BYKdb

Dataset for cluster tadcd of phylum chlorobi

[Download (right click)] [Edit] [Sequences] [Repertoires]

29 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A136PFK4      MPCSGGWRLRTVVEQARTLRPRSNPRFPFSPILLPGYIALGAFFRMASNNNYPYGRDGAN
A0A136K9M8      ------------------------------------------------------------
A0A533TY12      ------------------------------------------------------------
B3QVI2          ------------------------------------------MSKDFLNGNQAVATNSGS
B3QXQ6          --------------------------------------------MSSFNGN----MKDGS
A0A081SFU7      -------------------------------------------MENSKENGYAANGGASK
A0A395LXF8      -------------------------------------------MQNIKANGYRAGGEVPM
A0A533TG10      ------------------------------------------------------------
B3EF76          ------------------------------------------------------------
A0A4R0QIM7      ------------------------------------------------------------
A0A222SG44      ------------------------------------------------------------
A0A5M8I9A7      -----------------------------------------------MP-----------
A0A5C4S1T9      ------------------------------------------------------------
A0A317T3L6      ------------------------------------------------------------
A0A422HIT8      ---------------------------------------------MQDP-----------
A0A4R0QI83      --------------------------------------MSQPSLSQSKP-----------
A0A1B1Q171      ---------------------------------------------MTPD-----------
A0A1W6HT77      ---------------------------------------------MQDP-----------
B3EME9          ---------------------------------------------MPNN-----------
A0A369RAQ9      ---------------------------------------------MTNN-----------
B4S3Z6          ---------------------------------------------MTNN-----------
A0A4Q1D2F1      --------------------------------------MILGTYTFMEYSNQQY------
A0A1D8D4L1      ----------------------------------------------MDYKSHQA------
A0A5C4S4Y6      ----------------------------------------------MDYKNQQA------
B4SD09          --------------------------------------------MMVEKETTL-------
A0A4R0QJ17      --------------------------------------------MPVKHHDRLL------
A4SF30          ----------------------------------------------MKNESRLLGSGNND
A0A533TZM3      ---------------------------------------------MAELLPPAL------
A1BJQ6          --------------------------------------------MKVEQQTPIK------
                                                                            

A0A136PFK4      GSQLPSRSQQFSPARPQPYNTDMVRLQRTLRDVDEKKNRLQWLDYVGLLWRGKWIILACL
A0A136K9M8      --------------------------------------------------MDWIYVLLIF
A0A533TY12      -------MQQDFAFSTK------INYRQLFR----------------VLWNFKYFIAVVF
B3QVI2          NYPVFQRESDFLELEDD------FDFKRIFS----------------LLLRYKWLILSSV
B3QXQ6          YYS--KSKTMPFQVEEEDISVLIFNYLRALS-------------------RGKWVILITF
A0A081SFU7      FYRQLQQAQLEQEEDFG------VVFYNYLR----------------ALLKGKWVILFLF
A0A395LXF8      PDHRTLRQALQEDDDNA------DLYYRYLR----------------ALLRGKWIILILF
A0A533TG10      --------------MKE------IDIRELFN----------------VLNRRKYGIIFFL
B3EF76          -------MPEQNNFEQE------INIQELLR----------------LLWGRKYLILAVT
A0A4R0QIM7      ------MHNDSRPLQKE------INISEILG----------------ILWQRRGLMGSVM
A0A222SG44      -------MLEMKDAGSQ------LNVQELLR----------------LAWKNRYVIGLIT
A0A5M8I9A7      ----QLHNESPAPFEQE------INIQELLQ----------------VLWAKKRLITVVL
A0A5C4S1T9      ------MSQQQDQFEQE------IDIKDLLF----------------TLWHNRLIIAAVS
A0A317T3L6      ------MADNENQIEQE------INIQELLQ----------------ILWKNRVLIGVVT
A0A422HIT8      ----TPQSQQGNQFEQE------INIQELLQ----------------VLWKNKLIIGAVT
A0A4R0QI83      ----SITQAAAGHFEPQ------VSVQELLQ----------------LFWVKKRLIGLVI
A0A1B1Q171      ----HN-----NQFEQE------IDIKELLF----------------TLWHNRLVIGAVT
A0A1W6HT77      ----TPHSQSGNQFEQE------INIQELLQ----------------VLWKNKLIIAAVT
B3EME9          ----DP-----NQFEQE------INIQELLQ----------------VLWQNRLIIGAVT
A0A369RAQ9      ----DP-----NQFEQE------INIQELLQ----------------VLWNNKLIIGAVT
B4S3Z6          ----DP-----NQFEQE------INIQELLQ----------------VLWNNKLIIGAVT
A0A4Q1D2F1      ----PAGSQVRSEEEKE------ITIAEILQ----------------VIARRKIGIGIII
A0A1D8D4L1      ----VTGNQVQVQDDKE------ITLAEIFQ----------------IIARRKIGIGIIV
A0A5C4S4Y6      ----VVGNQVQNQDDKE------ITLAEIFQ----------------IVARRKIGIGIIV
B4SD09          ----STQSNNEQTQGSE------ISLGEILK----------------IILRRKYGILLIL
A0A4R0QJ17      ----FPFRAGRVGRKKE------LTAEELFR----------------IIRRRGPGMIMIM
A4SF30          GSRHTEYAAHHSAARRE------ITVDELFR----------------IIRRRRFGILVLM
A0A533TZM3      ----QREEYERPPSERE------ISIQEIIK----------------IILRRKWGILAIL
A1BJQ6          ----QQEEIER--GERE------ISLEEIFK----------------IVLRRKYGIILVM
                                                                       :    

A0A136PFK4      LVMGSLAAWYTYSLPFIYESSLQILVNEKDQ------SIDLLNNRNYWSNTD--RELKKE
A0A136K9M8      LGVLLTTVFYVLNARNIYESTTVIKITKPQGSILTSSPIPEFQDFGFLSDRY----ISNE
A0A533TY12      FVTLFDAYLKTISTPPSYRATSTVVI---------AFPEKKYLDFGNEGNDYNSNRLTNE
B3QVI2          IFSTLISALAIYFSLPIYKSEGTMLVQESSGKLGRGAGSDLSNLLASTYGVGMGSTIANE
B3QXQ6          VATVLISVIYSFRQKDIYEGITSVLVRDNTRQ----------SSVIVNFSVTDRRNLANE
A0A081SFU7      LVSTTIGILVSRSQKNIYEGVTSVLVKNTKSS---ASVVVSLDLQER--ESY-----ADE
A0A395LXF8      LTSVLVGYLINVSQPDIYEGVTTALVNNTRSN---ASVIISLDVMQQRGESN-----VDD
A0A533TG10      IISVALAWLFHKAEEPAYYAESIMLIDNPFGN---NPVDAALGTTGESDAKA----VKKD
B3EF76          AASLALALLFRYSATPEFRSTAVVMIKDSNG-----SEGDVLAPMLAVMPSSFIDPMKND
A0A4R0QIM7      AVALLLALLAHFSATPEYRPSSIVLIKTDKSS---ATAEKFLDPFGSLAGVS----IEND
A0A222SG44      GLALVIALFIYLSARPVYSATATIMLKSSQKE---ELVGE-LSGSERVGEMQ----VQNH
A0A5M8I9A7      VAVMSAVLIFHFSSTPEYRYPAMVLIKKSQNK---AMSG--IDPFGSLVSDG----LGND
A0A5C4S1T9      LLVMVLVLFYHFSAVPEYRSSSLVLIKESKS-----SPAELINPFESMTGFQ----LQND
A0A317T3L6      GLALVLVLLYHFSATPEYRSTSVVLIKTDKG-----GVGEMINPFESMTGFE----LQND
A0A422HIT8      GLVVVLVLLYHFSATPEYRSTSVVLIKSDKGA---AAMGEMINPFESMTGFE----LQND
A0A4R0QI83      LLVMLGGVLFHFSQTPEYRYPAMVLIKKSGD----DKIGG-INPYISLSG-S----LGND
A0A1B1Q171      VAALLIVFLMYLGSTPEYRSTSMVLIKSSKS----S-PAELMTPFESMTGSQ----LQND
A0A1W6HT77      GIVVFMVLIYHFSATPEYRSTSIVLIKNDKG----VVTGEMINPFESLTGFE----LQND
B3EME9          GVVLVLVMLYHFSATPEYRSTSVVLIKSDKG----G-MSEMINPFESMTGFE----LQND
A0A369RAQ9      GLVVLLVLLYHFSATPEYRSTSMVLIKQDKG----GAMGEMINPFGSLTGFD----LQND
B4S3Z6          GLVVMLVLLYHFSATPEYRSTSMVLIKQDKG----GAMGEMINPFGSLTGFD----LQND
A0A4Q1D2F1      FFSVLISLMAYFSQTPEYRATSVLMINQQQG------TDDLVQAVLGGAGAADSKMAQKD
A0A1D8D4L1      SLSLLVSILFYYSQTPEYRAVSVLMINQKND------SQGLVEAVLGGGPAADSKMAQKD
A0A5C4S4Y6      LLSLLTSILFYYSQTPEYRAVSVLMINKEND------SQQLVEAVLGGGPAADSKMAQKD
B4SD09          IASLVMAWIYNKAQTPEYHAVSVMMINENKA------PGDLLATLLGPSAGVDTKSARKD
A0A4R0QJ17      AGALLLAVIFYFLKTPEYHAVSVVMIKDDKR------SSDLLQAILGPEASVDINASKKD
A4SF30          GASLVLTMLVYVLQKPEYHAVSVVMIKDDKR------PSDLLQAVLGPDASVDMNASKKD
A0A533TZM3      SAAFFLTLFFHSIQTPEYRADSILMINNTDN------KGDLMEAIMGPNAVVDEKVTKKD
A1BJQ6          ALSLFAAIFYHYTETPEYHAVAVMMINDNKE------PTDLLATVLGSGAAVDNKAVKKD
                                 :       :                                . 

