75      ------------D-TKSV---KPITALFF---IISA--IIGFLASYSFILIQEMFFTLVD
A9KN92          ------------I---PT---SPHIMKNT---ILSG--IIGALISAFVIIFIHIIDDSIK
A0A352MUJ1      ------------S---PS---NINPVKYA---GIFA--VVGFVISVGVILVLNLFDSTVK
R5YI67          ------------A---PS---NINPVKYA---GVFA--VVGFALSIGVILILNLFDSTVK
A0A174DL89      ------------K---PT---KPNIIINI---SLSF--ILGLIFSISLVVLINYLDQRIK
A0A1Y0IQP5      ------------DVQQPV---RPKPFLNM---AAAL--VLGAMAGAGLAFLLEFLNNTVK
A0A4R2R7B1      ------------DVLEPV---RPKPYLNM---AVAL--VLGAMAGAGLALLLAFLNNTVQ
A0A1M6E8I2      ------------H---PV---NINLKFNG---AIGF--IVGIMTGLSIILMLEMLDGTIK
A0A1Y4N105      ------------S---AS---NPLNYSRIQ--KLGT--LASGVVMIGIIALLSIFRQTVK
A0A1Y4QP75      ------------S---AS---NPLNYSRIQ--KLGT--LASGVVMIGIIALLSIFRQTVK
A0A3D4QRB5      ------------I---PI---RPTTVRNC---IIAA--FLGLMVGLGIIFLIEYLDNTIK
A0A349DEH5      ------------Y---PN---STKSAVSLA--AIVG--FIGAVATCIIMFIIFLVKDTAK
A0A3D4T7B4      ------------Y---PN---STKSAVSLA--AIVG--FIGAVAPCIIMFIIFLVKDTAK
A0A350XYC7      ------------A---PN---SNRSVFSLA--LMVG--FVAAVATCVVFFIMFLVKDTAK
R6DNR8          ------------A---PN---SNRSVVSLA--LMVG--FISAIACCVVFFIMFLVKDTAK
A0A355KUM5      ------------Y---PN---SNRSVVSLA--LMVG--FIAAVASCVVFFIMFLVKDTAK
R5YGY6          ------------Y---PN---SNRSVVSLA--LMIG--FIAAVASCVVFFIMFLVKDTAK
A0A0K8J554      ------------G---PS---GPNILLNT---MIGA--LAGFFLAFTFAFLWELIDVKVK
A0A1I0RG99      ------------S---PS---SPNILKNT---LVGG--MFGFVLSIAVSLLLVLFDLNVK
A0A1I5G322      ------------S---PS---SPNIFKNT---LIGG--MITFIITILISLLGEVMDVNVK
A0A7C6IYW8      ------------K---PS---GPNIIKNT---LVGG--MLGLIASVFIILLVEILDTNIK
A0A3N1XSX6      ------------K---PS---SPNILKNT---LIGG--MLGLVLSIIFSFLWEIFDVNIK
A0A7C6JZF1      ------------S---PS---GPNILLNT---LVGG--ILGLLLSVMASFLWEAFNVKIK
A0A7G9WCY6      ------------S---PV---KPRPALNV---AIAF--LLGAMLGVGIVFLMEFLDNTLK
A0A1C6G0U3      ------------K---PI---KPRKLINI---AIAS--IIGILISIAFAFILDYLDSKIK
A0A3D4LLB3      ------------A---PV---KPDIIMNT---AIAG--ILGAMVILLILFLKEYFDSTAK
A0A0A5GPA9      ------------H-ETPI---KPNLLMNT---ILSL--LLGLFLALLLVFLKEVIFTRAD
A0A271M6M4      ------------K-GRPV---KPDPVIYM---VIFL--CIGVFLSFIIIFLKETIFTKFD
A0A7C7AD93      ----------------PY---QYEVLSDSFFYTVSI--ICGAITALFVVLVIELFDSTIK
A0A2V3W8U6      ------------H-KTPI---SPKLFFNT---VISF--IIGFLFACTYAFLSAYFNTKIS
A0A6N3BXA1      ------------K---HI---RPRKTVNT---IIAT--LIGIILAITVILLREILDKTIK
A0A351SRI8      ------------E---PY---NVHVLKQI---VLGT--GLGFVLSSIIIAICFYFDDTVK
A0A1V5LU59      ------------T---PI---SPNKKKNV---ALAG--IIGLALGAGLIYLLEMIDYTFK
A0A1E3BVC3      ------------N---PI---KPNKKMNV---GAAG--LFGLVLGVGLIFLLELIDHTFK
A0A4Q0I6S0      ------------N---PI---KPNKKMNV---GAAG--LFGLVLGVGLIFLLELIDHTFK
A3DF66          ------------N---PI---KPNKKMNI---CVAG--LFGLVLGIGLIFLLELIDHTFK
W4V1T8          ------------N---PI---KPNKKMNV---GAAG--LLGLVLGVGLIFLLELIDHTFK
A0A1C6ITD7      ------------K---PS---KPNIILNI---GLSF--LLGLMLSICLVILIDYLDQRIK
A0A381IX63      ------------Q---PI---SPNKFRNL---ALGG--IIGVVIAIFVVLLLDYFDNKVK
A0A1G9IUT4      ------------K---PV---KPNKIMNT---MIGA--IIGLILGLIVTFVREYIDTKVK
A0A1M6RWV2      ------------N---PI---KPRPMLNI---AIAL--VLGLMIGIGLVFLLEYLDNSFK
A0A143XPI5      ------------E---PS---NQPNLKRMA--LNGC--LAGIVLSGILLAVYALTRNTIC
A0A355G1X5      ------------A---HD---PQLSLMRFA--AIGG--AIGFALAFIVILIVNAARDTLM
A0A0M6WXE3      ------------A---PV---NPPQNGEMA--KKGF--FLGMAVCILLFAIWSYMHNTVK
A0A348SAK2      ------------A---PV---NPPQNGEMA--KKGF--FLGMAVCILLFAIWSYMHNTVK
A0A1G9H5B9      ------------L---PN---EKKAVFSSL--KYGA--AAGAAFAVVLLALLYILNQKIT
R5EFZ0          ------------S---PT---NQNFAFHQM--KKAA--VIAALAATALLAILSYLRDAVR
A0A1Y4H8L0      ------------Y---PS---NPLNTSRAM--KLAF--LAAAAALAALFGLLSFFRDTVK
A0A4B9BMD9      AIGNVRIIDPAVT---QP---QPVKPKKAL--NVVLGFILGLFISVGAVLARAMLRRGVE
A0A0M6WYQ8      ------------D---TT---NQGVISSSW--KRGA--LKGAIIGLVILSLYVLTRRTVK
A0A348SAK1      ------------D---TT---KQGVISSSW--KRGA--LKGAIIGLVILSLYVLTRRTVK
A0A252F281      ------------A---PS---NAMSLRSRL--ILAG--ALGALAMLAVVILMSCLRDTVK
A0A1Y4QKE6      ------------S---PY---NKLTFTNTV--IVGG--IIGLVFGTVILGCMALFRKTVK
B1C231          ------------D---PY---NKLTFTNTV--LVGG--IIGLVSGTIILGCMALFRKTVK
A0A1Y3TUL5      ------------R---IG---GNVNASMWL--YMS---LLGLAVGIGFSFLKFLLLPTVV
A0A1Y4JAX2      ------------R---IG---GNVNASMWL--YMS---LLGLAVGIGFSFLKFLLLPTVV
A0A1Y4T590      ------------R---IG---GNVNASMWL--YMS---LLGLAVGIGFSFLKFLLLPTVV
R5B467          ------------Q---PS---NPFSWRHSL--VRGA--LIGAVLSLLVLYLSGRARATVM
A0A1Y3T163      ------------E---PF---NHIGLRRTL--ALGG--GAGALAGILILGLTALFRRTAR
A0A1Y3YCA2      ------------E---PF---NHIGLRRTL--ALGG--GAGALAGILILGLTALFRRTAR
A0A1Y4L6N9      ------------E---PF---NKPNYVRTT--VKGA--FLGVLAGLLLVVLYAFLKRTVQ
A0A173T644      ------------E---PY---NQPNFVKKA--VKGA--LLGAAAGIFLIVLYAFFRKTVQ
A0A1C5TSB8      ------------E---PY---NQPNFVKKA--VKGA--LLGAAAGIFLIVLYAFFRKTVQ
C0CIK6          ------------E---PY---NQPNFVKKA--VKGA--LLGAAAGIFLIVLYAFFRKTVQ
A0A1Y3WEF6      ------------E---PY---NRPSYLDQI--LKGA--LFGAGSGFLLICLCALFKKTVQ
A0A417T0L2      ------------E---PY---NRPSYRGQI--KKGA--VYGAGAGFLLICLYAFFKKTVQ
A0A1H9EPU3      ------------T---PT---SPSSPNVSR--NTLLGMLIGIFIACAIVVLRFMLDDSIK
A0A354IGV3      ------------Q---PS---NQIDSRDLI--RKTA--GICALIMIVLIALLTLVRDTIQ
A0A417JMV2      ------------G---PV---NKFQPTALM--KKTF--LMTIVALCGLIAILSFLKDTVR
A0A415VWX5      ------------G---PV---NKFQPTALM--KKTF--LMTIVALCGLIAILSFLKDTVR
A0A173UY96      ------------G---PV---NKFQPTALM--KKTF--FTTIVALCGLIAILSFLKDTVR
B0P408          ------------G---PV---NKFQPTALM--KKTF--FTTIVALCGLIAILSFLKDTVR
D4MV82          ------------G---PV---NKFQPTALM--KKTF--FTTIVALCGLIAILSFLKDTVR
A0A173QTL1      ------------G---PV---NKFQPTALM--KKTF--FTTIVALCGLIAILSFLKDTVR
A0A174J359      ------------G---PV---NKFQPTALM--KKTF--SMTIVALCGLIAILSFLKDTVR
A0A174A3T7      ------------G---PV---NKFQPTALM--KKTF--FTTIVALCGLIAILSFLKDTVR
A0A417UUA3      ------------G---PV---NKFQPTALM--KKTF--FTTIVALCGLIAILSFLKDTVR
A0A6N2VB70      ------------G---PV---NKFQPTALM--KKTF--FTTIVALCGLIAILSFLKDTVR
A0A1C6EUV9      ------------G---PV---NEFQPAALM--KKTF--VMTIIALCGLIAIVSFLKDTVR
A0A173Y645      ------------G---PV---NEFQPAALM--KKTF--VMTIVALCGLIAIISFLKDTVR
A0A374AVY6      ------------G---PV---NEFQPAALM--KKTF--VMTIVALCGLIAIISFLKDTVR
R7BXS4          ------------G---PV---NEFQPAALM--KKTF--VMTIVALCGLIAIISFLKDTVR
A0A143ZUX1      ------------G---PN---TDYKKILYP--AAGA--LLGLAVGLFLVWVLTRVSHTIQ
A0A1W1Z4C3      ------------F---AN----GRNDMKKG--IIGA--LIGAVIACALLTLLFLMNHRVE
A0A239QN83      ------------L---AN----GRADMKKG--FIGG--LAGAILACAFLTLLFMMNHQVE
A0A3R9WAA7      ------------F---PS---NPVDYRRLI--GSGA--AIGAAIALFFIVVYAFARKTIH
A0A1G6BLF1      ------------A---PS---NEDWSHGAA--KTGI--LIGFVIDILVLFVYSMTKRTIR
R6HZX3          ------------V---PV---NTFRGSRSA--AKGV--AAGLLLGLALTLLMAIGRKTVR
A0A1W2CEA6      ------------K---PI----YPNVNATI--AKGA--VLGGLGIMLIFLFIILLDDRIR
R7FFK6          ------------T---PV----SPNVTKNT--AIGF--AAGAMLAILVILVIDFFDNTIK
A0A373MPB9      ------------T---PV----SPNTTKNV--ALGF--VGGLMVAVLVILVIDFFDNTVK
A0A373L519      ------------T---PV----SPNTTKNV--ALGF--VGGLMVAVLVILVIDFFDNTVK
A0A373W906      ------------T---PV----SPNTTKNV--ALGF--VGGLMVAVLVILVIDFFDNTVK
A0A373VCW2      ------------T---PV----SPNTTKNV--ALGF--VGGLMVAVLVILVIDFFDNTVK
W0U604          ------------T---PV----SPNTTKNV--ALGF--VGGLMVAVLVILVIDFFDNTVK
A0A374B6G0      ------------S---PV----SPNTTKNV--ALGF--VGGLMVAVLVILVIDFFDNTVK
A0A373VM36      ------------T---PV----SPNTTKNV--ALGF--VGGLMVAVLVILVIDFFDNTVK
A0A1C5P379      ------------T---PV----SPNTTKNV--ALGF--VGGLMVAVLVILVIDFFDNTVK
A0A373XXX0      ------------T---PV----SPNTTKNV--ALGF--VGGLMVAVLVILVIDFFDNTVK
A0A5R9MJM9      ------------T---PV----SPNTTKNV--ALGF--VGGLMVAVLVILVIDFFDNTVK
A0A356CW82      ------------T---PV----SPNTTKNV--ALGF--VGGLMVAVLVILVIDFFDNTVK
R6T4X7          ------------T---PV----SPNTTKNV--ALGF--VGGLMVAVLVILVIDFFDNTVK
A0A374HTV1      ------------T---PV----SPNTTKNV--ALGF--VGGLMVAVLVILVIDFFDNTVK
A0A374GB66      ------------T---PV----SPNTTKNV--ALGF--VGGLMVAVLVILVIDFFDNTVK
A0A374ECC6      ------------T---PV----SPNTTKNV--ALGF--VGGLMVAVLVILVIDFFDNTVK
A0A374BM61      ------------T---PV----SPNTTKNV--ALGF--VGGLMVAVLVILVIDFFDNTVK
A0A373UGZ4      ------------T---PV----SPNTTKNV--ALGF--VGGLMVAVLVILVIDFFDNTVK
A0A373SA66      ------------T---PV----SPNTTKNV--ALGF--VGGLMVAVLVILVIDFFDNTVK
A0A1C5X6X7      ------------T---PV----SPNTTKNV--ALGF--VGGLMVAVLVILVIDFFDNTVK
A0A1C6JIH3      ------------T---PV----SPNTTKNV--ALGF--VGGLMVAVLVILVIDFFDNTVK
A0A373PSC3      ------------T---PV----SPNTTKNV--ALGF--VGGLMVAVLVILVIDFFDNTVK
A0A1K1WYK8      ------------K---PV----APNNTKNG--ILGM--AAAFLIVVMVILIIDYFDNTIK
A0A1H6IUB1      ------------S---PV----APNMKKNA--VLGA--MAALMLTCMIIFLIDFFDNTVK
A0A1M7L1F9      ------------N---PV----APNMKKNA--VLGA--MAALMLTCMIIFLVDFFDNTVR
A0A1C6B4L6      ------------T---PV----APNVIKNT--LLGM--AAALLIVVTIILITDYFDNTVK
A0A1Q6T9P4      ------------T---PV----APNVIKNT--LLGM--AAALLIVVTIILITDYFDNTVK
A0A315Y4F9      ------------T---PV----APNIMKNT--MIGA--VAGFMLIVLIIFLIDFFDNTIK
A0A354K620      ------------H---PV----APNTMKNT--ALGA--AAGFMLIVLIIFLIDFFDTTIK
A0A355G3J9      ------------E---DE---SEWPIVGNI--AIGF--ALGLVLSVAYVLLSNALDTTIY
A0A3D2AD87      ------------V---VY-----PRTVMST--AIAF--LVGAVLAFAISFIIDISDQSIR
A0A143XN92      ------------A---AS---NANQAEDIA--KKAF--WMSGTAVLALILFFSMKKDTIK
A0A173ZYY6      ------------T---PD---NPLDAGGQA--KKGG--LVAGALVIILLGLFSYMKNTIK
A0A6L8RXB5      ------------T---PD---NPLDAGGQA--KKGG--LVAGALVIILLGLFSYMKNTIK
A0A6N9JW85      ------------T---PD---NPLDAGRQA--KKGG--LVAGALVLILLGMFSYMKNTIK
A0A173SMI2      ------------T---PD---NPLDAGGQA--KKGG--LVAGALVLILLGLFSYMKNTIK
A0A174ASH7      ------------T---PD---NPLDAGGQA--KKGG--LVAGALVLILLGLFSYMKNTIK
A6BH65          ------------T---PD---NPLDAGRQA--KKGG--LVAGALVLILLGMFSYMKNTIK
R7G0D7          ------------T---PD---NPLDAGRQA--KKGG--LVAGALVLILLGMFSYMKNTIK
A0A2T5IYJ6      ------------A---PT----KPRKTLII--GISL--VLSLLFGAALAFLLDYLDSTFK
A0A3C0QME1      ------------K---PV----SPNKPKMA--LIGA--MAGLILAAFIVLMIDFFDNSVR
A0A355FYK5      ------------I---SN----SDNSVKIA--FLAF--MAGALLIALIVVLVEIFSDTIK
A0A357AQU0      ------------V---KS----GPSVSRYT--IMGF--LIGFILVAAAIVIRTITDNTFR
A0A3C1YJQ7      ------------V---KS----GPSVSRYT--IMGF--LIGFILVAAAIVIRTITDNTFR
A0A3D0JG38      ------------V---KS----GPSVSRYT--IMGF--LIGFILVAAAIVIRTITDNTFR
A0A3C0IHX1      ------------S---PS----APDVKKIT--MMAA--AAGFVLSAGVAVLIYLLDRTIK
R5V506          ------------S---PS----APDVKKIT--MMAA--AAGFVLSAGVAVLIYLLDRTIK
A0A352TIU5      ------------S---PS----APDVKKIT--MMAA--AAGFVLSAGVAVLIYMLDRTIK
A0A3E5FSY5      ------------D---PY---NKLTFTNTV--LVGG--IIGLVSGTIILGCMALFRKTVK
A0A1V5S3C0      ------------S---PD---ADYSGFLYT--FIGA--VSGAIVAFAIILISNRIKNLVQ
A0A1Y3TC98      ------------A---PF---NQMSVRRCL--LLGG--AGGAAVSLLIFLLMSLFWKAVC
A0A1Q6REE0      ------------A---PV---AEFNYRYYI--TCGA--VVGAAVWCVILAFLVLMKNTVH
R5ETF9          ------------A---PV---AEFNYRYYI--TCGA--VVGAAVWCVILAFLVLMKNTVH
R6VAT5          ------------T---PI---NPISYREKA--LIGT--AVGALLGLLIVFFLENLNHTVR
A0A1Q6S448      ------------S---AA---RSYNVPRTC--LIAA--AAGAALTAAAVVWAAVFSGTVQ
A0A351MYR0      ------------A---PS---RSYNVPRIC--LIAA--IAGAALTALGVAWASVSSGTVQ
R6HPC1          ------------A---PS---RSYNVPKIC--LLAG--VIGAGLTAAAVAWASVTSGTVQ
A0A3D4G5Z5      ------------A---PS---RSYNVPKIC--LLAG--VIGAGLTAAAVAWASVTSGTVQ
A0A3D5ES03      ------------A---PS---RSYNVPKIC--LLAG--VIGAGLTAAAVAWASVTSGTVQ
A0A0F2P7X6      ------------F---PN----APATFRNV--GVGA--VLGLMLGLGIVFMLMFFDRTIK
A0A359B487      ------------F---PN----APATFRNV--GVGA--VLGLMLGLGIVFMLMFFDRTIK
A0A348P5V4      ------------A---PN---GDNTKLLYP--MLGF--VLGFFAACLCIIVAVVFKDTIK
A0A356PT74      ------------A---PN---RDASARNYT--IVGF--AAGLVISIFAIVLAVIAKDTVK
A0A3D5LL19      ------------A---PN---RDASARNYT--IVGF--AAGLVISIFAIVLAVIAKDTVK
R5MNF0          ------------A---PN---RDASARNYT--IVGF--AAGLVISIFAIVLAVIAKDTVK
A0A1Q9JSI0      ------------G---PVNKFQPTALMKKT--FVYT--L--IFLCGLIGII-SFLKDTVR
A0A3D5TNI1      ------------E---PD---KSVGITRNA--IIGA--LAGAVICALIIIIRDSARNTVR
A0A358LJD0      ------------K---PD---KSVGTVRNT--IIGA--LAGAVICALIIIIRDSARNTVR
R6I3L7          ------------K---PD---KSVGTVRNA--IIGA--LAGAVICALIIIIRDSARNTVR
A0A3D1HXX0      ------------K---PD---KSVGTVRNA--IIGA--LAGAVICALIIIIRDSARNTVR
A0A3D2QJB8      ------------K---PD---KSVGTVRNA--IIGA--LAGAVICALIIIIRDSARNTVR
D4LC36          ------------A---AV----SPSVTKNT--AIGF--AGGALLAILVILLIDFFDNTVR
R7MQJ4          ------------N---PV----SPNFLKMA--VIGA--FAGMLLAALIILVIDFFDNTVK
A0A1V5GLC0      ------------N---PV----GPNIKKNT--ALGA--IAGAMLMALIILVIDFFDNTFK
W7V182          ------------S---PV----APNVKKNT--MLGL--MAAAMLAACIIVVIDFFDNTVK
                                                                            

S3FFL2          DPSEVERQFGLPLL----------GSVPKVTDGR----------------------SPRD
A0A328M4V1      DPAAIER-LGLPVY----------VSIPRSELQRERTLLRVRHRRTVGRQNLLAAGAPTD
A0A6A8IF17      GRKDLEN-LTIPFI----------GEIPLFTRKKKGIL----GKKPQEVKAVIVKEGNRD
A0A3D5R4X5      TPEDIERYLNLSII----------GAIPHNEKAE------------------------KR
A0A1I4C3N6      RKYEVEDMFNIPII----------GTVPLVESTD------------------------K-
A0A3B9CIM7      RKYEIEDLFTIPIL----------GDVPQMEPAA------------------------KG
A0A1G9WHW8      KKYEIEDMFTIPIL----------GDVPEIETEE------------------------AK
A0A1H5VAA0      KKYEIEDMFTIPIL----------GDVPEIETEE------------------------TK
A0A3R6VK11      RRYELKLAFRIPVL----------GDIPQIQASD------------------------RK
A0A3R6QUY7      RRYELKLAFRIPVL----------GDIPQIQAPD------------------------RK
A0A373K3P9      RRYELKLAFRIPVL----------GDIPQIQAPD------------------------RK
A0A3R6JRU5      RRYELKLAFRIPVL----------GDIPQIQAPD------------------------RK
A0A1C5MS04      RRYELKLAFRIPVL----------GDIPQIQAPD------------------------RK
A0A3C1J150      RRYELKLAFRIPVL----------GDIPQIQAPD------------------------RK
A0A416CXD7      RRYELKLAFRIPVL----------GDIPQIQAPD------------------------RK
A0A6N2X662      RRYELKLAFRIPVL----------GDIPQIQAPD------------------------RK
R6XBL9          RRYELKLAFRIPVL----------GDIPQIQAPD------------------------RK
A0A355W5Z7      RRYELKLAFRIPVL----------GDIPQIQAPD------------------------RK
A0A143WVN6      RKSSARRQLDGRIL----------ATIPYERKYK------------------------SI
W6RXP9          TKESVEGALNIPVM----------GVIPQMSNSS------------------------KP
W6S4G8          SKEEVERNLKLPVL----------GVIPKFGRK---------------------------
A0A1G6BLB6      AENEVEKKIDTKRL----------GTLYHEKKYK------------------------TF
A0A1C6G8M0      NEEDIQKCSGLSVL----------GTIPDYKGGK------------------------KR
A0A416MP73      SDEDIQKCTGLSVL----------GAIPDYKG--------------------------KK
A0A3E4LL92      SMEQAKRLLDIPMI----------GSLDYVKKKS------------------------GQ
A0A415D1L1      SMEQAKRLLDIPMI----------GSLDHVKKKS------------------------GQ
A0A0H5SF45      SKEDLTKRYQIPIL----------GVIPDFGVKM------------------------PK
A0A1M6JRJ5      SQEDLLKHYNIPLL----------GAIPDFAAED------------------------NS
A0A1M7Y1S2      NQEDLLKHYDTPLL----------GCIPDFSPVN------------------------SS
A0A7I8DMN1      NQEDLLKHYDVPLL----------GSIPDFSTGQ------------------------GS
A0A396G6S7      NPGEVSTKLDTRLL----------GTIAYEKKSK------------------------AL
A0A3E5A223      NPGEVSTKLDTRLL----------GTIAYEKKSK------------------------AL
R7D5E6          NPGEVSTKLDTRLL----------GTIAYEKKSK------------------------AL
A0A415HQH5      NPGEVSTKLDTRLL----------GTIAYEKKSK------------------------AL
A0A414W2C6      NPGEVSTKLDTRLL----------GTIAYEKKSK------------------------AL
A5ZNE7          NPGEVSTKLDTRLL----------GTIAYEKKSK------------------------AL
A0A395X821      NPGEVSTKLDTRLL----------GTIAYEKKSK------------------------AL
A0A1C5PY68      NPGEVSTKLDTRLL----------GTIAYEKKSK------------------------AL
A0A174CJF8      NPGEVSTKLDTRLL----------GTIAYEKKSK------------------------AL
A0A564SRR2      NPGEVSTKLDTRLL----------GTIAYEKKSK------------------------AL
A0A174R7V0      NPGEVSTKLDTRLL----------GTIAYEKKSK------------------------AL
A0A373MWV2      NETEFGRKIDADLL----------GTVYHEKKRK------------------------NS
A0A417CE88      NETEFGRKIDADLL----------GTVYHEKKRK------------------------NS
A0A416Y441      NETEFGRKIDADLL----------GTVYHEKKRK------------------------NS
A0A357GPJ7      NETEFGRKIDADLL----------GTVYHEKKRK------------------------NS
A0A396PAC1      NETEFGRKIDADLL----------GTVYHEKKRK------------------------NS
A0A416EYU4      NETEFGRKIDADLL----------GTVYHEKKRK------------------------NS
A0A416SCQ2      NETEFGRKIDADLL----------GTVYHEKKRK------------------------NS
A0A416TGN7      NETEFGRKIDADLL----------GTVYHEKKRK------------------------NS
A0A417SMF6      NETEFGRKIDADLL----------GTVYHEKKRK------------------------NS
A0A1Y4MW77      KTQELEEVTNIKCL----------ATVPYLKQKK------------------------RS
R6UHV6          KESDINKKLITQRL----------VSIPTQKKRL------------------------SV
A0A3R9Q621      DEEELKQRYNKPVI----------GNIPSYQGND------------------------AV
A0A069RC75      SAEDIQNGIGISVI----------GSVPKLKMSG------------------------EK
A0A6S6R676      NQEDLTKKYSMPVL----------GNIPSFDEIS------------------------RE
A0A174F2W5      NETEFGRKIDADLL----------GTVYHEKKRK------------------------NS
A0A174S8E9      NETEFGRKIDADLL----------GTVYHEKKRK------------------------NS
A0A416ZL97      NEAEFTRKIDADLL----------GVVYHEKKKK------------------------NS
A0A174LSK1      NEAEFTRKIDADLL----------GVVYHEKKKK------------------------NS
A0A373GY92      NEAEFTRKIDADLL----------GVVYHEKKKK------------------------NS
A0A373NZQ6      NEAEFTRKIDADLL----------GVVYHEKKKK------------------------NS
A0A417I9B9      NEAEFTRKIDADLL----------GVVYHEKKKK------------------------NS
A0A417MP97      NEAEFTRKIDADLL----------GVVYHEKKKK------------------------NS
A0A417WQF8      NEAEFTRKIDADLL----------GVVYHEKKKK------------------------NS
A0A373RZ83      NEAEFTRKIDADLL----------GVVYHEKKKK------------------------NS
A0A416U6I1      NEAEFTRKIDADLL----------GVVYHEKKKK------------------------NS
R7JQZ9          NEAEFTRKIDADLL----------GVVYHEKKKK------------------------NS
A0A7C6SMH0      KPEEVERHLGLNVV----------GTIPKFKGGK------------------------RG
A0A3B8KKL6      KPDEVERYLSLNVV----------GTIPKFKGGK------------------------RG
A0A2K9E6R0      KPDEVERYLSLNVV----------GTIPKFKGGK------------------------RG
A0A2S8RBI0      KPDEVERYLSLNVV----------GTIPKFKGGK------------------------RG
A0A0L6JLG6      KPEDVEHHLGLNVI----------GTVPAFEGGK------------------------RG
G8LSN0          KPEDVERQMELTVI----------GAVPKFEGGK------------------------RG
A0A1M5UYN6      TKEEVEKFIGLPVI----------GLIPKITEK---------------------------
A0A176JBT8      SKKGITDLLGIPYL----------GEIPAIIPQG------------------------PT
A0A1I5HIC6      DVEQIEKYLGLTVL----------GTIPLETKYA------------------------GK
A0A1Y3TC51      NPLCAQRQLDGKVR----------GVIPFEQKGT------------------------AL
A0A1Y3T1N0      SPSSASRLLDGTVR----------GIIPFESKG--------------------------I
A0A1Y3Y8U8      SPSSASRLLDGTVR----------GIIPFESKG--------------------------I
A0A5B0BQY5      TERKVERSLGIPFL----------GSILMKKEKK------------------------GK
A6CLL4          NQEKVERMLNAPYL----------GSVPKLPPQS------------------------NL
A0A176U8D6      TDEDVQKCTGLSVL----------GAIPDYKG--------------------------KK
A0A1Q6KSQ5      NEEDIQKCSGLSVL----------GTIPDYKGGK------------------------KR
A0A3D3U8B3      NEEDIQKCSGLSVL----------GTIPDYKGGK------------------------KR
A0A3E5FRL7      SSKNATKLLDGRVV----------GVIPYEKKKR------------------------DK
A0A1Y4QK93      SSKNAGKLLDGRVV----------GIIPYEKKKR------------------------NK
B1C232          SSENATKLLDGRVV----------GVIPYEKKKR------------------------NK
A0A401USI6      SEDDVQRYLNLPMV----------GIIPKQNKM---------------------------
A0A1V4IQ10      NKEKLERIVQLPTF----------GLIPDDTKIR------------------------KT
A0A1S8TRD2      DKEKLERIVQLPTF----------GIIPDDTKVR------------------------KI
G7M1U2          DKEKLERIVQLPTF----------GIIPDDTKVR------------------------KI
A0A2T6KJ75      SSEKAEKALALPVI----------GLVPPGE-----------------------------
A9KN92          NAEQIEKYLGLTVL----------GTIPLELKNS------------------------NK
A0A352MUJ1      NDKDIEKTLNIKTL----------ASFAKNQNAR------------------------PG
R5YI67          NDKDIEKALNIKTL----------ATFARNPNIK------------------------QG
A0A174DL89      DKDELKELITFPIL----------GEIPDFSSVN------------------------IN
A0A1Y0IQP5      TEGEIEQLLQLPAL----------GAITAYDNKG------------------------RA
A0A4R2R7B1      TEAEAEQLLQLPAL----------GAIPFFEQKG------------------------SS
A0A1M6E8I2      TSDDIEKHIGLPVI----------GSIFEFNSES------------------------E-
A0A1Y4N105      RSKQAKYQLDGRII----------TTIPYERKYH------------------------SL
A0A1Y4QP75      RSKQAKYQLDGRII----------TTIPYERKYH------------------------SL
A0A3D4QRB5      TQEDAEEFLKLPVI----------GRIPNFDTKK------------------------SK
A0A349DEH5      TADELSDKLDVHIL----------GSVQQITNKN------------------------KA
A0A3D4T7B4      TADELSDKLDVHIL----------GSVQQITNKN------------------------KA
A0A350XYC7      TADELSEKLDVHIL----------GSVQQITNKN------------------------KT
R6DNR8          TADELSEKLDVHIL----------GSVQQITNKN------------------------KT
A0A355KUM5      TADELSEKLDVHIL----------GSVQQITNKN------------------------KT
R5YGY6          TADELSEKLDVHIL----------GSVQQITNKN------------------------KT
A0A0K8J554      SKDDLMEKYQIPIL----------GAIPSFNDMI------------------------PR
A0A1I0RG99      NQDELLKRYQLPIL----------GTIPNFNVNI------------------------KR
A0A1I5G322      NQDDLLRKYQVPIL----------GVIPNYKNNK------------------------KK
A0A7C6IYW8      NKEDLIETYKLPVL----------GEIPNLNLSK------------------------ES
A0A3N1XSX6      EKEELITNYQLPVL----------GEIPNFNGYK------------------------EK
A0A7C6JZF1      SKEELVKRYSIPVI----------GSIPYYKRRE------------------------KS
A0A7G9WCY6      NPEDIERHLKLPVL----------ATVPEIEGSQ------------------------SD
A0A1C6G0U3      NKGDVEKYLDLPII----------GGIPMDKMLK------------------------KE
A0A3D4LLB3      TEKDIENLLGLSII----------GAVPNFNHGS------------------------KT
A0A0A5GPA9      SEEKVEKVFRLSSL----------GVVPIISDEW------------------------NQ
A0A271M6M4      SQEKIEQAFKLPSL----------GVIPVISDKP------------------------KR
A0A7C7AD93      NEEDIENQLNVPVI----------GTIPKFRKSD------------------------FN
A0A2V3W8U6      SKEDIEKYLGLSFL----------GEVGIISKNR------------------------KN
A0A6N3BXA1      TTKDIEKYFDFNIL----------GVVSKQKEKL--------------------------
A0A351SRI8      NESDAERELGVPIL----------GAVPKYKEKV------------------------SS
A0A1V5LU59      KPEQVEKQLGLNLI----------GVVPKFEGGK------------------------RG
A0A1E3BVC3      KPEEVERTLGINVI----------GTIPEFEGGK------------------------RG
A0A4Q0I6S0      KPEEVERTLGINVI----------GTIPEFEGGK------------------------RG
A3DF66          KPEEVEKMLGINVI----------GTIPAFDGGK------------------------RG
W4V1T8          KPEEVERILGINVI----------GTIPAFEGGK------------------------RG
A0A1C6ITD7      DKSELKELIHLPIL----------GEIPNFSSIN------------------------IN
A0A381IX63      TPEELEDILDTSLL----------GVIPFENEEE------------------------RK
A0A1G9IUT4      SSKDVEEKLNLQII----------GNIPNENNLD------------------------S-
A0A1M6RWV2      GPDDVEKRLNLPVL----------GAVPAVENEN------------------------SL
A0A143XPI5      GDEDVKKIMQIKSL----------GTLPTVKM------------------K-------KR
A0A355G1X5      SSDDVQIKLDAKLL----------GTVYTVRN------------------K-------SG
A0A0M6WXE3      QEREVEKKLDARSL----------GAISYEWKYK--------------TIK-------EW
A0A348SAK2      QEREVEKKLDARSL----------GAISYEWKYK--------------TIK-------EW
A0A1G9H5B9      DLRELKENYKLPIL----------AEIK----------------------R-------LD
R5EFZ0          SGTEAREKLDCSYL----------GEISHERKYK--------------TVF-------AL
A0A1Y4H8L0      QEDDVEAKLDTRSL----------GALVYEPKAK--------------NLR-------EL
A0A4B9BMD9      APEQLEEH-GISVYATIPMSEWLDKRTRLRKKNL--------------FSN-------QQ
A0A0M6WYQ8      TGKEIKTHLNLVDL----------GTLPEVHVK-----------------K-------RN
A0A348SAK1      TGKEIKTHLNLVDL----------GTLPEVHVK-----------------K-------RN
A0A252F281      REEEVKEKLDTHLI----------ASVPHEKRP-----------------D-------GK
A0A1Y4QKE6      NPEDMKRITNLNCM----------ATIPRVKI------------------K-------AR
B1C231          NPEDMKRITNLNCM----------ATIPQVKF------------------K-------AR
A0A1Y3TUL5      NTKDIENTLGLEVL----------GEIPENVEY---------------------------
A0A1Y4JAX2      NTKDIENTLGLEVL----------GEIPENVEY---------------------------
A0A1Y4T590      NTKDIENTLGLEVL----------GEIPENVEY---------------------------
R5B467          NRDDLQQATSARYL----------GALPAVRV--------------------------KK
A0A1Y3T163      NPEEMQKITSLRCL----------AMIPQVRF------------------K-------AR
A0A1Y3YCA2      NPEEMQKITSLRCL----------AMIPQVRF------------------K-------AR
A0A1Y4L6N9      KPEELKKVSNLKCL----------AKIPNVRQ------------------K-------AR
A0A173T644      TPDELKNVMSLPCL----------GNLPEMKQ------------------K-------AR
A0A1C5TSB8      TPDELKNVMSLPCL----------GNLPEMKQ------------------K-------AR
C0CIK6          TPDELKNVMSLPCL----------GNLPEMKQ------------------K-------AR
A0A1Y3WEF6      KPEELNSVMSLSCI----------ANIPEVSK------------------K-------LR
A0A417T0L2      KPEELKSVMSLSCI----------ANIPEVSR------------------K-------LR
A0A1H9EPU3      TQEDVENKIGLSVLANMPYKENIEEGLYENDPEK--------------KEK-------NK
