BYKdb

Dataset for cluster tadcd of phylum candidatus-omnitrophica

[Download (right click)] [Edit] [Sequences] [Repertoires]

27 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1G1IP08      MDLITMPDPKVAPPYSTKESQISTGAPEERLDASIHSYVFVLWKRKWLIAASIVFCLGIS
A0A2J0KU82      --------MEREPLYKFYK------------EWELKDYIEVIIRRKKILLTFLLSLVFIV
A0A1G1K0W1      ----------MAEVPELDYSSGVFQSEEEADAYNLQLLWKAVQNKRGIIVTITGIAFVFS
A0A1G1K4H2      ----------MAEVPELDYSSGVFQSEEEADAYNLQLLWKAVQNKRGIIVTITGIAFVFS
A0A1G1LHA8      ----------MVNVPESALGGMQFESERESDEVNLELLWRIFRTRSWFIFTVVAMVTVLA
A0A1J4VP59      ------------MTLNDGIGNVPKMGLDGNQSTDLAKYWFVFLAHLRIIASATGVFFIIS
A0A1G1PGV5      ----------------MSPTLSEAVRQAKTLEWRFDDYVVFIRRHWLTIVLGGLLGWGAA
A0A660WJ06      -----------------------------MESIHLIDFLNIIKKKKILFLNFFLGTLTIA
A0A351I6G3      -----------------------MENTTFNKELHIKEYISVILRRKWTLIAFFLITVTAV
A0A2J0LAF9      ---------------------MFFQSEKGQKDIHLKNYLFILFNRKWIVISFFFIIVTTI
A0A2J0LM30      ---------------------MFFQSEKGQKDIHLKNYLFILFNRKWIVISFFFIIVATI
A0A0F0CSR3      ---------MGVKKKGNKNMPNSTQNPFLEREQDIKEYLSILYNRRWLIISFTLVLCTIS
A0A1G1IVX7      --------------------MAAAGSVFGEEEIHLRDYYYVLMKRRRLILTFLLAALSLG
A0A1G1KQI3      ------------------MTTRPYLEQEESEAVNLRYYFDLIFRQRVPIVTFLIIIVTVA
A0A2H0LEC5      ------------------------MALIGEVDWKPEDYLHAAFSHKFTLFMITLVIGSYA
A0A1W9RLH0      ----------------MRGMIEEKEIGYSPSEEGIRDILNKIYKRRWFIFNFTFLCIVFT
A0A3C0MWS5      --------------------------MQAQEVSGTSEYPDILIRRRKTIILFFVLTLAAV
A0A2H0LL91      ------------MVSMDQPAVGYPNSPEEAESINLSYYLGLLYRHRVFLFTFFFISVTLV
A0A2J0LFS5      ------------------------------------------------MVTFFVAIVSFV
A0A1V5SP48      ---------------MPNVPEAQNPQIHRDTEMDFKKFFSAVRDRYIIIIILTTVILAGV
A0A1J4Z4I0      -----------------------MIPKSDLKELNFNDYLEIVGKHRWIVVTFFVAIVSFV
A0A2J0LS24      -----------------------MIPKSDLKELNFNDYLEIAGKHRWIVVTFFVAIVSFV
A0A1G1JZ27      ------------------MKIFPSSKISDELQLSLYDYWYIIQKRKRLALTFFLIVVIST
A0A1G1K375      ------------------MKIFPSSKISDELQLSLYDYWYIIQKRKRLALTFFLIVVIST
A0A7C5FNS3      -----------------------MIPPSDLRELTVKDYFDIVLKRIWIVILIVVVITGFI
A0A1G1JR53      --------------------MESPRPSIKEEGLQLKNYTHIIRRRADVLILFFVATVSVI
A0A1G1KL63      ----------------------MTANLEKQKERHLKDYIEVLRRWRDIAITFFVSMVLLV
                                                                            

A0A1G1IP08      TFINVTQKPVFRASTEVVLQPKESDT-SSSSVHPG----NSIMQDPTFLLTQLRVIKGPQ
A0A2J0KU82      SVYSYTATPIYQATTQILIERNEPQILNFQEVYAM----PS--AETEYYQTQYRILKSRS
A0A1G1K0W1      LLYALHLPTVYTARTKIFIEGGKESAFQNPEMMES----PAANPLPTYFQTRAEMLKSHH
A0A1G1K4H2      LLYALHLPTVYTARTKIFIEGGKESAFQNPEMMES----PAANPLPTYFQTRAEMLKSHH
A0A1G1LHA8      SIYALRLPNVYTARTKLLVQKVDPSPLQNPELMK-----PTTAYGDTYYLTRIEVMKSRP
A0A1J4VP59      VFHFFSLPNIYTATTTILAEQTETPPSRQEMLKTTTSTDVD-----EYYGTQLAILRGLK
A0A1G1PGV5      AWWVSTIPNSYQAQTRLLIDRYSGEPVGFGETASMSSARRDI----EFLATEYQLIISRP
A0A660WJ06      LAINALQKPVYKTSVEILVERSQPEVLLTGEGYRFSV--D-----KTFFQTQFRLLKSDN
A0A351I6G3      TFATFKQHPIYRAVSTIIIDVAEPDILAVKDIIKLGE--TNYFAYRAYIETQQEIIKSRN
A0A2J0LAF9      TIATFMQKNVYRAAATVIVDAESPDVLSVKDIVKLGE--SNYFAYKDYIETQQEIIRSRR
A0A2J0LM30      TIATFMQKNVYRAAATVIVDAESPDVLSVKDIVKLGE--SNYFAYKDYIETQQEIIRSRR
A0A0F0CSR3      LIRTFMMRPVYEATTKILIQKKAPRIIKIDEMDTTNY--SA----SDTLFTQYKILESD-
A0A1G1IVX7      IFFTFTERVIYQASATLLIEKDNPNVLDFKEVLTFDA--SS----TDYYQTQYQMLKGAG
A0A1G1KQI3      VLVVLKLPNNYQAVAELLFDNPEAVSAPERELATPNY-------GQDHIATQLQILKGIS
A0A2H0LEC5      YFREAQKPDIYQASTEIVIEQDDADLVQFQRGARYNANAGD-----QFLRTEHMLIRGPE
A0A1W9RLH0      LFFSFKVKPVYRAKTRILIESKVPKIVQFEDVYL-----TDYGNSDRYYNSQCEILKSNT
A0A3C0MWS5      GMGTVLMTPVYQAKAVLLIDVAGPDVVATTANVAMESQGASYYSYREYYRSQMAIVKSYP
A0A2H0LL91      GIFLMKLPDQYRSTTQVLIE-SAPVSAGASEELEPTF--QSY----TYVDTQAEIIASIP
A0A2J0LFS5      AFFSFWVEPTYRATTVILIERQQPKVLSVEEVYGMGL--ADK----EYYETQYKILRSRT
A0A1V5SP48      LFYNSTLVPIYRATTQLMIEIPEFVGHDTKEAKSPTI--GSS----DYFNSQYEILRSVS
A0A1J4Z4I0      AFFSFWVEPTYRATTVILIERQQPKVLSVEEVYGMGL--ADK----EYYETQYKILRSRT
A0A2J0LS24      AFFSFWVEPTYRATTVILIERQQPKVLSVEEVYGMGL--ADK----EYYETQYKILRSRT
A0A1G1JZ27      ALYSLLSPKIYKATTRILIERSNQNILSFDNIFPVQM--AGL----DYYPTQYKILRSRS
A0A1G1K375      ALYSLLSPKIYKATTRILIERSNQNILSFDNIFPVQM--AGL----DYYPTQYKILRSRS
A0A7C5FNS3      AFKSFSTPKIYQTQVKLYIGKTTPRVSGKEDII--------YKGSPPTKEEMLNLLKSRV
A0A1G1JR53      TIGSFIMEPVYRATTTLLIDPESPNVLTTTGMVELES--QNYFSYKEYYQSQAELLTSYT
A0A1G1KL63      TISSFIMKPVYRATLTMIIDPESPNVLTATGMVALKS--EDYLSYKDYFQSQMMIMCSHS
                          : :   :                                     :: .  

