BYKdb

Dataset for cluster tadcd of phylum chlorobi

[Download (right click)] [Edit] [Sequences] [Repertoires]

30 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A136PFK4      MPCSGGWRLRTVVEQARTLRPRSNPRFPFSPILLPGYIALGAFFRMASNNNYPYGRDGAN
A0A6H9I6C6      ------------------------------------------------------------
A0A533TY12      ------------------------------------------------------------
B3QVI2          ------------------------------------------------------------
B3QXQ6          ------------------------------------------------------------
A0A081SFU7      ------------------------------------------------------------
A0A395LXF8      ------------------------------------------------------------
A0A533TG10      ------------------------------------------------------------
A0A7C5W8E5      ------------------------------------------------------------
B3EF76          ------------------------------------------------------------
A0A4R0QIM7      ------------------------------------------------------------
A0A222SG44      ------------------------------------------------------------
A0A5M8I9A7      ------------------------------------------------------------
A0A5C4S1T9      ------------------------------------------------------------
A0A317T3L6      ------------------------------------------------------------
A0A422HIT8      ------------------------------------------------------------
A0A4R0QI83      ------------------------------------------------------------
A0A1B1Q171      ------------------------------------------------------------
A0A1W6HT77      ------------------------------------------------------------
B3EME9          ------------------------------------------------------------
A0A369RAQ9      ------------------------------------------------------------
B4S3Z6          ------------------------------------------------------------
A0A4Q1D2F1      ------------------------------------------------------------
A0A1D8D4L1      ------------------------------------------------------------
A0A5C4S4Y6      ------------------------------------------------------------
B4SD09          ------------------------------------------------------------
A0A4R0QJ17      ------------------------------------------------------------
A4SF30          ------------------------------------------------------------
A0A533TZM3      ------------------------------------------------------------
A1BJQ6          ------------------------------------------------------------
                                                                            

A0A136PFK4      GSQLPSRSQQFSPARPQPYNTDMVRLQRTLRDVDEKKNR------LQWLDYVGLLWRGKW
A0A6H9I6C6      --------------------------MVKKSRDKDKHNI------DILKEFIGIIRVDWI
A0A533TY12      -----------------------------MQQDFAFSTK------INYRQLFRVLWNFKY
B3QVI2          ----MSKDFLNGNQAVATNSGSNYPVFQRESDFLELEDD------FDFKRIFSLLLRYKW
B3QXQ6          ------MSSFNGN----MKDGSYYS--KSKTMPFQVEEEDISVLIFNYLRALS---RGKW
A0A081SFU7      -----MENSKENGYAANGGASKFYRQLQQAQLEQEEDFG------VVFYNYLRALLKGKW
A0A395LXF8      -----MQNIKANGYRAGGEVPMPDHRTLRQALQEDDDNA------DLYYRYLRALLRGKW
A0A533TG10      ------------------------------------MKE------IDIRELFNVLNRRKY
A0A7C5W8E5      MPTTPRARQAA---------------SRNGSAPLSLQRH------FTLVDYLHLIWQGKW
B3EF76          -----------------------------MPEQNNFEQE------INIQELLRLLWGRKY
A0A4R0QIM7      ----------------------------MHNDSRPLQKE------INISEILGILWQRRG
A0A222SG44      -----------------------------MLEMKDAGSQ------LNVQELLRLAWKNRY
A0A5M8I9A7      ---------MP---------------QLHNESPAPFEQE------INIQELLQVLWAKKR
A0A5C4S1T9      ----------------------------MSQQQDQFEQE------IDIKDLLFTLWHNRL
A0A317T3L6      ----------------------------MADNENQIEQE------INIQELLQILWKNRV
A0A422HIT8      -------MQDP---------------TPQSQQGNQFEQE------INIQELLQVLWKNKL
A0A4R0QI83      MSQPSLSQSKP---------------SITQAAAGHFEPQ------VSVQELLQLFWVKKR
A0A1B1Q171      -------MTPD---------------HN-----NQFEQE------IDIKELLFTLWHNRL
A0A1W6HT77      -------MQDP---------------TPHSQSGNQFEQE------INIQELLQVLWKNKL
B3EME9          -------MPNN---------------DP-----NQFEQE------INIQELLQVLWQNRL
A0A369RAQ9      -------MTNN---------------DP-----NQFEQE------INIQELLQVLWNNKL
B4S3Z6          -------MTNN---------------DP-----NQFEQE------INIQELLQVLWNNKL
A0A4Q1D2F1      MILGTYTFMEYSNQQY----------PAGSQVRSEEEKE------ITIAEILQVIARRKI
A0A1D8D4L1      --------MDYKSHQA----------VTGNQVQVQDDKE------ITLAEIFQIIARRKI
A0A5C4S4Y6      --------MDYKNQQA----------VVGNQVQNQDDKE------ITLAEIFQIVARRKI
B4SD09          ------MMVEKETTL-----------STQSNNEQTQGSE------ISLGEILKIILRRKY
A0A4R0QJ17      ------MPVKHHDRLL----------FPFRAGRVGRKKE------LTAEELFRIIRRRGP
A4SF30          --------MKNESRLLGSGNNDGSRHTEYAAHHSAARRE------ITVDELFRIIRRRRF
A0A533TZM3      -------MAELLPPAL----------QREEYERPPSERE------ISIQEIIKIILRRKW
A1BJQ6          ------MKVEQQTPIK----------QQEEIER--GERE------ISLEEIFKIVLRRKY
                                                                   .        

A0A136PFK4      IILACLLVMGSLAAWYTYSLPFIYESSLQILVNEKDQ------SIDLLNNRNYWSNTD--
A0A6H9I6C6      YVLLIFLGVLLTTVFYVLNARNIYESTTVIKITKPQGSILTSSPIPEFQDFGFLSDRY--
A0A533TY12      FIAVVFFVTLFDAYLKTISTPPSYRATSTVVIAFPEK---------KYLDFGNEGNDYNS
B3QVI2          LILSSVIFSTLISALAIYFSLPIYKSEGTMLVQESSGKLGRGAGSDLSNLLASTYGVGMG
B3QXQ6          VILITFVATVLISVIYSFRQKDIYEGITSVLVRDNTRQ----------SSVIVNFSVTDR
A0A081SFU7      VILFLFLVSTTIGILVSRSQKNIYEGVTSVLVKNTKS------SASVVVSLDLQER--ES
A0A395LXF8      IILILFLTSVLVGYLINVSQPDIYEGVTTALVNNTRS------NASVIISLDVMQQRGES
A0A533TG10      GIIFFLIISVALAWLFHKAEEPAYYAESIMLIDNPFGN---NPVDAALGTTGESDAKA--
A0A7C5W8E5      WIIGITGAILAAAFYYTWTRPFIYEASARLLVNTSRP-----PTGIVLVGLGGQDERT--
B3EF76          LILAVTAASLALALLFRYSATPEFRSTAVVMIKDSNG-----SEGDVLAPMLAVMPSSFI
A0A4R0QIM7      LMGSVMAVALLLALLAHFSATPEYRPSSIVLIKTDKSS---ATAEKFLDPFGSLAGVS--
A0A222SG44      VIGLITGLALVIALFIYLSARPVYSATATIMLKSSQKE---ELVGE-LSGSERVGEMQ--
A0A5M8I9A7      LITVVLVAVMSAVLIFHFSSTPEYRYPAMVLIKKSQNK---AMSG--IDPFGSLVSDG--
A0A5C4S1T9      IIAAVSLLVMVLVLFYHFSAVPEYRSSSLVLIKESKS-----SPAELINPFESMTGFQ--
A0A317T3L6      LIGVVTGLALVLVLLYHFSATPEYRSTSVVLIKTDKG-----GVGEMINPFESMTGFE--
A0A422HIT8      IIGAVTGLVVVLVLLYHFSATPEYRSTSVVLIKSDKGA---AAMGEMINPFESMTGFE--
A0A4R0QI83      LIGLVILLVMLGGVLFHFSQTPEYRYPAMVLIKKSGD----DKIGG-INPYISLSG-S--
A0A1B1Q171      VIGAVTVAALLIVFLMYLGSTPEYRSTSMVLIKSSKS----S-PAELMTPFESMTGSQ--
A0A1W6HT77      IIAAVTGIVVFMVLIYHFSATPEYRSTSIVLIKNDKG----VVTGEMINPFESLTGFE--
B3EME9          IIGAVTGVVLVLVMLYHFSATPEYRSTSVVLIKSDKG----G-MSEMINPFESMTGFE--
A0A369RAQ9      IIGAVTGLVVLLVLLYHFSATPEYRSTSMVLIKQDKG----GAMGEMINPFGSLTGFD--
B4S3Z6          IIGAVTGLVVMLVLLYHFSATPEYRSTSMVLIKQDKG----GAMGEMINPFGSLTGFD--
A0A4Q1D2F1      GIGIIIFFSVLISLMAYFSQTPEYRATSVLMINQQQG------TDDLVQAVLGGAGAADS
A0A1D8D4L1      GIGIIVSLSLLVSILFYYSQTPEYRAVSVLMINQKND------SQGLVEAVLGGGPAADS
A0A5C4S4Y6      GIGIIVLLSLLTSILFYYSQTPEYRAVSVLMINKEND------SQQLVEAVLGGGPAADS
B4SD09          GILLILIASLVMAWIYNKAQTPEYHAVSVMMINENKA------PGDLLATLLGPSAGVDT
A0A4R0QJ17      GMIMIMAGALLLAVIFYFLKTPEYHAVSVVMIKDDKR------SSDLLQAILGPEASVDI
A4SF30          GILVLMGASLVLTMLVYVLQKPEYHAVSVVMIKDDKR------PSDLLQAVLGPDASVDM
A0A533TZM3      GILAILSAAFFLTLFFHSIQTPEYRADSILMINNTDN------KGDLMEAIMGPNAVVDE
A1BJQ6          GIILVMALSLFAAIFYHYTETPEYHAVAVMMINDNKE------PTDLLATVLGSGAAVDN
                 :                     :       :                            