A0A354IGV3      TPTCIERKLDIKRF----------GVIYHERKNR--------------TLR-------DS
A0A417JMV2      KPKEVSRKLDAKLL----------QTLYHEKIYK--------------TWK-------AR
A0A415VWX5      KPKEVSRKLDAKLL----------QTLYHEKIYK--------------TWK-------AR
A0A173UY96      KPKEVSRKLDAKLL----------QTLYHEKIYK--------------TWK-------AR
B0P408          KPKEVSRKLDAKLL----------QTLYHEKIYK--------------TWK-------AR
D4MV82          KPKEVSRKLDAKLL----------QTLYHEKIYK--------------TWK-------AR
A0A173QTL1      KPKEVSRKLDAKLL----------QTLYHEKIYK--------------TWK-------AR
A0A174J359      KPKEVSRKLDAKLL----------QTLYHEKIYK--------------TWK-------AR
A0A174A3T7      KPKEVSRKLDAKLL----------QTLYHEKIYK--------------TWK-------AR
A0A417UUA3      KPKEVSRKLDAKLL----------QTLYHEKIYK--------------TWK-------AR
A0A6N2VB70      KPKEVSRKLDAKLL----------QTLYHEKIYK--------------TWK-------AR
A0A1C6EUV9      KPKEVSKKLDGTLL----------QTLYHERIYK--------------SWK-------AR
A0A173Y645      KPKEVSKKLDGTLL----------QTLYHERLYK--------------SWK-------AR
A0A374AVY6      KPKEVSKKLDGTLL----------QTLYHERSYK--------------SWK-------AR
R7BXS4          KPKEVSKKLDGTLL----------QTLYHERSYK--------------SWK-------AR
A0A143ZUX1      SEDDVYDFLPVKLF----------ASIPTIGSRS--------------------------
A0A1W1Z4C3      KPAELTDNYTPPIL----------SYIRR-----------------------------AK
A0A239QN83      KPGEITDHYTPPIL----------SYIRR-----------------------------AK
A0A3R9WAA7      KPDDLIQITNVKLL----------GLLPHLRERK------------------------KN
A0A1G6BLF1      KEKDFAKILNVKCI----------AAIPHVRFKKRG----------------------KN
R6HZX3          TADDLKRSTSVPCM----------GTIPAIQVKR-------------------------R
A0A1W2CEA6      SGEDITKAVDLPVF----------GAVTRQNMERNAAELGADMPRNP-----------AF
R7FFK6          DSSELGEHFQKPMI----------GEIQSIGGKV------------KKKDR-------GT
A0A373MPB9      NSDELGDIYQKPIV----------GEIMNIGGKT------------SKKDE-------GS
A0A373L519      NSDELGDIYQKPIV----------GEIMNIGGKT------------SKKDE-------GS
A0A373W906      NSDELGDIYQKPIV----------GEIMNIGGKT------------SKKDE-------GS
A0A373VCW2      NSDELGDIYQKPIV----------GEIMNIGGKT------------SKKDE-------GS
W0U604          NSDELGDIYQKPIV----------GEIMNIGGKT------------SKKDE-------GS
A0A374B6G0      NSDELGDIYQKPIV----------GEIMNIGGKT------------SKKDE-------GS
A0A373VM36      NSDELGDIYQKPIV----------GEIMNIGGKT------------SKKDE-------GS
A0A1C5P379      NSDELGDIYQKPIV----------GEIMNIGGKT------------SKKDE-------GS
A0A373XXX0      NSDELGDIYQKPIV----------GEIMNIGGKT------------SKKDE-------GS
A0A5R9MJM9      NSDELGDIYQKPIV----------GEIMNIGGKT------------SKKDE-------GS
A0A356CW82      NSDELGDIYQKPIV----------GEIMNIGGKT------------SKKDE-------GS
R6T4X7          NSDELGDIYQKPIV----------GEIMNIGGKT------------SKKDE-------GS
A0A374HTV1      NSDELGDIYQKPIV----------GEIMNIGGKT------------SKKDE-------GS
A0A374GB66      NSDELGDIYQKPIV----------GEIMNIGGKT------------SKKDE-------GS
A0A374ECC6      NSDELGDIYQKPIV----------GEIMNIGGKT------------SKKDE-------GS
A0A374BM61      NSDELGDIYQKPIV----------GEIMNIGGKT------------SKKDE-------GS
A0A373UGZ4      NSDELGDIYQKPIV----------GEIMNIGGKT------------SKKDE-------GS
A0A373SA66      NSDELGDIYQKPIV----------GEIMNIGGKT------------SKKDE-------GS
A0A1C5X6X7      NSDELGEIYQKPIV----------GEIMNIGGKT------------SKKDE-------GS
A0A1C6JIH3      NSDELGEIYQKPIV----------GEIMNIGGKT------------SKKDE-------GS
A0A373PSC3      NSDELGEIYQKPIV----------GEIMNIGGKT------------SKKDE-------GS
A0A1K1WYK8      ESEKIAKKYDKAII----------GEIQQFG--E------------GKKKK-------KG
A0A1H6IUB1      DTDSVADKFKKPII----------GEIAAFG--V------------EKKKK-------DS
A0A1M7L1F9      DTDAVGKEFKKPII----------GEIASFG--I------------EKKKK-------DQ
A0A1C6B4L6      DVALLEKKYKKAII----------GEIQEFA--A------------ERNDK-------SS
A0A1Q6T9P4      DVALLEKKYKKAII----------GEIQEFA--A------------ERNDK-------SS
A0A315Y4F9      DTDALGKKYNKAII----------GDIQAFG--D------------SKKKR-------DA
A0A354K620      DTDDLGKKYNKAII----------GEIQAFG--D------------SKKKK-------DA
A0A355G3J9      GRKEIENAFTLPII----------ATIPIQGEGK------------PNGKR-------NS
A0A3D2AD87      GEDEFVNQYEIPLL----------GSIPDFDNIVSSPNYKGYYGKASYRSRLKKHLTDSN
A0A143XN92      SEEEFRKKLDIRYL----------GTIYHERKHK--------------TIR-------SA
A0A173ZYY6      QENEIEKKLDARSL----------GAISYEWKYK--------------TIR-------DI
A0A6L8RXB5      QENEIEKKLDARSL----------GAISYEWKYK--------------TIR-------DI
A0A6N9JW85      QENEIEKKLDARSL----------GAISYEWKYK--------------TIW-------DI
A0A173SMI2      QENEIEKKLDARSL----------GAISYEWKYK--------------TIR-------DI
A0A174ASH7      QENEIEKKLDARSL----------GAISYEWKYK--------------TIR-------DI
A6BH65          QENEIEKKLDARSL----------GAISYEWKYK--------------TIR-------DI
R7G0D7          QENEIEKKLDARSL----------GAISYEWKYK--------------TIR-------DI
A0A2T5IYJ6      NAEDVEDKLGISML----------GMVPLIKKRK--------------------------
A0A3C0QME1      SSEMLTTKYEKAVF----------GEIVNFSDGNSK--------KVQSEHR---------
A0A355FYK5      DIDDIRNKTNVPII----------GSIPYVGKSTGL--------INKKPL----------
A0A357AQU0      DAEDINKKFGLSVL----------GEVMDYGTKKDK--------KKRRNVD-------PS
A0A3C1YJQ7      DAEDINKKFGLSVL----------GEVMDYGTKKDK--------KKRRNVD-------PS
A0A3D0JG38      DAEDINKKFGLSVL----------GEVMDYGTKKDK--------KKRRNVD-------PS
A0A3C0IHX1      GEDDI-QSFSISYL----------GEVPEMVEARSG--------KRKRRKK-------KN
R5V506          GEDDI-QSFSISYL----------GEVPEMVEARSG--------KRKRRKK-------KN
A0A352TIU5      GEDDI-QSFSISYL----------GEVPEMVEARSG--------KRKRRKK-------KN
A0A3E5FSY5      NPEDMKRITNLNCM----------ATIPQVKFKA----------RKIHKQT-------R-
A0A1V5S3C0      TSDDIRKRYNLNII----------AVVSKLDLKR----------RK--------------
A0A1Y3TC98      SPEDMKKITSLRCL----------AFIPHVRFKA--------------RKK-------LD
A0A1Q6REE0      NEDELRETLNAPCL----------GQIPAVKISR----------KR--------------
R5ETF9          NEDELRETLNAPCL----------GQIPAVKISR----------KR--------------
R6VAT5          HPDEIRKLLNNQRL----------GSIVKVVKKK--------------------------
A0A1Q6S448      TLEGARSGLDARII----------SSVPHEGRRTRKLLGWFDDRRRERRAR-------RG
A0A351MYR0      TQEGARSDLDAKII----------STVPHEGRRTRKLLGWMDD-RRERQAR-------RG
R6HPC1          TQEGARSDLDAKLI----------STVPHEGRRTRKLLGWMDD-RWERRSR-------RG
A0A3D4G5Z5      TQEGARSDLDAKLI----------STVPHEGRRTRKLLGWMDD-RRERRSR-------RG
A0A3D5ES03      TQEGARSDLDAKLI----------STVPHEGRQTRKLLGWMDD-RRERRSR-------RG
A0A0F2P7X6      SGDDVKNKLGLTLL----------GSIPYLSPKA----------RKGQGQS-------QG
A0A359B487      SGDDVKNKLGLTLL----------GSIPYLSPKA----------RK-------------D
A0A348P5V4      NSDEVTNKLGMKLL----------GVIGRVYR-K----------NK--KGE-------SK
A0A356PT74      TADDVKDKLGVDVI----------GMVAHVNRKK----------KK--KGE-------DY
A0A3D5LL19      TADDVKDKLGVDVI----------GMVAHVNRKK----------KK--KGE-------DY
R5MNF0          TADDVKDKLGVDVI----------GMVAHVNRKK----------KK--KGE-------DY
A0A1Q9JSI0      KPKEVSRKLDGKLL----------ETLYHEKRYK----------TW--KAR-------LH
A0A3D5TNI1      SQEDIQNKLQLNVI----------GEVSQVPGGE----------RF--YKK-------SA
A0A358LJD0      SQEDIQNKLQLNVI----------GEVSQVPGGE----------RF--YKK-------SA
R6I3L7          SQEDIQNKLQLNVI----------GEVSQVPSGE----------RF--YKK-------SA
A0A3D1HXX0      SQEDIQNKLQLNVI----------GEVSQVPSGE----------RF--YKK-------ST
A0A3D2QJB8      SQEDIQNKLQLNVI----------GEVSQVPSGE----------RF--YKK-------SA
D4LC36          GTEELREHFSKPII----------AEIQSIGGKA----------KK--KNR-------GT
R7MQJ4          DKEEIAQKYEKAII----------GEIPEFIDDK----------KK--KKD-------SN
A0A1V5GLC0      DPEALREKYKKAVV----------GEIQDFTIGR----------KK--KG---------E
W7V182          DAGRLGESYKKAII----------GEIQQFDESK----------KR--KKD-------VD
                                                                            

S3FFL2          VLFD-------------------------------------RKSDMVDAYLAVQTNLGF-
A0A328M4V1      L--------------------------------------------AVEALRSLRTSLHF-
A0A6A8IF17      I--------------------------------------------INEAFRVLRTNLEFM
A0A3D5R4X5      --------------------------------KVVTFED--PKSPVAEAYRSLRTNLKFA
A0A1I4C3N6      ------VK-----------------------KSPILGEN--SSFEMREAYNEIRTFLTFS
A0A3B9CIM7      ------EK-----------------------VNKILHKE--SPFAVRESYNSIRAKLLFT
A0A1G9WHW8      GVIKNSSY-----------------------NPKVLNED--STFTITEAYNSIRTKLLYT
A0A1H5VAA0      GVIKNSSY-----------------------NPKVLNED--STFTITEAYNSIRTKLLYT
A0A3R6VK11      ------SK-----------------------PVLVLGEN--SSFAVKESYNTIRANLLFT
A0A3R6QUY7      ------SK-----------------------PVLVLGEN--SSFAVKESYNTIRANLLFT
A0A373K3P9      ------SK-----------------------PVLVLGEN--SSFAVKESYNTIRANLLFT
A0A3R6JRU5      ------SK-----------------------PVLVLGEN--SSFAVKESYNTIRANLLFT
A0A1C5MS04      ------SK-----------------------PVLVLGEN--SSFAVKESYNTIRANLLFT
A0A3C1J150      ------SK-----------------------PVLVLGEN--SSFAVKESYNTIRANLLFT
A0A416CXD7      ------SK-----------------------PVLVLGEN--SSFAVKESYNTIRANLLFT
A0A6N2X662      ------SK-----------------------PVLVLGEN--SSFAVRESYNTIRANLLFT
R6XBL9          ------SK-----------------------PVLVLGEN--SSFAVKESYNTIRANLLFT
A0A355W5Z7      ------SK-----------------------PVLVLGEN--SSFAVKESYNTIRANLLFT
A0A143WVN6      HEYLHKPKK----------------------SVLISSRL--LSMSFTESNRKLATLIERH
W6RXP9          GK-----------------------------KYFVVEDD--PKAVASESYRTLKTNIQYS
W6S4G8          -R-----------------------------EKLVMEEE--PRSLEAECYRTMVTNIQYS
A0A1G6BLB6      TRRSKKKKR----------------------SILITDPT--VSFSYSEAVRRMVSRVRNK
A0A1C6G8M0      K------------------------------EKIIWPDE--LPFSAAEAIYQLRTAILYS
A0A416MP73      Q------------------------------KKIMWPED--LPFNASEAIYQLRTGILYS
A0A3E4LL92      K------------------------------ALLISDQD--TDHVYEEAVDRIVTSIGSE
A0A415D1L1      K------------------------------ALLISDQD--TDHVYEEAVDRIVTSIRSE
A0A0H5SF45      RYLLMQKLPFKNRLNEIIKDK---VE-----FNQVKNQE--ANFLVNEAYKALRTNLLYT
A0A1M6JRJ5      R-----DKSIPARLKK-LIRKGYGED-----LNQGLITQ--DSFLVTESYKALRTNLRFS
A0A1M7Y1S2      R-----KNKILLELKGILIKGENFMK-----PEKIQNRQ--NSFLVAESYKTLRTNLRFS
A0A7I8DMN1      S-----RYKVIEDIKAILVKKGILNE-----CKKETIMG--DSFLTVESYKAFRTNLKFS
A0A396G6S7      SMKRKKDYL----------------------SMLIQNPL--RSFAYVESSKMAASRVRSY
A0A3E5A223      SMKRKKDYL----------------------SMLIQNPL--RSFAYVESSKMAASRVRSY
R7D5E6          SMKRKKDYL----------------------SMLIQNPL--RSFAYVESSKMAASRVRSY
A0A415HQH5      SMKRKKDYL----------------------SMLIQNPL--RSFAYVESSKMAASRVRSY
A0A414W2C6      SMKRKKDYL----------------------SMLIQNPL--RSFAYVESSKMAASRVRSY
A5ZNE7          SMKRKKDYL----------------------SMLIQNPL--RSFAYVESSKMAASRVRSY
A0A395X821      SMKRKKDYL----------------------SMLIQNPL--RSFAYVESSKMAASRVRSY
A0A1C5PY68      SMKRKKDYL----------------------SMLIQNPL--RSFAYVESSKMAASRVRSY
A0A174CJF8      SMKRKKDYL----------------------SMLIQNPL--RSFAYVESSKMAASRVRSY
A0A564SRR2      SMKRKKDYL----------------------SMLIQNPL--RSFAYVESSKMAASRVRSY
A0A174R7V0      SMKRKKDYL----------------------SMLIQNPL--RSFAYVESSKMAASRVRSY
A0A373MWV2      -------------------------------SMLITNPA--RSFPYVESLKRIASRVRGR
A0A417CE88      -------------------------------SMLITNPA--RSFPYVESLKRIASRVRGR
A0A416Y441      -------------------------------SMLITNPA--RSFPYVESLKRIASRVRGR
A0A357GPJ7      -------------------------------SMLITNPA--RSFPYVESLKRIASRVRGR
A0A396PAC1      -------------------------------SMLITNPA--RSFPYVESLKRIASRVRGR
A0A416EYU4      -------------------------------SMLITNPA--RSFPYVESLKRIASRVRGR
A0A416SCQ2      -------------------------------SMLITNPA--RSFPYVESLKRIASRVRGR
A0A416TGN7      -------------------------------SMLITNPA--RSFPYVESLKRIASRVRGR
A0A417SMF6      -------------------------------SMLITNPA--RSFPYVESLKRIASRVRGR
A0A1Y4MW77      RGKTI--------------------------MPSILNLQ--TNPLFLENIESLHIRLAKE
R6UHV6          REKVKGIKR----------------------PLSITNPV--ISFEFREAFKRLRQKIVSD
A0A3R9Q621      REKLRRILPGRNKNRQAGRGKAKSGG-----LDKIIDEN--TKFIITEAYRALRSNLRYT
A0A069RC75      G------------------------------AELVIKTS--PKSPGAEAFRSIRTNMQFA
A0A6S6R676      RTAVKRIMAKLQKSEQQK-------------TDRPIDEN--TKFLVTEAYKAFRTNLRFS
A0A174F2W5      -------------------------------SMLITNPA--RSFPYVESLKRIASRVRGR
A0A174S8E9      -------------------------------SMLITNPA--RSFPYVESLKRIASRVRGR
A0A416ZL97      -------------------------------SMLITNPA--RSFLYVESLKRIASRVRGR
A0A174LSK1      -------------------------------SMLITNPA--RSFLYVESLKRIASRVRGR
A0A373GY92      -------------------------------SMLITNPA--RSFLYVESLKRIASRVRGR
A0A373NZQ6      -------------------------------SMLITNPA--RSFLYVESLKRIASRVRGR
A0A417I9B9      -------------------------------SMLITNPA--RSFLYVESLKRIASRVRGR
A0A417MP97      -------------------------------SMLITNPA--RSFLYVESLKRIASRVRGR
A0A417WQF8      -------------------------------SMLITNPA--RSFLYVESLKRIASRVRGR
A0A373RZ83      -------------------------------SMLITNPA--RSFLYVESLKRIASRVRGR
A0A416U6I1      -------------------------------SMLITNPA--RSFLYVESLKRIASRVRGR
R7JQZ9          -------------------------------SMLITNPA--RSFLYVESLKRIASRVRGR
A0A7C6SMH0      KSKAKDRRELEREYL----------------KNLITKND--PKAAATEAFRELRTNLHYI
A0A3B8KKL6      KSKAKNRRELEKEHL----------------KNLITIND--PKAAATEAFRELRTNLHYI
A0A2K9E6R0      KSKAKNRRELEKEYL----------------KNLITKND--PKAAATEAFRELRTNLHYI
A0A2S8RBI0      KSKAKNRRELEKEYL----------------KNLITKND--PKAAATEAFRELRTNLHYI
A0A0L6JLG6      NKKAKDEKQLEEEYL----------------KNLITAND--PKAAASEAYRELRTNLQYK
G8LSN0          KNEKKDSKENERDYL----------------KNLITKND--PKAPASEAFREIRTNLHYK
A0A1M5UYN6      -------------------------------VYLIVKSN--PSSIAAEGFRTLRTNIQYS
A0A176JBT8      NKYLDERY-----------------------NKLVAHTE--PHSSSSEAYRSVRANLDIL
A0A1I5HIC6      IKNKKKAIKKRKKEENIYPE-----------GISIEKAS--LEFSVNEAYKTLRTNIQFC
A0A1Y3TC51      RQKKNPKE-----------------------ALLLDSPV--VSMGFAEAGRRTAARVEYH
A0A1Y3T1N0      LGRKNTKK-----------------------ALLLNSPL--VSMDFAEASRRAEAKVEYH
A0A1Y3Y8U8      LGRKNAKK-----------------------ALLLNSPL--VSMDFAEASRRAEAKVEYH
A0A5B0BQY5      SRNYNSDF-----------------------ESVTPRVQ--FPKAEKEDFNKLAATIHYF
A6CLL4          NNKHSPNNTYS--------------------KFLISSSE--ANSPAMELYREIRTNIQFL
A0A176U8D6      Q------------------------------KKIMWPEN--LPFNASEAIYQLRTGILYS
A0A1Q6KSQ5      K------------------------------EKIIWPDE--LPFSAAEAIYQLRTAILYS
A0A3D3U8B3      K------------------------------EKIIWPDE--LPFSAAEAIYQLRTAILYS
A0A3E5FRL7      HLKKLKQ------------------------SLLISSPI--ASMNFVEANGRMSSRIEYH
A0A1Y4QK93      HLKKSKQ------------------------SLLITSPI--ASMNFVEANGRMSSRIEHH
B1C232          HLKKSKQ------------------------SLLISSPI--ASMNFVEANGRMSSRIEHN
A0A401USI6      -------------------------------VNLIVERE--PKSPVTEAFKSMRTNLLFS
A0A1V4IQ10      KNH----------------------------ITLIVEQK--PKSIVAEAYRTLITNILYS
A0A1S8TRD2      KNH----------------------------IALIVEKK--PKSIVAEAYRTLITNILYS
G7M1U2          KNH----------------------------ITLIVEKK--PKSIVAEAYRTLITNILYS
A0A2T6KJ75      -------------------------------GKLIHDLP--TFDVFTEMFRSIRANLLYV
A9KN92          RGKNKKAYKRKKGDTNNE-------------HSSIQKAT--LEFTINEAYKSLRTNIQFC
A0A352MUJ1      ----------------------------------VIDLD--PKSQIAEGFKSLRTNLQFM
R5YI67          ----------------------------------LIDLD--PKSQCAEGFKSLRTNLQFM
A0A174DL89      NKG----------------------------NYLFVNES--PKSLPSEAINILRTNLQFC
A0A1Y0IQP5      G------------------------------HRLAVRQD--PRSAEAEAFRTLRTNIQYD
A0A4R2R7B1      G------------------------------YRVVVRQD--PRSAVAEAFRTLRTNIQYD
A0A1M6E8I2      -------------------------------GIIVHENP---KSPISEAYRSLRTNINFA
A0A1Y4N105      QELKKKPKK----------------------SVLINSPL--LSMPYSEANRKLGALIERH
A0A1Y4QP75      QELKKKPKK----------------------SVLINSPL--LSMPYSEANRKLGALIERH
A0A3D4QRB5      KKSADRS------------------------PRLATGAA--TRAPVTEAYKTLRTNIQFS
A0A349DEH5      AK-----------------------------GLLVTDRK--NGFSFIETYKSIRTKIENN
A0A3D4T7B4      AK-----------------------------GLLVTDRK--NGFSFIETYKSIRTKIENN
A0A350XYC7      AK-----------------------------GLLVTDRK--NGFSFIETYKAIRTKIENN
R6DNR8          AK-----------------------------GLLVTDRK--NGFSFIETYKAIRTKIENN
A0A355KUM5      AK-----------------------------GLLVTDRK--NGFSFIETYKAIRTKIENN
R5YGY6          AK-----------------------------GLLVTDRK--NGFSFIETYKSIRTKIENN
A0A0K8J554      KNVLLQKMSFLNRKK------------KKSNLNQMINEQ--ANFIITEAYKALRINLLYT
A0A1I0RG99      K-FVLKKTILTDLLHKKV---------KRNNISKN--KD--TEFVIAEAYKSLRSNLNFT
A0A1I5G322      KVLLIKLTSIAKRLNKKIDSKENKKAGKSENIKENAEKD--TQFIITEAYNSLRTNLKFT
A0A7C6IYW8      GIYKK-IPYISKKK-------------RHLKAKNDYNKN--LKFIFSESFKSFRTNLRFV
A0A3N1XSX6      QLYKRYFPFLLKYK-------------KFSKTERELMDN--SKFIITESYKSLRTNLRFT
A0A7C6JZF1      LFDFIPIPVVGKRS-------------LLLAQRGDAKEE--RRFDVNEAFQELKTNMRFT
A0A7G9WCY6      I------------------------------NLITYREP---KSPISEAYRMLRTNIQFA
A0A1C6G0U3      VTNTLISN----------------------------------EGPILEAYRSIRTNIEFF
A0A3D4LLB3      AYG----------------------------NFLIKDNP---SSPTAEAYRKITTNIEFS
A0A0A5GPA9      KKEDLMQNDRYF-------------------KLLPRLGT---YSPITEAYRSIRTNLQYT
A0A271M6M4      SNGLFDREDRFN-------------------KMLPQLNP---YSAVTEAYRAVRTNVQYT
A0A7C7AD93      IDNIIRDN----------------------------------KYCSLDSFRTIRTYLLYI
A0A2V3W8U6      RLNSNKKEDLHS-------------------ILTSRKGP--MSTPVLEAYRSIRTNLQFQ
A0A6N3BXA1      -------------------------------MYVKDLDR---KNLVQEEFIKIRTNIQYA
A0A351SRI8      GKAS---------------------------DLIICKDS---KSGISEAIRTLRTNLQFS
A0A1V5LU59      KSKNKDQKQLEQ---------------DYLKNLITKNDP---KAPASEAFREIRTNLHYT
A0A1E3BVC3      KKKAKDEKELQE---------------QYLKNLIVHNNP---KATSAEAFRELRTNLYYS
A0A4Q0I6S0      KKKAKDEKELQE---------------QYLKNLIVHNNP---KATSAEAFRELRTNLYYS
A3DF66          KKKAKDEKELQE---------------QYLKNLIVHNNP---KSATAEAFRELRTNLYYS
W4V1T8          KKKAKDEKELQE---------------EYLKNLIVHNNP---KSASAEAFRELRTNLHYS
A0A1C6ITD7      NEDN---------------------------YLFANVSP---KSLPSEAINILRTNLQFC
A0A381IX63      KYEG---------------------------NVTIIGNS---KSSVSEAYRNTRTNIQFS
A0A1G9IUT4      ------------------------------------KNM---KSILDENYKNIRTNIEFS
A0A1M6RWV2      R-------------------------------LITMKDP---KSPISEAYRILRTNIQFS
A0A143XPI5      RKDKNM-------------------------EVSLLNQK--LSPSFMEGIRTLRIRVDAA
A0A355G1X5      KKNQHP-------------------------VLMITDRS--LGFSFIESYKAIRTRVETL
A0A0M6WXE3      IKHRKK-------------------------AVLVDNPL--ASFRFVESFKMLAARVEYH
A0A348SAK2      IKHRKK-------------------------AVLVDNPL--ASFRFVESFKMLAARVEYH
A0A1G9H5B9      SAKKDP-------------------------EAFLLTNR--SPLEVSENYAKLRMNLFYT
R5EFZ0          LRRKKT-------------------------SILITNPV--TSFRFVESIRKLRRRVEQH
A0A1Y4H8L0      FQKQKK-------------------------ALLVSQPL--AGFGFVESYRKFVSKLEYQ
A0A4B9BMD9      RHRTKN-------------------------IPFLAVDN--PADSAVEAVRALRTSLHFA
A0A0M6WYQ8      KESFYN-------------------------SVNVLNKR--IPQGYLEAFRKVGIKVMKQ
A0A348SAK1      KESFYN-------------------------SVNVLNKR--IPQGYLEAFRKVGIKVMKQ
A0A252F281      NKKEKH-------------------------SFLITHTV--ISFAFEESIRQIRTRLEYA
A0A1Y4QKE6      KIHKQT-------------------------RISINDRR--IPFAFKENMRSLQMRLERV
B1C231          KIHKQT-------------------------RISINDRR--ISFAFKENMRSLQIRLERV
A0A1Y3TUL5      FRRKKS-------------------------LLVEDDDP--IGAEVRESFVSAAHILHNR
A0A1Y4JAX2      FRRKKS-------------------------LLVEDDDP--MGAEVRESFVSAAHILHNR
A0A1Y4T590      FRRKKS-------------------------LLVEDDDP--MGAEVRESFVSAAHILHNR
R5B467          RSRTTP-------------------------AALPEEMA--RSSAYCEAMRIVAMRVDKA
A0A1Y3T163      KKQKKK-------------------------KISVLDKR--LSFGYRESLRALEIRLENM
A0A1Y3YCA2      KKQKKK-------------------------KISVLDKR--LSFGYRESLRALEIRLENM
A0A1Y4L6N9      KKRIES-------------------------RITVFDSR--VGAGFRENIKGLQMRVKRE
A0A173T644      KKKRRR-------------------------DISILNKE--FSQRFKESLLSIELKAERE
A0A1C5TSB8      KKKRRR-------------------------DISILNKE--FSQRFKESLLSIELKAERE
C0CIK6          KKKRRR-------------------------DISILNKE--FSQRFKESLLSIELKAERE
A0A1Y3WEF6      KKQDTR-------------------------WIQMQDSR--TPQAFRENIQSLQIRISRE
A0A417T0L2      KKQTTR-------------------------WIQMQDSR--TPQAFRENIQSLQIRISRE
A0A1H9EPU3      LKLRQN-------------------------GQVIPT-N--KDIRISKNISEAYKKLRSN
A0A354IGV3      LHKVNR-------------------------SVLLTNPV--ASFPFTETISKMCTRLEYA
A0A417JMV2      IHRKKS-------------------------PVLLTNPG--TSFQYVEDMKKLARKVSSK
A0A415VWX5      IHRKKS-------------------------PVLLTNPG--TSFQYVEDMKKLARKVSSK
A0A173UY96      IHRKKS-------------------------PVLLTNPG--TSFQYVEDMKKLARKVSSK
B0P408          IHRKKS-------------------------PVLLTNPG--TSFQYVEDMKKLARKVSSK
D4MV82          IHRKKS-------------------------PVLLTNPG--TSFQYVEDMKKLARKVSSK
A0A173QTL1      IHRKKS-------------------------PVLLTNPG--TSFQYVEDMKKLARKVSSK
A0A174J359      IHRKKS-------------------------PVLLTNPG--TSFQYVEDMKKLARKVSSK
A0A174A3T7      IHRKKS-------------------------PVLLTNPG--TSFQYVEDMKKLARKVSSK
A0A417UUA3      IHRKKS-------------------------PVLLTNPG--TSFQYVEDMKKLARKVSSK
A0A6N2VB70      IHRKKS-------------------------PVLLTNPG--TSFQYVEDMKKLARKVSSK
A0A1C6EUV9      IHRKKS-------------------------SVLLTNPG--TSFQYVEDMKKLARKVSSK
A0A173Y645      IHRKKS-------------------------SVLLTNPG--TSFQYVEDMKKLARKVSSK
A0A374AVY6      IHRKKS-------------------------SVLLTNPG--TSFQYVEDMKKLARKVSSK
R7BXS4          IHRKKS-------------------------SVLLTNPG--TSFQYVEDMKKLARKVSSK
A0A143ZUX1      RSRKGN-------------------------SSLLISPR--SDFSYVEAYKSLRVRVESL
A0A1W1Z4C3      GEEKDA-------------------------GVFLLNDK--TDMDMVESYAKLRMNLLYT
A0A239QN83      GSEKDA-------------------------GAYLLNEK--SDMDLVEGYAKLRMNLLYT
A0A3R9WAA7      IIGDVR-------------------------KRAQTDR---MALGYMDDMYKIRTRLNKI
A0A1G6BLF1      ASKNVE-------------------------LVLMDNFR--VPPGFVEAMRSVRRRIENH
R6HZX3          RKAAGS-------------------------GVSILNPH--LGDTLSVPIGALQVRLLRS
A0A1W2CEA6      ADGKHQ-------------------------AVFRGNLK--LDYAGEEAINAVCSSMSFT
R7FFK6          SADRKR-------------------------KLIYHNSD--LPFSILETYKALRSSLNFL
A0A373MPB9      SADRKK-------------------------QLLFNNKD--IPFNIVENYKTMRTNLMFT
A0A373L519      SADRKK-------------------------QLLFNNKD--IPFNIVENYKTMRTNLMFT
A0A373W906      SADRKK-------------------------QLLFNNKD--IPFNIVENYKTMRTNLMFT
A0A373VCW2      SADRKK-------------------------QLLFNNKD--IPFNIVENYKTMRTNLMFT
W0U604          SADRKK-------------------------QLLFNNKD--IPFNIVENYKTMRTNLMFT
A0A374B6G0      SADRKK-------------------------QLLFNNKD--IPFNIVENYKTMRTNLMFT
A0A373VM36      SADRKK-------------------------QLLFNNKD--IPFNIVENYKTMRTNLMFT
A0A1C5P379      SADRKK-------------------------QLLFNNKD--IPFNIVENYKTMRTNLMFT
A0A373XXX0      SADRKK-------------------------QLLFNNKD--IPFNIVENYKTMRTNLMFT
A0A5R9MJM9      SADRKK-------------------------QLLFNNKD--IPFNIVENYKTMRTNLMFT
A0A356CW82      SADRKK-------------------------QLLFNNKD--IPFNIVENYKTMRTNLMFT
R6T4X7          SADRKK-------------------------QLLFNNKD--IPFNIVENYKTMRTNLMFT
A0A374HTV1      SADRKK-------------------------QLLFNNKD--IPFNVVENYKTMRTNLMFT
A0A374GB66      SADRKK-------------------------QLLFNNKD--IPFNIVENYKTMRTNLMFT
A0A374ECC6      SADRKK-------------------------QLLFNNKD--IPFNIVENYKTMRTNLMFT
A0A374BM61      SADRKK-------------------------QLLFNNKD--IPFNIVENYKTMRTNLMFT
A0A373UGZ4      SADRKK-------------------------QLLFNNKD--IPFNIVENYKTMRTNLMFT
A0A373SA66      SADRKK-------------------------QLLFNNKD--IPFNIVENYKTMRTNLMFT
A0A1C5X6X7      SADRKK-------------------------QLLFNNKD--IPFNIVENYKTMRTNLMFT
A0A1C6JIH3      SADRKK-------------------------QLLFNNKD--IPFNIVENYKTMRTNLMFT
A0A373PSC3      SADRKK-------------------------QLLFNNKD--IPFNIVENYKTMRTNLMFT
A0A1K1WYK8      KHRTEP-------------------------RGLLTDKD--VPFNIVESYKTIRANILFT
A0A1H6IUB1      DEDEHV-------------------------K--LTDKS--VPFNVVESYKSIRTNISFA
A0A1M7L1F9      DEDAHV-------------------------K--LTDKN--VPFTVVESYKSIRTNVSFA
A0A1C6B4L6      K-DNYS-------------------------K--LTDKD--IPFYIVERYKSIRTNVNFS
A0A1Q6T9P4      K-DNYS-------------------------K--LTDKD--IPFYIVERYKSIRTNVNFS
A0A315Y4F9      D-DVHL-------------------------K--LTDKD--APFYIIESYKSIRTNLSFA
A0A354K620      D-DDYV-------------------------K--LTDKE--TPFHIIESYKSIRTNLSFA
A0A355G3J9      FDNAVE-------------------------QQVILSED--TPFSVKEAYHKARSNILYL
A0A3D2AD87      NADDSK-------------------------ESVLEKKQ--IPFVIVESYKNIRTGVAYL
A0A143XN92      IKRESV-------------------------NMLITNPI--LSRKYINSIEITAAKVRNR
A0A173ZYY6      FRRKKK-------------------------AILVDDPV--ASFRFVESYKKLAAKVEYR
A0A6L8RXB5      FRRKKK-------------------------AILVDDPV--ASFRFVESYKKLAAKVEYR
A0A6N9JW85      FRRKKK-------------------------AILVDDPV--ASFRFVESYKKLAAKVEYR
A0A173SMI2      FRRKKK-------------------------AILVDDPV--ASFRFVESYKKLAAKVEYR
A0A174ASH7      FRRKKK-------------------------AILVDDPV--ASFRFVESYKKLAAKVEYR
A6BH65          FRRKKK-------------------------AILVDDPV--ASFRFVESYKKLAAKVEYR
R7G0D7          FRRKKK-------------------------AILVDDPV--ASFRFVESYKKLAAKVEYR
A0A2T5IYJ6      -KDTSA-------------------------IYFLDSKQ----NGYAEAMRTVRTSVVLS
A0A3C0QME1      ---------------------------------TILDEK--MDFNIVENYKSIRSNIMFA
A0A355FYK5      ----FT-------------------------GGLLITDEDKVSFAFIECVKAIRTKLENL
A0A357AQU0      KKNNFS-------------------------FETILNKE--IPFSVVESFKSIRTNIMFA
A0A3C1YJQ7      KKNNFS-------------------------FETILNKD--IPFSVVESFKSIRTNIMFA
A0A3D0JG38      KKNNFS-------------------------FETILNKE--IPFSVVESFKSIRTNIMFA
A0A3C0IHX1      SPSALR-------------------------NMLLCAKD--IPFPCSEAYRSIRTNLMFA