A0A1G1IP08      LAERILQKFSTGE-----------------ERQLAADCFALKGNWAKKDAPFTEREQGFL
A0A2J0KU82      LAEKIVEKLNLTA-----------------SPRF---------------------QGGNP
A0A1G1K0W1      ILEQAAKELNLVE-----------------------HYQKVNKRIKTNE---------EA
A0A1G1K4H2      ILEQAAKELNLVE-----------------------HYQKVNKRIKTNE---------EA
A0A1G1LHA8      ILAPIAERLNLPE-----------------------HYG-----VETTE---------NA
A0A1J4VP59      IEKMVKAELGGDS---------------------------------------------EG
A0A1G1PGV5      VLEEVLRTMNLGG----------------------------FPPFSISN---------DP
A0A660WJ06      ILEKVINRIS-------------------------------PDIPPSQK---------IS
A0A351I6G3      IAMQVINNLGLAD----------------------------KEEFKKEK---------DP
A0A2J0LAF9      TAHKVMKNLGLKD----------------------------RTEFIRSK---------DP
A0A2J0LM30      TAHKVMKNLGLKD----------------------------RTEFIRSK---------DP
A0A0F0CSR3      ---------------FLAEKVFKTLGDYIPWDKWHGRKKINTSKPLTDL---------QK
A0A1G1IVX7      LIRELLHEERLENDPYLEGLVRGRMRNFLRKQPWVAGI---LGKFLVPQ---------SP
A0A1G1KQI3      VTEEAVKKTNYHE----------------------------KVGMSMER----------A
A0A2H0LEC5      ILQSVVKTLNLDA----------------------------FPPFARSE---------YP
A0A1W9RLH0      IAKMVLDMLGDYK----------------------------PWDIWHGRKKDATFTEEEK
A0A3C0MWS5      IIKQVFDEFGVGK----------------------------SEKYAKAK---------DP
A0A2H0LL91      ILTVAAEKEDLAN----------------------------FFEVEDLR---------EA
A0A2J0LFS5      LIKLIFDDMNLYL----------------------------DPEFSDAR---------DP
A0A1V5SP48      LARKIAEKLDLKA----------------------------LPEF-QGK---------IP
A0A1J4Z4I0      LIKLIFDDMNLYL----------------------------DPEFSDAR---------DP
A0A2J0LS24      LIKLIFDDMNLYL----------------------------DPEFSDAR---------DP
A0A1G1JZ27      IAKRVMDELHLWP----------------------------QFSW--AS---------DP
A0A1G1K375      IAKRVMDELHLWP----------------------------QFSW--AS---------DP
A0A7C5FNS3      VAERVVKILNLLS----------------------------DEEFIDVK---------DP
A0A1G1JR53      LVKKVFNEFGLEE----------------------------QFEYFDAK---------EP
A0A1G1KL63      LAKKVFEDFKLGE----------------------------TKEYYKTK---------EP
                                                                            

A0A1G1IP08      VSMIRGF-ISAEQVERGARIIAISMTGYDAYGVKKMVDTAAETYIDLNYETQIDAFKKSF
A0A2J0KU82      IDALLGM-IIIEPVGK-SRLVNINVQSDNPQFAATIANTIAEEYVKKDIEDKLFTTKYAV
A0A1G1K0W1      ADLLGDDKTNVKLLKG-TQIVQLSVTDTDPQWAAKIADGISDTFIKESWRERLFISEQIL
A0A1G1K4H2      ADLLGDDKTNVKLLKG-TQIVQLSVTDTDPQWAAKIADGISDTFIKESWRERLFISEQIL
A0A1G1LHA8      AQILRGN-LDAHLVRN-TEVIEVALSDRDPKMAARIADAVAEHFARETWREQLFISDQVL
A0A1J4VP59      YA------ISASHIRD-TRILSLSVTHLKPELAAKIANKFAEIYVRESKHENAFIGQQIL
A0A1G1PGV5      AGVLSGL-VSVVPVRG-TKLVDIVVTSTNPTLAMRIANTVAETYVQLNLERRQQQATGGA
A0A660WJ06      LKEKIKSSIIPKQIPG-TRIFSIIVVGENPEWVAKVANTLAEVYVEENIEARIKASSQTF
A0A351I6G3      VGHLLKK-LKVELVKD-TRIIKISIDDKDPRQAVLIVNKFAKVYTDSNIASRINPSNEAE
A0A2J0LAF9      LETLLKK-LRVELVRG-TRILKINADDNDPVQACRIANEFANVYVDSNIALKMRTSNEAE
A0A2J0LM30      LETLLKK-LRVELVRG-TRILKINADDNDPVQACRIANEFANVYVDSNIALKMRTSNEAE
A0A0F0CSR3      IETLLSH-LKITPIPN-TELVLIKFEDIDPVLSAKIANLWANSYISYILDTRFDVSSYAS
A0A1G1IVX7      EDVFAAHMLQIKPVRN-SQLVSVIVLHPDNRRAASIANTLARLYIEQNLRNRYEVSTQAT
A0A1G1KQI3      AGSALGA-LSTIQIKG-TRIVRVVFQSEDPKIAAEMVNAICEGYIKKNIENRLYFSQEIM
A0A2H0LEC5      ADLLAGM-VSVQPVRG-TNLVNISVTGKKPDLVARISDAVAETYADRNLQRRIEKTGGGT
A0A1W9RLH0      IKALLKN-VKVKKAVR-SQLVDILVEDTDPELAAKIANFWVGAYLNYIQQSRSSLTKYAS
A0A3C0MWS5      MKEFLKT-IDVQSVRD-TRLMDVNVENEDPVIAAKMVNRIADLYIRRNLDYIS-------
A0A2H0LL91      VFVLKKK-LRVRAVRG-TQLINISIATPSAEKSAAIVNSIAETYVKQSIQNRLFFSKEIL
A0A2J0LFS5      ISVFISR-LTIDPVRN-SRLVNLHFDGKDPQKITTIANTLAELYIKQDAEIRTKASRDAV
A0A1V5SP48      ELALQEM-ITVKPVKN-SRIVMLSVESSRPELAANIANALADIYIQQNIEGMMFMSKEIL
A0A1J4Z4I0      ISVFISR-LTIDPVRN-SRLVNLHFDGKDPQKITTIANTLAELYIKQDAEIRTKASRDAV
A0A2J0LS24      ISVFISR-LTIDPVRN-SRLVNLHFDGKDPQKITTIANTLAELYIKQDAEIRTKASRDAV
A0A1G1JZ27      PAAFLQK-VDIDPVKQ-SRLVDVSAYSTSPKQAADMANAMVKFYIEQNLSNKLAMTQQAA
A0A1G1K375      PAAFLQK-VDIDPVKQ-SRLVDVSAYSTSPKQAADMANAMVKFYIEQNLSNKLAMTQQAA
A0A7C5FNS3      AAKLIGM-VSIDSPKD-TNVVFLKVTGKSPLKITKIANTWAEEFIKVDIDNRASAAKYGV
A0A1G1JR53      IKKFLKT-IKVDPVRD-TRLLKLNVDNKDPELAAKIANRMANLYVMRNLYYIS-------
A0A1G1KL63      IKNFLKT-IRVDPVPD-TRLVKLSVDNKDPQLAANIANRMAELYVMQNLYYTS-------
                                 : :. :            : :     :                