A0A136PFK4      LQILTSRPIYEKAAQRLLTLRYTDTIRRKTVLPMLVAVEAKLG------------TASHN
A0A136K9M8      IEVLKSFSIRSLTAKTLLDSAEANG--------NISSFYHLLN----------------D
A0A533TY12      IQIIQSRSLAEEVIKTLSVNAKNNTLELFGKRRYRTTLEKLLH----------SEVIGNP
B3QVI2          LFVLQSR----KMSYKLAKVLLQERWQKGGELYPLLWEKYPDD-----------------
B3QXQ6          IEILKSRTLAEQVAYKLLQIIYRDPIRKTDTLDII---KGAGS-----------------
A0A081SFU7      IEILKSRTVAEEVAYKLLQIVFKDETTKKDTLDLIREEDGKIS-----------------
A0A395LXF8      IEILKSRTVSEEVAYKLLQWVYKNPSEKKDTLSIILTADGKIA-----------------
A0A533TG10      VELLTSMPITQLAVRELLKTTKRDSLEFFGKRQYRSSFDDLIT--LVSPFSDKRSAQTMN
B3EF76          IELMSSLPIAEKAVEQLYRSPMRDSLELFGKRRYISPIDRLLAFAGLQGFSEK-----DA
A0A4R0QIM7      IELLKSFPLAEAAIRSLYYSNDRKPLELFAEREFVPKAFMPFR---WMKRSG------GG
A0A222SG44      LQLLASVPLAEEVIRSLVAGGAQDSLELFGNRPYKTKIQGFLDGMFGVSEPS------RQ
A0A5M8I9A7      IELIKSQPLAEDVVRKLYEEPGRQKLELFGEKVFKSPIADLFS---WLPGRTK-----PE
A0A5C4S1T9      IELIKSFPLAEDVVRTLYADTERDSLEIFGERTYVSPVGVMFGFLDGFSLLP------QK
A0A317T3L6      IELIKSFPLAEEVVRDLAARKDRDSLQLFGERRYVSPIGALFS---GLQFG-------MG
A0A422HIT8      IELIKSFPLAEEVVRDLFRKTDRDSLQLFGERRYVSPLQGLFG---GLSFGSA-----SA
A0A4R0QI83      IVLMQSAPLAEEVVRDLYDEPGRQKLELFGERPYTAPLADFFG---IKSE--------PV
A0A1B1Q171      IELIKSFPLAEEVVRSLYRQTERDSLELFRERRYISPLARFFG------AGNGDEPSVAE
A0A1W6HT77      IELIKSFPLAEEVVRDLYQQQDRDSLQLFGERRYVSPLKDLFG---GLSFGFG-----GK
B3EME9          IELVKSFPLAEEVVRELYARKDRDSLQLFGERRYISPIGHLFS---WMRF--G-----TR
A0A369RAQ9      IELVKSFPLAEEVVRNLYTKKDRDTLQIFGERNYVSPIGGLFG---WLSFG-G-----AA
B4S3Z6          IELVKSFPLAEEVVRNLYTKKDRDTLQLFGERNYVSPIGGLFG---WLSFG-G-----AA
A0A4Q1D2F1      VELLQSLPIAEMTVRALWSGGRRDSLEFFGNREYISPMWALIH--WIAPVQKAKAESRYL
A0A1D8D4L1      VELLQSLPVADMTVRALWNSSRRDSLEFFGYRPYISPIRRLVD--WIAPVKPLNASDRDI
A0A5C4S4Y6      VELLQSLPISEMTVRALWNNSRRDSLEFFGYRPYISPIRKIVN--WIAPVQQLKADDNSV
B4SD09          VELLQSHPIAELTVKELYKTTRKDSLEFFGKRKYVSPIDFLFS--AIDVFHPLNADQKA-
A0A4R0QJ17      IALFKSMPIARQTIEQLERTQQGKSIELFGTRSYHSPLMAVLM--HFKPFSVGEARMAE-
A4SF30          IALIKSMPIAELTIKELERSRNGKALEIFGNKTYQSPVIALVS--HIVPFKVGNAGPRK-
A0A533TZM3      MELLKSMPIAELTVKDLYKSNRRDSLEFLGNKHYFSWLTGPME--PVILFFKQSQKKKT-
A1BJQ6          VELIKSMPIAMLAVGELYKSARRDSLEFFEKRIYRSPVSRFFS--QLNVFTPLNADQNP-
                : :. *          *      .                                    

A0A136PFK4      QSSQDRHARLIDEVVESLHKMIEVKPSK--D-ADIIQVITRAGDPLEAALVANTFAEVYI
A0A136K9M8      PDDLSKGLKNEFEIAKMLKQVVQVVQKK--G-LDVVDLSVESPSPYEAAIICNAYAKTYS
A0A533TY12      LDTLRLTDTQVQEYAESLRGRISVKKIP--D-TDFLEISVSSPFADEAAYLANTVCNVYK
B3QVI2          -----STIVSEDVLAQRIRKQLQVAQAD--KSADVINISFESPSPFEASRMVDLTMDTYS
B3QXQ6          -----AKIARVDVIAARIMGAVSVEQVD--K-ADLLLIKFRSHDPEEAAVVSKAIAESYE
A0A081SFU7      ---------NIDAIAARVRSGISIAQPKATS-TSILLISFKSFDPFEAATVSRAIASVYQ
A0A395LXF8      ---------SVDEIAARVRMAMFVVPAKVPG-SNIITIGFRAFDPYEAATVSRAITEVFQ
A0A533TG10      LNGPEYPDDFIRINAMKLSVRIKVDPVR--E-TSLIKVSVASPFQDEAVYLTNTLCNAYK
B3EF76          EEVPASQKETMRNFAENLKGRITIDNPK--E-TNVLHVTVSSPFPEEAAVLSNALCRAYQ
A0A4R0QIM7      EEPQMSEEQLIRKYAGALQKRIMVANSR--D-TDILDVSVSSPFADESAVLTNALCRAYV
A0A222SG44      PVQAGEILDNIRPYAELLRSRLSVLNER--G-TDIITVTVSSPFPREAALLANIVGRTYQ
A0A5M8I9A7      SLDHLPIDLRIRVFSARFQARVQVTNTR--E-TDILSVSVSSPFPEEAAFLTNTLCRAYM
A0A5C4S1T9      QKEPVPFDVQMRGYASRLQQRVSVSNTR--D-TDILQVSVSSPFADEAALLTNAICQAYM
A0A317T3L6      KEEAADYDLLMREYAKTLQKRISVGNAR--D-TDILKVSVSSPFPDEAALLTNAICQSYM
A0A422HIT8      EEEPVDYDVQMREYAAALQKRIEVNNAR--D-TDILKVSVSSPFPDEAALLTNAICEAYM
A0A4R0QI83      DFGSMPREMMFKLLAARLQGRVAISSAK--E-TDILNVTVASPYADEAALLTNALCKAYM
A0A1B1Q171      KKRKIPLDLKLRSYASRLSSRVTVENGR--D-TDILYVSVSSPFSHEAALLTNVLCKTYM
A0A1W6HT77      EEEEVDFDLKMRTYAEALKKRVSVSNSR--D-TDILQVSVSSPFPDEAALLTNAICQAYM
B3EME9          EKEEKEYDIRMREYATALQKRISVSNSR--D-TDILQVSVSSPFPDEAALLTNAICRSYM
A0A369RAQ9      EKDSVDYDVQMRKYAAALQERIKVGNSR--D-TDILNVSVSSPFPEEAALLTNAICQAYM
B4S3Z6          EKDSVDYDVQMRKYAAALQERIKVGNSR--D-TDILNVSVSSPFPEEAALLTNAICQAYM
A0A4Q1D2F1      NENTPAFNLMIRYYALKLNKKINVEGSR--D-TSVLRVSVASPFADESTYLTNVLCNVYK
A0A1D8D4L1      IENTPAFDTMMRFYAIKLSKRIKVEGSR--D-SSVLRVSVASPFSDEATFLSNMLCSVYQ
A0A5C4S4Y6      IENTPAFNAMVRYYAVQLNNRIKVEGSR--D-SSVLRVSVASPFPDEATFLSNMLCDVYQ
B4SD09          -EAWHYSDALLRFHAMQLKDRIRVIPLR--D-TNLLQVSVASPFADEAVFLTNILCQTYK
A0A4R0QJ17      -DDGVGREELLRQRCITLTKRIRVEPVK--D-TNMLNISVASPFPDEAELLTNTLCDVYR
A4SF30          -DR--SPEEILRRRALLLTKRIRVTPVK--D-TNMLKVSVASPFSNEAELLTNTLCSVYR
A0A533TZM3      -P-----DEILRDFAIKLNKRIKVDAIR--Q-TNLLKVSVSSPFPDEAAFLSNTLCKVYK
A1BJQ6          -PYRALSDEELRRYAVKLNSRITVEAAR--E-TNVLKVSVASPFADEAAYLSNTLCRVYR
                                 .   : :         ..: :   :    *:  :       : 