R5V506          SPSALR-------------------------NMLLCAKD--IPFPCSEAYRSIRTNLMFA
A0A352TIU5      SPSALR-------------------------NMLLCAKD--IPFPCSEAYRSIRTNLMFA
A0A3E5FSY5      --------------------------------ISINDRR--ISFAFKENMRSLQIRLERV
A0A1V5S3C0      -NSPKK-------------------------GLLIIDKT--VGLPFIETFKLIRTKIENA
A0A1Y3TC98      DTR-----------------------------LSLLNEK--LPFGYRESIRSLQKRVVKN
A0A1Q6REE0      -----P-------------------------YPLLHRYR--SESGFSESVRLLRLRVEKA
R5ETF9          -----P-------------------------YPLLHRYR--SESGFSESVRLLRLRVEKA
R6VAT5          SSHSTG-------------------------SLTIDDAH--TDPRFKESVFSIRNKIIKL
A0A1Q6S448      GKRLRR-------------------------NLNISSPA--ISFAFTESIHRIAEKFQHE
A0A351MYR0      GKRLRR-------------------------NLNISSPA--ISFAFTESIHRIAEKFQHE
R6HPC1          GKRLRR-------------------------NLNISSPA--ISFAFTESIHRIAEKFQHE
A0A3D4G5Z5      GRRLRR-------------------------NLNISSPA--ISFAFTESIHRIAEKFQHE
A0A3D5ES03      GKRLRR-------------------------NLNISSPA--ISFAFTESIHRIAEKFQHE
A0A0F2P7X6      QGQGQG-------------------------APLVTSDQ--VGFGFVESYKAAGTNLRFA
A0A359B487      QGQGQG-------------------------APLVNSDQ--VGFGFVESYKAAGTNLRFA
A0A348P5V4      QG------------------------------ILITDKK--SGFGFIESYKLIRTKIEHA
A0A356PT74      KP------------------------------LLISDRR--SGFPFIETFKIIRTKIEHT
A0A3D5LL19      KP------------------------------LLISDRR--SGFPFIETFKIIRTKIEHT
R5MNF0          KP------------------------------LLISDSR--SGFPFIETFKIIRTKIEHT
A0A1Q9JSI0      RKKNP---------------------------VLLTNPG--TSFRYVENMKKLARRVSSQ
A0A3D5TNI1      HGDRE---------------------------LLITDKA--CGFAFIETYKAMRTKLELL
A0A358LJD0      HGGRE---------------------------LLITDKA--CGFAFVETYKAMRTKLELL
R6I3L7          HGDRE---------------------------LLITDKA--CGFAFVETYKAMRTKLELL
A0A3D1HXX0      HGDRE---------------------------LLITDKA--CGFAFVETYKAMRTKLELL
A0A3D2QJB8      HGDRE---------------------------LLITDKA--CGFAFVETYKAMRTKLELL
D4LC36          DADRKT-------------------------RLLFGNEN--IPFSTVEAYKSFRTALSFV
R7MQJ4          DYD-----------------------------LLLTQKG--IPFTIKESYKSMRTNVMFS
A0A1V5GLC0      DDH-----------------------------FKLTDGN--IPFYITESYKSLRTNITFA
W7V182          DNH-----------------------------VKLTDKN--VPFAVVESYKSIRTNITFA
                                                                            

S3FFL2          TT--AHGVP--RTFAVTSTRPGEGKSTTALALATMLSRA-QRRVILIDGDMRSP---SVH
A0A328M4V1      AR--LEAKN--NLLLISSSSPGVGKSFVASNLAAVIAQA-GQRVLLIDADMRKG---TLH
A0A6A8IF17      TG--KDKTS--NVIIMTSFNPGSGKSFLTMNIAVSLAIK-GKKVLVIDGDLRHA---SAS
A0A3D5R4X5      SL--DKE-I--KSIVVTSTIAGEGKSLTTSNLATAIAQT-GNKVLLVDTDFRKP---SIH
A0A1I4C3N6      KR--DEK-C--PVYGILSADKGEGKTVSALNIASSLANT-GKKILFIDADLRES---RTA
A0A3B9CIM7      GK--GEK-C--PVYAITSADPGEGKTLTCINLASAYAQL-GKKILLIDADMRKS---NLK
A0A1G9WHW8      AK--DQK-C--PIYGITSADSGEGKSLNSMNLAISYSFL-GKKVLLIDGDLRKS---GIS
A0A1H5VAA0      AK--DQK-C--PIYGITSADSGEGKSLNSMNLAISYSFL-GKKVLLIDGDLRKS---GIS
A0A3R6VK11      GK--GER-C--PVYAVTSADKDEGKTLNSVNIAISYAQL-GKKVLLIDGDMRNM---SVA
A0A3R6QUY7      GK--GER-C--PVYAVTSADKDEGKTLNSVNIAISYAQL-GKKVLLIDGDMRNM---SVA
A0A373K3P9      GK--GER-C--PVYAVTSADKDEGKTLNSVNIAISYAQL-GKKVLLIDGDMRNM---SVA
A0A3R6JRU5      GK--GER-C--PVYAVTSADKDEGKTLNSVNIAISYAQL-GKKVLLIDGDMRNM---SVA
A0A1C5MS04      GK--GER-C--PVYAVTSADKDEGKTLNSVNIAISYAQL-GKKVLLIDGDMRNM---AVA
A0A3C1J150      GK--GEH-C--PVYAVTSADKDEGKTLNSVNIAISYAQL-GKKVLLIDGDMRNM---SVA
A0A416CXD7      GK--GEH-C--PVYAVTSADKDEGKTLNSVNIAISYAQL-GKKVLLIDGDMRNM---SVA
A0A6N2X662      GK--GER-C--PVYAVTSADKDEGKTLNSVNIAISYAQL-GKKVLLIDGDMRNM---SVA
R6XBL9          GK--GER-C--PVYAVTSADKDEGKTLNSVNIAISYAQL-GKKVLLIDGDMRNM---SVA
A0A355W5Z7      GK--GER-C--PVYAVTSADKDEGKTLNSVNIAISYAQL-GKKVLLIDGDMRNM---SVA
A0A143WVN6      MT--RHQ-Q--KVLLVCSVAENEGKSSVASNIALALADR-HKKVLLVDGDLRKP---ALH
W6RXP9          SF--DEK-H--RVMVVTSSTPGEGKSTTTGNLALALAEG-EAKVILIDCDMRKP---TVH
W6S4G8          SI--DSR-C--KTIVVTSSQKGEGKTTISGNLALSLAGW-GNRVVLIDCDIRRA---ALH
A0A1G6BLB6      MN--HRN-S--KVLMVTSVLENEGKSTVAVNLALELVEE-EQKVLLIDGDFRKP---ALY
A0A1C6G8M0      SK--D---V--KMIAVTSAFENQGKSFISFHLAYSLSQV-GKRVLLVDTDMRKS---VLQ
A0A416MP73      SK--D---V--KTIVVTSAFENQGKSFISFHLAYSLSQV-GKRVLLVDTDMRKS---VLQ
A0A3E4LL92      MS--AEG-Y--KTLMVGSIKENDGKSTVTANMVLDLARR-GKKVVLVDCDMRHP---SLA
A0A415D1L1      MS--AEG-Y--KTLMVGSVKENDGKSTVTANIALNLARR-GKKVVLVDCDMRHP---SLA
A0A0H5SF45      IR--KNG-C--KKILVNSPNPRDGKSTTCTNIAIALAKT-GARVLLIDCDLRKG---RLH
A0A1M6JRJ5      IR--KEE-C--KKILITSPSPEDGKSTTSINLSIAISQA-GYKVLLIDCDLRKG---RLH
A0A1M7Y1S2      IR--KEG-C--KKILITSPSPEDGKSTISINLSIAIAHA-GYKVLLIDCDLRKG---RIH
A0A7I8DMN1      IR--KEE-C--KKILITSPSPEDGKSTTSINLAIAISQS-GYKVLLIDGDLRKG---RIH
A0A396G6S7      MD--KED-A--KVLLVTSVMENEGKSTVAANLALSLAQG-GSRVMLIDCDFRKP---AQY
A0A3E5A223      MD--KED-A--KVLLVTSVMENEGKSTVAANLALSLAQE-GSRVMLIDCDFRKP---AQY
R7D5E6          MD--KED-A--KVLLVTSVMENEGKSTVAANLALSLAQG-GSRVMLIDCDFRKP---AQY
A0A415HQH5      MD--KED-A--KVLLVTSVMENEGKSTVAANLALSLAQG-GSRVMLIDCDFRKP---AQY
A0A414W2C6      MD--KED-A--KVLLVTSVMENEGKSTVAANLALSLAQE-GSRVMLIDCDFRKP---AQY
A5ZNE7          MD--KED-A--KVLLVTSVMENEGKSTVAANLALSLAQE-GSRVMLIDCDFRKP---AQY
A0A395X821      MD--KED-A--KVLLVTSVMENEGKSTVAANLALSLAQG-GSRVMLIDCDFRKP---AQY
A0A1C5PY68      MD--KED-A--KVLLVTSVMENEGKSTVAANLALSLAQG-GSRVMLIDCDFRKP---AQY
A0A174CJF8      MD--KED-A--KVLLVTSVMENEGKSTVAANLALSLAQG-GSRVMLIDCDFRKP---AQY
A0A564SRR2      MD--KED-A--KVLLVTSVMENEGKSTVAANLALSLAQE-GSRVMLIDCDFRKP---AQY
A0A174R7V0      MD--KED-A--KVLLVTSVMENEGKSTVAANLALSLAQG-GSRVMLIDCDFRKP---AQY
A0A373MWV2      LD--RRG-G--KVLLVTSVAENEGKSTLAANLALALSEE-QNRVLLLDCDFRQP---ALY
A0A417CE88      LD--RRG-G--KVLLVTSVAENEGKSTLAANLALALSEE-QNRVLLLDCDFRQP---ALY
A0A416Y441      LD--RRG-G--KVLLVTSVAENEGKSTLAANLALAISEE-QNRVLLLDCDFRQP---ALY
A0A357GPJ7      LD--RRG-G--KVLLVTSVAENEGKSTLAANLALALSEE-QNRVLLLDCDFRQP---ALY
A0A396PAC1      LD--RRG-G--KVLLVTSVAENEGKSTLAANLALALSEE-QNRVLLLDCDFRQP---ALY
A0A416EYU4      LD--RRG-G--KVLLVTSVAENEGKSTLAANLALALSEE-QNRVLLLDCDFRQP---ALY
A0A416SCQ2      LD--RRG-G--KVLLVTSVAENEGKSTLAANLALALSEE-QNRVLLLDCDFRQP---ALY
A0A416TGN7      LD--RRG-G--KVLLVTSVAENEGKSTLAANLALALSEE-QNRVLLLDCDFRQP---ALY
A0A417SMF6      LD--RRG-G--KVLLVTSVAENEGKSTLAANLALALSEE-QNRVLLLDCDFRQP---ALY
A0A1Y4MW77      LA--DIN-G--KTLIFTSTVAKEGKSTIATNVAYALAKN-NKKVLLIDADLRKQ---DLS
R6UHV6          SK--THH-N--KVYAVTSSLENEGKTTVAVNLALSLAKM-DYKVLLIDGDLRKP---AVA
A0A3R9Q621      LR--KDG-C--KIIMINSPMPEDGKSTTCANLGITMAQT-GARVLLVDCDLRKG---KLH
A0A069RC75      NI--DQN-I--KTILFTSSIPGEGKTLVSANMATALCGI-GKKVMLFDCDFRKP---RLA
A0A6S6R676      LR--KEG-C--KKIIVSSPVPEDGKSTTSTNIAITIAQT-NSRVLVLDCDLRKG---RLH
A0A174F2W5      LD--RRG-G--KVLLVTSVAENEGKSTLAANLALALSEE-QNRVLLLDCDFRQP---ALY
A0A174S8E9      LD--RRG-G--KVLLVTSVAENEGKSTLAANLALALSEE-QNRVLLLDCDFRQP---ALY
A0A416ZL97      LN--RKG-G--KVLLVTSVAENEGKSTLAANLALALAEE-QNRVLLLDCDFRQP---ALH
A0A174LSK1      LD--RKG-G--KVLLVTSVAENEGKSTLAANLALALAEE-QNRVLLLDCDFRQP---ALH
A0A373GY92      LD--RKG-G--KVLLVTSVAENEGKSTLAANLALALAEE-QNRVLLLDCDFRQP---ALH
A0A373NZQ6      LD--RKG-G--KVLLVTSVAENEGKSTLAANLALALAEE-QNRVLLLDCDFRQP---ALH
A0A417I9B9      LD--RKG-G--KVLLVTSVAENEGKSTLAANLALALAEE-QNRVLLLDCDFRQP---ALH
A0A417MP97      LD--RKG-G--KVLLVTSVAENEGKSTLAANLALALAEE-QNRVLLLDCDFRQP---ALH
A0A417WQF8      LD--RKG-G--KVLLVTSVAENEGKSTLAANLALALAEE-QNRVLLLDCDFRQP---ALH
A0A373RZ83      LD--RKG-G--KVLLVTSVAENEGKSTLAANLALALAEE-QNRVLLLDCDFRQP---ALH
A0A416U6I1      LD--RKG-G--KVLLVTSVAENEGKSTLAANLALALAEE-QNRVLLLDCDFRQP---ALH
R7JQZ9          LD--RKG-G--KVLLVTSVAENEGKSTLAANLALALAEE-QNRVLLLDCDFRQP---ALH
A0A7C6SMH0      NI--DKE-V--KTMVLTSPSMGDGKSVTAANLAVTLAKS-GKKVLIVDADLRKP---KVH
A0A3B8KKL6      NI--DKE-V--KTMVVTSPSMGDGKSVTAANLAVILAKS-GKRVLIVDADLRKP---KVH
A0A2K9E6R0      NI--DKE-V--KTMVVTSPSMGDGKSVTAANLAVILAKS-GKRVLIVDADLRKP---KVH
A0A2S8RBI0      NI--DKE-V--KTMVVTSPSMGDGKSVTAANLAVTLAKS-GKRVLIVDADLRKP---KVH
A0A0L6JLG6      SV--DKD-M--KVILLTSPSLGDGKTVTTVNLAITLAQS-GKKVLVIDADLRKP---KVH
G8LSN0          SV--DKE-L--KTIVITSPALGDGKTVTSVNMAVTLAKS-GKKVLLIDSDLRKP---KVH
A0A1M5UYN6      SI--DKK-I--RTIVVTSAGQGEGKTQVSGNLALTMANL-EKKTIIIDCDMRRP---NVH
A0A176JBT8      RQ--SKQ-P--VTILVTSTSAGDGKSLTCGNLAVTLAKD-NKKVVFVDSDMRKP---NGH
A0A1I5HIC6      GK--D---I--KTICITSSLPDEGKTVVAFRLATALSES-GKKVLFIDADLRKS---VIV
A0A1Y3TC51      MR--RHR-Q--KMLLVSSIAENEGKSTVAANLALALAEK-HKKVLLVDGDLRRP---AQH
A0A1Y3T1N0      MR--RND-Q--KILLVTSISENEGKSTVAANIALALAEK-HQKVLLVDGDLRQP---AQY
A0A1Y3Y8U8      MR--RND-Q--KILLVTSISENEGKSTVAANIALALAEK-HQKVLLVDGDLRQP---AQY
A0A5B0BQY5      IK--QKK-V--KTIMMTSSGAGEGKTFIGSNLAVKLAMD-GQKTLFIDADFRKS---DGR
A6CLL4          LK--KEK-T--KVLLVTSSGASEGKSLTTGNLAISMAMD-GVKTVVIDMDLRKG---VGS
A0A176U8D6      SK--D---V--KTIAVTSAFENQGKSFISFHLAYSLSQV-GKRVLLVDTDMRKS---VLQ
A0A1Q6KSQ5      SK--D---V--KMIAVTSAFENQGKSFISFHLAYSLSQV-GKRVLLVDTDMRKS---VLQ
A0A3D3U8B3      SK--D---V--KMIAVTSAFENQGKSFISFHLAYSLSQV-GKRVLLVDTDMRKS---VLQ
A0A3E5FRL7      LN--RYN-Y--QVLLVTGISENEGKSTVAANICLSFVEK-NKKVLLIDGDFRKP---AQY
A0A1Y4QK93      FD--KHN-F--KVLLVTGIGENDGKSTVAANICLLFVEK-NKKVLLIDGDFRKP---AQY
B1C232          FD--KHN-F--KVLLVTGTGENEGKSTVAANICLSFVEK-NKKVLLIDGDFRKP---AQY
A0A401USI6      ME--NRG-I--KTLMVCSPGPKDGKTSVSTNIASTIAQT-GKSILLIDCDLRKP---CIH
A0A1V4IQ10      ES--EKN-I--KTILITSSKLQEGKSTVAGNLALSFAEN-DNKVIIVDCDLRKP---SLH
A0A1S8TRD2      ES--EKT-I--KTILVTSSKLQEGKSTVAGNLALSFAEN-DKKVIIVDCDLRKP---SLH
G7M1U2          ES--EKT-I--KTILVTSSKLQEGKSTVAGNLALSFAEN-DKKVIIVDCDLRKP---SLH
A0A2T6KJ75      LS--KNN-A--KTLLVTSAESGDGKSFVSANLSIVFAMD-QKKTVFIDADLRRG---TGR
A9KN92          GK--D---I--KTICITSSLPNEGKTVVSFRLATAFADS-GKKVLFIDADLRKS---VII
A0A352MUJ1      KG--SDGDL--KSVLITSSLPGEGKSWVATNLAITFARG-GYRTILVDADMRKG---VQH
R5YI67          NG--SEG-L--KSVLITSALPGAGKSWVATNLAITFARG-GYRTILVDADMRKG---IQH
A0A174DL89      NV--NYN-L--KKILITSSSPSEGKSTIISNLGISMALT-NKKVIIIDCDMRKP---KIH
A0A1Y0IQP5      EA--GQH-V--KVLMVTSTAAGEGKTTVIANLAVTMAQA-GKKVLLIDGDLRKP---TLH
A0A4R2R7B1      EA--GKH-V--KVLIVTSTLAGEGKSMVLANLAVTMAQA-GKRVLLIDGDLRKP---TLH
A0A1M6E8I2      NL--DNN-M--KTILITSATPGEGKTQTVMNLAVAMAQN-DKKVIVVDCDMRKP---RIH
A0A1Y4N105      MR--RRN-Q--QVLLVTSVAENEGKSSTAGNIALSMVDR-GKKVVIIDCDFRKP---ALY
A0A1Y4QP75      MR--RRN-Q--QVLLVTSVAENEGKSSIAGNIALSMVDR-GKKVVIIDCDFRKP---ALY
A0A3D4QRB5      NV--DNN-L--KVLMVTSTSKDEGKSSTAANLAVSIAQS-NKKVLLIDCDLRSS---IVH
A0A349DEH5      SA--RTG-N--KVFLITSACENEGKTTSCVNIALSLAQN-GKKVLIIDADLRKP---SVS
A0A3D4T7B4      SA--RTG-N--KVFLITSACENEGKTTSCVNIALSLAQN-GKKVLIIDADLRKP---SVS
A0A350XYC7      ST--RTG-N--KVFLVTSACENEGKTTVCVNVALSLAQN-GKNVLIIDADLRKP---SVG
R6DNR8          ST--KTG-N--KVYLVTSACENEGKTTSCVNIALSLAQN-GKNVLIIDADLRKP---SVS
A0A355KUM5      ST--RTG-N--KVFLVTSACENEGKTTSCVNIALSIAQN-GKNVLIIDADLRKP---SVS
R5YGY6          ST--RTG-N--KVFLVTSACENEGKTTSCVNIALSIAQN-GKNVLIIDADLRKP---SVS
A0A0K8J554      IR--KQG-C--KKILINSPNPEEGKSTTCLNIGIALANA-GAKVLLIDCDLRKG---RLH
A0A1I0RG99      LR--FNG-C--KKIIISSPVPQDGKSTTITNVGISIAQT-GAKVLLMDCDLRKG---RLH
A0A1I5G322      LR--HQG-C--KKIVISSSLPEDGKSTITTNLGIVIGQT-GSKVLLVDCDLRKG---RLH
A0A7C6IYW8      LV--KEG-C--KKIIISSPLPGDGKSTACINLGITLSQA-GSSVLIIDCDLRKG---KLH
A0A3N1XSX6      LL--KDQ-C--KKIIVSSPVPEEGKSTTSINLGITISQT-GSKVLLIDCDLRKG---KIH
A0A7C6JZF1      LF--HGG-C--KKIIITSPLPEEGKSTTSSNLAIKLAQS-GERVLLLDCDLRKG---KIS
A0A7G9WCY6      NL--DND-L--KTIVITSTGPSEGKSTTISNLAITLIGM-GHKTLIIDADLRKP---KVH
A0A1C6G0U3      NI--DKT-I--KVIMVTSSQPGEGKSTFISNISKVFATLDDKKILLIDCDFRRP---KIH
A0A3D4LLB3      NV--DNV-I--KTIMITSAKQDEGKTTTICNLAMVMTEL-KKNILLIDLDLRKP---TVH
A0A0A5GPA9      LN--QKS-A--KTVLFTSTHSSEGKSITAANIAYSMAMD-HVNTVFVDLDLRKG---VGN
A0A271M6M4      IS--QED-A--QTILITSSHPGEGKSLTAANLAICLAMD-HMETIFVDLDLRKG---VGR
A0A7C7AD93      SK--KSG-I--KAIVITSARAQEGKSSTAAMLAIVLAQS-GKKTLLMDCDLRSP---SLH
A0A2V3W8U6      LM--DKS-L--KTILVTSTSKNEGKTITCSNLAMMMAID-NKKTVVIDADLRKE---KMG
A0A6N3BXA1      NI--DNE-M--KVILFTSTHKDEGKSILSLNTAYKFSELEETKVLLIDCDLRNP---TIN
A0A351SRI8      SI--DRK-I--KTILVTSSVPGEGKSFVASNLAVALANS-GQRVLLVDCDIRKG---RQH
A0A1V5LU59      SV--DKE-L--KTIVVTSPTLGDGKTVTAVNMAVTIAKS-GKKVLIIDTDLRKP---KVH
A0A1E3BVC3      SV--DRE-I--KTIVVTSPTLGDGKTVTAVNLAVTLARS-GKKVLVIDADLRKP---KVH
A0A4Q0I6S0      SV--DRE-I--KTIVVTSPTLGDGKTVTAVNLAVTLARS-GKKVLVIDADLRKP---KVH
A3DF66          SV--DSE-V--KTIVVTSPTLGDGKTVTAVNLAITLARS-GKKVLVIDADLRKP---KVH
W4V1T8          SV--DRE-V--KTIVVTSPTLGDGKTVTAVNLATTLARS-GKKVLVIDADLRKP---KVH
A0A1C6ITD7      NV--NSN-L--KKILITSSSPSEGKSTIISNLGISIALT-NKKVVIIDCDMRKP---RIH
A0A381IX63      NL--DEN-L--NVIAITSSKPSEGKSTMISNIGAAFGNLENKKVLIIDCDLRNP---SIH
A0A1G9IUT4      NV--DKN-I--KSIVITSSQKNEGKTTIVSSLGSSFAQL-DKKILIIDCDFRNP---SIH
A0A1M6RWV2      NL--DNK-L--KTILVTSSGPAEGKSTTISNLAVTMVNM-GHKVLLIDADFRKP---QIH
A0A143XPI5      LQ--EVS-A--KTILVNSAIQGEGKTTIAVNLALVRALR-GEKVLLIDADLRNP---SVS
A0A355G1X5      CT--RKD-Y--KTILVTSAGANEGKTTFSLNLALSLSQN-GKSVLLIDADMRKP---TLY
A0A0M6WXE3      MS--KIN-G--KVLVVTSVCENEGKSSVAGNLAITLAKK-GKRIILIDGDIRCP---AQY
A0A348SAK2      MS--KIN-G--KVLVVTSVCENEGKSSVAGNLAITLAKK-GKRIILIDGDIRCP---AQY
A0A1G9H5B9      LV--DKE-Q--KIVVITSSVSGEGKSTISANLAISCAMS-GNKVILVDSDMRRS---SQS
R5EFZ0          MD----G-G--KVLIVTSLLENEGKSTVTVNLALAMEQK-GKRVLLIDCDLRKP----AC
A0A1Y4H8L0      ME--KHH-S--KVLVVSSVSENEGKSTVAANIAISLVQR-GKKVLLIDGDLRRP---SQF
A0A4B9BMD9      MM--ETE-N--NILMITGATPDSGKTFVSSTLAAVIAQS-DQKVLFIDADLRRG---YSH
A0A0M6WYQ8      ME--EEE-F--KTLLVTSSVPEEGKTAFSVNLAIIEAKL-GKNVILVDCDMRRP---SVA
A0A348SAK1      ME--EEE-F--KTLLVTSSVPEEGKTAFSVNLAIIEAKL-GKNVILVDCDMRRP---SVS
A0A252F281      AK--QDG-A--KVFLISSFGENEGKSTISANSALSLAEK-GYHVLLIDADFRKP---AQY
A0A1Y4QKE6      FK--KEE-H--KVIVVTSTAANEGKTTLTINLAETFATN-GKRVLLIDADLRRQ---SIA
B1C231          FK--KEE-H--KVIVVTSTAANEGKTTLTINLAETFAAN-GKRVLLIDADLRRQ---SIA
A0A1Y3TUL5      LG--VGE-H--QCIYITSAEQDEGKTHVAANLAVQLSDL-EHKVLLIDLDVRNP---SLG
A0A1Y4JAX2      LG--VGE-H--QCIYITSAEQDEGKTHVAANLAVQLSDL-EHKVLLIDLDVRNP---SLG
A0A1Y4T590      LG--VGE-H--QCIYITSAEQDEGKTHVAANLAVQLSDL-EHKVLLIDLDVRNP---SLG
R5B467          MQ--HHA-Y--RTLLVSSAAPGEGKTTFVCQLALALVRQ-GRHVLVIDCDLRNP---SVH
A0A1Y3T163      MA--KEG-G--KVLLISSTASGEGKSTLAVNLSELLASR-GKRVLLIDGDLRKQ---DDA
A0A1Y3YCA2      MA--KEG-G--KVLLISSTASGEGKSTLAVNLSELLASR-GKRVLLIDGDLRKQ---DDA
A0A1Y4L6N9      ME--RID-G--KVLLVTSTVAEEGKTTVAVNLAFSLAEY-GYKVLLLDGDMRKQ---TDW
A0A173T644      LQ--DKN-G--KILLVTSTISGEGKSTVALNMAYAAALH-EKKVLFIDADLRKQ---TDR
A0A1C5TSB8      LQ--DKN-G--KILLVTSTISGEGKSTVALNMAYAAALH-EKKVLFIDADLRKQ---TDR
C0CIK6          LQ--DKN-G--KILLVTSTISGEGKSTVALNMAYAAALH-EKKVLFIDADLRKQ---TDR
A0A1Y3WEF6      LE--EKG-G--KVLVLTSTLPGEGKSTLAYNLAIAAASH-GVKVLFVDADLRKK---ADR
A0A417T0L2      LE--EKG-G--KVLVLTSTMPGEGKSTLAYNLAIAAASH-GVKVLFIDADLRKQ---ADR
A0A1H9EPU3      IQFSGRH-V--RVIGITSTVPNEGKSVLSLNLAISLAEL-GKRVIFIDADLRKSVLVGRY
A0A354IGV3      AT--RHG-R--KVILITSVGENEGKSTIAANLALGLAQR-HSKVLLIDGDLRKP---AVY
A0A417JMV2      MK--EKN-A--KTLLVASVEENEGKSTVAANLALALAEE-SEKVLLIDADLRKP---SQY
A0A415VWX5      MK--EKN-A--KTLLVASVEENEGKSTVAANLALALAEE-SEKVLLIDADLRKP---SQY
A0A173UY96      MK--EKN-A--KTLLVASVEENEGKSTVAANLALALAEE-SEKVLLIDADLRKP---SQY
B0P408          MK--EKN-A--KTLLVASVEENEGKSTVAANLALALAEE-SEKVLLIDADLRKP---SQY
D4MV82          MK--EKN-A--KTLLVASVEENEGKSTVAANLALALAEE-SEKVLLIDADLRKP---SQY
A0A173QTL1      MK--EKN-A--KTLLVASVEENEGKSTVAANLALALAEE-SEKVLLIDADLRKP---SQY
A0A174J359      MK--EKN-A--KTLLVASVEENEGKSTVAANLALALAEE-SEKVLLIDADLRKP---SQY
A0A174A3T7      MK--EKN-A--KTLLVASVEENEGKSTVAANLALALAEE-SEKVLLIDADLRKP---SQY
A0A417UUA3      MK--EKN-A--KTLLVASVEENEGKSTVAANLALALAEE-SEKVLLIDADLRKP---SQY
A0A6N2VB70      MK--EKN-A--KTLLVASVEENEGKSTVAANLALALAEE-SEKVLLIDADLRKP---SQY
A0A1C6EUV9      MK--DKQ-A--KTLLVASVEENEGKSTVAANLALALAEE-SEKVLLIDADLRKP---SQY
A0A173Y645      MK--DKQ-A--KTLLVASVEENEGKSTVAANLALALAEE-SEKVLLIDADLRKP---SQY
A0A374AVY6      MK--DKQ-A--KTLLVASVEENEGKSTVAANLALALAEE-SEKVLLIDADLRKP---SQY
R7BXS4          MK--DKQ-A--KTLLVASVEENEGKSTVAANLALALAEE-SEKVLLIDADLRKP---SQY
A0A143ZUX1      AA--ERG-Y--KKFIVTSTLADEGKSTVAANLAIALAQK-GKKVLLIDVDLRRP---TQH
A0A1W1Z4C3      MS--EKM-R--RTVLVTSAISGEGKSTIAANLAVSLALS-GKKVLLVDGDMRRA---CQS
A0A239QN83      LS--EKM-H--RTVLVTSAISGEGKSTIAANLAVSLAMS-GKKILLVDADMRRA---CQS
A0A3R9WAA7      IT--NRD-I--KTLLITSAIPAEGKSTFAFNLATAMAEL-DRKVILVDCDFRRP---SIM
A0A1G6BLF1      SL--DTK-K--NIYLVTSALPEEGKSTVAANIALSLALK-GEKVVIVDMDLRNP---SLA
R6HZX3          QP--AGG-TG-RIILITSTMPGEGKTTVSFNLAASLAQS-GKRVILVDADLRHQ---VVK
A0A1W2CEA6      GK--NLK-R----VLVSSCGANEGKTFATIQIAIGMTRR-GARVLLIDADLRLS---VMK
R7FFK6          VS--TSE-N--KIVAVTSASPNEGKSVTVANLATAISET-DKTVLLIDADMRKP---VQH
A0A373MPB9      LS--TTR-N--KIVVVSSPNPSEGKSVTVANLAASMAET-ENKVLLIDADMRKP---VQH
A0A373L519      LS--TTR-N--KIVVVSSPNPSEGKSVTVANLAASMAET-ENRVLLIDADMRKP---VQH
A0A373W906      LS--TTR-N--KIVVVSSPNPSEGKSVTVANLAASMAET-ENKVLLIDADMRRP---VQH
A0A373VCW2      LS--TTR-N--KIVVVSSPNPSEGKSVTVANLAASMAET-ENKVLLIDADMRRP---VQH
W0U604          LS--TTR-N--KIVVVSSPNPSEGKSVTVANLAASMAET-ENKVLLIDADMRRP---VQH
A0A374B6G0      LS--TTR-N--KIVVVSSPNPSEGKSVTVANLAASMAET-ENKVLLIDADMRKP---VQH
A0A373VM36      LS--TTR-N--KIVVVSSPNPSEGKSVTVANLAASMAET-ENKVLLIDADMRRP---VQH
A0A1C5P379      LS--TTR-N--KIVVVSSPNPSEGKSVTVANLAASMAET-ENKVLLIDADMRRP---VQH
A0A373XXX0      LS--TTR-N--KIVVVSSPNPSEGKSVTVANLAASMAET-ENKVLLIDADMRRP---VQH
A0A5R9MJM9      LS--TTR-N--KIVVVSSPNPSEGKSVTVANLAASMAET-ENKVLLIDADMRRP---VQH
A0A356CW82      LS--TTR-N--KIVVVSSPNPSEGKSVTVANLAASMAET-ENKVLLIDADMRRP---VQH
R6T4X7          LS--TTR-N--KIVVVSSPNPSEGKSVTVANLAASMAET-ENKVLLIDADMRRP---VQH
A0A374HTV1      LS--TTR-N--KIVVVSSPNPSEGKSVTVANLAASMAET-ENKVLLIDADMRRP---VQH
A0A374GB66      LS--TTR-N--KIVVVSSPNPSEGKSVTVANLAASMAET-ENKVLLIDADMRRP---VQH
A0A374ECC6      LS--TTR-N--KIVVVSSPNPSEGKSVTVANLAASMAET-ENKVLLIDADMRRP---VQH
A0A374BM61      LS--TTR-N--KIVVVSSPNPSEGKSVTVANLAASMAET-ENKVLLIDADMRRP---VQH
A0A373UGZ4      LS--TTR-N--KIVVVSSPNPSEGKSVTVANLAASMAET-ENKVLLIDADMRRP---VQH
A0A373SA66      LS--TTR-N--KIVVVSSPNPSEGKSVTVANLAASMAET-ENKVLLIDADMRRP---VQH
A0A1C5X6X7      LS--TTR-N--KIVVVSSPNPSEGKSVTVANLAASMAET-ENKVLLIDADMRRP---VQH
A0A1C6JIH3      LS--TTR-N--KIVVVSSPNPSEGKSVTVANLAASMAET-ENKVLLIDADMRRP---VQH
A0A373PSC3      LS--TTR-N--KIVVVSSPNPSEGKSVTVANLAASMAET-ENKVLLIDADMRRP---VQH
A0A1K1WYK8      AA--DSD-K--KVIAVSSPNPGEGKSTSAANLAIALAQT-GSAVLLIDADMRKP---VQH
A0A1H6IUB1      LS--TVD-K--KIFAVSSANPREGKSTTSSNIAIALAQG-GNKILLIDADMRKA---VQH
A0A1M7L1F9      LS--TVD-K--KIFAVSSSNPREGKSTTSANIAIALAQG-GNKILLIDADMRKA---VQH
A0A1C6B4L6      LA--TSD-K--KIFAVSSANPSEGKSIISANIAIALAQG-GNKALLIDADMRKA---VQH
A0A1Q6T9P4      LA--TSD-K--KIFAVSSANPSEGKSIISANIAIALAQG-GNKALLIDADMRKA---VQH
A0A315Y4F9      LS--TVE-K--KTFVVSSANPGEGKSTTSANIAIAIAQS-GSHVLLIDADMRKS---VQH
A0A354K620      LS--TFD-K--KVFAVSSANPGEGKSTTSANIAVAIAQS-GSHVLLIDADMRRS---VQH
A0A355G3J9      PS--DEE-NGCKTLVITSALVSEGKSTFSVNLAITLAKS-GNKVLLIDGDLRKP---KVS
A0A3D2AD87      LS--REE-K--SSFTITSANAGEGKSTTAANLAVAFSQL-GKTVLLVDADLRRA---SLH
A0A143XN92      MD--AKR-I--KTVMITSMMENEGKSTVAANLALEFAKM-GKNVLLIDLDLRKP---AQH
A0A173ZYY6      MA--KNE-Q--KVLVVTSVSENEGKSTVAANLAITLAEQ-SKRVLLVDGDIRRP---SQF
A0A6L8RXB5      MA--KNE-Q--KVLVVTSVSENEGKSTVAANLAITLAEQ-SKRVLLVDGDIRRP---SQF
A0A6N9JW85      MA--KNE-Q--KVLVVTSVSENEGKSTVAANLAITLAEQ-SKRVLLVDGDIRRP---SQF
A0A173SMI2      MA--KNE-Q--KVLVVTSVSENEGKSTVAANLAITLAEQ-SKRVLLVDGDIRRP---SQF
A0A174ASH7      MA--KNE-Q--KVLVVTSVSENEGKSTVAANLAITLAEQ-SKRVLLVDGDIRRP---SQF
A6BH65          MA--KNE-Q--KVLVVTSVSENEGKSTVAANLAITLAEQ-SKRVLLVDGDIRRP---SQF
R7G0D7          MA--KNE-Q--KVLVVTSVSENEGKSTVAANLAITLAEQ-SKRVLLVDGDIRRP---SQF
A0A2T5IYJ6      GI--DKP-H--KVVMLTSSVPSEGKSTSAINLAVALAQM--ERVLLIDGDMRKP---TIA
A0A3C0QME1      FS--TMP-R--KILAVSSANPGEGKSTTASNIAIAFAQM-ESKVLLIDADMRKP---VQH
A0A355FYK5      SA--NKG-F--KTFMVTSTYENEGKTTVAINIATSLAQK-GKSVLLIDADLRKP---AVL
A0A357AQU0      VA--TQG-K--KVIAVTSANPSEGKSSTTTNIAIAMAMA-NEKVLLIDGDLRKP---VQH
A0A3C1YJQ7      VA--TQG-K--KVIAVTSANPSEGKSSTTTNIAIAMAMA-NEKVLLIDGDLRKP---VQH
A0A3D0JG38      VA--TQG-K--KVIAVTSANPSEGKSSTTTNIAIAMAMA-NEKVLLIDGDLRKP---VQH
A0A3C0IHX1      LA--PQE-H--KIVAVTSPNAADGKSLTAANIAMAMAMM-NKKVLFIDADLRKP---VQH
R5V506          LA--PQE-H--KIVAVTSPNAADGKSLTAANIAMAMAMM-NKKVLFIDADLRKP---VQH
A0A352TIU5      LA--PQE-H--KIVAVTSPNAADGKSLTAANIAMAMAMM-NKKVLFIDADLRKP---VQH
A0A3E5FSY5      FK--KEE-H--KVIVVTSTAANEGKTTLTINLAETFAAN-GKRVLLIDADLRRQ---SIA
A0A1V5S3C0      SF--KKG-Y--KVFAVTSSAENEGKTTVAVNTALSLAKS-GKSVLLIDCDIRKP---AVY
A0A1Y3TC98      LE--HMD-G--KILMVTSSTAGEGKTTVAVNLAQMLAAD-GSRVLLIDGDLRKH---GSA
A0A1Q6REE0      MQ--ENG-Q--KILLVSSAIPGEGKTTVSVNLAVSLAQK-GRRVLLIDCDFRNP---SVA
R5ETF9          MQ--ENG-Q--KILLVSSAIPGEGKTTVSVNLAVSLAQK-GRRVLLIDCDFRNP---SVA
R6VAT5          CA--DQK-I--NSVMVASTTTNEGKTTVAANLAIALAKK-HYRTVIIDCDLRNP---TVR
A0A1Q6S448      HA--K-G-R--RVFLFSSVSAAEGKSTLAANTAISLASR-GVSVLFIDLDLRRP---VQS
A0A351MYR0      HA--R-G-R--RVFLFSSVSAAEGKSTLAANTAISLASR-GVSVLFIDLDLRRP---VQS
R6HPC1          HA--K-G-R--RVFLFSSVSAAEGKSTLAANTAISLASR-GVSVLFIDLDLRRP---VQS
A0A3D4G5Z5      HA--K-G-R--RVFLFSSVSAAEGKSTLAANTAISLASR-GVSVLFIDLDLRRP---VQS
A0A3D5ES03      HA--K-G-R--RVFLFSSVSAAEGKSTLAANTAISLASR-GVSVLFIDLDLRRP---VQS
A0A0F2P7X6      SA--VTS-A--KKLLVTSILTGEGKSTVAVNLAITIART-GKSVLLVDCDLRKS---NMH
A0A359B487      SA--VTN-A--KKLLVTSILTGEGKSTVAVNLAITIAHT-GKSVLLVDCDLRKS---NMH
A0A348P5V4      AS--RQD-Y--KAIIVTSTMENEGKTTSATNIALSLAQN-GKSVLLIDADLRKP---SVA
A0A356PT74      AQ--REK-Y--KTFVVTSTAENEGKTTSAVNIALALAQN-GKSVLLVDGDLRKP---AVA
A0A3D5LL19      AQ--REK-Y--KTFVVTSTAENEGKTTSAVNIALALAQN-GKSVLLVDGDLRKP---AVA
R5MNF0          AQ--REK-Y--KTFVVTSTAENEGKTTSAVNIALALAQN-GKSVLLVDGDLRKP---AVA
A0A1Q9JSI0      MQ--DHN-A--KTLMVTSAVENEGKSTVAANLALAMAEE-SAKVLLIDADLRKP---SQY
A0A3D5TNI1      NG--RRG-Y--KSFVISSAGANEGKTTVAVNLSLALAQN-GYSVLLIDADLRKP---SVL
A0A358LJD0      NG--RRG-Y--KSFVVSSAGANEGKTTVAVNLSLALAQN-GYSVLLVDADLRKP---SVL
R6I3L7          NG--RRG-Y--KSFVVSSTGANEGKTTVAVNLSLALAQN-GYSVLLVDADLRKP---SVL
A0A3D1HXX0      NG--RRG-Y--KSFVVSSAGANEGKTTVAVNLSLALAQN-GYSVLLVDADLRKP---SVL
A0A3D2QJB8      NG--RRG-Y--KSFVVSSAGANEGKTTVAVNLSLALAQN-GYSVLLVDADLRKP---SVL
D4LC36          IS--TCD-S--RIVAMTSANPSEGKSVTVANLAVAVAQT-DKKVLLIDADMRKP---VQH
R7MQJ4          LS--VSE-K--KVIVVSSANPGEGKSTTAANLAITFSQM-EHKVLLIDADMRKP---VQH
A0A1V5GLC0      LA--TSD-K--KIFAISSANPSEGKSTVSANTAIALAQG-GNKVLLVDADMRKS---VQH
W7V182          LS--TSE-K--KIFTVSSANPSEGKSTTSANIAIALAQG-GNKVLLIDGDLRKS---CQH
                               . .     **:                  :..* *.*        

S3FFL2          HLGG---VDHNRGLSNFLAG-----E-----ND-IASLTFSMSEL---------N-----
A0A328M4V1      KIVG---GNPERGLSELISG-----Q-----AE-LPEVLRNVDGI--------SK-----
A0A6A8IF17      SYI----DSPDKGLSDYLGG-----R-----IDNLDEIIVPDPKH--------KS-----
A0A3D5R4X5      KIAR--KPNAD-GLADVLIN-----K-----SD-YRSS--VKQSR----T---KN-----
A0A1I4C3N6      EVLG--MSGT--GLSEYLGS-----D-----EA-ELNI--QR--S----G---RG-----
A0A3B9CIM7      SLLD--IEGKE-GLSEYLAG-----I-----TK-ELKV--YK--R----A---EN-----
A0A1G9WHW8      RVLK--TTSRQ-GLSQYLAG-----I-----NK-DYEL--FN--Y----N---NN-----
A0A1H5VAA0      RVLK--TTSRQ-GLSQYLAG-----I-----NK-DYDL--FN--Y----N---NN-----
A0A3R6VK11      SLLK--LRGRL-GLSQYLAG-----L-----RE-TPQI--VE--Y----R---QN-----
A0A3R6QUY7      SLLK--LRGRL-GLSQYLAG-----L-----RE-TPQI--VE--Y----R---QN-----
A0A373K3P9      SLLK--LRGRL-GLSQYLAG-----L-----RE-TPQI--VE--Y----R---QN-----
A0A3R6JRU5      SLLK--LRGRL-GLSQYLAG-----L-----RE-TPQI--VE--Y----R---QN-----
A0A1C5MS04      SLLK--LRGRL-GLSQYLAG-----L-----RE-TPQI--VE--Y----R---QN-----
A0A3C1J150      SLLK--LRGRL-GLSQYLAG-----L-----RE-TPQI--VE--Y----R---QN-----
A0A416CXD7      SLLK--LRGRL-GLSQYLAG-----L-----RE-TPQI--VE--Y----R---QN-----
A0A6N2X662      SLLK--LRGRL-GLSQYLAG-----L-----RE-TPQI--VE--Y----R---QN-----
R6XBL9          SLLK--LRGRL-GLSQYLAG-----L-----RE-TPQI--VE--Y----R---QN-----
A0A355W5Z7      SLLK--LRGRL-GLSQYLAG-----L-----RE-TPQI--VE--Y----R---QN-----
A0A143WVN6      RIFDLHDQVKY-SLSEYLLG-----Q-----CS-FEQV---ITEV----P---NG-----
W6RXP9          KKFH--ISNDK-GLSDVLIG-----K-----VD-IMEA---AHKY----N---KN-----
W6S4G8          KAFN--ISNSK-GLTDVLVN-----Q-----AS-LKDV---AVGI----K---ET-----
A0A1G6BLB6      KVLQIDPKEVT-DLGEVLNH-----K-----IS-PKNM--IYQKE----N---SN-----
A0A1C6G8M0      RRMG--LEGVKLGLSEYLSG-----N-----AE-VGQV--IYDVG----I---PN-----
A0A416MP73      RRMG--LDGVKLGLSEYLSG-----N-----AE-LGQV--IYDVG----L---PN-----
A0A3E4LL92      KIFDAAVDPKE-QLSEYLLG-----K-----CE-LDKVLKRTEVQ----A---HP-----
A0A415D1L1      KIFDATVDPKE-QFSEYLLG-----K-----CE-LDQVLKQTEVQ----A---HP-----
A0A0H5SF45      VPFN--LNSTP-GVTNLLSG-----M-----NT-EKET--IQYTS----Y---NN-----
A0A1M6JRJ5      HYFK--AKSQP-GLSDLLSH-----I-----NS-LKEC--LYITP----Y---EN-----
A0A1M7Y1S2      HHFK--GKSQP-GLSDFLSN-----I-----NS-LKEC--LYITP----Y---DN-----
A0A7I8DMN1      HYFK--GKNQP-GLSDLLSH-----M-----NT-IKEC--LYITP----Y---DN-----
A0A396G6S7      KIFNVRDNEEK-DLGDVLIN-----H-----AS-TEKI--IRNWN----N---SG-----
A0A3E5A223      KIFNVRDNEET-DLGDVLIN-----H-----AS-TEKI--IRNWN----N---SG-----
R7D5E6          KIFNVRDNEEK-DLGDVLIN-----H-----AS-TEKI--IRNWN----N---SG-----
A0A415HQH5      KIFNVRDNEEK-DLGDVLIN-----H-----AS-TEKI--IRNWN----N---SG-----
A0A414W2C6      KIFNVRDNEET-DLGDVLIN-----H-----AS-TEKI--IRNWN----N---SG-----
A5ZNE7          KIFNVRDNEET-DLGDVLIN-----H-----AS-TEKI--IRNWN----N---SG-----
A0A395X821      KIFNVRDNEEK-DLGDVLIN-----H-----AS-TEKI--IRNWN----N---SG-----