A0A1G1IP08      SVISKSLNEIREKIKAGEMALQK-------------------------------------
A0A2J0KU82      GWLTDEMKKMKEKVEESEKKLQEYKETNELV-----SLEESQNIVVQKLAELNSKATQAK
A0A1G1K0W1      EWFPKEGETLQK---SSGINQLRQLDKEGAI-----------------------------
A0A1G1K4H2      EWFPKEGETLQK---SSGINQLRQLDKEGAI-----------------------------
A0A1G1LHA8      KWFPEEGKILEM---NSPIGQLRRLEND-PI-----------------------------
A0A1J4VP59      QLLPGSPEAV---LPGGSAVVSQGFSKQEFA-----------------------------
A0A1G1PGV5      EWLQEEVVKTEGQMKAAQEALQGFKEKHQMV--SLEDQQNVIVQRLQELSSAATEAKTAR
A0A660WJ06      VYLNKRINELKNKLERDQKELARIEQSAGIYTFISGKSGSLESSKLEDFNSRYLSARAER
A0A351I6G3      TWLREEVDKQKLKVRESEFSLQAYKEKNNIVGSIEDKQNIINDA-LMKLNTVYLDAQRKR
A0A2J0LAF9      DWLKKEVDKQKTKVREAEFMLQSYKEKNDII-SIENKENIINDS-LISMNASYLAAQKKR
A0A2J0LM30      DWLKKEVDKQKTKVREAEFMLQSYKEKNDII-SIENKENIINDS-LISMNANYLAAQKKR
A0A0F0CSR3      GWLDDKIKEEKNNLETAEKTLQEYRKANTII-----------------------------
A0A1G1IVX7      ELISGQIGILKDKVAEADLKLQKYKEEHSLV-----------------------------
A0A1G1KQI3      KLLPAETQKTLKS--QTPMGQLEELSQKELI-----------------------------
A0A2H0LEC5      QWLQEELAWTEKKMRAAQLELQNFLEEHETV-----------------------------
A0A1W9RLH0      TWLEKEIERAKKKVEEAELALQKYREENNII-----------------------------
A0A3C0MWS5      ------------------------------------------------------------
A0A2H0LL91      NLLPEGGGKKTIEDLSPIGQLEKLEDIKFAA-----------------------------
A0A2J0LFS5      SWLMEQIVSVKKRLEESETALVKYMEQEKIT-----------------------------
A0A1V5SP48      RVISGEHGLPEPGMPSD--ILPSAAERQKII-----------------------------
A0A1J4Z4I0      SWLMEQIVSVKKRLEESETALVKYMEQEKIT-----------------------------
A0A2J0LS24      SWLMEQIVSVKKRLEESETALVKYMEQEKIT-----------------------------
A0A1G1JZ27      EWLKGRSKDV--------------------------------------------------
A0A1G1K375      EWLKGRSKDV--------------------------------------------------
A0A7C5FNS3      SWLKEQINETLKKLEDEEKKLNDFLKENRIV-----------------------------
A0A1G1JR53      ------------------------------------------------------------
A0A1G1KL63      ------------------------------------------------------------
                                                                            

A0A1G1IP08      ------------------------------IIK---ELQ---------LLDQFKVYGDKH
A0A2J0KU82      GKKLETENKYKQVEENRDKPDTLPSVRDNALVQ---ELKQVCATKEGTLSEMMKRYKEKH
A0A1G1K0W1      --------------------TSLPSVAKDPVIN---SIKEERIKVDAMMRELSKRYTSEH
A0A1G1K4H2      --------------------TSLPSVAKDPVIN---SIKEERIKVDAMMRELSKRYTSEH
A0A1G1LHA8      --------------------ASLPSVMQDPVIG---GIEQKQMGVDEEMTVLSARYTPEH
A0A1J4VP59      --------------------SSLNSVSGDPQVT---QLLNEKLGIQSKLTELSQRYGPEH
A0A1G1PGV5      LNAEAEWAEISRALSAGRPVDSLPIVRQSPRIL---TLEPQIAAKETELSDRQKIYGEKH
A0A660WJ06      IELESKLKEFEKLYKEKKYSELKEII-DDPVIS---DLSAQLREAEITLISLKKEYLEQH
A0A351I6G3      IQAESAHKSSVDTEGNLRLENLSTLLSNNEVLQ---QLKKDYSKQQAILAEYKEVYKNKH
A0A2J0LAF9      VSSETTYKSLVDGGGKLNLDRLPTILTDNDILK---ELKKEYLKQEALLVEYKKVYKDKH
A0A2J0LM30      VSSETTYKSLVDGGGKLNLDRLPTILTDNDILK---ELKKEYLEQEALLVEYKKVYKDKH
A0A0F0CSR3      ---------------------IDTVDEEHRVLN---KLLAKKSELEVLLSEKQEYYKAQH
A0A1G1IVX7      --------------------SIPSLHEKDQFLQ---DAKLQLMKLQAREARMAKRYLPAH
A0A1G1KQI3      --------------------ESLPSVQADPTLR---ELKKKKTEIENELTALRQQYREQH
A0A2H0LEC5      --------------------DFSTNRQ-NTIFQRISDLNRALTQVKQERIEAETRYREKH
A0A1W9RLH0      --------------------DDPATTSEDTALL--NKLIERKAELETELAQQLNYFKEKH
A0A3C0MWS5      ----------------------------KSELL--NLLKNEYLRLDARLAEYSKIYKEGH
A0A2H0LL91      --------------------TLPSVRSDPTILE----LKNQIAKAETDLFELKRQYREQH
A0A2J0LFS5      --------------------ESPEAGNKDNTVNLPETLKREQLRLEVEISEISRRYGPKH
A0A1V5SP48      --------------------QMLPSVVNNPEIL---NLRKERSGIESQIAQLSKRYKPKH
A0A1J4Z4I0      --------------------ESPEAGNKDNTVNLPETLKREQLRLEVEISEISRRYGPKH
A0A2J0LS24      --------------------ESPEAGNKDNTVNLPKTLKREQLRLEVEISEISRRYGPKH
A0A1G1JZ27      ----------------------------REKLS-KSELEFEAMKLKKELTELNEKYLPKH
A0A1G1K375      ----------------------------REKLS-KSELEFEAMKLKKELTELNEKYLPKH
A0A7C5FNS3      --------------------AIPDIGEQKEALL-E-KLKNQKSDLEKQILEASKKYGEMH
A0A1G1JR53      ----------------------------RTELT-N-LLKNEYLKLESRVSEYAKVYKEGH
A0A1G1KL63      ----------------------------KVELS-N-LLKNEYLKLETKAAEYAKVYKEGH
                                               .                       :   *

