BYKdb

Dataset for cluster tadcd of phylum fibrobacteres

[Download (right click)] [Edit] [Sequences] [Repertoires]

82 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3C0PHK7      MVRLENRTYDDQQCAYASGYHSGVERGFQMIGNNTTDSQLKGEI-GVKDYLNIMMRRKWI
A0A1M6RVC1      -----------------------------------MASKKKEET-DLTELLKDVAKNWYI
A0A2N3RSN9      -----------------------------------MASKKKEET-DLTELLKDVAKNWYI
A0A1M5IPF7      -----------------------------------MASKKKEET-DLTELLKDVAKNWYI
A0A254RX70      -----------------------------------MASKKKEET-DLTELLKDVAKNWYI
A0A1M7GQ27      -----------------------------------MASAKKEET-DLWDLLKDLAKNWKI
A0A1X7JCK4      -----------------------------------MASAKKEET-DLWDLLKDLAKNWKI
A0A1M7HDE6      ----------------------------------MASSAKKEET-DLFDLLKDLAKNWQI
A0A2C9A7H2      ----------------------------------MASSAKKEET-DLFDLLKDLVKNWHI
A0A254SF58      ----------------------------------MAASSKKEET-DLFDLLKDLAKNWKI
A0A316ANB4      ----------------------------------MASTSKKEET-DILDLFKELLNNWKI
A0A1J5E847      ----------------------------------MASKNQDETN-ELAELASDLWKNRIA
A0A254RM08      -----------------------------------MATKKKEET-DLGEFLKELAKNWYI
A0A1M7CD42      -----------------------------------MATKKKEET-DLGEFLKELAKNWYI
A0A254SZB4      -----------------------------------MATKKKEET-DLGEFLKELAKNWYI
A0A1M5LBR0      -----------------------------------MATSKKEET-DLGEFLKILVKNWQI
A0A1M7DJN3      -----------------------------------MATSKKEET-DLGEFLKILVKNWQI
A0A1M6UFW9      -----------------------------------MATKKKEDT-DLGELLKELAKNWPI
A0A1M6I669      -----------------------------------MASAKKEET-DLFDLAKDLVKNWYI
A0A1M6WDT9      ----------------------------------MASPKKKEDI-DILDLIKTQLKNWYI
A0A254RG57      ----------------------------------MASSSKKEET-DLFDLLKNIAKNWQI
A0A254S791      ----------------------------------MASSSKKEET-DLFDLLKELAKNWKI
A0A285ZTW6      ----------------------------------MSASSKKEET-DLFDILKDLAKNWRI
A0A380S6W7      ----------------------------------MAASSKKEET-DLFDLLKDLAKNWKI
A0A1M6V3G7      ----------------------------------MAASSKKEET-DLFDLLKEFVKNWKI
A0A1N6J281      ----------------------------------MAASSKKEET-DLFDLLKEFVKNWKI
A0A285ZYD6      --------------------MAEKEEKKVVSQATIQLPPDNNTI-TLLEAMQILWEKKFT
A0A1M6S079      --------------------MDINEKNASANQTALPAQKGDDSI-DLLEVLGILWSKKFT
A0A1M6WR43      --------------------METNEQKATINLAGLLPQRAGDTI-TLIEAIGILWSKKFF
A0A2N3RVS2      --------------------METNEQKATINLAGLLPQRAGDTI-TLIEAIGILWSKKFF
A0A1M5VRV4      --------------------METNEQKATINLAGLLPQRAGDTI-TLIEAIGILWSKKFF
A0A254RLG7      --------------------METNEQKATINLAGLLPQRAGDTI-TLIEAIGILWSKKFF
A0A1M6SHG3      --------------------MMDLNSQNNVQNVTQVATAKDDEI-DLLEVLGILLKHKVF
A0A1M6WJF1      --------------------MEPNSQYSSSTSSSASHNKDDDEI-DLLEVLGILLKHKLF
A0A254RQS8      --------------------MEPNNQYNSTGSTSSAKHKDEDEI-DILEVLSLLLKHKLF
A0A1M6Z6I9      --------------------MELNNQYNSIGSTSSANHKDEDEI-DILEVLGLLLKHKLF
A0A254STU0      ------------------MKMELNNQYNSIGSTSSANHKDEDEI-DILEVLGLLLKHKLF
A0A1M5G181      --------------------MEPNNQYNSTGSTSSANHKDDDEI-DILEVLGLLLKHKFF
A0A1M6VYU0      --------------------MEPNNQYNSMGSSSPAKHKEDDEI-DILEVLGLLLKHKFF
A0A1M7DAK0      ----------------------MIIEKETKSNSSNSTHISGSAI-TMMEFLMLLWRKKFI
A0A254SNB3      ----------------------MAESEQQTIVVGAQQMQAENTI-TLLEALFILWKRRFL
A0A380RVE7      ----------------------MAESEQQTIVVGAQQMQAENTI-TLLEALFILWKRRFL
A0A1M5F234      ----------------------MADSEQQTIVVGAQAQTPNNTI-TLLEALFILWKRRYL
A0A1M6VST0      ----------------------MADSEQQTIVVGAQAQTPNNTI-TLLEALFILWKRRYL
A0A2C8Y654      --------------------------MDNKVPQGATAKPEDDEI-DILEILVFLKSKWKF
A0A1M5J685      --------------------------MDNNVSQNVAPKQEDDEI-DILEILMFLKTKWKF
A0A1M7JMJ6      --------------------------MDNNVSQNVAPKQEDDEI-DILEILMFLKTKWKF
A0A254S3F1      --------------------------MNEKMTQNMSNASADGEI-DILEIIVYLKSKWKF
A0A254SFQ7      --------------------------MNEKMTQNASNASADDEI-DILEILVYLKGKWKF
A0A380S7L2      --------------------------MNEKMTQNASNASADDEI-DILEILVYLKGKWKF
A0A1M7MCZ6      --------------------------MNEKMTQNVSNASADDEI-DILEILVYLKGKWKF
A0A1X7KIP6      --------------------------MNEKMTQNVSNASADDEI-DILEILVYLKGKWKF
A0A286A129      --------------------------MNEKMTQNVSSKSDDDEI-DILEILVYLKSKWKF
C9RRK0          --------------------------MNEKMTQNGSNASADDEI-DILEILVYLKGKWKF
A0A2M9A3A4      ------------------------MQQNNVNMDYAQQKNADDEI-DILELVGVLLAKWPI
A0A2P6UPN2      ------------------------MQTITNQDVANSTQKAEDEI-DLLELAGILIAKWPV
A0A1M6RBQ2      ----------------MKDSITAPVTPTTINLTGIQNIKPKGNF-SLVKAVDVLWKQRWL
A0A316BGL2      ----------------MKETVATPVTPTTINLTGIQNIKPNGSF-SLVKAIETLWKERWL
A0A1M6IQ57      ---------------------MEQNTQQTISVAAVAQPQSGNTI-TLLEALAILWKNKFR
A0A316ATY6      ---------------------MDSNDQKNSVNQASEPLKTDDSI-DLLEVIGILWAKKHI
A0A1T4QDW5      -----------------------MAENENTMNAPVSAAPKDDEI-SILEVCGILWEKKFF
A0A1M6VSY0      -----------------------MAENENTMNAPVSAAPKDDEI-SILEVCGILWEKKFF
A0A2A3HHG6      -----------------------MAENENTMNAPVSAAPKDDEI-SILEVCGILWGKKFF
C9RP30          -------------------MSEKEEQKVISQPTAIQVPQNANTI-TLLEALEILWDKKFI
A0A1M5V3U1      -------------------MAEEVKNVQ----------TEVDSL-TVVDFVHHLWKKKFL
A0A1M7NG89      -------------------MNENTKKIS----------SLGNSL-TIVEFALLLWKKKFL
A0A2C8YXS0      -------------------MDENIKKIQ----------PLEGSI-TLLDVAQTLWNRRWV
A0A254RLK0      ----------------------MAENEQQTIVVGAQAQSANNTI-TLLEALFILWKKRFT
A0A1M6RGU5      ----------------------MAENEQQTIVVGAQAQSTNNTI-TLLEALFILWKKRFT
A0A254SQM8      ----------------------MAENEQQTIVVGAQAQSTNNTI-TLLEALFILWKKRFT
A0A316B5S0      -------------------MDLNSQNNLQSVNQVSVVPTKDDEI-DLLEVLGILLKHKVF
A0A254RXS0      -------------------MDNSQVNTKNGSNTGSA--KNDDEI-DLLEVLGILLKHKLF
A0A1M6X012      -------------------MDNSQVNTKNGSNTGSA--KNDDEI-DLLEVLGILLKHKLF
A0A1M5TLF1      -------------------MDNSQVNTKNGSNTGSA--KNDDEI-DLLEVLGILLKHKLF
A0A2N3RVJ9      -------------------MDNSQVNAKNGSNTGSA--KNDDEI-DLLEVLGILLKHKLF
A0A1M6R2N3      -------------------MTNTTENQMNQGPVTQGGINQNDVI-DVFELFGIFRRHWFI
A0A1N6GS15      -------------------MTNTPEKQMNQLPVSQGAIKPVDVI-DVFELFSIFRRHWLI
A0A254SB44      -------------------MTVTPNNK--QQNPQQPFFMQVNTG-DSFDLLGNILRHWKL
A0A1M7LKR0      -------------------MTITPNNK--QVNPQQPMFMSAKAS-DSFDLLDSILRHWKL
A0A1X7JP42      -------------------MTITPNNK--QVNPQQPMFMSAKAG-DSFDLLDSILRHWKL
A0A1M6UBQ0      -------------------MTVTPNNN--QPNTQLPFFMPIKAG-DSFDLFSNVLHHWKL
A0A1X7IS68      -------------------MINEVNQK--QNSQCSEHSKPVDAAQDILNLLNIIRHHWII
                                                                .        .  

A0A3C0PHK7      IIASLLSVAFSTFFYVSKIKDVYESFSTIVIEEKN------------IAISQATNTMNTG
A0A1M6RVC1      MLPCLVVAGIVGVFVSLWIRPVYQVDALLQIESKN--SKN-----SMGMMGGLGALFSNA
A0A2N3RSN9      MLPCLVVAGIVGVFVSLWIRPVYQVDALLQIESKN--SKN-----SMGMMGGLGALFSNA
A0A1M5IPF7      MLPCLVVAGIVGVFVSLWIRPVYQVDALLQIESKN--SKN-----SMGMMGGLGALFSNA
A0A254RX70      MLPCLVVAGIVGVFVSLWIRPVYQVDALLQIESKN--SKN-----SMGMMGGLGALFSNA
A0A1M7GQ27      MVPCIFVAGIIGVFIAFWIRPVYKVDALLQIESKS--NK------SVGMMGGLPSLFASS
A0A1X7JCK4      MVPCIFVAGIIGVFIAFWIRPVYKVDALLQIESKS--NK------SVGMMGGLPSLFASS
A0A1M7HDE6      MLPCLILSGVVGVFVAMWIRPIYQVDALLQIESKN--NKG----MASAMMGSLGSLFASS
A0A2C9A7H2      MLPCLILSGFIGIILAMWIRPIYQVDALLQIESKS--NKG----MTGAMMGGLGSLFASS
A0A254SF58      MIPCLIVSAIIGVFVAMWIRPIYQVDALLQIESKN--NK------SMGMTGGLSSLFATT
A0A316ANB4      MIPCIFLAGVVGVIVAMWIRPIYQVDALLQIENKN--SKG----PAASMMGGLASLFASA
A0A1J5E847      VCLFLLLSGIIGVFAAYWIRPVYEVNALLQVETKG--KGA----NASAMMGDLGSLFATG
A0A254RM08      MVPCILLAGAVGAFVAQWIRPVYQVDALLQIEAKS--NKS----A--GLVGGLGNLFATN
A0A1M7CD42      MVPCILLAGAVGAFVAQWIRPVFQVDALLQIEAKN--NKS----A--GLVGGLGNLFATN
A0A254SZB4      MVPCILLAGAVGAFVAQWIRPVFQVDALLQIEAKN--NKS----A--GLVGGLGNLFATN
A0A1M5LBR0      MAPVMLLSAIIGVFVAMWARPIYQVDALLQIESKN--SKP----S--GMMGSLGALFATS
A0A1M7DJN3      MAPVMLLSAIIGVFVAMWARPIYQVDALLQIESKN--SKP----S--GMMGSLGALFATS
A0A1M6UFW9      MVPIMLLAGIIGVFVAMWVRPVYQVDALLQIESKN--SKP----S--GMMGSLGALFATS
A0A1M6I669      VLPCLILSGIIGVIVALWIRPVYQVDALLQIESKS--NKS----MAGAMMGGLGSLFASS
A0A1M6WDT9      ILPCVILAGIIGVVVSMWIRPIYKVDALLQIESKN--NKS----M--GVMGGLTNLFATS
A0A254RG57      MVPCLILAGIIGVFVAMWIRPIYKVDALLQIESKN--GKN----V--GMMAGLGNLFSTT
A0A254S791      MIPSIILSGIIGVFVAMWIRPVYKVDALLQIESKN--SKS----L--SLMGGLGNLFAST
A0A285ZTW6      MIPCIIVAGIVGVFVAMWIRPIYKVDALLQIETKS--NKS----V--GLMGGLPSLFASS
A0A380S6W7      MIPCLIVSGIIGVFVALWIRPIYQVDALLQIESKN--NKS----M--GMTGGLGNLFATT
A0A1M6V3G7      MVPCIILAGIIGVFVAMWIRPVYKVDALLQIESKN--NKS----V--GLMGGLPSLFASA
A0A1N6J281      MVPCIILAGIIGVFVAMWIRPVYKVDALLQIESKN--NKS----V--GLMGGLPSLFASA
A0A285ZYD6      LLLFILVGGLVGFSIANWLRPQYTSDILLQIDAKG--GNA----T--KAMGEMGSILDVA
A0A1M6S079      ILSFLFMGGVIGFLLMNWVRPEYTSDAMIQVDIRG--NKV----S--RAMGEMGALLDMA
A0A1M6WR43      IAAFMVVGALIGCLVMNWIRPEFTSDAMLQIDIRG--NKA----T--RAMGEMGALLDMT
A0A2N3RVS2      IATFMVVGALIGCLVMNWIRPEFTSDAMLQIDIRG--NKA----T--RAMGEMGALLDMT
A0A1M5VRV4      IAAFMVVGALIGCLVMNWIRPEFTSDAMLQIDIRG--NKA----T--RAMGEMGALLDMT
A0A254RLG7      IATFMVVGALIGCLVMNWIRPEFTSDAMLQIDIRG--NKA----T--RAMGEMGALLDMT
A0A1M6SHG3      LVFCIMVGCCVGFLASNWARPQYTSDALLQIDVKG--NKA----G--KAMGEMGALLDVA
A0A1M6WJF1      LSVCIVFGCIVGFLVSNWMTPQYTSDALLQIDVKG--NKA----G--KAMGEMGALLDVA
A0A254RQS8      LACCIVLGCVAGFLASNWMRPQYTSDALLQIDVKG--NKA----G--KAMGEMGALLDVA
A0A1M6Z6I9      LAFCIVLGCAAGFLASNWMRPQFTSDALLQIDVKG--NKA----G--KAMGEMGALLDVA
A0A254STU0      LAFCIVLGCAAGFLASNWMRPQFTSDALLQIDVKG--NKA----G--KAMGEMGALLDVA
A0A1M5G181      LACCIAVGCAVGFLASNFMRPQYTSDALLQIDVKG--NKA----G--KAMGEMGALLDVA
A0A1M6VYU0      LACCIAVGCAVGFLASNFMRPQYTSDALLQIDVKG--NKA----G--KAMGEMGALLDVA
A0A1M7DAK0      ILLFVVLATIFGACYAMWVRPSFTSDVLLQVNTKGASSKS----T--KALGEMGAVLDLA
A0A254SNB3      LLLFLAFGAIVGVLIGMWIRPQFTSDALLQIDVKG--NKA----G--KAMGEMGALLEVA
A0A380RVE7      LLLFLAFGAIVGVLIGMWIRPQFTSDALLQIDVKG--NKA----G--KAMGEMGALLEVA
A0A1M5F234      LCLFLLVGAAIGVVVGQWIRPQYTSDALFQIDIKG--NKS----A--RALGEMGSLLEVA
A0A1M6VST0      LCLFLLVGAAIGVVVGQWIRPQYTSDALFQIDIKG--NKS----A--RALGEMGSLLEVA
A0A2C8Y654      LTIFLVLGLFAGGVASMWMRPAYKSDILLQVDVKG--NKS----S--KALGEMGALLDVS
A0A1M5J685      LLVFLLLGLFAGGVAAMWMRPAYKSDILLQVDVKG--NKS----S--KALGEMGALLDVS
A0A1M7JMJ6      LLVFLLLGLFAGGVAAMWMRPAYKSDILLQVDVKG--NKS----S--KALGEMGALLDVS
A0A254S3F1      LLVFLFFGVVFGCLAAMWIRPSFKSDILLQVNVKG--NKQ----G--LALGEMGALFDVS
A0A254SFQ7      LLIFLFLGVIFGGFVSMWLRPSYRSDILLQVNVKG--NKQ----G--LALGEMGALLDVS
A0A380S7L2      LLIFLFLGVVFGGLVSMWLRPSYRSDILLQVNVKG--NKQ----G--LALGEMGALLDVS
A0A1M7MCZ6      LLIFLFLGVVFGGLVSMWIRPAYKSDILLQVNVKG--NKQ----G--LALGEMGALLDVS
A0A1X7KIP6      LLIFLFLGVVFGGLVSMWIRPAYKSDILLQVNVKG--NKQ----G--LALGEMGALLDVS
A0A286A129      LLIFLILGIGFGGLFSMWLRPSFRSDILLQVNVKG--NKQ----G--LALGEMGALLDVS
C9RRK0          LFIFLILGVVFGGLAAMWLRPSFRSDILLQVNVKG--NKQ----G--LALGEMGALLDVS
A0A2M9A3A4      LAVFVVLGTVSGFIVSNYIRPVFSSDALLQVDLNG--NSA----S--LAMGEMGALLDAA
A0A2P6UPN2      LLLFILLGGGIGFFVANFLRPSYSSDALLQVDQNG--KTA----G--LAMGEMGALLDVA
A0A1M6RBQ2      LLTFVLVGAAVGVFVGNWIRPQYSSDALLKLEVKS--SKS----N--KSSDVLDMLFAQG
A0A316BGL2      LLMFILVGAAVGVFIGNWARPQYSSDALLKLEVKS--AKS----S--KPTDVLDFFFEKA
A0A1M6IQ57      LMLFVLFGAFIGAVVGFWIRPAFTSDALLQIDVRG--SKKGNVMS--QAMGDMGALLDVT
A0A316ATY6      IFVFLLMGGLFGFLLMNWIRPEYTSDAMIQVDIRG--NKV----S--RAMGEMGALLDMA
A0A1T4QDW5      LLFCLILGAVVGVLAAYWIRPQYTSDALLQIDVSG--SAS----A--KALGDMGALLESS
A0A1M6VSY0      LLFCLILGAVVGVLAAYWIRPQYTSDALLQIDVSG--SAS----A--KALGDMGALLESS
A0A2A3HHG6      LLFCLILGAVVGVLAAYWIRPQYTSDALLQIDVSG--SAS----A--KALGDMGALLESS
C9RP30          LALFLIVGGAVGYCVANWLRPQYTSDVLLQIDVKG--GKS-G-----KAIGDMGALLDVA
A0A1M5V3U1      VALFVVVATLIGSFYAMWVRPQFTSDALLQVNVKG--TSSKA--T--KAFGEMGAVLDLA
A0A1M7NG89      VALFVIVAAMLGATYAMWVRPLFTSDVLLQVNVKG--TSSKS--T--KALGEMGAVLDLA
A0A2C8YXS0      ILLFTLLTVVFGYAYAMWVRPQFTSDVLLQVNVKG--SSSKS--T--KALGEMGAVLDLA
A0A254RLK0      LCLFLAAGALIGLVIGQWIRPQFTSDALLQIDVKG--NKA-A--N--RAMGEMGAILDVA
A0A1M6RGU5      LCLFLAAGALIGFVIGQWIRPQFTSDALLQIDVKG--NKA-A--N--RAMGEMGAILDVA
A0A254SQM8      LCLFLAAGALIGLVIGQWIRPQFTSDALLQIDVKG--NKA-A--N--RAMGEMGAILDVA
A0A316B5S0      LILCVIVGCGIGFLASNWARPQYTSDALLQIDVKG--NKA-G-----KAMGEMGALLDVA
A0A254RXS0      LFFCLVVGAVVGFLASNWVRPQYTSDALLQIDVKG--NKA-G-----KAMGEMGALLDVA
A0A1M6X012      LFFCLVVGTVVGFLASNWVRPQYTSDALLQIDVKG--NKA-G-----KAMGEMGALLDVA
A0A1M5TLF1      LFFCLVVGAVVGFLASNWVRPQYTSDALLQIDVKG--NKA-G-----KAMGEMGALLDVA
A0A2N3RVJ9      LFFCLVVGAVVGFLASNWVRPQYTSDALLQIDVKG--NKA-G-----KAMGEMGALLDVA
A0A1M6R2N3      FALLSFIGLVVGATYARYSRDVFRSTAMLQLDTKS--RSG-------KAIADIGELFESH
A0A1N6GS15      FALLSVVGLVAGATYARYSRDVFRSTAMLQLDTKS--KSG-------KAIADIGALFESH
A0A254SB44      VAVLSIVGLLAGTVASRYVRDSFDNKTMLQLDTKS--KSG-------KAVSDFGDLFDAK
A0A1M7LKR0      VVFFSIIGLFVGVVVSRYVRDSFENKTMLQLDTKS--KSG-------KAVSDFGDLFDAK
A0A1X7JP42      VVFFSIIGLFVGVVVSRYVRDSFENKTMLQLDTKS--KSS-------KAVSDFGDLFDAK
A0A1M6UBQ0      VAFLSIVGLMAGTVFSRYVRDSFDNKTMLQLDTKS--KSG-------KAVSDIGDLFDVQ
A0A1X7IS68      IVSFTIVGLMAGLTYSRYSRNLFECTTMLQLDTKS--KNA-------KAIVDIGDLFQQQ
                .                     :     : ::  .                     :   

