BYKdb

Dataset for cluster tadcd of phylum candidatus-omnitrophica

[Download (right click)] [Edit] [Sequences] [Repertoires]

26 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1G1IP08      MDLITMPDPKVAPPYSTKESQISTGAPEERLDASIHSYVFVLWKRKWLIAASIVFCLGIS
A0A2J0KU82      --------MEREPLYKFYK------------EWELKDYIEVIIRRKKILLTFLLSLVFIV
A0A1G1K0W1      ----------MAEVPELDYSSGVFQSEEEADAYNLQLLWKAVQNKRGIIVTITGIAFVFS
A0A1G1K4H2      ----------MAEVPELDYSSGVFQSEEEADAYNLQLLWKAVQNKRGIIVTITGIAFVFS
A0A1G1LHA8      ----------MVNVPESALGGMQFESERESDEVNLELLWRIFRTRSWFIFTVVAMVTVLA
A0A1G1KQI3      ------------------MTTRPYLEQEESEAVNLRYYFDLIFRQRVPIVTFLIIIVTVA
A0A2J0LFS5      ------------------------------------------------MVTFFVAIVSFV
A0A1J4VP59      ------------MTLNDGIGNVPKMGLDGNQSTDLAKYWFVFLAHLRIIASATGVFFIIS
A0A1G1PGV5      ----------------MSPTLSEAVRQAKTLEWRFDDYVVFIRRHWLTIVLGGLLGWGAA
A0A3C0MWS5      --------------------------MQAQEVSGTSEYPDILIRRRKTIILFFVLTLAAV
A0A2H0LL91      ------------MVSMDQPAVGYPNSPEEAESINLSYYLGLLYRHRVFLFTFFFISVTLV
A0A1V5SP48      ---------------MPNVPEAQNPQIHRDTEMDFKKFFSAVRDRYIIIIILTTVILAGV
A0A1G1JR53      --------------------MESPRPSIKEEGLQLKNYTHIIRRRADVLILFFVATVSVI
A0A1G1KL63      ----------------------MTANLEKQKERHLKDYIEVLRRWRDIAITFFVSMVLLV
A0A660WJ06      -----------------------------MESIHLIDFLNIIKKKKILFLNFFLGTLTIA
A0A351I6G3      -----------------------MENTTFNKELHIKEYISVILRRKWTLIAFFLITVTAV
A0A2J0LAF9      ---------------------MFFQSEKGQKDIHLKNYLFILFNRKWIVISFFFIIVTTI
A0A2J0LM30      ---------------------MFFQSEKGQKDIHLKNYLFILFNRKWIVISFFFIIVATI
A0A0F0CSR3      ---------MGVKKKGNKNMPNSTQNPFLEREQDIKEYLSILYNRRWLIISFTLVLCTIS
A0A1G1IVX7      --------------------MAAAGSVFGEEEIHLRDYYYVLMKRRRLILTFLLAALSLG
A0A1J4Z4I0      -------------------MIPKSDLK----ELNFNDYLEIVGKHRWIVVTFFVAIVSFV
A0A2J0LS24      -------------------MIPKSDLK----ELNFNDYLEIAGKHRWIVVTFFVAIVSFV
A0A2H0LEC5      -----------------MALI-------GEVDWKPEDYLHAAFSHKFTLFMITLVIGSYA
A0A1G1JZ27      -----------------MKIFPSSKIS-DELQLSLYDYWYIIQKRKRLALTFFLIVVIST
A0A1G1K375      -----------------MKIFPSSKIS-DELQLSLYDYWYIIQKRKRLALTFFLIVVIST
A0A1W9RLH0      ----------------MRGMIEEKEIGYSPSEEGIRDILNKIYKRRWFIFNFTFLCIVFT
                                                                            

A0A1G1IP08      TFINVTQKPVFRASTEVVL-----------QPKESDT-SSSSVHPGNSI-----MQDPTF
A0A2J0KU82      SVYSYTATPIYQATTQILI-----------ERNEPQILNFQEVYAMPS-------AETEY
A0A1G1K0W1      LLYALHLPTVYTARTKIFI-----------EGGKESAFQNPEMMESPAA-----NPLPTY
A0A1G1K4H2      LLYALHLPTVYTARTKIFI-----------EGGKESAFQNPEMMESPAA-----NPLPTY
A0A1G1LHA8      SIYALRLPNVYTARTKLLV-----------QKVDPSPLQNPELMK-PTT-----AYGDTY
A0A1G1KQI3      VLVVLKLPNNYQAVAELLF-----------DNPEA-VSAPERELATPNYGQD-------H
A0A2J0LFS5      AFFSFWVEPTYRATTVILI-----------ERQQPKVLSVEEVYGMGLADKE-------Y
A0A1J4VP59      VFHFFSLPNIYTATTTILA-----------EQTETPPSRQEMLKTTTST--D----VDEY
A0A1G1PGV5      AWWVSTIPNSYQAQTRLLI-----------DRYSGEPVGFGETASMSSARRD----IE-F
A0A3C0MWS5      GMGTVLMTPVYQAKAVLLI-----------DVAGPDVVATTANVAMESQGASYYSYRE-Y
A0A2H0LL91      GIFLMKLPDQYRSTTQVLIESAPVSAGASEELEPT------------------FQSYT-Y
A0A1V5SP48      LFYNSTLVPIYRATTQLMIEIPEFVGHDTKEAKSPTI-----------------GSSD-Y
A0A1G1JR53      TIGSFIMEPVYRATTTLLI-----------DPESPNVLTTTGMVELESQ--NYFSYKE-Y
A0A1G1KL63      TISSFIMKPVYRATLTMII-----------DPESPNVLTATGMVALKSE--DYLSYKD-Y
A0A660WJ06      LAINALQKPVYKTSVEILV-----------ERSQPEVLLTGEGYRFSVD-------KT-F
A0A351I6G3      TFATFKQHPIYRAVSTIII-----------DVAEPDILAVKDIIKLGET--NYFAYRA-Y
A0A2J0LAF9      TIATFMQKNVYRAAATVIV-----------DAESPDVLSVKDIVKLGES--NYFAYKD-Y
A0A2J0LM30      TIATFMQKNVYRAAATVIV-----------DAESPDVLSVKDIVKLGES--NYFAYKD-Y
A0A0F0CSR3      LIRTFMMRPVYEATTKILI-----------QKKAPRIIKIDEMDTTNYS--A----SD-T
A0A1G1IVX7      IFFTFTERVIYQASATLLI-----------EKDNPNVLDFKEVLTFDAS--S----TD-Y
A0A1J4Z4I0      AFFSFWVEPTYRATTVILI-----------ERQQPKVLSVEEVYGMGLA--D----KE-Y
A0A2J0LS24      AFFSFWVEPTYRATTVILI-----------ERQQPKVLSVEEVYGMGLA--D----KE-Y
A0A2H0LEC5      YFREAQKPDIYQASTEIVI-----------EQDDADLVQFQRGARYNAN--A----GDQF
A0A1G1JZ27      ALYSLLSPKIYKATTRILI-----------ERSNQNILSFDNIFPVQMA--G----LD-Y
A0A1G1K375      ALYSLLSPKIYKATTRILI-----------ERSNQNILSFDNIFPVQMA--G----LD-Y
A0A1W9RLH0      LFFSFKVKPVYRAKTRILI-----------ESKVPKIVQFEDVYLTDYG--N----SDRY
                          : :   :.            :                             