A0A136PFK4      RELKKELQILTSRPIYEKAAQRLLTL---RYTDTIRRKTVLPMLVAVEAKLG--------
A0A6H9I6C6      --ISNEIEVLKSFSIRSLTAKTLLDS-----------AEANGNISSFYHLLN--------
A0A533TY12      NRLTNEIQIIQSRSLAEEVIKTLSVN---AKNNTLELFGKRRYRTTLEKLLH--------
B3QVI2          STIANELFVLQSR----KMSYKLAKV---LLQERWQKGGELYPLLWEKYPDD--------
B3QXQ6          RNLANEIEILKSRTLAEQVAYKLLQI---IYRDPIRKTDTLDII---KGAGS--------
A0A081SFU7      --YADEIEILKSRTVAEEVAYKLLQI---VFKDETTKKDTLDLIREEDGKIS--------
A0A395LXF8      --NVDDIEILKSRTVSEEVAYKLLQW---VYKNPSEKKDTLSIILTADGKIA--------
A0A533TG10      --VKKDVELLTSMPITQLAVRELLKT---TKRDSLEFFGKRQYRSSFDDLIT--LVSPFS
A0A7C5W8E5      --LRNELMQMNAHETMQAVAEALWRKVRSGTQLPLADFSKGKKAPPLRTWED--------
B3EF76          DPMKNDIELMSSLPIAEKAVEQLYRS---PMRDSLELFGKRRYISPIDRLLAFAGLQGFS
A0A4R0QIM7      --IENDIELLKSFPLAEAAIRSLYYS---NDRKPLELFAEREFVPKAFMPFR---WMKRS
A0A222SG44      --VQNHLQLLASVPLAEEVIRSLVAG---GAQDSLELFGNRPYKTKIQGFLDGMFGVSEP
A0A5M8I9A7      --LGNDIELIKSQPLAEDVVRKLYEE---PGRQKLELFGEKVFKSPIADLFS---WLPGR
A0A5C4S1T9      --LQNDIELIKSFPLAEDVVRTLYAD---TERDSLEIFGERTYVSPVGVMFGFLDGFSLL
A0A317T3L6      --LQNDIELIKSFPLAEEVVRDLAAR---KDRDSLQLFGERRYVSPIGALFS---GLQFG
A0A422HIT8      --LQNDIELIKSFPLAEEVVRDLFRK---TDRDSLQLFGERRYVSPLQGLFG---GLSFG
A0A4R0QI83      --LGNDIVLMQSAPLAEEVVRDLYDE---PGRQKLELFGERPYTAPLADFFG---IKSE-
A0A1B1Q171      --LQNDIELIKSFPLAEEVVRSLYRQ---TERDSLELFRERRYISPLARFFG------AG
A0A1W6HT77      --LQNDIELIKSFPLAEEVVRDLYQQ---QDRDSLQLFGERRYVSPLKDLFG---GLSFG
B3EME9          --LQNDIELVKSFPLAEEVVRELYAR---KDRDSLQLFGERRYISPIGHLFS---WMRF-
A0A369RAQ9      --LQNDIELVKSFPLAEEVVRNLYTK---KDRDTLQIFGERNYVSPIGGLFG---WLSFG
B4S3Z6          --LQNDIELVKSFPLAEEVVRNLYTK---KDRDTLQLFGERNYVSPIGGLFG---WLSFG
A0A4Q1D2F1      KMAQKDVELLQSLPIAEMTVRALWSG---GRRDSLEFFGNREYISPMWALIH--WIAPVQ
A0A1D8D4L1      KMAQKDVELLQSLPVADMTVRALWNS---SRRDSLEFFGYRPYISPIRRLVD--WIAPVK
A0A5C4S4Y6      KMAQKDVELLQSLPISEMTVRALWNN---SRRDSLEFFGYRPYISPIRKIVN--WIAPVQ
B4SD09          KSARKDVELLQSHPIAELTVKELYKT---TRKDSLEFFGKRKYVSPIDFLFS--AIDVFH
A0A4R0QJ17      NASKKDIALFKSMPIARQTIEQLERT---QQGKSIELFGTRSYHSPLMAVLM--HFKPFS
A4SF30          NASKKDIALIKSMPIAELTIKELERS---RNGKALEIFGNKTYQSPVIALVS--HIVPFK
A0A533TZM3      KVTKKDMELLKSMPIAELTVKDLYKS---NRRDSLEFLGNKHYFSWLTGPME--PVILFF
A1BJQ6          KAVKKDVELIKSMPIAMLAVGELYKS---ARRDSLEFFEKRIYRSPVSRFFS--QLNVFT
                    . :  . :          *                                     

A0A136PFK4      ----TASHNQSSQDRHARLIDEVVESLHKMIEVKPSK--D-ADIIQVITRAGDPLEAALV
A0A6H9I6C6      --------DPDDLSKGLKNEFEIAKMLKQVVQVVQKK--G-LDVVDLSVESPSPYEAAII
A0A533TY12      --SEVIGNPLDTLRLTDTQVQEYAESLRGRISVKKIP--D-TDFLEISVSSPFADEAAYL
B3QVI2          --------------STIVSEDVLAQRIRKQLQVAQAD--KSADVINISFESPSPFEASRM
B3QXQ6          --------------AKIARVDVIAARIMGAVSVEQVD--K-ADLLLIKFRSHDPEEAAVV
A0A081SFU7      ------------------NIDAIAARVRSGISIAQPKATS-TSILLISFKSFDPFEAATV
A0A395LXF8      ------------------SVDEIAARVRMAMFVVPAKVPG-SNIITIGFRAFDPYEAATV
A0A533TG10      DKRSAQTMNLNGPEYPDDFIRINAMKLSVRIKVDPVR--E-TSLIKVSVASPFQDEAVYL
A0A7C5W8E5      ------------------SLQALAARVRSVVNLVPTR--D-ADIVDIRVRTNDPQEAALI
B3EF76          EK-----DAEEVPASQKETMRNFAENLKGRITIDNPK--E-TNVLHVTVSSPFPEEAAVL
A0A4R0QIM7      G------GGEEPQMSEEQLIRKYAGALQKRIMVANSR--D-TDILDVSVSSPFADESAVL
A0A222SG44      S------RQPVQAGEILDNIRPYAELLRSRLSVLNER--G-TDIITVTVSSPFPREAALL
A0A5M8I9A7      TK-----PESLDHLPIDLRIRVFSARFQARVQVTNTR--E-TDILSVSVSSPFPEEAAFL
A0A5C4S1T9      P------QKQKEPVPFDVQMRGYASRLQQRVSVSNTR--D-TDILQVSVSSPFADEAALL
A0A317T3L6      -------MGKEEAADYDLLMREYAKTLQKRISVGNAR--D-TDILKVSVSSPFPDEAALL
A0A422HIT8      SA-----SAEEEPVDYDVQMREYAAALQKRIEVNNAR--D-TDILKVSVSSPFPDEAALL
A0A4R0QI83      -------PVDFGSMPREMMFKLLAARLQGRVAISSAK--E-TDILNVTVASPYADEAALL
A0A1B1Q171      NGDEPSVAEKKRKIPLDLKLRSYASRLSSRVTVENGR--D-TDILYVSVSSPFSHEAALL
A0A1W6HT77      FG-----GKEEEEVDFDLKMRTYAEALKKRVSVSNSR--D-TDILQVSVSSPFPDEAALL
B3EME9          -G-----TREKEEKEYDIRMREYATALQKRISVSNSR--D-TDILQVSVSSPFPDEAALL
A0A369RAQ9      -G-----AAEKDSVDYDVQMRKYAAALQERIKVGNSR--D-TDILNVSVSSPFPEEAALL
B4S3Z6          -G-----AAEKDSVDYDVQMRKYAAALQERIKVGNSR--D-TDILNVSVSSPFPEEAALL
A0A4Q1D2F1      KAKAESRYLNENTPAFNLMIRYYALKLNKKINVEGSR--D-TSVLRVSVASPFADESTYL
A0A1D8D4L1      PLNASDRDIIENTPAFDTMMRFYAIKLSKRIKVEGSR--D-SSVLRVSVASPFSDEATFL
A0A5C4S4Y6      QLKADDNSVIENTPAFNAMVRYYAVQLNNRIKVEGSR--D-SSVLRVSVASPFPDEATFL
B4SD09          PLNADQKA--EAWHYSDALLRFHAMQLKDRIRVIPLR--D-TNLLQVSVASPFADEAVFL
A0A4R0QJ17      VGEARMAE--DDGVGREELLRQRCITLTKRIRVEPVK--D-TNMLNISVASPFPDEAELL
A4SF30          VGNAGPRK--DR--SPEEILRRRALLLTKRIRVTPVK--D-TNMLKVSVASPFSNEAELL
A0A533TZM3      KQSQKKKT--P-----DEILRDFAIKLNKRIKVDAIR--Q-TNLLKVSVSSPFPDEAAFL
A1BJQ6          PLNADQNP--PYRALSDEELRRYAVKLNSRITVEAAR--E-TNVLKVSVASPFADEAAYL
                                          .   : :         ..: :   :    *:  :