A0A1G1IP08      PMVVSLQTDITGLSVKLRES--------TNDL-----EKMEISQRKDRFSLIVESHTDMK
A0A2J0KU82      PKIIQLKSELKTLQERIDTE--------IGKVVDSIKGEYEEAEANERTALLALTEQEKK
A0A1G1K0W1      PKIKELQARADYLESEMKSQ-------------------------------------IQK
A0A1G1K4H2      PKIKELQARADYLESEMKSQ-------------------------------------IQK
A0A1G1LHA8      PKMKELLTQAAYLQSEKKAR-------------------------------------IEK
A0A1J4VP59      PAIKDLNQRLSTVESDIKAR-------------------------------------SET
A0A1G1PGV5      PAIAQLTEELTALRKQREAE--------VGKVVEDARLEYSAVQAKEQELQQALVEQERL
A0A660WJ06      PEVKKLQDKIRILKQKIEEE--------GEKALARLKARIATLKSKEKALLKSLNDLKKE
A0A351I6G3      PKMIALFETTNYLKSRIKSEELHIKAEETSRVTTKLETEDDYAAEEEGKLKKLLDERKEE
A0A2J0LAF9      PKMARLFENMDYIKSRIKTE---------------VENEYNYAKEEEAKFKKMLETQKNE
A0A2J0LM30      PKMARLFENMDYIKSRIKTE---------------VENEYNYAKEEEAKFKKMLETQKNE
A0A0F0CSR3      PEILGIKSELESIVKTIANE-------------------------------------KTK
A0A1G1IVX7      PKRIHLRSEIEGLDEKIKTE-------------------------------------ETR
A0A1G1KQI3      PSIIQREANLKFIDESIQIE-------------------------------------TQK
A0A2H0LEC5      PILQELLKREAEMEAAFKQQ-------------------------------------EKK
A0A1W9RLH0      PIIKGLKAELNSINKKIEEE-------------------------------------RQR
A0A3C0MWS5      PEMIRVREEMADVVASINKE-------------------------------------KET
A0A2H0LL91      PDVMKVQANLKFLKESVDVQ-------------------------------------IKR
A0A2J0LFS5      PQMVKVLSELESVKSKLDIE-------------------------------------TQN
A0A1V5SP48      PRMIALNTQLGSINEQIKAR-------------------------------------TDE
A0A1J4Z4I0      PQMVKVLSELESVKSKLDIE-------------------------------------TQN
A0A2J0LS24      PQMVKVLSELESVKSKLDIE-------------------------------------TQN
A0A1G1JZ27      PKIIRTQERIRVIEEQFGGG-------------------------------------ISK
A0A1G1K375      PKIIRTQERIRVIEEQFGGG-------------------------------------ISK
A0A7C5FNS3      PKMDSLRAQLEAIEQKLKEE-------------------------------------QDL
A0A1G1JR53      PEMIKVKNEMAELVAKIEKE-------------------------------------KKS
A0A1G1KL63      PEMIKLRTEMADMIKRMDNV-------------------------------------NMP
                *           :                                               

A0A1G1IP08      SLTDAEVDLQTMKPLLEQEVNTNKELYNSLFKKLQEVELSGSRNVWLDAKVIEKAAVPGR
A0A2J0KU82      ALELNRMAIEY--NVLKRDTETNREMYEALLKRMKETDISGGLQA-SNIRVIDKAEVPKG
A0A1G1K0W1      IVSGLKSG------------------------------LSGEFSA-SNMKVIERAEIPTK
A0A1G1K4H2      IVSGLKSG------------------------------LSGEFSA-SNMKVIERAEIPTK
A0A1G1LHA8      IISALKAG------------------------------LTGDFTI-TNVKVIEPAAIPSR
A0A1J4VP59      ILSNVKAN------------------------------LAGEANI-TNIKVLEEAPVPKN
A0A1G1PGV5      ALGLNRLKLDY--ENLNRQAQLSVDLYNSLSKRLKELEVVQSMQS-NNVRIVDGAKLPDG
A0A660WJ06      IATKNKMVARY--TLLKQEIATTQQLYEALLKKLQQMDISSPSSY-INVRILTPAKVPSK
A0A351I6G3      ALEVERKIIEY--NALKRELETNKRILDIVLNRMKETAISSKIQT-NNVRIQDIAEEPKR
A0A2J0LAF9      LLALERKVIDY--NALKRELETNERVLDIVLNRLKETSISSQVQT-NNIRVQDLADVPKK
A0A2J0LM30      LLALERKVIDY--NALKRELETNERVLDIVLNRLKETSISSQVQT-NNIRVQDLADVPKK
A0A0F0CSR3      ELKIKDIEIEY--NILLREVETRKEVYESLLKRIRETEITGGLKT-TNVSILDIAQVPTK
A0A1G1IVX7      KIDIGGVAIQY--DELEREAESARKVYRALLERLEQTHSEAKAQA-SNITVVDKAVPEPR
A0A1G1KQI3      IVANLKSS------------------------------ISGRLQI-SNVRFIKRADPPMS
A0A2H0LEC5      ALEFTRLSIQY--NVLQRNSETTEGIYDVLLKRLKELSVEGNLQA-NNIRIISRAKIPKS
A0A1W9RLH0      LLALKEKAIRY--RILKREVETNKAIYESLLNRLKETKSIQNLRL-TNIRVVDRATVPIK
A0A3C0MWS5      GLEGSKAV---------------HDRYKEQLRGALA-----GLKA-NNVSVVEYAQDPIE
A0A2H0LL91      VVHELKTA------------------------------LSKRLQV-SDVRVVQAGEPALL
A0A2J0LFS5      LINLNRKAAQY--TILKREVDSNRDIYETLVKRAKETGVSEQLEA-TNIRVVDPAEVPDR
A0A1V5SP48      VIASVKAE------------------------------LEGKLRP-NNIRILDRAQTPKI
A0A1J4Z4I0      LINLNRKAAQY--TILKREVDSNRDIYETLVKRAKETGVSEQLEA-TNIRVVDPAEVPDR
A0A2J0LS24      LINLNRKAAQY--TILKREVDSNRDIYETLVKRAKETGVSEQLEA-TNIRVVDPAEVPDG
A0A1G1JZ27      DFASGEISTQY--NQLQREVDSQGKIYEAMLSRLKETSASEGIED-TNVVVIDRAEVPTR
A0A1G1K375      DFASGEISTQY--NQLQREVDSQGKIYEAMLSRLKETSASEGIED-TNVVVIDRAEVPTR
A0A7C5FNS3      IYSLQEKSLQY--KILRRNVDTLKSMYNDLLVRLKDLEMSKETII-SNIQILDKATPPSK
A0A1G1JR53      VYDYDNIE------------DYLKPEAQHQLAGFKA----------NNISVQDSAEIPVV
A0A1G1KL63      IHDYSKME------------ESLKSDSGRTLAGFKA----------NNISIRDPAEKPVT
                                                               :  .   .     