A0A3C0PHK7      GRSVDFYQGILESRTFQEMLADSIGLNVLKANNPKLTREQAIKNLHSSLTLKSTEYASFL
A0A1M6RVC1      SPA----ETEIELIRSRQVMGAAVEKMRLQYEAEPLNFLDRLLHREGRLDLAQIEVPWD-
A0A2N3RSN9      SPA----ETEIELIRSRQVMGAAVEKMRLQYEAEPLNFLDRLLHREGRLDLAQIEVPWD-
A0A1M5IPF7      SPA----ETEIELIRSRQVMGAAVEKMRLQYEAEPLNFLDRLLHREGRLDLAQIEVPWD-
A0A254RX70      SPA----ETEIELIRSRQVMGAAVEKMRLQYEAEPLNFLDRLLHREGRLDLAQIEVPWD-
A0A1M7GQ27      SPA----ETEIELIKSRHIIGEAVEKMHLQYTATPVNSLDRLLHREGRMEISRFEVPWT-
A0A1X7JCK4      SPA----ETEIELIKSRHIIGEAVEKMHLQYTATPVNSLDRLLHREGRMEISRFEVPWT-
A0A1M7HDE6      SPA----ETEIELIKSRQIIGDAVDKMRLLYVATPTRKLQRLLHKEGRMELNQLEIPWD-
A0A2C9A7H2      SPA----ETEIELIKSRHIIGDAVDKMHLQYIATPTNKLDRLLHKEGRMELNQLEIPWA-
A0A254SF58      SPA----ETEIELIGSRQIIGEAVEKMHLQYVAIPTNKLDRLMHREGRMELSLFEFPWK-
A0A316ANB4      SPA----ETEIELINSRQVIGDAVEKMHLQYVATPTNKLDRLLHKEGRMELNQFIVPGN-
A0A1J5E847      SPA----ETEIELVKSRRVMGAAVEASRLQNVAIPLGFWDRLLHREGRLNLLDFRIPLE-
A0A254RM08      SPA----ETEMELIKSRQVMGSAVEKMRLDLVAEPLNKLDRLLHKEGRVDLMNFSYNKE-
A0A1M7CD42      SPA----ETEMELIKSRQVMGSAVEKMRLDLVAEPLNKLDRLLHKEGRVDLMNFSYNKD-
A0A254SZB4      SPA----ETEMELIKSRQVMGSAVEKMRLDLVAEPLNKLDRLLHKEGRVDLMNFSYNKD-
A0A1M5LBR0      SPA----ETEMELIRSRQVMGSAVEKMRLDLVAEPLDKMDRLLHKEGRLELNNFNVPWD-
A0A1M7DJN3      SPA----ETEMELIRSRQVMGSAVEKMRLDLVAEPLDKMDRLLHKEGRLELNNFNVPWD-
A0A1M6UFW9      SPA----ETEMELIKSRQVMGAAVEKMRLDLVADPQSKLDRLMHKEGRLELSNFNVPWN-
A0A1M6I669      SPA----ETEIELIKSRQIIGDAVDKMHLQYIATPTLKLQRLFHKEGRMELVQLEIPWD-
A0A1M6WDT9      TPA----ETEIELINSRQILGDAVEKMHLQYSANPKNVLDRLLQKEGRMDINQFEVPWD-
A0A254RG57      SPA----ETEIELIMSRQIIGEAVEKMHLQYEATPISKINRILHQEGRMELSAFEVPWS-
A0A254S791      SPA----ATEIELINSRQIIGEAVEKMHLQYIADPINKLDRLTHHEGRMELSAFEVPWD-
A0A285ZTW6      SPA----ETEIELINSRQIIGDAVEKMHLQYEANPINVMDRLLHREGRMELNQYEIPWD-
A0A380S6W7      SPA----ETEIELIKSRQIIGEAVEKMRLQYVATPINKLDRLLHHEGRMELNNFDFPWE-
A0A1M6V3G7      SPA----ETEIELIYSRQIIGEAVEKLRLQYTATPINKMDRLLHHEGRMELSQFEVPWK-
A0A1N6J281      SPA----ETEIELIYSRQIIGEAVEKLRLQYTATPINKMDRLLHHEGRMELSQFEVPWK-
A0A285ZYD6      SPA----DAEIELIKSRMVLSYVVEAERLCFNATPVGAVDRFTHKEGRMDLDSLYIPTL-
A0A1M6S079      SPS----DAEIELVKSRSVLAYVVEEEHLRFNATPIGKMDRLLHREGRMDIDELDIPQI-
A0A1M6WR43      SPA----DAEIELVKSRSVLAYVVEEEHLRFNAIPVGKMDRLLHREGRMDIDELDIPEI-
A0A2N3RVS2      SPA----DAEIELVKSRSVLAYVVEEEHLRFNAIPVGKMDRLLHREGRMDIDELDIPEI-
A0A1M5VRV4      SPA----DAEIELVKSRSVLAYVVEEEHLRFNAIPVGKMDRLLHREGRMDIDELDIPEI-
A0A254RLG7      SPA----DAEIELVKSRSVLAYVVEEEHLRFNAIPVGKMDRLLHREGRMDIDELDIPEI-
A0A1M6SHG3      SPA----EAEIELLKSRMVLSYVVNQEHLCFNAYPKDPIKRLTHKEGRMDLEELHIPEI-
A0A1M6WJF1      SPA----EAEIELLKSRMVLSFVVEQEHLCFNAYPVGVLDRLLHKQGRMDIENLYIPEI-
A0A254RQS8      SPA----EAEIELLKSRMVLTYVVEQERLCFNAYPKGAIDRLLHQEGRMDLEDLYIPEI-
A0A1M6Z6I9      SPA----EAEIELLKSRMVLNYVVEQERLCFNAYPKGAIDRLLHQEGRMDLEDLYIPEI-
A0A254STU0      SPA----EAEIELLKSRMVLTYVVEQERLCFNAYPKGAIDRLLHQEGRMDLEDLYIPEI-
A0A1M5G181      SPA----EAEIELLKSRMVLNYVVDKEHLCFNAYPKGLIDRLLHTEGRMDLEDLYIPEI-
A0A1M6VYU0      SPA----EAEIELLKSRMVLNYVVEKEHLCFNAYPKGIIDRLLHTEGRMDLEDLYIPEI-
A0A1M7DAK0      SPA----DAEIELIKSRMVLNYVVSVEHLHLKAIPIGFWDRFTHSEGRLDLDSLIIPEK-
A0A254SNB3      SPA----DAEIELIKSRMVLSYVVSQEHLDYSAAPLSAMNRLLHKEGRMDIDYLEIPEL-
A0A380RVE7      SPA----DAEIELIKSRMVLSYVVSQEHLDYSAAPLSAMNRLLHKEGRMDIDYLEIPEL-
A0A1M5F234      SPA----DAEIELIKSRLVLNYVVDQEHLMYSATPQGALNRLLHREGRMDIDFLNIPEL-
A0A1M6VST0      SPA----DAEIELIKSRLVLNYVVDQEHLMYSATPQGALNRLLHREGRMDIDFLDIPEL-
A0A2C8Y654      TPS----EAEMQLIKSRMVLSTVVDEQRLCYSAVPLDKVDRLLHREGRMDLEFLSIPRA-
A0A1M5J685      TPS----EAEMQLIKSRMVLSSVVEEQRLCYSAVPLDKVDRLLHREGRMDLEFLSIPRA-
A0A1M7JMJ6      TPS----EAEMQLIKSRMVLSSVVEEQRLCYSAVPLDKVDRLLHREGRMDLEFLSIPRA-
A0A254S3F1      TPS----AAEMELIKSRVILDQVVQDERLCYSAVPLNKLDRLMHREGRMDLELLVIPRA-
A0A254SFQ7      TPS----AAEMELIKSRVVLDHVVNEERLCFSATPLNKQDRLLHHEGRMDLELLVIPRA-
A0A380S7L2      TPS----AAEMELIKSRVVLDHVVNEEKLCFSAIPLNKQDRLLHHEGRMDLELLVIPRA-
A0A1M7MCZ6      TPS----AAEMELIKSRGVLDQVVQDERLCYSAIPLNKKDRLLHKEGRMDIELLSIPRA-
A0A1X7KIP6      TPS----AAEMELIKSRGVLDQVVQDERLCYSAIPLNKKDRLLHKEGRMDIELLSIPRA-
A0A286A129      TPS----AAEMELLKSRVVLDQVVEDERLCFSAVPLNKMDRLKHREGRMDLELLSIPRA-
C9RRK0          TPS----AAEMELIKSRVVLDHVVKEERLCYSAIPLDKADRLMHREGRMDLELLEIPRA-
A0A2M9A3A4      SPA----DAEIQLIRSRRVLSVVVDKEHLSYGATPVALLPRLLHKEGRVDVGLLHFPEV-
A0A2P6UPN2      SPS----DAEIELIKSRRVLDEVVELEHLAYSAKPVAFLPRLLHTEGRVDVEFLHIPEI-
A0A1M6RBQ2      SPA----DAEIEMIKSRRVLSYVVDAEGLCYKANPIGLVDRLRHHEGRMDVQSLVLPTH-
A0A316BGL2      SPA----DAEIEMIKSRKVLSYVVDAEGLCFNAVPVGIVDRLRNNEGRMDVQSLVLPAE-
A0A1M6IQ57      TPA----DAEIELLKSRMVLSYVVDEEHLAFSATPTSKLNRLLHREGRMDVDKLNIPAA-
A0A316ATY6      SPS----DAEIELVKSRSVLAYVVEEEHLRFNAVPIGKMDRLLHREGRMDIDELDIPEI-
A0A1T4QDW5      SPA----DAEIELIKSRMVLNDVVEQEKLCYSATPIGKMNRLLHREGRMDLDSLYIPEF-
A0A1M6VSY0      SPA----DAEIELIKSRMVLNDVVEHEKLCYSATPIGKMNRLLHREGRMDLDSLYIPEF-
A0A2A3HHG6      SPA----DAEIELIKSRMVLNDVVEQEKLCYSATPIGKMNRLLHREGRMDLDSLYIPEF-
C9RP30          SPA----DAEIELLKSRMILSYVVDVEHLCFQATPIGAADRFLHHEGRMDLDSLYIPQI-
A0A1M5V3U1      SPA----DAEIELIKSRMVLSYVTMAEHLYLWTVPVGFWDRLLHREGRMDLDSLRIPLK-
A0A1M7NG89      SPA----DAEIELIKSRMVLSDVVAKEHLYVWTVPIGFWDRLTHKEGRMDVDSLRIPEK-
A0A2C8YXS0      SPA----DAEIELIKSRMVLSEVVAIEHLHIWTIPIGVSDRFTHKEGRMDVDSLIIPEK-
A0A254RLK0      SPA----DAEIELIKSRLVLNYVVSEEHLNYSATPTSALNRLLHREGRMDLDYLFIPDM-
A0A1M6RGU5      SPA----DAEIELIKSRLVLNYVVSEEHLNYSATPTSALNRLLHREGRMDLDYLFIPDM-
A0A254SQM8      SPA----DAEIELIKSRLVLNYVVSEEHLNYSATPTSALNRLLHREGRMDLDYLFIPDM-
A0A316B5S0      NPA----EAEIELLKSRMVLSYVVQKENLCFNAYPKDPIKRLTHTEGRMDLENLHIPEI-
A0A254RXS0      SPA----EAEIELLKSRMVLSYVVEQERLCFNAYPKGPMKRLTHKEGRMDLENLHIPEI-
A0A1M6X012      SPA----EAEIELLKSRMVLSYVVEQERLCFNAYPKGPMKRLTHKEGRMDLENLHIPEI-
A0A1M5TLF1      SPA----EAEIELLKSRMVLSYVVEQERLCFNAYPKGPMKRLTHKEGRMDLENLHIPEI-
A0A2N3RVJ9      SPA----EAEIELLKSRMVLSYVVEQERLCFNAYPKGPMKRLTHKEGRMDLENLHIPEI-
A0A1M6R2N3      SPA----KSEIYLIKSLSVLMPVVEKMHLNYGAEPVGVMDRLMHREGRMDLDLFEPPRV-
A0A1N6GS15      SPA----LAEIHLIKSLNVLMPVVEKLRLNYGAEPIGLVDRLMHREGRMDLDLFEPPKV-
A0A254SB44      SPA----VAEIHLIKSLSVLMPVVEQLHLNYMAEPQGIVDRLMRREGRMDLDLFEPPKAG
A0A1M7LKR0      SPA----VAEIHLIKSLSVLMPVVEQLHLNYTAEPQGIVDRLMRREGRMDLDLFEPPKMD
A0A1X7JP42      SPA----VAEIHLIKSLSVLMPVVEQLHLNYTAEPQGIVDRLMRREGRMDLDLFEPPKMD
A0A1M6UBQ0      SPA----VAEIHLIKSLSVLMPVVEQLRLNYMAEPQGVVDRLMRREGRMDLELFEPPRM-
A0A1X7IS68      SPA----KAEILLIQSMSVMLPVVEKLHLNYTAKPLGIIDRLLQREGRMDLKLFEPPKP-
                  :       :       ::        *            : .  . : :         

A0A3C0PHK7      RLNARSETQE-------LAFLTASI-GTDVFRKRCEEVE----SEESRRSMIEIDNQLKL
A0A1M6RVC1      SVPKTDKIKEW------EVEIKDSTGRFDLYDHLDKVVL-SGEPGHTYKFPYAGDSAAFG
A0A2N3RSN9      SVPKTDKIKEW------EVEIKDSTGRFDLYDHLDKVVL-SGEPGHTYKFPYAGDSAAFG
A0A1M5IPF7      SVPKTDKIKEW------EVEIKDSTGRFDLYDHLDKVVL-SGEPGHTYKFPYAGDSAAFG
A0A254RX70      SVPKTDKIKEW------EVEIKDSTGRFDLYDHLDKVVL-SGEPGHTYKFPYAGDSAAFG
A0A1M7GQ27      LIPKNEKIVPW------IAEATDSTT-FNLYDHNNKLVL-SGSVGNTYHFPYAGDTAVFC
A0A1X7JCK4      LIPKNEKIVPW------IAEATDSTT-FNLYDHNNKLVL-SGSVGNTYHFPYAGDTAVFC
A0A1M7HDE6      NLPEEERGGAW------TAVANDSLS-FELYDHNNKKVMSNCHAGETYRIPYAGDTATFS
A0A2C9A7H2      LFPREERNKPW------IAVIMDSLT-FKLYDHNKKLIADNCHAGITYKFPYMGDSVTFS
A0A254SF58      TIPKEKRKGSW------TTEALDSTTQYNLYDNKKQKVL-SGIVGKTYHVPYLSDTLTFR
A0A316ANB4      VMPKEEKHDPW------IAKVIDSTT-FEVYDHNHQKVVTSGKVSQTYHIPYGQDTVVLS
A0A1J5E847      NIPEEFRSEPW------TLVAEDSV-NFKLLDYADNFVL-RGHAGETVVAPYAGDSVRIG
A0A254RM08      LLPTDFRDEPW------FLEMRDSLGNFNLYDYKDSLVL-SGAVGQTYHFEYAGDSAAFG
A0A1M7CD42      LLPSDFRDEPW------FLEMKDSLGNFDLYDYKDSLVL-SGAVGQTYHFAYAGDSAAFG
A0A254SZB4      LLPSDFRDEPW------FLEMKDSLGNFDLYDYKDSLVL-SGAVGQTYHFAYAGDSAAFG
A0A1M5LBR0      NVPKEERGMPW------TVVAKDSLGNFELYDHNKNLVL-SGVAGQTYRFPYAGDTASFG
A0A1M7DJN3      NVPKEERGMPW------TVVAKDSLGNFELYDHNKNLVL-SGAAGQTYRFPYAGDTASFG
A0A1M6UFW9      NVPKEKRNLPW------TVVAKDSLGNFELFDQDKKLVL-TGSAGQTYHFTYAGDTASFG
A0A1M6I669      NLPEEERGKPW------VAVVKDSL-TFKLLDHNKKLIVDNCHAGETYKIPYAGDTVTFS
A0A1M6WDT9      KLPADEKTGPW------VAITKDSL-SFDLYDHKGAFVL-TGVPGQTYKVPYAGDSVTFS
A0A254RG57      KLPPDEETGPW------HAVVIDSN-HYYLLDHNKKKFL-ECTVSQTCRAPYAGDTVTIN
A0A254S791      SIPTDEKIKPW------IAKAIDSL-SFELYDHNDKKIL-TGVIGQTYRIPYARDTVIFS
A0A285ZTW6      KIPEDEKIKPW------IAEATDST-SFKLIDHNDKEVL-SGTVGKTYHFIYAGDTATFS
A0A380S6W7      TLPKEEKIKPW------IAEVTDSL-TYDLYDHHNKKIL-SGQIGQTYRVPYANDTLIFS
A0A1M6V3G7      SIPKDEKRGPW------IATAVDST-SFDLYDHNNNKIL-TGTVGQTYRVPYAGDTLIFS
A0A1N6J281      SIPKDEKRGPW------IATAVDSS-SFDLYDHNNNKIL-TGTVGQTYRVPYAGDTLIFS
A0A285ZYD6      -----ARAEKW------MARAVDEN-TYEVISPEEQVIL-EGKVGELYKAPYAGDTLDIH
A0A1M6S079      -----ARKERW------IAQITGIN-SYEVITPEGAVLA-KAEIGETIRAPYAGDTLVMR
A0A1M6WR43      -----ARRDRW------TATVTGAN-SYAVITPEGAKLV-EAEVGETVRAPYAGDTLVMR
A0A2N3RVS2      -----ARRDRW------TATVTGAN-SYAVITPEGAKLV-EAEVGETVRAPYAGDTLVMR
A0A1M5VRV4      -----ARRDRW------TATVTGAN-SYAVITPEGAKLV-EAEVGETVRAPYAGDTLVMR
A0A254RLG7      -----ARRDRW------TATVTGAN-SYAVITPEGAKLV-EAEVGETVRAPYAGDTLVMR
A0A1M6SHG3      -----AITDKW------LAKTIDDT-TYAIITPEETELA-RGVIGQPLVASYAGDSLTIL
A0A1M6WJF1      -----ARIEKW------TAEVVSEN-EIAVYTPEGVKLL-QGPVGERLTAAYGGDTLVIQ
A0A254RQS8      -----ARIEKW------TAEVVGEN-EFAVYTPEGVKLL-QGKVGEALAAPYGGDTLRIN
A0A1M6Z6I9      -----ARIEKW------TAEVVGDN-EFAVYTPEGVKLL-QGKVGESLSAPYGGDTLRVH
A0A254STU0      -----ARIEKW------TAEVVGDN-EFAVYTPEGVKLL-QGKVGESLSAPYGGDTLRVH
A0A1M5G181      -----ARDEKW------MAHVVGEN-EIAVFTPEGVKLL-QGKVGESLSAPYGGDTLRIH
A0A1M6VYU0      -----ARDEKW------MAHVVGED-EIAVFTPEGVKLL-QGKVGEALSAPYGGDTLRIH
A0A1M7DAK0      -----ARNGKW------TAIVKSDE-SYSVVAPDGKEVL-NGKVGHVYKTKYAEDSLTIR
A0A254SNB3      -----ARAERW------IAVVTGAD-TYDVYTPEETKLV-GGKVGDLLKAPYAGDTLCIR
A0A380RVE7      -----ARAERW------IAVVTGAD-TYDVYTPEETKLV-GGKVGDLLKAPYAGDTLCIR
A0A1M5F234      -----ARADRW------EAVVTGDN-SYAIYTPEETKLV-EGMVGDLLSAPYAGDTLRIR
A0A1M6VST0      -----ARADRW------EAVVTGEN-TYAIYTPEETKLV-EGKVGDLLSAPYAGDTLRMR
A0A2C8Y654      -----VTEAKIKIK---ARVLPDST-KFELLGEDDAVLL-KGEVGETYRQPYAGDTLAIC
A0A1M5J685      -----VSEAKIKIK---ARVLPDST-KFELLGEDDAVLL-KGEVGETYRQPYAGDTLAIC
A0A1M7JMJ6      -----VSEAKIKIK---ARVLPDST-KFELLGEDDAVLL-KGEVGETYRQPYAGDTLAIC
A0A254S3F1      -----FEEAKGELV---ARVTADSS-AYEVIGLEGEVVL-SGKVGETYRKPFAGDTLAIC
A0A254SFQ7      -----FQEAKGKLV---ARVTADSS-AYEVIGLEGEVVL-SGSVGETYRKPFAGDTLVIC
A0A380S7L2      -----FQEAKGKLV---ARVTADSS-AYEVIGLEGEVVL-SGSVGETYRKPFAGDTLVIC
A0A1M7MCZ6      -----FEEADGKLI---ARVTADSS-AYEVLGLEDEVVL-SGKVGETYRKPFAGDTLVIC
A0A1X7KIP6      -----FEEADGKFI---ARVTADSS-AYEVLGLEDEVVL-SGKVGETYRKPFAGDTLVIC
A0A286A129      -----FVEAKGELI---ARVTADSS-AYEVLGLEGEVVL-SGSVGETYRKPFAGDTLVIC
C9RRK0          -----FQEAKGKLI---ARVTADSS-AYEVIGLEGEVVL-AGAVGETYRKPFAGDTLVIC
A0A2M9A3A4      -----YEPDANWFLVASSDSSLSNS-HYQIVDPMQKVIL-EGIVGDTYRVPVAGDTFAIQ
A0A2P6UPN2      -----ARTE-KWMLMASADSALSNS-EFSIIDPMEKVIL-QGKVGDTYRIPVMGDTFAIR
A0A1M6RBQ2      ------IRDGW------TAKIVNDR-SYVVYSPDGRSVM-KGVVGKESSATYKGESVSIL
A0A316BGL2      ------RRKGW------TAKIVNDR-SYVVYGPDGNSVM-KGEVGKESVGKFKGDSVSIL
A0A1M6IQ57      -----ARAEEL------TAVATGDN-TYKVVNPQNTVLV-QGKVGDVLKALYAGDTLVIR
A0A316ATY6      -----ARKEKW------IAQVTGVN-SYEVITPEGAVLA-KADIGETIRAPYAGDTLVMR
A0A1T4QDW5      -----ARTEEW------KAVVLSPD-SFAVLDPEEKQVL-RGEVRKLLVAPYAGDTLAIR
A0A1M6VSY0      -----ARTEEW------KAVVLSPD-SFAVLDPEEKQVL-RGEVRKLLVAPYAGDTLAIR
A0A2A3HHG6      -----ARTEEW------KAVVLSPD-SFAVLDPEEKQVL-RGEVRKLLVAPYAGDTLAIR
C9RP30          -----ARAEKW------MARVTGDD-TYEVISPEEQVIL-EGKVGEMHRAAYAGDTFDIQ
A0A1M5V3U1      -----VRAKKW------MAEVTGKD-SYSVISPDGKKIL-DGVVGEVAFAEFADDTLSIR
A0A1M7NG89      -----VRAKKW------MAVAKSDS-AYSVVSSDEKNVL-DGVVGEVAFKEYAGDTLAIR
A0A2C8YXS0      -----LRVKKW------IAVVKDEN-SYAVIAPDGKVAL-EGRVGEVYSAVFAGDTLTIR
A0A254RLK0      -----ARTEKW------MAVVTGDD-TYAIYNEDETKLI-EGKVGQMLKVLYAGDTLQIR
A0A1M6RGU5      -----ARTEKW------RAVVTGDD-TYAVYNEDETRLV-EGKVGQMLKVLYAGDTLQIR
A0A254SQM8      -----ARTEKW------WAVVTGDD-TYAVYNEDETRLV-EGKVGQMLKVLYAGDTLQIR
A0A316B5S0      -----AITEKW------MARTIDDS-TYAIITPEETELA-RGVLGKELVAPYGGDSLVIL
A0A254RXS0      -----AITEKW------YALVTGQD-EFIVITPEDTELV-KGRVGEPVSAPYAGDSLVIQ
A0A1M6X012      -----AITEKW------YALVTGQD-EFIVITPEDTELV-KGRVGEPVSAPYAGDSLVIQ
A0A1M5TLF1      -----AITEKW------YALVTGQD-EFIVITPEDTELV-KGRVGEPVSAPYAGDSLVIQ
A0A2N3RVJ9      -----AITEKW------YALVTGQD-EFIVITPEDTELV-KGRVGEPVSAPYAGDSLVIQ
A0A1M6R2N3      ---FDEDDGNW------VAEVKSED-SYELFTPLGTSVV-VGKVGETYRVHVEGDSVAIC
A0A1N6GS15      ---FDDDDGDW------VAEVKSED-SYELFTPLGSSVV-VGKVGETYRVPVEGDSVAIC
A0A254SB44      MLGIDKKDEKW------IAVVRSQD-TYELFSPMGQSLV-VGKVGETYRIPMGADSVAIC
A0A1M7LKR0      REDKSLKGKKW------IAVVQSQD-SYELFSPMGQSLV-VGKIGETYRIPMGADTVAIC
A0A1X7JP42      REDKSLKGKKW------IAVVQSQD-TYELFSPMGQSLV-VGKIGETYRIPMGADTVAIC
A0A1M6UBQ0      DEELVKKGKKW------IAVIQSED-SYELFSPMGQSLV-VGKVGETYRIPMDADTVAIC
A0A1X7IS68      KDD---EKIEW------ITEILSDS-TYDLRSPFGGSLV-IGKIGETYRVPFADDTVAIS
                                             :                        :.    