A0A1G1IP08      LLTQLRVIKGPQLAERILQKFSTGEERQLAADCFALKGNWAKKDA--------PFTEREQ
A0A2J0KU82      YQTQYRILKSRSLAEKIVEKLNLTASPRF-----------------------------QG
A0A1G1K0W1      FQTRAEMLKSHHILEQAAKELNLVEHYQKV-----------------------NKRIKTN
A0A1G1K4H2      FQTRAEMLKSHHILEQAAKELNLVEHYQKV-----------------------NKRIKTN
A0A1G1LHA8      YLTRIEVMKSRPILAPIAERLNLPEHYG----------------------------VETT
A0A1G1KQI3      IATQLQILKGISVTEEAVKKTNYHE----------------------------KVGMSME
A0A2J0LFS5      YETQYKILRSRTLIKLIFDDMNLYL----------------------------DPEFSDA
A0A1J4VP59      YGTQLAILRGLKIEKMVKAELGGDSEGYA-------------------------------
A0A1G1PGV5      LATEYQLIISRPVLEEVLRTMNLGG----------------------------FPPFSIS
A0A3C0MWS5      YRSQMAIVKSYPIIKQVFDEFGVGK----------------------------SEKYAKA
A0A2H0LL91      VDTQAEIIASIPILTVAAEKEDLAN----------------------------FFEVEDL
A0A1V5SP48      FNSQYEILRSVSLARKIAEKLDLKA----------------------------LPE-FQG
A0A1G1JR53      YQSQAELLTSYTLVKKVFNEFGLEE----------------------------QFEYFDA
A0A1G1KL63      FQSQMMIMCSHSLAKKVFEDFKLGE----------------------------TKEYYKT
A0A660WJ06      FQTQFRLLKSDNILEKVINRIS-------------------------------PDIPPSQ
A0A351I6G3      IETQQEIIKSRNIAMQVINNLGLAD----------------------------KEEFKKE
A0A2J0LAF9      IETQQEIIRSRRTAHKVMKNLGLKD----------------------------RTEFIRS
A0A2J0LM30      IETQQEIIRSRRTAHKVMKNLGLKD----------------------------RTEFIRS
A0A0F0CSR3      LFTQYKILESD----------------FLAEKVFKTLGDYIPWDKWHGRKKINTSKPLTD
A0A1G1IVX7      YQTQYQMLKGAGLIRELLHEERLENDPYLEGLVRGRMRNFLRKQPWVAGI---LGKFLVP
A0A1J4Z4I0      YETQYKILRSRTLIKLIFDDMNLYLDPEFS----------------------------DA
A0A2J0LS24      YETQYKILRSRTLIKLIFDDMNLYLDPEFS----------------------------DA
A0A2H0LEC5      LRTEHMLIRGPEILQSVVKTLNLDAFPPFA-----------------------------R
A0A1G1JZ27      YPTQYKILRSRSIAKRVMDELHL--WPQFS-W---------------------------A
A0A1G1K375      YPTQYKILRSRSIAKRVMDELHL--WPQFS-W---------------------------A
A0A1W9RLH0      YNSQCEILKSNTIAKMVLDMLGD--YKPWDIWHGRK-----------------KDATFTE
                  :   :: .                                                  

A0A1G1IP08      GFLVSMIRGF-ISAEQVERGARIIAISMTGYDAYGVKKMVDTAAETYIDLNYETQIDAFK
A0A2J0KU82      GNPIDALLGM-IIIEPVGK-SRLVNINVQSDNPQFAATIANTIAEEYVKKDIEDKLFTTK
A0A1G1K0W1      EEAADLLGDDKTNVKLLKG-TQIVQLSVTDTDPQWAAKIADGISDTFIKESWRERLFISE
A0A1G1K4H2      EEAADLLGDDKTNVKLLKG-TQIVQLSVTDTDPQWAAKIADGISDTFIKESWRERLFISE
A0A1G1LHA8      ENAAQILRGN-LDAHLVRN-TEVIEVALSDRDPKMAARIADAVAEHFARETWREQLFISD
A0A1G1KQI3      RAAGSA-LGA-LSTIQIKG-TRIVRVVFQSEDPKIAAEMVNAICEGYIKKNIENRLYFSQ
A0A2J0LFS5      RDPISVFISR-LTIDPVRN-SRLVNLHFDGKDPQKITTIANTLAELYIKQDAEIRTKASR
A0A1J4VP59      -----------ISASHIRD-TRILSLSVTHLKPELAAKIANKFAEIYVRESKHENAFIGQ
A0A1G1PGV5      NDPAGVLSGL-VSVVPVRG-TKLVDIVVTSTNPTLAMRIANTVAETYVQLNLERRQQQAT
A0A3C0MWS5      KDPMKEFLKT-IDVQSVRD-TRLMDVNVENEDPVIAAKMVNRIADLYIRRN---LDYISK
A0A2H0LL91      REAVFVLKKK-LRVRAVRG-TQLINISIATPSAEKSAAIVNSIAETYVKQSIQNRLFFSK
A0A1V5SP48      KIPELALQEM-ITVKPVKN-SRIVMLSVESSRPELAANIANALADIYIQQNIEGMMFMSK
A0A1G1JR53      KEPIKKFLKT-IKVDPVRD-TRLLKLNVDNKDPELAAKIANRMANLYVMRN---LYYISR
A0A1G1KL63      KEPIKNFLKT-IRVDPVPD-TRLVKLSVDNKDPQLAANIANRMAELYVMQN---LYYTSK
A0A660WJ06      KISLKEKIKSSIIPKQIPG-TRIFSIIVVGENPEWVAKVANTLAEVYVEENIEARIKASS
A0A351I6G3      KDPVGHLLKK-LKVELVKD-TRIIKISIDDKDPRQAVLIVNKFAKVYTDSNIASRINPSN
A0A2J0LAF9      KDPLETLLKK-LRVELVRG-TRILKINADDNDPVQACRIANEFANVYVDSNIALKMRTSN
A0A2J0LM30      KDPLETLLKK-LRVELVRG-TRILKINADDNDPVQACRIANEFANVYVDSNIALKMRTSN
A0A0F0CSR3      LQKIETLLSH-LKITPIPN-TELVLIKFEDIDPVLSAKIANLWANSYISYILDTRFDVSS
A0A1G1IVX7      QSPEDVFAAHMLQIKPVRN-SQLVSVIVLHPDNRRAASIANTLARLYIEQNLRNRYEVST
A0A1J4Z4I0      RDPISVFISR-LTIDPVRN-SRLVNLHFDGKDPQKITTIANTLAELYIKQDAEIRTKASR
A0A2J0LS24      RDPISVFISR-LTIDPVRN-SRLVNLHFDGKDPQKITTIANTLAELYIKQDAEIRTKASR
A0A2H0LEC5      SEYPADLLAGMVSVQPVRG-TNLVNISVTGKKPDLVARISDAVAETYADRNLQRRIEKTG
A0A1G1JZ27      SDPPAAFLQK-VDIDPVKQ-SRLVDVSAYSTSPKQAADMANAMVKFYIEQNLSNKLAMTQ
A0A1G1K375      SDPPAAFLQK-VDIDPVKQ-SRLVDVSAYSTSPKQAADMANAMVKFYIEQNLSNKLAMTQ
A0A1W9RLH0      EEKIKALLKN-VKVKKAVR-SQLVDILVEDTDPELAAKIANFWVGAYLNYIQQSRSSLTK
                                    : :. :            : :     :             