A0A136PFK4      KDNKEQNSRKATQIRQFVADKMEKVRDSLAVIELRLKDYLESKNILGLDIQAHDLVQAKS
A0A136K9M8      DYSLEFSRLDLTNIINYLNTEKEKKFRDLKLSEAALEDFQQREGVVQLDVQADELVRSLS
A0A533TY12      KRDIQKSANQAISAQQYIKQELDQQRSELAKSEENVIAYARANKIYGVDSTASGVLSKLI
B3QVI2          TLSTEQNRLMARSALEFLENEKQRVENNLRVTEEQLRDFMNQKGLIQIDAQTTDVIKILT
B3QXQ6          ERSMKYTRNTARSVRQFLEDQLAQKRRLLYESEERLRRFMEDNRVISLDEEGRRMIQRYS
A0A081SFU7      ERKKKSSSNTARILREFLEDQLAQKKRQLAESERTLQSYMEENRVVSLNEEATRMIGRYS
A0A395LXF8      ERKRKSANNAARMLRQFIEDQLVQKKRQLAESERALQAYMEQNRIVALNEEATRMIQRYS
A0A533TG10      NADINRKSEKYKQSSTFIAEMLHNQQKFVAQTDSTLSRYMESNKMYENSGNVGQLLSKVT
B3EF76          QKDIEWNSEQAKSVNQFVEEQLGEQQKKVATVENNLSGYMEKQDIYELTGNADQLLKKLI
A0A4R0QIM7      NKDIEWNADQALQVKGFVSEQLVEQQAEIRATDERLSAYMKQKNIYELTGNAENLLQKLV
A0A222SG44      KQDVAWNVEQARNVNQFVVDQLREQQKKVAEVEAAVSRYMKQENIYEVTGGAEELQERLA
A0A5M8I9A7      RKDIEWNADQAIQVKDFVSEQLDKQKSEVAEIDGRLSSYMKKENIYELTGNAQNLLNQLI
A0A5C4S1T9      QKDIEWNADQAMMVKDFVNEQLQVQEKEIAAVEAKLSNYMKQQNIYELTGNAQNLLDKLV
A0A317T3L6      RKDIEWNADQAMSVKEFVSEQLASQQREIAAVEDQLSSYMKQQNIYELTGNAEKLLEKLV
A0A422HIT8      RKDIEWNADQAMSVKEFVGEQLSQQQQEIAEVEDRLSAYMKNQNIYELTGNAENLLEKLV
A0A4R0QI83      RKDIEWNADRAMQVKGFVTEQLDKQKAEINDVDARLSAYMKRENIYELTGNAQSLLTRLV
A0A1B1Q171      QKDIEWNADQAMMIKDFVSEQLAVQEKEIAAVESQLSSYMKQENIYELTGNAQNLLNRLV
A0A1W6HT77      RKDIEWNADQALSVKDFVSEQLAQQQREIAAVENQLSAYMKNQNIYELTGNAEKLLEKLV
B3EME9          RKDIEWNADQAMSVKEFVSDQLASQQKEIGEVENQLSSYMKKQNIYELTGNAEKLLEKLV
A0A369RAQ9      RKDIEWNADQAMSVKEFVGEQLAQQQREISSVENKLSSYMKNQNIYELTGNAEKLLEKLV
B4S3Z6          RKDIEWNADQAMSVKEFVGEQLAQQQREISSVENKLSSYMKNQNIYELTGNAEKLLEKLV
A0A4Q1D2F1      DSDIQRNSEKYIQSNRFVAEMLQEQKNMVGKADAALSEFMSKNQMYDVTGNTAALLQKLV
A0A1D8D4L1      KSDIQRNSEKYIQSNQFVAEMLQEQKDMMANADAALSKFMTENQMYEVSGNTGGLLAKLI
A0A5C4S4Y6      KSDIQRNSEKYIQSNRFVAEMLQEQKEMMAKADSSLSEFMAENQMYEVSGNTGGLLGKLI
B4SD09          NADIIRNSEKYTQANKFIAEMIQDQQQKVGEADNALSQYMQANKIYEVSGNTGAILAKVV
A0A4R0QJ17      QADITRNSEKYSQANSYIAKSLVEQQHKVDEADRALSGFMTRNEIYEVSGNTQQLLDKLV
A4SF30          EADIERNSEKYAQANSFIAKSLVDQKQKLDEADRSLSGYMSRNEIYEVSGNTQQLLNKMV
A0A533TZM3      ESDVDRNSEKYTQANQFITDMLQDQQKKVSDADNAQAKYMQSHQIYELTGNTQSLLDKLI
A1BJQ6          EADIDRNSEKYAQANKFIAEMLGDQQKKVGDADYALSKYMEANEIYELTGNTQQLLNKLV
                  .             ::          :   :     :     :         :     

A0A136PFK4      KLENDASQTQIQISTLSRKLQEARQQYQAVDSGFATE-FASGDWAYASQLQTQIASLKTQ
A0A136K9M8      AIDKEKTMTSIELAANEKKYSELSQKIDEIDPKLKVYLESEISKGYLPELQKQIAQLEIE
A0A533TY12      DAESQYLNTKTEYNIAKSRQDYLLNKLSSSDQAVSSR-ISDNMKSRSSQLQAQLRNDERD
B3QVI2          DLESKSQEIKVQRVAIDAALQNYKQQLNSFKPGIAEQYTDAYGATLSRC-QYRLAELETE
B3QXQ6          LAMSSAEEAEVMVKMLQSSLKAYEQEIRAMTPKLSNSAVQATIDPYTKLFQEEIAKLEVE
A0A081SFU7      QAQAQLDETGVLLNALTASLKQYNEELAALQPKLSNSAVQASIEPYTKQFQQEIARLEFE
A0A395LXF8      QAVAQMDEAAVMLSALNASLKAYNEELAALQPKLSNSAVQAAIDPYAKQFQAEIARLEFE
A0A533TG10      EIESKVNELKTESRITQNSLDFLQSKLTEADRILSTR-IAKTVNAKLSAILEDIKNQQKQ
B3EF76          DIDARYNEIMAERNILAKRLDFIRKKLSGEEKALSAN-IAESVGSQLRAVQNRIKAEEAD
A0A4R0QIM7      EAESRYNDALSEYNILKKRQEYITRKLSDEERAFSAK-VSRNIDRQAQELKTRIRQEETG
A0A222SG44      DADARYNEVQAEARILRQRLAFLRRKLSEDEKAYSER-VAETMAPRLKAVQDMIRKEESV
A0A5M8I9A7      AAETRYNDAKSEYNILKKRQDFIIRKLSQEEKAFMAK-VAENINRQSGDLKAMIRKQEKD
A0A5C4S1T9      EAESRYNDARAEYNILQNRQEFLVQKLSREEREISAQ-IARNVDRQSSELKKRIKEEEMA
A0A317T3L6      EAESRYNDAQAEYNILKNRQDFLVQKLSEEEKALSAK-IAKNVDQQSKELKSRIKQEEKT
A0A422HIT8      EAESRYNDAQSEITILKKRQDFLVQKLSVEEKALSDK-IAQNIDRQASDLKDRIKSEEKE
A0A4R0QI83      EAESRYNDAKSEQNILRKRRDFIVTKLSEEEKAFMAK-VSKSIDRQAGELKARIRNEEKS
A0A1B1Q171      EAESRYNDTRSEINILTKRQEYLVEKLSEEERAISAR-IAQNVDRQSSELKRRIMEEERT
A0A1W6HT77      EAESRYNDAQSEITILKKRQDFLVQKLSAEEKALSDK-IASNVDRQASDLKNRIKQEEKA
B3EME9          EAESRYNDAQAECNILKNRQDYLINKLSAEEKALSAK-IAKNVDQQSRELKERIKQEEKQ
A0A369RAQ9      EAESRYNDAQAEYNILKKRQDFLVQKLSDEEKQISAR-IAKNVDQQSIDLKSRIKKEEKA
B4S3Z6          EAESRYNDAQAEYNILKKRQDFLVQKLSDEEKQISAR-IAKNVDQQSIDLKSRIKKEEKA
A0A4Q1D2F1      DFEGRYKDLMAEYNIVMNSRDFLEKQLSQADRELSDR-IARNVNAQLGTIQDEIKAKEAD
A0A1D8D4L1      EFEGRYNDIMAEYNIVSNSRNFLENQLTQADREMSDR-IARNVNAQLGAIRDEIHSKESA
A0A5C4S4Y6      EFDGRYNDIMAEYNIISNSRDFLEKQLTQADRELSDR-IARNVSAQLSAIQDEIHSKESA
B4SD09          DADARYNDIKAESRIASNSLAFLEKKLSDTDREISSR-IAKNVNSQLGAIMDELRTLESD
A0A4R0QJ17      DADAQYNAIQAEYHTVSNTLRFLEQRLSESDKAIGSQ-IEQTVNAKLGAIMEEIRGMEGG
A4SF30          DSDAQYNAVQAEYHTVANTLNFLEKKLSESDKAISSQ-IEQTVNSQLSSIMDKIHGLENS
A0A533TZM3      DSDSKYYDVKAEYNITKNSLAFLDKKLTDGDRALSSQ-ISQNVTAQLGNIMDEIKTRERE
A1BJQ6          EADAKFKSIQAEYNIANNGLAFLEKKLSESDRAISSQ-IAKNVSNQLGSIMDEIKGLESE
                                                                     :   :  