A0A1G1IP08      PIRPNKQMNLLLGLLLGGFIGTGLAYFLEYLDSSLRSLNDLRSYLKIFPLGMVPMVELPE
A0A2J0KU82      PIKPRKSTNIIMAIFIGILSGAAAAFTLEYLDDSIRNQRDIEAYIQLPFLGHVPIV----
A0A1G1K0W1      PSGPKRLVMVSLSTLIALFLSIVLAVQLNNLDLNIKAEEDVRQ-IPMPFLGYLPQLDTLA
A0A1G1K4H2      PSGPKRLVMVSLSTLIALFLSIVLAVQLNNLDLNIKAEEDVRQ-IPMPFLGYLPQLDTLA
A0A1G1LHA8      PSGPKRSIIVLASAAVSFAGSLLLVVFLHHLDQNISSEEDVRK-IPATFLGYLPLISGLN
A0A1J4VP59      PSGPNRFRGILSWTLIGFCASASLISFFEYANQKVRTKNDVIS-LGICFLGYIPLVKEFL
A0A1G1PGV5      PIAPHRVRIVLQGLLLGLVVGGGLAFLQDLMTTTIRMRRDLEELVNLPFLGHVVRVPLPR
A0A660WJ06      PIKPKKVYNIVFGLIFGLFLGTGVVFLDEYMDTTIKTPSDVEKFLSLPVLGQVPYS----
A0A351I6G3      PIKPKKTLNIALSIVLGIIGGLTLVFFREYMDTTIKNSNDIVTLLQLPVLGSVPRI-KPD
A0A2J0LAF9      PIKPRKKLNIAFAVVMGLAGGIGLAFFREYMDTTIKDPDEIAGLLQIPVLGSVPRV-RVD
A0A2J0LM30      PIKPRKKLNIAFAVVMGLAGGIGLAFFREYMDTTIKDPDEIAGLLQIPVLGSVPRV-RVD
A0A0F0CSR3      PTRPNKKLSLIITLFISVLSGSALAFLIEALDQTLKTPEDIKKFLNIPPLAGIPLP-RDE
A0A1G1IVX7      PARPRPFLNLLMALVLGLMGGVFSAFLAEYLDPTIKIPDDVEKGLGLDLYGMIPKAGRIN
A0A1G1KQI3      PSGPDRKKLLLIVVLGYLFASSLIVILLDQFDDRIKGQEDIERYLHLPYLGHLPLIRKQD
A0A2H0LEC5      PIGPNRQRGILVGIFLGLILGCGQAILREMLSKTLRNRREFEGTLQIPFLGALPDIHVGR
A0A1W9RLH0      PVRPNKKMNFVLALFIGLFLSTGAALLIENLDLSIKEPDEVQKYLGLPLLGTIPLYKQKK
A0A3C0MWS5      PVKPNKLLNLLLAIVTGLFGGVGLALFFEYQDATIRSVEDIEKLTSWSFLGKVPVIPGS-
A0A2H0LL91      PEGPKRLRLILLFIILELLLSFGFVILIDYIDDRVKNQDDIERFVRLPYLGHTPVLRLEG
A0A2J0LFS5      PIRPNKKNNIILACLVGLMLGVSTAFFIEYIDNTVKDPDDVTNYIGLPFLGYVPSARKEA
A0A1V5SP48      PIDSPKIPNILKGILAGILLGLGLIYLLEKIDTTVKTQEDVQQSLRLPFFGDFPFLKGGD
A0A1J4Z4I0      PIRPNKKNNIILACLVGLMLGVSTAFFIEYIDNTVKDPDDVTNYIGLPFLGYVPSARKEA
A0A2J0LS24      PIRPNKKNNIILACLVGLMLGVSTAFFIEYIDNTVKDPDDVTNYIGLPFLGYVPSARKEA
A0A1G1JZ27      PVAPRFFLNVFLSILVGAFGAAALCIIFESLDNTVKTPEDIEKLGELPLLGVVSHWEAA-
A0A1G1K375      PVAPRFFLNVFLSILVGAFGAAALCIIFESLDNTVKTPEDIEKLGELPLLGVVSHWEAA-
A0A7C5FNS3      PIIPQPSKDITKALIFSVVFAISFCYFLEYIDSTLKTSEDVEFYTKMPFLGYIPSAKRDI
A0A1G1JR53      PIKPKRALNIVLAVVIGIMGGIGMAFFSEYLDDTAKSIEDVEEIAPWPFLGSVPRMKGR-
A0A1G1KL63      PIKPKKRLNFLLSIVIGLLGGVGLAFFFEYLDDSVKTVDDIERICEWPILGCVPDIDSRI
                *  .     .          .                  :.         .         