A0A1G1IP08      KSFSVISKSLNEIREKIKAGEMALQK----------------------------------
A0A2J0KU82      YAVGWLTDEMKKMKEKVEESEKKLQEYKETNELV-----SLEESQNIVVQKLAELNSKAT
A0A1G1K0W1      QILEWFPKEGETLQK--SSGINQLRQLDKEGAIT--------------------------
A0A1G1K4H2      QILEWFPKEGETLQK--SSGINQLRQLDKEGAIT--------------------------
A0A1G1LHA8      QVLKWFPEEGKILEM--NSPIGQLRRLEND-PIA--------------------------
A0A1G1KQI3      EIMKLLPAETQKTLK--SQTPMGQLEELSQKELI--------------------------
A0A2J0LFS5      DAVSWLMEQIVSVKKRLEESETALVKYMEQEKIT--------------------------
A0A1J4VP59      QILQLLPGSPEAVLPG--GSAVVSQGFSKQEFAS--------------------------
A0A1G1PGV5      GGAEWLQEEVVKTEGQMKAAQEALQGFKEKHQMV--SLEDQQNVIVQRLQELSSAATEAK
A0A3C0MWS5      SELLNL------------------------------------------------------
A0A2H0LL91      EILNLLPEGGGKKTIEDLSPIGQLEKLEDIKFAA--------------------------
A0A1V5SP48      EILRVISGEHGLPEPGMPSDI-LPSAAERQKIIQ--------------------------
A0A1G1JR53      TELTNL------------------------------------------------------
A0A1G1KL63      VELSNL------------------------------------------------------
A0A660WJ06      QTFVYLNKRINELKNKLERDQKELARIEQSAGIYTFISGKSGSLESSKLEDFNSRYLSAR
A0A351I6G3      EAETWLREEVDKQKLKVRESEFSLQAYKEKNNIVGSIEDKQNIINDA-LMKLNTVYLDAQ
A0A2J0LAF9      EAEDWLKKEVDKQKTKVREAEFMLQSYKEKNDII-SIENKENIINDS-LISMNASYLAAQ
A0A2J0LM30      EAEDWLKKEVDKQKTKVREAEFMLQSYKEKNDII-SIENKENIINDS-LISMNANYLAAQ
A0A0F0CSR3      YASGWLDDKIKEEKNNLETAEKTLQEYRKANTII--------------------------
A0A1G1IVX7      QATELISGQIGILKDKVAEADLKLQKYKEEHSLV--------------------------
A0A1J4Z4I0      DAVSWLMEQIVSVKKRLEESETALVKYMEQEKIT--------------------------
A0A2J0LS24      DAVSWLMEQIVSVKKRLEESETALVKYMEQEKIT--------------------------
A0A2H0LEC5      GGTQWLQEELAWTEKKMRAAQLELQNFLEEHETV--------------------------
A0A1G1JZ27      QAAEWLKGRSKDVREKLSKSELEFEAMK--------------------------------
A0A1G1K375      QAAEWLKGRSKDVREKLSKSELEFEAMK--------------------------------
A0A1W9RLH0      YASTWLEKEIERAKKKVEEAELALQKYREENNII--------------------------
                     :                                                      

A0A1G1IP08      ---------------------------------IIKELQ---------LLDQFKVYGDKH
A0A2J0KU82      QAKGKKLETENKYKQVEENRDKPDTLPSVRDNALVQELKQVCATKEGTLSEMMKRYKEKH
A0A1G1K0W1      ------------------------SLPSVAKDPVINSIKEERIKVDAMMRELSKRYTSEH
A0A1G1K4H2      ------------------------SLPSVAKDPVINSIKEERIKVDAMMRELSKRYTSEH
A0A1G1LHA8      ------------------------SLPSVMQDPVIGGIEQKQMGVDEEMTVLSARYTPEH
A0A1G1KQI3      --------------------ESLPSVQADPTLR---ELKKKKTEIENELTALRQQYREQH
A0A2J0LFS5      --------------------ESPEAGNKDNTVNLPETLKREQLRLEVEISEISRRYGPKH
A0A1J4VP59      ------------------------SLNSVSGDPQVTQLLNEKLGIQSKLTELSQRYGPEH
A0A1G1PGV5      TARLNAEAEWAEISRALSAGRPVDSLPIVRQSPRILTLEPQIAAKETELSDRQKIYGEKH
A0A3C0MWS5      -------------------------------------LKNEYLRLDARLAEYSKIYKEGH
A0A2H0LL91      ------------------------TLPSVRSDPTILELKNQIAKAETDLFELKRQYREQH
A0A1V5SP48      ------------------------MLPSVVNNPEILNLRKERSGIESQIAQLSKRYKPKH
A0A1G1JR53      -------------------------------------LKNEYLKLESRVSEYAKVYKEGH
A0A1G1KL63      -------------------------------------LKNEYLKLETKAAEYAKVYKEGH
A0A660WJ06      AERIELESKLKEFEKLYKEKKYSELKEII-DDPVISDLSAQLREAEITLISLKKEYLEQH
A0A351I6G3      RKRIQAESAHKSSVDTEGNLRLENLSTLLSNNEVLQQLKKDYSKQQAILAEYKEVYKNKH
A0A2J0LAF9      KKRVSSETTYKSLVDGGGKLNLDRLPTILTDNDILKELKKEYLKQEALLVEYKKVYKDKH
A0A2J0LM30      KKRVSSETTYKSLVDGGGKLNLDRLPTILTDNDILKELKKEYLEQEALLVEYKKVYKDKH
A0A0F0CSR3      ------------------------IDTVDEEHRVLNKLLAKKSELEVLLSEKQEYYKAQH
A0A1G1IVX7      -----------------------SIPSLHEKDQFLQDAKLQLMKLQAREARMAKRYLPAH
A0A1J4Z4I0      --------------------ESPEAGNKDNTVNLPETLKREQLRLEVEISEISRRYGPKH
A0A2J0LS24      --------------------ESPEAGNKDNTVNLPKTLKREQLRLEVEISEISRRYGPKH
A0A2H0LEC5      --------------------DFS-TNRQNTIFQRISDLNRALTQVKQERIEAETRYREKH
A0A1G1JZ27      --------------------------------------------LKKELTELNEKYLPKH
A0A1G1K375      --------------------------------------------LKKELTELNEKYLPKH
A0A1W9RLH0      --------------------DDP-ATTSEDT-ALLNKLIERKAELETELAQQLNYFKEKH
                                                                       :   *