A0A136PFK4      ANTFAEVYIKDNKEQNSRKATQIRQFVADKMEKVRDSLAVIELRLKDYLESKNILGLDIQ
A0A6H9I6C6      CNAYAKTYSDYSLEFSRLDLTNIINYLNTEKEKKFRDLKLSEAALEDFQQREGVVQLDVQ
A0A533TY12      ANTVCNVYKKRDIQKSANQAISAQQYIKQELDQQRSELAKSEENVIAYARANKIYGVDST
B3QVI2          VDLTMDTYSTLSTEQNRLMARSALEFLENEKQRVENNLRVTEEQLRDFMNQKGLIQIDAQ
B3QXQ6          SKAIAESYEERSMKYTRNTARSVRQFLEDQLAQKRRLLYESEERLRRFMEDNRVISLDEE
A0A081SFU7      SRAIASVYQERKKKSSSNTARILREFLEDQLAQKKRQLAESERTLQSYMEENRVVSLNEE
A0A395LXF8      SRAITEVFQERKRKSANNAARMLRQFIEDQLVQKKRQLAESERALQAYMEQNRIVALNEE
A0A533TG10      TNTLCNAYKNADINRKSEKYKQSSTFIAEMLHNQQKFVAQTDSTLSRYMESNKMYENSGN
A0A7C5W8E5      ANTFAEVYLQVNEQNNRANARRVREFLQQQYEWTRDTLAKAEQALQDYMSRTGSMELDAR
B3EF76          SNALCRAYQQKDIEWNSEQAKSVNQFVEEQLGEQQKKVATVENNLSGYMEKQDIYELTGN
A0A4R0QIM7      TNALCRAYVNKDIEWNADQALQVKGFVSEQLVEQQAEIRATDERLSAYMKQKNIYELTGN
A0A222SG44      ANIVGRTYQKQDVAWNVEQARNVNQFVVDQLREQQKKVAEVEAAVSRYMKQENIYEVTGG
A0A5M8I9A7      TNTLCRAYMRKDIEWNADQAIQVKDFVSEQLDKQKSEVAEIDGRLSSYMKKENIYELTGN
A0A5C4S1T9      TNAICQAYMQKDIEWNADQAMMVKDFVNEQLQVQEKEIAAVEAKLSNYMKQQNIYELTGN
A0A317T3L6      TNAICQSYMRKDIEWNADQAMSVKEFVSEQLASQQREIAAVEDQLSSYMKQQNIYELTGN
A0A422HIT8      TNAICEAYMRKDIEWNADQAMSVKEFVGEQLSQQQQEIAEVEDRLSAYMKNQNIYELTGN
A0A4R0QI83      TNALCKAYMRKDIEWNADRAMQVKGFVTEQLDKQKAEINDVDARLSAYMKRENIYELTGN
A0A1B1Q171      TNVLCKTYMQKDIEWNADQAMMIKDFVSEQLAVQEKEIAAVESQLSSYMKQENIYELTGN
A0A1W6HT77      TNAICQAYMRKDIEWNADQALSVKDFVSEQLAQQQREIAAVENQLSAYMKNQNIYELTGN
B3EME9          TNAICRSYMRKDIEWNADQAMSVKEFVSDQLASQQKEIGEVENQLSSYMKKQNIYELTGN
A0A369RAQ9      TNAICQAYMRKDIEWNADQAMSVKEFVGEQLAQQQREISSVENKLSSYMKNQNIYELTGN
B4S3Z6          TNAICQAYMRKDIEWNADQAMSVKEFVGEQLAQQQREISSVENKLSSYMKNQNIYELTGN
A0A4Q1D2F1      TNVLCNVYKDSDIQRNSEKYIQSNRFVAEMLQEQKNMVGKADAALSEFMSKNQMYDVTGN
A0A1D8D4L1      SNMLCSVYQKSDIQRNSEKYIQSNQFVAEMLQEQKDMMANADAALSKFMTENQMYEVSGN
A0A5C4S4Y6      SNMLCDVYQKSDIQRNSEKYIQSNRFVAEMLQEQKEMMAKADSSLSEFMAENQMYEVSGN
B4SD09          TNILCQTYKNADIIRNSEKYTQANKFIAEMIQDQQQKVGEADNALSQYMQANKIYEVSGN
A0A4R0QJ17      TNTLCDVYRQADITRNSEKYSQANSYIAKSLVEQQHKVDEADRALSGFMTRNEIYEVSGN
A4SF30          TNTLCSVYREADIERNSEKYAQANSFIAKSLVDQKQKLDEADRSLSGYMSRNEIYEVSGN
A0A533TZM3      SNTLCKVYKESDVDRNSEKYTQANQFITDMLQDQQKKVSDADNAQAKYMQSHQIYELTGN
A1BJQ6          SNTLCRVYREADIDRNSEKYAQANKFIAEMLGDQQKKVGDADYALSKYMEANEIYELTGN
                       :   .             ::          :   :     :            

A0A136PFK4      AHDLVQAKSKLENDASQTQIQISTLSRKLQEARQQYQAVDSGFATE-FASGDWAYASQLQ
A0A6H9I6C6      ADELVRSLSAIDKEKTMTSIELAANEKKYSELSQKIDEIDPKLKVYLESEISKGYLPELQ
A0A533TY12      ASGVLSKLIDAESQYLNTKTEYNIAKSRQDYLLNKLSSSDQAVSSR-ISDNMKSRSSQLQ
B3QVI2          TTDVIKILTDLESKSQEIKVQRVAIDAALQNYKQQLNSFKPGIAEQYTDAYGATLSRC-Q
B3QXQ6          GRRMIQRYSLAMSSAEEAEVMVKMLQSSLKAYEQEIRAMTPKLSNSAVQATIDPYTKLFQ
A0A081SFU7      ATRMIGRYSQAQAQLDETGVLLNALTASLKQYNEELAALQPKLSNSAVQASIEPYTKQFQ
A0A395LXF8      ATRMIQRYSQAVAQMDEAAVMLSALNASLKAYNEELAALQPKLSNSAVQAAIDPYAKQFQ
A0A533TG10      VGQLLSKVTEIESKVNELKTESRITQNSLDFLQSKLTEADRILSTR-IAKTVNAKLSAIL
A0A7C5W8E5      ANALVTQLAELDGKASEARIARDALRQTLEQYQRQLREIEPTLAEE-LSAVSSPYIETLQ
B3EF76          ADQLLKKLIDIDARYNEIMAERNILAKRLDFIRKKLSGEEKALSAN-IAESVGSQLRAVQ
A0A4R0QIM7      AENLLQKLVEAESRYNDALSEYNILKKRQEYITRKLSDEERAFSAK-VSRNIDRQAQELK
A0A222SG44      AEELQERLADADARYNEVQAEARILRQRLAFLRRKLSEDEKAYSER-VAETMAPRLKAVQ
A0A5M8I9A7      AQNLLNQLIAAETRYNDAKSEYNILKKRQDFIIRKLSQEEKAFMAK-VAENINRQSGDLK
A0A5C4S1T9      AQNLLDKLVEAESRYNDARAEYNILQNRQEFLVQKLSREEREISAQ-IARNVDRQSSELK
A0A317T3L6      AEKLLEKLVEAESRYNDAQAEYNILKNRQDFLVQKLSEEEKALSAK-IAKNVDQQSKELK
A0A422HIT8      AENLLEKLVEAESRYNDAQSEITILKKRQDFLVQKLSVEEKALSDK-IAQNIDRQASDLK
A0A4R0QI83      AQSLLTRLVEAESRYNDAKSEQNILRKRRDFIVTKLSEEEKAFMAK-VSKSIDRQAGELK
A0A1B1Q171      AQNLLNRLVEAESRYNDTRSEINILTKRQEYLVEKLSEEERAISAR-IAQNVDRQSSELK
A0A1W6HT77      AEKLLEKLVEAESRYNDAQSEITILKKRQDFLVQKLSAEEKALSDK-IASNVDRQASDLK
B3EME9          AEKLLEKLVEAESRYNDAQAECNILKNRQDYLINKLSAEEKALSAK-IAKNVDQQSRELK
A0A369RAQ9      AEKLLEKLVEAESRYNDAQAEYNILKKRQDFLVQKLSDEEKQISAR-IAKNVDQQSIDLK
B4S3Z6          AEKLLEKLVEAESRYNDAQAEYNILKKRQDFLVQKLSDEEKQISAR-IAKNVDQQSIDLK
A0A4Q1D2F1      TAALLQKLVDFEGRYKDLMAEYNIVMNSRDFLEKQLSQADRELSDR-IARNVNAQLGTIQ
A0A1D8D4L1      TGGLLAKLIEFEGRYNDIMAEYNIVSNSRNFLENQLTQADREMSDR-IARNVNAQLGAIR
A0A5C4S4Y6      TGGLLGKLIEFDGRYNDIMAEYNIISNSRDFLEKQLTQADRELSDR-IARNVSAQLSAIQ
B4SD09          TGAILAKVVDADARYNDIKAESRIASNSLAFLEKKLSDTDREISSR-IAKNVNSQLGAIM
A0A4R0QJ17      TQQLLDKLVDADAQYNAIQAEYHTVSNTLRFLEQRLSESDKAIGSQ-IEQTVNAKLGAIM
A4SF30          TQQLLNKMVDSDAQYNAVQAEYHTVANTLNFLEKKLSESDKAISSQ-IEQTVNSQLSSIM
A0A533TZM3      TQSLLDKLIDSDSKYYDVKAEYNITKNSLAFLDKKLTDGDRALSSQ-ISQNVTAQLGNIM
A1BJQ6          TQQLLNKLVEADAKFKSIQAEYNIANNGLAFLEKKLSESDRAISSQ-IAKNVSNQLGSIM
                   :                                                        