A0A136PFK4      R---GLMLSVPFDGASKLAYDQKVKTLTEQMEMLESQLAPVIARLKNSNVGTLLSTTKQG
A0A136K9M8      RELQLSIIS-NDRVR-----QKAKEEYDRKISSLQESLDKNVKSLDAGM-------YVMT
A0A533TY12      L---VSLTS-QLGAD-----DPQVIEKKKEIVQLKQQMADLSRRDIAAG-------MSIA
B3QVI2          R---LLILSRNPGLKQKEENSPELKKIQDEISVLRSEIKVITSKMLSDDQDQLSSILSAT
B3QXQ6          R---DKILT-DPASRYNVNVQERLQEYNDKIESYKKRLQQSFERQVKQG-------LSNV
A0A081SFU7      R---DKVLA-DPGSQTNLNVQERIRQYEDQIESYKKKLQQAFDRQVKQG-------LANV
A0A395LXF8      R---DKALA-DPGIQFNISAQERVKQYEDQIEAYKKKLQQAYDRQVKQG-------LANT
A0A533TG10      Y---VQLIA-EKGVD-----DADTRNKKQQLDAAQSRYENLSRSQIAGE-------INYT
B3EF76          Y---MALLQ-QKGAA-----SPEVKARRQQIDQMKSQLDQVVRGKIAGE-------LAYS
A0A4R0QIM7      I---IGQVA-ATD------------MKKQELAALKQRLRELTRNAMAGE-------LAFS
A0A222SG44      L---SELIV-QRGPE-----DTAVRTKQEQIRNMKAQLDQITRTRIAGE-------IAYS
A0A5M8I9A7      L---IGQEG-EADEA-----SG-----RQQLTMLKQRLLEVTRNSLAGE-------LAYS
A0A5C4S1T9      L---IAMER-EGQGA-----TEAYAVRKQQLDLLRRRLEEATGNIIAGE-------LAFM
A0A317T3L6      L---ITLAG-ESGAE-----SSSYIAKKQQLDVLKQRLQELTRNMIAGE-------LAFT
A0A422HIT8      L---ISLAN-DAGTN-----SPQYASKKQQLDMLKQRLQELTRNMIAGE-------LAFS
A0A4R0QI83      L---IGVEK-EPSAE-----S------RQQLELLKQRLLDVTRNSLAGE-------LAYS
A0A1B1Q171      L---IEMER-LGNAS-----GEAYDIRKQQLELLRRRLEESTGNIIAGE-------LAFM
A0A1W6HT77      L---IDIAT-QNGTS-----DPSYVAKRQEVDVLKQRLQELTRNMIAGE-------LAFS
B3EME9          L---IAMAG-EAGTQ-----DAGYLAKKQQLDMFKQRLQELTSNTIAGE-------LAFA
A0A369RAQ9      L---IELAN-STGTE-----DGSYIAKKQQLDVLKQRLQELTRNMIAGE-------LSYT
B4S3Z6          L---IELAN-STGTE-----DGSYIAKKQQLDVLKQRLQELTRNMIAGE-------LSYT
A0A4Q1D2F1      Y---IAILR-VKAAD-----DPVAKGKKQELDQVRARYDQLSRSKIAGQ-------IEYV
A0A1D8D4L1      Y---ISLLR-EKTVD-----DPEVKGKKQELEQAKARYDQISRSKIAGQ-------IEYI
A0A5C4S4Y6      Y---VNVLR-EKPVN-----DPEVKGKKQELEQVKARYDQLSRSKIAGQ-------IEYI
B4SD09          Y---IKMVR-EKGID-----NPEVKIKRQQLDVVKTRYEQLSRSKIAGE-------IGYA
A0A4R0QJ17      Y---VALLK-QKGAD-----DPAVKTAKTRLDEVKSRYETLQRSQIAGE-------IGYA
A4SF30          Y---VALLK-QKGSD-----EPAVKAKKQELDEVKARYEKLQRSSIAGE-------IGYA
A0A533TZM3      Y---IQLIS-QKGAK-----DEEAKSKRQELDVVKARYDQLSKSKIAGL-------IGYA
A1BJQ6          Y---MQLVQ-EKGID-----NADVKAKRQQLEVVKTRYEQLSRSKIAGE-------IGYA
                                              :                             

A0A136PFK4      ELPTAPLGNLRQQIFEDEIALQALRAQGAAINA-ARAQVNAQ---MSAVPQQQMDVGRLV
A0A136K9M8      PEERR---EMVWELVKTGVMVNSDRIKNRVLGN-YVNEYETR---FNKLPSQIIEYARLE
A0A533TY12      NRTKQYQFGYIGQQLQNDAKLADLEYTAAQYQQ-LKNTYEKQ---LSQLPEKQLGYARLL
B3QVI2          NGDIAAE-ILLTKRKLLELDI--QRRQYDAQSAVLEQELEKKKLFFEKIPDNMIILARLK
B3QXQ6          NASEAYQ-ELFKNKLNTELELIEQKSKFEAYKK-LAEEYDKA---FLKSPGVNVEFGRLE
A0A081SFU7      DNSQYFK-EIYRKKLETELQIIGLQTKLKAYKD-LAQDYDRA---FLKTPGKNIEFARLQ
A0A395LXF8      NNTEYFR-EIYKKKLDTELQIVAVQTRLKAYKE-LAEEYDKA---FLKTPGKNIEFARLQ
A0A533TG10      GRTKKYSFDLIAEKLETERKLNLLSNSAIEYEK-LKQGYEAR---VNLLPKKQQDYAKLQ
B3EF76          GRAQKFQFDLISEQLQTDLRLAELNYSAQEFGK-LKNYYESQ---LNALPDKQLNYARLQ
A0A4R0QIM7      NKARQFQFDLISEQLQTEIRLAELSYIADEYKR-SKDYYDAQ---LNKLPQKQLEYARLQ
A0A222SG44      GRSQRYQFGLIAEQLQTDARLAELEFSASELNR-LRNYYQAQ---LRSLPQKQLELARLQ
A0A5M8I9A7      TKARQFQFDLISEQLQIDVRLAELGYIADEYQR-VKASYNSQ---LNQLPQKQLNFARLQ
A0A5C4S1T9      SKARQYQFDLISEQLQTDVRLAELSYIADEYLK-SKNYYESQ---LNRLPQKQLNYARLQ
A0A317T3L6      SKARQYQFDLISEQLQTDVRLAELSYIAQEYQR-SKNYYESQ---LNRLPQKQLNYARLQ
A0A422HIT8      SKARQFQFDLISEQLQTDVRLAELQYIAQEYLR-AKNYYENQ---LNKLPQKQLNYARLQ
A0A4R0QI83      SAARQYQFDLISEQLQIDVRLAELSYVAEEYQR-VKGVYNAQ---LNQLPVKQLTFARLQ
A0A1B1Q171      SKARQYQFDLISEQLQADVRLAELTYVADEYLK-SKNYYEAQ---LNKLPQKQLNYARLQ
A0A1W6HT77      SKARQFQFDLISEQLQTDVRLAELDYIAQEYLR-AKNYYESQ---LNRLPQKQLNYARLQ
B3EME9          SKARQYQFDLISEQLQTDVRLAELKYIAQEFQR-SKNYYESQ---LNRLPQKQLNYARLQ
A0A369RAQ9      SRARQFQFDLISEQLQTDLRMAELGYVAQEYLR-AKNYYESQ---LNRLPQKQLNYARLQ
B4S3Z6          SRARQFQFDLISEQLQTDLRMAELGYVAQEYLR-AKNYYESQ---LNRLPQKQLNYARLQ
A0A4Q1D2F1      GKAEKYRFDLISEKLQLDQKLNRLKFSATEYQR-VKKSYDDQ---LANLPEKEQAFVRLE
A0A1D8D4L1      GKAQKYRYDLISEKLQLDQKLNTLKFSAGEYAK-VKQKYDGQ---LAQLPEKEQNFVRLQ
A0A5C4S4Y6      GKAQKYRYDLISEKLQMDQKLNRLKFSAGEYAK-VKQKYDSQ---LAQLPEKEQNFIRLQ
B4SD09          GKAQKFSFDMVSEKLQIERKLNDLNFSASEFSL-LKQYYESQ---LSMLPIKQQEFIKLQ
A0A4R0QJ17      GRTKKFGFDMIAEKLQIERKLNELQFRAGEFSR-IRQYYEQK---LAALPNKQQEFLKLE
A4SF30          GRARKFGFDMVSEKLQIERKLNELKFRAGEFAR-IRQYYESQ---LSNLPYKQQAYLKLE
A0A533TZM3      GKAQKVNFDMVSEKMEIERKLNELNFRALEMGK-LKQYYDSQ---LSTLPTKQQEYAKIL
A1BJQ6          GKAQKFSFDMVSEKLQIQRKLNELSFSSREFSR-LKEYYEGL---LGQLPEKQQDYIKLQ
                            :       :                  :     .   *       .: 