A0A3C0PHK7      VRDKLEQAERDYQTYKERTGNIAGGTTPELKTLQEASATNIAQLGLKE-------ADLTA
A0A1M6RVC1      IISCDVRPGQRFVVRKRKRLDAISSFRSAFDVKEKGKKTGILEFTYQDIYPDRGMAVLNE
A0A2N3RSN9      IISCDVRPGQRFVVRKRKRLDAISSFRSAFDVKEKGKKTGILEFTYQDIYPDRGMAVLNE
A0A1M5IPF7      IISCDVRPGQRFVVRKRKRLDAISSFRSAFDVKEKGKKTGILEFTYQDIYPDRGMAVLNE
A0A254RX70      IISCDVRPGQRFVVRKRKRLDAISSFRSAFDVKEKGKKTGILEFTYQDIYPDRGMAVLNE
A0A1M7GQ27      VHRMEATAGQKFELQELNRLDAIAAFKKAFEIKEKGKKTGILEFSYQDIYPDRATQILNE
A0A1X7JCK4      VHRMEATAGQKFELQELNRLDAIAAFKKAFDIKEKGKKTGILEFSYQDIYPDRATQILNE
A0A1M7HDE6      VLKMDIKKGQRFSLYKMNRLDAIDAFKSAFDIKEKGKKTGILEFSYQDIYPDRATEILNE
A0A2C9A7H2      VLKMNVKKGQTFNLTKIDRLDAINAFRDVFDITEKGKKTGILEFSYQDIYPDRATEILNE
A0A254SF58      IERMEAAPGQKFKIGKMERLDAIEAFKGAFNIKERGKKTGILEFSYQDIYPDRATKVLNE
A0A316ANB4      VYRMIARAGQEFELSQVERLESIEAFKHAFGVKERGKKTGILEFSYQDIYPDRATEVLNE
A0A1J5E847      VLRMMAHKGQTFAVSNRLRLDAISAFESAFSVAERGKKTGILEFTYQDIYPDRAMNVVNQ
A0A254RM08      IFKAEVREGQRFAVSKLKRLDAIGLFRSAFDVKEKGKKTGILEFSYQDIYADRAVEILNE
A0A1M7CD42      IFKAEVREGQRFAVSKLKRLDAIEQFRSAFDVKEKGKKTGILEFSYQDIYADRAVEILNE
A0A254SZB4      IFKAEVREGQRFAVSKLKRLDAIEQFRSAFDVKEKGKKTGILEFSYQDIYADRAVEILNE
A0A1M5LBR0      IFRAVVREGQRFAVSKMKRLEAIEAFRSAFKVSEKGKKTGILEFSYQDIYPDRAVEILNE
A0A1M7DJN3      IFRAVVREGQRFAVSKMKRLEAIEAFRSAFKVSEKGKKTGILEFSYQDIYPDRAVEILNE
A0A1M6UFW9      IFRAEVRPGQTFSVYKLKRLDAIEKFRGAFNVSEKGKKTGILEFSYQDIYPDRGVEILNE
A0A1M6I669      VLRMNVKKGQFFNLYKKNRLDAIDAFKSAFEIKEKGKKTGILEFTYQDIYPDRATEILNE
A0A1M6WDT9      VFKMKVKANQKFEINKSERLDAIDAFRGAFEVKERGKKTGILEFSYKDIYPDRATEILNE
A0A254RG57      VFYMDAEPKQKFKLQKMERLDAIASFKSKFKVKERGKKTGILEFSYQDIYPDRATSILNE
A0A254S791      VFNMEAVAGQKFELTKLDRLDAIAKFKGAFEVKERGKKTGILEFSYQDIYPDRATKIVNE
A0A285ZTW6      VFNMKARAGQRFELFKRTRLDAIAKFKSAFDVGEKGKKTGILEFSYQDIYPDRATKILNE
A0A380S6W7      VLNMKATAGQRFELGKMERLDAIDKFKGAFDVKEKGKKTGILEFSYQDIYPDRATKILNE
A0A1M6V3G7      VFHMDATAGQKFKLNKLERLDAIAKFKKAFEVKEKSRKTGILEFSYQDIYPDRATKILNE
A0A1N6J281      VFHMDATAGQKFKLNKLERLDAIAKFKKAFEVKEKSRKTGILEFSYQDIYPDRATKILNE
A0A285ZYD6      VSKMLAQPGQEFVLSQSGMLGAIAALKGGLKVAEKGKKSGIIEASFNHRYPDRAASILNT
A0A1M6S079      VRLMRGIEGQQFILRQLTPLSAIRGLASKLSVAEKGKQTGIIAVSLKHRYADRSAAILNT
A0A1M6WR43      VRLIRAAVGQEFVLQQLKPLAAIRSLARKLSVSEKGKQTGILAVSLKHRYADRSATILNA
A0A2N3RVS2      VRLIRAAVGQEFVLQQLKPLAAIRSLARKLSVSEKGKQTGILAVSLKHRYADRSATILNA
A0A1M5VRV4      VRLIRAAVGQEFVLQQLKPLAAIRSLARKLSVSEKGKQTGILAVSLKHRYADRSATILNA
A0A254RLG7      VRLIRAAVGQEFVLQQLKPLAAIRSLARKLSVSEKGKQTGILAVSLKHRYADRSATILNA
A0A1M6SHG3      VKRMRAEPGQVFVLVQTDPLDAMRGLVKKLNVAEKGKQTGIIGVSFTHQYPDRAAAILNS
A0A1M6WJF1      VKRLLATPGQKFVIAQSEPLDAVRGLVKSLDVAEKGKQTGIIGVSYTNRYADKAASVLNS
A0A254RQS8      VKHLLARPGQLFVLAQSEPLDAVRGLVKKLDVGEKGKQTGIIGVSYTDRYADKAASVLNT
A0A1M6Z6I9      VKHLLARPGQRFVLVQSEPLDAVRALVKKLDVAEKGKQTGIIGVSYTDRYADKAASVLNT
A0A254STU0      VKHLLARPGQRFVLVQSEPLDAVRGLVKKLDVAEKGKQTGIIGVSYTDRYADKAASVLNT
A0A1M5G181      VKHLHARPGQVFVIVQSEPLDAVRGLVKQLDVSERGKQTGIIGVSYTNRYADKAASVLNT
A0A1M6VYU0      VKHLLARPGQVFAIVQSEPLDAVRGLVKQLDVSERGKQTGIIGVSYTNRYADKAASVLNT
A0A1M7DAK0      VSYMDAKVGQRFKLLQGSLLKTEQILMRSLNVNERGKQTGIISVRYSHRYPDRAASILNT
A0A254SNB3      VNLMRATVGERFAIGQSNTLLAVRGLASALKVAEKGKQTGIIGVSYSHRYADRAASILNT
A0A380RVE7      VNLMRATVGERFAIGQSNTLLAVRGLASSLKVAEKGKQTGIIGVSYSHRYADRAASILNT
A0A1M5F234      VKLMRATLGEKFVIKQGNPLLAVRGLAGSLKVAEKGKQTGVIGISYSHRYADRAASILNT
A0A1M6VST0      VKLMRATLGEKFVIKQGNPLLAVRGLAGSLKVAEKGKQTGVIGISYSHRYADRAASILNT
A0A2C8Y654      VRSMKARPGQVFLLGATHPQMAVAGLLGGLSVSEEGKNSGIIRVSMQHAYPDRVADILNS
A0A1M5J685      VRSMKARPGQTFLLGATHPQMAVAGLLGGLSVSEEGKNSGIIRVSMQHAYPDRVADILNS
A0A1M7JMJ6      VRSMKARPGQTFLLGATHPQMAVAGLLGGLSVSEEGKNSGIIRVSMQHAYPDRVADILNS
A0A254S3F1      VKNLTATVGQTFLLTAVHPQVAAGNLLKGLSISEEGKSSGIIRVSLENRYADRVAAILNT
A0A254SFQ7      VKSLTATVGQTFLLSAVHPQIAAASLLKGLSISEEGKNSGIIRVSLENRYADRVAAILNT
A0A380S7L2      VRSLTATVGQTFLLSAVHPQIAAASLLKGLSISEEGKNSGIIRVSLENRYADRVAAILNT
A0A1M7MCZ6      VKSMTATVGQTFLLVAVHPQIAVNNLLSGLGISEEGKNSGIIRVSLEDRYADRVAAILNT
A0A1X7KIP6      VKSMTATVGQTFLLVAVHPQIAVNNLLSGLGISEEGKNSGIIRVSLEDRYADRVAAILNT
A0A286A129      VKSLTATVGQTFLLNAVHPQTASASLLKGISISEEGKNSGIIRVSFEHRYADRVAAILNT
C9RRK0          VKSLTATVGQTFLLSAVHPQTAAAGLLKGLGISEEGKNSGIIRVSLEDRYADRVAAILNT
A0A2M9A3A4      ILNMMASPSEKFRLFESDPRQALDALRNQLSVTEQGKKTGIIQMQIHHRYADRAAHILNS
A0A2P6UPN2      ISQMNALPEEKFELTELDPRTALDILKKQLVVSEMGKKTGIIQMQIAHRYPDRAASILNS
A0A1M6RBQ2      VSKISGVPGQRFDLEITSSLKAARSLANKLIIEERGKQTGIIGITYAHRYPDRAVSILNS
A0A316BGL2      VSKIKGQPGQEFDLQITTPLKAARSLAQQLKIEEKGKLTGIIGITYAHRYPDRAMSVLNS
A0A1M6IQ57      VKFLSAKVGEEFALRQGNPLSVVRALSKSIKASEKGKQSGIIAVSYSHRYADRAAGILNT
A0A316ATY6      VRLMRGIEGQQFVLRQLTPLSAIRSLAHKLSVSEKGKQTGIITVSLKHRYADRSASILNA
A0A1T4QDW5      VSLLRAEAGEEFALAQSSPLNVARALATGLEIAEKGKKTGILTMNFSHRYPDRAAAILNA
A0A1M6VSY0      VSLLRAEAGEEFALAQSSPLNVARALATGLEIAEKGKKTGILTMNFSHRYPDRAAAILNA
A0A2A3HHG6      VSLLRAEAGEEFALAQSSPLNVARALATGLEIAEKGKKTGILTMNFSHRYPDRAAAILNA
C9RP30          VSRMLAQPEQMFILSQISDLGAMGALKASLKVAEKGKQTGIIEASYNHRYPDRAAAILNT
A0A1M5V3U1      VNFMDAKQGQKFIIAQGSPINAERSLAGGLSVMEKGKQTGIIAVRYSHRYPDRAASILNT
A0A1M7NG89      VNFMDARKGQKFALVRGTPLKAERALAAGLNVMEKGKQTGIISVRYSHRHPDRAASILNT
A0A2C8YXS0      VNYMQARKGQKFQIVQGSPLKAERALKASLNVAEKGKQTGIISVRYSHRYPDRAASILNT
A0A254RLK0      VSRMRATIGEEFRINMSNPLIAVRSLAAGLKVAEKGKQTGVIGVSFSHRYADRAASILNT
A0A1M6RGU5      VSRMRATVGEEFRINMTNPLIAVRSLAAGLKVAEKGKQTGVIGVSFSHRYADRAASILNT
A0A254SQM8      VSRMRATVGEEFRISMTNPLIAVRSLAAGLKVAEKGKQTGVIGVSFSHRYADRAASILNT
A0A316B5S0      VKRMRAEPDQMFVLVESDPLDAVRSLVKQLNVAEKGKQTGIIGVSFTHQYPDRAAAILNS
A0A254RXS0      VKALRAEPGQMFVLVESDPLAAVRELVKQLNVAERGKQTGIIGVSYTHQYADRAASILNT
A0A1M6X012      VKALRAEPGQMFVLVESDPLAAVRELVKQLNVAERGKQTGIIGVSYTHQYADRAASILNT
A0A1M5TLF1      VKALRAEPGQMFVLVESDPLAAVRELVKQLNVAERGKQTGIIGVSYTHQYADRAASILNT
A0A2N3RVJ9      VKALRAEPGQMFVLVESDPLAAVRELVKQLNVAERGKQTGIIGVSYTHQYADRAASILNT
A0A1M6R2N3      VRSMDALPGQKFVLHRLSVLRMAEILQKIVQADELGKNTNIIEIAYQDRYPDRAAKVLNA
A0A1N6GS15      VRSMDALPGQKFVLYRLSVLRMAEILQKTVLADEKGKNTNIIEIAYQDRYPDRAAKVLNA
A0A254SB44      VRAFSAEPGQSFRLFRSSVLSVAEGLQAAINAYEKEKNSNILEISYSGRYPDRVADVLNA
A0A1M7LKR0      VKAIYAAPGQSFSLSKSSVLNVAEGLQSAINAYEKEKNSNILEVSFSGRYPDRVANVLNA
A0A1X7JP42      VKAIYAAPGQSFSLSKSSVLNVAEGLQSAINAYEKEKNSNILEVSFSGRYPDRVANVLNA
A0A1M6UBQ0      VKAINAEPGQSFSLSRASVLSVAEGLQASINAYEKEKNSNILEISYSDRYPDRVAEVLNA
A0A1X7IS68      VESISAKPGQKFSLTRIPALYAAKNLSLAINAIEKEKNTNIIEISYMDRYPDRAAAVLNA
                :          :                 .   :    :.:                :. 