A0A136PFK4      TQIASLKTQRGLMLSVPFDGASK--LAYDQKVKTLTEQMEM--------LESQLAPVIAR
A0A6H9I6C6      KQIAQLEIERELQLSIISNDRVR-----QKAKEEYDRKISS--------LQESLDKNVKS
A0A533TY12      AQLRNDE--RDLVSLTS-QLGAD-----DPQVIEKKKEIVQ--------LKQQMADLSRR
B3QVI2          YRLAELE--TERLLILSRNPGLKQKEENSPELKKIQDEISV--------LRSEIKVITSK
B3QXQ6          EEIAKLE--VERDKILT-DPASRYNVNVQERLQEYNDKIES--------YKKRLQQSFER
A0A081SFU7      QEIARLE--FERDKVLA-DPGSQTNLNVQERIRQYEDQIES--------YKKKLQQAFDR
A0A395LXF8      AEIARLE--FERDKALA-DPGIQFNISAQERVKQYEDQIEA--------YKKKLQQAYDR
A0A533TG10      EDIKNQQ--KQYVQLIA-EKGVD-----DADTRNKKQQLDA--------AQSRYENLSRS
A0A7C5W8E5      QQIAQLEVQRDLILASK-PIVAS-----SVYFQTQMQQLEAQLAELKEKLRQRTEELKRS
B3EF76          NRIKAEE--ADYMALLQ-QKGAA-----SPEVKARRQQIDQ--------MKSQLDQVVRG
A0A4R0QIM7      TRIRQEE--TGIIGQVA-ATD------------MKKQELAA--------LKQRLRELTRN
A0A222SG44      DMIRKEE--SVLSELIV-QRGPE-----DTAVRTKQEQIRN--------MKAQLDQITRT
A0A5M8I9A7      AMIRKQE--KDLIGQEG-EADEA-----SG-----RQQLTM--------LKQRLLEVTRN
A0A5C4S1T9      KRIKEEE--MALIAMER-EGQGA-----TEAYAVRKQQLDL--------LRRRLEEATGN
A0A317T3L6      SRIKQEE--KTLITLAG-ESGAE-----SSSYIAKKQQLDV--------LKQRLQELTRN
A0A422HIT8      DRIKSEE--KELISLAN-DAGTN-----SPQYASKKQQLDM--------LKQRLQELTRN
A0A4R0QI83      ARIRNEE--KSLIGVEK-EPSAE-----S------RQQLEL--------LKQRLLDVTRN
A0A1B1Q171      RRIMEEE--RTLIEMER-LGNAS-----GEAYDIRKQQLEL--------LRRRLEESTGN
A0A1W6HT77      NRIKQEE--KALIDIAT-QNGTS-----DPSYVAKRQEVDV--------LKQRLQELTRN
B3EME9          ERIKQEE--KQLIAMAG-EAGTQ-----DAGYLAKKQQLDM--------FKQRLQELTSN
A0A369RAQ9      SRIKKEE--KALIELAN-STGTE-----DGSYIAKKQQLDV--------LKQRLQELTRN
B4S3Z6          SRIKKEE--KALIELAN-STGTE-----DGSYIAKKQQLDV--------LKQRLQELTRN
A0A4Q1D2F1      DEIKAKE--ADYIAILR-VKAAD-----DPVAKGKKQELDQ--------VRARYDQLSRS
A0A1D8D4L1      DEIHSKE--SAYISLLR-EKTVD-----DPEVKGKKQELEQ--------AKARYDQISRS
A0A5C4S4Y6      DEIHSKE--SAYVNVLR-EKPVN-----DPEVKGKKQELEQ--------VKARYDQLSRS
B4SD09          DELRTLE--SDYIKMVR-EKGID-----NPEVKIKRQQLDV--------VKTRYEQLSRS
A0A4R0QJ17      EEIRGME--GGYVALLK-QKGAD-----DPAVKTAKTRLDE--------VKSRYETLQRS
A4SF30          DKIHGLE--NSYVALLK-QKGSD-----EPAVKAKKQELDE--------VKARYEKLQRS
A0A533TZM3      DEIKTRE--REYIQLIS-QKGAK-----DEEAKSKRQELDV--------VKARYDQLSKS
A1BJQ6          DEIKGLE--SEYMQLVQ-EKGID-----NADVKAKRQQLEV--------VKTRYEQLSRS
                  :   :                               :                     

A0A136PFK4      LK------NSNVGT-------LLSTTKQGELPTAPLGNLRQQIFEDEIALQALRAQGAAI
A0A6H9I6C6      LD---------AGM-------YVMTPEERR-------EMVWELVKTGVMVNSDRIKNRVL
A0A533TY12      DI---------AAG-------MSIANRTKQYQF----GYIGQQLQNDAKLADLEYTAAQY
B3QVI2          ML---------SDDQDQLSSILSATNGDIAAE-----ILLTKRKLLELDI--QRRQYDAQ
B3QXQ6          QV---------KQG-------LSNVNASEAYQ-----ELFKNKLNTELELIEQKSKFEAY
A0A081SFU7      QV---------KQG-------LANVDNSQYFK-----EIYRKKLETELQIIGLQTKLKAY
A0A395LXF8      QV---------KQG-------LANTNNTEYFR-----EIYKKKLDTELQIVAVQTRLKAY
A0A533TG10      QI---------AGE-------INYTGRTKKYSF----DLIAEKLETERKLNLLSNSAIEY
A0A7C5W8E5      KLGALPLAPEGGGP-------TAALQNLRQKVF----ELSVQLRAEEARLAAIE------
B3EF76          KI---------AGE-------LAYSGRAQKFQF----DLISEQLQTDLRLAELNYSAQEF
A0A4R0QIM7      AM---------AGE-------LAFSNKARQFQF----DLISEQLQTEIRLAELSYIADEY
A0A222SG44      RI---------AGE-------IAYSGRSQRYQF----GLIAEQLQTDARLAELEFSASEL
A0A5M8I9A7      SL---------AGE-------LAYSTKARQFQF----DLISEQLQIDVRLAELGYIADEY
A0A5C4S1T9      II---------AGE-------LAFMSKARQYQF----DLISEQLQTDVRLAELSYIADEY
A0A317T3L6      MI---------AGE-------LAFTSKARQYQF----DLISEQLQTDVRLAELSYIAQEY
A0A422HIT8      MI---------AGE-------LAFSSKARQFQF----DLISEQLQTDVRLAELQYIAQEY
A0A4R0QI83      SL---------AGE-------LAYSSAARQYQF----DLISEQLQIDVRLAELSYVAEEY
A0A1B1Q171      II---------AGE-------LAFMSKARQYQF----DLISEQLQADVRLAELTYVADEY
A0A1W6HT77      MI---------AGE-------LAFSSKARQFQF----DLISEQLQTDVRLAELDYIAQEY
B3EME9          TI---------AGE-------LAFASKARQYQF----DLISEQLQTDVRLAELKYIAQEF
A0A369RAQ9      MI---------AGE-------LSYTSRARQFQF----DLISEQLQTDLRMAELGYVAQEY
B4S3Z6          MI---------AGE-------LSYTSRARQFQF----DLISEQLQTDLRMAELGYVAQEY
A0A4Q1D2F1      KI---------AGQ-------IEYVGKAEKYRF----DLISEKLQLDQKLNRLKFSATEY
A0A1D8D4L1      KI---------AGQ-------IEYIGKAQKYRY----DLISEKLQLDQKLNTLKFSAGEY
A0A5C4S4Y6      KI---------AGQ-------IEYIGKAQKYRY----DLISEKLQMDQKLNRLKFSAGEY
B4SD09          KI---------AGE-------IGYAGKAQKFSF----DMVSEKLQIERKLNDLNFSASEF
A0A4R0QJ17      QI---------AGE-------IGYAGRTKKFGF----DMIAEKLQIERKLNELQFRAGEF
A4SF30          SI---------AGE-------IGYAGRARKFGF----DMVSEKLQIERKLNELKFRAGEF
A0A533TZM3      KI---------AGL-------IGYAGKAQKVNF----DMVSEKMEIERKLNELNFRALEM
A1BJQ6          KI---------AGE-------IGYAGKAQKFSF----DMVSEKLQIQRKLNELSFSSREF
                                                         :       :          