A0A136PFK4      REQSASAKMYEDMLDEYNKKVLEEQSVTSTARIFEDAQPVLKPVSPNRTANILTGCFLGL
A0A136K9M8      RDKLTNEKIYILLEEKYQEALINQNARIGNVTIIDPAFESLLPSKPNRVFLLVSGAVFGL
A0A533TY12      RDQAVLNRNYTFLKQKYQEAGMAVASQVGKVTIIDPASIPGGSESPNMLNNLIRGALTGL
B3QVI2          RNVDVNEKLYLTISERYAETALWEQTQFGLGRPIDYGYLPEAPIKPKKQIFLLVGFLFGL
B3QXQ6          RKTKSAQELYLLLEKKYQEALIAEEQVPKMVEVIDWAITPGAPIAPNRKANILVGVVIGL
A0A081SFU7      RNNQTLQDLYSLLEKRYQEALIAEEQIPSGVEVIDLAVPNLVPVGPNRATNVILGVVVGL
A0A395LXF8      RNNKILEELFSLLEKRYQEALIAEEQVPSGVEVIDWAVPNPIPVGPNRRNNMILSVVIGL
A0A533TG10      RDRDVAGKTYTFLKEKLDESRILLGSEVGNVSIIGSAFRPFFPANSSPLKSMLIGLLIGG
B3EF76          RDREVVNSTYTFLKQKFEESRIKIASEVGRVVIVGPAYPPKLRESPDTKKILLVGLVLGL
A0A4R0QIM7      RDREVQSNTYTFLKGKLEESRIQIASEVGKVVVVGPAYPPERPVAPSLRKTLLVALMLGL
A0A222SG44      RDRDVVNRTYSFLRERLDESGIEIASEVGQVVVIGDAHPPDSPVSPNLGMNLFLGLFSGL
A0A5M8I9A7      RDRDVLNNTYTFLKGKLQESRIQIASEVGKVVIVGESYPLGGPIAPNLQKNLLIGLILGL
A0A5C4S1T9      RDREVLNNTYTFLREKLEESRIKIASEAGKVVIVGAGYPPLSPVAPDLKKNVLIGLILGL
A0A317T3L6      RDREVLNNTYTFLKEKLEESRIKIASEVGKVVIVGAAFPPIDPVAPDLKKNLLIGLILGL
A0A422HIT8      RDREVLNNTYTFLKEKLEESRIKIASEVGKVVIVGAGYPPTSPVAPDLKKNLLIGLILGL
A0A4R0QI83      RDREVLTNTYTFLKGKLEESRIQIASEVGKVVIVGEAYPLGGPVSPNMKKNLLAALILGL
A0A1B1Q171      RDREVLNNTYTFLRNKLEESRIKIAAESGKVVIVGAGYPPLSPVAPDLKKNVLIGLILGL
A0A1W6HT77      RDREVLNNTYTFLKEKLEESRIKIASEVGKVVIVGAAFPPVQPVAPDLKKNLLIGLILGL
B3EME9          RDREVLNNTYTFLKEKLEESRIKIASEVGKVVIVGAAFPPIEPVAPDLKKNLLIGLILGL
A0A369RAQ9      RDREVLNNTYTFLKEKLEESRIKIASEVGKVVIVGAAYPELAPVAPSLKKNLLIGLILGL
B4S3Z6          RDREVLNNTYTFLKEKLEESRIKIASEVGKVVIVGAAYPELAPVAPSLKKNLLIGLILGL
A0A4Q1D2F1      RDRAVVSKTYLFLKEKLDETRILIGSEVGSVSIIGAAFQPFIPESPVLVKNLLIGMVLGL
A0A1D8D4L1      RDRDVVSKTYLFLKEKLDETRILIGSEVGSVTMIGSAFKPFMPEKPELVKNILAGLVIGI
A0A5C4S4Y6      RDRDVVSKTYLFLKEKLDETRILIGSEVGSVTMIGSAFKPFTPEKPELIKNLLAGFVIGI
B4SD09          RDKEVVGKTYLYLKEKLDETRIMLGSEVGGVSIIGSAFKPFSPEKPVLSRDLLAGFILGG
A0A4R0QJ17      RDRNVASKTYEELKQRFDETSIFLGSEVGGVSLIGKAFRPFFPESPSLLKSLLLGVLFGG
A4SF30          RDRNVASKTYEELKQKFDETRIFLGSEVGGVSIIGSAFRPFTPEKPSLPVNLLLGVLFGG
A0A533TZM3      RDHEVVNKTYTFLKSKLDESRILLGSEVGSVSLVGDAFKPFKPESPDLKKNLLLGLVLGG
A1BJQ6          RDREVVGKTYLYLKEKLDETRIMLGSEVGGVSVIGSAFVPFKPEKPNLKKNMLMGLVLGG
                *.       :  :     :  :           .  .        .     :. . . * 