A0A1C5PY68      KIFNVRDNEET-DLGDVLIN-----H-----AS-TEKI--IRNWN----N---SG-----
A0A174CJF8      KIFNVRDNEET-DLGDVLIN-----H-----AS-TEKI--IRNWN----N---SG-----
A0A564SRR2      KIFNVRDNEET-DLGDVLIN-----H-----AS-TEKI--IRNWN----N---SG-----
A0A174R7V0      KIFNVRDNEEK-DLGDVLIN-----H-----AS-TEKI--IRNWN----N---SG-----
A0A373MWV2      KIFELPQKAGK-DFGQVAAG-----K-----EP-ASSV--FEKYK----D---TN-----
A0A417CE88      KIFELPQKAGK-DFGQVAVG-----K-----ES-ASSV--FEKYK----D---TN-----
A0A416Y441      KIFELPQKAGK-DFGQVAVG-----K-----ES-ASSV--FEKYK----D---TN-----
A0A357GPJ7      KIFELPQKAGK-DFGQVAVG-----K-----ES-ASSV--FEKYK----D---TN-----
A0A396PAC1      KIFELPQKAGK-DFGQVAVG-----K-----ES-ASSV--FEKYK----D---TN-----
A0A416EYU4      KIFELPQKAGK-DFGQVAVG-----K-----ES-ASSV--FEKYK----D---TN-----
A0A416SCQ2      KIFELPQKAGK-DFGQVAVG-----K-----ES-ASSV--FEKYK----D---TN-----
A0A416TGN7      KIFELPQKAGK-DFGQVAVG-----K-----ES-ASSV--FEKYK----D---TN-----
A0A417SMF6      KIFELPQKAGK-DFGQVAVG-----K-----ES-ASSV--FEKYK----D---TN-----
A0A1Y4MW77      KQMN--LTTNGVGLSSIKYG-----S-----DV-VEDA--IVYLE----K---QN-----
R6UHV6          KFLEAKITNGK-SIIDFLRG-----K-----AR-LSEI--ASYDE----I---NN-----
A0A3R9Q621      RFFN--FKSMP-GLSDILSG-----L-----AS-ETEV--IHSTA----Y---KN-----
A0A069RC75      KVFG--LSNTV-GITDALMS-----K-----RD-YREF--VKETH----I---EN-----
A0A6S6R676      NFFG--IKSSP-GISDCLSG-----M-----ID-VEET--IYSTS----H---DN-----
A0A174F2W5      KIFELPQKAGK-DFGQVAAG-----K-----EP-ASSV--FEKYK----D---TN-----
A0A174S8E9      KIFELPQKAGK-DFGQVAVG-----K-----ES-ASSV--FEKYK----D---TN-----
A0A416ZL97      KIFEIPEKDGK-DFGKVVLG-----K-----ES-ASGV--FEKHK----D---TN-----
A0A174LSK1      KIFEIPEKDGK-DFGKVVLG-----K-----ES-ASGV--FEKHK----D---TN-----
A0A373GY92      KIFEIPEKDGK-DFGKVVLG-----K-----ES-ASGV--FEKHK----D---TN-----
A0A373NZQ6      KIFEIPEKDGK-DFGKVVLG-----K-----ES-ASGV--FEKHK----D---TN-----
A0A417I9B9      KIFEIPEKDGK-DFGKVVLG-----K-----ES-ASGV--FEKHK----D---TN-----
A0A417MP97      KIFEIPEKDGK-DFGKVVLG-----K-----ES-ASGV--FEKHK----D---TN-----
A0A417WQF8      KIFEIPEKDGK-DFGKVVLG-----K-----ES-ASGV--FEKHK----D---TN-----
A0A373RZ83      KIFEIPEKDGK-DFGKVVLG-----K-----ES-ASGV--FEKHK----D---TN-----
A0A416U6I1      KIFEIPEKDGK-DFGKVVLG-----K-----ES-ASGV--FEKHK----D---TN-----
R7JQZ9          KIFEIPEKDGK-DFGKVVLG-----K-----ES-ASGV--FEKHK----D---TN-----
A0A7C6SMH0      HYFG--VKNNI-GLTNILTD-----T-----KD-DLKVKAIEKTE----T---SN-----
A0A3B8KKL6      HYFG--VKNNI-GLTSILTD-----T-----KE-DIKAKAIEKTE----I---SN-----
A0A2K9E6R0      HYFG--VKNNI-GLTSILTD-----T-----KE-DIKAKAIEKTE----I---SN-----
A0A2S8RBI0      HYFG--VKNNI-GLTSILTD-----T-----KE-DIKAKAIEKTE----I---SN-----
A0A0L6JLG6      HYFG--VKNTE-GLTNILAT-----E-----KE-LKKSMIQNKEG----I---EN-----
G8LSN0          LYFG--IPNEK-GLTNIIKG-----D-----IE-DKDINVLELKD----I---PN-----
A0A1M5UYN6      RKFR--ISNEI-GLSDILSE-----Q-----AE-FEEV---VHSY----D---KH-----
A0A176JBT8      SLFN--LHNRC-GLTNYLTG-----F-----SS-SDEI--IQSTA----I---PK-----
A0A1I5HIC6      NRLK--ISNGANGLSQYLSG-----M-----ST-LEEV--IHKTN----V---EN-----
A0A1Y3TC51      KVFEEKGKERF-SFSQVLKG-----E-----AD-WKDA--AFYNK----R---SD-----
A0A1Y3T1N0      KVFEEKSAGRT-SVEQVFTG-----K-----AS-WKEN--LYYNK----A---AG-----
A0A1Y3Y8U8      KVFEEKSAGRT-SVEQVFRG-----K-----AS-WKEN--LYYNK----A---AG-----
A0A5B0BQY5      LLFN--LPERK-GLTSVISG-----F-----YE-LDTI--IQETG----I---EN-----
A6CLL4          QLFH--LPSKK-GISNYLHG-----I-----TP-LNEI--IQRTD----I---PK-----
A0A176U8D6      RRMG--LDGVKLGLSEYLSG-----N-----AE-LGQV--IYDVG----L---PN-----
A0A1Q6KSQ5      RRMG--LEGVKLGLSEYLSG-----N-----AE-VGQV--IYDVG----I---PN-----
A0A3D3U8B3      RRMG--LEGVKLGLSEYLSG-----N-----AE-VGQV--IYDVG----I---PN-----
A0A3E5FRL7      KIFDKEVLDTN-PLQDVITG-----K-----TT-LKES--IYFNK----K---SN-----
A0A1Y4QK93      KIFDKEVLDTN-PLQDVITE-----K-----KS-LKDS--IYFNK----K---SN-----
B1C232          KIFDKEVLDTN-PLQDVITG-----K-----AT-LKES--IYFNK----K---SN-----
A0A401USI6      RHFN--ITNNAKGLVDIVLQ-----E-----RK-IEEI---SIGI----D---DK-----
A0A1V4IQ10      QKFN--IPNTS-GLSDVILK-----K-----ES-LDKV---IQKH----N---EN-----
A0A1S8TRD2      EKFN--ISNTS-GLSDVILK-----R-----DS-LDNV---IQKH----N---KN-----
G7M1U2          EKFN--ISNTS-GLSDVILK-----R-----DS-LDNV---IQKH----N---KN-----
A0A2T6KJ75      NLFH--LPKRI-GITSYLAG-----Q-----CT-LHEI--IQSTE----V---PN-----
A9KN92          SKLK--IDNAVNGLSQYISG-----M-----NS-LEEV--IHKSN----V---EN-----
A0A352MUJ1      KKFR--LKQVP-GLSDFLNSRIEDYE-----NE-LPKY--VQPTE----L---DN-----
R5YI67          KKFR--LNQVP-GLSDFLSSSSENLE-----EE-LQKC--IQPTE----L---DN-----
A0A174DL89      RIFS--LSNII-GLSHILSN-----Q-----AE-LEEC--LQSSG----I---NN-----
A0A1Y0IQP5      HVFH--LGGQK-GLTEVLCE-----E-----TP-LEDV---IVPS----A---AG-----
A0A4R2R7B1      HVFH--LGGQI-GLTEVLCE-----G-----VA-PEEV---ILPS----A---AG-----
A0A1M6E8I2      KILN--ISNTS-GIAEYLMD-----G-----RN-IDDY--INRMY----N---LD-----
A0A1Y4N105      KVFE--LKELKNGLSDYLDG-----N-----CK-YEDI----ITY----Q---NN-----
A0A1Y4QP75      KVFE--LKELKNCLSDYLDG-----N-----CK-YEDI----ITY----Q---NN-----
A0A3D4QRB5      RIFH--LLNEK-GLTNILVG-----E-----AE-PSSI--VNSGG----I---SN-----
A0A349DEH5      KLLS--LPDTDCGLSDVILG-----N-----AT-LNQA--IKLVN----N---FN-----
A0A3D4T7B4      KLLS--LPDTDCGLSDVILG-----N-----AT-LNQA--IKLVN----N---FN-----
A0A350XYC7      KMLS--LKENDRGLSDVILG-----K-----VE-LNKA--IKSVN----T---FN-----
R6DNR8          KMLS--LQDTEEGLSDVILG-----K-----AD-LGKA--IKSVN----S---FN-----
A0A355KUM5      KMLS--LPATEYGLSDVILG-----N-----VE-LNQA--IKRVT----S---FN-----
R5YGY6          KMLS--LPTTEYGLSDVILG-----N-----VE-LNQA--IKRVT----S---FN-----
A0A0K8J554      KPLN--VKSTP-GLSNVLSV-----M-----KT-DEEV--VQDTD----Y---EN-----
A0A1I0RG99      RLFN--IQLIP-GVSDALSS-----T-----MD-VKKS--IYKTS----Y---DN-----
A0A1I5G322      NFFN--IKSSP-GVTNVLSN-----M-----ID-IENA--IQKTT----Y---DN-----
A0A7C6IYW8      SYFN--IKYRP-GLSDALSG-----M-----VE-FKDA--IRKTS----H---EN-----
A0A3N1XSX6      NYFN--LKYKP-GLSDVLSG-----M-----AE-LTNV--IRKTS----Y---EN-----
A0A7C6JZF1      SYFK--LRSKP-GMSDLLSG-----L-----LS-EKEV--IQYTP----Y---EK-----
A0A7G9WCY6      KVFN--LDNDS-GMTNVLMG-----E-----SL-ENAV---KRIG----G---IK-----
A0A1C6G0U3      KIFK--ISNTQ-GLTNILVK-----N-----IH-ISEC----INT----V---SG-----
A0A3D4LLB3      KQFK--LSNKT-GLTDLLMK-----K-----DD-YKAY---LQNI----Y---PG-----
A0A0A5GPA9      HLFN--NPVRK-GATNYLEG-----Y-----AS-IDEV--VSRTD----I---PH-----
A0A271M6M4      QLFH--IPLRK-GVTTYLEG-----M-----AT-IEEI--IVKTN----V---SN-----
A0A7C7AD93      SIFA--TP-QV-GLSNYLSG-----E-----ES-ALED-IVYESI----T---AN-----
A0A2V3W8U6      M-----SNGQI-GLTHYLAG-----N-----RS-VQDI--LLDTF----T---PN-----
A0A6N3BXA1      KILN--KPNQK-GVMDILLG-----K-----KD-IKNS--IEKVN--------DK-----
A0A351SRI8      RIFG--SPNKK-GLSNLLLE-----D-----VA-QVYRTYINESD----V---PN-----
A0A1V5LU59      LYFG--IKNAE-GVTNMLSS-----D-----KG-NNKVKPTKIEG----I---SN-----
A0A1E3BVC3      HYFG--VKNKE-GLTNILTD-----S-----KE-DIKVKPTEKSD----I---SN-----
A0A4Q0I6S0      HYFG--VKNKE-GLTNILTD-----S-----KE-DIKVKPTEKSD----I---SN-----
A3DF66          HYFG--VKNKE-GLTNLLTD-----S-----KE-EVKIKTTERSD----I---SN-----
W4V1T8          HYFG--VKNKE-GLTNLLTE-----S-----KE-EIKIKTTEKSD----I---SN-----
A0A1C6ITD7      RLFS--LSNII-GLSHILSN-----Q-----AE-LEEC--LQSSG----I---EN-----
A0A381IX63      RMFG--LSNAI-GLTDVLIG-----N-----KT-FNQC--VQNTE----V---KN-----
A0A1G9IUT4      KVFD--ISNKQ-GIADVLLN-----K-----VN-LKDC--VHEIS----S---EN-----
A0A1M6RWV2      KIFN--LSNDV-GMTNILMG-----E------K-LEDV--IHTVG----G---LK-----
A0A143XPI5      QVLHLDTNK--KEIADVLEG-----K-----LS-WKSA--LISEQ----E---TG-----
A0A355G1X5      RFLNLNIPRG-NDLASVICG-----K-----TD-LSDA--IKYVE----K---YK-----
A0A0M6WXE3      LLLGMSPKKE-NELGEFLNG-----R-----TG-ANNI--LLNTE----R---KR-----
A0A348SAK2      LLLGMSPKKE-NELGEFLEG-----R-----ID-ANHI--LLNTE----R---KR-----
A0A1G9H5B9      EIFKYETDK--EGLSDVLAG-----R-----CQ-WQNV--IMKDV----A---QK-----
R5EFZ0          GMVLGQSKFT-YGLNDILGG-----K-----EN-LSEC--FLRYQ----N---SD-----
A0A1Y4H8L0      LILGIETQDK-NELGEYLKS-----G-----RF-SDEI--ITKTD----I---GG-----
A0A4B9BMD9      NL--FTVSNE-HGLSEYLAG-----K-----DE-LNKV--IQHFG----K---GG-----
A0A0M6WYQ8      KAM-NQEGEF-PGLQAVLQG-----K-----VK-ISEA--MTTVELEKCP---GS-----
A0A348SAK1      KAM-NQEGEF-PGLQAVLQG-----K-----VK-ISEA--MTTVELEKCP---GS-----
A0A252F281      KVLNRDVDEA-NCLGEYLRG-----T-----CS-VDKI--IQTNA----E---VN-----
A0A1Y4QKE6      SI--LHCKDN-QGLIDVYLQ-----K-----GD-VLKN--IRKLD----D---SK-----
B1C231          KI--LKCDNN-EGLVDLYLQ-----K-----GD-VLKN--IRKLD----N---SK-----
A0A1Y3TUL5      GLFLDKVDYA-HSLNALYRG-----D-----AS-PEDV--ITHLT----G----------
A0A1Y4JAX2      GLFLDKVDYA-HSLNALYRG-----D-----AS-PEDV--ITHLT----G----------
A0A1Y4T590      GLFLDKVDYA-HSLNALYRG-----D-----AS-PEDV--ITHLT----G----------
R5B467          KT--LGRPAQ-TGLAEYLAG-----T-----AK-PGQI--VTALG----K---DK-----
A0A1Y3T163      GI--IGIRDG-AGLADIVKG-----E-----KT-IREG--LRKLK----K---SG-----
A0A1Y3YCA2      GI--IGIRDS-AGLADIVKG-----E-----KT-IREG--LRKLK----K---SG-----
A0A1Y4L6N9      KY--IEGVKG-KGLYEVLRK-----E-----CT-VKDA--IFHDE----E---SG-----
A0A173T644      RC--LTETEG-KGLYGVVTG-----K-----CS-LEKA--VEKDG----R---SG-----
A0A1C5TSB8      RC--LTETEG-KGLYGVVTG-----K-----CS-LEKA--VEKDG----R---SG-----
C0CIK6          RC--LTETEG-KGLYGVVTG-----K-----CS-LEKA--VEKDG----R---SG-----
A0A1Y3WEF6      KH--LTEEKG-RGLASVVTG-----K-----CS-LQEA--VYREE----E---TG-----
A0A417T0L2      KH--LTEEKG-RGLASVVAG-----K-----CT-LKEA--VYREK----E---TG-----
A0A1H9EPU3      KI----SKQV-KGLTHYLSG-----V-----NS-FDEV--VCETN----V---KN-----
A0A354IGV3      KLLQLRLQPE-QALSHYLSD-----DSVRLSDF-VSSA--VMQEE----K---TG-----
A0A417JMV2      KIFGLDQEEI-QQFGEVLNG-----N-----EQ-IDNL--VTDLP----K---SE-----
A0A415VWX5      KIFGLDQEEI-QQFGEVLNG-----N-----EQ-IDNL--VTDLP----K---SE-----
A0A173UY96      KIFGLDQEEI-QQFGEVLNG-----N-----EQ-IDNL--VTDLP----K---SE-----
B0P408          KIFGLNQEEI-QQFGEVLNG-----N-----EQ-IDNL--VTDLP----K---SE-----
D4MV82          KIFGLNQEEI-QQFGEVLNG-----N-----EQ-IDNL--VTDLP----K---SE-----
A0A173QTL1      KIFGLDQEEI-QQFGEVLNG-----N-----EQ-IDNL--VTDLP----K---SE-----
A0A174J359      KIFGLDQEEI-QQFGEVLNG-----N-----EQ-IDNL--VTDLP----K---SE-----
A0A174A3T7      KIFGLDQEEI-QQFGEVLNG-----N-----EQ-IDNL--VTDLP----K---SE-----
A0A417UUA3      KIFGLDQEEI-QQFGEVLNG-----N-----EQ-IDNL--VTDLP----K---SE-----
A0A6N2VB70      KIFGLDQEEI-QQFGEVLNG-----N-----EQ-IDNL--VTDLP----K---SE-----
A0A1C6EUV9      KIFGLAPEEV-QEFGEVLNG-----N-----EK-ADHL--VHALA----K---SE-----
A0A173Y645      KIFGLAPEEV-QEFGEVLNG-----N-----EK-SDHL--VHALA----K---SE-----
A0A374AVY6      KIFGLAPEEV-QEFGEVLNG-----N-----EK-SDHL--VHALA----K---SE-----
R7BXS4          KIFGLAPEEV-QEFGEVLNG-----N-----EK-SDHL--VHALA----K---SE-----
A0A143ZUX1      NLFQQTTYRN-KGLSDILTG-----S-----VY-PMDA--IHHNE----K---YG-----
A0A1W1Z4C3      EMFYYDPNS--PGLSDILTS-----N-----IK-VEQA--ILNST----W---DN-----
A0A239QN83      EIFYYDPNA--SGLADILTG-----S-----TT-AKKA--IVSTV----W---EN-----
A0A3R9WAA7      KMLPYSAGT--VCLNDVLKE-----K-----EK-LTDA--IRYYD----E---YK-----
A0A1G6BLF1      DSFALESVK--CGTIDVLKG-----R-----KE-IQDA--LVQYK----D---TS-----
R6HZX3          ARFGITTPSA-GLLELSRAA-----K-----PD-IARV--LIPVP----G--VAN-----
A0A1W2CEA6      EKYDIHFGGQPTGLAHLLSG-----Q-----CA-LEDA--IYHTN----I---PG-----
R7FFK6          KNFQVS--NK-LGLSNVITD-----A-----SL-LDEA--LHQNV----T---GT-----
A0A373MPB9      RNFKLK--NN-VGLSTILSG-----E-----ST-FDKC--VHETK----N---GN-----
A0A373L519      RNFKLK--NN-VGLSTILSG-----E-----ST-FDKC--VHETK----N---GN-----
A0A373W906      RNFKLK--NN-VGLSTILSG-----E-----ST-FDKC--VHETK----N---GN-----
A0A373VCW2      RNFKLK--NN-VGLSTILSG-----E-----ST-FDKC--VHETK----N---GN-----
W0U604          RNFKLK--NN-VGLSTILSG-----E-----ST-FDKC--VHETK----N---GN-----
A0A374B6G0      RNFKLK--NN-VGLSTILSG-----E-----ST-FDKC--VHETK----N---GN-----
A0A373VM36      RNFKLK--NN-VGLSTILSG-----E-----ST-FDKC--VHETK----N---GN-----
A0A1C5P379      RNFKLK--NN-VGLSTILSG-----E-----ST-FDKC--VHETK----N---GN-----
A0A373XXX0      RNFKLK--NN-VGLSTILSG-----E-----ST-FDKC--VHETK----N---GN-----
A0A5R9MJM9      RNFKLK--NN-VGLSTILSG-----E-----ST-FDKC--VHETK----N---GN-----
A0A356CW82      RNFKLK--NN-VGLSTILSG-----E-----ST-FDKC--VHETK----N---GN-----
R6T4X7          RNFKLK--NN-VGLSTILSG-----E-----ST-FDKC--VHETK----N---GN-----
A0A374HTV1      RNFKLK--NN-VGLSTILSG-----E-----ST-FDKC--VHETK----N---GN-----
A0A374GB66      RNFKLK--NN-VGLSTILSG-----E-----ST-FDKC--VHETK----N---GN-----
A0A374ECC6      RNFKLK--NN-VGLSTILSG-----E-----ST-FDKC--VHETK----N---GN-----
A0A374BM61      RNFKLK--NN-VGLSTILSG-----E-----ST-FDKC--VHETK----N---GN-----
A0A373UGZ4      RNFKLK--NN-VGLSTILSG-----E-----ST-FDKC--VHETK----N---GN-----
A0A373SA66      RNFKLK--NN-VGLSTILSG-----E-----ST-FDKC--VHETK----N---GN-----
A0A1C5X6X7      RNFKLK--NN-VGLSTILSG-----E-----ST-FDKC--VHETK----N---GN-----
A0A1C6JIH3      RNFKLK--NN-VGLSTILSG-----E-----ST-FDKC--VHETK----N---GN-----
A0A373PSC3      RNFKLK--NN-VGLSTILSG-----E-----ST-FDKC--VHETK----N---GN-----
A0A1K1WYK8      RTFKIK--ND-EGLSTLIIK-----K-----SS-MAKS--VKSNV----I---NN-----
A0A1H6IUB1      KVFGLK--NK-KGLSSAISK-----M-----CS-LEEC--IHKNV----M---EN-----
A0A1M7L1F9      KIFGLK--NK-KGLSSAISK-----M-----SK-LEEC--IQKDV----M---EN-----
A0A1C6B4L6      KIFEIK--NK-KGLSTAISK-----M-----NK-LDEC--IQKNV----M---EN-----
A0A1Q6T9P4      KIFEIK--NK-KGLSTAISK-----M-----NK-LDEC--IQKNV----M---EN-----
A0A315Y4F9      KIFELV--NK-KGLSTAVSK-----M-----HT-PDEC--IQKNV----M---EN-----
A0A354K620      KIFELV--NK-KGLSTAVSK-----M-----HS-PDKC--IQKNV----M---EN-----
A0A355G3J9      LYLDLY--GK-YGLSEYLAN-----L-----TD-ELCP--MNYSE----N----------
A0A3D2AD87      KKFKLE--NG-KGLADVLTG-----T-----AT-LDEA--IVTIK--------PG-----
A0A143XN92      DIFGRKGEQF-VGIAEWLEN-----K-----ID-LKEK--IVRIN----N---SN-----
A0A173ZYY6      LIFGMEPKEE-NELGEYLRG-----N-----GS-LADV--MVPCT----R---KH-----
A0A6L8RXB5      LIFGMEPKEE-NELGEYLKG-----N-----RA-LADV--MVPCT----R---KH-----
A0A6N9JW85      LIFGMEPKEE-NELGEYLKG-----N-----RA-LADV--MVPCT----R---KH-----
A0A173SMI2      LIFGMEPKEE-NELGEYLRG-----N-----GS-LADV--MVPCT----R---KH-----
A0A174ASH7      LIFGMEPKEE-NELGEYLRG-----N-----GS-LADV--MVPCT----R---KH-----
A6BH65          LIFGMEPKEE-NELGEYLRG-----N-----GS-LADV--MVPCT----R---KH-----
R7G0D7          LIFGMEPKEE-NELGEYLKG-----N-----RA-LADV--MVPCT----R---KH-----
A0A2T5IYJ6      KVLGLPP-NS-PGLSNVVAG-----T-----SV-LDDC--ILHVE----D---AN-----
A0A3C0QME1      KVFELS--NK-KGLSTAIGH-----M-----NP-LEES--VHKGV----Y---KH-----
A0A355FYK5      RTIGVKYDDK-SGLIPIIKG-----E-----ST-YQES--IKYVK----S---LG-----
A0A357AQU0      KIYNIK--ND-SGLSNIVSK-----Q-----KK-FDAV--VHKAV----Y---KDKDCDG
A0A3C1YJQ7      KIYNIK--ND-SGLSNIVSK-----Q-----KK-FDAV--VHKAV----Y---KDKDCDG
A0A3D0JG38      KIYNIK--ND-SGLSNIVSK-----Q-----KK-FDAV--VHKAV----Y---KDKDCDG
A0A3C0IHX1      QRLKLE--NK-VGLSEVLGH-----M-----TT-WQVA--RHLAP----L---PN-----
R5V506          QRLKLE--NK-VGLSEVLGH-----M-----TT-WQVA--RHLAP----L---PN-----
A0A352TIU5      QRLKLE--NK-VGLSEVLGH-----M-----TT-WQVA--RHLAP----L---PN-----
A0A3E5FSY5      KILKCDN--N-EGLVDLYLQ-----K-----GD-VLKN--IRKLD----N---SK-----
A0A1V5S3C0      KVLGVPVGGD-KGIYDIVRG-----K-----ST-FEEA--IKYVE----K---YN-----
A0A1Y3TC98      GLLGVSG--K-YSLKDVAGM-----D-----TK-KVKA--GELLE----RIPGST-----
A0A1Q6REE0      KTLSSKSHPL-DEGRNLTNF-----T-----GS-GEAA--GALAQ----ATDVEG-----
R5ETF9          KTLSSKSHPL-DEGRNLTNF-----T-----GS-GEAA--GALAQ----ATDVEG-----
R6VAT5          QQLNIPESCS-LGIVDVITG-----T-----CS-LQDA--IVKTK----K---NG-----
A0A1Q6S448      EMLGLSVKQK-NELGTLLTE-----S-----AA-PEKI--LAAAV----TDPATG-----
A0A351MYR0      EMLGLSVKQK-NELGTLLTE-----S-----AA-PEKI--LSAVV----TDPATG-----
R6HPC1          EMLGLPVKQK-NELGTLLSE-----S-----AA-PEKI--LSAAV----TDPSTG-----
A0A3D4G5Z5      EMLGLSVKQK-NELGTLLSE-----S-----AA-PEKI--LSAAV----TDPSTG-----
A0A3D5ES03      EMLGLSVKQK-NELGTLLSE-----S-----AD-PEKI--LSAAV----TDPSTG-----
A0A0F2P7X6      GVLELDLEDH-QGLAAVLNG-----A-----CA-AEEG--IVFAA----E---QG-----
A0A359B487      GVLELDLEDN-QGLAAVLNG-----A-----CA-AEEC--IVFAT----E---QG-----
A0A348P5V4      KTLGFSASDD-EGICGIVSG-----K-----KT-LKES--IKYSE----K---YQ-----
A0A356PT74      KLLGINASED-GGVYGVING-----E-----KT-LAEA--IKYSE----K---YN-----
A0A3D5LL19      KLLGINASED-GGVYGVING-----E-----KT-LAEA--IKYSE----K---YN-----
R5MNF0          KLLGINASED-GGVYGVING-----E-----KT-LAEA--IKYSE----K---YN-----
A0A1Q9JSI0      KIFGIDKEEI-KQFGEVLNG-----N-----EN-AENL--VLPIA----N---SD-----
A0A3D5TNI1      KNLGITNISG-NGIADVVGR-----V-----KN-SSDA--IKYIE----K---YK-----
A0A358LJD0      KNLGISNLSG-NGIADVVNG-----A-----KN-SSDA--IKYIE----K---YK-----
R6I3L7          KNLGISNLSG-NGIADVVNG-----E-----KN-SSDA--IKYIE----K---YK-----
A0A3D1HXX0      KNLGISNLSG-NGIADVVNG-----A-----KN-SSDA--IKYIE----K---YK-----
A0A3D2QJB8      KNLGISNLSG-NGIADVVNG-----A-----KN-SSDA--IKYIE----K---YK-----
D4LC36          KCFRLSN--K-VGLSDVITG-----D-----KP-LDKA--LNRNV----T---GS-----
R7MQJ4          KIFGLKN--K-KGLSSIIGK-----M-----NK-FDEC--VNKNV----V---KS-----
A0A1V5GLC0      KIFDLKN--K-KGLSTAVSK-----M-----NS-VEEC--IIRNV----E---DN-----
W7V182          KIFGIKN--K-KGLSTAISK-----M-----AA-LDEC--ISKDV----M---ED-----
                                                                            

S3FFL2          -FTAMSAGPI-PPNAAELLTGDRFGVLLTRLLDQYDHVVVDSPPVMGLADAPLIASRVEG
A0A328M4V1      -LFFISRGKI-PPNPSELLMHARFTSLLEGLKSRFDLIIIDTPPILAVTDAAVIGHHVGT
A0A6A8IF17      -MDILPVGTI-PPNPTELLFDERLKQTIDTVREQYDYVLIDCPPVELVADTQIIEKLADR
A0A3D5R4X5      -LDLMFSGLI-PPNPSELLGSKSMLEFIEKVKEEYDYVIFDTPPVALVTDAAILANEVDG
A0A1I4C3N6      -FDVILAGAK-PSNAADLLAGGKIRELINAQKENYDMIIVDLAPAGRVIDGLELADCLTS
A0A3B9CIM7      -LYVAMAGEV-PPNPAELLSGERWSELLEKCKEEYDCIFVDLPPAGIVADALVLAATATA
A0A1G9WHW8      -LDILFAGEI-PPNPMELLSSEKCKNLLESLKETYDVIFIDFPPVGEVADALALADSVTS
A0A1H5VAA0      -LDILFAGEI-PPNPMELLSSEKCKNLLESLKETYDVIFIDFPPVGEVADALALADSVTS
A0A3R6VK11      -LDVLVGGEN-PPNPSELLGGERMKELLTTLRSRYDCIIIDLPPVGIVTDALLLSHEVTA
A0A3R6QUY7      -LDVLVGGEN-PPNPSELLGGERMKELLTTLRSRYDCIIIDLPPVGIVTDALLLSHEVTA
A0A373K3P9      -LDVLVGGEN-PPNPSELLGGERMKELLTTLRSRYDCIIIDLPPVGIVTDALLLSHEVTA
A0A3R6JRU5      -LDVLVGGEN-PPNPSELLGGERMKELLTTLRSRYDCIIIDLPPVGIVTDALLLSHEVTA
A0A1C5MS04      -LDVLVGGEN-PPNPSELLGGERMKELLTTLRSRYDCIIIDLPPVGIVTDALLLSHEVTA
A0A3C1J150      -LDVLVGGEN-PPNPSELLGGERMKELLTTLRSRYDCIIIDLPPVGIVTDALLLSHEVTA
A0A416CXD7      -LDVLVGGEN-PPNPSELLGGERMKELLTTLRSRYDCIIIDLPPVGIVTDALLLSHEVTA
A0A6N2X662      -LDVLVGGEN-PPNPSELLGGERMKELLTTLRSRYDCIIIDLPPVGIVTDALLLSYEVTA
R6XBL9          -LDVLVGGEN-PPNPSELLGGERMKELLTTLRSRYDCIIIDLPPVGIVTDALLLSHEVTA
A0A355W5Z7      -LDVLVGGEN-PPNPSELLGGERMKELLTTLRSRYDCIIIDLPPVGIVTDALLLSHEVTA
A0A143WVN6      -LQIICQTRG-LNNSTKYIMSKNMLDFILKCRENYDLIVLDTPPIGAGVDVEAILNYGDT
W6RXP9          -LLILTAGKI-PPNPSEMLGSKTMKELLDRLKEVVDYIILDTPPVQAVADAQILSTRADG
W6S4G8          -LLLIPAGRV-SPNPTELLNSKAMELLLEELKETCDYVILDTAPVEAVADAQILSAKADG
A0A1G6BLB6      -LHLLLNTVI-YPNSTELLSQGLLERIIGELKREYDYIIIDCSPMALVADAEEMLNMVDN
A0A1C6G8M0      -MHVLFSGKL-VTNASALLSAKWLRTLCDSVKDSYDYIIFDTPPVGVVGDAAIVSSVCDG
A0A416MP73      -MHVLFSGKL-VPNASALLSAKWLENLCAEVRDSYDYVIFDTPPICVVGDAAIVASFCDG
A0A3E4LL92      -IYCLWQKKA-VARPYRLLESERFASLIHQLKEQFDYVVMDTPPLELIRDAEIISETADA
A0A415D1L1      -MGCIWQKKA-VAKPYRLLGSERFISLIDQLKEQFDYVVMDTPPLELIRDAEIISETADA
A0A0H5SF45      -LQIIPCGSI-APNPTELLSSIQMEELIKKLEQNYDYIIIDTAPVNLVADALSLAKMVDG
A0A1M6JRJ5      -LHMMPMGST-PPNPSELLGSKQMELLIKELETEYDYIVLDTPPVNVVADSLSFIKSTDG
A0A1M7Y1S2      -LHIMPMGSI-PPNPSELLGSRQMELLIKELEAEYDYIILDTPPINIVADSLSFIKSTDG
A0A7I8DMN1      -LHIMPMGSM-PPNPSELLGSRQMELLINDLEMEYDYIILDTPPINVVADSLSLIKSMDG
A0A396G6S7      -LYMILNKTS-SNAIETLLKSMTLKQIIAFCREKMDYVVIDTSPLALVADTEELAQMTDA
A0A3E5A223      -LYMILNKTS-SNAIETLLKSMTLKQIIAFCREKMDYVVIDTSPLALVADTEELAQMTDA
R7D5E6          -LYMILNKTS-SNAIETLLKSMTLKQIIAFCREKMDYVVIDTSPLALVADTEELAQMTDA
A0A415HQH5      -LYMILNKTS-SNAIETLLKSMTLKQIIAFCREKMDYVVIDTSPLALVADTEELAQMTDA
A0A414W2C6      -LYMILNKTS-SNAIETLLKSMTLKQIIAFCREKMDYVVIDTSPLALVADTEELAQMTDA
A5ZNE7          -LYMILNKTS-SNAIETLLKSMTLKQIIAFCREKMDYVVIDTSPLALVADTEELAQMTDA
A0A395X821      -LYMILNKTS-LNAIETLLKSMTLKQIIAFCREKMDYVVIDTSPLALVADTEELAQMTDA
A0A1C5PY68      -LYMILNKTS-SNAIETLLKSMTLKQIIAFCREKMDYVVIDTSPLALVADTEELAQMTDA
A0A174CJF8      -LYMILNKTS-SNAIETLLKSMTLKQIIAFCREKMDYVVIDTSPLALVADTEELAQMTDA
A0A564SRR2      -LYMILNKTS-SNAIETLLKSMTLKQIIAFCREKMDYVVIDTSPLALVADTEELAQMTDA
A0A174R7V0      -LYMILNKTS-SNAIETLLKSMTLKQIIAFCREKMDYVVIDTSPLALVADTEELAQMTDA
A0A373MWV2      -VYMGICRER-LEEPSEAVGGEIFRRILDMCRTNMDYIILDTPPMGAAADAEELVELADG
A0A417CE88      -VYMGICRER-LEEPSEAVGGKIFRRILDTCRTNMDYIILDTPPMGAAADAEELVELADG
A0A416Y441      -VYMGICRER-LEEPSEAVGGEIFRRILDTCRTNMDYIILDTPPMGAAADAEELVELADG
A0A357GPJ7      -VYMGICRER-LEEPSEAVGGEIFRRILDTCRTNMDYIILDTPPMGAAADAEELVELADG
A0A396PAC1      -VYMGICRER-LEEPSEAVGGEIFRRILDTCRTNMDYIILDTPPMGAAADAEELVELADG
A0A416EYU4      -VYMGICRER-LEEPSEAVGGEIFRRILDTCRTNMDYIILDTPPMGAAADAEELVELADG
A0A416SCQ2      -VYMGICRER-LEEPSEAVGGEIFRRILDTCRTNMDYIILDTPPMGAAADAEELVELADG
A0A416TGN7      -VYMGICRER-LEEPSEAVGGEIFRRILDTCRTNMDYIILDTPPMGAAADAEELVELADG
A0A417SMF6      -VYMGICRER-LEEPSEAVGGEIFRRILDTCRTNMDYIILDTPPMGAAADAEELVELADG
A0A1Y4MW77      -LYFLGGNST-IDDLTAVLTNPNMEQFMNDMRQKMDYIIFDAPPCEAFEDVFLLEKYGDA
R6UHV6          -ITIMGSNKG-TQQANELITGEKMDYLISAAREQYDYIIIDTPPLCFVSDAEDILTLSDS
A0A3R9Q621      -LHVLPMGSK-PPNPAEMLASVHMEELIAKLAKSYDYIIIDTPPINVVSDVIGLVKLVDG
A0A069RC75      -LHIMTAGNS-VQNPAELLQSERIRELIRKIENDYDYIIVDTPPATAVTDASIVSTFSDA
A0A6S6R676      -LYVMPMGSI-PPNPTELMASKQMEDLIQKLEKEYDYIIMDTPPVNVVSDSLSLVKLVDG
A0A174F2W5      -VYMGICRER-LEEPSEAVGGEIFRRILDMCRTNMDYIILDTPPMGAAADAEELVELADG
A0A174S8E9      -VYMGICRER-LEEPSEAVGGEIFRRILDTCRTNMDYIILDTPPMGAAADAEELVELADG
A0A416ZL97      -VYTGICRNR-LEEPSLAIGGEIFHRILETCRTNMDYIILDTPPMGMTADAEELAEYADA
A0A174LSK1      -VYTGICRNR-LEEPSLAIGGEIFHRILETCRTNMDYIILDTPPMGMTADAEELAEYADA
A0A373GY92      -VYTGICRNR-LEEPSLAIGGEIFHRILETCRTNMDYIILDTPPMGMTADAEELAEYADA
A0A373NZQ6      -VYTGICRNR-LEEPSLAIGGEIFHRILETCRTNMDYIILDTPPMGMTADAEELAEYADA
A0A417I9B9      -VYTGICRNR-LEEPSLAIGGEIFHRILETCRTNMDYIILDTPPMGMTADAEELAEYADA
A0A417MP97      -VYTGICRNR-LEEPSLAIGGEIFHRILETCRTNMDYIILDTPPMGMTADAEELAEYADA
A0A417WQF8      -VYTGICRNR-LEEPSLAIGGEIFHRILETCRTNMDYIILDTPPMGMTADAEELAEYADA
A0A373RZ83      -VYTGICRNR-LEEPSLAIGGEIFHRILETCRTNMDYIILDTPPMGMTADAEELAEYADA
A0A416U6I1      -VYTGICRNR-LEEPSLAIGGEIFHRILETCRTNMDYIILDTPPMGMTADAEELAEYADA
R7JQZ9          -VYTGICRNR-LEEPSLAIGGEIFHRILETCRTNMDYIILDTPPMGMTADAEELAEYADA
A0A7C6SMH0      -LDIITSGPV-PPNPYEMLSSNKMQNFIDKVKEEYDIVIFDTPPVGQVTDAAILAGLTDG
A0A3B8KKL6      -LDIITSGPV-PPNPYEMLSSNKMQSFVEKVKGEYDIVIFDTPPVGQVTDAAILAGLADG
A0A2K9E6R0      -LDIITSGPV-PPNPYEMLSSNKMQSFVEKVKGEYDIVIFDTPPVGQVTDAAILAGLADG
A0A2S8RBI0      -LDIITSGPV-PPNPYEMLSSNKMQSFVEKVKGEYDIVIFDTPPVGQVTDAAILAGLADG
A0A0L6JLG6      -LFIIPSGPI-PPNPSEILSSDKMRQLVEKLKSEYDVIFIDTPPVGQVTDAAILTGIADG
G8LSN0          -LSVITSGPI-PPNPAEILSSNKMQNLLEDLRGNYDFILLDTPPVGQVTDAAILAGIADG
A0A1M5UYN6      -LCVIPSGPM-PPNPAEMLNSIKMKFFIEKLKNDFDYIILDTPPVIPVTDAQVIANEADG
A0A176JBT8      -LSFISAGPI-SPNPHELIISKKMDLLIDRLKQKFDVILFDSSPL-LVSDSILLSGKMDG
A0A1I5HIC6      -VDIIFTGIL-PPHPSEMLGNEEFKDLVRSQREIYDYIIIDTPPLGVVIDSANVAEICDG
A0A1Y3TC51      -IWELFQFRA-VREPARILREEKLEGLAEEWKREMDYIIIDCSPVAVSADAEVWVSVADS
A0A1Y3T1N0      -IWELFQFSG-AKDPAAVFAEAPMKTLAREWKQEMDYIIIDCPPTAVSTDAEVWMEAADT
A0A1Y3Y8U8      -IWELFQFSG-AKDPAAVFAEAPMKTLAREWKQEMDYIIIDCPPTAVSTDAEVWMEAADT
A0A5B0BQY5      -LSFIGTGPL-PLNPVKFILADGMDKLLDDIKILFDVVIIDSPPL-TVADGISLIQAVDG
A6CLL4          -LFFISAGPL-PPNPTELLSSDRLSSMINTLKKEVDLILIDTPPL-IVSDAAVLSSRVDG
A0A176U8D6      -MHVLFSGKL-VPNASALLSAKWLENLCAEVRDSYDYVIFDTPPICVVGDAAIVASFCDG
A0A1Q6KSQ5      -MHVLFSGKL-VTNASALLSAKWLRTLCDSVKDSYDYIIFDTPPVGVVGDAAIVSSVCDG
A0A3D3U8B3      -MHVLFSGKL-VTNASALLSAKWLRTLCDSVKDSYDYIIFDTPPVGVVGDAAIVSSVCDG
A0A3E5FRL7      -IYELFLYHA-IDDPSKLMNAVTLKKIMEQLKEHFDYIVIDCSPVAVSVDAEVWMEVVDS
A0A1Y4QK93      -IYELFLYHA-IDDPSKLMNVVTLKKIMDQLKKHFDYIVIDCSPVAVSVDAEVWMEVVDS
B1C232          -IYELFLYHA-VDDPSKLMDVITLKKIIDQLKEQFDYIIIDCSPISVSVDAEVWMEVVDS
A0A401USI6      -FDVLTAGKA-NYNPSELLSSQKMKDFIKDMEKKYDYVILDTPPIIAFADALTLATEKIG
A0A1V4IQ10      -LYLMSSGKF-TGKPASMLASQEMDNILTELKKNFDIILLDSPPVQAVTDAQILSTKVDC
A0A1S8TRD2      -LYVISSGKF-TEKPASMLASQTMDDILTELKQKYDIILLDSPPAQAVTDAQILSSKVDC
G7M1U2          -LYVISSGKF-TEKPASMLASQTMDDILTELNQKYDIILLDSPPAQAVTDAQILSSKVDC
A0A2T6KJ75      -LSFISAGPV-PPNPTELLSSTKFVQLLEELKNQFDIIIVDTPPL-LVADTLHISANVDG
A9KN92          -RDIIFTGIL-PPNPSEMLGSEEFKNLVKNLRDEYDYIIIDTPPLGVVIDSANVADICDG
A0A352MUJ1      -LCVLPCGSI-TYDSSELLLSNRIIKTVETLKKNCDIVIFDATPSNLVTDAVVLSRLVDT
R5YI67          -LCVLTCGSI-TYDSSELLLSNKIIKAVEILKKNCDIVIFDATPSNLVTDAIVLSRLVDT
A0A174DL89      -LSILTAGVI-PPNPSELISSNGMKILLDRLTSNFDFILIDSPPLPLVADSQALSTFVDG
A0A1Y0IQP5      -PDVITAGAI-PSNPSELLGSPKLRAALADVRTRYDLVLIDSPPLLPVTDGQVLSTLCDG
A0A4R2R7B1      -PDVIPAGAI-PANPSELLGSPKLRGLLSDLRIRYDLVLIDSPPLLPVTDGQVLSTLCDG
A0A1M6E8I2      -IDVMTSGKL-PGNPSELLQSNVMKKMVEFLEKKYDYVLFDSPPVVPVTDAVVMTRYIEG
A0A1Y4N105      -LAIISQKDS-KKNSSNYFLTAQFTQFIKKCRSNFDYIIIDTPPMGACVDVEAIINHSDS
A0A1Y4QP75      -LAIISQKDS-KKNSSNYFLTTQFAQFIKKCRSNFDYIIIDTPPMGACVDVEAIINHSDS
A0A3D4QRB5      -LHIISAGPK-PPNPSELLGSTRMQAFLQQAAEIYDMIILDAPPIMPVSDALVLSKYTDG
A0A349DEH5      -VCILADQKS-VPNPSELLSTDKMEAIIDEVRKNFDYVLIDTAPASVVTDTSVIAGFVDA
A0A3D4T7B4      -VCILADQKS-VPNPSELLSTDKMEAIIDEVRKNFDYVLIDTAPASVVTDTSVIAGFVDA