A0A136PFK4      NA-ARAQVNAQ---MSAVPQQQMDVGRLVREQSASAKMYEDMLDEYNKKVLEEQSVTSTA
A0A6H9I6C6      GN-YVNEYETR---FNKLPSQIIEYARLERDKLTNEKIYILLEEKYQEALINQNARIGNV
A0A533TY12      QQ-LKNTYEKQ---LSQLPEKQLGYARLLRDQAVLNRNYTFLKQKYQEAGMAVASQVGKV
B3QVI2          SAVLEQELEKKKLFFEKIPDNMIILARLKRNVDVNEKLYLTISERYAETALWEQTQFGLG
B3QXQ6          KK-LAEEYDKA---FLKSPGVNVEFGRLERKTKSAQELYLLLEKKYQEALIAEEQVPKMV
A0A081SFU7      KD-LAQDYDRA---FLKTPGKNIEFARLQRNNQTLQDLYSLLEKRYQEALIAEEQIPSGV
A0A395LXF8      KE-LAEEYDKA---FLKTPGKNIEFARLQRNNKILEELFSLLEKRYQEALIAEEQVPSGV
A0A533TG10      EK-LKQGYEAR---VNLLPKKQQDYAKLQRDRDVAGKTYTFLKEKLDESRILLGSEVGNV
A0A7C5W8E5      -Q-ARRKAEGE---FQQLPAQIIALARLRRTTGSLEKLHELLSEKLNEAIIAEQSVFATV
B3EF76          GK-LKNYYESQ---LNALPDKQLNYARLQRDREVVNSTYTFLKQKFEESRIKIASEVGRV
A0A4R0QIM7      KR-SKDYYDAQ---LNKLPQKQLEYARLQRDREVQSNTYTFLKGKLEESRIQIASEVGKV
A0A222SG44      NR-LRNYYQAQ---LRSLPQKQLELARLQRDRDVVNRTYSFLRERLDESGIEIASEVGQV
A0A5M8I9A7      QR-VKASYNSQ---LNQLPQKQLNFARLQRDRDVLNNTYTFLKGKLQESRIQIASEVGKV
A0A5C4S1T9      LK-SKNYYESQ---LNRLPQKQLNYARLQRDREVLNNTYTFLREKLEESRIKIASEAGKV
A0A317T3L6      QR-SKNYYESQ---LNRLPQKQLNYARLQRDREVLNNTYTFLKEKLEESRIKIASEVGKV
A0A422HIT8      LR-AKNYYENQ---LNKLPQKQLNYARLQRDREVLNNTYTFLKEKLEESRIKIASEVGKV
A0A4R0QI83      QR-VKGVYNAQ---LNQLPVKQLTFARLQRDREVLTNTYTFLKGKLEESRIQIASEVGKV
A0A1B1Q171      LK-SKNYYEAQ---LNKLPQKQLNYARLQRDREVLNNTYTFLRNKLEESRIKIAAESGKV
A0A1W6HT77      LR-AKNYYESQ---LNRLPQKQLNYARLQRDREVLNNTYTFLKEKLEESRIKIASEVGKV
B3EME9          QR-SKNYYESQ---LNRLPQKQLNYARLQRDREVLNNTYTFLKEKLEESRIKIASEVGKV
A0A369RAQ9      LR-AKNYYESQ---LNRLPQKQLNYARLQRDREVLNNTYTFLKEKLEESRIKIASEVGKV
B4S3Z6          LR-AKNYYESQ---LNRLPQKQLNYARLQRDREVLNNTYTFLKEKLEESRIKIASEVGKV
A0A4Q1D2F1      QR-VKKSYDDQ---LANLPEKEQAFVRLERDRAVVSKTYLFLKEKLDETRILIGSEVGSV
A0A1D8D4L1      AK-VKQKYDGQ---LAQLPEKEQNFVRLQRDRDVVSKTYLFLKEKLDETRILIGSEVGSV
A0A5C4S4Y6      AK-VKQKYDSQ---LAQLPEKEQNFIRLQRDRDVVSKTYLFLKEKLDETRILIGSEVGSV
B4SD09          SL-LKQYYESQ---LSMLPIKQQEFIKLQRDKEVVGKTYLYLKEKLDETRIMLGSEVGGV
A0A4R0QJ17      SR-IRQYYEQK---LAALPNKQQEFLKLERDRNVASKTYEELKQRFDETSIFLGSEVGGV
A4SF30          AR-IRQYYESQ---LSNLPYKQQAYLKLERDRNVASKTYEELKQKFDETRIFLGSEVGGV
A0A533TZM3      GK-LKQYYDSQ---LSTLPTKQQEYAKILRDHEVVNKTYTFLKSKLDESRILLGSEVGSV
A1BJQ6          SR-LKEYYEGL---LGQLPEKQQDYIKLQRDREVVGKTYLYLKEKLDETRIMLGSEVGGV
                        :     .   *       .: *        .  :     :  :         

A0A136PFK4      RIFEDAQPVLKPVSPNRTANILTGCFLGLAIGVGIALLLAYSDTTVHSPD-DLEKHGFTV
A0A6H9I6C6      TIIDPAFESLLPSKPNRVFLLVSGAVFGLILGIGFVITRNYLDKSIKTPD-DLENNGYSI
A0A533TY12      TIIDPASIPGGSESPNMLNNLIRGALTGLLSGIVLSFVINLLDTAIHESD-YITDKGFVI
B3QVI2          RPIDYGYLPEAPIKPKKQIFLLVGFLFGLAGAVTFIYVKESLNTGIDGAE-KLKKKQYPL
B3QXQ6          EVIDWAITPGAPIAPNRKANILVGVVIGLTFGVGIVMLIQFLDKTVYTPE-QAERLG-PL
A0A081SFU7      EVIDLAVPNLVPVGPNRATNVILGVVVGLVLGVGVVMLLQFLDQSVHTPE-QAEKLG-TL
A0A395LXF8      EVIDWAVPNPIPVGPNRRNNMILSVVIGLLAGVGVTLVLQFLDQNIHTPE-QAEKLG-ML
A0A533TG10      SIIGSAFRPFFPANSSPLKSMLIGLLIGGVMASIYTLISEFLDDSIKDEI-SLKNQGFTV
A0A7C5W8E5      SILERALPPSRPISPNRSLNMTVATLLGLLLGIGFVLLRALTDTTIRSPE-DVENSGTVV
B3EF76          VIVGPAYPPKLRESPDTKKILLVGLVLGLGLGGALVFVLEMRDHSVKEEQ-FFDDHGFVT
A0A4R0QIM7      VVVGPAYPPERPVAPSLRKTLLVALMLGLGVGGALVRLLEAQDNSLRDDT-FLTEHGFIT
A0A222SG44      VVIGDAHPPDSPVSPNLGMNLFLGLFSGLGLSALLLISQNLLDDTIRDDS-FLEDNGFVE
A0A5M8I9A7      VIVGESYPLGGPIAPNLQKNLLIGLILGLGLGGALVFVKEMMDHSLKDDQ-FLENHGYLP
A0A5C4S1T9      VIVGAGYPPLSPVAPDLKKNVLIGLILGLGLGGALVFVREMLDNSLRDNE-FLEQHGYVP
A0A317T3L6      VIVGAAFPPIDPVAPDLKKNLLIGLILGLGLGGAMVFVREMLDHSLKDDT-FLEDHGYTP
A0A422HIT8      VIVGAGYPPTSPVAPDLKKNLLIGLILGLGLGGALVFVREMLDHSLKDDT-FLEDHGFTP
A0A4R0QI83      VIVGEAYPLGGPVSPNMKKNLLAALILGLGLGGVLVFVQEMLDHSVRDDH-FLENHGFVP
A0A1B1Q171      VIVGAGYPPLSPVAPDLKKNVLIGLILGLGLGGALVFVREMLDNSLRDNE-FLEQHGYVP
A0A1W6HT77      VIVGAAFPPVQPVAPDLKKNLLIGLILGLGLGGALVFVREMLDHSLKDDA-FLEDHGFVP
B3EME9          VIVGAAFPPIEPVAPDLKKNLLIGLILGLGLGGALVFVREMLDHSLKDDA-FLEDHGYTP
A0A369RAQ9      VIVGAAYPELAPVAPSLKKNLLIGLILGLGLGGALVFVREMLDHSLKDDS-FLEDHGFTP
B4S3Z6          VIVGAAYPELAPVAPSLKKNLLIGLILGLGLGGALVFVREMLDHSLKDDS-FLEDHGFTP
A0A4Q1D2F1      SIIGAAFQPFIPESPVLVKNLLIGMVLGLILSASYVYGIEMLDDTVNEEMQFFKSLGFNI
A0A1D8D4L1      TMIGSAFKPFMPEKPELVKNILAGLVIGIVLAGLFTYGAEMIYDTVNEEMQFFKSLGLNI
A0A5C4S4Y6      TMIGSAFKPFTPEKPELIKNLLAGFVIGIVLAGLFTYGAEMIDDTVNEEMQFFKGLGLNI
B4SD09          SIIGSAFKPFSPEKPVLSRDLLAGFILGGLLAVLYTFGAEMADNTVKDDL-FFRDLGLTV
A0A4R0QJ17      SLIGKAFRPFFPESPSLLKSLLLGVLFGGMLAIGYAYIEEAMDGTLQDEG-LYEEIGLKP
A4SF30          SIIGSAFRPFTPEKPSLPVNLLLGVLFGGLLAIGYTYIEESVDGTLQDDF-FFDEIGVRP
A0A533TZM3      SLVGDAFKPFKPESPDLKKNLLLGLVLGGLLSAMYAYGAETVDDSVKDES-YFKDLGLPI
A1BJQ6          SVIGSAFVPFKPEKPNLKKNMLMGLVLGGLLAVLFTYTAELVDDSVKDDS-FFRDIGLAT
                  .  .        .     :  . . *   .             :              