A0A1G1IP08      PMVVSLQTDITGLSVKLRES--------TNDL-----EKMEISQRKDRFSLIVESHTDMK
A0A2J0KU82      PKIIQLKSELKTLQERIDTE--------IGKVVDSIKGEYEEAEANERTALLALTEQEKK
A0A1G1K0W1      PKIKELQARADYLESEMKSQ----------------------------------------
A0A1G1K4H2      PKIKELQARADYLESEMKSQ----------------------------------------
A0A1G1LHA8      PKMKELLTQAAYLQSEKKAR----------------------------------------
A0A1G1KQI3      PSIIQREANLKFIDESIQIE-------------------------------------TQK
A0A2J0LFS5      PQMVKVLSELESVKSKLDIE-------------------------------------TQN
A0A1J4VP59      PAIKDLNQRLSTVESDIKAR----------------------------------------
A0A1G1PGV5      PAIAQLTEELTALRKQREAE--------VGKVVEDARLEYSAVQAKEQELQQALVEQERL
A0A3C0MWS5      PEMIRVREEMADVVASINKE----------------------------------------
A0A2H0LL91      PDVMKVQANLKFLKESVD------------------------------------------
A0A1V5SP48      PRMIALNTQLGSINEQIK------------------------------------------
A0A1G1JR53      PEMIKVKNEMAELVAKIEKE----------------------------------------
A0A1G1KL63      PEMIKLRTEMADMIKRMDNV----------------------------------------
A0A660WJ06      PEVKKLQDKIRILKQKIEEE--------GEKALARLKARIATLKSKEKALLKSLNDLKKE
A0A351I6G3      PKMIALFETTNYLKSRIKSEELHIKAEETSRVTTKLETEDDYAAEEEGKLKKLLDERKEE
A0A2J0LAF9      PKMARLFENMDYIKSRIKTE---------------VENEYNYAKEEEAKFKKMLETQKNE
A0A2J0LM30      PKMARLFENMDYIKSRIKTE---------------VENEYNYAKEEEAKFKKMLETQKNE
A0A0F0CSR3      PEILGIKSELESIVKTIANE-------------------------------------KTK
A0A1G1IVX7      PKRIHLRSEIEGLDEKIKTE-------------------------------------ETR
A0A1J4Z4I0      PQMVKVLSELESVKSKLDIE-------------------------------------TQN
A0A2J0LS24      PQMVKVLSELESVKSKLDIE-------------------------------------TQN
A0A2H0LEC5      PILQELLKREAEMEAAFKQQ-------------------------------------EKK
A0A1G1JZ27      PKIIRTQERIRVIEEQFGGG-------------------------------------ISK
A0A1G1K375      PKIIRTQERIRVIEEQFGGG-------------------------------------ISK
A0A1W9RLH0      PIIKGLKAELNSINKKIEEE-------------------------------------RQR
                *           :                                               

A0A1G1IP08      SLTDAEVDLQTMKPLLEQEVNTNKELYNSLFKKLQEVELSGSRNVWLDAKVIEKAAVPGR
A0A2J0KU82      ALELNRMAIEY--NVLKRDTETNREMYEALLKRMKETDISGGLQA-SNIRVIDKAEVPKG
A0A1G1K0W1      -------------------------IQKIV--SGLKSGLSGEFSA-SNMKVIERAEIPTK
A0A1G1K4H2      -------------------------IQKIV--SGLKSGLSGEFSA-SNMKVIERAEIPTK
A0A1G1LHA8      -------------------------IEKII--SALKAGLTGDFTI-TNVKVIEPAAIPSR
A0A1G1KQI3      IVA------------------------------NLKSSISGRLQI-SNVRFIKRADPPMS
A0A2J0LFS5      LINLNRKAAQY--TILKREVDSNRDIYETLVKRAKETGVSEQLEA-TNIRVVDPAEVPDR
A0A1J4VP59      --------------------------SETILSNVK-ANLAGEANI-TNIKVLEEAPVPKN
A0A1G1PGV5      ALGLNRLKLDY--ENLNRQAQLSVDLYNSLSKRLKELEVVQSMQS-NNVRIVDGAKLPDG
A0A3C0MWS5      ---------------KETGLEGSKAVHDRY--KEQLRGALAGLKA-NNVSVVEYAQDPIE
A0A2H0LL91      ----------------------VQ-IKRVV--HELKTALSKRLQV-SDVRVVQAGEPALL
A0A1V5SP48      ----------------------AR-TDEVI--ASVKAELEGKLRP-NNIRILDRAQTPKI
A0A1G1JR53      ---------------KKSVYDYDN-IEDYL--KPEAQHQLAGFKA-NNISVQDSAEIPVV
A0A1G1KL63      ---------------NMPIHDYSK-MEESL--KSDSGRTLAGFKA-NNISIRDPAEKPVT
A0A660WJ06      IATKNKMVARY--TLLKQEIATTQQLYEALLKKLQQMDISSPSSY-INVRILTPAKVPSK
A0A351I6G3      ALEVERKIIEY--NALKRELETNKRILDIVLNRMKETAISSKIQT-NNVRIQDIAEEPKR
A0A2J0LAF9      LLALERKVIDY--NALKRELETNERVLDIVLNRLKETSISSQVQT-NNIRVQDLADVPKK
A0A2J0LM30      LLALERKVIDY--NALKRELETNERVLDIVLNRLKETSISSQVQT-NNIRVQDLADVPKK
A0A0F0CSR3      ELKIKDIEIEY--NILLREVETRKEVYESLLKRIRETEITGGLKT-TNVSILDIAQVPTK
A0A1G1IVX7      KIDIGGVAIQY--DELEREAESARKVYRALLERLEQTHSEAKAQA-SNITVVDKAVPEPR
A0A1J4Z4I0      LINLNRKAAQY--TILKREVDSNRDIYETLVKRAKETGVSEQLEA-TNIRVVDPAEVPDR
A0A2J0LS24      LINLNRKAAQY--TILKREVDSNRDIYETLVKRAKETGVSEQLEA-TNIRVVDPAEVPDG
A0A2H0LEC5      ALEFTRLSIQY--NVLQRNSETTEGIYDVLLKRLKELSVEGNLQA-NNIRIISRAKIPKS
A0A1G1JZ27      DFASGEISTQY--NQLQREVDSQGKIYEAMLSRLKETSASEGIED-TNVVVIDRAEVPTR
A0A1G1K375      DFASGEISTQY--NQLQREVDSQGKIYEAMLSRLKETSASEGIED-TNVVVIDRAEVPTR
A0A1W9RLH0      LLALKEKAIRY--RILKREVETNKAIYESLLNRLKETKSIQNLRL-TNIRVVDRATVPIK
                                                               :  .   .     