A0A350XYC7      -VCVLADQNG-VNNPSELLSTEKMEHIIEEVRNAFDYVLIDTAPASVVTDTAVIAGFADA
R6DNR8          -VCVLADQKG-VNNPSELLSTEKMESIIEEVRKAFDFVLIDTAPASVVTDTSVIAGFVDA
A0A355KUM5      -VCVLADQKG-VNNPSELLSTEKMESIIEEARKEFDYVLIDTAPASVVTDTSVIAGFVDA
R5YGY6          -VCVLADQKG-VNNPSELLSTEKMESIIEEARKEFDYVLIDTAPASVVTDTSVIAGFVDA
A0A0K8J554      -LQLIACGTI-APNPTELLSSIQMEELLLRLEKRYDYIILDSAPVNLVADALSLAKLVDG
A0A1I0RG99      -LYVMPMGTI-PPNPSELLASIQMEELLSQLNNEYEYILIDTPPVKVVSDALNLVKMVDG
A0A1I5G322      -LYVLPLGTI-PPNPSELMASSQMEELLKKLEREYDYIIIDTPPVRVVSDALILMKAADG
A0A7C6IYW8      -LDIIPLGSI-SPNPSELLSSSQMEKLLVNLEKEYDYIIFDTPPVNVLSDALSLVKYSDG
A0A3N1XSX6      -LNIITIGSI-SPNPSELLSSSHMEELINVLEKDYDYIIFDTPPVNVLSDSLSLVKLSDG
A0A7C6JZF1      -LQVITMGSI-PPNPAVLLGSPQLEELFQRLEKNYDYIIIDSPPVNVVSDVLSLAKSVDG
A0A7G9WCY6      -LDILTSGPI-PPNPSELLGSKKMKDFIEECSRSYDFVLIDAPPIGIVTDSAILSSICDG
A0A1C6G0U3      -LNIITSGTK-PINPSDILASKKMINFIKQIRNEYDYIFIDSPPVNIVSDSEVLSRIVDG
A0A3D4LLB3      -LDVLTTGMI-PANPAEIINSRALKELIKEVSADYDYILLDVPPVMLVSDPIIISTFSNA
A0A0A5GPA9      -LSYVAKGPM-PKNPAEVLSSDKINTMLAELKEHFDLVIIDTPPL-VVADAVALSTRVDG
A0A271M6M4      -LSFIGTGPL-SANPAELLSSEKIDIMLETLQESYDLVIIDTPPL-VVSDAVVLSTKVDG
A0A7C7AD93      -LFVLPAGTN-AINPVELISSDAMKNLINSLKEEFDYIILDTPPVGMFTEAQVLSQFTDG
A0A2V3W8U6      -LQSITCGPI-PPNPAELLSSERMDQLLQELKEHFDRIIIDSPPL-FFSDAAILATKVDG
A0A6N3BXA1      -FDILFTGKI-PQNPTEILASKKMKNLIDYLKNDYDYIFIDTPPAGVVSDCSILSRYSDG
A0A351SRI8      -LYLMFKGVT-PPNPSELLNSDKNKKLVSSLSNNFDIIIFDSAPINGLADSLVMSTLVDG
A0A1V5LU59      -LDIIPSGPI-PPNPAELLSSKRMNQLLEELKNEYDVIIIDTPPVGQVTDAAIIAGITDG
A0A1E3BVC3      -LYIITSGPI-PPNPAEMLNSNRMKKLLEKMKEEYDIIIIDTPPVGQVTDAAIVAGITDG
A0A4Q0I6S0      -LYIITSGPI-PPNPAEMLNSNRMKKLLEKMKEEYDIIIIDTPPVGQVTDAAIVAGITDG
A3DF66          -LYIITSGPI-PPNPAEMLNSNRMKSLLEKVREEYDIVIIDTPPVGQVTDAAILAGITDG
W4V1T8          -LYIITSGPI-PPNPAEMLNSNRMKSLLEKVKEEYDIIVIDTPPVGQVTDAAVIAGITDG
A0A1C6ITD7      -LSILTAGVI-PPNPSELISSNGMKMLLDRLSSNFDFILIDSPPLPLVADSQVLSTFVDG
A0A381IX63      -LKVLTTGNI-PNNPAEILNSNRMRSFVEETKEHFDYVFIDTPPIGIVSDAGIVSTYSDG
A0A1G9IUT4      -LNVLTCGSI-PSNPSELLSSHKMQKLLEELKNEYDYIFIDSPPIGRVTDAGVISNYVDS
A0A1M6RWV2      -LDIITTGPI-PPNPSEILGSNAMKKFIEQCKEYYDIILIDSPPAGIVTDAAVLSKITDG
A0A143XPI5      -LQLLAGTYR-RDNSAKLMESTYMEQLLEEAKEQFDCVIVDAPPCTILSDAIILAKKLDS
A0A355G1X5      -LFILSSIEP-NSEPTEILASQQMNKIIKAAKKEFDYVIIDTAPAAVVTDATILSNFADA
A0A0M6WXE3      -LGFIGGKVS-YSASTEMLGNRQLPVLIEACSKIVDYVIIDTPPSGMIGDAQIFAQHADA
A0A348SAK2      -LGFIGGKVS-YSASTEMLGNRQLPVLIEACSKIVDYVIIDTPPSGMIGDAQIFAQHADA
A0A1G9H5B9      -VDLLPAGHL-PPNPAELLESARMQQLLLELNDAYDLVLLDMPPVDIVADPLAVSAHVAG
R5EFZ0          -MYMLLAKRG-EQNTGDLLISPRMNALLDWARECFDFIVLDLPPMSAASDAEGMADLADA
A0A1Y4H8L0      -LYFMGGRNC-YSMSTDMLQSGNIEKLLKTCRRLVDYVVIDTPPAGPLGDAELFARYADE
A0A4B9BMD9      -FDVITRGQV-PPNPSELLMRDRMRQLLEWANDHYDLVIVDTPPMLAVSDAAVVGRSVGT
A0A0M6WYQ8      -LQILYGKTT-EGSSSDLLESKQMERLISILKKKADLVIFDTAPSEMLADAPVLARYLDA
A0A348SAK1      -LQILYGGTK-EGSSSDLLESKQMERLISILKKKADLVIFDTAPSEMLADAPVLARYLDA
A0A252F281      -LYEMFGKNY-YSDSVELLGSARMKKLLEVSRQKMDFIIIDSPPMSALSDTEVLAELVDA
A0A1Y4QKE6      -LWFIGNDNP-VDNPVSVLSHPDLKEFIEKMKKEFDYVIIDTPPCGIFQDVTLIQKYADA
B1C231          -FWFIGNDKP-INNPVSVLSHPDFKKFIEKMKKEFDYVIIDTPPCGIFQDVTLIQEYSDA
A0A1Y3TUL5      ---YLDLLPS-ILEPKEIPLSDALLTLIKDLSQNYDYVLMDSAPVGRVAETLSLNRIAKS
A0A1Y4JAX2      ---YLDLLPS-ILEPKEIPLSDALLTLIKDLSQNYDYVLMDSAPVGRVAETLSLNRIAKS
A0A1Y4T590      ---YLDLLPS-ILEPKEIPLSDALLTLIKDLSQNYDYVLMDSAPVGRVAETLSLNRIAKS
R5B467          -PDVIFAGRR-AGAQTEQLGSAAFHTLLHDLREHYDVVLLDTPPCAVMTDALETGAATDC
A0A1Y3T163      -IWFLGSRRI-VKQPASVLSSPRTGELIQALKKEMDYIIIDTPPCEMFQDAGMLSDYADG
A0A1Y3YCA2      -IWFLGSRRT-VKQPASVLSSPRTGELIQALKKEMDYIIIDTPPCETFQDAGMLSDYADG
A0A1Y4L6N9      -VYFLGGKEP-IKEVTQTLNSSNLLDVMESLRKEMDYVIIDAPPSEMFEDAAVLSEYADG
A0A173T644      -ISFLCGSLP-VRNVPAVLNRPEFQETLRRVRGEYDLVILDSPPAEMFEDASLMAEFSDG
A0A1C5TSB8      -ISFLCGSLP-VRNVPAVLNRPEFQETLRRVRGEYDLVILDSPPAEMFEDASLMAEFSDG
C0CIK6          -ISFLCGSLP-VRNVPAVLNRPEFQETLRRVRGEYDLVILDSPPAEMFEDASLMAEFSDG
A0A1Y3WEF6      -VDFLGGSKP-VKGVQQILNHSSFHEVIKEMKAQWDLILLDAPPTEMFEDASILAEQADG
A0A417T0L2      -VDFLGGNKP-VKGVQQILNHSHFHEVMEEMKAQWDLILLDAPPVEMFEDASILAEQSDG
A0A1H9EPU3      -LHMVFSGIV-PPNPAELLESVYFRELVKQLRQAYDYVVIDTPPVGTVIDGAIIGKECDG
A0A354IGV3      -LYVIAGDHS-VPMSSELVSSARMQALLAHFREEMDFILIDSPPMALFSDAEALANLSDA
A0A417JMV2      -LLLIAGSMI-YPNSTEMIASPIFQKIVEFFKTKLDYIIIDTPPMSQAADAEELVDLADA
A0A415VWX5      -LLLIAGSMI-YPNSTEMIASPIFQKIVEFFKTKLDYIIIDTPPMSQAADAEELVDLADA
A0A173UY96      -LLLIAGSMI-YPNSTEMIASPIFQKIVEFFKTKLDYIIIDTPPMSQAADAEELVELADA
B0P408          -LLLIAGSMI-YPNSTEMIASPIFQKIVEFFKTKLDYIIIDTPPMSQAADAEELVDLADA
D4MV82          -LLLIAGSMI-YPNSTEMIASPIFQKIVEFFKTKLDYIIIDTPPMSQAADAEELVDLADA
A0A173QTL1      -LLLIAGSMI-YPNSTEMIASPIFQKIVEFFKTKLDYIIIDTPPMSQAADAEELVDLADA
A0A174J359      -LLLIAGSMI-YPNSTEMIASPIFQKIVEFFKTKLDYIIIDTPPMSQAADAEELVDLADA
A0A174A3T7      -LLLIAGSMI-YPNSTEMIASPIFQKIVEFFKTKLDYIIIDTPPMSQAADAEELVDLADA
A0A417UUA3      -LLLIAGSMI-YPNSTEMIASPIFQKIVEFFKTKLDYIIIDTPPMSQAADAEELVDLADA
A0A6N2VB70      -LLLIAGSMI-YPNSTEMIASPIFQKIVEFFKTKLDYIIIDTPPMSQAADAEELVDLADA
A0A1C6EUV9      -LLLVTGTMI-YPNSTEMIASDMFYKIVDFFKDRLDYVIIDTPPMSQAADAEELVDYADA
A0A173Y645      -LLLVTGTMI-YPNSTEMIASDMFYKIVDFFKERLDYVIIDTPPMSQAADAEELVDYADA
A0A374AVY6      -LLLVTGTMI-YPNSTEMIASDMFYKIVDFFKERLDYVIIDTPPMSQAADAEELVDYADA
R7BXS4          -LLLVTGTMI-YPNSTEMIASDMFYKIVDFFKERLDYVIIDTPPMSQAADAEELVDYADA
A0A143ZUX1      -VYILYSGKP-TDQASELLGNDLMNEFFKIVEPNFDFIIIDTPPAHVVSDAMTIRRFVDA
A0A1W1Z4C3      -LDVLPAGAV-PTNPCELLESPAMQELLKELEEKYDLILMDVPPINIVSDPLALSGQCAG
A0A239QN83      -LDILPAGSM-PSNPCELLESPTMAKLIQELEEQYDLVLMDVPPINIVSDPLALSSQAAG
A0A3R9WAA7      -IAVLACSKQ-LEESSEILGKRAIGSILEQLKEEYDYIILDSAPSAVISDTIELAKYADG
A0A1G6BLF1      -LEILPGGKA-ISKTSRVLSSEKVGNLIRTLQKEYDYVILDTPPCALLNDATMVASQAQA
R6HZX3          -LSLLAGDTR-MTSPMGILDSPKMRSLLERTRTLADYVIIDAPPAGLLADAAVLCRSADQ
A0A1W2CEA6      -LDLLPDGAS-IKTPLALLTSAEFDSLMATVGRDYDFVIVDTPPLGVVVDAAEISRRCDG
R7FFK6          -LDLLTAGTI-PPNPSELLASKQMAELLDKLKEKYDIILIDCAPVNVVSDVAGMANSIAG
A0A373MPB9      -FAVLTSGVL-PPNPSELLASEKMRELLEYVQHKYDYVIIDGTPLLPVTDVMSLADEVAG
A0A373L519      -FAVLTSGVL-PPNPSELLASEKMRELLEYVQHKYDYVIVDGTPLLPVTDVMSLADEVAG
A0A373W906      -FAVLTSGVL-PPNPSELLASEKMRELLEYVQHKYDYVIVDGTPLLPVTDVMSLADEVAG
A0A373VCW2      -FAVLTSGVL-PPNPSELLASEKMRELLEYVQHKYDYVIVDGTPLLPVTDVMSLADEVAG
W0U604          -FAVLTSGVL-PPNPSELLASEKMRELLEYVQHKYDYVIVDGTPLLPVTDVMSLADEVAG
A0A374B6G0      -FAVLTSGVL-PPNPSELLASEKMRELLEYVQHKYDYVIVDGTPLLPVTDVMSLADEVAG
A0A373VM36      -FAVLTSGVL-PPNPSELLASEKMRELLEYVQHKYDYVIIDGTPLLPVTDVMSLADEVAG
A0A1C5P379      -FAVLTSGVL-PPNPSELLASEKMRELLEYVQHKYDYVIVDGTPLLPVTDVMSLADEVAG
A0A373XXX0      -FAVLTSGVL-PPNPSELLASEKMRELLEYVQHKYDYVIVDGTPLLPVTDVMSLADEVAG
A0A5R9MJM9      -FAVLTSGVL-PPNPSELLASEKMRELLEYVQHKYDYVIVDGTPLLPVTDVMSLADEVAG
A0A356CW82      -FAVLTSGVL-PPNPSELLASEKMRELLEYVQHKYDYVIVDGTPLLPVTDVMSLADEVAG
R6T4X7          -FAVLTSGVL-PPNPSELLASEKMRELLEYVQHKYDYVIVDGTPLLPVTDVMSLADEVAG
A0A374HTV1      -FAVLTSGVL-PPNPSELLASEKMRELLEYVQHKYDYVIVDGTPLLPVTDVMSLADEVAG
A0A374GB66      -FAVLTSGVL-PPNPSELLASEKMRELLEYVQHKYDYVIVDGTPLLPVTDVMSLADEVAG
A0A374ECC6      -FAVLTSGVL-PPNPSELLASEKMRELLEYVQHKYDYVIVDGTPLLPVTDVMSLADEVAG
A0A374BM61      -FAVLTSGVL-PPNPSELLASEKMRELLEYVQHKYDYVIVDGTPLLPVTDVMSLADEVAG
A0A373UGZ4      -FAVLTSGVL-PPNPSELLASEKMRELLEYVQHKYDYVIVDGTPLLPVTDVMSLADEVAG
A0A373SA66      -FAVLTSGVL-PPNPSELLASEKMRELLEYVQHKYDYVIVDGTPLLPVTDVMSLADEVAG
A0A1C5X6X7      -FAVLTSGVL-PPNPSELLASEKMRELLEYVQHKYDYVIVDGTPLLPVTDVMSLADEVAG
A0A1C6JIH3      -FAVLTSGVL-PPNPSELLASEKMRELLEYVQHKYDYVIVDGTPLLPVTDVMSLADEVAG
A0A373PSC3      -FAVLTSGVL-PPNPSELLASEKMRELLEYVQHKYDYVIVDGTPLLPVTDVMSLADEVAG
A0A1K1WYK8      -LDLLPSGPL-PPNPSELLASENFKKLLEQFATNYDYVIIDTPPVNVVSDAMVMKDSISG
A0A1H6IUB1      -LDVMTAGPV-PPNPSELLASDNMGAILEKLSEEYSMILIDTPPVNVVTDAMELAKYVSG
A0A1M7L1F9      -LDVMTAGPV-PPNPSELLASDNMGAILEQLSSEYSMILIDTPPVNVVTDAMELAKYISG
A0A1C6B4L6      -LDVMTSGPL-PPNPSELLASENMLAILDELNKKYQIIIIDTPPVNVVTDAMELAKCVSG
A0A1Q6T9P4      -LDVMTSGPL-PPNPSELLASENMLAILDELNKKYQIIIIDTPPVNVVTDAMELAKCVSG
A0A315Y4F9      -LDVMTAGPI-PPNPSELLASEMMEQMLNELSEKYDAILIDTPPVNVVTDAMELAKSVSG
A0A354K620      -LDIMTAGPI-PPNPSELLASDTMEQMLHDLSEKYDVILIDTPPVNVVTDAMELAKMISG
A0A355G3J9      -LDVITSGKC-TSYAADLLSTTRAKESISAFRKDYDYIIIDSPPINEVSDAMTLVDVVNG
A0A3D2AD87      -LNILTAGFI-PPNPSELLDSVNFEETMKLLNEQYDYVIVDTPPLNVVTDSMIIAPQTGG
A0A143XN92      -LFILFNSQP-LQNSLELMDYSSWKDWIKKMEQEMDYILIDTSPVALTSDGESLAHIIKD
A0A173ZYY6      -MLFMGGKNC-YSSSTEMLNSESFFKLMAACRKFVDYVIIDTPPAGIIGDAQIFAHCADA
A0A6L8RXB5      -MLFMGGKNC-YSSSTEMLNSDSFYKLMTACRKFVDYVIIDTPPAGIIGDAQIFAHCADA
A0A6N9JW85      -MLFMGGKNC-YSSSTEMLNSDSFYKLMTACRKFVDYVIIDTPPAGIIGDAQIFAHCADA
A0A173SMI2      -MLFMGGKNC-YSSSTEMLNSESFFKLMAASRKFVDYVIIDTPPAGIIGDAQIFAHCADA
A0A174ASH7      -MLFMGGKNC-YSSSTEMLNSDSFYKLMTACRKFVDYVIIDTPPAGIIGDAQIFAHCADA
A6BH65          -MLFMGGKNC-YSSSTEMLNSDSFYKLMTACRKFVDYVIIDTPPAGIIGDAQIFAHCADA
R7G0D7          -MLFMGGKNC-YSSSTEMLNSDSFYKLMTACRKFVDYVIIDTPPAGIIGDAQIFAHCADA
A0A2T5IYJ6      -IDVLTAGLV-PPNPLELLSSQKFMDLIAKLSETYDRIVIDSPPTLLVSDSLVMSKAVDA
A0A3C0QME1      -LDVMPSGPI-PPNPSEMLASQQFSDILDELEPQYDYIIIDTPPINVVSDTLVMGKILSG
A0A355FYK5      -LFILPSGGI-TQKSSEVLDADKVRHVIEQARKEFDFIIIDTPPSRVVSDSMVMSSLADS
A0A357AQU0      FVDLLTAGTI-PPNPSEILASEALKNLITEASEQYTVILIDTPPVNMVSDVYGLSDSIAG
A0A3C1YJQ7      FVDLLTAGTI-PPNPSEILASEALKNLITEASEQYTVILIDTPPVNMVSDVYGLSDSIAG
A0A3D0JG38      FVDLLTAGTI-PPNPSEILASEALKNLITEASEQYTVILIDTPPVNMVSDVYGLSDSIAG
A0A3C0IHX1      -MDVLTAGTC-PPNPSELLASPAMKKLLEEAEQQYDYIIIDTPPVNVVSDALGLSDCIGG
R5V506          -MDVLTAGTC-PPNPSELLASPAMKKLLEEAEQQYDYIIIDTPPVNVVSDALGLSDCIGG
A0A352TIU5      -MDVLTAGTC-PPNPSELLASPAMKKLLEEAEQQYDYIIIDTPPVNVVSDALGLSDCIGG
A0A3E5FSY5      -FWFIGNDKP-INNPVSVLSHPDFKKFIEKMKKEFDYVIIDTPPCGIFQDVTLIQEYSDA
A0A1V5S3C0      -MYLLISGEP-VSDPSEVLASSITQETINEAKKNFDFVIIDCAPAGVVADATIVSNYCDA
A0A1Y3TC98      -MWLLGNNEV-VKQPAPVLSSRMVKLFIREMRRKMDYVIIDSPPCTMFQDAGILADHADA
A0A1Q6REE0      -LFVIVGNADGKADYFDAPTQARLTKLIRYARDKYDYVILDTPPCSLLTDAAEAAEAAEA
R5ETF9          -LFVIVGNADGKADYFDVPTQARLTKLIRYARDKYDYVILDTPPCSLLTDAAEAAEAAEA
R6VAT5          -LYVLPGTIP-VNNASELMGSKQLADLVAALEKIFDYVVIDAPPVGIVSDALEMKDYVGG
A0A1Q6S448      -LHSLLSTKS-YTDVIELLASDQLAKVVALARERYDYVIIDSPPLGFFSDSELLSDLSDA
A0A351MYR0      -LHSLLSTKS-YTDVIELLASAQLAKVVALARERYDYVIIDSPPLGFFSDSELLSDLSDA
R6HPC1          -LHSLLSTKS-YTDVIELLASDQLAKVVALAREQYDYVIIDSPPLGFFSDSELLSDLSDA
A0A3D4G5Z5      -LHSLLSTKS-YTDVIELLASDQLAKVVALAREQYDYVIIDSPPLGFFSDSELLSDLSDA
A0A3D5ES03      -LHSLLSTKS-YTDVIELLASDQLAKVVALAREQYDYVIIDSPPLGFFSDSELLSDLSDA
A0A0F2P7X6      -IYVMPNGYI-VPNPSELLGSEKMAALLAALEKQYDYIILDTPPSYLLTDAVALSVYADG
A0A359B487      -IHVMPNGYI-VPNPSELLGSEKMAALLAALEKQYDYIILDTPPAYLLTDAVALSVYANG
A0A348P5V4      -LFVLVSGVA-VENSTEILSSPKMEEIVEAAKKEFDYVIIDTAPCGIIADASILAGYADT
A0A356PT74      -LFLLVSGKP-VFDPSELLSTDAMSDIIKSAEKEFDYIIIDTAPCGVVADASILSSYADG
A0A3D5LL19      -LFLLVSGKP-VFDPSELLSTDAMSDIIKSAEKEFDYIIIDTAPCGVVADASILSSYADG
R5MNF0          -LFLLVSGKP-VFDPSELLSTDAMSDIIKSAEKEFDYIIIDTAPCGVVADASILSSYADG
A0A1Q9JSI0      -LLLVADSMI-YPNSTEMIARPLFQKVLDFFKERLDYIIIDTPPMSQAADAEEMVDLVDA
A0A3D5TNI1      -IFVLAGDEC-IADPTEVLSNAKTGEFIAAAKEKFDYIIIDTPPAGIVADAAICAKYTDS
A0A358LJD0      -IFVLAGDES-IADPTEVLSNAKTGEFLAAAREKFDYIIIDTPPVGIVADAAICAKYTDS
R6I3L7          -MFVLAGDES-ITDPTEMLSNAKTGEFIAAAREKFDYIIIDTPPIGIVADAAICAKYTDS
A0A3D1HXX0      -IFVLAGDES-ITDPTEVLSNAKTGEFIAAAREKFDYIIIDTPPVGIVADAAICAKYTDS
A0A3D2QJB8      -IFVLAGDES-ITDPTEVLSNAKTGEFIAAAREKFDYIIIDTPPVGIVADAAICAKYTDS
D4LC36          -LDVLTSGTI-PPNPSELLASRQMKELLETLKERYDMILIDCAPINVVSDVAGLSQEIAG
R7MQJ4          -LDILTSGTK-PANPSELLASEQAAELLNTLSEAYDYIIVDTPPVNIVSDAMGLSNSIAG
A0A1V5GLC0      -LDVMCAGPI-PPNPSELLASENMSQMLEKLSAEYSAIVIDTPPINVVTDAMELARNISG
W7V182          -LDIMTAGPI-PPNPSELLASSNMENILDQLSERYSVIIIDTPPVNVVTDAMELANKVSG
                                                     :..* .*     :          

S3FFL2          VIYAIESHGIRATLVKTALGRLLNANVHIFGGVLTKFEATKSNSGYGYEYG------YGY
A0A328M4V1      SLLVVQ-FGLNQPREIALAKQRFEQNGVPIKGAIFNLVEKRSAGYYAYAY-------YTY
A0A6A8IF17      TVFVVR-AGLLERSMLAELEKIYEEKKYKNMSLILNGTEG-SGGRYGYRYGYRYGYHYGY
A0A3D5R4X5      VILVTSFGMVDYQIAKRAVELL-KNANANILGSVLNKIPMGR-------------GGYSY
A0A1I4C3N6      YVLVVREMVTKFEREEMIIRNI-EELKGDICGFIYNGISTKS-------------EDYNY
A0A3B9CIM7      YILVVREGVTKFDREQMVVQML-EPVGANICGFVFNGISMKS-------------QDYHY
A0A1G9WHW8      FVLVVRENHTKFDKEENVIRTI-EPLGADICGFIYNGIAVNS-------------REYKY
A0A1H5VAA0      FVLVVRENHTKFDKEENVIRTI-EPLGADICGFIYNGIAVNS-------------REYKY
A0A3R6VK11      YLLVVRAGVSHMSREKSAVTLL-EQVDADICGILFNGLPPKS-------------KDCNY
A0A3R6QUY7      YLLVVRAGVSHMSREKAAVTLL-EQVDADICGILFNGLPPKS-------------KDCNY
A0A373K3P9      YLLVVRAGVSHMSREKSAVTLL-EQVDADICGILFNGLPPKS-------------KDCNY
A0A3R6JRU5      YLLVVRAGVSHMSREKSAVTLL-EQVDADICGILFNGLPPKS-------------KDCNY
A0A1C5MS04      YLLVVRAGVSHMSREKSAVTLL-EQVDADICGILFNGLPPKS-------------KDCNY
A0A3C1J150      YLLVVRAGVSHMSREKSAVTLL-EQVDADICGILFNGLPPKS-------------KDCNY
A0A416CXD7      YLLVVRAGVSHMSREKSAVTLL-EQVDADICGILFNGLPPKS-------------KDCNY
A0A6N2X662      YLLVVRAGVSHMSREKSAVTLL-EQVDADICGILFNGLPPKS-------------KDCNY
R6XBL9          YLLVVRAGVSHMSREKSAVTLL-EQVDADICGILFNGLPPKS-------------KDCNY
A0A355W5Z7      YLLVVRAGVSHMSREKAAVTLL-EQVDADICGILFNGLPPKS-------------KDCNY
A0A143WVN6      SIMTVRQDWSEIGAINDFSDLL-KQNDKEFMGFVLNAFHENIL---------IEKSYGQY
W6RXP9          TLLVIKAGETKKEATENAINLL-NKVNANVIGGILNGAED-R----------KNKTYYYY
W6S4G8          TLVVIKSGDTRINVIQDALNLL-NKVRGKILGVVLNATEDGR----------LSKMYQYY
A0A1G6BLB6      TLLVVRQHYANVRDINDAIDII-NSRKEKLIGCVFNNVGGNRVSLTHGGQGYGEYGNYGY
A0A1C6G8M0      TLLVIENGVTKKKTLCQIAAEL-EKIDTNILGVVQNMVGSKK----------DSSYYGKG
A0A416MP73      ALLVIENGVTKKKTLAQMKFEM-DKVGANVIGVVQNMVGSKK----------DSSYYGKG
A0A3E4LL92      MLMVMCQDEVHAVAVNDAVDLL-EENGVTVIGGVLNMTKGER----------N-ISKDRE
A0A415D1L1      MLMVMRQDEVHAVAVNDTVDLL-EENGVTVIGGVLNMTKGER----------D-TSKDRY
A0A0H5SF45      VLMVVREKSTTYPHVETALNKY-ELIGGNILGFVLNGSALTQ----------ENKSKSSY
A0A1M6JRJ5      AILVTRENKTTYSDIDNALMKY-HYAKANILGFVLNGISEKE----------LGGHKSKY
A0A1M7Y1S2      AILVVRENKTTYTDIDNALMKY-RYARANILGVVLNGISERD----------LGGYKSKY
A0A7I8DMN1      AVLVVRENKTTYADIENALMKY-RYAKANVLGFVLNGISEKG----------LGKYKSKY
A0A396G6S7      SVLVVRQDTVLTKDINDAIDIL-NNTRGKVLGCILNGVTSQN----------M-AGSGHY
A0A3E5A223      SVLVVRQDTVLTKDINDAIDIL-NNTRGKVLGCILNGVTSQN----------M-AGSGHY
R7D5E6          SVLVVRQDTVLTKDINDAIDIL-NNTRGKVLGCILNGVTSQN----------M-AGSGHY
A0A415HQH5      SVLVVRQDTVLTKDINDAIDIL-NNTRGKVLGCILNGVTSQN----------M-AGSGHY
A0A414W2C6      SVLVVRQDTVLTKDINDAIDIL-NNTRGKVLGCILNGVTSQN----------M-AGSGHY
A5ZNE7          SVLVVRQDTVLTKDINDAIDIL-NNTRGKVLGCILNGVTSQN----------M-AGSGHY
A0A395X821      SVLVVRQDTVLTKDINDAIDIL-NNTRGKVLGCILNGVTSQN----------M-AGSGHY
A0A1C5PY68      SVLVVRQDTVLTKDINDAIDIL-NNTRGKVLGCILNGVTSQN----------M-AGSGHY
A0A174CJF8      SVLVVRQDTVLTKDINDAIDIL-NNTRGKVLGCILNGVTSQN----------M-AGSGHY
A0A564SRR2      SVLVVRQDTVLTKDINDAIDIL-NNTRGKVLGCILNGVTSQN----------M-AGSGHY
A0A174R7V0      SVLVVRQDTVLTKDINDAIDIL-NNTRGKVLGCILNGVTSQN----------M-AGSGHY
A0A373MWV2      AVLAVRQDGVLTRDINDAIDAL-NQKEEKVIGCVFGNVYPGF----------GERIGGSY
A0A417CE88      AVLAVRQDGVLTRDINDAIDAL-NQKEEKVIGCVFGNVYPGF----------GERIGGSY
A0A416Y441      AVLAVRQDGVLTRDINDAIDAL-NQKEEKVIGCVFGNVYPGF----------GERIGGSY
A0A357GPJ7      AVLAVRQDGVLTRDINDAIDAL-NQKEEKVIGCVFGNVYPGF----------GERIGGSY
A0A396PAC1      AVLAVRQDGVLTRDINDAIDAL-NQKEEKVIGCVFGNVYPGF----------GERIGGSY
A0A416EYU4      AVLAVRQDGVLTRDINDAIDAL-NQKEEKVIGCVFGNVYPGF----------GERIGGSY
A0A416SCQ2      AVLAVRQDGVLTRDINDAIDAL-NQKEEKVIGCVFGNVYPGF----------GERIGGSY
A0A416TGN7      AVLAVRQDGVLTRDINDAIDAL-NQKEEKVIGCVFGNVYPGF----------GERIGGSY
A0A417SMF6      AVLAVRQDGVLTRDINDAIDAL-NQKEEKVIGCVFGNVYPGF----------GERIGGSY
A0A1Y4MW77      FVYVIKQDFVQRPRIVDCIGTL-ADSELPLLGYVFNGDSFTF----------RDYSRYGY
R6UHV6          SLIVVRRNVANALSINDTIDII-LASGVKLMGCVYNDAENVS----------IVGRGSVY
A0A3R9Q621      MLIVVRQAVTSHPNIAGALSKY-ELVNANILGFVLNGVIRKQ----------G--LKSKS
A0A069RC75      AVIVCSSGIVDIDELKRAKAQL-EGVNARIMGAIFNRASEAS----------S-------
A0A6S6R676      VVLVVREGMTSHPNIEGALTKY-KFAETNLLGFVLNGVAHNS----------G--KSYKS
A0A174F2W5      AVLAVRQDGVLTRDINDAIDAL-NQKEEKVIGCVFGNVYPGF----------GERIGGSY
A0A174S8E9      AVLAVRQDGVLTRDINDAIDAL-NQKEEKVIGCVFGNVYPGF----------GERIGGSY
A0A416ZL97      AVLSVRQDGALTRDINDAIDAL-NQKEEKVIGCVFGNVYPGF----------GERIGNSY
A0A174LSK1      AVLSVRQDGVLTRDINDAIDAL-NQKEEKVIGCVFGNVYPGF----------GERIGNSY
A0A373GY92      AVLSVRQDGVLTRDINDAIDAL-NQKEEKVIGCVFGNVYPGF----------GERIGNSY
A0A373NZQ6      AVLSVRQDGVLTRDINDAIDAL-NQKEEKVIGCVFGNVYPGF----------GERIGNSY
A0A417I9B9      AVLSVRQDGVLTRDINDAIDAL-NQKEEKVIGCVFGNVYPGF----------GERIGNSY
A0A417MP97      AVLSVRQDGVLTRDINDAIDAL-NQKEEKVIGCVFGNVYPGF----------GERIGNSY
A0A417WQF8      AVLSVRQDGVLTRDINDAIDAL-NQKEEKVIGCVFGNVYPGF----------GERIGNSY
A0A373RZ83      AVLSVRQDGALTRDINDAIDAL-NQKEEKVIGCVFGNVYPGF----------GERIGNSY
A0A416U6I1      AVLSVRQDGALTRDINDAIDAL-NQKEEKVIGCVFGNVYPGF----------GERIGNSY
R7JQZ9          AVLSVRQDGALTRDINDAIDAL-NQKEEKVIGCVFGNVYPGF----------GERIGNSY
A0A7C6SMH0      TILVLASAGTRIDMAKRACKAL-EGVNANMIGAVLTKIDFRK----------T--SYYGY
A0A3B8KKL6      TILVLACAGTRIDMAKRACKAL-EGVNANMIGAVLTKIDFRK----------T--SYYGY
A0A2K9E6R0      TILVLACAGTRIDMAKRACKAL-EGVNANMIGAVLTKIDFRK----------T--SYYGY
A0A2S8RBI0      TILVLACAGTRIDMAKRACKAL-EGVNANMIGAVLTKIDFRK----------T--SYYGY
A0A0L6JLG6      SIVVVAGGQTRIDMAKRAKKAL-TAINANIIGIVMTKIDSRS----------A--YYHYY
G8LSN0          TIMVFACSQTRIDMAKRAKKAL-ESVGSNILGTVLTKLDIGR----------A--RYYSY
A0A1M5UYN6      VILVVASNEADKDAVVRAKELL-LKVRANILGVVLNKIEFSK----------GKGYWYNY
A0A176JBT8      CIYVLNARKTNRDDANEKIELL-KRSSNELIGAILNEKKTHK----------S--NPHYY
A0A1I5HIC6      TILVIESGKISYRLIQRVLKQL-ITGKSRVLGAVLNKANIYG----------KGYKKNYY
A0A1Y3TC51      VLLVVREDWADVRVINDAVDMI-SQNGTDFTGFVLNAFHREW----------S-RPAGRQ
A0A1Y3T1N0      VLLVVREDWSDVRIVNDTVDMI-WQSGCDFSGFILNAFHRDW----------I-SQSSGY
A0A1Y3Y8U8      VLLVVREDWSDVRIVNDTVDMI-WQSGCDFSGFILNAFHRDW----------I-SQSSGY
A0A5B0BQY5      CIYVTHVKKTTEDNALKYLEYL-KNVNATVLGSVLNGNKKGL----------NRHS----
A6CLL4          CLFLINARKTRMETAKKNLNKL-NRVGANIIGVILNKTKKEK----------S--QTYYY
A0A176U8D6      ALLVIENGVTKKKTLAQMKSEM-DKVGANVIGVVQNMVGSKK----------D-SSYYGK
A0A1Q6KSQ5      TLLVIENGVTKKKTLCQIAAEL-EKIDTNILGVVQNMVGSKK----------D-SSYYGK
A0A3D3U8B3      TLLVIENGVTKKKTLCQIAAEL-EKIDTNILGVVQNMVGSKK----------D-SSYY--
A0A3E5FRL7      TILVIRQDWTDIRVVNDTVDLI-WQSNCNFTGFALNMFIDND----------S--HHNDY
A0A1Y4QK93      TILLVRQDWTDIRMVNDTVDLI-WQSGCDFTGFALNMFIDDE----------I--RHNDY
B1C232          TILLVRQDWTDIRIINDTVDLI-WQSDCDFIGFALNMFIDDE----------I--RHNDY
A0A401USI6      VILVIGSEESTIENCKKSKQLL-LNINATIIGIVLNKVDKRS----------F--IGYGY
A0A1V4IQ10      TLVVIRSGVTNAKSVLETKSLL-TKINGLVIGTVLHRTEYNK----------D-------
A0A1S8TRD2      TLIVIRSGLTNAKSVLETKNLL-IKVNGLVIGTVLHRTEYNK----------D-------
G7M1U2          TLIVIRSGLTNAKSVLETKSLL-TKVSGLVIGTVLHRTEYNK----------D-------
A0A2T6KJ75      CLYVVNAESSKVEQAIYSIELL-KQVQAPLIGTIINKSKGSV----------R--SYSYY
A9KN92          TIMVIESNKISYRFAQRVLKQL-ITEKSKVLGAVLNKANIYG----------VGYNKKYY
A0A352MUJ1      SFIVTEHEKTQIDDIAKIKTQI-EDVGGNIAGIVINKVQDDK----------A--SKGNY
R5YI67          SFIVTEHEKTQIEDIEKIKTQI-EDVGGNIAGIVINKVQDEK----------S--SKGNY
A0A174DL89      TIIITKLGYTTKSALLNTKEIL-DGLKTNVIGVVLNNSPLDS----------S--VNYYY
A0A1Y0IQP5      VLLVVRSGAVTRDHLQQAKALL-DRVGAQVIGAVLNGKKRKG----------K--EQT--
A0A4R2R7B1      VLFVVRSGEVARDQLQQAKGLL-ERVGAQVIGAVLNGKQRKR----------S--EPA--
A0A1M6E8I2      AILVVASGNVGVDMVKKAKKSL-EFSGVKLIGSVLNIIPTNH----------S--K--GY
A0A1Y4N105      SVMVVREDWSEIGAINDLCDVL-KQNDQDFIGFILNAFHRSI----------F--SNDSY
A0A1Y4QP75      SVMVVREDWSEIGAINDLCDVL-KQNDQDFIGFILNAFHRSI----------F--SNDSY
A0A3D4QRB5      VVYVVGYGDIAREMVIRAKTDL-EKVGAKILGSVINDIPLDT----------L--V--GY
A0A349DEH5      AIIVVREDFSPYSRIRMSIEDI-DANGAEIIGCIFNADTSNV----------S--KTGRY
A0A3D4T7B4      AIIVVREDFSPYSRIRMSIEDI-DANGAEIIGCIFNADTSNV----------S--KTGRY
A0A350XYC7      AIIVVREDFAPYSRIRMSIEDI-DSNGAEIIGCVFNADTSNV----------S--NSSRY
R6DNR8          AIVVVREDFAPYSRIRMSIEDI-DSNGAEIIGCIFNADTSNL----------S--KSSRY
A0A355KUM5      AIIVVREDFSPYSRIRMSIEDI-DSNGAEIIGCIFNADTSNL----------S--KTSRY
R5YGY6          AIIVVREDFSPYSRIRMSIEDI-DSNGAEIIGCIFNADTSNL----------S--KTSRY
A0A0K8J554      ILMVVRENGTTYPNIDSALNKY-ELIDGKLLGFVINGITFKQ----------G--EKSKS
A0A1I0RG99      VLIVVREGVTSHPCVSSVITKF-QFLNANILGFVLNGISLNQ----------Q--ERSKY
A0A1I5G322      VLIVVREEVTSHSDITNFLSKC-KYMEIKVLGFILNGISLNQ----------E--KKSKY
A0A7C6IYW8      LLIVLREGITSHPNLTNALDKF-KLSQGNILGFILNNVSVNQ----------G--KKFNY
A0A3N1XSX6      LIIVVREGVTSHPNVSNALEKF-RLSQGNILGFVINGVSINQ----------T--KKSKY
A0A7C6JZF1      IAVVVREGVTTHPNVANALEKF-KLADAVVLGFIINGSSRNQ----------G--KRSKS
A0A7G9WCY6      TIFVVAAGEAQKDQTLKAKEML-EKVGKKTLGVVVNKVKITK----------R--NYGTY
A0A1C6G0U3      VIVVIGCNEVDRNSVKQCKEKL-NNLNANILGCIVNKENIKK----------G--N-YYY
A0A3D4LLB3      VILAIEHGKTEKELAKKAVNSL-KQVDANIIGAVFNNIPVSK----------Q--NNYYY
A0A0A5GPA9      CVFVVNAQKTNTEQVSKSLQRL-NKVKATIFGVVLNRGVKET----------N--AHYYY
A0A271M6M4      CIFIVNAQKTKVDQTVKSIQKL-KKVEANILGVVLNSGKESK----------R--TSYYY
A0A7C7AD93      YLIVVSSNESEKALARKAVKLL-RYAEANIIGALLNKVPDSK----------L------Y
A0A2V3W8U6      CLLVVQSDTTKVTHIQQGLGQL-TNVNATILGAIINKKKERK----------N--D-INY
A0A6N3BXA1      LVYIMASKESEIDYIKDSIKGL-QGI--KIIGCILNKFDAKS----------V--SYYNY
A0A351SRI8      VIIVTACKETSKTLLKTVKKDL-ENVGANILGIVLNRTDTNK----------S--K---Y
A0A1V5LU59      VLLVFASSQTRIDIAKRAKKAL-ESVNSNIIGAILTKLNTGR----------G--S---Y
A0A1E3BVC3      VMLVLASGQTRIEMAKRATKSL-ESVKARFVGAVLTKLDTER----------T--G---Y
A0A4Q0I6S0      VMLVLASGQTRIEMAKRATKSL-ESVKARFVGAVLTKLDTER----------T--G---Y
A3DF66          VILVLASGQTRIEMAKRAFKSL-ESVKARFIGAVLTKLDTER----------T--G--YY
W4V1T8          VMLVLASGQTRIEMAKRAYKSL-ESVKAQFVGAVLTKLDTER----------T--G---Y
A0A1C6ITD7      TIIVTKFGYTTKSALINTKEIL-DGLNTNVIGVLLNNSPINS----------S--S----
A0A381IX63      IILVAASNEVDDNVIKLSKDRL-VKVNANIIGCILNKFDYKN----------H--NEYEY
A0A1G9IUT4      TIIVIAENEVNIDDVKVAKKKL-QQVNANILGSIFNKSSLYK----------S--E--CY
A0A1M6RWV2      TLFVVAAGQTTIELAQKAKDML-DKVQAKVIGVLVNKVNIEK----------R--R--YQ
A0A143XPI5      VIMVIRYDYARVNQILRGSESL-ADTGISMIGYVLNAVESGIM-----------SYGY--
A0A355G1X5      CIMVVRENFSDVSRIRSVISDL-ESYKAELIGCVYNNTANRDG-----------------
A0A0M6WXE3      VMVVARQNVTLAEDINEMMDDF-RDNHTKVLGVVLNGVMTFQSIADSPVGDHYSRYS---
A0A348SAK2      VMVVARQNVTLAEDINEMMDDF-RDNHTKVLGVVLNGVMTFQSIADSPVGDHYSRYS---
A0A1G9H5B9      CILMVRQHFTTHQDLRKALNAA-EMTDMNVLGFVFYGEHMHES-------------GYYS
R5EFZ0          SLLVVRQNAAAAPALNNAVASL-DGHKAKVLGCVLNNV-------------------YAT
A0A1Y4H8L0      VLLVVRQNYMLAEDINDVLDHF-REVGCHVVGVVLNRVQSFENLTAQTVGRYAGRYGYGY
A0A4B9BMD9      SLLVARFGLNTAKEVSLSMQRL-EQAGVNIKGAILNGVIKRAS----------------T
A0A0M6WYQ8      AVYVIRYDYAKMRQIRMGVENI-SMSGIHMLGYVLNRDR-------STGGGYGYGYGYYG
A0A348SAK1      AVYVIRYDYAKMRQIRMGVENL-SMSGIHMLGYVLNRDR-------STGGGYGYGYGYYG
A0A252F281      TVLVVREDTSAVPDLNESIMIL-NESKSRLLGCVYNDKHTSPL---SRLPIYGKYADY--
A0A1Y4QKE6      LLYVVKYDFLPYQKIQNGLSIL-KE-DCCFMGYVFNIYTKKSS-----------------
B1C231          LLYVVKYDFLPYQKIQNGLSIL-KE-DCCFMGYVFNIYTKKSS-----------------
A0A1Y3TUL5      ALFVIRFDYSNMNTIRDSLERL-DKSGINPLGCIVNRV--------KTLGDKL-NNNY--
A0A1Y4JAX2      ALFVIRFDYSNMNTIRDSLERL-DKSGINPLGCIVNRV--------KTLGDKL-NNNY--
A0A1Y4T590      ALFVIRFDYSNMNTIRDSLERL-DKSGINPLGCIVNRV--------KTLGDKLNNNNY--
R5B467          ALLVVRQDASSRVSVINSLAAL-DALGVPVLGYTLNACAGRSH----------GGYGYGF
A0A1Y3T163      ILYVVKYDFIPQRRIWEGLSFL-GGRSARILGYVFNSYPESVS-----------EYGYGR
A0A1Y3YCA2      ILYVVKYDFIPQRRIWEGLSFL-GGRSARILGYVFNSYPESVS-----------EYGYGR
A0A1Y4L6N9      ILYVVRYDFVQRRRVLDGLAEL-DGVHTRLLGYVFNGIKVGHS-----------GYGYGY
A0A173T644      ICYVIRHDFVQKRRILESLAGL-ESSGTTILGYAFNGVPLHKG-----------RYGY--
A0A1C5TSB8      ICYVIRHDFVQKRRILESLAGL-ESSGTTILGYAFNGVPLHKG-----------RYGY--
C0CIK6          ICYVIRHDFVQKRRILESLAGL-ESSGTTILGYAFNGVPLHKG-----------RYGY--
A0A1Y3WEF6      ILYVIRYDQVQKRRILDSISGL-EDSSAPLLGYVFNGVPVHRG-----------GYGY--
A0A417T0L2      ILYVIRYDQVQKRRILDSISGL-EDSKAPLLGYVFNGVPVHRG-----------GYGY--
A0A1H9EPU3      VVMVVGSGDISYKLVERAKEQL-ETSGSRILGVALNKV--------PMDKGKGYYGKYYG
A0A354IGV3      SVMVIRQSRSLAQEINTAADTL-ESGHSELLGCILNDVY-GMPFPLSLLDNDSYSYGYGD
A0A417JMV2      SILVVRQHTALVKDINETIGIL-NSAEGTMLGCVYNDVFHGVA---QTARNYGYKYAYGS
A0A415VWX5      SILVVRQHTALVKDINETISIL-NSAEGTMLGCVYNDVFHGVA---QTARNYGYKYAYGS
A0A173UY96      SILVVRQHTALVKDINETIGIL-NSAEGTMLGCVYNDVFHGVA---QTARNYGYKYAYGS
B0P408          SILVVRQHTALVKDINETISIL-NSAEGTMLGCVYNDVFHGVA---QTARNYGYKYAYGS
D4MV82          SILVVRQHTALVKDINETISIL-NSAEGTMLGCVYNDVFHGVA---QTARNYGYKYAYGS
A0A173QTL1      SILVVRQHTALVKDINETIGIL-NSAEGTMLGCVYNDVFHGVA---QTARNYGYKYAYGS
A0A174J359      SILVVRQHTALVKDINETISIL-NSAEGTMLGCVYNDVFHGVA---QTARNYGYKYAYGS
A0A174A3T7      SILVVRQHTALVKDINETISIL-NSAEGTMLGCVYNDVFHGVA---QTARNYGYKYAYGS
A0A417UUA3      SILVVRQHTALVKDINETISIL-NSAEGTMLGCVYNDVFHGVA---QTARNYGYKYAYGS
A0A6N2VB70      SILVVRQHTALVKDINETISIL-NSAEGTMLGCVYNDVFHGVA---QTARNYGYKYAYGS
A0A1C6EUV9      SILVVRQHTALVKDINEAISVL-NSGDGTMLGCVYNDVFHGIA---QTARNYGYRYAYGS
A0A173Y645      SILVVRQHTALVKDINEAISIL-NSGEGTMLGCVYNDVFHGIA---QTARNYGYRYAYGS