A0A136PFK4      LTAIPLIPEGMLNYEII-------------------------------------------
A0A6H9I6C6      LAWIPSIDIKEKS-----------------------------------------------
A0A533TY12      LSRIPWIGK---------------DKINFVPDIIKNIFSS--------------------
B3QVI2          LAVIPDMEEVIKESYDEE--K---------------------------------------
B3QXQ6          LATIPMMESFDDDVRDKSGAS---------------------------------------
A0A081SFU7      LATIPVIETFDESVRGKAGTE---------------------------------------
A0A395LXF8      LTTIPVIETYDETVRDKASAG---------------------------------------
A0A533TG10      LSQIPYVTNTPD--GSKATLG---NYIKE-------------------------------
A0A7C5W8E5      LAAIPRIPPDLTA-QDAALLA---QSEED-------------------------------
B3EF76          LARIPFVDKAEF--TLADGMK---KAVGQLLVTIDPGKGNGKS-----------------
A0A4R0QIM7      LATIPYVAPDESA-GIPESLR---KKIAGISAALPGLLGRSYAK--------GKAKTPPD
A0A222SG44      LARIPFTGSGETH------EA---AVPFGIAKLFSRFTNR--------------------
A0A5M8I9A7      LAAIPYVDSPGDEFNLQNTLS---RTLQQISSVISGLSLNGNGKVGGNLKHKKQHRNRSS
A0A5C4S1T9      LAFIPFIADKARG-MQRKQSG---KKAKRVGGLIEKLLV-------------QLSPKK--
A0A317T3L6      LAAIPYVEDGNGK-DLPKTLK---GSLEQLTGYLPKYGDNGK----------SSKYIK--
A0A422HIT8      LAAIPYVPR-EGE-TLQGSFR---KSMDDITRALPSLNLNGNGKNG------TSKHKK--
A0A4R0QI83      LALIPFVGETEQR-GLRERLS---ALLKGVAARLPALPLPLGGA--------AKAERRSS
A0A1B1Q171      LAFIPFIADKARG-MQRKQSG---KKAKRVGGLIEKLLVQL-SP--------KKEHER--
A0A1W6HT77      LAAVPYVAREGE--TLQGSLQ---KSVDDVRKLLPSFNGN--GT--------SGKHQK--
B3EME9          LAAIPYVGDENES-DLQDSLK---KSIRQLSDSIPGFGASSNGK--------DASHVK--
A0A369RAQ9      LAAIPFVDSDGGG-SMQASMK---KSLKDFASVFPFLSGNTDGK--------KDQHQK--
B4S3Z6          LAAIPFVDSDGGG-SMQASMK---KSLKDFASVFPFLSGNTDGK--------KDQHQK--
A0A4Q1D2F1      WGVVPFVNQANEYMNLESVEK---DGKKKHG-RFKKILKKNSDI----------------
A0A1D8D4L1      WGVIPFINSSSDYSGTYHEAK---RKIEKKSVMLLDIFKKKEEQ----------------
A0A5C4S4Y6      WGVVPFISSSSDYSATYHETK---DKIEKNGKRLFEVFHNKSKK----------------
B4SD09          LSVIPLVGQKGQTPFLDNKESFIKRFLYSKSQAFREKVLSEASV----------------
A0A4R0QJ17      LSVIPMVGPGRYPAIQATGAS---RRIGHMGGSLRR--LLSDGS----------------
A4SF30          LAYIPTVGPYGYPALPGYGKG---KLMESTGRTIRK--LLPGSS----------------
A0A533TZM3      LSYVPLVTREGKSSLSMSGESRLSRLLYNQSKAFREKLLLTGST----------------
A1BJQ6          LSIIPLVPGE-KNAVPSREVSGFNRILYNTSKAFREKVLLSGNG----------------
                   :*                                                       

A0A136PFK4      -----SNDPLSVRLNGRASSHLITHIQPKAPISESYRSLRTAVQFAAI-----EEPVRKI
A0A6H9I6C6      --------------DLSSPDEFIVASDAKSSISEAFKVLRTRVQYAKI----EEEPLKTI
A0A533TY12      -----VLNNHNLIKSKQSNDALWISDRLSSTFAESFRDLRTAITFSQS-----DKVIRSL
B3QVI2          ----YITVKGS-----KISTRLVSFLDVISPIAESFRRLQSNVIYS------HPDEKLKL
B3QXQ6          ----VKVIEGPDAEYKKIASHLVTHFDPKSSVSEAYRTLRTNILFSGVHDFNGSKKQGLI
A0A081SFU7      ----VKAEDETDLEYKKIASHLVTHFDPKSSVSESYRALRTSILFSSSFVGNGEKEDGNV
A0A395LXF8      ----DKVAEDPNAEYKKIASHLVTHLDPKSAVSEAYRSLRTAILFSSASPTKENGKAGKV
A0A533TG10      ---------TDQLSTDQRNTVPLITDRLSSWYAESFRTLRTAISYCSI-----DNPIRSL
A0A7C5W8E5      -----TAFYSRFPAEQTLPPHLISHCNPKSPIAENYRAVRTALQFAIV-----DTAHPVV
B3EF76          -----NGNGRHPGQGSADGAPLLITDKLSSPFSESFRDLRTNLTFARA-----GTPLRSV
A0A4R0QIM7      GGAPVADGVSALNGTSPANPFVLMAGQLSSHLAESFRDLRTNIIFSRA-----DSELNSI
A0A222SG44      -----KNADVELHAGKSGAAPLLISDYPSTAFAESFRDLRTNIMFSRA-----DNPVNSM
A0A5M8I9A7      YGLYKKSSTGKPIAFSPGQKPLLIADQLAYPLAESFRELRTNITFAQV-----DRTVKSI
A0A5C4S1T9      -----EHERLALHTQATADEPLLMNNSLDAGFSESFRDLRTNITFSRA-----DNPLKTI
A0A317T3L6      -----TNSQGKIVPSTHDRKPLLMADSLSSPFAESFRDLRTNIVFSQA-----DRPLKSI
A0A422HIT8      -----VDSQGKSVPSSSKKPPLMMADSLSSPFAESFRDLRTNITFSQA-----DKTVKSI
A0A4R0QI83      GGSKGKSSLGKPLPDGSGRKPLLIVDRLASQLAESFRELRTNVVFSQA-----DRNIKSL
A0A1B1Q171      -----LALHTQATAD----EPLLMNNSLDAGFSESFRDLRTNITFSRA-----DNPLKTI
A0A1W6HT77      -----QNSQGKPVASSSKRPPLLMADSLSSPFAEAFRDLRTNIIFSQA-----DRKVKSI
B3EME9          -----MNSSGKSVPSTRESKPRLMADSLASPFAEAFRDLRTNLVFSRA-----DRKLKSI
A0A369RAQ9      -----KNSYGKPVESTRNKQPLLIADSLSSPFAESFRDLRTNITFSQA-----DRTLKSI
B4S3Z6          -----KNSYGKPVESTRNKQPLLIADSLSSAFAESFRDLRTNITFSQA-----DRTLKSI
A0A4Q1D2F1      -----QGDSEKEPVSQVR-AYPLMTDKLNSSFAESFRTLRTNLNFSRI-----DKPVKTI
A0A1D8D4L1      -----INNPQSEVSGDIK-NNPLMTDKLNSSFAESFRTLRTNLNFSRI-----DKPFKTI
A0A5C4S4Y6      -----LNEPAKEVKSDIK-TYPLMTDKLNSSFAESFRTLRTNLNFSRI-----DKPFKTI
B4SD09          -----KGAL----------PMPMITDSLSSAFAESFRTLRTALDYSRVDFSRIDSSLKFI
A0A4R0QJ17      -----STQPLEAQDGAVL-PVPLITDSLTSSFAESIRILRTSIHYSRS-----GNPPQSI
A4SF30          -----EGDGENSVTVTVL-PAPLICDNLDSPFAESIRMLRTSIQYSIP-----GKPPQSI
A0A533TZM3      -----SNGNKPYVPKVEEIPMPTIMDSLTSPFAESFRTLRTALDYSRI-----DTPLKSI
A1BJQ6          -----AGKRKGAQPKVET-PMPMITDSLSSSFAESFRTLRTALDYSRV-----ESPLKSL
                                                :*  . :.: : :.             :