A0A3C0PHK7      EKKQLALMEATITPAEEERSPEFL---------KLRSRLHELEQEKMRLENLGINMVGSS
A0A1M6RVC1      VASSYLRQNVEERNAEAQKTLEFLEKQLPDVKAQMDSSLMNLNAYRNRVGSVDVNAETQL
A0A2N3RSN9      VASSYLRQNVEERNAEAQKTLEFLEKQLPDVKAQMDSSLMNLNAYRNRVGSVDVNAETQL
A0A1M5IPF7      VASSYLRQNVEERNAEAQKTLEFLEKQLPDVKAQMDSSLMNLNAYRNRVGSVDVNAETQL
A0A254RX70      VASSYLRQNVEERNAEAQKTLEFLEKQLPDVKAQMDSSLMNLNAYRNRVGSVDVNAETQL
A0A1M7GQ27      IATSYLRQNVEQRNAEAQKTLEFLEKQLPAVKEQMDSSLLKFNTYRNKVGSVDIGAETQI
A0A1X7JCK4      IATSYLRQNVEQRNAEAQKTLEFLEKQLPAVKEQMDSSLLKFNTYRNKVGSVDIGAETQI
A0A1M7HDE6      IANAYLRQNVERSNAEAQKTLEFLEKQLPEVKAQMDSAMLRFNSYRNRVGSVDINAETRL
A0A2C9A7H2      ISTAYLRQNVERSNEEAQKTLEFLEKQLPDVKMQMDSAMLRFNNYRNRVGSVDINAETRL
A0A254SF58      IATSYLRQNVEQRNAEAQKTLEFLEKQLPIVKAQMDSTLLKYNTYRNKVGSVDIYAETKL
A0A316ANB4      IATNYLRQNVEQRNAEAQKTLEFLEKQLPEVKAQMDSSLLKFNTYRNRVGSVDINAETRI
A0A1J5E847      VANAYLRQNVEQRSAEAEKTLAFLEQQIPDVKLKLDSAEAELSAYRYQVGSVDINTETRI
A0A254RM08      VASSYLRQNVEERNAEAQKTLEFLEKQLPDVKAQMDSSLLNLNTYRNQVGSVDINAETQL
A0A1M7CD42      VASSYLRQNVEERNAEAQKTLEFLEKQLPDVKAQMDSSLLNLNTYRNQVGSVDINAETQL
A0A254SZB4      VASSYLRQNVEERNAEAQKTLEFLEKQLPDVKAQMDSSLLNLNTYRNQVGSVDINAETQL
A0A1M5LBR0      VASSYLRQNVEERNAEAQKTLEFLEKQLPDVKAQMDSSLLNLNTYRNRVGSVDINAETQL
A0A1M7DJN3      VASSYLRQNVEERNAEAQKTLEFLEKQLPDVKAQMDSSLLNLNTYRNRVGSVDINAETQL
A0A1M6UFW9      VASSYLRQNVEERNAEAQKTLEFLEKQLPDVKAQMDSSLMNLNTYRNRVGSVDINAETQL
A0A1M6I669      IAATYLRQNVERSNAEAQKTLEFLEKQLPEVKSQMDSAMLRFNNYRNRVGSVDINAETRL
A0A1M6WDT9      VASSYLQQNVEQRNAEAQKTLEFLEKQLPEIKARMDSSLLKYNTYRNKVGSVDINAETRI
A0A254RG57      IATTYLRQNVEQRNAEAQKTLEFLEKQLPDVKAQMDSSLLKYNTYRNRVGSIDINAETRL
A0A254S791      IATTYLRQNVEQRNAEAQKTLEFLEKQLPDVKAQMDSSLLKFNTYRNKVGSIDIDAETRL
A0A285ZTW6      IATSYLRQNVEQRNAEAQKTLEFLEKQLPDVKAQMDSSLLKFNTYRNKVGSVDIDAETRL
A0A380S6W7      IATSYLRQNVEQRNAEAQKTLEFLEKQLPDIKAQMDSSLLKFNTYRNKVGSVDIGAETQI
A0A1M6V3G7      IATSYLRQNVEQRNAEAQKTLEFLEKQLPDVKAQMDSSLLKFNTYRNKVGSIDIGAETQL
A0A1N6J281      IATSYLRQNVEQRNAEAQKTLEFLEKQLPDVKAQMDSSLLKFNTYRNKVGSIDIGAETQL
A0A285ZYD6      VAKTYLRQNVEMRSAEAAKTLEFLEKQLPGVKAKLDSVEKILADYRYSIGSVDMTGETHA
A0A1M6S079      IADTYVRRNVEKRSAEAEKTLEFLEKQLPGVRAKLDTAERILADYRHKIGSVDMTGETQV
A0A1M6WR43      IANTYVRHNVEKRSAEAEKTLEFLEKQLPGVKAKLDTAEKILADYRHKIGSVDMTGETQV
A0A2N3RVS2      IANTYVRHNVEKRSAEAEKTLEFLEKQLPGVKAKLDTAEKILADYRHKIGSVDMTGETQV
A0A1M5VRV4      IANTYVRHNVEKRSAEAEKTLEFLEKQLPGVKAKLDTAEKILADYRHKIGSVDMTGETQV
A0A254RLG7      IANTYVRHNVEKRSAEAEKTLEFLEKQLPGVKAKLDTAEKILADYRHKIGSVDMTGETQV
A0A1M6SHG3      IANVYLRQNVEMRSAEAEKTLEFLEQQLPGVKAKLDSAEKNLADYRHKIGSVDMTGETRA
A0A1M6WJF1      IANIYLRQNVEMRSAEAEKTLEFLEAQLPGVKAKLDTAEKALADYRLKIGSVDMSGETRS
A0A254RQS8      IANIYLRQNVEMRSAEAEKTLEFLEEQLPGVKAKLDTAEKKLADYRLKIGSVDMTGETRV
A0A1M6Z6I9      IANIYLRQNVEMRSAEAEKTLEFLEEQLPGVKAKLDTAEKKLADYRLKIGSVDMTGETRV
A0A254STU0      IANIYLRQNVEMRSAEAEKTLEFLEDQLPGVKAKLDSAEKKLADYRLKIGSVDMTGETRV
A0A1M5G181      IANIYLRQNVEMRSAEAEKTLEFLEDQLPGVKAKLDTAEKKLADYRLKIGSVDMTGETKA
A0A1M6VYU0      IANIYLRQNVEMRSAEAEKTLEFLEEQLPGVKAKLDTAEKNLADYRLKIGSVDMTGETRV
A0A1M7DAK0      IAKTYLRQNVEMRSAEAEKTLEFLEGQLPAVKAKLDSAEKILADYRYSIGSVDMTGETKA
A0A254SNB3      IANTYVRQNVEMRSAEAEKTLEFLESQLPGVKSKLDSAEKVLADYRHQIGSVDMTGETQA
A0A380RVE7      IANTYVRQNVEMRSAEAEKTLEFLESQLPGVKSKLDSAEKVLADYRHQIGSVDMTGETQA
A0A1M5F234      IANTYVRQNVEMRSAEAEKTLEFLETQLPGIKAKLDSSEKVLSDYRHSVGSVDMTGETRA
A0A1M6VST0      IANTYVRQNVEMRSAEAEKTLEFLETRLPGIKATLDSSEKVLSDYRHSVGSVDMTGETRA
A0A2C8Y654      IANTYLKQNIEMRSAEAKKTLDFLEEQLPSVKAKLDSSEQKLTSFRNANGTIDLSGETRV
A0A1M5J685      IANTYLKQNIEMRSAEAKKTLDFLEEQLPSVKAKLDSSEQKLTSFRNANGTIDLSGETRV
A0A1M7JMJ6      IANTYLKQNIEMRSAEAKKTLDFLEEQLPSVKAKLDSSEQKLTSFRNANGTIDLSGETRV
A0A254S3F1      VANTYLKQNIEMRSAEAKKTLMFLEEQLPGVKAKLDSAEQKLTSFRNAKGTIDLSGETRL
A0A254SFQ7      IANTYLKQNIEMRSAEAKKTLAFLEEQLPGVKAKLDSAEQKLTSFRNSKGTIDLTGETRV
A0A380S7L2      IANTYLKQNIEMRSAEAKKTLAFLEEQLPGVKAKLDSAEQKLTSFRNSKGTIDLTGETRV
A0A1M7MCZ6      IANTYLKQNIEMRSAEAKKTLMFLEEQLPGVKAKLDSAEQKLTSFRHANGTIDLTGETRV
A0A1X7KIP6      IANTYLKQNIEMRSAEAKKTLMFLEEQLPGVKAKLDSAEQKLTSFRHANGTIDLTGETRV
A0A286A129      IANTYLKQNIEMRSAEAKKTLAFLEEQLPGVKAKLDSAEQKLTSFRHANGTIDLSGETRV
C9RRK0          IANTYLKQNIEMRSAEAKKTLSFLEEQLPGVKAKLDSAEQKLTSFRNSKGTIDLTGETRV
A0A2M9A3A4      IADTYVRQNVESRSEEATKTLEFLEKQLPGVKAKLDSAEQILSSYRQEEGSIDLSGEARG
A0A2P6UPN2      IADTYVRQNVEARSEEATKTLAFLEKQLPGVKAKLDSSEQVLSTYRKDEGSVDLNGEARN
A0A1M6RBQ2      LADVYLNQNIEMRSAEAAKTLQFLEEQLPGVKARLDSAEKKLADYRQSVGAVDLSVESQS
A0A316BGL2      LTDVYLNQNIEMRSAEAAKTLQFLEEQLPSVKARLDSSEKKLADYRQSIGSVDVSVESQA
A0A1M6IQ57      VLNTYVRQNVEMRSAEAEKTLEFLEEQLPGVKAKLDSAEKVLADYRHSIGSVDMTGETRA
A0A316ATY6      IADTYVRRNVEKRNAEAEKSLKFLEKQLPSIKAKLDSSEKILADYRHKIGSVDLTGETQV
A0A1T4QDW5      VANAYFRQNVEMRSAEAEKTLAFLEEQLPAVKAKLDTSEKVLADYRFQVGSVDMTGETHA
A0A1M6VSY0      VANAYFRQNVEMRSAEAEKTLAFLEEQLPAVKAKLDTSEKVLADYRFQVGSVDMTGETHA
A0A2A3HHG6      VANAYFRQNVEMRSAEAEKTLAFLEEQLPAVKAKLDTSEKVLADYRFQVGSVDMTGETHA
C9RP30          IAKTYLRQNVEMRSAEAAKTLEFLEKQLPGVKAKLDSVEKILADYRYSIGSVDMTGETHA
A0A1M5V3U1      IAKTYLRQNVEMRSAEAEKTLEFLEAQLPGVKAKLDSAEKVLADYRYKIGSVDMTGETKA
A0A1M7NG89      IAKTYLRQNVEMRSAEAEKTLEFLEGQLPGVKAKLDSAEKILADYRYKVGSVDISGETKA
A0A2C8YXS0      IAKTYLRQNVEMRSAEAEKTLEFLEGQLPGVKAKLDSAEKVLADYRHKVGSVDIGGETKA
A0A254RLK0      IANTYVRQNVEMRSAEAEKTLEFLESQLPGVKAKLDSSEKILADYRHSIGSVDMTGETQA
A0A1M6RGU5      IANTYVRQNVEMRSAEAEKTLEFLESQLPGVKAKLDSSEKVLADYRHSIGSVDMTGETQA
A0A254SQM8      IANTYVRQNVEMRSAEAEKTLEFLESQLPGVKAKLDSSEKVLADYRHSIGSVDMTGETQA
A0A316B5S0      IANVYLRQNVEMRSAEAEKTLEFLEQQLPGVKAKLDSAEKNLADYRHKIGSVDMTGETRA
A0A254RXS0      IANIYLRQNVEMRSAEAEKTLEFLENQLPGVKAKLDSAEKKLADYRHKIGSVDLSGETRT
A0A1M6X012      IANIYLRQNVEMRSAEAEKTLEFLENQLPGVKAKLDSAEKKLADYRHKIGSVDLSGETRT
A0A1M5TLF1      IANIYLRQNVEMRSAEAEKTLEFLENQLPGVKAKLDSAEKKLADYRHKIGSVDLSGETRT
A0A2N3RVJ9      IANIYLRQNVEMRSAEAEKTLEFLENQLPGVKAKLDSAEKKLADYRHKIGSVDLSGETRT
A0A1M6R2N3      VAQMYVRQNVEMRSAEAEKSLEFLEKQLPTIKAKLDSAQQLLTNYRNKVGTVDLGAEAQG
A0A1N6GS15      VAQMYVRQNVEMRSAEAEKSLEFLEKQLPTIKAKLDSAQQLLTSYRNKVGTVDLGAEARG
A0A254SB44      VAQAYVRQNVEMRSAEAEKSLEFLEEQLPSIKAKLDSSERLLTNYRNKMGTVDLGAEAKG
A0A1M7LKR0      IAQAYVRQNVEMRSAEAEKSLEFLEEQLPSIKAKLDSSERLLTDYRNKMGTIDLGAEAKG
A0A1X7JP42      IAQAYVRQNVEMRSAEAEKSLEFLEEQLPSIKAKLDSSERLLTNYRNKMGTIDLGAEAQG
A0A1M6UBQ0      IAQTYVRQNVEMRSAEAEKSLDFLEEQLPSIKAKLDSSERLLTNYRNKMGTVDLGAEAKG
A0A1X7IS68      IAETYVRQNVEMRSAEAEKSLEFLEQQLPSIKAKLDSAQQLLTNYRNTVGTVDLGAEAQG
                        :      *  .:  **          : :        .     :.:      

A0A3C0PHK7      TVDREIQEVERQLLQYKKSKEPVAIDPRVVVQWQELRKSVLNKENDLELFKRRLESYNNA
A0A1M6RVC1      VLQRRM-KLQQDILALQQRK-------------QEAIRLFHSEHPTVKTLEDQEDALKRE
A0A2N3RSN9      VLQRRM-KLQQDILALQQRK-------------QEAIRLFHSEHPTVKTLEDQEDALKRE
A0A1M5IPF7      VLQRRM-KLQQDILALQQRK-------------QEAIRLFHSEHPTVKTLEDQEDALKRE
A0A254RX70      VLQRRM-KLQQDILALQQRK-------------QEAIRLFHSEHPTVKTLEDQEDALKRE
A0A1M7GQ27      ILEKRN-VLQQKLLDLQQKK-------------QSAIRLFQPEHPTIKTLEEQENNLKRE
A0A1X7JCK4      ILEKRN-VLQQKLLDLQQKK-------------QSAIRLFQPEHPTIKTLEEQENNLKRE
A0A1M7HDE6      VLERRN-KLQQDLLNLQQKK-------------QDAIRLFQPEHPTIKTYEEQEATIKRE
A0A2C9A7H2      VLERRN-KLQQDLLSLQQKK-------------QDAIRLFQPEHPTIKTYEEQEAAIKRE
A0A254SF58      VLEKRN-KLQQSLLELQQKK-------------QSAIRLFQPEHPTIKTLEEQENNLKRE
A0A316ANB4      VLEKRA-KLQQDLLSLQQKK-------------QDAIRLFQPEHPTVKTLEEQENALKRE
A0A1J5E847      VLEGEM-RLQQQILSLEQRR-------------EDAVRLFHEEHPSVKTLDEQINNLRKE
A0A254RM08      VLQRRM-RLQQDILSLQQKK-------------QEAIRLFHSEHPTVKTLEDQENALRRE
A0A1M7CD42      VLQRRM-RLQQDILSLQQKK-------------QEAIRLFHSEHPTVKTLEDQENALRRE
A0A254SZB4      VLQRRM-RLQQDILSLQQKK-------------QEAIRLFHSEHPTVKTLEDQENALRRE
A0A1M5LBR0      VLQQRM-KLQQDILALQQRK-------------QSAIRLFHAEHPSVKTLEEQENALKRE
A0A1M7DJN3      VLQQRM-KLQQDILALQQRK-------------QSAIRLFHAEHPSVKTLEEQENALKRE
A0A1M6UFW9      VLQRRM-KLQQDILALQQRK-------------QEAIRLFHSEHPTVKTLEDQEDALRRE
A0A1M6I669      VLEKRT-KLQQDLLVLQQKK-------------QDAIRLFQPEHPTIKTYEEQENALKRE
A0A1M6WDT9      VLERRT-KLQQDLLALQQKK-------------QDAVRLFQPEHPTVKTLEDQEAALKRE
A0A254RG57      VLEKRT-KLQQNLLDLQQKK-------------QSAIRLFQPEHPTIKTLEEQENALKRE
A0A254S791      VLEKRT-RLQQSLLELQQKK-------------QSAIRLFQPEHPTIKTLEEQEAAIKRE
A0A285ZTW6      ILEKRN-RLQQNLLDLQQKK-------------QSAIRLFQPEHPTIKTLEEQENNLKRE
A0A380S6W7      ILEKRN-KLQQSLLDLQQRK-------------QSAIRLFQPEHPTIKTLEDQENNIKRE
A0A1M6V3G7      ILEKRN-KLQQSLLDLQQKK-------------QSAVRLFQPEHPTIKTLEDQESNLKRE
A0A1N6J281      ILEKRN-KLQQSLLDLQQKK-------------QSAVRLFQPEHPTIKTLEDQESNLKRE
A0A285ZYD6      HLNKES-EIQRQILDLEQQK-------------QAAMRLFKEEHPSVQTLIRQQNRLRAE
A0A1M6S079      HLQKEV-DLQKQLLRLEQER-------------QEATRLFKEEHPSVQTLTKQQDKLRRE
A0A1M6WR43      HLQKEV-DLQKQLLKLQQEY-------------QEATRLFKDEHPAVRTIAKQQDKLKGE
A0A2N3RVS2      HLQKEV-DLQKQLLKLQQEY-------------QEATRLFKDEHPAVRTIAKQQDKLKGE
A0A1M5VRV4      HLQKEV-DLQKQLLKLQQEY-------------QEATRLFKDEHPAVRTIAKQQDKLKGE
A0A254RLG7      HLQKEV-DLQKQLLKLQQEY-------------QEATRLFKDEHPAVRTIAKQQDKLKGE
A0A1M6SHG3      HLEKDA-ALQRQILELEQQR-------------QETTRLFKEEHPSVQTIVKQQNRLRAE
A0A1M6WJF1      HLEKVA-ELEKQILELDQQR-------------QEATRLFKEEHPAVQTIMQQQGRLRSE
A0A254RQS8      HLEKVS-ELEKQVLELEQQR-------------QEATRLFKEEHPAVQTIMQQQSRLRSE
A0A1M6Z6I9      HLEKVT-ELEKQVLELEQQR-------------QEATRLFKEEHPAVQTIMQQQSRLRSE
A0A254STU0      HLEKVS-ELEKQVLELEQQR-------------QEATRLFKEEHPAVQTIMQQQSRLRSE
A0A1M5G181      HLEKVS-ELEKQVLELEQQR-------------QEATRLFKEEHPAVQTIMQQQSRLRSE
A0A1M6VYU0      HLEKVS-ELEKQVLELEQQR-------------QEATRLFKEEHPSVQTIVQQQNRLRAE
A0A1M7DAK0      HLDKEG-QLQRQIMQLEQER-------------QAALRLFKEEHPNVQTIVKQQSKLRAE
A0A254SNB3      HLSKEM-DLQRQLLQLEQQR-------------QEATRLFKEEHPAVVTIVKQEAKLRRE
A0A380RVE7      HLSKEM-DLQRQLLQLEQQR-------------QEATRLFKEEHPAVVTIVKQEAKLRRE
A0A1M5F234      HLDKEV-DLQRQLLQLEQQR-------------QQATRLFKEEHPSVQTIVKQQDRLRGE
A0A1M6VST0      HLDKEV-DLQRQLLQLEQQR-------------QEATRLFKEEHPSVQTIVKQQDKLRGE
A0A2C8Y654      HLEKDV-SLQQRLLELEQKK-------------QEALRLFQAEHPTVRTIEQQQARLYGE
A0A1M5J685      HLEKDV-SLQQRLLELEQKK-------------QEALRLFQAEHPTVRTIEQQQARLYGE
A0A1M7JMJ6      HLEKDV-SLQQRLLELEQKK-------------QEALRLFQAEHPTVRTIEQQQARLYGE
A0A254S3F1      HLEKDV-TLQQRIIELEQKK-------------QEVLRLFRAEHPTVRTIEEQQARLRRE
A0A254SFQ7      HLEKDV-SLQQRLIELEQKK-------------QEALRLFRAEHPTVRTIEEQQSRLRRE
A0A380S7L2      HLEKDV-SLQQRLIELEQKK-------------QEALRLFRAEHPTVRTIEEQQSRLRRE
A0A1M7MCZ6      HLEKDV-SLQQRLLELEQKK-------------QEALRLFRAEHPTVRTIEEQQSKLRRE
A0A1X7KIP6      HLEKDV-SLQQRLLELEQKK-------------QEALRLFRAEHPTVRTIEEQQSKLRRE
A0A286A129      HLEKDV-SLQQRLLELEQKK-------------QEALRLFRAEHPTVRTIEEQQSRLRRE
C9RRK0          HLEKDV-SLQQRLIELEQKK-------------QEALRLFRAEHPTVRTIEEQQSRLRRE
A0A2M9A3A4      VLEKRM-QLEKSLLELQQKY-------------EETTRLFKEDHPTVLSLKKQQNQLRRE
A0A2P6UPN2      ALEKRM-ELEKQLLELQQKH-------------QEVSRLFKEDHPNVISLKKQQAQIRRE
A0A1M6RBQ2      LLKKEQ-DLTRQISALEQKR-------------QETTRLFKAEHPSVQAITRQLSKARSE
A0A316BGL2      LMKKEH-DLNVQIMNLEAKR-------------QEATRLFKSEHPSVQTITRQLSRLRNE
A0A1M6IQ57      HLDKEV-NLQSQIIALEQER-------------QKATRLFKEEHPSVQTIKKQQDKLRGE
A0A316ATY6      HLQKEV-DLQKQLLKLDQQY-------------QEATRLFKQEHPAVQTIAKQQNKLRAE
A0A1T4QDW5      LLEKET-NLQKQLLELGAER-------------QRLVRLFTEEHPNVQTIVAQQQRIQNE
A0A1M6VSY0      LLEKET-NLQKQLLELGAER-------------QRLVRLFTEEHPNVQTIVAQQQRIQNE
A0A2A3HHG6      LLEKET-NLQKQLLELGAER-------------QRLVRLFTEEHPNVQTIVAQQQRIQNE
C9RP30          HLNKES-EIQRQILDLEQQK-------------QAAMRLFKEEHPSVQTLIRQQNRLRAE
A0A1M5V3U1      HLDKEG-QLQRQIMQLEQER-------------QAAMRLFKAEHPNVQTIVKQQNKLRVE
A0A1M7NG89      HLDKEG-QLQRQIMQLEQER-------------QSALRLFKAEHPNVQTIVKQQNKLRAE
A0A2C8YXS0      HLDKEG-QLQRQIMQLEQER-------------QSALRLFKAEHPNVQTIVKQQNKVKAE
A0A254RLK0      HLNKEV-DLQRQLLQLEQER-------------QQATRLFKEEHPSVQTIVKQQNRLRGE
A0A1M6RGU5      HLNKEV-DLQRQLLHLEQER-------------QQATRLFKEEHPSVQTIVKQQNRLRGE
A0A254SQM8      HLNKEV-DLQRQLLHLEQER-------------QQATRLFKEEHPSVQTIVKQQNRLRGE
A0A316B5S0      HLEKDA-ALQRQILELEQQR-------------QEATRLFKEEHPSVQTIVKQQNRLRAE
A0A254RXS0      HLEKEA-NLEKQILELEQKR-------------QEQTRLFKDEHPAVVTIVKQQDRLRTE
A0A1M6X012      HLEKEA-NLEKQILELEQKR-------------QEQTRLFKDEHPAVVTIVKQQDRLRAE
A0A1M5TLF1      HLEKEA-NLEKQILELEQKR-------------QEQTRLFKDEHPAVVTIVKQQDRLRAE
A0A2N3RVJ9      HLEKEA-NLEKQILELEQKR-------------QEQTRLFKDEHPAVVTIVKQQDRLRAE
A0A1M6R2N3      TLKRQV-DLKTQLLALEQEY-------------QEKSRLFKQDHPAMQAILSQQGRIRKE
A0A1N6GS15      TLDRQV-QLKTQLLSLQQQY-------------QEKSRLFKQDHPAMQAILSQQERIRKE
A0A254SB44      TLERQV-ELKTQLLSLQQQY-------------QEKARLFKEDHPAMQALLQQQQRLNRE
A0A1M7LKR0      TLERQI-ALKTQLLSLQQEY-------------QEKARLFKEDHPAMQAIVQQQQRLSRE
A0A1X7JP42      TLKRQV-DLKAQLLMLQQEY-------------QEKARLFKEDHPAMQAILQQQQRLGKE
A0A1M6UBQ0      TLERQV-ELKTQLLSLQQQY-------------HEKARLFKEDHPAMQAILQQQQRLSHE
A0A1X7IS68      TLKRQV-ELRTMLLASQQDY-------------QEKSRLFKQDHPVMQALLQQQARLKKE
                 :.     :   :                        . .  .   :     .       