A0A374AVY6      SILVVRQHTALVKDINEAISIL-NSGEGTMLGCVYNDVFHGIA---QTARNYGYRYAYGS
R7BXS4          SILVVRQHTALVKDINEAISIL-NSGEGTMLGCVYNDVFHGIA---QTARNYGYRYAYGS
A0A143ZUX1      TILVVRQDFTPASTIRHTLEDL-DSEETPVIGCVFNGVARPNR--LLGYGRYSSYY----
A0A1W1Z4C3      ALFVVRQNFSDHREIRRALISA-EMTGLEVLGFVFYGENIHQG--RYYSKRSQRGYQY--
A0A239QN83      TLFVVRQEFSDHREIRRALVSC-EMTGLEVLGFVFYGEKLHQG--KYYSKRSQRGYEY--
A0A3R9WAA7      VIYVIRQDYSRVRQIQQGMEHIVESSRAEIIGCVLNNVRHMPA--G---------YGY--
A0A1G6BLF1      AIFVVRQDYARVDRIYEGIENL-AETGVDIMGCLLNGAEVGLT--GTGYSKSYSYARY--
R6HZX3          VLYVVRYDSFARNQVADAMHSV-SGRGAELTGYVINGRPTRRG--RGYGYGYD-------
A0A1W2CEA6      SLLVLEYNRTHGKALKEAVRLL-RRTGTPVLGCILNKTAVSRI--GKSGYSY--------
R7FFK6          VVMVVHYGTTTYAETEDAVKQL-ELANCNVLGFVLNEVVHKHS--AGYYSNYKYKYKY--
A0A373MPB9      VLLIARYGRTTYQEIEESMKKL-EIGDCNLLGFVLNDISAKNG--SHYGYKYSYKYKY--
A0A373L519      VLLIARYGRTTYQEIEESMKKL-EIGDCNLLGFVLNDISAKNG--SHYGYKYSYKYKY--
A0A373W906      VLLIARYGRTTYQEIEESMKKL-EIGDCNLLGFVLNDISAKNG--SHYG----YKYKY--
A0A373VCW2      VLLVARYGRTTYQEIEESMKKL-EIGDCNLLGFVLNDISAKNG--SHYGYKYSYKYKY--
W0U604          VLLVARYGRTTYQEIEESMKKL-EIGDCNLLGFVLNDISAKNG--SHYGYKYSYKYKY--
A0A374B6G0      VLLIARYGRTTYQEIEESMKKL-EIGDCNLLGFVLNDISAKNG--SHYGYKYSYKYKY--
A0A373VM36      VLLIARYGRTTYQEIEESMKKL-EIGDCNLLGFVLNDISAKNG--SHYGYKYSYKYKY--
A0A1C5P379      VLLVARYGRTTYQEIEESMKKL-EIGDCNLLGFVLNDISAKNG--SHYRYKYSYKYKY--
A0A373XXX0      VLLVARYGRTTYQEIEESMKKL-EIGDCNLLGFVLNDISAKNG--SHYG----YKYKY--
A0A5R9MJM9      VLLVARYGRTTYQEIEESMKKL-EIGDCNLLGFVLNDISAKNG--SHYGYKYNYKYKY--
A0A356CW82      VLLVARYGRTTYQEIEESMKKL-EIGDCNLLGFVLNDISTKNG--SHYGYKYNYKYKY--
R6T4X7          VLLVARYGRTTYQEIEESMKKL-EIGDCNLLGFVLNDISAKNG--SHYGYKYSYKYKY--
A0A374HTV1      VLLVARYGRTTYQEIEESMKKL-EIGDCNLLGFVLNDISAKNG--SHYGYKYSYKYKY--
A0A374GB66      VLLVARYGRTTYQEIEESMKKL-EIGDCNLLGFVLNDISAKNG--SHYGYKYSYKYKY--
A0A374ECC6      VLLVARYGRTTYQEIEESMKKL-EIGDCNLLGFVLNDISAKNG--SHYGYKYSYKYKY--
A0A374BM61      VLLVARYGRTTYQEIEESMKKL-EIGDCNLLGFVLNDISAKNG--SHYGYKYSYKYKY--
A0A373UGZ4      VLLVARYGRTTYQEIEESMKKL-EIGDCNLLGFVLNDISAKNG--SHYGYKYSYKYKY--
A0A373SA66      VLLVARYGRTTYQEIEESMKKL-EIGDCNLLGFVLNDISAKNG--SHYGYKYSYKYKY--
A0A1C5X6X7      VLLVARYGRTTYQEIEESMKKL-EIGDCNLLGFVLNDISAKNG--SHYGYKYSYKYKY--
A0A1C6JIH3      VLLVARYGRTTYQEIEESMKKL-EIGDCNLLGFVLNDISAKNG--SHYGYKYSYKYKY--
A0A373PSC3      VLLVARYGRTTYQEIEESMKKL-EIGDCNLLGFVLNDISAKNG--SHYGYKYNYKYKY--
A0A1K1WYK8      IMLVIRYAMTTYEELANCMKQI-ELAKVNMLGFVLNDVHHNHG--ANYYNY---KYKYKK
A0A1H6IUB1      IVLVLRYGVTTNEDAEDAIKKI-EFAKMNMLGFIMNDIKMKKS--GYYSSKYKGKYYYKK
A0A1M7L1F9      IIVVLRYGVTTNEDVDAAIKKV-EFAQMNMLGFIMNDVKIKKA--GYY-SKYKNKYYYKK
A0A1C6B4L6      IVVVLCYGRTTTEDIEAVVKKM-EFSKVNMLGFILNSIKNKRS--GRYYSKY--KYDYKR
A0A1Q6T9P4      IVVVLRYGRTTTEDIEAVVKKM-DFSKVNMLGFILNGIKNKRS--GRYYSKY--KYDYKR
A0A315Y4F9      IVLVVRYGRTTDEDVDNVFKRV-ELANMNLLGFILNGVKSKHA--G-YYSK------YGK
A0A354K620      IVLVVRYGKTTDEDVENVFKRI-ELAKMNLLGFIMNGINTKRA--G-YYAKG--KYYYKK
A0A355G3J9      YIMCSIAGYSDAEETKQAVLSL-EQIGAKIFGFVVIGVDFKVE--Q--------------
A0A3D2AD87      VILIVRDGYTPHYSIKKVLGDM-DFANINILGAVMNGSHPKNK--NKYIY-----RKY--
A0A143XN92      TILVVRYDTMLAADLNEVADTL-NEAGSRVIGGIFNNA---------YSNILERIGME--
A0A173ZYY6      VMIVSKQNYMLAEDINEVMDDF-RDKEGKVLGVVLNGV-------RSFSGLVDSPVGH--
A0A6L8RXB5      VMIVSKQNYMLAEDINEVMDAF-RDKEGKVLGVVLNGV-------RSFSGLVDSPVGH--
A0A6N9JW85      VMIVSKQNYMLAEDINEVMDAF-RDKEGKVLGVVLNGV-------RSFSGLVDSPVGH--
A0A173SMI2      VMIVAKQNYMLAEDINEVMDAF-RDKEGKVLGVVLNGV-------RSFSGLVDSPVGH--
A0A174ASH7      VMIVAKQNYMLAEDINEVMDAF-RDKEGKVLGVVLNGV-------RSFSGLVDSPVGH--
A6BH65          VMIVAKQNYMLAEDINEVMDAF-RDKEGKVLGVVLNGV-------RSFSGLVDSPVGH--
R7G0D7          VMIVSKQNYMLAEDINEVMDAF-RDKEGKVLGVVLNGV-------RSFSGLVDSPVGH--
A0A2T5IYJ6      VLYVIRSDTTAQNAARTGVNRL-RAAKAPLIGVILNKVNMKRA--AQYYGTYSSYYA---
A0A3C0QME1      LLLVVKYGQTTFEELQDAINHA-NLSELNVIGFVVNNISRKGS--GH-YYSYKYKYKY--
A0A355FYK5      LVFVIRKDHAKIADINETLEEI-AGTNIDIAGAVFTMNDEESR--GRILNKGGSGSRY--
A0A357AQU0      IVLVAEFEGTTSYDIKHALEGA-KLSNVNVLGVILNAVAGSST--GYGYKKYGYKYGY--
A0A3C1YJQ7      IVLVAEFEGTTSYDIKHALEGA-KLSNVNVLGVILNAVAGSST--GYGYKKYGYKYGY--
A0A3D0JG38      IVLVAEFEGTTSYDIKHALEGA-KLSNVNVLGVILNAVAGSST--GYGYKKYGYKYGY--
A0A3C0IHX1      ILMVARYYVTTTKELETALQAI-SVTGATVLGLVLTEVDFKQG--GY-YKKYYKKGSY--
R5V506          ILMVARYYVTTTKELETALQAI-SVTGATVLGLVLTEVDFKQG--GY-YKKYYKKGSY--
A0A352TIU5      ILMVARYYVTTTKELETALQAI-SVTGATVLGLVLTEVDFKQG--GY-YKKYYKKGSY--
A0A3E5FSY5      LLYVVKYDFLPYQKIQNGLSIL-KE-DCCFMGYVFNIYTKKSS--E--------------
A0A1V5S3C0      VLFVVAENKTSLREIEYAVSDL-STTKAEVFGCIYNNARRGIL--SMAGDTRGGYFSR--
A0A1Y3TC98      VLYVVKYDELPLQKIQEGLSFL-GSQRTPFTGYVFNNF----P--EGPGEYGY--SRY--
A0A1Q6REE0      GLMVIRQDYASRDQILDGAQRL-SDSRLPIIGCALNNV----R--RGLSGSKE--YGY--
R5ETF9          GLMVIRQDYASRDQILDGAQRL-SDSRLPIIGCALNNV----R--KSLSGSKE--YGY--
R6VAT5          LVFVVRQDYAKVSKILDSISLF-GYSKIKILGCIFNMASGVLS--TRGYGRYG--YNS--
A0A1Q6S448      SVLVVRQDTVPAPEINDAIDAL-RAGKAEFLGCILNDM----------AHLTA--YSA--
A0A351MYR0      SVLVVRQDTVPAPEINDAIDAL-RAGKAEFLGCILNDM----------SHLTA--YSA--
R6HPC1          SVLVVRQDTVPAPEINDAIDAL-RAGKAEFLGCILNDM----------AHLTA--YSA--
A0A3D4G5Z5      SVLVVRQDTVPAPEINDAIDAL-RAGKAEFLGCILNDM----------VHLTA--YSA--
A0A3D5ES03      SVLVVRQDTVPAPEINDAIDAL-RAGKAEFLGCILNDM----------AHLTA--YSA--
A0A0F2P7X6      VILVVKQGCAKVDVINSAQAAF-ENAGVRIIGCILNGIKYNQL--GAFYQSQN--YER--
A0A359B487      VILVVKQGCAKVDVINSAQAAF-ENAGVRIIGCILNGIKYNQL--GAFYQSRN--YER--
A0A348P5V4      IVLVVKQDYASARRIKRAVDNF-ENSGTEIIGCIFNNSENGMS--N------S--KIY--
A0A356PT74      ILLVVRNDMVASRRIKRAVENL-ENSGTKLVGCIYNDTESGMP--KRFMSSYN--KKY--
A0A3D5LL19      ILLVVRNDMVASRRIKRAVENL-ENSGTKLVGCIYNDTESGMP--KRFMSSYN--KKY--
R5MNF0          ILLVVRNDMVASRRIKRAVENL-ENSGTKLVGCIYNDTESGMP--NRFMSSYN--KKY--
A0A1Q9JSI0      SILVVKQHTALVKDINEAIAIL-KSGEGTMLGCVYN---------DVFPGFAE--TAK--
A0A3D5TNI1      SIFVIREDRFPVPAILEAVSDL-TQGGTDLAGCVYNISTDRSR--GGYGSYSV--SRR--
A0A358LJD0      SIFVIREDVFPVPAILEAVSDL-TQGGSDLAGCVYNISTDRSK--GGYGNYSI--SRR--
R6I3L7          SIFVIREDVFPVPAILEAVSDL-TQGGTDLAGCVYNISTDRSK--GGYGNYSI--SRR--
A0A3D1HXX0      SIFVIREDVFPVPAILEAVSDL-TQGGTDLAGCVYNISTDRSK--GGYGNYSI--SRR--
A0A3D2QJB8      SIFVIREDVFPVPAILEAVSDL-TQGGTDLAGCVYNISTDRSK--GGYGNYSI--SSR--
D4LC36          VVMVVHYGFTTYPELDDAVNRL-ALANCNVLGFAVNEV--SSK--HGSGYYSN--YKY--
R7MQJ4          ILMVLRYGRTTFDDLDNAMKKI-ELADVKMLGFILNDISKKHG--SYSKYGYN--YKS--
A0A1V5GLC0      IILVTSYGKTTVDDMDSAMKKI-EFANMNLLGFILNGI--KIK--KNGKYYSN--YK---
W7V182          IIMVARYAKTTTDDIDNAMKKI-EFAKMNMLGFILNDI--KTG--RSGKYYSK--YR---
                                               .                            

S3FFL2          GRDEKAGD----------------------------------------------------
A0A328M4V1      AAAKS-------------------------------------------------------
A0A6A8IF17      GSGYH-------------------------------------------------------
A0A3D5R4X5      YKYYSSYYGEYEKTSRKKRKKRSDVID---------------------------------
A0A1I4C3N6      --KKAAEKYGFVDTSAKVVSAKKKVAAR--------------------------------
A0A3B9CIM7      --K--HYAKDYKY-----------------------------------------------
A0A1G9WHW8      --NTKKYGKEYGYGLKYSASK---------------------------------------
A0A1H5VAA0      --NTKKYGKEYGYGLKYSASK---------------------------------------
A0A3R6VK11      --RLQQYWQEYKQQNGEAV-----------------------------------------
A0A3R6QUY7      --RLQQYWQEYKQQNGEAV-----------------------------------------
A0A373K3P9      --RLQQYWQEYKQQNGEAV-----------------------------------------
A0A3R6JRU5      --RLQQYWQEYKQQNGEAV-----------------------------------------
A0A1C5MS04      --RLQQYWQEYKQQNGEAV-----------------------------------------
A0A3C1J150      --RLQQYWQEYKQQNGEAV-----------------------------------------
A0A416CXD7      --RLQQYWQEYKQQNGEAV-----------------------------------------
A0A6N2X662      --RLQQYWQEYKQQNGEAV-----------------------------------------
R6XBL9          --RLQQYWQEYKQQNGEAV-----------------------------------------
A0A355W5Z7      --RLQQYWQEYKQQNGEAV-----------------------------------------
A0A143WVN6      --PYQNYQSRSVRKAEE-------------------------------------------
W6RXP9          --GE--------------------------------------------------------
W6S4G8          --GEEHKKKGDKVS----------------------------------------------
A0A1G6BLB6      --GRYHQYDHSEREGE--------------------------------------------
A0A1C6G8M0      --NYGYYYGNNQNKK---------------------------------------------
A0A416MP73      --NYGYYYGNYGNNQNKNKFTKAIVN----------------------------------
A0A3E4LL92      --SYGKYYNENAK-KNAGE-----------------------------------------
A0A415D1L1      --GYSKYYKENAKIENAGE-----------------------------------------
A0A0H5SF45      --YYYQRNND--------------------------------------------------
A0A1M6JRJ5      --YYSTKKNKNNGIVH--------------------------------------------
A0A1M7Y1S2      --YYYNPDNK--------------------------------------------------
A0A7I8DMN1      --YYYDSESDVNKKKKKLEQKL--------------------------------------
A0A396G6S7      --GYGGHYGKRA------------------------------------------------
A0A3E5A223      --GYGGHYGKRA------------------------------------------------
R7D5E6          --GYGGHYGKRA------------------------------------------------
A0A415HQH5      --GYGGHYGKRA------------------------------------------------
A0A414W2C6      --GCGGHYGKRA------------------------------------------------
A5ZNE7          --GCGGHYGKRA------------------------------------------------
A0A395X821      --GYGGHYGKRA------------------------------------------------
A0A1C5PY68      --GYGGHYGKRA------------------------------------------------
A0A174CJF8      --GYGGHYGKRA------------------------------------------------
A0A564SRR2      --GYGGHYGKRA------------------------------------------------
A0A174R7V0      --GYGGHYGKRA------------------------------------------------
A0A373MWV2      --GYGYGYGAYSRAER--------------------------------------------
A0A417CE88      --GYGYGYGAYSRAER--------------------------------------------
A0A416Y441      --GYGYGYGAYSRAER--------------------------------------------
A0A357GPJ7      --GYGYGYGAYSRAER--------------------------------------------
A0A396PAC1      --GYGYGYGAYSRAER--------------------------------------------
A0A416EYU4      --GYGYGYGAYSRAER--------------------------------------------
A0A416SCQ2      --GYGYGYGAYSRAER--------------------------------------------
A0A416TGN7      --GYGYGYGAYSRAER--------------------------------------------
A0A417SMF6      --GYGYGYGAYSRAER--------------------------------------------
A0A1Y4MW77      --RYYNKYGYRHYSYYNNEKKAAK------------------------------------
R6UHV6          --SDYQYGKYGYGKYGKYGSTAE-------------------------------------
A0A3R9Q621      --GYYYRSKDD-------------------------------------------------
A0A069RC75      ----YYSYYGK-------------------------------------------------
A0A6S6R676      --RYYYYNAGNNDD----------------------------------------------
A0A174F2W5      --GYGYGYGAYSRAER--------------------------------------------
A0A174S8E9      --GYGYGYGAYSRAER--------------------------------------------
A0A416ZL97      --GYGYGYGTYSRAER--------------------------------------------
A0A174LSK1      --GYGYGYGTYSRAER--------------------------------------------
A0A373GY92      --GYGYGYGTYSRAER--------------------------------------------
A0A373NZQ6      --GYGYGYGTYSRAER--------------------------------------------
A0A417I9B9      --GYGYGYGTYSRAER--------------------------------------------
A0A417MP97      --GYGYGYGTYSRAER--------------------------------------------
A0A417WQF8      --GYGYGYGTYSRAER--------------------------------------------
A0A373RZ83      --GYGYGYGTYSRAER--------------------------------------------
A0A416U6I1      --GYGYGYGTYSRAER--------------------------------------------
R7JQZ9          --GYGYGYGTYSRAER--------------------------------------------
A0A7C6SMH0      --SYSYKYD---------------------------------------------------
A0A3B8KKL6      --SYSYQYD---------------------------------------------------
A0A2K9E6R0      --SYSYQYD---------------------------------------------------
A0A2S8RBI0      --SYSYQYD---------------------------------------------------
A0A0L6JLG6      --KYE-------------------------------------------------------
G8LSN0          --NYEYK-----------------------------------------------------
A0A1M5UYN6      --EYYYSYGSSNKHKNTKSKRLKQKSI---------------------------------
A0A176JBT8      ----YGGYMG--------------------------------------------------
A0A1I5HIC6      --GKYYGR----------------------------------------------------
A0A1Y3TC51      --EYSYGRAYRSQDMPGEGLTGRSGEHTARGE-RG-------------------------
A0A1Y3T1N0      --GYDY---------------GNYGKNIRRGDQRG-------------------------
A0A1Y3Y8U8      --GYDY---------------GDYGKNIRRGDQRG-------------------------
A0A5B0BQY5      ------------------------------------------------------------
A6CLL4          ------------------------------------------------------------
A0A176U8D6      --GNYGYYYGNYGNNQNKK-----------------------------------------
A0A1Q6KSQ5      --GNYGYY---YGNNQNKK-----------------------------------------
A0A3D3U8B3      ------------------------------------------------------------
A0A3E5FRL7      --GYSYYDYKTHRHESR-------------------------------------------
A0A1Y4QK93      --GYSYYDYKNHRHESR-------------------------------------------
B1C232          --GYSYYDYKTHRHESR-------------------------------------------
A0A401USI6      --DYYSYDKEKSSRLRNKSGRKKRNNNEKPNPINI-------------------------
A0A1V4IQ10      ----TYYYSSHSSSSNTIKSLLG-------------------------------------
A0A1S8TRD2      ----TYYYRSHGSSNKITRSLLG-------------------------------------
G7M1U2          ----TYYYRSHGSSNKTTRSLLG-------------------------------------
A0A2T6KJ75      --N---------------------------------------------------------
A9KN92          --GKYYSHVYANDYDENGN-----------------------------------------
A0A352MUJ1      ----YYMNESDIKRRKTRSRR---------------------------------------
R5YI67          ----YYMNEEDIKRKKRKRSEHH-------------------------------------
A0A174DL89      --Q---------------------------------------------------------
A0A1Y0IQP5      ----YSYYASPAGDRDD-------------------------------------------
A0A4R2R7B1      ----YSYYAAPEGDPHD-------------------------------------------
A0A1M6E8I2      --NSYYYYYEESET----------------------------------------------
A0A1Y4N105      --SHYGDYQRRTTSNLHK------------------------------------------
A0A1Y4QP75      --SHYGDYQRRTTSNLHK------------------------------------------
A0A3D4QRB5      --GSYYYYYGSDSDGKGKKSRNKKRRAQHSA-----------------------------
A0A349DEH5      --GKRYGHYGKSGR--YGYGSYGYGYGQSKK-----------------------------
A0A3D4T7B4      --GKRYGHYGKSGR--YGYGSYGYGYGQSKK-----------------------------
A0A350XYC7      --GRHYGKKGT-----YGYGGYG-GYGQSSK-----------------------------
R6DNR8          --GRRYGHYGKSGRYGYGYGSYGYGYGQSKK-----------------------------
A0A355KUM5      --GRRYG-----------------------------------------------------
R5YGY6          --GRRYGGYGK--RYGYGSYGYGYGQSSSKK-----------------------------
A0A0K8J554      ----KYYYNVNQDD----------------------------------------------
A0A1I0RG99      ----RYYN----------------------------------------------------
A0A1I5G322      ----HYYYYNNYND----------------------------------------------
A0A7C6IYW8      ----YYSHYGAKND----------------------------------------------
A0A3N1XSX6      ----YYYQYGDSND----------------------------------------------
A0A7C6JZF1      ----YYYYQGKNG-----------------------------------------------
A0A7G9WCY6      ----YNYYYAEEK-----------------------------------------------
A0A1C6G0U3      ------------------------------------------------------------
A0A3D4LLB3      ----YKSYC---------------------------------------------------
A0A0A5GPA9      ------------------------------------------------------------
A0A271M6M4      ------------------------------------------------------------
A0A7C7AD93      --RKYGYYYG--------------------------------------------------
A0A2V3W8U6      ----YHYGTR--------------------------------------------------
A0A6N3BXA1      --SNYSYYYGE-------------------------------------------------
A0A351SRI8      ----YGHYYQ--------------------------------------------------
A0A1V5LU59      ----YSYKYK--------------------------------------------------
A0A1E3BVC3      ----YSYKYE--------------------------------------------------
A0A4Q0I6S0      ----YSYKYE--------------------------------------------------
A3DF66          ----YSYKYE--------------------------------------------------
W4V1T8          ----YSYKYD--------------------------------------------------
A0A1C6ITD7      -----NYYYKE-------------------------------------------------
A0A381IX63      ----YGYYYSAEGNKRKKRKNK--------------------------------------
A0A1G9IUT4      ----YGYYYENE------------------------------------------------
A0A1M6RWV2      ----YYYYYLED------------------------------------------------
A0A143XPI5      ---YAYRYGYYHK-----GYRYYSINNKDMELHNK-------------------------
A0A355G1X5      ------LLGLYSKS----SYGYKSYHSYGYGYGFE-------------------------
A0A0M6WXE3      ------RYG---------RYG---------RYGKY-------------------------
A0A348SAK2      ------RYG---------RYG---------RYGKY-------------------------
A0A1G9H5B9      RKYYRKYYKNYYSKRT--TRGSTLGSNLETARGST-------------------------
R5EFZ0          QLSTGQSYGGYSKYSHYGHYG---------NYGSS-------------------------
A0A1Y4H8L0      GYGYG-------------AYA-------QYANDRG-------------------------
A0A4B9BMD9      AYSYGYNY---------------------YGYSYS-------------------------
A0A0M6WYQ8      RYRYG-RYGRYG------RYG---------GYRHY-------------------------
A0A348SAK1      RYRYG-RYGRYG------RYG---------GYRHY-------------------------
A0A252F281      -YGYRGYYG---------NYG---------KYGKS-------------------------
A0A1Y4QKE6      ------EYGHHSY-----GYN-------RYGYVK--------------------------
B1C231          ------EYGHYSY-----GYN-------QYRYSKG-------------------------
A0A1Y3TUL5      ------NYE---------SEGSASRRGRGSSSGKS-------------------------
A0A1Y4JAX2      ------NYE---------SEGSASRRGRGSSSGKS-------------------------
A0A1Y4T590      ------NYE---------SEGSASRRGRGSSSGKS-------------------------
R5B467          GYGYG-GYG-YGY-----GYG-----GYGYGYGSG-------------------------
A0A1Y3T163      -YGYG-RYGRYGY-------G-------KYGYGGG-------------------------
A0A1Y3YCA2      -YGYG-RYGRYGY-------G-------KYGYGGG-------------------------
A0A1Y4L6N9      GYGYGYNYG-YGYR----RDG-------EYGDEKY-------------------------
A0A173T644      -YGYG-RYG-YGY------YG-------KYGYGEQ-------------------------
A0A1C5TSB8      -YGYG-RYG-YGY------YG-------KYGYGEQ-------------------------
C0CIK6          -YGYG-RYG-YGY------YG-------KYGYGEQ-------------------------
A0A1Y3WEF6      -YGYG-RYG-YGYY----GYG-------SYGYGER-------------------------
A0A417T0L2      -YGYG-RYG-YGYY----GYG-------SYGYGKK-------------------------
A0A1H9EPU3      GY-YGGYYG-YGNY----SYG---------------------------------------
A0A354IGV3      LHNYGRYRK-YGKYGKYGGYGRYGGYGRYGDYGAA-------------------------
A0A417JMV2      GYGYGSKYG-YGNHGY--GYG----YGYGYGYGYG-------------------------
A0A415VWX5      GYGYGNKYG-YGNH----GYG----YGYGYGYGYG-------------------------
A0A173UY96      GYGYGSKYG-YGNHGY--GYG----YGYGYGYGYG-------------------------
B0P408          GYGYGNKYG-YGNHGY--GYG----YGYGYGYGYG-------------------------
D4MV82          GYGYGNKYG-YGNHGY--GYG----YGYGYGYGYG-------------------------
A0A173QTL1      GYGYGSKYG-YGNHGY--GYG----YGYGYGYGYG-------------------------
A0A174J359      GYGYGSKYG-YGNH----GYG----YGYGYGYGYG-------------------------
A0A174A3T7      GYGYGNKYG-YGNHGY--GYG----YGYGYGYGYG-------------------------
A0A417UUA3      GYGYGSKYG-YGNH----GYG----YGYGYGYGYG-------------------------
A0A6N2VB70      GYGYGSKYG-YGNHGY--GYG----YGYGYGYGYG-------------------------
A0A1C6EUV9      GSSYGYGYG-YGSK-Y--GYGGKYGYGYGYGYGRS-------------------------
A0A173Y645      GSSYGYGYG-YGNK-Y--GYGGK--YGYGYGYGRS-------------------------
A0A374AVY6      GSSYGYGYG-YGNK-Y--G------YGYGYGYGRS-------------------------
R7BXS4          GSSYGYGYG-YGNK-Y--G------YGYGYGYGRS-------------------------
A0A143ZUX1      -----------------------------YDYRES-------------------------
A0A1W1Z4C3      -------------------YN-------KYDTRIQ-------------------------
A0A239QN83      -------------------YN-------KYDTRSR-------------------------
A0A3R9WAA7      ---------GYGYYGKYGRKS-------YYGKNTGIAANQVD------------------
A0A1G6BLF1      ---------GYGHGEKRYGYG-------YGGYGIK-------------------------
R6HZX3          ---------RYG-------YG-------KYGYGTK-------------------------
A0A1W2CEA6      ---------YYG--------G-------KNGYGKQ-------------------------
R7FFK6          ---------KYD-----------------YQYRTE-------------------------
A0A373MPB9      ---------DYS-----------------YKYGGK-------------------------
A0A373L519      ---------DYS-----------------YKYGGK-------------------------
A0A373W906      ---------DYS-----------------YKYGGK-------------------------
A0A373VCW2      ---------DYS-----------------YKYGGK-------------------------
W0U604          ---------DYS-----------------YKYGGK-------------------------
A0A374B6G0      ---------DYS-----------------YKYGGK-------------------------
A0A373VM36      ---------DYS-----------------YKYGGK-------------------------
A0A1C5P379      ---------DYS-----------------YKYGGK-------------------------
A0A373XXX0      ---------DYS-----------------YKYGGK-------------------------
A0A5R9MJM9      ---------DYS-----------------YKYGGK-------------------------
A0A356CW82      ---------DYS-----------------YKYGGK-------------------------
R6T4X7          ---------DYS-----------------YKYGGK-------------------------
A0A374HTV1      ---------DYS-----------------YKYGGK-------------------------
A0A374GB66      ---------DYS-----------------YKYGGK-------------------------
A0A374ECC6      ---------DYS-----------------YKYGGK-------------------------
A0A374BM61      ---------DYS-----------------YKYGGK-------------------------
A0A373UGZ4      ---------DYS-----------------YKYGGK-------------------------
A0A373SA66      ---------DYS-----------------YKYGGK-------------------------
A0A1C5X6X7      ---------DYS-----------------YKYGGK-------------------------
A0A1C6JIH3      ---------DYS-----------------YKYGGK-------------------------
A0A373PSC3      ---------DYS-----------------YKYGGK-------------------------
A0A1K1WYK8      YGYGYGSY-GYG-----------------YTYGNN-------------------------
A0A1H6IUB1      -GYGYGGYGGY--------------------YGSK-------------------------
A0A1M7L1F9      -GYGYGGY-GY--------------------YGSK-------------------------
A0A1C6B4L6      -G--Y----GY--------------------YGEK-------------------------
A0A1Q6T9P4      -G--Y----GY--------------------YGEK-------------------------
A0A315Y4F9      -GKYY----GY--------------------YGAK-------------------------
A0A354K620      -GYGY----GY--------------------YGEK-------------------------
A0A355G3J9      ----------YGRYKRYGKYG-------YRSYRYS-------------------------
A0A3D2AD87      ---------SYGYYGSYYKYD-------YHKNGYN-------------------------
A0A143XN92      ---------QYGRKTSY-------------------------------------------
A0A173ZYY6      ---------YYGKYSKYGRYG-------NYGRSKGM------------------------
A0A6L8RXB5      ---------YYGKYSKYGRYG-------NYGRSKGM------------------------
A0A6N9JW85      ---------YYGKYSKYGRYG-------NYGRSKGM------------------------
A0A173SMI2      ---------YYGKYSKYGRYG-------NYGRSKGM------------------------
A0A174ASH7      ---------YYGKYSKYGRYG-------NYGRSKGM------------------------
A6BH65          ---------YYGKYSKYGRYG-------NYGRSKGM------------------------
R7G0D7          ---------YYGKYSKYGRYG-------NYGRSKGM------------------------
A0A2T5IYJ6      -------------------YG-------DYVYGSS-------------------------
A0A3C0QME1      ---------RY-KSYEY-HYV--------SHSEDSMTSTPKLSMREDAPQEVPAETKAVE
A0A355FYK5      ------------YKRYY-RYG--------GKYGYG-------------------------
A0A357AQU0      ---------KYGYKYGY-RYG--------YGYGNN-------------------------
A0A3C1YJQ7      ---------KYGYKYGY-RYG--------YGYGNN-------------------------
A0A3D0JG38      ---------KYGYKYGY-RYG--------YGYGNN-------------------------
A0A3C0IHX1      ----------------Y-TYG--------NGNGNG-------------------------
R5V506          ----------------Y-TYG--------NGNGNG-------------------------
A0A352TIU5      ----------------Y-TYG--------NENGNG-------------------------
A0A3E5FSY5      -------------------YG-------HYSYGYN-------------------------
A0A1V5S3C0      ---------SYSYSYSK-SYG--------ADYGQE-------------------------
A0A1Y3TC98      ---------GYG---RY-GYG-------KYGYGRY-------------------------
A0A1Q6REE0      ---------GYGYGYGY-GYG--------YGYGSK-------------------------
R5ETF9          ---------GYGYGYGY-GYG--------YGYGSK-------------------------
R6VAT5          ---------YGGYGSYG-SYG-------RYGYGYG-------------------------
A0A1Q6S448      ---------GYGYGCGY--YG--------YGYGKK-------------------------
A0A351MYR0      ---------GYGYGYGY--YG--------YGYGKK-------------------------
R6HPC1          ---------GYGYGYGY--YG--------YGYGKK-------------------------
A0A3D4G5Z5      ---------GYGYGYGY--YG--------YGYGKK-------------------------