A0A136PFK4      -LVASSVPQEGKSTTSTNLAITLAQSGARTLLIDCDLRRPTQNSVFGFPREPGLVNCLIG
A0A6H9I6C6      -LITSTIPGEGKTTVAINLAGSFALDGKNVLLIDCDLRKPRVHSVMGVNRYPGLTDLLFG
A0A533TY12      -LITSSEPGDGKTTTCSNLAYAYALIGKKVLVVDCDLRRPSQHIMFSIKRSPGLSDYLAG
B3QVI2          IVVTSPGKGEGKTTVISNFAVALAESGKKIILVDTDFRRPYVHKMFGLDQQPGLTETLFD
B3QXQ6          YIITSSSPKEGKSTTISNLAITIAQGGQKVLLIDTDLRRPIIHSIFGYNKEPGITNYLVG
A0A081SFU7      FAVTSASPKEGKSTTISNLAITIAQGGQKVLLIDADLRRPVVHAIFGYNKEPGITNHLVG
A0A395LXF8      YLITSASPKEGKSTTVANLAITLGQGGQKTLLIDADLRRPVIHSVFGYNKEPGITNYLVG
A0A533TG10      -IISGVSIAEGKSSVCTNLGMALALNGRRVIIIDCDLRLASQHNIFKIKREVGLTDYLYS
A0A7C5W8E5      -VITSPVPQEGKTTTAVNLAITFAQAGYQTLLVDADLRRPSVHSVFGFGREPGLVNVLIG
B3EF76          -LVTGTAVSEGKSTICANLGLAFALTGKRVLIVDCDLRRPSQHKLLGSSKAPGLSNYLAG
A0A4R0QIM7      -LVTGTSIGEGKSTVALNLAFSFALIGKKVLVVDCDLRRPAQHRIASVPRSPGLSNYLTG
A0A222SG44      -LVTGTSISEGKSTVCSNLALSYSMIGKKVLVIDCDLRRPVQHQYLQTSRQPGVTDYLAG
A0A5M8I9A7      -LITGTEVGEGKSTVCINLAFAFALIGKRVLVIDCDLRRPSQHRMLNTRISPGLSDHLAG
A0A5C4S1T9      -MVSGTEMSEGKSTVAGNLGLAFALTGKRVLLLDCDLRRPILHRVFKVDRGPGLTDYLAG
A0A317T3L6      -LVTGTEISEGKSTVCGNLAYAFALNGSRVLLIDCDLRRPSQHRLYSCKKVPGLSDYLAG
A0A422HIT8      -LVTGTEISEGKSTVCSNLAFAFALTGKKVLVIDCDLRRPSQHRMLNTLRMPGLSDYLAG
A0A4R0QI83      -LITGTEVSEGKSTVCVNLATAFALTGKRVLVVDCDLRRPNQHRLVNSNKSPGLVDYLAG
A0A1B1Q171      -MVSGTEMSEGKSTVAGNLGLAFALTGKRVLLLDCDLRRPSLHRVFKVDRGPGLTDYLAG
A0A1W6HT77      -LVTGTEISEGKSTVCSNLAFAFALTGKRVLIVDCDMRRPSQHRMLNTLRMPGLSDYLAG
B3EME9          -LVTGTEISEGKSTVCANLAFAFALSGNRVLIVDCDLRRPSQHRIYSCKKTPGLSDYLAG
A0A369RAQ9      -LVTGTEISEGKSTVCTNLAFAFALTGKKVLIVDCDLRRPSQHRNLNTMRMPGLSDYLAG
B4S3Z6          -LVTGTEISEGKSTVCTNLAFAFALTGKKVLIVDCDLRRPSQHRNLNTMRMPGLSDYLAG
A0A4Q1D2F1      -LISGCSIGEGKSTVSTNLALAWAIADKKTLLIDGDLRRPSQHTILNKKRSPGLTDCLIS
A0A1D8D4L1      -LISGCSIGEGKSTVSTNLALAWAIADKKTLLIDADLRRPSQHTILGKKRSPGLTDCLID
A0A5C4S4Y6      -LISGCSIGEGKSTVSTNLALAWAIADKKTLLIDADLRRPSQHTILGKKRSPGLTDCLID
B4SD09          -LVSGTAMTEGKSTVCANLGMAYAISGKKTLIIDCDLRRASQHKKLNVKREPGLTDFLYS
A0A4R0QJ17      -LISGTAMWEGKSTVCLNLGMAYALVGKKTLIIDCDLRRPSQHVKLNCQRGPGLTDCLLG
A4SF30          -LISGTAMWEGKSTVCVNLGMAYALVGKKTLIIDCDLRRPSQHIKLNCQRGPGLTDFLNS
A0A533TZM3      -LISGTAMSEGKSTVCANLGMSLALTGKKTLIVDCDLRRASLHKKFGKNREPGLTDYLFS
A1BJQ6          -LISGTAMSEGKSTVCSNLAMAYALVGKKTIIVDCDFRRASQHKKFSVKREKGLTDYLFG
                  ::.    :**::   *:. : .  . . :::* *:* .  :         *: : * .

A0A136PFK4      -MARLDEAIRP-SGIPNLDILSSGSIPPNPSELIGSRRMRELLNDLEKDYDMILIDSPPI
A0A6H9I6C6      -NNDLSEVIRP-TKFDNMHFIPSGTIPPNPSELLGSLQMKKTLENLKTQYDIIVLDSPPS
A0A533TY12      QVQSLNSIINKSSKIENLFVLPSGQITLHPQELLESKKMADLVLELENSFDIVLLDSPPF
B3QVI2          -GVPVEEVIMK-SIVPNIDILTTGKRPSNPAAVNQSLKLRELLQSLKKKYDHVLVDTAPF
B3QXQ6          -RAQIDDIVRN-SPIQNLDIITSGTIPPNPSELIGTQRMKDMLQLFRERYDIVLLDSPPI
A0A081SFU7      --RAALDDITRSSAIPNLDIITSGTIPPNPSELLGSDRAREFITQVRQRYDTILFDTPPV
A0A395LXF8      --RASVEEITRITPIPNLSLITSGTIPPNPSELLGSPRMREFLDQMREKYDMILFDSPPV
A0A533TG10      DLKTIDDSFIKSTHVANLSVITAGKKIPNPNEFLSSQKMQDLILYLETKFDLVLIDSPP-
A0A7C5W8E5      -ELPAEQACRP-TGIRNLDVLTCGPIPPNPSELLGSERTRTLLQQLRQQYDLLLIDTPPI
B3EF76          QEADMSKLIQP-TLNENLFLLPAGAAVPNPNELIGSQKMSETVELLEFRYDMVIIDSPPL
A0A4R0QIM7      VSSEVSGLIKATALHERLFILPAGRKSPNPNELLGSNKMAELLRQLESDWDMVIIDSPPA
A0A222SG44      ASDEIAEEFIQDAGYENLFLLAAGSPVPNPNELLFSNKMTQLIERLKARFDIVLLDSPPV
A0A5M8I9A7      THADVRAIIQTTTMHENLSVLAAGSKPPNPNELIGSQKMTELVKALEQEWDYVFLDSPPL
A0A5C4S1T9      QQDDLKRLTRQ-VQHENLHLIPAGAKTPNPNELLGSQKMKELIRQLEAEWDIVILDTPPL
A0A317T3L6      LEVDAEALIQP-TMHENLYILPAGNKTPSPNELLGSNKMNELIKRFEDEWDYVILDTPPL
A0A422HIT8      VEKDLDVLLQP-TMHENLWLLPAGNSTPSPNELLGSRKMTDLVKELEEKWDYVILDTPPV
A0A4R0QI83      VQGDVHSLIQPTTLHENLFLLAAGSAAPNPNELLGSNRMTELVGELEKEWDYVLLDSPPV
A0A1B1Q171      QQDDLKRLTRQ-VLHENLHLIPAGAKTPNPNELLGSQKMKELIRQLEAEWDIVILDTPPL
A0A1W6HT77      VETDLEEILQP-TMHENLWLLPSGSTTPSPNELLGSNKMTELVEKLEEEWDYVILDTPPV
B3EME9          VEDDADALIQS-TMHENLFILPAGNSTPSPNELLGSNKMTGLVERLEEEWDYVILDTPPM
A0A369RAQ9      QEKDINAVLQP-TMHENLSVLPAGSQTPSPNELLGSNKMTELVKKLEEEWDYVILDTPPV
B4S3Z6          QEKDINAVLQP-TMHENLSVLPAGSQTPSPNELLGSNKMTELVKKLEEEWDYVILDTPPV
A0A4Q1D2F1      DESEINEKYFQKTHLDNLYLMSAGTPVPNPNELLGSEKMHEFLKKLSDKFDRIVIDSPP-
A0A1D8D4L1      DGKNDNDKYFQKTHVENLFLMTAGTPVPNPNELLGSEKMHLFLKKISDQFDRVVIDSPP-
A0A5C4S4Y6      NERESNDKYIQATHVDNLFLMSAGTPVPNPNELLGSEKMHEFLKILSEQFERIVIDSPP-
B4SD09          QQANIDESFFQPTHIENLFVLSAGKKVPNPNEILGSQKMIRLLKELDGKFDKVVFDSPP-
A0A4R0QJ17      RDGDSYAPNIQSTGMDNLFLMSAGSKVSGSSELLASDEMQGLLALMKTRFDCILLDCPP-
A4SF30          ENDEFSAPHIQTTQVDNLFLLSAGAKVSGPSELLASDDMQRLLAVMKTRFDCILLDCSP-
A0A533TZM3      SEHSIDDRYFQSTEMDNLYLLSAGKKLQNCNELLGSAKMKTLIQELEGKFDKILFDSPP-
A1BJQ6          EDRSIDESYFQATHVDNLFLLSSGKKVPNPNELLGSAKMQDLIRELETKFDKVIIDSPP-
                                .: .:. *        .  :      :  .   :: :..* .* 