A0A1G1IP08      PIRPNKQMNLLLGLLLGGFIGTGLAYFLEYLDSSLRSLNDLRSYLKIFPLGMVPMVELPE
A0A2J0KU82      PIKPRKSTNIIMAIFIGILSGAAAAFTLEYLDDSIRNQRDIEAYIQLPFLGHVPIV----
A0A1G1K0W1      PSGPKRLVMVSLSTLIALFLSIVLAVQLNNLDLNIKAEEDVRQ-IPMPFLGYLPQLDTL-
A0A1G1K4H2      PSGPKRLVMVSLSTLIALFLSIVLAVQLNNLDLNIKAEEDVRQ-IPMPFLGYLPQLDTL-
A0A1G1LHA8      PSGPKRSIIVLASAAVSFAGSLLLVVFLHHLDQNISSEEDVRK-IPATFLGYLPLISGL-
A0A1G1KQI3      PSGPDRKKLLLIVVLGYLFASSLIVILLDQFDDRIKGQEDIERYLHLPYLGHLPLI----
A0A2J0LFS5      PIRPNKKNNIILACLVGLMLGVSTAFFIEYIDNTVKDPDDVTNYIGLPFLGYVPSA----
A0A1J4VP59      PSGPNRFRGILSWTLIGFCASASLISFFEYANQKVRTKNDVIS-LGICFLGYIPLV--KE
A0A1G1PGV5      PIAPHRVRIVLQGLLLGLVVGGGLAFLQDLMTTTIRMRRDLEELVNLPFLGHVVRV----
A0A3C0MWS5      PVKPNKLLNLLLAIVTGLFGGVGLALFFEYQDATIRSVEDIEKLTSWSFLGKVPVIPGS-
A0A2H0LL91      PEGPKRLRLILLFIILELLLSFGFVILIDYIDDRVKNQDDIERFVRLPYLGHTPVLRLE-
A0A1V5SP48      PIDSPKIPNILKGILAGILLGLGLIYLLEKIDTTVKTQEDVQQSLRLPFFGDFPFLKGGD
A0A1G1JR53      PIKPKRALNIVLAVVIGIMGGIGMAFFSEYLDDTAKSIEDVEEIAPWPFLGSVPRMKGR-
A0A1G1KL63      PIKPKKRLNFLLSIVIGLLGGVGLAFFFEYLDDSVKTVDDIERICEWPILGCVPDIDSRI
A0A660WJ06      PIKPKKVYNIVFGLIFGLFLGTGVVFLDEYMDTTIKTPSDVEKFLSLPVLGQVPYS----
A0A351I6G3      PIKPKKTLNIALSIVLGIIGGLTLVFFREYMDTTIKNSNDIVTLLQLPVLGSVPRI-KP-
A0A2J0LAF9      PIKPRKKLNIAFAVVMGLAGGIGLAFFREYMDTTIKDPDEIAGLLQIPVLGSVPRV-RV-
A0A2J0LM30      PIKPRKKLNIAFAVVMGLAGGIGLAFFREYMDTTIKDPDEIAGLLQIPVLGSVPRV-RV-
A0A0F0CSR3      PTRPNKKLSLIITLFISVLSGSALAFLIEALDQTLKTPEDIKKFLNIPPLAGIPLP-RD-
A0A1G1IVX7      PARPRPFLNLLMALVLGLMGGVFSAFLAEYLDPTIKIPDDVEKGLGLDLYGMIPKAGRI-
A0A1J4Z4I0      PIRPNKKNNIILACLVGLMLGVSTAFFIEYIDNTVKDPDDVTNYIGLPFLGYVPSA----
A0A2J0LS24      PIRPNKKNNIILACLVGLMLGVSTAFFIEYIDNTVKDPDDVTNYIGLPFLGYVPSA----
A0A2H0LEC5      PIGPNRQRGILVGIFLGLILGCGQAILREMLSKTLRNRREFEGTLQIPFLGALPDI----
A0A1G1JZ27      PVAPRFFLNVFLSILVGAFGAAALCIIFESLDNTVKTPEDIEKLGELPLLGVVSHW----
A0A1G1K375      PVAPRFFLNVFLSILVGAFGAAALCIIFESLDNTVKTPEDIEKLGELPLLGVVSHW----
A0A1W9RLH0      PVRPNKKMNFVLALFIGLFLSTGAALLIENLDLSIKEPDEVQKYLGLPLLGTIPLY----
                *  .     .          .                  :.         .         