A0A3D5ES03      ---------GYGYGYGY--YG--------YGYGKK-------------------------
A0A0F2P7X6      ---------FLG---DY-YKD--------YALTNK-------------------------
A0A359B487      ---------FLG---DY-YKN--------YALTNK-------------------------
A0A348P5V4      ---------GRK-------YG--------YGYGYG-------------------------
A0A356PT74      ---------GYG-------YG--------YGYGYG-------------------------
A0A3D5LL19      ---------GYG-------YG--------YGYGYG-------------------------
R5MNF0          ---------GYG-------YG--------YGYGYG-------------------------
A0A1Q9JSI0      ---------AYGYKYGY-GYG--------YGYGYG-------------------------
A0A3D5TNI1      ---------RYGYGYGR-HYG--------YGYGKH-------------------------
A0A358LJD0      ---------RYG-------YG--------YSYGKR-------------------------
R6I3L7          ---------GYG-------YG--------YGYGKH-------------------------
A0A3D1HXX0      ---------RYG-------YG--------YGYGKH-------------------------
A0A3D2QJB8      ---------RYG-------YG--------YGYGKH-------------------------
D4LC36          ---------KYK-------YK--------YDYQYG-------------------------
R7MQJ4          ---------HYY-------DS--------YGYGEE-------------------------
A0A1V5GLC0      ----------YR-------SV--------YGYGND-------------------------
W7V182          ----------YD-------KG--------YGYGVK-------------------------
                                                                            

S3FFL2          ------------------------------------------------------------
A0A328M4V1      ------------------------------------------------------------
A0A6A8IF17      ------------------------------------------------------------
A0A3D5R4X5      ------------------------------------------------------------
A0A1I4C3N6      ------------------------------------------------------------
A0A3B9CIM7      ------------------------------------------------------------
A0A1G9WHW8      ------------------------------------------------------------
A0A1H5VAA0      ------------------------------------------------------------
A0A3R6VK11      ------------------------------------------------------------
A0A3R6QUY7      ------------------------------------------------------------
A0A373K3P9      ------------------------------------------------------------
A0A3R6JRU5      ------------------------------------------------------------
A0A1C5MS04      ------------------------------------------------------------
A0A3C1J150      ------------------------------------------------------------
A0A416CXD7      ------------------------------------------------------------
A0A6N2X662      ------------------------------------------------------------
R6XBL9          ------------------------------------------------------------
A0A355W5Z7      ------------------------------------------------------------
A0A143WVN6      ------------------------------------------------------------
W6RXP9          ------------------------------------------------------------
W6S4G8          ------------------------------------------------------------
A0A1G6BLB6      ------------------------------------------------------------
A0A1C6G8M0      ------------------------------------------------------------
A0A416MP73      ------------------------------------------------------------
A0A3E4LL92      ------------------------------------------------------------
A0A415D1L1      ------------------------------------------------------------
A0A0H5SF45      ------------------------------------------------------------
A0A1M6JRJ5      ------------------------------------------------------------
A0A1M7Y1S2      ------------------------------------------------------------
A0A7I8DMN1      ------------------------------------------------------------
A0A396G6S7      ------------------------------------------------------------
A0A3E5A223      ------------------------------------------------------------
R7D5E6          ------------------------------------------------------------
A0A415HQH5      ------------------------------------------------------------
A0A414W2C6      ------------------------------------------------------------
A5ZNE7          ------------------------------------------------------------
A0A395X821      ------------------------------------------------------------
A0A1C5PY68      ------------------------------------------------------------
A0A174CJF8      ------------------------------------------------------------
A0A564SRR2      ------------------------------------------------------------
A0A174R7V0      ------------------------------------------------------------
A0A373MWV2      ------------------------------------------------------------
A0A417CE88      ------------------------------------------------------------
A0A416Y441      ------------------------------------------------------------
A0A357GPJ7      ------------------------------------------------------------
A0A396PAC1      ------------------------------------------------------------
A0A416EYU4      ------------------------------------------------------------
A0A416SCQ2      ------------------------------------------------------------
A0A416TGN7      ------------------------------------------------------------
A0A417SMF6      ------------------------------------------------------------
A0A1Y4MW77      ------------------------------------------------------------
R6UHV6          ------------------------------------------------------------
A0A3R9Q621      ------------------------------------------------------------
A0A069RC75      ------------------------------------------------------------
A0A6S6R676      ------------------------------------------------------------
A0A174F2W5      ------------------------------------------------------------
A0A174S8E9      ------------------------------------------------------------
A0A416ZL97      ------------------------------------------------------------
A0A174LSK1      ------------------------------------------------------------
A0A373GY92      ------------------------------------------------------------
A0A373NZQ6      ------------------------------------------------------------
A0A417I9B9      ------------------------------------------------------------
A0A417MP97      ------------------------------------------------------------
A0A417WQF8      ------------------------------------------------------------
A0A373RZ83      ------------------------------------------------------------
A0A416U6I1      ------------------------------------------------------------
R7JQZ9          ------------------------------------------------------------
A0A7C6SMH0      ------------------------------------------------------------
A0A3B8KKL6      ------------------------------------------------------------
A0A2K9E6R0      ------------------------------------------------------------
A0A2S8RBI0      ------------------------------------------------------------
A0A0L6JLG6      ------------------------------------------------------------
G8LSN0          ------------------------------------------------------------
A0A1M5UYN6      ------------------------------------------------------------
A0A176JBT8      ------------------------------------------------------------
A0A1I5HIC6      ------------------------------------------------------------
A0A1Y3TC51      ------------------------------------------------------------
A0A1Y3T1N0      ------------------------------------------------------------
A0A1Y3Y8U8      ------------------------------------------------------------
A0A5B0BQY5      ------------------------------------------------------------
A6CLL4          ------------------------------------------------------------
A0A176U8D6      ------------------------------------------------------------
A0A1Q6KSQ5      ------------------------------------------------------------
A0A3D3U8B3      ------------------------------------------------------------
A0A3E5FRL7      ------------------------------------------------------------
A0A1Y4QK93      ------------------------------------------------------------
B1C232          ------------------------------------------------------------
A0A401USI6      ------------------------------------------------------------
A0A1V4IQ10      ------------------------------------------------------------
A0A1S8TRD2      ------------------------------------------------------------
G7M1U2          ------------------------------------------------------------
A0A2T6KJ75      ------------------------------------------------------------
A9KN92          ------------------------------------------------------------
A0A352MUJ1      ------------------------------------------------------------
R5YI67          ------------------------------------------------------------
A0A174DL89      ------------------------------------------------------------
A0A1Y0IQP5      ------------------------------------------------------------
A0A4R2R7B1      ------------------------------------------------------------
A0A1M6E8I2      ------------------------------------------------------------
A0A1Y4N105      ------------------------------------------------------------
A0A1Y4QP75      ------------------------------------------------------------
A0A3D4QRB5      ------------------------------------------------------------
A0A349DEH5      ------------------------------------------------------------
A0A3D4T7B4      ------------------------------------------------------------
A0A350XYC7      ------------------------------------------------------------
R6DNR8          ------------------------------------------------------------
A0A355KUM5      ------------------------------------------------------------
R5YGY6          ------------------------------------------------------------
A0A0K8J554      ------------------------------------------------------------
A0A1I0RG99      ------------------------------------------------------------
A0A1I5G322      ------------------------------------------------------------
A0A7C6IYW8      ------------------------------------------------------------
A0A3N1XSX6      ------------------------------------------------------------
A0A7C6JZF1      ------------------------------------------------------------
A0A7G9WCY6      ------------------------------------------------------------
A0A1C6G0U3      ------------------------------------------------------------
A0A3D4LLB3      ------------------------------------------------------------
A0A0A5GPA9      ------------------------------------------------------------
A0A271M6M4      ------------------------------------------------------------
A0A7C7AD93      ------------------------------------------------------------
A0A2V3W8U6      ------------------------------------------------------------
A0A6N3BXA1      ------------------------------------------------------------
A0A351SRI8      ------------------------------------------------------------
A0A1V5LU59      ------------------------------------------------------------
A0A1E3BVC3      ------------------------------------------------------------
A0A4Q0I6S0      ------------------------------------------------------------
A3DF66          ------------------------------------------------------------
W4V1T8          ------------------------------------------------------------
A0A1C6ITD7      ------------------------------------------------------------
A0A381IX63      ------------------------------------------------------------
A0A1G9IUT4      ------------------------------------------------------------
A0A1M6RWV2      ------------------------------------------------------------
A0A143XPI5      ------------------------------------------------------------
A0A355G1X5      ------------------------------------------------------------
A0A0M6WXE3      ------------------------------------------------------------
A0A348SAK2      ------------------------------------------------------------
A0A1G9H5B9      ------------------------------------------------------------
R5EFZ0          ------------------------------------------------------------
A0A1Y4H8L0      ------------------------------------------------------------
A0A4B9BMD9      ------------------------------------------------------------
A0A0M6WYQ8      ------------------------------------------------------------
A0A348SAK1      ------------------------------------------------------------
A0A252F281      ------------------------------------------------------------
A0A1Y4QKE6      ------------------------------------------------------------
B1C231          ------------------------------------------------------------
A0A1Y3TUL5      ------------------------------------------------------------
A0A1Y4JAX2      ------------------------------------------------------------
A0A1Y4T590      ------------------------------------------------------------
R5B467          ------------------------------------------------------------
A0A1Y3T163      ------------------------------------------------------------
A0A1Y3YCA2      ------------------------------------------------------------
A0A1Y4L6N9      ------------------------------------------------------------
A0A173T644      ------------------------------------------------------------
A0A1C5TSB8      ------------------------------------------------------------
C0CIK6          ------------------------------------------------------------
A0A1Y3WEF6      ------------------------------------------------------------
A0A417T0L2      ------------------------------------------------------------
A0A1H9EPU3      ------------------------------------------------------------
A0A354IGV3      ------------------------------------------------------------
A0A417JMV2      ------------------------------------------------------------
A0A415VWX5      ------------------------------------------------------------
A0A173UY96      ------------------------------------------------------------
B0P408          ------------------------------------------------------------
D4MV82          ------------------------------------------------------------
A0A173QTL1      ------------------------------------------------------------
A0A174J359      ------------------------------------------------------------
A0A174A3T7      ------------------------------------------------------------
A0A417UUA3      ------------------------------------------------------------
A0A6N2VB70      ------------------------------------------------------------
A0A1C6EUV9      ------------------------------------------------------------
A0A173Y645      ------------------------------------------------------------
A0A374AVY6      ------------------------------------------------------------
R7BXS4          ------------------------------------------------------------
A0A143ZUX1      ------------------------------------------------------------
A0A1W1Z4C3      ------------------------------------------------------------
A0A239QN83      ------------------------------------------------------------
A0A3R9WAA7      ------------------------------------------------------------
A0A1G6BLF1      ------------------------------------------------------------
R6HZX3          ------------------------------------------------------------
A0A1W2CEA6      ------------------------------------------------------------
R7FFK6          ------------------------------------------------------------
A0A373MPB9      ------------------------------------------------------------
A0A373L519      ------------------------------------------------------------
A0A373W906      ------------------------------------------------------------
A0A373VCW2      ------------------------------------------------------------
W0U604          ------------------------------------------------------------
A0A374B6G0      ------------------------------------------------------------
A0A373VM36      ------------------------------------------------------------
A0A1C5P379      ------------------------------------------------------------
A0A373XXX0      ------------------------------------------------------------
A0A5R9MJM9      ------------------------------------------------------------
A0A356CW82      ------------------------------------------------------------
R6T4X7          ------------------------------------------------------------
A0A374HTV1      ------------------------------------------------------------
A0A374GB66      ------------------------------------------------------------
A0A374ECC6      ------------------------------------------------------------
A0A374BM61      ------------------------------------------------------------
A0A373UGZ4      ------------------------------------------------------------
A0A373SA66      ------------------------------------------------------------
A0A1C5X6X7      ------------------------------------------------------------
A0A1C6JIH3      ------------------------------------------------------------
A0A373PSC3      ------------------------------------------------------------
A0A1K1WYK8      ------------------------------------------------------------
A0A1H6IUB1      ------------------------------------------------------------
A0A1M7L1F9      ------------------------------------------------------------
A0A1C6B4L6      ------------------------------------------------------------
A0A1Q6T9P4      ------------------------------------------------------------
A0A315Y4F9      ------------------------------------------------------------
A0A354K620      ------------------------------------------------------------
A0A355G3J9      ------------------------------------------------------------
A0A3D2AD87      ------------------------------------------------------------
A0A143XN92      ------------------------------------------------------------
A0A173ZYY6      ------------------------------------------------------------
A0A6L8RXB5      ------------------------------------------------------------
A0A6N9JW85      ------------------------------------------------------------
A0A173SMI2      ------------------------------------------------------------
A0A174ASH7      ------------------------------------------------------------
A6BH65          ------------------------------------------------------------
R7G0D7          ------------------------------------------------------------
A0A2T5IYJ6      ------------------------------------------------------------
A0A3C0QME1      TTAPIEETPAEVVEESAPIEETPAEVVEESAPIEETPAEVVEESAPIEETPAEVVEESAP
A0A355FYK5      ------------------------------------------------------------
A0A357AQU0      ------------------------------------------------------------
A0A3C1YJQ7      ------------------------------------------------------------
A0A3D0JG38      ------------------------------------------------------------
A0A3C0IHX1      ------------------------------------------------------------
R5V506          ------------------------------------------------------------
A0A352TIU5      ------------------------------------------------------------
A0A3E5FSY5      ------------------------------------------------------------
A0A1V5S3C0      ------------------------------------------------------------
A0A1Y3TC98      ------------------------------------------------------------
A0A1Q6REE0      ------------------------------------------------------------
R5ETF9          ------------------------------------------------------------
R6VAT5          ------------------------------------------------------------
A0A1Q6S448      ------------------------------------------------------------
A0A351MYR0      ------------------------------------------------------------
R6HPC1          ------------------------------------------------------------
A0A3D4G5Z5      ------------------------------------------------------------
A0A3D5ES03      ------------------------------------------------------------
A0A0F2P7X6      ------------------------------------------------------------
A0A359B487      ------------------------------------------------------------
A0A348P5V4      ------------------------------------------------------------
A0A356PT74      ------------------------------------------------------------
A0A3D5LL19      ------------------------------------------------------------
R5MNF0          ------------------------------------------------------------
A0A1Q9JSI0      ------------------------------------------------------------
A0A3D5TNI1      ------------------------------------------------------------
A0A358LJD0      ------------------------------------------------------------
R6I3L7          ------------------------------------------------------------
A0A3D1HXX0      ------------------------------------------------------------
A0A3D2QJB8      ------------------------------------------------------------
D4LC36          ------------------------------------------------------------
R7MQJ4          ------------------------------------------------------------
A0A1V5GLC0      ------------------------------------------------------------
W7V182          ------------------------------------------------------------
                                                                            

S3FFL2          ------------------------------------------------------------
A0A328M4V1      ------------------------------------------------------------
A0A6A8IF17      ------------------------------------------------------------
A0A3D5R4X5      ------------------------------------------------------------
A0A1I4C3N6      ------------------------------------------------------------
A0A3B9CIM7      ------------------------------------------------------------
A0A1G9WHW8      ------------------------------------------------------------
A0A1H5VAA0      ------------------------------------------------------------
A0A3R6VK11      ------------------------------------------------------------
A0A3R6QUY7      ------------------------------------------------------------
A0A373K3P9      ------------------------------------------------------------
A0A3R6JRU5      ------------------------------------------------------------
A0A1C5MS04      ------------------------------------------------------------
A0A3C1J150      ------------------------------------------------------------
A0A416CXD7      ------------------------------------------------------------
A0A6N2X662      ------------------------------------------------------------
R6XBL9          ------------------------------------------------------------
A0A355W5Z7      ------------------------------------------------------------
A0A143WVN6      ------------------------------------------------------------
W6RXP9          ------------------------------------------------------------
W6S4G8          ------------------------------------------------------------
A0A1G6BLB6      ------------------------------------------------------------
A0A1C6G8M0      ------------------------------------------------------------
A0A416MP73      ------------------------------------------------------------
A0A3E4LL92      ------------------------------------------------------------
A0A415D1L1      ------------------------------------------------------------
A0A0H5SF45      ------------------------------------------------------------
A0A1M6JRJ5      ------------------------------------------------------------
A0A1M7Y1S2      ------------------------------------------------------------
A0A7I8DMN1      ------------------------------------------------------------
A0A396G6S7      ------------------------------------------------------------
A0A3E5A223      ------------------------------------------------------------
R7D5E6          ------------------------------------------------------------
A0A415HQH5      ------------------------------------------------------------
A0A414W2C6      ------------------------------------------------------------
A5ZNE7          ------------------------------------------------------------
A0A395X821      ------------------------------------------------------------
A0A1C5PY68      ------------------------------------------------------------
A0A174CJF8      ------------------------------------------------------------
A0A564SRR2      ------------------------------------------------------------
A0A174R7V0      ------------------------------------------------------------
A0A373MWV2      ------------------------------------------------------------
A0A417CE88      ------------------------------------------------------------
A0A416Y441      ------------------------------------------------------------
A0A357GPJ7      ------------------------------------------------------------
A0A396PAC1      ------------------------------------------------------------
A0A416EYU4      ------------------------------------------------------------
A0A416SCQ2      ------------------------------------------------------------
A0A416TGN7      ------------------------------------------------------------