A0A136PFK4      AIGVGIALLLAYSDTTVHSPD-DLEKHGFTVLTAIPLIPEGMLNYEI-------------
A0A136K9M8      ILGIGFVITRNYLDKSIKTPD-DLENNGYSILAWIPSIDIKEKS----------------
A0A533TY12      LSGIVLSFVINLLDTAIHESD-YITDKGFVILSRIPWIGK---------------DKINF
B3QVI2          AGAVTFIYVKESLNTGIDGAE-KLKKKQYPLLAVIPDMEEVIKESYDEE--K--------
B3QXQ6          TFGVGIVMLIQFLDKTVYTPE-QAERLG-PLLATIPMMESFDDDVRDKSGAS--------
A0A081SFU7      VLGVGVVMLLQFLDQSVHTPE-QAEKLG-TLLATIPVIETFDESVRGKAGTE--------
A0A395LXF8      LAGVGVTLVLQFLDQNIHTPE-QAEKLG-MLLTTIPVIETYDETVRDKASAG--------
A0A533TG10      VMASIYTLISEFLDDSIKDEI-SLKNQGFTVLSQIPYVTNTPD--GSKATLG---NYIKE
B3EF76          GLGGALVFVLEMRDHSVKEEQ-FFDDHGFVTLARIPFVDKAEF--TLADGMK---KAVGQ
A0A4R0QIM7      GVGGALVRLLEAQDNSLRDDT-FLTEHGFITLATIPYVAPDESA-GIPESLR---KKIAG
A0A222SG44      GLSALLLISQNLLDDTIRDDS-FLEDNGFVELARIPFTGSGETH------EA---AVPFG
A0A5M8I9A7      GLGGALVFVKEMMDHSLKDDQ-FLENHGYLPLAAIPYVDSPGDEFNLQNTLS---RTLQQ
A0A5C4S1T9      GLGGALVFVREMLDNSLRDNE-FLEQHGYVPLAFIPFIADKARG-MQRKQSG---KKAKR
A0A317T3L6      GLGGAMVFVREMLDHSLKDDT-FLEDHGYTPLAAIPYVEDGNGK-DLPKTLK---GSLEQ
A0A422HIT8      GLGGALVFVREMLDHSLKDDT-FLEDHGFTPLAAIPYVPR-EGE-TLQGSFR---KSMDD
A0A4R0QI83      GLGGVLVFVQEMLDHSVRDDH-FLENHGFVPLALIPFVGETEQR-GLRERLS---ALLKG
A0A1B1Q171      GLGGALVFVREMLDNSLRDNE-FLEQHGYVPLAFIPFIADKARG-MQRKQSG---KKAKR
A0A1W6HT77      GLGGALVFVREMLDHSLKDDA-FLEDHGFVPLAAVPYVAREGE--TLQGSLQ---KSVDD
B3EME9          GLGGALVFVREMLDHSLKDDA-FLEDHGYTPLAAIPYVGDENES-DLQDSLK---KSIRQ
A0A369RAQ9      GLGGALVFVREMLDHSLKDDS-FLEDHGFTPLAAIPFVDSDGGG-SMQASMK---KSLKD
B4S3Z6          GLGGALVFVREMLDHSLKDDS-FLEDHGFTPLAAIPFVDSDGGG-SMQASMK---KSLKD
A0A4Q1D2F1      ILSASYVYGIEMLDDTVNEEMQFFKSLGFNIWGVVPFVNQANEYMNLESVEK---DGKKK
A0A1D8D4L1      VLAGLFTYGAEMIYDTVNEEMQFFKSLGLNIWGVIPFINSSSDYSGTYHEAK---RKIEK
A0A5C4S4Y6      VLAGLFTYGAEMIDDTVNEEMQFFKGLGLNIWGVVPFISSSSDYSATYHETK---DKIEK
B4SD09          LLAVLYTFGAEMADNTVKDDL-FFRDLGLTVLSVIPLVGQKGQTPFLDNKESFIKRFLYS
A0A4R0QJ17      MLAIGYAYIEEAMDGTLQDEG-LYEEIGLKPLSVIPMVGPGRYPAIQATGAS---RRIGH
A4SF30          LLAIGYTYIEESVDGTLQDDF-FFDEIGVRPLAYIPTVGPYGYPALPGYGKG---KLMES
A0A533TZM3      LLSAMYAYGAETVDDSVKDES-YFKDLGLPILSYVPLVTREGKSSLSMSGESRLSRLLYN
A1BJQ6          LLAVLFTYTAELVDDSVKDDS-FFRDIGLATLSIIPLVPGE-KNAVPSREVSGFNRILYN
                  .             :                 :*                        

A0A136PFK4      ------------------------------------ISNDPLSVRLNGRASSHLITHIQP
A0A136K9M8      ---------------------------------------------DLSSPDEFIVAS-DA
A0A533TY12      VPDIIKNIFSS-------------------------VLNNHNLIKSKQSNDALWISD-RL
B3QVI2          ------------------------------------YITVKGS-----KISTRLVSFLDV
B3QXQ6          ------------------------------------VKVIEGPDAEYKKIASHLVTHFDP
A0A081SFU7      ------------------------------------VKAEDETDLEYKKIASHLVTHFDP
A0A395LXF8      ------------------------------------DKVAEDPNAEYKKIASHLVTHLDP
A0A533TG10      TDQL----------------------------------------STDQRNTVPLITD-RL
B3EF76          LLVTIDPGKGNGKS----------------------NGNGRHPGQGSADGAPLLITD-KL
A0A4R0QIM7      ISAALPGLLGRSYAK--------GKAKTPPDGGAPVADGVSALNGTSPANPFVLMAG-QL
A0A222SG44      IAKLFSRFTNR-------------------------KNADVELHAGKSGAAPLLISD-YP
A0A5M8I9A7      ISSVISGLSLNGNGKVGGNLKHKKQHRNRSSYGLYKKSSTGKPIAFSPGQKPLLIAD-QL
A0A5C4S1T9      VGGLIEKLLV-------------QLSPKK-------EHERLALHTQATADEPLLMNN-SL
A0A317T3L6      LTGYLPKYGDNGK----------SSKYIK-------TNSQGKIVPSTHDRKPLLMAD-SL
A0A422HIT8      ITRALPSLNLNGNGKNG------TSKHKK-------VDSQGKSVPSSSKKPPLMMAD-SL
A0A4R0QI83      VAARLPALPLPLGGA--------AKAERRSSGGSKGKSSLGKPLPDGSGRKPLLIVD-RL
A0A1B1Q171      VGGLIEKLLVQL-SP--------KKEHER-------LALHTQATAD----EPLLMNN-SL
A0A1W6HT77      VRKLLPSFNGN--GT--------SGKHQK-------QNSQGKPVASSSKRPPLLMAD-SL
B3EME9          LSDSIPGFGASSNGK--------DASHVK-------MNSSGKSVPSTRESKPRLMAD-SL
A0A369RAQ9      FASVFPFLSGNTDGK--------KDQHQK-------KNSYGKPVESTRNKQPLLIAD-SL
B4S3Z6          FASVFPFLSGNTDGK--------KDQHQK-------KNSYGKPVESTRNKQPLLIAD-SL
A0A4Q1D2F1      HG-RFKKILKKNSDI---------------------QGDSEKEPVSQVR-AYPLMTD-KL
A0A1D8D4L1      KSVMLLDIFKKKEEQ---------------------INNPQSEVSGDIK-NNPLMTD-KL
A0A5C4S4Y6      NGKRLFEVFHNKSKK---------------------LNEPAKEVKSDIK-TYPLMTD-KL
B4SD09          KSQAFREKVLSEASV---------------------KGAL----------PMPMITD-SL
A0A4R0QJ17      MGGSLRR--LLSDGS---------------------STQPLEAQDGAVL-PVPLITD-SL
A4SF30          TGRTIRK--LLPGSS---------------------EGDGENSVTVTVL-PAPLICD-NL
A0A533TZM3      QSKAFREKLLLTGST---------------------SNGNKPYVPKVEEIPMPTIMD-SL
A1BJQ6          TSKAFREKVLLSGNG---------------------AGKRKGAQPKVET-PMPMITD-SL
                                                                      :     

A0A136PFK4      KAPISESYRSLRTAVQFAAI-----EEPVRKI-LVASSVPQEGKSTTSTNLAITLAQSGA
A0A136K9M8      KSSISEAFKVLRTRVQYAKI----EEEPLKTI-LITSTIPGEGKTTVAVNLAGSFALDGK
A0A533TY12      SSTFAESFRDLRTAITFSQS-----DKVIRSL-LITSSEPGDGKTTTCSNLAYAYALIGK
B3QVI2          ISPIAESFRRLQSNVIYS------HPDEKLKLIVVTSPGKGEGKTTVISNFAVALAESGK
B3QXQ6          KSSVSEAYRTLRTNILFSGVHDFNGSKKQGLIYIITSSSPKEGKSTTISNLAITIAQGGQ
A0A081SFU7      KSSVSESYRALRTSILFSSSFVGNGEKEDGNVFAVTSASPKEGKSTTISNLAITIAQGGQ
A0A395LXF8      KSAVSEAYRSLRTAILFSSASPTKENGKAGKVYLITSASPKEGKSTTVANLAITLGQGGQ
A0A533TG10      SSWYAESFRTLRTAISYCSI-----DNPIRSL-IISGVSIAEGKSSVCTNLGMALALNGR
B3EF76          SSPFSESFRDLRTNLTFARA-----GTPLRSV-LVTGTAVSEGKSTICANLGLAFALTGK
A0A4R0QIM7      SSHLAESFRDLRTNIIFSRA-----DSELNSI-LVTGTSIGEGKSTVALNLAFSFALIGK
A0A222SG44      STAFAESFRDLRTNIMFSRA-----DNPVNSM-LVTGTSISEGKSTVCSNLALSYSMIGK
A0A5M8I9A7      AYPLAESFRELRTNITFAQV-----DRTVKSI-LITGTEVGEGKSTVCINLAFAFALIGK
A0A5C4S1T9      DAGFSESFRDLRTNITFSRA-----DNPLKTI-MVSGTEMSEGKSTVAGNLGLAFALTGK
A0A317T3L6      SSPFAESFRDLRTNIVFSQA-----DRPLKSI-LVTGTEISEGKSTVCGNLAYAFALNGS
A0A422HIT8      SSPFAESFRDLRTNITFSQA-----DKTVKSI-LVTGTEISEGKSTVCSNLAFAFALTGK
A0A4R0QI83      ASQLAESFRELRTNVVFSQA-----DRNIKSL-LITGTEVSEGKSTVCVNLATAFALTGK
A0A1B1Q171      DAGFSESFRDLRTNITFSRA-----DNPLKTI-MVSGTEMSEGKSTVAGNLGLAFALTGK
A0A1W6HT77      SSPFAEAFRDLRTNIIFSQA-----DRKVKSI-LVTGTEISEGKSTVCSNLAFAFALTGK
B3EME9          ASPFAEAFRDLRTNLVFSRA-----DRKLKSI-LVTGTEISEGKSTVCANLAFAFALSGN
A0A369RAQ9      SSPFAESFRDLRTNITFSQA-----DRTLKSI-LVTGTEISEGKSTVCTNLAFAFALTGK
B4S3Z6          SSAFAESFRDLRTNITFSQA-----DRTLKSI-LVTGTEISEGKSTVCTNLAFAFALTGK
A0A4Q1D2F1      NSSFAESFRTLRTNLNFSRI-----DKPVKTI-LISGCSIGEGKSTVSTNLALAWAIADK
A0A1D8D4L1      NSSFAESFRTLRTNLNFSRI-----DKPFKTI-LISGCSIGEGKSTVSTNLALAWAIADK
A0A5C4S4Y6      NSSFAESFRTLRTNLNFSRI-----DKPFKTI-LISGCSIGEGKSTVSTNLALAWAIADK
B4SD09          SSAFAESFRTLRTALDYSRVDFSRIDSSLKFI-LVSGTAMTEGKSTVCANLGMAYAISGK
A0A4R0QJ17      TSSFAESIRILRTSIHYSRS-----GNPPQSI-LISGTAMWEGKSTVCLNLGMAYALVGK
A4SF30          DSPFAESIRMLRTSIQYSIP-----GKPPQSI-LISGTAMWEGKSTVCVNLGMAYALVGK
A0A533TZM3      TSPFAESFRTLRTALDYSRI-----DTPLKSI-LISGTAMSEGKSTVCANLGMSLALTGK
A1BJQ6          SSSFAESFRTLRTALDYSRV-----ESPLKSL-LISGTAMSEGKSTVCSNLAMAYALVGK
                    :*: . *.: : :.             :  ::.    :**::   *:. : .  . 