A0A1G1IP08      LEKQIDLAENPELTRTWWNTNDGTLPLY--------VAEAYRIIRTSLAFGSL-DKTIKV
A0A2J0KU82      ------------------RTKGATVGLYANLYPRSEVSESLRSVKTNINFTLT-TPPPHA
A0A1G1K0W1      ----AGD-----------TKSDRRENLLEHVLTDMRLMDDITNIRAAVLFSMPADRS-KL
A0A1G1K4H2      ----AGD-----------TKSDRRENLLEHVLTDMRLMDDITNIRAAVLFSMPADRS-KL
A0A1G1LHA8      ----NGR-----------SKNGAKSNLLHRALSDSRLIDSITNMRAALLFSMPAERS-KR
A0A1G1KQI3      ---RKQD-----------VKSNQERALYSHHKPDSEVAEAIRYIRVGINFSAP-PEILRC
A0A2J0LFS5      ---RK-E-----------ARTEDEIDLIVYQKPHSVISEAYRSIRTSILFAFA-GKPSKT
A0A1J4VP59      FLKGQKY-----------HEFSEEPDLVRVLKANATLADAVANARTHILFSMPYEKS-RR
A0A1G1PGV5      -----PL-----------PRGRRGGALFFSRHPDGVAAESLRAVRTTLEFLLP-ERTTQR
A0A3C0MWS5      -----------------------KKEFSTHLKPEDFTSEAYKSIRTQLLLLDTKTHPLKT
A0A2H0LL91      ------G-----------EKNKSKGYFYVYANPQSDLAESLRYIRVGINFSAPPDM-LRA
A0A1V5SP48      KMMTGPE-----------SLLKLDSNI--------PASNAIREIRIGLNFLTIKNTPPKT
A0A1G1JR53      ------G-----------KRAELEKDVRVQRLPRDPVSESYRSIRTSILFSSTEERPLRS
A0A1G1KL63      SVEEAAS-----------PLGELEKDIFVSIKPKDPIAEAYKSIRTRLSLSSTEEHPLKS
A0A660WJ06      -----KS-----------LLKEPKLLYATEEKNIH-ILESFRILRTNIQFSSIDNPL-KT
A0A351I6G3      ---DGKN-----------IRNKIDADRVVEKDSLCMASEAYRSIRTNLLFSLKDSGYSKS
A0A2J0LAF9      ---DGIS-----------IKQETDIDRIVEKDSASLVAEAYRSIRTSLLFSLEDSRSAKS
A0A2J0LM30      ---DGIS-----------IKQETDIDRIVEKDSASLVAEAYRSIRTSLLFSLEDSRSAKS
A0A0F0CSR3      ---EEDK-----------LISPEFITSKKPRST---IAEAYRSLRTSILFTAIEHKR-KS
A0A1G1IVX7      ---NASS-----------AQGEIFSKWEIVPNP---AAEAIRALRTALVFKLRHMKGCHA
A0A1J4Z4I0      ----RKE-----------ARTEDEIDLIVYQKPHSVISEAYRSIRTSILFAFA-GKPSKT
A0A2J0LS24      ----RKE-----------ARTEDEIDLIVYQKPHSVISEAYRSIRTSILFAFA-GKPSKT
A0A2H0LEC5      ----HVG-----------RAHKGKEKLFLIKQPQSTEAESLRAIRTTAEFLLPAQQSSHV
A0A1G1JZ27      ----EAA-----------QKQ-----LVVHEDRSSGVAEGFRAIRTSLLFSSP-DHPLRT
A0A1G1K375      ----EAA-----------QKQ-----LVVHEDRSSGVAEGFRAIRTSLLFSSP-DHPLRT
A0A1W9RLH0      ----KQK-----------KDKSTHPALSIFTDSHSPALESYRTIKANLTLSNP-DLAKKL
                                                      :     .    :        . 

A0A1G1IP08      LQVTSAVKGEGKTTTVCNLGISLAQAGIKTLLIDADMRRPSLHHILHIDDRNQGLSTILS
A0A2J0KU82      LLLTSVAPQEGKTSLSSNLSIVMAQGGDRVLLVDADMRHPTVHKIFKTEN-SKGLRDYLS
A0A1G1K0W1      LMFTSTIPEEGKTTVASLFGMSLAHGGEKVLLIDADMRKPALHQIFGLEN-KIGLSHCLV
A0A1G1K4H2      LMFTSTIPEEGKTTVASLFGMSLAHGGEKVLLIDADMRKPALHQIFGLEN-KIGLSHCLV
A0A1G1LHA8      IMCTSAIPEEGKTTVLGLLGISLAQIGERILLIDADMRNPSLHQVFGLKN-ECGLSNCLI
A0A1G1KQI3      LLVTSSLPQEGKSFTAANLAVSMALDGNKVLLIDADSRRPVGHRIFQLRN-EVGLINFLT
A0A2J0LFS5      ILMTSSSPQEGKTSAAINLGITMANTSEKVLFVDADLRCSRLHKSFGIQK-ENGLSDYLV
A0A1J4VP59      IMLTSAIPDEGKSTVAALLAVSLTTLGRKILLVDGDLRKPSLHNYLGFRN-DKGLTDYLV
A0A1G1PGV5      VLITSSLPQEGKTTVSSNLAVSLQELGRRVVIIDADMRRPTLFRTFQVPI-EPGLSTYLQ
A0A3C0MWS5      IVFSSIGPQEGKTLTVCNLAIAIAQSQKRVLLVDADMRRPRLHEVLKVKD-GKGLCSFLS
A0A2H0LL91      FAITSSIPQEGKSFCSCNLASSFALDGNKVLLVDADNRRPVLHTVFNMDN-DYGLINYLT
A0A1V5SP48      FLITSSVPKEGKSLLAVYLAFSFAKSGANTLLIDADLRLPKLHYSMNVRQ-SPGFADLLR
A0A1G1JR53      VVVTSPGPQEGKTTTLCNLGISIAQNGSKALLVDADMRKPRLHEIFNIEN-KNGLSDFLC
A0A1G1KL63      VLITSPGPQEGKTITLCNLSIALAQNQKRVLLIDADMRKPRLHKVFKKEN-VSGLSSLLS
A0A660WJ06      LLVTSAVEKEGKTTIAANLAASFAKLGKKTLLVDCDLRKPGIHKIFNLKR-EEGLSKLLL
A0A351I6G3      IAITSSVPKEGKTISAVNLAIMMADSGESVLLVDSDMRKPRVHTVFNIDN-VSGFSNYLA
A0A2J0LAF9      IVITSSLPREGKTVTSVNLSTMIANSGEKVLLVDADMRKSRLHTIFNMDN-QTGLSQFLM
A0A2J0LM30      IVITSSLPREGKTVTSVNLSTMIANSGEKVLLVDADMRKSRLHTIFNMDN-QTGLSQFLM
A0A0F0CSR3      LLLTSSCPQEGKTTTAINLAVVMAMAGEKTLLVDADLRQPRIEKVFNLKD-KLGLSDVLI
A0A1G1IVX7      LLVTSPNPEEGKSTVALNLASAFQQNHFRALLIDADLRRPRLHKALGEGC-ERGLSDVLE
A0A1J4Z4I0      ILMTSSSPQEGKTSASINLGITMANTSEKVLLVDADLRCSRLHKSFGIQK-ENGLSDYLV
A0A2J0LS24      ILMTSSSPQEGKTSAAINLGITMANTSEKVLLVDADLRCSRLHKSFGIQK-ENGLSDYLV
A0A2H0LEC5      LIITSAIPEEGKSLVSLSLAISLAELERRVVFIDADMRRPTVHASVNLPL-DPGLSGFLE
A0A1G1JZ27      LVITSPFAEEGKTIVACNLAATIAQSGARVLLVDADMRRPRVNQVFQQNG-VHGLSHALT
A0A1G1K375      LVITSPFAEEGKTIVACNLAATIAQSGARVLLVDADMRRPRVNQVFQQNG-VHGLSHALT
A0A1W9RLH0      LLITSSVPNEGKSVFSVGLARIMAQAGEKVLLVDVDFRHPNLHEVFGVQR-THGLSDLLA
                .  :*    ***:     :.  :       :::* * * .     .       *:   * 