A0A3C0PHK7      IKKYKNKNPDILTNSLELLRLQRSSEVYQNVYNVLLEKAEEERMLNTSSSAGIKIVDIAR
A0A1M6RVC1      LAGTASQVKKLPTTQQEVLKLTNEVEQSKILYTTMLNNIQQLRLVSAGEVGSVRIVDFAE
A0A2N3RSN9      LAGTASQVKKLPTTQQEVLKLTNEVEQSKILYTTMLNNIQQLRLVSAGEVGSVRIVDFAE
A0A1M5IPF7      LAGTASQVKKLPTTQQEVLKLTNEVEQSKILYTTMLNNIQQLRLVSAGEVGSVRIVDFAE
A0A254RX70      LAGTASQVKKLPTTQQEVLKLTNEVEQSKILYTTMLNNIQQLRLVSAGEVGSVRIVDFAE
A0A1M7GQ27      LANNTAATKRLPNTQQEVLKLTNEVDMSKHMYTTMLNNIQQLKLVSAGEVGSVRIIDFAE
A0A1X7JCK4      LANNTAATKRLPNTQQEVLKLTNEVDMSKHMYTTMLNNIQQLKLVSAGEVGSVRIIDFAE
A0A1M7HDE6      LAHNTSESKKLPATQQEVLKLNNEVDLTKIMYTTMLNNIQQLKLVSAGEVGTVRIIDYAE
A0A2C9A7H2      LAHNTSESKRLPATQQEVLKLNNEVDLTKIMYTTMLNNIQQLKLVSAGEVGTVRIIDYAE
A0A254SF58      LANNTAATKKLPNTQQEVLKLTNEVDMSKLMYTTMLNNIQQLKLVSAGEVGSVRIIDFAE
A0A316ANB4      LSTNSSEARRLPATQQEVLKLTNEVDMSKIMYTSMLNNIQQLKLVSAGEVGSVRIIDFAE
A0A1J5E847      LAESSHQARKLPSTQQEILRLASEVELDKLLYTNMLNSIQQLRLVAAGEVGSVRIVDYAE
A0A254RM08      LAGTSSEVKKLPATQQEVLKLQNEVELTKVMYTSLLNNIQQLRLVSAGEVGSVRVVDFAE
A0A1M7CD42      LAGTSSEVKKLPATQQEVLKLQNEVELTKVMYTSLLNNIQQLRLVSAGEVGSVRVVDFAE
A0A254SZB4      LAGTSSEVKKLPATQQEVLKLQNEVELTKVMYTSLLNNIQQLRLVSAGEVGSVRVVDFAE
A0A1M5LBR0      LAGTSSAVKKLPATQQEVLKLQNEVELAKVMYTTMLNNIQQLRLVSAGEVGSVRIIDFAE
A0A1M7DJN3      LAGTSSAVKKLPATQQEVLKLQNEVELAKVMYTTMLNNIQQLRLVSAGEVGSVRIIDFAE
A0A1M6UFW9      LAGTSSEVKKLPATQQEVLKLQNQVELTKVMYTTMLNNIQQLRLVSAGEVGSVRIIDFAE
A0A1M6I669      LASNTSESKKLPATQQEVLKLSNEVELTKVMYTTMLNNIQQLKLVSAGEVGSVRIIDFAE
A0A1M6WDT9      LYSNSSEAKKLPATQQEVLKMTNEVDISKVMYTSMLNNIQQLKLVSAGEVGSVRIIDFAE
A0A254RG57      LASNYNETKKLPSTQQEVLKLTNEVDMSKIMYTTMLNNIQQLKLVSAGEVGSVRIIDFAE
A0A254S791      LALNSNETKKLPATQQEVLKLTNEVDMSKIMYTTMLNNIQQLKLVSAGEVGSVRIIDFAE
A0A285ZTW6      LASTSIATKKLPNTQQEVLKLTNEVDMSKIMYTTMLNNIQQLKLVSAGEVGSVRIIDFAE
A0A380S6W7      LASNYAATKKLPNTQQEVLKLTNEVEMSKHLYTTMLNNIQQLKLVSAGEVGSVRIIDFAE
A0A1M6V3G7      LASNYAATKKLPNTQQEVLKLTNEVDMSKHMYTTMLNNIQQLKLVSAGEVGSVRIIDFAE
A0A1N6J281      LASNYAATKKLPNTQQEVLKLTNEVDMSKHMYTTMLNNIQQLKLVSAGEVGSVRIIDFAE
A0A285ZYD6      LAKLKKTAEKMPLTQQEVARLKEDVAVNNEIYTTMLNNIQQLRVVRAGEVGNVRIVDFAQ
A0A1M6S079      LAKLKSSAEKMPLTQQEVMRLQEDVQVNNAIYNTMLNNIEQLRVVRAGEVGNVRVVDYAM
A0A1M6WR43      LSKLKASAAKMPLTQQEVMRLQEDVQVNNAIYNTMLNNIQQLRVVRAGEVGNVRVVDYAM
A0A2N3RVS2      LSKLKASAAKMPLTQQEVMRLQEDVQVNNAIYNTMLNNIQQLRVVRAGEVGNVRVVDYAM
A0A1M5VRV4      LSKLKASAAKMPLTQQEVMRLQEDVQVNNAIYNTMLNNIQQLRVVRAGEVGNVRVVDYAM
A0A254RLG7      LSKLKASAAKMPLTQQEVMRLQEDVQVNNAIYNTMLNNIQQLRVVRAGEVGNVRVVDYAM
A0A1M6SHG3      LSKLKNSAEKMPLTQQEVLRLQEEVAVQNAQYTSMLNNIQQLRVVRAGEVGTVRVVDYAQ
A0A1M6WJF1      LSRLKKSAENMPRTQQDVLSLQEEVAVNNAQYTAMLNNIQQLRVVRAGEVGNVRIVDYAQ
A0A254RQS8      LSRLKKSAENMPRTQQDVMSLQEEVAVNNAQYTAMLNNIQQLRVVRAGEVGNVRIVDYAQ
A0A1M6Z6I9      LSRLKKSAENMPRTQQDVMSLQEEVAVNNAQYTAMLNNIQQLRVVRAGEVGNVRIVDYAQ
A0A254STU0      LSRLKKSAENMPRTQQDVMSLQEEVAVNNAQYTAMLNNIQQLRVVRAGEVGNVRIVDYAQ
A0A1M5G181      LSRLKKSAENMPRTQQDVMSLQEEVAVNNAQYTAMLNNIQQLRVVRAGEVGNVRIVDYAQ
A0A1M6VYU0      LSRLKKSAENMPKTQQDVRSLQEEVAVNNAQYTAMLNNIQQLRVVRAGEVGNVRIVDYAQ
A0A1M7DAK0      LAALKKNAEKMPLTQQEVKRLQEEVAVNNEVYTNMLNNIQQLRVVRAGEVGNVRIVDFAQ
A0A254SNB3      LSRLKKNAESMPITQQEVLRLQEDVAVNNAQYTSMLNNIQQLRVVRAGEVGNVRIVDFAQ
A0A380RVE7      LSRLKKNAESMPITQQEVLRLQEDVAVNNALYTNMLNNIQQLRVVRAGEVGNVRIVDFAQ
A0A1M5F234      LARLKKSAESMPVTQQEMIRLQEDVALNNAQYTAMLNNIQQLRVVRAGEVGNVRVVDFAQ
A0A1M6VST0      LARLKKSAESMPVTQQEMIRLQEDVSLNNAQYTAMLNNIQQLRVVRAGEVGNVRVVDFAQ
A0A2C8Y654      LAKQKKAADKLPKTQQEFLSLQEEVEVNNKLYTNLLNNIQQLRVVQAGEVGNVRIVDQAY
A0A1M5J685      IAKQKKAADKLPKTQQEFLSLQEEVEVNNKLYTNLLNNIQQLRVVQAGEVGNVRIVDQAY
A0A1M7JMJ6      IAKQKKAADKLPKTQQEFLSLQEEVEVNNKLYTNLLNNIQQLRVVQAGEVGNVRIVDQAY
A0A254S3F1      LARQQRSASSLPVLQQEVLSLQEEVEVNNKLYTNLLNNIQQLRVVQAGEVGNVRIVDQAY
A0A254SFQ7      LAKQQRSAATLPVVQQEVLSLQEEVEVNNKLYTNLLNNIQQLRVVQAGEVGNVRIVDQAY
A0A380S7L2      LAKQQRSAATLPVVQQEVLSLQEEVEVNNKLYTNLLNNIQQLRVVQAGEVGNVRVVDKAY
A0A1M7MCZ6      IAKQQRSAASLPVVQQEVLSLQEEVEVNNKLYTNLLNNIQQLRVVQAGEVGNVRIVDQAY
A0A1X7KIP6      IAKQQRSAASLPVVQQEVLSLQEEVEVNNKLYTNLLNNIQQLRVVQAGEVGNVRIVDQAY
A0A286A129      IAKQQRSAASLPVVQQEVLSLQEEVEVNNKLYTNLLNNIQQLRVVQAGEVGNVRIVDQAY
C9RRK0          LAKQQRSAANLPVVQQEVLSLQEEVEVNNKLYTNLLNNIQQLRVVQAGEVGNVRIVDQAY
A0A2M9A3A4      MAKLSEETKDLPTKQQEILRLQGDVNVNNAIYTNMLNNIQQLRVVQAGEVGNVRVVDYAR
A0A2P6UPN2      MAKLSDETKDLPEKQQEILRLQGDVEVNNSIYTNMLNNIQQLRVVQAGEVGNARIVDRAR
A0A1M6RBQ2      LNKLKNDAGKMPATQQEMLALQEQVATNNAQYTSMLNNIQQLRTVRAGEVGTVTVVDYAV
A0A316BGL2      LSKLKTDAEKMPLTQQEILTMQEEVAANNAQYTSMLNNIQQLRTVRAGEVGTASVVDYAV
A0A1M6IQ57      LAKLKRSAEKMPLTQQEVMRLQEEVQVNNQVYTTMLNNIQQLRVVRAGEVGNVRIVDAAQ
A0A316ATY6      LAKLKANAEKMPLTQQEVLRLQEDVQVNNAIYNTMLNNIEQLRVVRAGEVGNVRVVDYAM
A0A1T4QDW5      LNRLKKNAEKMPKTQQEILRLQADLSVNNTVYLDMLNKIQQFRVVRAGAIGNVRIVDYAQ
A0A1M6VSY0      LNRLKKNAEKMPKTQQEILRLQADLSVNNTVYLDMLNKIQQFRVVRAGAIGNVRIVDYAQ
A0A2A3HHG6      LNRLKKNAEKMPKTQQEILRLQADLSVNNTVYLDMLNKIQQFRVVRAGAIGNVRIVDYAQ
C9RP30          LAKLKKTAEKMPLTQQEVARLKEDVAVNNEIYTTMLNNIQQLRVVRAGEVGNVRIVDFAQ
A0A1M5V3U1      LAALKKNAEKMPLTQQEVKRLQEEVAVNNEVYTNMLNNIQQLRVVRAGEVGNVRIVDFAQ
A0A1M7NG89      LAALKKNAEKMPLTQQEVKRLQEEVAVNNEVYTNMLNNIQQLRVVRAGEVGNVRIVDFAQ
A0A2C8YXS0      LAQLKKNAEKMPLTQQEVKRLQEEVAVNNEVYTNMLNNIQQLRVVRAGEVGNVRIVDFAQ
A0A254RLK0      LARLKKTAESMPVTQQEIIRLQEEVSVNNAQYTAMLNNIQQLRVVRAGEVGNVRIVDFAQ
A0A1M6RGU5      LARLKKTAESMPVTQQEMIRLQEEVSVNNAQYTAMLNNIQQLRVVRAGEVGNVRIVDFAQ
A0A254SQM8      LARLKKTAESMPVTQQEMIRLQEEVSVNNAQYTAMLNNIQQLRVVRAGEVGNVRIVDFAQ
A0A316B5S0      LSKLKNSAEKMPLTQQEVLRLQEEVAVQNAQYTSMLNNIQQLRVVRAGEVGNVRVVDYAQ
A0A254RXS0      LARLKSSAAKMPLTQQEVISLQEEVAVNNAQYTSMLNNIQQLRVVRAGEVGNVRIVDYAQ
A0A1M6X012      LARLKSSAAKMPLTQQEVISLQEEVAVNNAQYTSMLNNIQQLRVVRAGEVGNVRIVDYAQ
A0A1M5TLF1      LARLKSSAAKMPLTQQEVISLQEEVAVNNAQYTSMLNNIQQLRVVRAGEVGNVRIVDYAQ
A0A2N3RVJ9      LARLKSSAAKMPLTQQEVISLQEEVAVNNAQYTSMLNNIQQLRVVRAGEVGNVRIVDYAQ
A0A1M6R2N3      ISKEEGKVKALPVTQQDVLKLKQDVELNNELYTSILNNIQQLRVVRASEIGNVRIVDPAY
A0A1N6GS15      IGKEEGKVKALPVTQQDVLKLQQDVELNNELYTSVLNNIQQLRVVRASEIGNVRIVDPAY
A0A254SB44      IGKEESKTKKLPITQQDVLKLQQDVEINNQLYTSVLNNIQQLRVVRASEIGNVRVVDPAY
A0A1M7LKR0      IGKEENKTKKLPTTQQDVLKLQQDVEINNQLYTSVLNNIQQLRVVRASEIGNVRIVDPAY
A0A1X7JP42      IAMEEGKTKKLPTTQQDVLKLQQDVEINNQLYTSVLNNIQQLRVVRASEIGNVRIVDPAY
A0A1M6UBQ0      IGKEESKTKKLPITQQDVLKLQQDVEINNQLYTSVLNNIQQLRVVRASEIGNVRIVDPAY
A0A1X7IS68      IGIEENKTKKLPTTQQDVLKLQQDVEINNELYTSVLNNMQQLRVVRASEIGNVRIVDKAY
                :         :   . :.  :  .    :  *  :*:. :: . : :.  .   ::* * 

A0A3C0PHK7      KPDNPMPKNENRYYAVGIILGLFLGIALAMILEFNDT-TIKSNEDVERYLGESILGTIPH
A0A1M6RVC1      KALRPTKPKPKLIVAVALFLGFLFGTLIISLKTKFSS-GVKSASFIEKETGFTVYAKVP-
A0A2N3RSN9      KALRPTKPKPKLIVAVALFLGFLFGTLIISLKTKFSS-GVKSASFIEKETGFTVYAKVP-
A0A1M5IPF7      KALRPTKPKPKLIVAVALFLGFLFGTLIISLKTKFSS-GVKSASFIEKETGFTVYAKVP-
A0A254RX70      KALRPTKPKPKLIVAVALFLGFLFGTLIISLKTKFSS-GVKSASFIEKETGFTVYAKVP-
A0A1M7GQ27      EVSRPMKPKKSMIIFAMLFLGLLTGATFVTLRSKFSN-GVRDANFIERETGFSVYAKVP-
A0A1X7JCK4      EVSRPMKPKKSMIIFAMLFLGLLTGATFVTLRSKFSN-GVRDANFIERETGFSVYAKVP-
A0A1M7HDE6      QVRKPTKPKKKIILCVALFLGFLFGAALVSIKSKFSN-GVRDPNFIEKETGFSVYAKIP-
A0A2C9A7H2      QVTRPAKPKKKIIVCIALILGLLFGFALISLKKKMSS-GVRDANFIEKETGFSVFAKIP-
A0A254SF58      EVFRPIKPKKSLIVCIALFLGFLIGASISTLKSKISN-GVRDAHFIERETGYSVYAKVP-
A0A316ANB4      PVNKPTKPKKKIILLVALFIGFLVGATIVSIKSKLSS-GVKDANFIERETGYSVYAKVP-
A0A1J5E847      QETKPVQPRKKMILMVALFLGFCASVVYVSVKKKFHS-GIKDSRVIERELGISVYAKIP-
A0A254RM08      QVTKPAKPKKRVILCMALFLGFLLGAMLVSIKSKFSS-GVKSASFIEKETGYTVYAKVP-
A0A1M7CD42      QVTKPAKPKKRVILCMALFLGFLLGAMLVSIKSKFSS-GVKSASFIEKETGYTVYAKVP-
A0A254SZB4      QVTKPAKPKKRVILCMALFLGFLLGAMLVSIKSKFSS-GVKSASFIEKETGYTVYAKVP-
A0A1M5LBR0      QVTKPTKPKKKIILCVALFLGFLLGAAIVSIKSKVSS-GVKSANFIEKETGFTVYAKVP-
A0A1M7DJN3      QVTKPTKPKKKIILCVALFLGFLLGAAIVSIKSKVSS-GVKSANFIEKETGFTVYAKVP-
A0A1M6UFW9      QVTVPTKPKKKVILCVALFLGFLLGATIVSIKSKFSS-GVKSANFIEKETGFTVYAKVP-
A0A1M6I669      QVSRPTKPKKKMIVLIALFFGLLLGAAIVSIKSKFSN-GVRDAHFIERETGYSVYAKVP-
A0A1M6WDT9      QVTQPAKPNKKMIIVAFLFMGLLLGCAIVTIKSKFSN-GVRDAHFIERETGFSVYAKIP-
A0A254RG57      PALRPAKPKKPLIISAALFIGLLFGFALISIKSKLSS-GVRDANFIERETGFSVYAKVP-
A0A254S791      EVKKPSKPRKTVIVCIALFFGVLLGACIALLKSKFSN-GVRDAHFIERETGFSVYAKVP-
A0A285ZTW6      EVTRPAKPKKSLIICVALFLGFLLGACIATLKSKLSN-GVRDAHFIERETGYSVYAKVP-
A0A380S6W7      EVSRPFKPKKGMVVFISLFLGLIFGAVIISIKSKLNS-GVRDANLIERETGFSVYAKVP-
A0A1M6V3G7      EVSSPIKPKKSMIVCVALFIGLLFGTLIISIKSKFNN-GVRDANFIERETGFSVYAKVP-
A0A1N6J281      EVSSPIKPKKSMIVCVALFIGLLFGTLIISIKSKFNN-GVRDANFIERETGYSVYAKVP-
A0A285ZYD6      INGAPSKPKKMNIIICSVAASFMLGVLLVFLLRMMHN-GVRSVTEIERETNTSVLAKVP-
A0A1M6S079      VEDRPSKPKKMRILLGAIAASFVLASLLIYLLRMLHN-GVRSSNDVENTTGVSVYAKIP-
A0A1M6WR43      VEDRPSKPKKLNILICCVAASFMVAVLLVFLMRMLHN-GVRSTTEVEKATSISVFAKIP-
A0A2N3RVS2      VEDRPSKPKKLNILICCVAASFMVAVLLVFLMRMLHN-GVRSTTEVEKATSISVFAKIP-
A0A1M5VRV4      VEDRPSKPKKLNILICCVAASFMVAVLLVFLMRMLHN-GVRSTTEVEKATSISVFAKIP-
A0A254RLG7      VEDRPSKPKKLNILICCVAASFMVAVLLVFLMRMLHN-GVRSTTEVEKATSISVFAKIP-
A0A1M6SHG3      IERLPSKPNKKMIFLGCVAGAFLLGALLIYLLQMTKR-GVRSSLEIERETGVSVYAKIP-
A0A1M6WJF1      IEREPSKPNKKVIFAGCVGGCFLLGALLIYLLQMTKR-GVRSSLEIERETGISVYAKIP-
A0A254RQS8      IERRPSKPNKKMIFLACVGGAFLLGALLIYLLQMTKR-GVRSSLEIERETGISVYAKIP-
A0A1M6Z6I9      IERKPSKPNKKVIFAGCVGGAFLLGALLIYLLQMTKR-GVRSSLEIERETGISVYAKIP-
A0A254STU0      IERKPSKPNKKVIFAGCVGGAFLLGALLIYLLQMTKR-GVRSSLEIERETGISVYAKIP-
A0A1M5G181      VERKPSKPNKKVVFAGCVGGSFLLGALLLYLLQMTKR-GVRSSLEIERETGISVYAKIP-
A0A1M6VYU0      IERRPSKPNKKVVFAGCVGGSFLLGALLLYLLQMTKR-GVRSSLEIERETGISVYAKIP-
A0A1M7DAK0      IEQSQSKPNKSRIVLVSAVAGFMLGVLFVLLTYLLRN-GVKSASEIERETGLSVFAKIP-
A0A254SNB3      IEPIQSKPKKLNILICSMAASFMLGVLLVFLLRMMKN-GVRSSQELEHATDVSVFAKIP-
A0A380RVE7      IEPIQSKPKKLNILICSMAASFMLGVLLVFLLRMMKN-GVRSSQELEHATDVSVFAKIP-
A0A1M5F234      IEPIQSKPKKLNILVCCMAASFMVGVLLVFMLRMMRN-GIRSSQELEHATNVSVFAKIP-
A0A1M6VST0      IEPIQSKPKKFNILVCSMAASFMVGVLLVFLLRMMRN-GIRSSQELEHATNVSVFAKIP-
A0A2C8Y654      VPIKPAKPNRKLIFGGVALAFLLLGCAIVLVRRMSHN-GVASSTEVEQATGIGVYGKLP-
A0A1M5J685      VPIKPAKPNRKLIFGGVALAFLLLGCAIVLVRRMSHN-GVASSTEVEQATGIGVYGKLP-
A0A1M7JMJ6      VPIKPAKPNRKLIFGGVALAFLLLGCAIVLVRRMSHN-GVASSTEVEQATGIGVYGKLP-
A0A254S3F1      EPLKPNKPNRKLIFLGVMGAFLLLGCFIVYIRRLLSN-GVCSSSEVEQATGVGVYGKLP-
A0A254SFQ7      APLLPSKPNRKLIFLGVVAAFLLLGCFIVYIRRMLAN-GVCSSSEVEQATGVGVYGKLP-
A0A380S7L2      EPLKPSKPNRKLIFLGVVAAFLLLGCFIVYIRRMLAN-GVCSSSEVEQATGVGVYGKLP-
A0A1M7MCZ6      VPLKPSKPKRKLVFLGVVFAFLLLGCFIVYIRRILSN-GVCSSSEVEQATGIGVYGKLP-
A0A1X7KIP6      VPLKPSKPKRKLVFVGVVFAFLLLGCFIVYIRRILSN-GVCSSSEVEQATGIGVYGKLP-
A0A286A129      VPLKPAKPNRKLVFLGVVFAFLLLGCFIVYVRRMLSN-GVCSSSEVEQATGIGVYGKLP-
C9RRK0          VPLKPSKPNRKLVFVGVVFAFLLLGCLIVYVRRMLSN-GVCSSSEVEQATGVGVYGKLP-
A0A2M9A3A4      IEIKPVKPRKLVILLGFIAGGFILGACLIFVLRLLSSRGIRSSSDVERETGVSVYAKVP-
A0A2P6UPN2      MEIRPVKPQKSVILLGSIVGGFILGAVFVFLYRMIFNRGIRTSRELEQATGVSVYAKIP-
A0A1M6RBQ2      EDNEQIKPRKARIFFWSVGIFLFAGVMLVLLMRLFR-NGVRNALEIERKTGVSVYAKVP-
A0A316BGL2      EDSEQIKPRKAVIFLWSVAIAFAIGVLLVVFIRLFR-NGVRNSLEIERRTGISVYAKVP-
A0A1M6IQ57      IEPIQSKPKKFNIFVCSIAASFMVGVLLVFVLRMFK-NGVRGSTEIERETDMSVYAKIP-
A0A316ATY6      VEDRPSKPKKTHILMGAIAASFVMAALLIYLLRMLH-NGVRSSTEVENTTGVSVYAKIP-
A0A1T4QDW5      VETKPSKPKKTMIVLGSVAGGFVLGVLIIFFLRALSPRGVRSSVELERETGEVVLAKIP-
A0A1M6VSY0      VETKPSKPKKTMIVLGSVAGGFVLGVLIIFFLRALSPRGVRSSVELERETGEVVLAKIP-
A0A2A3HHG6      VETKPSKPKKTMIVLGSVAGGFVLGVLIIFFLRALSPRGVRSSVELERETGEVVLAKIP-
C9RP30          INGAPSKPKKMNIIICSVAASFMLGVLLVFLLRMMH-NGVRSVTEIERETNTSVLAKVP-
A0A1M5V3U1      AEQSQTKPNKSRIIMASIVFGFIFGVLFVFLMYILR-NGVKSTSRIERETGLSVFAKIP-
A0A1M7NG89      VEQSQTKPNKSRILMASVVFGFIFGVLFVFLMYILR-NGAKSASEIERETGLSVFAKIP-
A0A2C8YXS0      IEPSQSKPNKSRIIIASVAFGFALGILFVVLMRILK-NGVRSASEIERETGLSVFAKIP-
A0A254RLK0      IEPIQSKPKKFNILVCSMAAAFMLGVLWVFMLRMMR-NGIRSSQELEHATEVSVFAKIP-
A0A1M6RGU5      VEPIQSKPKKFNILICSMAAAFMLGVLWVFMLRMMH-NGVRSSQELEHATEVSVFAKIP-
A0A254SQM8      VEPIQSKPKKFNILICSMAAAFMLGVLWVFMLRMMR-NGVRSSQELEHATEVSVFAKIP-
A0A316B5S0      IERKPSKPNKKMIFLGCVAGAFLLGALLIYLLQMTK-RGVRSSLEIERATGVSVYAKIP-
A0A254RXS0      IERKPSKPNKKLILIGCIAGFFLLGALLIYLLQMTK-RGVRSSLEIERETGVSVYAKIP-
A0A1M6X012      IERKPSKPNKKLILIGCIAGFFLLGALLIYLLQMTK-RGVRSSLEIERETGVSVYAKIP-
A0A1M5TLF1      IERKPSKPNKKLILIGCIAGFFLLGALLIYLLQMTK-RGVRSSLEIERETGVSVYAKIP-
A0A2N3RVJ9      IERKPSKPNKKLILIGCIAGFFLLGALLIYLLQMTK-RGVRSSLEIERETGVSVYAKIP-
A0A1M6R2N3      IHWKPVKPKRKMIVLAGLGGGFGFAWVLVLLLHRIRNRGVGSSSEIERETGVSVYAKVP-
A0A1N6GS15      IHRKPIKPKRKMIALAGLGGGFAFAWVLVLMLHRMRNRGVGSSSEIERETGVSVYAKVP-
A0A254SB44      IHEKPSKPNRKKIMAAGLGGGFAFSVVLIYLLHLIGGRGVGSSSEIERETGVSVYAKIP-
A0A1M7LKR0      VREKPSKPNRKKIMLAGFGGGFAFSVILIYLLHTMRNRGVGSSSEIERETGVSVYAKIP-
A0A1X7JP42      VREKPSKPNRKKIMLAGFGGGFAFSVILIYLLHTMRNRGVGSSSEIERETGVSVYAKIP-
A0A1M6UBQ0      IHVKPSKPNRKKIMAAGFGGGFALSLVLIYLLHTLSNRGVGSSSEIERETGVSVYAKIP-
A0A1X7IS68      IDAKPAKPNRKKITLAGFAGGLGFGCILVILLQRIRNRGVGSSTQIEHETGVSVYAKIP-
                        .            .  .     .              :*.     : ..:* 