A0A1G1IP08      LEKQIDLAENPELTRTWWNTNDGTLPLY--------VAEAYRIIRTSLAFGSL-DKTIKV
A0A2J0KU82      ------------------RTKGATVGLYANLYPRSEVSESLRSVKTNINFTLT-TPPPHA
A0A1G1K0W1      GDTKSDR----------------RENLLEHVLTDMRLMDDITNIRAAVLFSMP-ADRSKL
A0A1G1K4H2      GDTKSDR----------------RENLLEHVLTDMRLMDDITNIRAAVLFSMP-ADRSKL
A0A1G1LHA8      GRSKNGA----------------KSNLLHRALSDSRLIDSITNMRAALLFSMP-AERSKR
A0A1J4VP59      KGQKYHE-----------FSE--EPDLVRVLKANATLADAVANARTHILFSMP-YEKSRR
A0A1G1PGV5      GRR--------------------GGALFFSRHPDGVAAESLRAVRTTLEFLLP-ERTTQR
A0A660WJ06      -KSLLKE-----------P----KLLYATEEKNIH-ILESFRILRTNIQFSSIDNPL-KT
A0A351I6G3      GKNIRNK-----------I----DADRVVEKDSLCMASEAYRSIRTNLLFSLKDSGYSKS
A0A2J0LAF9      GISIKQE-----------T----DIDRIVEKDSASLVAEAYRSIRTSLLFSLEDSRSAKS
A0A2J0LM30      GISIKQE-----------T----DIDRIVEKDSASLVAEAYRSIRTSLLFSLEDSRSAKS
A0A0F0CSR3      EDKLISP-----------E----FITSKKPRST---IAEAYRSLRTSILFTAIEHKR-KS
A0A1G1IVX7      ASSAQGE-----------I----FSKWEIVPNP---AAEAIRALRTALVFKLRHMKGCHA
A0A1G1KQI3      VKSNQ------------------ERALYSHHKPDSEVAEAIRYIRVGINFSAP-PEILRC
A0A2H0LEC5      AHKG-------------------KEKLFLIKQPQSTEAESLRAIRTTAEFLLPAQQSSHV
A0A1W9RLH0      DKST-------------------HPALSIFTDSHSPALESYRTIKANLTLSNP-DLAKKL
A0A3C0MWS5      -----------------------KKEFSTHLKPEDFTSEAYKSIRTQLLLLDTKTHPLKT
A0A2H0LL91      EKNKS------------------KGYFYVYANPQSDLAESLRYIRVGINFSAP-PDMLRA
A0A2J0LFS5      RTED-------------------EIDLIVYQKPHSVISEAYRSIRTSILFAFA-GKPSKT
A0A1V5SP48      KMMT-------------------GPESLLKLDSNIPASNAIREIRIGLNFLTIKNTPPKT
A0A1J4Z4I0      RTED-------------------EIDLIVYQKPHSVISEAYRSIRTSILFAFA-GKPSKT
A0A2J0LS24      RTED-------------------EIDLIVYQKPHSVISEAYRSIRTSILFAFA-GKPSKT
A0A1G1JZ27      -----------------------QKQLVVHEDRSSGVAEGFRAIRTSLLFSSP-DHPLRT
A0A1G1K375      -----------------------QKQLVVHEDRSSGVAEGFRAIRTSLLFSSP-DHPLRT
A0A7C5FNS3      RRSE-------------------KKEFISWIKPYSHTSEAFRNLRVSILFSFPADTSLKT
A0A1G1JR53      ------G-----------KRAELEKDVRVQRLPRDPVSESYRSIRTSILFSSTEERPLRS
A0A1G1KL63      SVEEAAS-----------PLGELEKDIFVSIKPKDPIAEAYKSIRTRLSLSSTEEHPLKS
                                                      :     .    :        . 

A0A1G1IP08      LQVTSAVKGEGKTTTVCNLGISLAQAGIKTLLIDADMRRPSLHHILHIDDRNQGLSTILS
A0A2J0KU82      LLLTSVAPQEGKTSLSSNLSIVMAQGGDRVLLVDADMRHPTVHKIFKTEN-SKGLRDYLS
A0A1G1K0W1      LMFTSTIPEEGKTTVASLFGMSLAHGGEKVLLIDADMRKPALHQIFGLEN-KIGLSHCLV
A0A1G1K4H2      LMFTSTIPEEGKTTVASLFGMSLAHGGEKVLLIDADMRKPALHQIFGLEN-KIGLSHCLV
A0A1G1LHA8      IMCTSAIPEEGKTTVLGLLGISLAQIGERILLIDADMRNPSLHQVFGLKN-ECGLSNCLI
A0A1J4VP59      IMLTSAIPDEGKSTVAALLAVSLTTLGRKILLVDGDLRKPSLHNYLGFRN-DKGLTDYLV
A0A1G1PGV5      VLITSSLPQEGKTTVSSNLAVSLQELGRRVVIIDADMRRPTLFRTFQVPI-EPGLSTYLQ
A0A660WJ06      LLVTSAVEKEGKTTIAANLAASFAKLGKKTLLVDCDLRKPGIHKIFNLKR-EEGLSKLLL
A0A351I6G3      IAITSSVPKEGKTISAVNLAIMMADSGESVLLVDSDMRKPRVHTVFNIDN-VSGFSNYLA
A0A2J0LAF9      IVITSSLPREGKTVTSVNLSTMIANSGEKVLLVDADMRKSRLHTIFNMDN-QTGLSQFLM
A0A2J0LM30      IVITSSLPREGKTVTSVNLSTMIANSGEKVLLVDADMRKSRLHTIFNMDN-QTGLSQFLM
A0A0F0CSR3      LLLTSSCPQEGKTTTAINLAVVMAMAGEKTLLVDADLRQPRIEKVFNLKD-KLGLSDVLI
A0A1G1IVX7      LLVTSPNPEEGKSTVALNLASAFQQNHFRALLIDADLRRPRLHKALGEGC-ERGLSDVLE
A0A1G1KQI3      LLVTSSLPQEGKSFTAANLAVSMALDGNKVLLIDADSRRPVGHRIFQLRN-EVGLINFLT
A0A2H0LEC5      LIITSAIPEEGKSLVSLSLAISLAELERRVVFIDADMRRPTVHASVNLPL-DPGLSGFLE
A0A1W9RLH0      LLITSSVPNEGKSVFSVGLARIMAQAGEKVLLVDVDFRHPNLHEVFGVQR-THGLSDLLA
A0A3C0MWS5      IVFSSIGPQEGKTLTVCNLAIAIAQSQKRVLLVDADMRRPRLHEVLKVKD-GKGLCSFLS
A0A2H0LL91      FAITSSIPQEGKSFCSCNLASSFALDGNKVLLVDADNRRPVLHTVFNMDN-DYGLINYLT
A0A2J0LFS5      ILMTSSSPQEGKTSAAINLGITMANTSEKVLFVDADLRCSRLHKSFGIQK-ENGLSDYLV
A0A1V5SP48      FLITSSVPKEGKSLLAVYLAFSFAKSGANTLLIDADLRLPKLHYSMNVRQ-SPGFADLLR
A0A1J4Z4I0      ILMTSSSPQEGKTSASINLGITMANTSEKVLLVDADLRCSRLHKSFGIQK-ENGLSDYLV
A0A2J0LS24      ILMTSSSPQEGKTSAAINLGITMANTSEKVLLVDADLRCSRLHKSFGIQK-ENGLSDYLV
A0A1G1JZ27      LVITSPFAEEGKTIVACNLAATIAQSGARVLLVDADMRRPRVNQVFQQNG-VHGLSHALT
A0A1G1K375      LVITSPFAEEGKTIVACNLAATIAQSGARVLLVDADMRRPRVNQVFQQNG-VHGLSHALT
A0A7C5FNS3      IMITSSIAKEGKSFVSTNLAITFAQAKEETLLIDADMRKGRLEEIFDIKT-KNGLSSLLA
A0A1G1JR53      VVVTSPGPQEGKTTTLCNLGISIAQNGSKALLVDADMRKPRLHEIFNIEN-KNGLSDFLC
A0A1G1KL63      VLITSPGPQEGKTITLCNLSIALAQNQKRVLLIDADMRKPRLHKVFKKEN-VSGLSSLLS
                .  :*    ***:     :.  :       :::* * *       .       *:   * 