A0A1G1IP08      GDPLL-SAKDFVRPTTI-ANLY-----CMTAGVIPPNPAELLSSRRIKSMLDALKEEFDM
A0A2J0KU82      GAADF-DS--VVQKSMV-ENLS-----IVASGRVPPNPVELLDSPRTKLFLKEAKAKFDR
A0A1G1K0W1      GTAKPQEA--IQKIDKI-PGLS-----IMTAGVTPPNPAALLGSSMLERLIQELEPHYRR
A0A1G1K4H2      GTAKPQEA--IQKIDKI-PGLS-----IMTAGVTPPNPAALLGSSMLERLIQELEPHYRR
A0A1G1LHA8      GSSRARDV--IQVVEGV-PGLH-----LMTAGARTPNPPVLLGSASIDRLIREIELDYHR
A0A1G1KQI3      SNISF-ES--VIQPSGVNEHLF-----VMPSGPTSPNPSELFASGRMKELVQLARTQYDR
A0A2J0LFS5      GNITL-DA--AIKPTRI-ENLS-----LLTAGSTPPNPAELLHSGKMKAFLEDAIKKFDR
A0A1J4VP59      GAATI-DE--IIQPMRN-NPLQ-----LITAGSVSRNPSELLASERFRELLDRCGERFDR
A0A1G1PGV5      GQAALEEI--LQTPAHV-QGVT-----VIASGATPPRPADLLASPKMGQLLEQLSASFQY
A0A3C0MWS5      EKAAL-EE--LVRKTDI-ENLY-----FVADPYSCANSTELLSAQKISDFLAFARKNFDY
A0A2H0LL91      SDVTL-ES--ITRKTDV-PGLD-----FIASGPESPNPSELLGSEKMAEFIQKAKSQYDR
A0A1V5SP48      GTMSP-DS--VIVRTGI-PDLS-----ILTAGQSNDNPSELFSRPNVPELFHQLSSQYDK
A0A1G1JR53      GRIEF-VS--SVKATDI-EGLS-----ITNGGTHPPNPSELLSSQKMKYFIQEAERKFDF
A0A1G1KL63      GQAVF-DN--IIQKTDI-TNLY-----FISGGILPPDPSELLASGKTKESIAKAGEKFDF
A0A660WJ06      TGGQI-DD--FVKKTEI-ENLY-----VMCAGPIPPNPTELLSSHKMDKIVNEMREKFDM
A0A351I6G3      GQVDF-DR--IIKYTGI-NNLS-----VIPAGSISHKSAELISSKNAKLFLEKAGARFSK
A0A2J0LAF9      GEKGL-ID--IINPTAV-DNLY-----IVTSGKSTHKPAELLSSSNMKLFLEQAGGQFSK
A0A2J0LM30      GEKGL-ID--IINPTAV-DNLY-----IVTSGKSTHKPAELLSSSNMKLFLEQAGGQFSK
A0A0F0CSR3      GNAKW-EQ--MIIETNI-KNLF-----ILPAGSIPPNPSELLGSGKMTTFLEDIDKKYDR
A0A1G1IVX7      GQCD-------IVSAVR-RNVAGFGFDFLPAGSRLDHPTELLGTETAAKLFTALRQEYDM
A0A1J4Z4I0      GNITL-DA--AIKPTRI-ENLS-----LLTAGSTPPNPAELLHSGKMKAFLEDAIKKFDR
A0A2J0LS24      GNITL-DA--AIKPTRI-ENLS-----LLTAGSTPPNPAELLHSGKMKAFLEDAIKKFDR
A0A2H0LEC5      GKVDPGDL--IQTSSEA-PGLS-----VITAGSQPAQPTDLLISGKMKDLIHQLRDEFQY
A0A1G1JZ27      DSANP-SG--FIQKTKI-ENLS-----VLFCGPLPPTPSEMIGSQKMHQLIEKLKGQFDY
A0A1G1K375      DSANP-SG--FIQKTKI-ENLS-----VLFCGPLPPTPSEMIGSQKMHQLIEKLKGQFDY
A0A1W9RLH0      EGIQDIHN--YIKKTNV-ENLD-----LLTCGSLPPDPAELLGTKKMEELIQELSKRYDR
                                    :                .  ::        .      :  