A0A3C0PHK7      IAHNKKDDIQIKRRSAKSKHAMSVVQYPRQILNFSGDDSVITESYRSLRTNLSFVSP-DS
A0A1M6RVC1      ------------KGNPQGTKGTRP-------LAVVEPDDVAVESLRALRSSLEFSMM-DD
A0A2N3RSN9      ------------KGNPQGTKGTRP-------LAVVEPDDVAVESLRALRSSLEFSMM-DD
A0A1M5IPF7      ------------KGNPQGTKGTRP-------LAVVEPDDVAVESLRALRSSLEFSMM-DD
A0A254RX70      ------------KGNPQGTKGTRP-------LAVVEPDDVAVESLRALRSSLEFSMM-DD
A0A1M7GQ27      ------------KGNPNGTKGTRP-------LAVVEPDDVAVESIRALRSSLEFSME-EG
A0A1X7JCK4      ------------KGNPNGTKGTRP-------LAVVEPDDVAVESIRALRSSLEFSME-EG
A0A1M7HDE6      ------------KGNPNGTKGTRP-------LAVVEPDDVAVESLRALRSSLEFSMD-EG
A0A2C9A7H2      ------------KGNPNGTKGTRP-------LAVVEPDDVAVESLRALRSSLEFSMD-EG
A0A254SF58      ------------KGNPKGTKGTRP-------LAVVEPDDVAVESLRTLRSSLEFSMD-ES
A0A316ANB4      ------------KGNPNGTKGTRP-------LAVVEPDDVAVESLRALRSSLEFSMD-DT
A0A1J5E847      ------------KGAASGTLGTLP-------LAVAFPDDVAVESMRTLRTSLEFVMP-ET
A0A254RM08      ------------KGNPKGTKGTRP-------LAVVEPDDVAVESLRALRSSLEFSMM-DE
A0A1M7CD42      ------------KGNPKGTKGTRP-------LAVVEPDDVAVESLRALRSSLEFSMM-DE
A0A254SZB4      ------------KGNPKGTKGTRP-------LAVVEPDDVAVESLRALRSSLEFSMM-DE
A0A1M5LBR0      ------------KGNPKGTKGTRP-------LAVVEPDDVAVESLRALRSSLEFSMM-DE
A0A1M7DJN3      ------------KGNPKGTKGTRP-------LAVVEPDDVAVESLRALRSSLEFSMM-DE
A0A1M6UFW9      ------------KGNPKGTKGTRP-------LAVVEPDDVAVESLRALRSSLEFSMM-DE
A0A1M6I669      ------------KGNPKGTKGTRP-------LAVVEPDDVAVESLRALRSSLEFSMD-EG
A0A1M6WDT9      ------------KGNPNGTKGTRP-------LAVVEPDDVAVESLRTLRSSLEFSME-DG
A0A254RG57      ------------KGNPKGTKGTRP-------LAVVEPDDVAVESLRALRSSLEFSME-DG
A0A254S791      ------------KGNPKGTKGTCP-------LAVVEPDDVAIESLRTLRSSLEFSMD-EG
A0A285ZTW6      ------------KGNPKGTKGTRP-------LAVVEPDDVAVESLRTLRSSLEFSMD-DG
A0A380S6W7      ------------KGNPNGTKGTRP-------LAVVEPDDVAVESLRALRSSLEFSMD-EG
A0A1M6V3G7      ------------KGNPNGTKGTRP-------LAVVEPDDVAIESLRALRSSLEFSME-DE
A0A1N6J281      ------------KGNPNGTKGTRP-------LAVVEPDDVAIESLRALRSSLEFSME-DE
A0A285ZYD6      ------------QYPDTGLNLKFR-KTRKT-HVQTDPDDPLSESIRSILTAIDFSFNMNK
A0A1M6S079      ------------EHHGKTSKSKK--R--IP-VVISEPEDRVSESFRSLLTSVDFSMT-SL
A0A1M6WR43      ------------ERRGKVMKARR--RNLVP-LVVSQPEDPASEAFRSLLTSVDFTVP-SQ
A0A2N3RVS2      ------------ERHGKVMKARR--RNLVP-LVVSQPEDPASEAFRSLLTSVDFTVP-SQ
A0A1M5VRV4      ------------ERRGKVMKARR--RNLVP-LVVSQPEDPASEAFRSLLTSVDFTVP-SQ
A0A254RLG7      ------------ERRGKVMKARR--RNLVP-LVVSQPEDPASEAFRSLLTSVDFTVP-SQ
A0A1M6SHG3      ------------ESDNSLLSRRKKGKNTLP-LVDESPDDPASEAFRSLYTAIDFSIA-DQ
A0A1M6WJF1      ------------KAENAILSKRNKGKYTKP-LVEDDPESPSSEALRSLYTAIEFATT-DL
A0A254RQS8      ------------KAENAILSKRNKGKNTKP-LVEDDPDSPSSEALRSLYTAIEFATS-DM
A0A1M6Z6I9      ------------KAENAILLKRNKGKNTKP-LVEDDPDSPSSEALRSLYTAIEFATN-DL
A0A254STU0      ------------KAENAILLKRNKGKNTKP-LVEDDPDSPSSEALRSLYTAIEFATN-DL
A0A1M5G181      ------------KAENAILLKRNKGKNTKP-LVEDDPDSPSSEALRSLYTAIEFATN-DL
A0A1M6VYU0      ------------KAENAILLKRNKGKNTKP-LVEDDPDSPSSEALRSLYTAIEFATN-DL
A0A1M7DAK0      ------------QSRNRLLRGHRHLHHGAP-FVLQNIDNGVCEAFRALQTALTFLMP-NP
A0A254SNB3      ------------VSKNKVVRNK---HNAMT-LVESSPNEPASEAFRTLQTAIDFSLS-EG
A0A380RVE7      ------------VSKNKVVRNK---HNAMT-LVESSPNEPASEAFRTLQTAIDFSLS-EG
A0A1M5F234      ------------ESKNRLVKDK---RRKLT-LVESSPNDQASEAFHTLQTALDFSLE-AG
A0A1M6VST0      ------------ESKNRLVKDK---RRKLT-LVESSPNDQASEAFRTLQTALDFSLE-AG
A0A2C8Y654      ------------MLGKGTENNV---LD--P-VVHEKPDEPFAEAVRALRTALEFSLF-AD
A0A1M5J685      ------------MLGKGTENNV---LD--P-VVHEKPDEPFAEAVRALRTALEFSLF-AD
A0A1M7JMJ6      ------------MLGKGTENNV---LD--P-VVHEKPDEPFAEAVRALRTALEFSLF-AD
A0A254S3F1      ------------MLDGKTLNDV---YK--P-CVATNPDDPFAEGIRALRTALEFSVF-SD
A0A254SFQ7      ------------MLDGKTQNDV---MK--P-CVSVKPDDPFAEGIRALRTALEFSVF-SD
A0A380S7L2      ------------MLDGKTQNDV---MK--P-CVSVKPDDPFAEGIRALRTALEFSVF-SD
A0A1M7MCZ6      ------------MLDGRTQNDV---TK--P-CVSTNPDDPFAEGVRALRTALEFSVF-SD
A0A1X7KIP6      ------------MLDGRTQNDV---TK--P-CVSTNPDDPFAEGVRALRTALEFSVF-SD
A0A286A129      ------------MLDGKTQNDV---YK--P-CVSTNPDDPFAEGIRALRTALEFSVF-SD
C9RRK0          ------------MLDRKTQNDV---TK--P-CVVTNPDDPFAEGVRALRTALEFSVF-CD
A0A2M9A3A4      ------------ETAQMKKMKK---MKTFS-LVEVDSEDVACEALRTLRTSLEFSMM-DS
A0A2P6UPN2      ------------ELKERK--------KSFT-LIEEGGEDIASEALRILRTSLEFSMG-VG
A0A1M6RBQ2      ------------ESSNRDLKKKSRKGTLP--LVCCCPEDPASEALRSVFTSVEFSA--AA
A0A316BGL2      ------------ESGNRDLKKKDRKGTLP--LVCSNPEDPASEALRSVFTSVEFSA--TA
A0A1M6IQ57      ------------ESHHKHTRSKHKTS-----LVEAAPNDLASEAFRGLQTALDFSLG-EG
A0A316ATY6      ------------EHHGKSSKSKKRRP-----IVITDPEDRVSESFRSLLTSVDFTLP-TQ
A0A1T4QDW5      ------------RTFSRVLTNRRRSGEGNPILVLEDPDDPASENIRSLLTAVEFGML-SK
A0A1M6VSY0      ------------RTFSRVLTNRRRSGEGNPILVLEDPDDPASENIRSLLTAVEFGML-SK
A0A2A3HHG6      ------------RTFSRVLTNRRRSGEGNPILVLEDPDDPASENIRSLLTAVEFGML-SK
C9RP30          ------------QNPDTGLNL-KFRKTRKT-HVQTDPDDPLSESIRSILTAIDFSFNMNK
A0A1M5V3U1      ------------QSSHKFLRTNKRVHHSAP-FVLQNPEDKVSESFRSLQTALAFLMP-NP
A0A1M7NG89      ------------QSTHKLLRGHKHLHHGAP-FVLQNAEDKVSESFRSLQTALMFLMP-NP
A0A2C8YXS0      ------------QSTHKFLRANTRVHHSAP-FVLQNTEDKVSESFRSLQTALMFLMP-NP
A0A254RLK0      ------------ESKNRLL---RDKRHKLT-LVEAAPNDQASEAFRTLQTAVDFSLS-EG
A0A1M6RGU5      ------------ESRNRLL---RDKRHKLT-LVEASPNDQASEAFRTLQTAVDFSLT-EG
A0A254SQM8      ------------ESRNRLL---RDKRHKLT-LVEASPNDQASEAFRTLQTAVDFSLT-EG
A0A316B5S0      ------------ESDNNILHHRKKGKNTLP-LVEQSPDDPASEAFRSLYTAIDFSIA-N-
A0A254RXS0      ------------KSENSILSLRKKGKNTLP-LVEEDPEDPASEAFRSLYTAIDFSVG-E-
A0A1M6X012      ------------KSENSILSLRKKGKNTLP-LVEEDPEDPASEAFRSLYTAIDFSVG-E-
A0A1M5TLF1      ------------KSENSILSLRKKGKNTLP-LVEEDPEDPASEAFRSLYTAIDFSVG-E-
A0A2N3RVJ9      ------------KSENSILSLRKKGKNTLP-LVEEDPEDPASEAFRSLYTAIDFSVG-E-
A0A1M6R2N3      ------------KT--HISHKLPGVNDKRFILAKADSEDFAIEKLRALRTALEFSCI-DE
A0A1N6GS15      ------------KT--HISHKLPGVNDKRFILAKADSEDFAIEKIRALRTALEFSCL-DE
A0A254SB44      ------------KT--QISRKLPGVNDKRFILAKADAEDIAIEKVRTLRTALEFSFL-EE
A0A1M7LKR0      ------------KT--QISRKLPGVSDKRFILAKADPEDIAVEKVRTLRTALEFSFL-DE
A0A1X7JP42      ------------KT--QISRKLPGVSDKRFILAKADPEDIAVEKVRTLRTALEFSFL-DE
A0A1M6UBQ0      ------------KT--QISHKLPGASDKRFILAKADSEDLAVEKIRALRTALEFSFL-DE
A0A1X7IS68      ------------KT--KINPKLPNVNDKRFILAKEDSEDIAIERIRTLRTTLEFSCL-DE
                                                     :.   *  . : : : *      