A0A1G1IP08      GDP-LLSAKDFVRPTTI-ANLY-----CMTAGVIPPNPAELLSSRRIKSMLDALKEEFDM
A0A2J0KU82      GAA-DFDS--VVQKSMV-ENLS-----IVASGRVPPNPVELLDSPRTKLFLKEAKAKFDR
A0A1G1K0W1      GTA-KPQE--AIQKIDKIPGLS-----IMTAGVTPPNPAALLGSSMLERLIQELEPHYRR
A0A1G1K4H2      GTA-KPQE--AIQKIDKIPGLS-----IMTAGVTPPNPAALLGSSMLERLIQELEPHYRR
A0A1G1LHA8      GSS-RARD--VIQVVEGVPGLH-----LMTAGARTPNPPVLLGSASIDRLIREIELDYHR
A0A1J4VP59      GAA-TIDE--IIQPMRN-NPLQ-----LITAGSVSRNPSELLASERFRELLDRCGERFDR
A0A1G1PGV5      GQA-ALEE--ILQTPAHVQGVT-----VIASGATPPRPADLLASPKMGQLLEQLSASFQY
A0A660WJ06      TGG-QIDD--FVKKTEI-ENLY-----VMCAGPIPPNPTELLSSHKMDKIVNEMREKFDM
A0A351I6G3      GQV-DFDR--IIKYTGI-NNLS-----VIPAGSISHKSAELISSKNAKLFLEKAGARFSK
A0A2J0LAF9      GEK-GLID--IINPTAV-DNLY-----IVTSGKSTHKPAELLSSSNMKLFLEQAGGQFSK
A0A2J0LM30      GEK-GLID--IINPTAV-DNLY-----IVTSGKSTHKPAELLSSSNMKLFLEQAGGQFSK
A0A0F0CSR3      GNA-KWEQ--MIIETNI-KNLF-----ILPAGSIPPNPSELLGSGKMTTFLEDIDKKYDR
A0A1G1IVX7      GQC-D------IVSAVR-RNVAGFGFDFLPAGSRLDHPTELLGTETAAKLFTALRQEYDM
A0A1G1KQI3      SNI-SFES--VIQPSGVNEHLF-----VMPSGPTSPNPSELFASGRMKELVQLARTQYDR
A0A2H0LEC5      GKVDPGDL--IQTSSEA-PGLS-----VITAGSQPAQPTDLLISGKMKDLIHQLRDEFQY
A0A1W9RLH0      EGIQDIHN--YIKKTNV-ENLD-----LLTCGSLPPDPAELLGTKKMEELIQELSKRYDR
A0A3C0MWS5      EKA-ALEE--LVRKTDI-ENLY-----FVADPYSCANSTELLSAQKISDFLAFARKNFDY
A0A2H0LL91      SDV-TLES--ITRKTDV-PGLD-----FIASGPESPNPSELLGSEKMAEFIQKAKSQYDR
A0A2J0LFS5      GNI-TLDA--AIKPTRI-ENLS-----LLTAGSTPPNPAELLHSGKMKAFLEDAIKKFDR
A0A1V5SP48      GTM-SPDS--VIVRTGI-PDLS-----ILTAGQSNDNPSELFSRPNVPELFHQLSSQYDK
A0A1J4Z4I0      GNI-TLDA--AIKPTRI-ENLS-----LLTAGSTPPNPAELLHSGKMKAFLEDAIKKFDR
A0A2J0LS24      GNI-TLDA--AIKPTRI-ENLS-----LLTAGSTPPNPAELLHSGKMKAFLEDAIKKFDR
A0A1G1JZ27      DSA-NPSG--FIQKTKI-ENLS-----VLFCGPLPPTPSEMIGSQKMHQLIEKLKGQFDY
A0A1G1K375      DSA-NPSG--FIQKTKI-ENLS-----VLFCGPLPPTPSEMIGSQKMHQLIEKLKGQFDY
A0A7C5FNS3      GMC-SFDE--AITTTPI-TNLY-----LMPRGPATPNPAELLSTQQIINVFEEAKKRFKR
A0A1G1JR53      GRI-EFVS--SVKATDI-EGLS-----ITNGGTHPPNPSELLSSQKMKYFIQEAERKFDF
A0A1G1KL63      GQA-VFDN--IIQKTDI-TNLY-----FISGGILPPDPSELLASGKTKESIAKAGEKFDF
                                    :                .  ::        .      :  