A0A136PFK4      RTLLIDCDLRRPTQNSVFGFPREPGLVNCLIGMAR--LDEAIRPSGIPNLDILSSGSIPP
A0A136K9M8      NVLLIDCDLRKPRVHSVMGVNRYPGLTDLLFGNND--LSEVIRPTKFDNMHFIPSGTIPP
A0A533TY12      KVLVVDCDLRRPSQHIMFSIKRSPGLSDYLAGQVQSLNSIINKSSKIENLFVLPSGQITL
B3QVI2          KIILVDTDFRRPYVHKMFGLDQQPGLTETLFDGVP--VEEVIMKSIVPNIDILTTGKRPS
B3QXQ6          KVLLIDTDLRRPIIHSIFGYNKEPGITNYLVGRAQ--IDDIVRNSPIQNLDIITSGTIPP
A0A081SFU7      KVLLIDADLRRPVVHAIFGYNKEPGITNHLVGRAA--LDDITRSSAIPNLDIITSGTIPP
A0A395LXF8      KTLLIDADLRRPVIHSVFGYNKEPGITNYLVGRAS--VEEITRITPIPNLSLITSGTIPP
A0A533TG10      RVIIIDCDLRLASQHNIFKIKREVGLTDYLYSDLKTIDDSFIKSTHVANLSVITAGKKIP
B3EF76          RVLIVDCDLRRPSQHKLLGSSKAPGLSNYLAGQEADMSKLIQP-TLNENLFLLPAGAAVP
A0A4R0QIM7      KVLVVDCDLRRPAQHRIASVPRSPGLSNYLTGVSSEVSGLIKATALHERLFILPAGRKSP
A0A222SG44      KVLVIDCDLRRPVQHQYLQTSRQPGVTDYLAGASDEIAEEFIQDAGYENLFLLAAGSPVP
A0A5M8I9A7      RVLVIDCDLRRPSQHRMLNTRISPGLSDHLAGTHADVRAIIQTTTMHENLSVLAAGSKPP
A0A5C4S1T9      RVLLLDCDLRRPILHRVFKVDRGPGLTDYLAGQQDDLKRLTRQ-VQHENLHLIPAGAKTP
A0A317T3L6      RVLLIDCDLRRPSQHRLYSCKKVPGLSDYLAGLEVDAEALIQP-TMHENLYILPAGNKTP
A0A422HIT8      KVLVIDCDLRRPSQHRMLNTLRMPGLSDYLAGVEKDLDVLLQP-TMHENLWLLPAGNSTP
A0A4R0QI83      RVLVVDCDLRRPNQHRLVNSNKSPGLVDYLAGVQGDVHSLIQPTTLHENLFLLAAGSAAP
A0A1B1Q171      RVLLLDCDLRRPSLHRVFKVDRGPGLTDYLAGQQDDLKRLTRQ-VLHENLHLIPAGAKTP
A0A1W6HT77      RVLIVDCDMRRPSQHRMLNTLRMPGLSDYLAGVETDLEEILQP-TMHENLWLLPSGSTTP
B3EME9          RVLIVDCDLRRPSQHRIYSCKKTPGLSDYLAGVEDDADALIQS-TMHENLFILPAGNSTP
A0A369RAQ9      KVLIVDCDLRRPSQHRNLNTMRMPGLSDYLAGQEKDINAVLQP-TMHENLSVLPAGSQTP
B4S3Z6          KVLIVDCDLRRPSQHRNLNTMRMPGLSDYLAGQEKDINAVLQP-TMHENLSVLPAGSQTP
A0A4Q1D2F1      KTLLIDGDLRRPSQHTILNKKRSPGLTDCLISDESEINEKYFQKTHLDNLYLMSAGTPVP
A0A1D8D4L1      KTLLIDADLRRPSQHTILGKKRSPGLTDCLIDDGKNDNDKYFQKTHVENLFLMTAGTPVP
A0A5C4S4Y6      KTLLIDADLRRPSQHTILGKKRSPGLTDCLIDNERESNDKYIQATHVDNLFLMSAGTPVP
B4SD09          KTLIIDCDLRRASQHKKLNVKREPGLTDFLYSQQANIDESFFQPTHIENLFVLSAGKKVP
A0A4R0QJ17      KTLIIDCDLRRPSQHVKLNCQRGPGLTDCLLGRDGDSYAPNIQSTGMDNLFLMSAGSKVS
A4SF30          KTLIIDCDLRRPSQHIKLNCQRGPGLTDFLNSENDEFSAPHIQTTQVDNLFLLSAGAKVS
A0A533TZM3      KTLIVDCDLRRASLHKKFGKNREPGLTDYLFSSEHSIDDRYFQSTEMDNLYLLSAGKKLQ
A1BJQ6          KTIIVDCDFRRASQHKKFSVKREKGLTDYLFGEDRSIDESYFQATHVDNLFLLSSGKKVP
                . :::* *:* .  :         *: : * .                .: .:.:*    