A0A3C0PHK7      PIHAVLVTSAGPGEGKSLTTANLAMAYAQMGKKTLLVDTDLRRPVIHHFFNMKREPGFSD
A0A1M6RVC1      NGSVIGVSGLIPGVGKSFISVNLAALFAGLGKKVLLIDADLRKGRLHKEFGIKRGNGLSQ
A0A2N3RSN9      NGSVIGVSGLIPGVGKSFISVNLAALFAGLGKKVLLIDADLRKGRLHKEFGIKRGNGLSQ
A0A1M5IPF7      NGSVIGVSGLIPGVGKSFISVNLAALFAGLGKKVLLIDADLRKGRLHKEFGIKRGNGLSQ
A0A254RX70      NGSVIGVSGLIPGVGKSFISVNLAALFAGLGKKVLLIDADLRKGRLHKEFGIKRGNGLSQ
A0A1M7GQ27      SSPTIGVSGLIPGVGKSFISVNLAALYAGLGKKVLLIDADLRKGRLHKEFGIKRGKGLSQ
A0A1X7JCK4      SSPTIGVSGLIPGVGKSFISVNLAALYAGLGKKVLLIDADLRKGRLHKEFGIKRGKGLSQ
A0A1M7HDE6      CRPIIGVSGLIPGVGKSFISVNLAALFAGLGKKVLLIDADLRKGRLHKEFGIKRGNGLSQ
A0A2C9A7H2      CRPIIGVSGLIPGVGKSFISVNLAALFAGLGKKVLLIDADLRKGRLHKEFGIKRGDGLSQ
A0A254SF58      SNSIIGVSGLIPGVGKSFVSVNLAALYAGLGKKVLLIDADLRKGRLHKEFGIKRGKGLSQ
A0A316ANB4      MRQIIGVSGLIPGVGKSFISVNLAALYAGLGKRVLLIDADLRKGRLHKEFGLSRDKGLSQ
A0A1J5E847      GASVIVLSGLIPAVGKSFVSVNLAALFAGTEKRVLLIDADLRKGRLHKEFGIRRDQGLSE
A0A254RM08      GGSVVGVSGLIPGVGKSFISVNLAALFAGLGKRVLLIDADLRKGRLHKEFGIKRGNGLSQ
A0A1M7CD42      GGSVVGVSGLIPGVGKSFVSVNLAALFAGLGKSVLLIDADLRKGRLHKEFGIKRGNGLSQ
A0A254SZB4      GGSVVGVSGLIPGVGKSFVSVNLAALFAGLGKSVLLIDADLRKGRLHKEFGIKRGNGLSQ
A0A1M5LBR0      GGSIVGVSGLIPGVGKSFVSVNLAALFAGLGKKVLLIDADLRKGRLHKEFGIKRGNGLSQ
A0A1M7DJN3      GGSIVGVSGLIPGVGKSFVSVNLAALFAGLGKKVLLIDADLRKGRLHKEFGIKRGNGLSQ
A0A1M6UFW9      GGSIIGVSGLIPGVGKSFISVNLAALFAGLGKKVLLIDADLRKGRLHKEFGIKRGDGLSQ
A0A1M6I669      CRPVIGISGLIPSVGKSFISVNLAALFAGLGKKVLLIDADLRKGRLHKEFGLKRGNGLSQ
A0A1M6WDT9      ARQIIGVSGLIPGVGKSFVSVNLAALCAGLGKKVILIDADLRKGRLHKEFGIKRGNGISQ
A0A254RG57      QRRIIGVSGLIPGVGKSFISVNLAALCAGLGKKVLLIDADLRKGRLHKEFGIKRGKGLSQ
A0A254S791      SSPIIGISGLIPGVGKSFISVNLAALYAGLGKKVLLIDADLRKGRLHKEFGIKRGKGLSQ
A0A285ZTW6      SSPIIGISGLIPGVGKSFISVNLAALYAGLGKKVLLIDADLRKGRLHKEFGIKRGKGLSQ
A0A380S6W7      VHTIIGVSGLIPGVGKSFISVNLAALFAGLGKKVLLIDADLRKGRLHKEFGIKRGKGLSQ
A0A1M6V3G7      SKSIIGVSGLIPGVGKSFISVNLAALFAGLGKRVLLIDADLRKGRLHKEFGIKRDKGLSQ
A0A1N6J281      SKSIIGVSGLIPGVGKSFISVNLAALFAGLGKRVLLIDADLRKGRLHKEFGIKRDKGLSQ
A0A285ZYD6      EHQVIMVSGITPGVGKSFISTNLAATFAMVGKKTLFIDADMRKATCR-F---TKV-GLAD
A0A1M6S079      SHPVLMISGLIPGGGKSFVSLNLAALYAESGKRTLLIDADMRRGVHHSG---CKM-GLAE
A0A1M6WR43      THPVIMVSGLIPGVGKSFVSSNLAALHATSGKRTLLIDADMRRGVHRSS---SKM-GLAE
A0A2N3RVS2      THPVIMVSGLIPGVGKSFVSSNLAALHATSGKRTLLIDADMRRGVHRSS---SKM-GLAE
A0A1M5VRV4      THPVIMVSGLIPGVGKSFVSSNLAALHATSGKRTLLIDADMRRGVHRSS---CKM-GLAE
A0A254RLG7      THPVIMVSGLIPGVGKSFVSSNLAALHATSGKRTLLIDADMRRGVHRSS---SKM-GLAE
A0A1M6SHG3      K--VIMVTGMVPGVGKSFVSKNLTALYASNGKKVLLIDADMRRGVVYSK---HRE-GLGD
A0A1M6WJF1      R--VMMVTGMIPGVGKSFVSKNIAALFAGSGKKTLLIDADMRRGVIYSH---RKQ-GLGD
A0A254RQS8      R--VMMVTGMVPGVGKSFVSKNVSALFAGSGKKTLLIDADMRRGVVYSH---HKQ-GLGD
A0A1M6Z6I9      R--VMMVTGMIPGVGKSFVSKNVSALFAGSGKKTLLIDADMRRGVVYSH---RKQ-GLGD
A0A254STU0      R--VMMVTGMIPGVGKSFVSKNVSALFAGSGKKTLLIDADMRRGVVYSH---RKQ-GLGD
A0A1M5G181      R--VMMVTGMIPGVGKSFVSKNVSALFAGSGKKTLLIDADMRRGVVYSH---RKQ-GLGD
A0A1M6VYU0      R--VMMVTGMIPGVGKSFVSKNVSALFAGSGKKTLLIDADMRRGVVYSH---RKQ-GLGD
A0A1M7DAK0      EHCVLLVMGLNPGAGKSFVSLNLAATMATSGKKVLLIDADMRRGVIHSG---SKF-GLAD
A0A254SNB3      QK-VIMICGLVPGVGKSFVSKNLAAVYAMNGKRVLLIDADMRKGVIHSS---KHV-GLTE
A0A380RVE7      QK-VIMICGLVPGVGKSFVSKNLAAVYAMNGKRVLLIDADMRKGVIHSS---KHV-GLTE
A0A1M5F234      QK-VVMTCGLVPGVGKSFVAKNLAAVYAMNGKRVLLIDADMRKGVIRSS---KYI-GLTE
A0A1M6VST0      QK-VVMTCGLMPGVGKSFVAKNLAAVYAMNGKRVLLIDADMRKGVIRSS---KYI-GLTE
A0A2C8Y654      GKKVLMVSGLIEGVGKSFVSTNLACSFAMSGKKVLLVDMDLRRGRMFKK---GHK-GLCE
A0A1M5J685      GKKVLMVSGLIEGVGKSFVSTNLACSFAMSGKKVLLVDMDLRRGRMFKK---GHK-GLCE
A0A1M7JMJ6      GKKVLMVSGLIEGVGKSFVSTNLACSFAMSGKKVLLVDMDLRRGRMFKK---GHK-GLCE
A0A254S3F1      GKKVLMVSGLVQGVGKSFVSTNLAASFAMSGKKVLLVDMDLRRGHLFKH---SQK-GLCE
A0A254SFQ7      GKKVLMVSGLVQGVGKSFVSTNLAASFAMSGKKVLLVDMDLRRGHLFKH---SQK-GLCE
A0A380S7L2      GKKVLMVSGLVQGVGKSFVSTNLAASFAMSGKKVLLVDMDLRRGHLFKH---SQK-GLCE
A0A1M7MCZ6      GKKILMVSGLVQGVGKSFVSTNLAASFAMSGKKVLLVDMDLRRGHFFKH---TQK-GLCE
A0A1X7KIP6      GKKILMVSGLVQGVGKSFVSTNLAASFAMSGKKVLLVDMDLRRGHFFKH---TQK-GLCE
A0A286A129      GKKILMVSGLVQGVGKSFVSTNLAASFAMSGKKVLLVDMDLRRGHLFKH---SQK-GLCE
C9RRK0          GKKILMVSGLVQGVGKSFVSTNLAASFAMSGKKVLLVDMDLRRGHLFKH---SQK-GLCE
A0A2M9A3A4      --KVLLVTGLSPGSGKSFISKNLAALIAMNGKKVLLIDTDFRASYMSSR---GRKRGLSD
A0A2P6UPN2      --KVLLITGCVPNCGKTFISKNLAALYAASGKKVLLLDTDFRASELSPR---GRKHGLSD
A0A1M6RBQ2      ERPVIMVAGLVAGVGKSFVSRNLAALYANFGKKVLLVDVDMRRGVVYSK---HSQ-GLAD
A0A316BGL2      DHPVIMVAGLVAGVGKSFVSRNLAALYANFGKKVLLIDVDMRRGVVYSK---NAQ-GLAD
A0A1M6IQ57      QN-VVMVCGLVPGVGKSFVSKNLSAVYAMNGKRVLLIDADMRKGVIRST---KYA-GLTD
A0A316ATY6      GHPVMMISGLIPGVGKSFVSLNLAALYAEAGKKTLLIDADMRRGVHHSG---SKM-GLAE
A0A1T4QDW5      TNNVIMVTGIDKGIGKSFISLNFAAAMANAGKKVLLIDADMRRGKLIRK---RRK-GLVE
A0A1M6VSY0      TNNVIMVTGIDKGIGKSFISLNFAAAMANAGKKVLLIDADMRRGKLIRK---RRK-GLVE
A0A2A3HHG6      TNNVIMVTGIDKGIGKSFISLNFAAAMANAGKKVLLIDADMRRGKLIRK---RRK-GLVE
C9RP30          EHQVIMVSGIMPGVGKSFISTNLAATFAMVGKKTLFIDADMRKATCR-F---TKV-GLVD
A0A1M5V3U1      EHCVILVMGLMPGVGKSFVSLNLAAVLAASGKKVLLIDADMRRGVINGR---SKF-GLAD
A0A1M7NG89      EHSVVLVMGLIPGVGKSFVSLNLAATIAASGKKVLLIDADMRRGVIHGR---SKF-GLAD
A0A2C8YXS0      EHSVVLVMGLIPGVGKSFVSLNLAATIAVSGKKVLLIDADMRRGVIHGR---SKF-GLAD
A0A254RLK0      QK-VVMVCGLVPGVGKSFVSKNLAAVYAMNGRRVLLVDADMRKGVIRSS---KYL-GLTE
A0A1M6RGU5      QK-VLMICGLMPGVGKSFVSKNLAAVYAMNGKRVLLIDADMRKGVIRSS---KYL-GLAE
A0A254SQM8      QK-VLMICGLMPGVGKSFVSKNLAAVYAMNGKRVLLIDADMRKGVIRSS---KYL-GLAE
A0A316B5S0      QK-VVMVTGMVPGVGKSFVSKNLAALYATNGKRVLLIDADMRRGVVYSK---HRQ-GLGD
A0A254RXS0      QK-VIMVTGMIPGVGKSFVSKNLAALYAAAGKKTLLIDADMRRGVVYSH---HKQ-GLGD
A0A1M6X012      QK-VIMVTGMIPGVGKSFVSKNLAALYAAAGKKTLLIDADMRRGVVYSH---HKQ-GLGD
A0A1M5TLF1      QK-VIMVTGMIPGVGKSFVSKNLAALYAAAGKKTLLIDADMRRGVVYSH---HKQ-GLGD
A0A2N3RVJ9      QK-VIMVTGMIPGVGKSFVSKNLAALYAAAGKKTLLIDADMRRGVVYSH---HKQ-GLGD
A0A1M6R2N3      GGRVLMVTGISPEAGKSFVSLNLTYLFAKQNKRVIFIDADLRKSRLSHK---HEK-GVSD
A0A1N6GS15      GGRVLMVTGISPEAGKSFVSLNLTYLFAKQNKRVIFIDADLRKSRLSHK---HEK-GVSD
A0A254SB44      GGRVLMVTGIVPGAGKSFVSLNLAYLFAKQNKRVLFVDADLRKSRLSHM---REK-GVSD
A0A1M7LKR0      GGRVLMVTGVAPGAGKSFVSLNLSYLFAKQNKRVVFVDADLRKSRLSHS---REK-GISD
A0A1X7JP42      GGRVLMVTGVAPGAGKSFVSLNLSYLFAKQNKRVVFVDADLRKSRLSHS---REK-GISD
A0A1M6UBQ0      GGKVLMVTGIAPGAGKSFVSLNLAYLFAQQGKRSIFIDADLRKSRLSHK---HEK-GITD
A0A1X7IS68      GGKVVIVTGITPGAGKSFISLNLAYLFAKQEKRVLFIDADLRKSRLSHI---REK-GVSD
                    :   .     **:: : *.:   *   .  :::* *:*              *. :

A0A3C0PHK7      LFIENPDYEHV-IRSSKKENLDVVTAGVFTPNPAELIGSNKMGQHIEYFKKNYDMVFFDT
A0A1M6RVC1      VLLREVQVEEV-IHPTEVENMFVIPCGNVPANPAELLGSRHYADLIERFKSEYDLVIVDT
A0A2N3RSN9      VLLREVQVEEV-IHPTEVENMFVIPCGNVPANPAELLGSKHYADLIERFKSEYDLVIVDT
A0A1M5IPF7      VLLREVQVEEV-IHPTEVENMFVIPCGNVPANPAELLGSRHYSDLIERFKSEYDLVIVDT
A0A254RX70      VLLREVQVEEV-IHPTEVENMFVIPCGNVPANPAELLGSRHYSDLIERFKSEYDLVIVDT
A0A1M7GQ27      ILLGEATVDEV-IHNTEVDNLFIMQCGTVPPNPSELLGSKHYASMISELEKSYDLIIVDT
A0A1X7JCK4      ILLGEATVDEV-IHNTEVDNLFIMQCGTVPPNPSELLGSKHYASMISELEKSYDLIIVDT
A0A1M7HDE6      LLMRNAELADV-IHSTEVENLFVMPCGNVPSNPSELLGSKHYTELISNLEKEYDMIIIDT
A0A2C9A7H2      LLMRNAELKDV-IHTTEVENLFVMPCGNVPSNPSELLGSKHYAELINGLEKEYDLIIIDT
A0A254SF58      ILLHTATAEEV-ISSTEVENLDIIPCGMVPSNPSELLGSKRYSELIEELKSKYDLIIVDT
A0A316ANB4      ILLGEINAQDV-TYETEVENLYVMPCGKSPTNPSEILGSKHYAELIESLEKQFDLIIVDT
A0A1J5E847      VLVGKCKLEEC-LHVTNVPNLSLLVAGKIPASPAELLGSHRYVQLLEKLKTMFDVIIVDT
A0A254RM08      VLLREVKVEDV-IHKTEVENLFVVPCGNVPANPAELLGSKHYAELIEEFKNSYDLVIVDT
A0A1M7CD42      VLLREVKAEDV-IHKTEVENLYVMPCGNVPNNPAELLGSKHYAELIEQFKKDYDLVIVDT
A0A254SZB4      VLLREVKAEDV-IHKTEVENLYVMPCGNVPNNPAELLGSKHYAELIEQFKKDYDLVIVDT
A0A1M5LBR0      VLLREVEAESV-VFPTEVENLFVIPCGNVPNNPAELLGSKHYAEVINKFKKEYDLVVIDT
A0A1M7DJN3      VLLREVEAESV-VFPTEVENLFVIPCGNVPNNPAELLGSKHYAEVINKFKKEYDLVVIDT
A0A1M6UFW9      ILLRKVEPEDV-IFPTEVENLFVIPCGNVPANPAELLGSKHYSEIINKFKQEYDLVIVDT
A0A1M6I669      YLLHETTLEDV-IHSTEVENLFVIPCGHVPSNPSEILGSKHYSDMIDELEKHYDLIIVDT
A0A1M6WDT9      VLLHEAEINDV-IHATEVENLFVMPCGNSPSNPSELLGSKHYTNLIEELEKQFDLIIVDT
A0A254RG57      VLLHNATLDEV-ICSTEVENLDIIPCGNVPSNPSELLGSKHYTSTIDELEKKYDLIIVDT
A0A254S791      VLLHTATAEEV-ISKTEVENLEIIPCGNVPSNPSELLGSKRYNDLIQELKSRYDLIIIDT
A0A285ZTW6      ILLHSATFEEV-VSKTEVENLEIIPCGMVPSNPSELLGSKRYLDLIDELKSKYDLIIIDT
A0A380S6W7      ILLHTATLEDV-ISSTEVNNLDVIQCGNVPSNPSELLGSKHYSTLIENLKNQYDLIIVDT
A0A1M6V3G7      ILLHTATPAEV-ISKTEVPNLEVMQCGNVPSNPSELLGSKHYAAMIEELKKQYDLIIIDT
A0A1N6J281      ILLHTATPAEV-IRKTEVPNLEVMQCGNVPSNPSELLGSRHYAAMIEELKQQYDLIIIDT
A0A285ZYD6      VLMGKVAFENAKISSPNLPNLDILESGKFTLSAFELLRGDMLKKLIDEIRPQYDAIIIDT
A0A1M6S079      LLSGTCELGAV-AVQSNVENMYVVSAGHSRLSPSELLRGENFTKLMDVARKQFDIIIVDT
A0A1M6WR43      VLGGLCEFGVA-VATSDIENLFVISAGHTKLSPSELLRGENFRSMLDEARKQFDVIIVDT
A0A2N3RVS2      VLGGLCEFGVA-VATSDIENLFVISAGHTKLSPSELLRGENFRSMLDEARKQFDVIIVDT
A0A1M5VRV4      VLGGLCEFGVA-VATSDIENLFVISAGHTKLSPSELLRGENFRSMLDEARKQFDVIIVDT
A0A254RLG7      VLGGLCEFGVA-VATSDIENLFVISAGHTKLSPSELLRGENFRSMLDEARKQFDVIIVDT
A0A1M6SHG3      VLSGKASLDAV-VSESLVKNMYTLGAGNSEVAPSELLRGDNFKKLLEDAKTKFDMIVVDT
A0A1M6WJF1      VLSGHCSLDSA-IADSITKNLFVLGAGKTDVSPSELLRGDTFKNLLEEAKSKYDIVIVDT
A0A254RQS8      VLSGHCSLDSA-VADSITKNLYVLGAGKTDVSPSELLRGDNFKNLLDEAKAKFDIVIVDT
A0A1M6Z6I9      VLEGKCSLDNA-VADSITKNLYVLGAGKTDVSPSELLRGETFKNLLEEAKSKFDIIIVDT
A0A254STU0      VLEGKCSLDNA-VADSITKNLYVLGAGKTDVSPSELLRGDNFKNLLDEAKSKFDIVIVDT
A0A1M5G181      VLEGKCSLDNA-VADSITKNLYVLGAGKTDVSPSELLRGETFKNLLEEAKSKFDIIIVDT
A0A1M6VYU0      VLEGKCSLDNA-VADSITKNLYVLGAGKTDVSPSELLRGETFKNLLEEAKSKFDIIIVDT
A0A1M7DAK0      VLLGLATLDTA-VVSKHDDNLFVMNAGKTKLAACELLRGDAMDKLFKEARQKFDMVIVDT
A0A254SNB3      VLSGKVDWHEA-VSDNRCQNLFVMGGGKRLMSPSELLRRDTFKNLLEEMKSEFDMILVDT
A0A380RVE7      VLSGKVDWHEA-VSDNRCQNLFVMGGGKRLMSPSELLRRDTFKNLLEEMKSEFDMILVDT
A0A1M5F234      VLSGKVEWREA-VADARCQNLFVMGCGKRLMSPSELLRHDKFKALLEDLKQEYDMIIVDT
A0A1M6VST0      VLSGKVEWHEA-VADARCENLFVMGCGKRLMSPSELLRHDKFKTLLEDLKQEYDMIIVDT
A0A2C8Y654      MLRAEKFDDEY-IEMVSE-NYHIIGSGKRVVNPGDLLNKNRFGTFLDTFRKKYDLIILDT
A0A1M5J685      MLRAEKFDDEY-IEVVSE-NYHIIGSGKRVVNPGDLLNKNRFGTFLDTFRKKYDLIILDT
A0A1M7JMJ6      MLRAEKFDDEY-IEMVSE-NYHIIGSGKRVVNPGDLLNKNRFGTFLDTFRKKYDLIILDT
A0A254S3F1      MLEEENYGDDY-VVKVMD-NFHVLGAGARVVNPGGLLTSSRFSAFLDAFRDKYDLIVLDT
A0A254SFQ7      MLEKEDYSDEY-VVKVTD-NFYVLGSGARVVNPGGLLNSSRFSAFLDAFKDKYDLIVLDT
A0A380S7L2      MLEKEDYSDEY-VVKVTD-NFYVLGSGARVVNPGGLLNSSRFSAFLDAFKDKYDLIVLDT
A0A1M7MCZ6      MLEKENYTDEY-VVKVTD-NFHVLGSGARVVNPGGLLNSSRFSAFLDSFRDKYDLIVLDT
A0A1X7KIP6      MLEKENYTDEY-VVKVTD-NFHVLGSGARVVNPGGLLNSSRFSAFLDSFRDKYDLIVLDT
A0A286A129      MLEKEDYSDEY-VVHVMD-NFYVLGSGARVVNPGGLLNSSRFSAFLDAFRDKYDLIVLDT
C9RRK0          MLEKEDYSDEY-VVKISD-NFYVLGSGARVVNPGGLLNSSRFSAFLDAFRDKYDLIVLDT
A0A2M9A3A4      YLLGQIALDEA-VEHLDGAQVDLLGAGSYSSSPSEMISSKAFENLLNEMKSKYDLIIVDS
A0A2P6UPN2      YLLNKISLDEA-IDHLEKLGFDLIGAGSYTSSPTEMLASSAFGDLISQMRNRYDLIILDS
A0A1M6RBQ2      ILSGKMSFDEC-LSKTDVDNMWVIGAGKPEQAPTDLLHGETFADMLRYAKQNFDVIVLDT
A0A316BGL2      ILSGKRSFDEC-LSKTDVEGMWVIGSGKPLQAPTDLLHGETFAELLKFAKQNFDVIVLDT
A0A1M6IQ57      VLAGKVDWHDV-VADCPCKGLFILGRGSVVMAPSELLRHDDFKKLLDEAKKEYDMVIVDT
A0A316ATY6      LLGGTCELAAVAKPSPEAENLFIVSSGHSRLSPSELLRGDNFKNLMDEARKQFEVVIVDT
A0A1T4QDW5      VLLGKESLDSMVTLYDNVENLYVLSTGILNVTASELLRGQAFANLVAEAREKYDVVLIDT
A0A1M6VSY0      VLLGKESLDSMVTLYDNVENLYVLSTGILNVTASELLRGQAFANLVAEAREKYDVVLIDT
A0A2A3HHG6      VLLGKESLDSMVTLYDNVENLYVLSTGILNVTASELLRGQAFANLVAEAREKYDVVLIDT
C9RP30          VLMGKVAFDNAKITSPNLPNLDILESGKFTLSAFELLRGDMLKKLIDEIRPQYDAIIIDT
A0A1M5V3U1      VLAGIATLDTA-VSQKHTDNLFVMNAGKTKLAACELLRGDAMDNLLKEARRKYDLVIVDT
A0A1M7NG89      VLAGIATLDTA-VSQKHVDNLCVMNAGKTKLAACELLRGDAMDKLLKEAREKFDMVIVDT
A0A2C8YXS0      VLAGIATLDTA-VSQKHDDNLYVMNAGKTKLAACELLRGEAMDKLLKEARERFDMIIVDT
A0A254RLK0      VLSGKIPWRET-VAESRCQNLFVMGCGKRLMSPSELLRHDLFKNLLEEMKSEYDMILVDT
A0A1M6RGU5      VLSGKIPWRET-VAESRCQNLFVMGCGKRLMSPSELLRHDLFKTLLEEMKSEYDMILVDT
A0A254SQM8      VLSGKIPWRET-VAESRCQNLFVMGCGKRLMSPSELLRHDLFKTLLEEMKSEYDMILVDT
A0A316B5S0      VLSGKVPLDNV-ISETLVKNMFALGAGNSEVAPSELLRGENFKRLLEDAKSQFDMIVVDT
A0A254RXS0      VLSGRCTLESA-VADSITKNLFVIGAGITDVSPSELLRGTKFKELLDSASETYDTIIVDT
A0A1M6X012      VLSGRCTLESA-VADSITKNLFVIGAGITDVSPSELLRGTKFKELLDSASETYDTIIVDT
A0A1M5TLF1      VLSGRCTLESA-VADSITKNLFVIGAGITDVSPSELLRGTKFKELLDSASETYDTIIVDT
A0A2N3RVJ9      VLSGRCTLESA-VADSITKNLFVIGAGITDVSPSELLRGTKFKELLDSASETYDTIIVDT
A0A1M6R2N3      VIAKSATLDS--VVVDMGEGAYFLPKGSRVANPGEMLASKAFAELVQECREKYDIVVIDT
A0A1N6GS15      VIAKTATLDS--VVVDMGEGAYFLPKGSRVANPGEMLASKSFAELVQECREKYDIVVIDT
A0A254SB44      ILINNGKLED--LVVDMGEGFFFLPKGSRAPNPGEMVSSRAFAELIDECKSKYDVVVIDT
A0A1M7LKR0      ILINNSKLED--CVIDMGEGMYFLPKGSRAPNPGEMVSSKAFADLIDECKAKYDVVVIDT
A0A1X7JP42      ILINNSKLED--CVIDMGEGMYFLPKGSRAPNPGEMVSSKAFADLIDECKAKYDVVVIDT
A0A1M6UBQ0      VIAKGCDLEK--ALIDIGDGAYFLPMGSRVANPGEMLGSKAFAELVQECKSKFDVVIIDT
A0A1X7IS68      IISKVCHLED--VIINLGEGADFLPNGTHTQNPAEMLSSKAFAELIHECREKYDVVIIDT
                 :                     :  *     .  ::        .      :: :..*:

A0A3C0PHK7      PPIVAVTDATLLGKKVDGVLLVVKSHHSDREFVSRALATFTNVGIK--VWGVILNDIDLT
A0A1M6RVC1      PPIMLVTDAALACRLAAQIVMVIEYNRHSIEAIQEGMSQILKGNSTA-HASIVINKYEHS
A0A2N3RSN9      PPIMLVTDAALACRLAAQIVMVIEYNRHSIEAIQEGMSQILKGNSTA-HASIVINKYEHS
A0A1M5IPF7      PPIMLVTDAALACRLAAQIVMVIEYNRHSIEAIQEGMGQILKGNSTA-HASIVINKYEHS
A0A254RX70      PPIMLVTDAALACRLAAQIVMVIEYNRHSIEAIQEGMSQILKGNSTA-HASIVINKYEHS
A0A1M7GQ27      PPIMLVTDAALACRVVSQIVMVIEYNKHSIDAIKDGMTQLLKGNSNA-HASFVINKYEHG
A0A1X7JCK4      PPIMLVTDAALACRVVSQIVMVIEYNKHSIDAIKDGMTQLLKGNSNA-HASFVINKYEHG
A0A1M7HDE6      PPIMLVTDATLACRYASQLVMVIEYNKHSIDAIKDGMAQLLKGNGDA-HASIVINKYEHS
A0A2C9A7H2      PPIMLVTDAALACRIASQIVMVIEYNKHSIDAIKDGMAQLLKGNTDA-HASIVVNKYEHS
A0A254SF58      PPIMLVTDAALACRVAAQIVMVIEYNKHSIEAIQDGMKQLLKGNTSA-HASFVINKYEHG
A0A316ANB4      PPIMLVTDAALACRFASQVVMVIEYNKHSINAIKDGMAHLLKGNNSA-HASFVINKYEHS
A0A1J5E847      PPVMLVTDAMLVCRHSDQAILVVEYNRHSIDAIREGLALFTKGASESVHKSIVINKYVHS
A0A254RM08      PPIMLVTDAALACRVAAQIVMVIEYNKHSIEAIKDGMAQILKG-NSSAHASIVINKYEHS
A0A1M7CD42      PPIMLVTDAALACRVAAQIVMVIEYNKHSIEAIKDGMAQILKG-NSSAHASIVINKYEHS
A0A254SZB4      PPIMLVTDAALACRVAAQIVMVIEYNKHSIEAIKDGMAQILKG-NSSAHASIVINKYEHS
A0A1M5LBR0      PPIMLVTDAALACHVASQIVMVIEYNKHSIDAIKDGMAQILKG-NSSAHASIVINKYEHS
A0A1M7DJN3      PPIMLVTDAALACHVASQIVMVIEYNKHSIDAIKDGMAQILKG-NSSAHASIVINKYEHS
A0A1M6UFW9      PPIMLVTDAALACHVADQIVMVIEFNKHSIEAIKDGMSQILKG-NPQAHASIVINKYEHS
A0A1M6I669      PPIMLVTDAALACRQASQIVMVIEYNKHSIEAIQDGMAQLLKG-NTNAHASFVINKYQHS
A0A1M6WDT9      PPIMLVTDASLACKVASQIVMVIEYNKHSIDAIQDGMKQLLKG-SPDAHASFVINKYEHS
A0A254RG57      PPIMLVTDAALACRVASQIVMVIEYNKHSIDAIKDGMKQLLKG-NNDVHASFVINKYEHS
A0A254S791      PPIMLVTDAALACRVAAQIVMVIEYNKHSIDAIQDGMKQLLKG-NNTAHASFVINKYEHG
A0A285ZTW6      PPIMLVTDAALACRVAAQIVMVIEYNKHSIDAIQDGMKQLLKG-NNTAHASFVINKYEHG
A0A380S6W7      PPIMLVTDAAQACRVASQIVMVIEYNRHSIEAIKDGMKQLLKG-NEEAHASFVINKYEHG
A0A1M6V3G7      PPIMLVTDAALACRVVSEIVMVIEYNRHSIDAIKDGMKQLLKG-NNDVHASLVINKYEHG
A0A1N6J281      PPIMLVTDAALACRVVSEIVMVIEYNRHSIDAIKDGMKQLLKG-NNDVHASLVINKYEHG
A0A285ZYD6      PPTNLVTDAYMICPLIDFALVVLHYGRHSMDSIKESLHTLERYCD-K-PKAFVLNHCEHR
A0A1M6S079      PPMSMVTDAELIYPVVDFSLFVLHYGKHNMNEIKESVAKMNRFGD-K-PKAFVMNHCERE
A0A1M6WR43      PPMSMVTDAELIYPAADFSLFVLHYGKHSMDEISEAMTKMKRFGE-K-PKAFVMNHCERE
A0A2N3RVS2      PPMSMVTDAELIYPAADFSLFVLHYGKHSMDEISEAMTKMKRFGE-K-PKAFVMNHCERE
A0A1M5VRV4      PPMSMVTDAELIYPAADFSLFVLHYGKHSMDEISEAMTKMNRFGE-K-PKAFVMNHCERE
A0A254RLG7      PPMSMVTDAELIYPAADFSLFVLHYGKHSMDEISEAMTKMNRFGE-K-PKAFVMNHCERE
A0A1M6SHG3      PPLNLVTDSELIYPVVDFALFVLHYGRHSMDQIKESMIKVDRCGD-K-PHAFVMNHVEHD
A0A1M6WJF1      PPLELVTDSELIYPIVDFALFVLHYGKHSMDQIKESMMKLDRCCEGK-SRAFVMNHCEHE
A0A254RQS8      PPLELVTDSELIYPIVDFALFVLHYGKHTMDQIKESMMKLDRCCEGK-PRAFVMNHCESD
A0A1M6Z6I9      PPLELVTDSELIYPIVDFALFVLHYGKHSMDQIKESMMKLDRCCEGK-PRAFVMNHCESD
A0A254STU0      PPLELVTDSELIYPIVDFALFVLHYGKHSMDQIKESMMKLDRCCEGK-PRAFVMNHCESD
A0A1M5G181      PPLELVTDSELIYPIVDFALFVLHYGKHSMDQIKESMMKLDRCCEGK-PRAFVMNHCESD
A0A1M6VYU0      PPLELVTDSELIYPIVDFALSVLHYGKHTMDQIKESMMKLDRCCEGK-ARAFVMNHCESD
A0A1M7DAK0      PPLNLVTDAELICPLVDYSLFVLHYGRHSIEEIKETIDRVKRYSD-K-PAAIVMNHCEQE
A0A254SNB3      PPVSMVTDAELIFPLVDFTLMVVHYGTDSLAQVKESLANLRRYAD-K-PCAFVMNHCEYE
A0A380RVE7      PPVSMVTDAELIFPLVDFTLMVVHYGTDSLAQVKESLANLRRYAD-K-PCAFVMNHCEYE
A0A1M5F234      PPVSMVTDAELIYPLVDFTLMVVHYGVDSLEQIKENLANLRRYAD-K-PCAFVLNHCEYE
A0A1M6VST0      PPVSMVTDAELIYPLVDFTLMVVHYGADSLEQIKENLANLRRYAD-K-PCAFVLNHCEYE
A0A2C8Y654      PPIFQCSDALLVEKYADYLLCVLKQSAQSMDNIQEALSTFDRSTETPLPKAFVFNKCE--
A0A1M5J685      PPVFQCSDALLVEKYADYLLCVLKQSAHSMDNIQEALSTFDRSTETPLPKAFVFNKCE--
A0A1M7JMJ6      PPVFQCSDALLVEKYADYLLCVLKQSAHSMDNIQEALSTFDRSTETPLPKAFVFNKCE--
A0A254S3F1      PPVFQCSDALLVEKHADYLLCVLKHAAHTIESIQDALNTFDRSTETPLQKAFVFNKCE--
A0A254SFQ7      PPVFQCSDALLVEKHADYLLCVLKHAAHTIESIQDALNTFDRSTETPLQKAFVFNKCE--
A0A380S7L2      PPVFQCSDALLVEKHADYLLCVLKHAAHTIESIQDALNTFDRSTETPLQKAFVFNKCE--
A0A1M7MCZ6      PPVFQCSDALLVEKHADYLLCVLKHAAHTIESIQDALNTFDRSTETPLPKAFVFNKCE--
A0A1X7KIP6      PPVFQCSDALLVEKHADYLLCVLKHAAHTIESIQDALNTFDRSTETPLPKAFVFNKCE--
A0A286A129      PPVFQCSDALLVEKHADYLLCVLKHAAHTIESIQDALNTFDRSTETPLQKAFVFNKCE--
C9RRK0          PPVFQCSDALLVEKHADYLLCVLKHAAHTIESIQDALNTFDRSTETPLQKAFVFNKCE--
A0A2M9A3A4      APVLAVADALVASRYADFVLLVIHYGHDSMEALREGLGQFEKANVE--HKAMVFNRCVYE
A0A2P6UPN2      APILSVADALTTSRYADFVLVAVRYAKDSLEGVEEALSLLDKAEVK--NRALVINRILSD
A0A1M6RBQ2      PPINLVADTELVLPLVDFSLFVLHYGRHTMDEIDEAVTKVNRLSES--PKAFVMNHCDRF
A0A316BGL2      PPINLVADTELVLPLVDFSLYVLHYGRHTMDEIDEAVNKIERLSEA--PRAFVMNHCDRD
A0A1M6IQ57      PPLSLVTDSELIYPHVDFLLMVLHYGIHSMEQIKESINGLKRFADK--PGAFVMNHCEHE
A0A316ATY6      PPMSMVTDAELIYPVVDMSLFVLHYGKHSMNEIKESVNKINRFGDK--PKAFVMNHCERE
A0A1T4QDW5      PPVALATDAELMANLATLVLFVIKYNTHSMEEIQEVLKRLKRYTSG--QLALVMNSCMRE
A0A1M6VSY0      PPVALATDAELMANLASLVLFVIKYNTHSMEEIQEMLKRLKRYLNG--QIALVMNSCMRE
A0A2A3HHG6      PPVALATDAELMANLASLVLFVIKYNTHSMEEIQEMLKRLKRYLNG--QIALVMNSCMRE
C9RP30          PPTNLVTDAYMICPLIDFALVVLHYGRHSMDSIKESLHTLERYCDK--PKAFVLNHCEHR
A0A1M5V3U1      PPLNLVTDAELICPLVDYSLFVLHYGRHSIEEIKETIERVRRYSDK--PSAIVMNHCEHE
A0A1M7NG89      PPLNLVTDAELICPLVDYSLFVLHYGRHSMEEIKETVERVKRYSDK--PAAIVMNHCERE
A0A2C8YXS0      PPLNLVTDAELICPLVDYSLFVLHYGRHSMEEIKETVERVKRYSDK--PAAIVMNHCERE
A0A254RLK0      PPVSMVTDAELIFPLVDFALMVVHYGTDSLAQIKENLANLRRYADK--PCAFVMNHCEYE
A0A1M6RGU5      PPVSMVTDAELIFPLVDFALMVVHYGTDSVAQIKENLANLRRYADK--PCAFVMNHCEYE
A0A254SQM8      PPVSMVTDAELIFPLVDFALMVVHYGTDSVAQIKENLANLRRYADK--PCAFVMNHCEYE
A0A316B5S0      PPLNLVTDSELIYPVVDFALFVLHYGRHSMEQIKESMIKVERCGDK--PHAFVMNHVEHD
A0A254RXS0      PPLNLVTDSELIFPVVDFALFVLHYGRHSMEQIKEAMIKIERCGNK--PHALVMNHCESD
A0A1M6X012      PPLNLVTDSELIFPVVDFALFVLHYGRHSMEQIKEAMIKIERCGNK--PHALVMNHCESD
A0A1M5TLF1      PPLNLVTDSELIFPVVDFALFVLHYGRHSMEQIKEAMIKIERCGNK--PHALVMNHCESD
A0A2N3RVJ9      PPLNLVTDSELIFPVVDFALFVLHYGRHSMEQIKEAMIKIERCGNK--PHALVMNHCESD
A0A1M6R2N3      PPCSLVSDAQAIAKLADFGLIVVEYKKHSMENIQEIIDQLSMAKLE--KKAIVLNKCVHD
A0A1N6GS15      PPCSLVSDAQAIAKLADFGLIVVEYKKHSMENIQEIIDQLSMAKLE--KKAIVLNKCVHD
A0A254SB44      PPNSLVSDAQSIAKLADFGLIVIEYKKHSMDEIQDVIDQLSIAKLD--KKAIVLNQCLQD
A0A1M7LKR0      PPNSLVSDAQAIAKLVDFGLVVIEYKKHSLEVIQETIDQLNIAKLK--KVAIALNQCVND
A0A1X7JP42      PPNSLVSDAQAVAKLVDFGLVVIEYKKHSLEVIQETIDQLNIAKLK--KVAIALNQCVND
A0A1M6UBQ0      PPIALVSDALAIAKLADFGLIVIEYKKHSMENIQETIEQLNIAKLD--KKAIVLNHCIHD
A0A1X7IS68      PPTSLVSDAQAIAKLADFGLLVIEYKKHTMESIQEAIDLISSSKLE--KKAIVLNQCVQD
                .*    :*:          : .:         :   :  .          .. .*     

A0A3C0PHK7      ------HRYSSYGYYKYYYHYYKSKKD----
A0A1M6RVC1      RTEGYGYKYGKY-------------------
A0A2N3RSN9      RTEGYGYKYGKY-------------------
A0A1M5IPF7      RTEGYGYKYGKY-------------------
A0A254RX70      RTEGYGYKYGKY-------------------
A0A1M7GQ27      HSDGYGYKYGKY-------------------
A0A1X7JCK4      HSDGYGYKYGKY-------------------
A0A1M7HDE6      HSDGYGYKYGKY-------------------
A0A2C9A7H2      HSDGYGYKYGKY-------------------
A0A254SF58      HNDGYGYKYGKY-------------------
A0A316ANB4      HADGYGYKYGKY-------------------
A0A1J5E847      KVDGYGYKYGKY-------------------
A0A254RM08      RTEGYGYKYGKY-------------------
A0A1M7CD42      RTEGYGYKYGKY-------------------
A0A254SZB4      RTEGYGYKYGKY-------------------
A0A1M5LBR0      RTEGYGYKYGKY-------------------
A0A1M7DJN3      RTEGYGYKYGKY-------------------
A0A1M6UFW9      RTEGYGYKYGKY-------------------
A0A1M6I669      HSDGFGYKYGKY-------------------
A0A1M6WDT9      HSDGYGYKYGKY-------------------
A0A254RG57      HSDGYGYKYGKY-------------------
A0A254S791      HNDGYGYKYGKY-------------------
A0A285ZTW6      HSDGYGYKYGKY-------------------
A0A380S6W7      HNDGYGYKYGKY-------------------
A0A1M6V3G7      HSDGYGYKYGKY-------------------
A0A1N6J281      HSDGYGYKYGKY-------------------
A0A285ZYD6      --HGYGYGYGYGYGYG--YGYYGSKSKKHKN
A0A1M6S079      A-GRYGYGYG----YGY-YGYYSKNK-----
A0A1M6WR43      T-GRYGYGYG----YGY-YGYYSKKK-----
A0A2N3RVS2      T-GRYGYGYG----YGY-YGYYSKKK-----
A0A1M5VRV4      T-GRYGYGYG----YGY-YGYYSKKK-----
A0A254RLG7      T-GRYGYGYG----YGY-YGYYSKKK-----
A0A1M6SHG3      G-RGYGYGYGGHG-YGK-YGYYSNKKKKK--
A0A1M6WJF1      ---GHGYGYGGYGYYGK-YGYYNKDKKKKS-
A0A254RQS8      ---GHGYGYGGYGYYGK-YSYYGKDKKKK--
A0A1M6Z6I9      ---GHGYGYGSYG-YGK-YSYYGKDKKKK--
A0A254STU0      ---GHGYGYGSYG-YGK-YSYYGKDKKKK--
A0A1M5G181      ---GHGYGYGSYG-YGK-YSYYGKDKKRK--
A0A1M6VYU0      ---GHGYGYGSYG-YGK-YGYYGKDKKKK--
A0A1M7DAK0      --PGR-YGYGYYG-----KGYKSK-------
A0A254SNB3      --PGHYYGYGYYG-----GGYYGKGYYSK--
A0A380RVE7      --PGHYYGYGYYG-----GGYYGKGYYSK--
A0A1M5F234      --PGHYYGYGYYG-----KGYYGKGYFSKS-
A0A1M6VST0      --PGHYYGYGYYG-----KGYYGKGYFSKS-
A0A2C8Y654      --RHSGYGYGGY--YGY-YGY-KKY------
A0A1M5J685      --RHSGYGYGGY--YGY-YGY-KKY------
A0A1M7JMJ6      --RHSGYGYGGY--YGY-YGY-KKY------
A0A254S3F1      --RHAGSGYGS---YGY-YGYHKKY------
A0A254SFQ7      --RHAGYGYGS---YGY-YGYHKKY------
A0A380S7L2      --RHAGYGYGS---YGY-YGYHKKY------
A0A1M7MCZ6      --RHAGYGYGS---YGY-YGYHKKY------
A0A1X7KIP6      --RHAGYGYGS---YGY-YGYHKKY------
A0A286A129      --RHAGYGYGS---YGY-YGYHKKY------
C9RRK0          --RHAGYGYGS---YGY-YGYHKKY------
A0A2M9A3A4      G-GHSSYGYG----YGYGYGYGKNKKKKKS-
A0A2P6UPN2      EISHYGYGYG----YGYGYGYKKKYGHKKS-
A0A1M6RBQ2      M-SSHYYYNGYSS-YGFKKK-----------
A0A316BGL2      L-GSRYYYNGY-G-YGFKKK-----------
A0A1M6IQ57      P-GHYGYGYGYYG-KKYYGSK----------
A0A316ATY6      A-GK--YGYGYGY--GYYGYYSKNK------
A0A1T4QDW5      R-G---YGYGYYG--GYGGGYSRYEKY----
A0A1M6VSY0      R-G---YGYGYYG--GYGGGYSRYEKY----
A0A2A3HHG6      R-G---YGYGYYG--GYGGGYSRYEKY----
C9RP30          H-GY-GYGYGY----GYYGSKSKKHKN----
A0A1M5V3U1      P-GRYGYGYGYYG-KGYYGK-----------
A0A1M7NG89      P-GH--YGYGYYD-KGYYGKKS---------
A0A2C8YXS0      P-GR--YGYGYYD-KGYYGKKS---------
A0A254RLK0      P-GH-YNGYGYYG-KGYYGK-GYFSKS----
A0A1M6RGU5      P-GH-YYGYGYYG-KGYYGK-GYFSKS----
A0A254SQM8      P-GH-YYGYGYYG-KGYYGK-GYFSKS----
A0A316B5S0      --GR-GYGYGYGG-YG-YGKYGYYSNRKKKK
A0A254RXS0      --GH-GYGH-YGS-YGSYGSYGSYKKKKKR-
A0A1M6X012      --GH-GYGH-YGS-YGSYGSYGSYKKKKKR-
A0A1M5TLF1      --GH-GYGH-YGS-YGSYGSYGSYKKKKKR-
A0A2N3RVJ9      --GH-GYGH-YGS-YGSYGSYGSYKKKKKR-
A0A1M6R2N3      G-SSYGYGYGY-G-YGYGYGYRYRYGEKKK-
A0A1N6GS15      G-SSYGYGYGY-G-YGYGYGYRYRYGEKKK-
A0A254SB44      ------------G-LGYGYDYRYRYDEIKKS
A0A1M7LKR0      G-SS--YGYGY-G-YGYGYGYRYRYGDKKKS
A0A1X7JP42      G-SS--YGYGY-G-YGYGYGYRYRYGDKKKS
A0A1M6UBQ0      S-GA--YGYGY-G-YGYGYRYRYRDK-----
A0A1X7IS68      D-SS--YGYGY-G-YGYGYGYKNRYRSDEKK
                                               

© 1998-2020Legal notice