A0A1G1IP08      ILIDSPPVISVADSPIISSHVEGTILVSRAGFIPRHICLHAKHAVEA-VNGRIIGGILNC
A0A2J0KU82      IIIDSPPIIAVSDALILAKLVDGVVYIVRGSKTSREAAFEGKRRLLD-IDAKILGIALNY
A0A1G1K0W1      IVFDGPPGLHIIDSLLLSAKVHGTILIFGFGKIHRNIAKKMKERILS-AKGTLIGAAING
A0A1G1K4H2      IVFDGPPGLHIIDSLLLSAKVHGTILIFGFGKIHRNIAKKMKERILS-AKGTLIGAAING
A0A1G1LHA8      IIFDVPPSLHIADGLILAGKVDGTVLVFRAGKVHQKIGRRMKEKIDA-AGGVIIGGVINR
A0A1G1KQI3      VVIDAPPLTGIGDGFVLGGVVGHLILIVMAGKTSRYAVSAIKHRLVD-SNIKIVGVILNS
A0A2J0LFS5      IIIDAPPILMVTDAAILANIVDGVIMLVRCGKIHIEIVSRTKQKLQD-SKANILGVLLNN
A0A1J4VP59      IVIDVPPVLYIPDGLIVAKIVHTGILICGADMVNKETIQEVKEKFDS-IGYSFIGAIINR
A0A1G1PGV5      ILVDTPPVLAVADSTILSRVVDSAILIVRANRTTRENLSSTQRILTQ-SPLKFVATILND
A0A3C0MWS5      ILLDSPPVGIVSDATLLSTLADGLVLVVESGKTPRKAIVRQRKALDG-AGIKVAGVIINK
A0A2H0LL91      VIVDAPPLVGIGDGLVLGKLIGHLILIIRSHRISRKVIRQIRERLQQ-HQIKVLGVILNH
A0A1V5SP48      IIIDSPPSLMIPDALLLARIVESTILVIRSGKLSANSIVKLKEKFDA-IGAPLTGFILNG
A0A1G1JR53      LLFDSPPVGMLTDAMIFSSMVDGMIMVIESSKTSKRTLARIYKLINS-AGVRVVGIVLNK
A0A1G1KL63      VLIDSPPIGILTDATILSSIVDGIIVVVESGKTSKKVLARVCQIINE-SKTHVIGLLLNK
A0A660WJ06      VIVDSPPSVSVPDPVIMGSKCDGAVMVISAGKVPRELYIEAKKFLEK-ANVKIIGTVMNN
A0A351I6G3      IIFDAPPVALVTDAAVLSGLCDGVILIAEADRTTKDLLNNSKELLHK-AGANIIGVILNN
A0A2J0LAF9      IIFDTPPVCLVTDAAILSSICTGTVLIAEGSRATRELLKRSKEILGK-VDARMLGVIVNN
A0A2J0LM30      IIFDTPPVCLVTDAAILSSICTGTVLIAEGSRTTRELLKRSKEILGK-VDARMLGVIVNN
A0A0F0CSR3      IIIDSPPVLAVTDAVILSGKVDGTIIVARASHTHRHAICQAKELIETVDTAHIVGMILNM
A0A1G1IVX7      IIFDTSPYLAVADVAVLSEHADVGVIVARYHKTDKRHLKDVRRIFGE-GNLKTFGIVMNL
A0A1J4Z4I0      IIIDAPPILMVTDAAILANIVDGVIMLVRCGKIHIEIVSRTKQKLQD-SKANILGVLLNN
A0A2J0LS24      IIIDAPPILMVTDAAILANIVDGVIMLVRCGKIHIEIVSRTKQKLQD-SKANILGVLLNN
A0A2H0LEC5      VILDTPPVLAVADTTALASLTDGIIYVVRAGRTPRDVTLAGKTRLTD-VGAKLIGGVLNG
A0A1G1JZ27      VLFDSPPFLVVTDPVVLSTFVDGVIIVTRYNKTPKDVIARGKQKFLG-VQAKLVGVILND
A0A1G1K375      VLFDSPPFLVVTDPVVLSTFVDGVIIVTRYNKTPKDVIARGKQKFLG-VQAKLVGVILND
A0A1W9RLH0      IIFDAPPVLAVTDALVLSTKVDGVIIIVRFEFTHRKALQRTKETLER-VNAKILGAVLNM
                ::.* .*   : *   ..      : :                 .         .  :* 

A0A1G1IP08      VTSHQHSSYYGYGYYYGKGYGYSYYGSDEKQG--GKKKKKRSAGAAPGKLEKLMMLK---
A0A2J0KU82      IDIRKERYYY-YGYYYG-GQGKRRKTEEDEVGKIGSQTAVSESEGEAVKAEELTQSKQLT
A0A1G1K0W1      TDYK-KLDYASYTYYQKYSKYYGVSKAGD-------------------------------
A0A1G1K4H2      TDYK-KLDYASYTYYQKYSKYYGVSKAGD-------------------------------
A0A1G1LHA8      ADFK-RLDSTYSRYYRQYTKYYHRRDGSKTEELSRLEPVHQ-------------------
A0A1G1KQI3      LDVE-RERYGYYRYHYYTYQRYYGKKK---------------------------------
A0A2J0LFS5      VDYG-KESY----YHYYYYSDEEKKKNV--------------------------------
A0A1J4VP59      ADFE-REGYRYKYYGTYKSYYKPR------------------------------------
A0A1G1PGV5      IRPEYEYQYYRRGYSYYTKRPPSTPVPAQSPG----------------------------
A0A3C0MWS5      AVIS-GSEGYYYSKSYHRMK----------------------------------------
A0A2H0LL91      LDME-KDRYGYYRYHYHTYNRYYGKK---AIKRKEKKERRHHKKAS--------------
A0A1V5SP48      SRLE-KIQH-YSSYYKSYYNKAHATKKKPAFKPKNKKPAIVPPAGS--------------
A0A1G1JR53      ISIH-GDDY-YHRYYRHYYGKP--------------------------------------
A0A1G1KL63      ISIT-PVNN-YYSYYYGNSNNPPKSK---SIRDRFSSDMIIKRAGKWAKLLANKISSILK
A0A660WJ06      LSPEIEYYYYYKRYYYY-----YPKE----------------------------------
A0A351I6G3      VSLT-RNSYYYPQYYYGKYYKPLNAK----------------------------------
A0A2J0LAF9      ISMV-RDGYYYPQYYYGRYYVPSRSK----------------------------------
A0A2J0LM30      ISMV-RDGYYYPHYYYGRYYVPSRSK----------------------------------
A0A0F0CSR3      VSINIGSGYYYYYYGKYGKYGKTPKKNTTVSAS---------------------------
A0A1G1IVX7      VEPR-ERHYYYHRYYYYGYGGDTPPK----------------------------------
A0A1J4Z4I0      VDYG-KESYYH--YYYYSDEEKKKNV----------------------------------
A0A2J0LS24      VDYG-KESYYH--YYYYSDEEKKKNV----------------------------------
A0A2H0LEC5      TQPE-K---RYVHYYYYQGARKARR-----------------------------------
A0A1G1JZ27      VDLE-QERYRYPAYSYYHDPLSEKGKADIPSLVAKVASDQDSAISSHPPRNFSPK-----
A0A1G1K375      VDLE-QERYRYPAYSYYHDPLSEKGKADIPSLVAKVASDQDSAISSHPPRNFSPK-----
A0A1W9RLH0      VNPR-GGSYYY--YYYYH--YGKKG-----------------------------------
                                                                            

A0A1G1IP08      --------EPVIDMISSTVSNIISILKSGQPRK
A0A2J0KU82      DVEKIAKAEPSVENKSKRPAFLRKLKRKPQSLS
A0A1G1K0W1      ---------------------------------
A0A1G1K4H2      ---------------------------------
A0A1G1LHA8      ---------------------------------
A0A1G1KQI3      ---------------------------------
A0A2J0LFS5      ---------------------------------
A0A1J4VP59      ---------------------------------
A0A1G1PGV5      ---------------------------------
A0A3C0MWS5      ---------------------------------
A0A2H0LL91      ---------------------------------
A0A1V5SP48      ---------------------------------
A0A1G1JR53      ---------------------------------
A0A1G1KL63      KSVSK----------------------------
A0A660WJ06      ---------------------------------
A0A351I6G3      ---------------------------------
A0A2J0LAF9      ---------------------------------
A0A2J0LM30      ---------------------------------
A0A0F0CSR3      ---------------------------------
A0A1G1IVX7      ---------------------------------
A0A1J4Z4I0      ---------------------------------
A0A2J0LS24      ---------------------------------
A0A2H0LEC5      ---------------------------------
A0A1G1JZ27      ---------------------------------
A0A1G1K375      ---------------------------------
A0A1W9RLH0      ---------------------------------
                                                 

© 1998-2020Legal notice