A0A417SMF6      ------------------------------------------------------------
A0A1Y4MW77      ------------------------------------------------------------
R6UHV6          ------------------------------------------------------------
A0A3R9Q621      ------------------------------------------------------------
A0A069RC75      ------------------------------------------------------------
A0A6S6R676      ------------------------------------------------------------
A0A174F2W5      ------------------------------------------------------------
A0A174S8E9      ------------------------------------------------------------
A0A416ZL97      ------------------------------------------------------------
A0A174LSK1      ------------------------------------------------------------
A0A373GY92      ------------------------------------------------------------
A0A373NZQ6      ------------------------------------------------------------
A0A417I9B9      ------------------------------------------------------------
A0A417MP97      ------------------------------------------------------------
A0A417WQF8      ------------------------------------------------------------
A0A373RZ83      ------------------------------------------------------------
A0A416U6I1      ------------------------------------------------------------
R7JQZ9          ------------------------------------------------------------
A0A7C6SMH0      ------------------------------------------------------------
A0A3B8KKL6      ------------------------------------------------------------
A0A2K9E6R0      ------------------------------------------------------------
A0A2S8RBI0      ------------------------------------------------------------
A0A0L6JLG6      ------------------------------------------------------------
G8LSN0          ------------------------------------------------------------
A0A1M5UYN6      ------------------------------------------------------------
A0A176JBT8      ------------------------------------------------------------
A0A1I5HIC6      ------------------------------------------------------------
A0A1Y3TC51      ------------------------------------------------------------
A0A1Y3T1N0      ------------------------------------------------------------
A0A1Y3Y8U8      ------------------------------------------------------------
A0A5B0BQY5      ------------------------------------------------------------
A6CLL4          ------------------------------------------------------------
A0A176U8D6      ------------------------------------------------------------
A0A1Q6KSQ5      ------------------------------------------------------------
A0A3D3U8B3      ------------------------------------------------------------
A0A3E5FRL7      ------------------------------------------------------------
A0A1Y4QK93      ------------------------------------------------------------
B1C232          ------------------------------------------------------------
A0A401USI6      ------------------------------------------------------------
A0A1V4IQ10      ------------------------------------------------------------
A0A1S8TRD2      ------------------------------------------------------------
G7M1U2          ------------------------------------------------------------
A0A2T6KJ75      ------------------------------------------------------------
A9KN92          ------------------------------------------------------------
A0A352MUJ1      ------------------------------------------------------------
R5YI67          ------------------------------------------------------------
A0A174DL89      ------------------------------------------------------------
A0A1Y0IQP5      ------------------------------------------------------------
A0A4R2R7B1      ------------------------------------------------------------
A0A1M6E8I2      ------------------------------------------------------------
A0A1Y4N105      ------------------------------------------------------------
A0A1Y4QP75      ------------------------------------------------------------
A0A3D4QRB5      ------------------------------------------------------------
A0A349DEH5      ------------------------------------------------------------
A0A3D4T7B4      ------------------------------------------------------------
A0A350XYC7      ------------------------------------------------------------
R6DNR8          ------------------------------------------------------------
A0A355KUM5      ------------------------------------------------------------
R5YGY6          ------------------------------------------------------------
A0A0K8J554      ------------------------------------------------------------
A0A1I0RG99      ------------------------------------------------------------
A0A1I5G322      ------------------------------------------------------------
A0A7C6IYW8      ------------------------------------------------------------
A0A3N1XSX6      ------------------------------------------------------------
A0A7C6JZF1      ------------------------------------------------------------
A0A7G9WCY6      ------------------------------------------------------------
A0A1C6G0U3      ------------------------------------------------------------
A0A3D4LLB3      ------------------------------------------------------------
A0A0A5GPA9      ------------------------------------------------------------
A0A271M6M4      ------------------------------------------------------------
A0A7C7AD93      ------------------------------------------------------------
A0A2V3W8U6      ------------------------------------------------------------
A0A6N3BXA1      ------------------------------------------------------------
A0A351SRI8      ------------------------------------------------------------
A0A1V5LU59      ------------------------------------------------------------
A0A1E3BVC3      ------------------------------------------------------------
A0A4Q0I6S0      ------------------------------------------------------------
A3DF66          ------------------------------------------------------------
W4V1T8          ------------------------------------------------------------
A0A1C6ITD7      ------------------------------------------------------------
A0A381IX63      ------------------------------------------------------------
A0A1G9IUT4      ------------------------------------------------------------
A0A1M6RWV2      ------------------------------------------------------------
A0A143XPI5      --------------------------------STSQEK----------------------
A0A355G1X5      --------------------------------DDEESAG---------------------
A0A0M6WXE3      --------------------------------TNNKEV----------------------
A0A348SAK2      --------------------------------ANNKEV----------------------
A0A1G9H5B9      --------------------------------LQTNQGSTQGSNLETTRGSTHINTQETE
R5EFZ0          --------------------------------GSRK------------------------
A0A1Y4H8L0      --------------------------------EQQ-------------------------
A0A4B9BMD9      --------------------------------EKE-------------------------
A0A0M6WYQ8      --------------------------------SRYEKQF-----------------DEPE
A0A348SAK1      --------------------------------SRYEKQL-----------------DEPV
A0A252F281      --------------------------------SRKREG----------------------
A0A1Y4QKE6      --------------------------------DEYKE-----------------------
B1C231          --------------------------------GEYKE-----------------------
A0A1Y3TUL5      --------------------------------SSRH------------------------
A0A1Y4JAX2      --------------------------------SSRH------------------------
A0A1Y4T590      --------------------------------SSRH------------------------
R5B467          --------------------------------ENRERNG---------------------
A0A1Y3T163      --------------------------------SYRQPYG---------------------
A0A1Y3YCA2      --------------------------------SYRQPYG---------------------
A0A1Y4L6N9      --------------------------------ANREK-----------------------
A0A173T644      --------------------------------DEETQS----------------------
A0A1C5TSB8      --------------------------------DEETQS----------------------
C0CIK6          --------------------------------DEETQS----------------------
A0A1Y3WEF6      --------------------------------KNRERIS---------------------
A0A417T0L2      --------------------------------QESKKKN---------------------
A0A1H9EPU3      ------------------------------------------------------------
A0A354IGV3      --------------------------------AQAEAEN---------------------
A0A417JMV2      --------------------------------SRTKKGN---------------------
A0A415VWX5      --------------------------------SRTKKGN---------------------
A0A173UY96      --------------------------------SRTKKGN---------------------
B0P408          --------------------------------SRTKKGN---------------------
D4MV82          --------------------------------SRTKKGN---------------------
A0A173QTL1      --------------------------------SRTKKGN---------------------
A0A174J359      --------------------------------SRTKKGN---------------------
A0A174A3T7      --------------------------------SRTKKGN---------------------
A0A417UUA3      --------------------------------SRTKKGN---------------------
A0A6N2VB70      --------------------------------SRTKKGN---------------------
A0A1C6EUV9      --------------------------------SRQSQKEDQKEEHQKEQYKKEDHNKEQK
A0A173Y645      --------------------------------SRQSKQE------------------EQK
A0A374AVY6      --------------------------------SRQSKQE------------------EQK
R7BXS4          --------------------------------SRQSKQE------------------EQK
A0A143ZUX1      ------------------------------------------------------------
A0A1W1Z4C3      -----------------------------------------------------ASSQKLS
A0A239QN83      -----------------------------------------------------VIG----
A0A3R9WAA7      ------------------------------------------------------------
A0A1G6BLF1      ------------------------------------------------------------
R6HZX3          ------------------------------------------------------YGYGKN
A0A1W2CEA6      ------------------------------------------------------------
R7FFK6          --------------------------------PSETESTETVAAEAEADAKHIEGEKQA-
A0A373MPB9      --------------------------------DTSAES----------------------
A0A373L519      --------------------------------DTSAES----------------------
A0A373W906      --------------------------------DTSAES----------------------
A0A373VCW2      --------------------------------DASAES----------------------
W0U604          --------------------------------DASAES----------------------
A0A374B6G0      --------------------------------DASAES----------------------
A0A373VM36      --------------------------------DASAES----------------------
A0A1C5P379      --------------------------------DTSAES----------------------
A0A373XXX0      --------------------------------DASAES----------------------
A0A5R9MJM9      --------------------------------DTSAES----------------------
A0A356CW82      --------------------------------DTSAES----------------------
R6T4X7          --------------------------------DTSAES----------------------
A0A374HTV1      --------------------------------DTSAES----------------------
A0A374GB66      --------------------------------DTSAES----------------------
A0A374ECC6      --------------------------------DASAES----------------------
A0A374BM61      --------------------------------DASAES----------------------
A0A373UGZ4      --------------------------------DTSAES----------------------
A0A373SA66      --------------------------------DTSAES----------------------
A0A1C5X6X7      --------------------------------DTSAES----------------------
A0A1C6JIH3      --------------------------------DASAES----------------------
A0A373PSC3      --------------------------------DASAES----------------------
A0A1K1WYK8      --------------------------------PTE-------------------------
A0A1H6IUB1      --------------------------------PET-DDDTAEEVKEETAKKETVKKESPS
A0A1M7L1F9      --------------------------------PETSDDDTDVEEKEETVKKEAAPKKT-N
A0A1C6B4L6      --------------------------------TDK-------------------------
A0A1Q6T9P4      --------------------------------TDT-------------------------
A0A315Y4F9      --------------------------------PEL-------------------------
A0A354K620      --------------------------------PEP-------------------------
A0A355G3J9      ---------------------------------------KEYGYKKKYDRSYESYDREKA
A0A3D2AD87      ----------------------------------------------------YDYTSKPE
A0A143XN92      ------------------------------------------------------------
A0A173ZYY6      ------------------------------------------------------------
A0A6L8RXB5      ------------------------------------------------------------
A0A6N9JW85      ------------------------------------------------------------
A0A173SMI2      ------------------------------------------------------------
A0A174ASH7      ------------------------------------------------------------
A6BH65          ------------------------------------------------------------
R7G0D7          ------------------------------------------------------------
A0A2T5IYJ6      ---------------------------------------KKKD-----------------
A0A3C0QME1      IEETPAELLEAENLLEEIPLQDAEEAPVKSAIEEAPVALTEETAVEESSEQADIETTKVD
A0A355FYK5      ---------------------------------------DGKYGYGSGGSGYGSGSGGYG
A0A357AQU0      ---------------------------------------NEKKA-------EEALAAKKE
A0A3C1YJQ7      ---------------------------------------NEKKA-------EEALAAKKE
A0A3D0JG38      ---------------------------------------NEKKA-------EEALAAKKE
A0A3C0IHX1      ---------------------------------------SKKKSHSHSTQQSEPVSTTTD
R5V506          ---------------------------------------SKKKSHSHSTQQSEPVSTTTD
A0A352TIU5      ---------------------------------------SKKKSHSHSTQQSEPVSTTTD
A0A3E5FSY5      ---------------------------------------Q----------YRYSKGGEYK
A0A1V5S3C0      ---------------------------------------SNTRRK---------------
A0A1Y3TC98      -------------------------------------------GYGKYGYGRYGYGSDGD
A0A1Q6REE0      ---------------------------------------SRQEKK---------------
R5ETF9          ---------------------------------------SRQEKK---------------
R6VAT5          ---------------------------------------Q----------YGDYYGNEEN
A0A1Q6S448      ---------------------------------------Y----------DKYGCGHRSG
A0A351MYR0      ---------------------------------------Y----------DKYGYGHRSG
R6HPC1          ---------------------------------------Y----------DKYGYGHRSG
A0A3D4G5Z5      ---------------------------------------Y----------DKYGYGHRSG
A0A3D5ES03      ---------------------------------------Y----------DKYGYGHRSG
A0A0F2P7X6      ---------------------------------------PAQEAAAASDKN---------
A0A359B487      ---------------------------------------PAQEAAAASDKN---------
A0A348P5V4      ------------------------------------------------------------
A0A356PT74      ---------------------------------------SNQK-----------------
A0A3D5LL19      ---------------------------------------SNQK-----------------
R5MNF0          ---------------------------------------SNQK-----------------
A0A1Q9JSI0      -----------------------------------------YGSYGYGGKYGYGYGKRDQ
A0A3D5TNI1      -----------------------------------------YG-------YGYGYGGHAG
A0A358LJD0      ---------------------------------------YGYG-------YGYGYGGHSG
R6I3L7          -----------------------------------------YG-------YGYGYGSHSG
A0A3D1HXX0      -----------------------------------------YG-------YGYGYGSHSG
A0A3D2QJB8      -----------------------------------------YG-------YGYGYGSHSG
D4LC36          ---------------------------------------SAKQAE---------------
R7MQJ4          ---------------------------------------TSEDKD---------------
A0A1V5GLC0      ---------------------------------------PEQDDDDSSDSDKNNKSDSKE
W7V182          ---------------------------------------YEEDSD-----EDKTETPEKS
                                                                            

S3FFL2          ------------------
A0A328M4V1      ------------------
A0A6A8IF17      ------------------
A0A3D5R4X5      ------------------
A0A1I4C3N6      ------------------
A0A3B9CIM7      ------------------
A0A1G9WHW8      ------------------
A0A1H5VAA0      ------------------
A0A3R6VK11      ------------------
A0A3R6QUY7      ------------------
A0A373K3P9      ------------------
A0A3R6JRU5      ------------------
A0A1C5MS04      ------------------
A0A3C1J150      ------------------
A0A416CXD7      ------------------
A0A6N2X662      ------------------
R6XBL9          ------------------
A0A355W5Z7      ------------------
A0A143WVN6      ------------------
W6RXP9          ------------------
W6S4G8          ------------------
A0A1G6BLB6      ------------------
A0A1C6G8M0      ------------------
A0A416MP73      ------------------
A0A3E4LL92      ------------------
A0A415D1L1      ------------------
A0A0H5SF45      ------------------
A0A1M6JRJ5      ------------------
A0A1M7Y1S2      ------------------
A0A7I8DMN1      ------------------
A0A396G6S7      ------------------
A0A3E5A223      ------------------
R7D5E6          ------------------
A0A415HQH5      ------------------
A0A414W2C6      ------------------
A5ZNE7          ------------------
A0A395X821      ------------------
A0A1C5PY68      ------------------
A0A174CJF8      ------------------
A0A564SRR2      ------------------
A0A174R7V0      ------------------
A0A373MWV2      ------------------
A0A417CE88      ------------------
A0A416Y441      ------------------
A0A357GPJ7      ------------------
A0A396PAC1      ------------------
A0A416EYU4      ------------------
A0A416SCQ2      ------------------
A0A416TGN7      ------------------
A0A417SMF6      ------------------
A0A1Y4MW77      ------------------
R6UHV6          ------------------
A0A3R9Q621      ------------------
A0A069RC75      ------------------
A0A6S6R676      ------------------
A0A174F2W5      ------------------
A0A174S8E9      ------------------
A0A416ZL97      ------------------
A0A174LSK1      ------------------
A0A373GY92      ------------------
A0A373NZQ6      ------------------
A0A417I9B9      ------------------
A0A417MP97      ------------------
A0A417WQF8      ------------------
A0A373RZ83      ------------------
A0A416U6I1      ------------------
R7JQZ9          ------------------
A0A7C6SMH0      ------------------
A0A3B8KKL6      ------------------
A0A2K9E6R0      ------------------
A0A2S8RBI0      ------------------
A0A0L6JLG6      ------------------
G8LSN0          ------------------
A0A1M5UYN6      ------------------
A0A176JBT8      ------------------
A0A1I5HIC6      ------------------
A0A1Y3TC51      ------------------
A0A1Y3T1N0      ------------------
A0A1Y3Y8U8      ------------------
A0A5B0BQY5      ------------------
A6CLL4          ------------------
A0A176U8D6      ------------------
A0A1Q6KSQ5      ------------------
A0A3D3U8B3      ------------------
A0A3E5FRL7      ------------------
A0A1Y4QK93      ------------------
B1C232          ------------------
A0A401USI6      ------------------
A0A1V4IQ10      ------------------
A0A1S8TRD2      ------------------
G7M1U2          ------------------
A0A2T6KJ75      ------------------
A9KN92          ------------------
A0A352MUJ1      ------------------
R5YI67          ------------------
A0A174DL89      ------------------
A0A1Y0IQP5      ------------------
A0A4R2R7B1      ------------------
A0A1M6E8I2      ------------------
A0A1Y4N105      ------------------
A0A1Y4QP75      ------------------
A0A3D4QRB5      ------------------
A0A349DEH5      ------------------
A0A3D4T7B4      ------------------
A0A350XYC7      ------------------
R6DNR8          ------------------
A0A355KUM5      ------------------
R5YGY6          ------------------
A0A0K8J554      ------------------
A0A1I0RG99      ------------------
A0A1I5G322      ------------------
A0A7C6IYW8      ------------------
A0A3N1XSX6      ------------------
A0A7C6JZF1      ------------------
A0A7G9WCY6      ------------------
A0A1C6G0U3      ------------------
A0A3D4LLB3      ------------------
A0A0A5GPA9      ------------------
A0A271M6M4      ------------------
A0A7C7AD93      ------------------
A0A2V3W8U6      ------------------
A0A6N3BXA1      ------------------
A0A351SRI8      ------------------
A0A1V5LU59      ------------------
A0A1E3BVC3      ------------------
A0A4Q0I6S0      ------------------
A3DF66          ------------------
W4V1T8          ------------------
A0A1C6ITD7      ------------------
A0A381IX63      ------------------
A0A1G9IUT4      ------------------
A0A1M6RWV2      ------------------
A0A143XPI5      ------------------
A0A355G1X5      ---------------NEE
A0A0M6WXE3      ------------------
A0A348SAK2      ------------------
A0A1G9H5B9      NESADHRSVDK-------
R5EFZ0          ------------------
A0A1Y4H8L0      ------------------
A0A4B9BMD9      ------------------
A0A0M6WYQ8      EETGAVNQKEVFTETKEN
A0A348SAK1      AETGAVNQKEVFTETKET
A0A252F281      ------------------
A0A1Y4QKE6      ------------------
B1C231          ------------------
A0A1Y3TUL5      ------------------
A0A1Y4JAX2      ------------------
A0A1Y4T590      ------------------
R5B467          ----------------AD
A0A1Y3T163      ----QKNAYEEEEAENG-
A0A1Y3YCA2      ----QKNAY-EEEAGNG-
A0A1Y4L6N9      ------------------
A0A173T644      ------------------
A0A1C5TSB8      ------------------
C0CIK6          ------------------
A0A1Y3WEF6      ----AEEDRGRNRRAKDD
A0A417T0L2      ----DTEELQS-------
A0A1H9EPU3      ------SYENEEASKDKK
A0A354IGV3      ---VSATDKEPEVK----
A0A417JMV2      EDKTQESKTERQVKKDHE
A0A415VWX5      EDKTQESKTERQVKKDHE
A0A173UY96      EDKTQESKTERQVKKDHE
B0P408          EDKTQESKTERQVKKDHE
D4MV82          EDKTQESKTERQVKKDHE
A0A173QTL1      EDKTQESKTERQVKKDHE
A0A174J359      EDKTQESKTERQVKKDHE
A0A174A3T7      EDKTQESKTERQVKKDHE
A0A417UUA3      EDKTQESKTERQVKKDHE
A0A6N2VB70      EDKTQESKTERQVKKDHE
A0A1C6EUV9      EQHNKDSVTERQVKKEDE
A0A173Y645      EQHNKDSVTERQVKKEDE
A0A374AVY6      EQHNKDSVTERQVKKEDE
R7BXS4          EQHNKDSVTERQVKKEDE
A0A143ZUX1      DSSQSQSSKKKQRITRNG
A0A1W1Z4C3      QNDNRNQETRNNRRGNKE
A0A239QN83      -------DPDNPKKKQKQ
A0A3R9WAA7      ------------------
A0A1G6BLF1      -------EDEEKKSENNK
R6HZX3          GSRKQDNAHRSSGDLGRG
A0A1W2CEA6      ---ETKAGRHPVRIKKGN
R7FFK6          ------------------
A0A373MPB9      ------------------
A0A373L519      ------------------
A0A373W906      ------------------
A0A373VCW2      ------------------
W0U604          ------------------
A0A374B6G0      ------------------
A0A373VM36      ------------------
A0A1C5P379      ------------------
A0A373XXX0      ------------------
A0A5R9MJM9      ------------------
A0A356CW82      ------------------
R6T4X7          ------------------
A0A374HTV1      ------------------
A0A374GB66      ------------------
A0A374ECC6      ------------------
A0A374BM61      ------------------
A0A373UGZ4      ------------------
A0A373SA66      ------------------
A0A1C5X6X7      ------------------
A0A1C6JIH3      ------------------
A0A373PSC3      ------------------
A0A1K1WYK8      -----ETKENENAD----
A0A1H6IUB1      TKTNKNSKNKNAKKKGKK
A0A1M7L1F9      NNSNNKSKKSNGKKKGKK
A0A1C6B4L6      -----NETKNEKK-----
A0A1Q6T9P4      -----NETKNEKK-----
A0A315Y4F9      -----DTVEAKAETQGKD
A0A354K620      -----DTEESKAETQEKN
A0A355G3J9      QTKKRKHNKKKI------
A0A3D2AD87      SQKETGEQ----------
A0A143XN92      ------------------
A0A173ZYY6      ------------------
A0A6L8RXB5      ------------------
A0A6N9JW85      ------------------
A0A173SMI2      ------------------
A0A174ASH7      ------------------
A6BH65          ------------------
R7G0D7          ------------------
A0A2T5IYJ6      ------------------
A0A3C0QME1      LSKESDKKESE-------
A0A355FYK5      YGYGSGGYG---------
A0A357AQU0      QEKATDKKS---------
A0A3C1YJQ7      QEKATDKKS---------
A0A3D0JG38      QEKATDKKS---------
A0A3C0IHX1      TDSDKQPVS---------
R5V506          TDSDKQPVS---------
A0A352TIU5      TDSDKQPVS---------
A0A3E5FSY5      E-----------------
A0A1V5S3C0      ------------------
A0A1Y3TC98      ETETEEQED---------
A0A1Q6REE0      ------------------
R5ETF9          ------------------
R6VAT5          SQAEEASYTDSDSADED-
A0A1Q6S448      QKQQ--------------
A0A351MYR0      RKQQ--------------
R6HPC1          QKQQ--------------
A0A3D4G5Z5      QKQQ--------------
A0A3D5ES03      QKQQ--------------
A0A0F2P7X6      ------------------
A0A359B487      ------------------
A0A348P5V4      ------------------
A0A356PT74      ------------------
A0A3D5LL19      ------------------
R5MNF0          ------------------
A0A1Q9JSI0      KKSERSKLKTDKSKSDF-
A0A3D5TNI1      SRDKKDK-----------
A0A358LJD0      SNDKNSRSK---------
R6I3L7          SHGKNSK-----------
A0A3D1HXX0      SHGKNSK-----------
A0A3D2QJB8      SHGKNSK-----------
D4LC36          ---------EKEKAGSAC
R7MQJ4          -ESKKDKSDNKVKKEKK-
A0A1V5GLC0      NDKKDSKNNKKGKKGGK-
W7V182          EKKTEEKNQSKKKKGGK-
                                  

© 1998-2021Legal notice