A0A136PFK4      GAVTDAMILSTMTDTTILVVRAHKTKMEFLEKSREGLE-RVNTPLLGVVLNDFDVSQTYG
A0A6H9I6C6      ISVTDSEILFKITDGTLLVVQSLKTPMDAFSKVYDRFNSFSEPNLLGTVLNNFS----YK
A0A533TY12      EFISDALLLSQSVDGVIIVAKTGKTSKS-ALKKLESLD-YIKPAILGFALIEKSTSLHYG
B3QVI2          GITTDAASIMKLTNGVILVVRFGQTSETELDQTVENLR-QVNANIIGTVLSAFDYRKTSD
B3QXQ6          IAVTDPQVLAKVADGMILVLLSGQTQIELAKRSIDAIR-KVNAKIIGFVLNSFDFNNSYG
A0A081SFU7      LAVTDAQVLATQVDGIMIVIAAGQTQVELAKRARQAVA-RVDGRFLGFILNNFDVANSY-
A0A395LXF8      MAVTDAQVLSQHADGVIVVLAAGQTQIELAKRTKQALL-KVDAPIIGYVLNNFDVTKAY-
A0A533TG10      LFLSDAAQLAQTVDGILIAARLNHTPRK-PLKDLADDH-LIFSNIIGVALIGSLKNSYGY
A0A7C5W8E5      ISVTDALVLAPLASVYILVARANETRIDALLKAREMLE-RVSARIAGAVLNEFDITTTY-
B3EF76          LLISDAALLSQSVDGILLAARLEYTNKK-LLQEVQKIS-YIKPQLLGVALIGSSSRDRY-
A0A4R0QIM7      VMLSDAAILSRSADAILMVARIGHSQRS-LLREAMATD-FVKKACLGVAVIGPQDPSGY-
A0A222SG44      LLLSDAAVLSRSVDGVVVVAKTGYTSKD-QFRELGKVD-YLRERMLGVALIGSVGQKKY-
A0A5M8I9A7      LLLSDTALLTKSADAILMVVRIGYTNKN-VLKDIQKLN-YVKENLLGVAIIGPDEPSNY-
A0A5C4S1T9      LMLSDATVLSRHVDGILMVARMGYTNKN-LLRDVQKTE-HIRKNILGVAIVGPSVQDKYN
A0A317T3L6      LLLSDTTLISRAADGILMVVRMGYTNRN-LLKEVQKLD-YLKHRLLGVAIVGPSEKIGY-
A0A422HIT8      LLLSDAALISRSADGILMVVRMGYTNKN-LLKEVQKLD-YLRNNMLGVAIIGPSEKSSY-
A0A4R0QI83      LLLSDAALISQAVDGIIMVVRVGLTNKN-LLREVQKIE-YFKKNLLGVAVIGPVDPIGT-
A0A1B1Q171      LMLSDATVLSRHVDGILMVARMGYTNKN-LLRDVQKTE-HIRKNILGVAIIGPSVQDKYN
A0A1W6HT77      LLLSDATLLSRAADGILMVVRMGYTNKN-LLKEVQKLD-YLKKTMLGVAIIGPSEKSGY-
B3EME9          MLLSDAALISRAADGILMVVRMGYTNRN-LLKEVQKLD-HIRKQMLGVAIIGPSEKAGY-
A0A369RAQ9      LLLSDATLLSRTADGILMVVRMGYTNKN-LLKEVQKLD-YLKHRLLGVAIIGPSDKSGY-
B4S3Z6          LLLSDATLLSRTADGILMVVRMGYTNKN-LLKEVQKLD-YLKHRLLGVAIIGPSDKSGY-
A0A4Q1D2F1      IFISDAAQLVNEVDGVLITARLHYSSRA-PLKQYASDN-FLHSKIIGVAIIDKPRPTKTR
A0A1D8D4L1      IFISDAAQLVNEVDGVLITARLHYSSRA-PLKQYASDN-FLHSKIIGVAIIDKPRPSKTR
A0A5C4S4Y6      IFISDAAQLVNEVDGVLITARLHYSSRA-PLKQYASDN-FLHSKIIGVAIIDKQRPSKIR
B4SD09          LFLSDAAQLAHSVDGVLLAARMHFTNKD-PIRNFAVDH-FLRPLILGVAMIESRDSQRYG
A0A4R0QJ17      FFLSDPAQLATWTDGVVLVSRLRYTERK-MLRNIISDP-VMKDSLLGVALIATPE-----
A4SF30          FFLSDASQLADWVDGIVMVSRLQYTGRK-MLQNIISDP-YLKARLLGVALISTTE-----
A0A533TZM3      LFLSDAAQLASSVDGILLAARLQFTSRR-PLHDFTTDH-YLRPLMLGVAVIESSDQGLFG
A1BJQ6          LFLSDAAQLAHSIDGILLVSRLQFTSRK-PIQDFVSDH-FMRPLLLGVALIGSRQ-----
                   :*.  :    .  ::.     :      .              *  :          

A0A136PFK4      SASYKY------YRYYRYYN-YYGGMEEEESSRRKDRRAKAIANGEATEKQPRLHG
A0A6H9I6C6      RNYGYY------YNYYYYYSSGEKPN------------------------------
A0A533TY12      L-----------YGKYGKNGLYYDNLSDIG--------------------------
B3QVI2          HYYN--------SGYYKYSYKRYTDYHEEKEV------------------------
B3QXQ6          SYYK----------YYRYYNYYYEPKGKNKNVKQGFLTKIIERLVDKV--------
A0A081SFU7      ---GSY------YKYYRYYNYYYESKGTPKIKKSFIEQLSDRFIGK----------
A0A395LXF8      ---GSY------YKYYRYYNYYYESKATPK-KKNFFEALSDRLSGIKS--------
A0A533TG10      GKYGHH------KYGYGNRGNYYGQN------------------------------
A0A7C5W8E5      GSYYRY------YRYYRYYH-YYSDS-DA--HRRRVPRTPS---------------
B3EF76          -----G------YDRYGYKG-QYKYK--T--YSHYIDTPES---------------
A0A4R0QIM7      ---GRY------HGRYGYNG-YNHAE------PSAAEEREVAGNVLR---------
A0A222SG44      GKYGYD------YKALDYYG-AGAKI------------------------------
A0A5M8I9A7      GNYGRY------YGRYGSKG-YYSYQ--T--NNKYLTPDIAKEEKDV---------
A0A5C4S1T9      YKYGRY------YGRYSYKG-YYSRE--S--YQKYLDTSST---------------
A0A317T3L6      GSYGRY------YGRYGYKG-YYSYK--S--YSSYLDEQRN---------------
A0A422HIT8      YKYGRY------YGRYGYKG-YYTYK--S--YSSYLEPEKTKG-------------
A0A4R0QI83      SGFGRY------YGRYGYKG-YYGYRRSS--YTSYLEAPEEERAG-----------
A0A1B1Q171      YKYGRY------YGRYSYKG-YYSRE--S--YQKYLDTSST---------------
A0A1W6HT77      YKYGRY------YGRYGYKG-YYSYK--S--YSSYLEPEKNKG-------------
B3EME9          GKYGRY------YGRYGYKG-YYSYK--T--YSSYMEPEKTKG-------------
A0A369RAQ9      SNYGRY------YGRYGYKG-YYSYK--S--YNAYLEPEKSNG-------------
B4S3Z6          SNYGRY------YGRYGYKG-YYSYK--S--YNAYLEPEKG---------------
A0A4Q1D2F1      YGYG--------EGKYGYGRSGYGRY--S---SVYPEKL-----------------
A0A1D8D4L1      YGYG--------EGKYGYGRSGYGRY--S---SVYPEKL-----------------
A0A5C4S4Y6      YGYG--------EGKYGYGRSGYGRY--S---SVYPEKL-----------------
B4SD09          YGYGKYGYGKYGYGKYGYGKYGYGKY--G--YGQYEEEA-----------------
A0A4R0QJ17      ------------LSRDGY----LGKY--G--SGIYEEDPLLLT-------------
A4SF30          ------------MSKQGY----YGKY--G--YAEYEEESQLLS-------------
A0A533TZM3      YGYGKYGYGKYGYGKYGYGKYGYSRY--G--YGQYEEKA-----------------
A1BJQ6          -GTG-YGYGKYGYGKYGYGKYGYGKY--Q--YGQYEEQA-----------------
                                                                        

© 1998-2021Legal notice