A0A1G1IP08      ILIDSPPVISVADSPIISSHVEGTILVSRAGFIPRHICLHAKHAVEA-VNGRIIGGILNC
A0A2J0KU82      IIIDSPPIIAVSDALILAKLVDGVVYIVRGSKTSREAAFEGKRRLLD-IDAKILGIALNY
A0A1G1K0W1      IVFDGPPGLHIIDSLLLSAKVHGTILIFGFGKIHRNIAKKMKERILS-AKGTLIGAAING
A0A1G1K4H2      IVFDGPPGLHIIDSLLLSAKVHGTILIFGFGKIHRNIAKKMKERILS-AKGTLIGAAING
A0A1G1LHA8      IIFDVPPSLHIADGLILAGKVDGTVLVFRAGKVHQKIGRRMKEKIDA-AGGVIIGGVINR
A0A1J4VP59      IVIDVPPVLYIPDGLIVAKIVHTGILICGADMVNKETIQEVKEKFDS-IGYSFIGAIINR
A0A1G1PGV5      ILVDTPPVLAVADSTILSRVVDSAILIVRANRTTRENLSSTQRILTQ-SPLKFVATILND
A0A660WJ06      VIVDSPPSVSVPDPVIMGSKCDGAVMVISAGKVPRELYIEAKKFLEK-ANVKIIGTVMNN
A0A351I6G3      IIFDAPPVALVTDAAVLSGLCDGVILIAEADRTTKDLLNNSKELLHK-AGANIIGVILNN
A0A2J0LAF9      IIFDTPPVCLVTDAAILSSICTGTVLIAEGSRATRELLKRSKEILGK-VDARMLGVIVNN
A0A2J0LM30      IIFDTPPVCLVTDAAILSSICTGTVLIAEGSRTTRELLKRSKEILGK-VDARMLGVIVNN
A0A0F0CSR3      IIIDSPPVLAVTDAVILSGKVDGTIIVARASHTHRHAICQAKELIETVDTAHIVGMILNM
A0A1G1IVX7      IIFDTSPYLAVADVAVLSEHADVGVIVARYHKTDKRHLKDVRRIFGE-GNLKTFGIVMNL
A0A1G1KQI3      VVIDAPPLTGIGDGFVLGGVVGHLILIVMAGKTSRYAVSAIKHRLVD-SNIKIVGVILNS
A0A2H0LEC5      VILDTPPVLAVADTTALASLTDGIIYVVRAGRTPRDVTLAGKTRLTD-VGAKLIGGVLNG
A0A1W9RLH0      IIFDAPPVLAVTDALVLSTKVDGVIIIVRFEFTHRKALQRTKETLER-VNAKILGAVLNM
A0A3C0MWS5      ILLDSPPVGIVSDATLLSTLADGLVLVVESGKTPRKAIVRQRKALDG-AGIKVAGVIINK
A0A2H0LL91      VIVDAPPLVGIGDGLVLGKLIGHLILIIRSHRISRKVIRQIRERLQQ-HQIKVLGVILNH
A0A2J0LFS5      IIIDAPPILMVTDAAILANIVDGVIMLVRCGKIHIEIVSRTKQKLQD-SKANILGVLLNN
A0A1V5SP48      IIIDSPPSLMIPDALLLARIVESTILVIRSGKLSANSIVKLKEKFDA-IGAPLTGFILNG
A0A1J4Z4I0      IIIDAPPILMVTDAAILANIVDGVIMLVRCGKIHIEIVSRTKQKLQD-SKANILGVLLNN
A0A2J0LS24      IIIDAPPILMVTDAAILANIVDGVIMLVRCGKIHIEIVSRTKQKLQD-SKANILGVLLNN
A0A1G1JZ27      VLFDSPPFLVVTDPVVLSTFVDGVIIVTRYNKTPKDVIARGKQKFLG-VQAKLVGVILND
A0A1G1K375      VLFDSPPFLVVTDPVVLSTFVDGVIIVTRYNKTPKDVIARGKQKFLG-VQAKLVGVILND
A0A7C5FNS3      IILDAPPVMGVSDTVILGDKVDGIVFVIKSASTPLNIINEVRKILGK--KIKIIGAVLNN
A0A1G1JR53      LLFDSPPVGMLTDAMIFSSMVDGMIMVIESSKTSKRTLARIYKLINS-AGVRVVGIVLNK
A0A1G1KL63      VLIDSPPIGILTDATILSSIVDGIIVVVESGKTSKKVLARVCQIINE-SKTHVIGLLLNK
                ::.* .*   : *   ..      : :                 .         .  :* 

A0A1G1IP08      VTSHQHSSYYGYGYYYGKGYGYSYYGSDEKQG--GKKKKKRSAGAAPGKLEKLMMLK---
A0A2J0KU82      IDIRKERYYY-YGYYYG-GQGKRRKTEEDEVGKIGSQTAVSESEGEAVKAEELTQSKQLT
A0A1G1K0W1      TDYK-KLDYASYTYYQKYSKYYGVSKAGD-------------------------------
A0A1G1K4H2      TDYK-KLDYASYTYYQKYSKYYGVSKAGD-------------------------------
A0A1G1LHA8      ADFK-RLDSTYSRYYRQYTKYYHRRDGSKTEELSRLEPVHQ-------------------
A0A1J4VP59      ADFE-REGYRYKYYGTYKSYYKPR------------------------------------
A0A1G1PGV5      IRPEYEYQYYRRGYSYYTKRPPSTPVPAQSPG----------------------------
A0A660WJ06      LSPEIEYYYYYKRYYYY-----YPKE----------------------------------
A0A351I6G3      VSLT-RNSYYYPQYYYGKYYKPLNAK----------------------------------
A0A2J0LAF9      ISMV-RDGYYYPQYYYGRYYVPSRSK----------------------------------
A0A2J0LM30      ISMV-RDGYYYPHYYYGRYYVPSRSK----------------------------------
A0A0F0CSR3      VSINIGSGYYYYYYGKYGKYGKTPKKNTTVSAS---------------------------
A0A1G1IVX7      VEPR-ERHYYYHRYYYYGYGGDTPPK----------------------------------
A0A1G1KQI3      LDVE-RERYGYYRYHYYTYQRYYGKKK---------------------------------
A0A2H0LEC5      TQPE-KR---YVHYYYYQGARKARR-----------------------------------
A0A1W9RLH0      VNPR-GGSY-YYYYYYHYGKKG--------------------------------------
A0A3C0MWS5      AVIS-GSEGYYYSKSYHRMK----------------------------------------
A0A2H0LL91      LDME-KDRYGYYRYHYHTYNRYYGKKAIKRKEKKERRHHKKAS-----------------
A0A2J0LFS5      VDYG-KESY-YHYYYYSDEEKKKNV-----------------------------------
A0A1V5SP48      SRLE-KIQH-YSSYYKSYYNKAHATKKK----------------PAFKPKNKKPAIVPPA
A0A1J4Z4I0      VDYG-KESY-YHYYYYSDEEKKKNV-----------------------------------
A0A2J0LS24      VDYG-KESY-YHYYYYSDEEKKKNV-----------------------------------
A0A1G1JZ27      VDLE-QERYRYPAYSYYHDPLSEKGKADIPSLVAKVASDQDSAISSHPPRNFSPK-----
A0A1G1K375      VDLE-QERYRYPAYSYYHDPLSEKGKADIPSLVAKVASDQDSAISSHPPRNFSPK-----
A0A7C5FNS3      IYVE-RDKY-YSYYHYYHYSFKEK------------------------------------
A0A1G1JR53      ISIH-GDDY-YHRYYRHYYGKP--------------------------------------
A0A1G1KL63      ISIT-PVNN-YYSYYYGNSNNPPKSKSIRDRFSSDMIIKRAGKWAKLLANKISSILKKSV
                                                                            

A0A1G1IP08      --------EPVIDMISSTVSNIISILKSGQPRK
A0A2J0KU82      DVEKIAKAEPSVENKSKRPAFLRKLKRKPQSLS
A0A1G1K0W1      ---------------------------------
A0A1G1K4H2      ---------------------------------
A0A1G1LHA8      ---------------------------------
A0A1J4VP59      ---------------------------------
A0A1G1PGV5      ---------------------------------
A0A660WJ06      ---------------------------------
A0A351I6G3      ---------------------------------
A0A2J0LAF9      ---------------------------------
A0A2J0LM30      ---------------------------------
A0A0F0CSR3      ---------------------------------
A0A1G1IVX7      ---------------------------------
A0A1G1KQI3      ---------------------------------
A0A2H0LEC5      ---------------------------------
A0A1W9RLH0      ---------------------------------
A0A3C0MWS5      ---------------------------------
A0A2H0LL91      ---------------------------------
A0A2J0LFS5      ---------------------------------
A0A1V5SP48      GS-------------------------------
A0A1J4Z4I0      ---------------------------------
A0A2J0LS24      ---------------------------------
A0A1G1JZ27      ---------------------------------
A0A1G1K375      ---------------------------------
A0A7C5FNS3      ---------------------------------
A0A1G1JR53      ---------------------------------
A0A1G1KL63      SK-------------------------------
                                                 

© 1998-2021Legal notice