A0A136PFK4      NPSELIGSRRMRELLNDLEKDYDMILIDSPPIGAVTDAMILSTMTDTTILVVRAHKTKME
A0A136K9M8      NPSELLGSLQMKKTLENLKTQYDIIVLDSPPSISVTDSEILFKITDGTLLVVQSLKTPMD
A0A533TY12      HPQELLESKKMADLVLELENSFDIVLLDSPPFEFISDALLLSQSVDGVIIVAKTGKTSKS
B3QVI2          NPAAVNQSLKLRELLQSLKKKYDHVLVDTAPFGITTDAASIMKLTNGVILVVRFGQTSET
B3QXQ6          NPSELIGTQRMKDMLQLFRERYDIVLLDSPPIIAVTDPQVLAKVADGMILVLLSGQTQIE
A0A081SFU7      NPSELLGSDRAREFITQVRQRYDTILFDTPPVLAVTDAQVLATQVDGIMIVIAAGQTQVE
A0A395LXF8      NPSELLGSPRMREFLDQMREKYDMILFDSPPVMAVTDAQVLSQHADGVIVVLAAGQTQIE
A0A533TG10      NPNEFLSSQKMQDLILYLETKFDLVLIDSPP-LFLSDAAQLAQTVDGILIAARLNHTPRK
B3EF76          NPNELIGSQKMSETVELLEFRYDMVIIDSPPLLLISDAALLSQSVDGILLAARLEYTNKK
A0A4R0QIM7      NPNELLGSNKMAELLRQLESDWDMVIIDSPPAVMLSDAAILSRSADAILMVARIGHSQRS
A0A222SG44      NPNELLFSNKMTQLIERLKARFDIVLLDSPPVLLLSDAAVLSRSVDGVVVVAKTGYTSKD
A0A5M8I9A7      NPNELIGSQKMTELVKALEQEWDYVFLDSPPLLLLSDTALLTKSADAILMVVRIGYTNKN
A0A5C4S1T9      NPNELLGSQKMKELIRQLEAEWDIVILDTPPLLMLSDATVLSRHVDGILMVARMGYTNKN
A0A317T3L6      SPNELLGSNKMNELIKRFEDEWDYVILDTPPLLLLSDTTLISRAADGILMVVRMGYTNRN
A0A422HIT8      SPNELLGSRKMTDLVKELEEKWDYVILDTPPVLLLSDAALISRSADGILMVVRMGYTNKN
A0A4R0QI83      NPNELLGSNRMTELVGELEKEWDYVLLDSPPVLLLSDAALISQAVDGIIMVVRVGLTNKN
A0A1B1Q171      NPNELLGSQKMKELIRQLEAEWDIVILDTPPLLMLSDATVLSRHVDGILMVARMGYTNKN
A0A1W6HT77      SPNELLGSNKMTELVEKLEEEWDYVILDTPPVLLLSDATLLSRAADGILMVVRMGYTNKN
B3EME9          SPNELLGSNKMTGLVERLEEEWDYVILDTPPMMLLSDAALISRAADGILMVVRMGYTNRN
A0A369RAQ9      SPNELLGSNKMTELVKKLEEEWDYVILDTPPVLLLSDATLLSRTADGILMVVRMGYTNKN
B4S3Z6          SPNELLGSNKMTELVKKLEEEWDYVILDTPPVLLLSDATLLSRTADGILMVVRMGYTNKN
A0A4Q1D2F1      NPNELLGSEKMHEFLKKLSDKFDRIVIDSPP-IFISDAAQLVNEVDGVLITARLHYSSRA
A0A1D8D4L1      NPNELLGSEKMHLFLKKISDQFDRVVIDSPP-IFISDAAQLVNEVDGVLITARLHYSSRA
A0A5C4S4Y6      NPNELLGSEKMHEFLKILSEQFERIVIDSPP-IFISDAAQLVNEVDGVLITARLHYSSRA
B4SD09          NPNEILGSQKMIRLLKELDGKFDKVVFDSPP-LFLSDAAQLAHSVDGVLLAARMHFTNKD
A0A4R0QJ17      GSSELLASDEMQGLLALMKTRFDCILLDCPP-FFLSDPAQLATWTDGVVLVSRLRYTERK
A4SF30          GPSELLASDDMQRLLAVMKTRFDCILLDCSP-FFLSDASQLADWVDGIVMVSRLQYTGRK
A0A533TZM3      NCNELLGSAKMKTLIQELEGKFDKILFDSPP-LFLSDAAQLASSVDGILLAARLQFTSRR
A1BJQ6          NPNELLGSAKMQDLIRELETKFDKVIIDSPP-LFLSDAAQLAHSIDGILLVSRLQFTSRK
                    .  :      :  .   :: :..* .*    :*.  :    :  ::.     :   

A0A136PFK4      FLEKSREGLE-RVNTPLLGVVLNDFDVSQTYGSASYKY------YR--YYRYYNYYGGME
A0A136K9M8      AFSKVYDRFNSFSEPNLLGTVL----NNFSYKRNYGYY------YN--YYYYYSSGEKPN
A0A533TY12      ALKKL-ESLD-YIKPAILGFALIEKSTSLHYGL-----------YG--KYGKNGLYYDNL
B3QVI2          ELDQTVENLR-QVNANIIGTVL----SAFDYRKTSDHY------YNSGYYKYSYKRYTDY
B3QXQ6          LAKRSIDAIR-KVNAKIIGFVL----NSFDFNNSYGSY------YK--YYRYYNYYYEPK
A0A081SFU7      LAKRARQAVA-RVDGRFLGFIL----NNFDVANSYGSY------YK--YYRYYNYYYESK
A0A395LXF8      LAKRTKQALL-KVDAPIIGYVL----NNFDVTKAYGSY------YK--YYRYYNYYYESK
A0A533TG10      PLKDL-ADDH-LIFSNIIGVALIGSLKNSYGYGKYGHH------KY--GYGNRGNYYGQN
B3EF76          LLQEV-QKIS-YIKPQLLGVALIGSSSRDRY------G------YD--RYGYKG-QYKYK
A0A4R0QIM7      LLREA-MATD-FVKKACLGVAVIGPQDPSGY----GRY------HG--RYGYNG-YNHAE
A0A222SG44      QFREL-GKVD-YLRERMLGVALIGSVGQKKY-GKYGYD------YK--ALDYYG-AGAKI
A0A5M8I9A7      VLKDI-QKLN-YVKENLLGVAIIGPDEPSNY-GNYGRY------YG--RYGSKG-YYSYQ
A0A5C4S1T9      LLRDV-QKTE-HIRKNILGVAIVGPSVQDKYNYKYGRY------YG--RYSYKG-YYSRE
A0A317T3L6      LLKEV-QKLD-YLKHRLLGVAIVGPSEKIGY-GSYGRY------YG--RYGYKG-YYSYK
A0A422HIT8      LLKEV-QKLD-YLRNNMLGVAIIGPSEKSSY-YKYGRY------YG--RYGYKG-YYTYK
A0A4R0QI83      LLREV-QKIE-YFKKNLLGVAVIGPVDPIGT-SGFGRY------YG--RYGYKG-YYGYR
A0A1B1Q171      LLRDV-QKTE-HIRKNILGVAIIGPSVQDKYNYKYGRY------YG--RYSYKG-YYSRE
A0A1W6HT77      LLKEV-QKLD-YLKKTMLGVAIIGPSEKSGY-YKYGRY------YG--RYGYKG-YYSYK
B3EME9          LLKEV-QKLD-HIRKQMLGVAIIGPSEKAGY-GKYGRY------YG--RYGYKG-YYSYK
A0A369RAQ9      LLKEV-QKLD-YLKHRLLGVAIIGPSDKSGY-SNYGRY------YG--RYGYKG-YYSYK
B4S3Z6          LLKEV-QKLD-YLKHRLLGVAIIGPSDKSGY-SNYGRY------YG--RYGYKG-YYSYK
A0A4Q1D2F1      PLKQY-ASDN-FLHSKIIGVAIIDKPRPTKTRYGYG--------EG--KYGYGRSGYGRY
A0A1D8D4L1      PLKQY-ASDN-FLHSKIIGVAIIDKPRPSKTRYGYG--------EG--KYGYGRSGYGRY
A0A5C4S4Y6      PLKQY-ASDN-FLHSKIIGVAIIDKQRPSKIRYGYG--------EG--KYGYGRSGYGRY
B4SD09          PIRNF-AVDH-FLRPLILGVAMIESRDSQRYGYGYGKYGYGKYGYG--KYGYGKYGYGKY
A0A4R0QJ17      MLRNI-ISDP-VMKDSLLGVALIATPE-----------------LS--RDGY----LGKY
A4SF30          MLQNI-ISDP-YLKARLLGVALISTTE-----------------MS--KQGY----YGKY
A0A533TZM3      PLHDF-TTDH-YLRPLMLGVAVIESSDQGLFGYGYGKYGYGKYGYG--KYGYGKYGYSRY
A1BJQ6          PIQDF-VSDH-FMRPLLLGVALIGSRQ------GTG-YGYGKYGYG--KYGYGKYGYGKY
                                 :*  :                                      

A0A136PFK4      EEESSRRKDRRAKAIANGEATEKQPRLHG
A0A136K9M8      -----------------------------
A0A533TY12      --SDIG-----------------------
B3QVI2          --HEEKEV---------------------
B3QXQ6          --GKNKNVKQGFLTKIIERLVDKV-----
A0A081SFU7      --GTPKIKKSFIEQLSDRFIGK-------
A0A395LXF8      --ATPK-KKNFFEALSDRLSGIKS-----
A0A533TG10      -----------------------------
B3EF76          --TYSH-----YIDTPES-----------
A0A4R0QIM7      ----PS-----AAEEREVAGNVLR-----
A0A222SG44      -----------------------------
A0A5M8I9A7      --TNNK-----YLTPDIAKEEKDV-----
A0A5C4S1T9      --SYQK-----YLDTSST-----------
A0A317T3L6      --SYSS-----YLDEQRN-----------
A0A422HIT8      --SYSS-----YLEPEKTKG---------
A0A4R0QI83      RSSYTS-----YLEAPEEERAG-------
A0A1B1Q171      --SYQK-----YLDTSST-----------
A0A1W6HT77      --SYSS-----YLEPEKNKG---------
B3EME9          --TYSS-----YMEPEKTKG---------
A0A369RAQ9      --SYNA-----YLEPEKSNG---------
B4S3Z6          --SYNA-----YLEPEKG-----------
A0A4Q1D2F1      --S-SV-----YPEKL-------------
A0A1D8D4L1      --S-SV-----YPEKL-------------
A0A5C4S4Y6      --S-SV-----YPEKL-------------
B4SD09          --GYGQ-----YEEEA-------------
A0A4R0QJ17      --GSGI-----YEEDPLLLT---------
A4SF30          --GYAE-----YEEESQLLS---------
A0A533TZM3      --GYGQ-----YEEKA-------------
A1BJQ6          --QYGQ-----YEEQA-------------
                                             

© 1998-2020Legal notice