BYKdb

Dataset for cluster orphancd of phylum candidatus-omnitrophica

[Download (right click)] [Edit] [Sequences] [Repertoires]

25 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1G1JUC3      MNTANLPPYGAKPAVESHSEDHLEANLFAYWHILVKRRLVLLMALLVCLGLALIINSMQT
A0A2J0KUN7      ----------------MEENSNLEATLRDYLEIVAKRKTVFVVGFIIALIGSIAVIFLFV
A0A2J0L3X7      ------------------------------------------------------------
A0A1G1J391      ------------------------------------------------------------
A0A1W9RBB3      ------------------------------------------------------------
A0A1W9R9H3      ------------------------------------------------------------
A0A496RIX0      ------------------------------------------------------------
A0A2H0LKN2      ------------------------------------------------------------
A0A1W9RLY2      ------------------------------------------------------------
A0A1G1PTZ0      ------------------------------------------------------------
A0A1G1PYB2      ------------------------------------------------------------
A0A1G1NXZ1      ------------------------------------------------------------
A0A1G1JRT8      ------------------------------------------------------------
A0A1G1MCV8      ------------------------------------------------------------
A0A357BIJ1      ------------------------------------------------------------
A0A3D2GIE7      ------------------------------------------------------------
A0A1G1N811      ------------------------------------------------------------
A0A1G1P565      ------------------------------------------------------------
A0A1G1PUA7      ------------------------------------------------------------
A0A1G1QJ19      ------------------------------------------------------------
A0A358AEN7      ------------------------------------------------------------
A0A496RSL4      ------------------------------------------------------------
A0A2J0M9Y8      ------------------------------------------------------------
A0A3B9ZHK0      ------------------------------------------------------------
A0A419DVK8      ------------------------------------------------------------
                                                                            

A0A1G1JUC3      PI-YRTGAELVVEP----------------------------------------------
A0A2J0KUN7      PLKYRATTEIMIGSPVTEVVDQQGTVYIRGKYDVAVAFELMRSDIIPEKISKTIEIEEKV
A0A2J0L3X7      ------------------------------------------------------------
A0A1G1J391      ------------------------------------------------------------
A0A1W9RBB3      ------------------------------------------------------------
A0A1W9R9H3      ------------------------------------------------------------
A0A496RIX0      ------------------------------------------------------------
A0A2H0LKN2      ------------------------------------------------------------
A0A1W9RLY2      ------------------------------------------------------------
A0A1G1PTZ0      ------------------------------------------------------------
A0A1G1PYB2      ------------------------------------------------------------
A0A1G1NXZ1      ------------------------------------------------------------
A0A1G1JRT8      ------------------------------------------------------------
A0A1G1MCV8      ------------------------------------------------------------
A0A357BIJ1      ------------------------------------------------------------
A0A3D2GIE7      ------------------------------------------------------------
A0A1G1N811      ------------------------------------------------------------
A0A1G1P565      ------------------------------------------------------------
A0A1G1PUA7      ------------------------------------------------------------
A0A1G1QJ19      ------------------------------------------------------------
A0A358AEN7      ------------------------------------------------------------
A0A496RSL4      ------------------------------------------------------------
A0A2J0M9Y8      ------------------------------------------------------------
A0A3B9ZHK0      ------------------------------------------------------------
A0A419DVK8      ------------------------------------------------------------
                                                                            

A0A1G1JUC3      -------------------KSSNESNTDLQLNNLMRDPT---YLMTQSRLV----SSKKF
A0A2J0KUN7      LISPGEVKGMIAFIAASAQRTKNPYAHNLILISAIHTDTRKAYLVAKAAIKILFEETRKY
A0A2J0L3X7      ------------------------------------------------------------
A0A1G1J391      ------------------------------------------------------------
A0A1W9RBB3      ------------------------------------------------------------
A0A1W9R9H3      ------------------------------------------------------------
A0A496RIX0      ------------------------------------------------------------
A0A2H0LKN2      ------------------------------------------------------------
A0A1W9RLY2      ------------------------------------------------------------
A0A1G1PTZ0      ------------------------------------------------------------
A0A1G1PYB2      ------------------------------------------------------------
A0A1G1NXZ1      ------------------------------------------------------------
A0A1G1JRT8      ------------------------------------------------------------
A0A1G1MCV8      ------------------------------------------------------------
A0A357BIJ1      ------------------------------------------------------------
A0A3D2GIE7      ------------------------------------------------------------
A0A1G1N811      ------------------------------------------------------------
A0A1G1P565      ------------------------------------------------------------
A0A1G1PUA7      ------------------------------------------------------------
A0A1G1QJ19      ------------------------------------------------------------
A0A358AEN7      ------------------------------------------------------------
A0A496RSL4      ------------------------------------------------------------
A0A2J0M9Y8      ------------------------------------------------------------
A0A3B9ZHK0      ------------------------------------------------------------
A0A419DVK8      ------------------------------------------------------------
                                                                            

A0A1G1JUC3      AKRVLETAVDTGIQIQMLEQAGRSISHERKKNFKLEDREQELLMRIFAGSITLRPVAAGA
A0A2J0KUN7      RKRVIKEMYDA-LSSQLLE-----------KHRQLEESERELTRYIIDNDIIAKGIEVGS
A0A2J0L3X7      ------------------------------------------------------------
A0A1G1J391      ------------------------------------------------------------
A0A1W9RBB3      ------------------------------------------------------------
A0A1W9R9H3      ------------------------------------------------------------
A0A496RIX0      ------------------------------------------------------------
A0A2H0LKN2      ------------------------------------------------------------
A0A1W9RLY2      ------------------------------------------------------------
A0A1G1PTZ0      ------------------------------------------------------------
A0A1G1PYB2      ------------------------------------------------------------
A0A1G1NXZ1      ------------------------------------------------------------
A0A1G1JRT8      ------------------------------------------------------------
A0A1G1MCV8      ------------------------------------------------------------
A0A357BIJ1      ------------------------------------------------------------
A0A3D2GIE7      ------------------------------------------------------------
A0A1G1N811      ------------------------------------------------------------
A0A1G1P565      ------------------------------------------------------------
A0A1G1PUA7      ------------------------------------------------------------
A0A1G1QJ19      ------------------------------------------------------------
A0A358AEN7      ------------------------------------------------------------
A0A496RSL4      ------------------------------------------------------------
A0A2J0M9Y8      ------------------------------------------------------------
A0A3B9ZHK0      ------------------------------------------------------------
A0A419DVK8      ------------------------------------------------------------
                                                                            

A0A1G1JUC3      RIFSLEVKGTQADLCAELANIAAEVYVEMNHAANIDAFKSRFSMTSKSLNEIREKVKASE
A0A2J0KUN7      -----DLKGGKPGV---------EVWRGPQINEKYLALKSQRLNEEQFLEEVKKNRQQDE
A0A2J0L3X7      ------------------------------------------------------------
A0A1G1J391      ------------------------------------------------------------
A0A1W9RBB3      ------------------------------------------------------------
A0A1W9R9H3      ------------------------------------------------------------
A0A496RIX0      ------------------------------------------------------------
A0A2H0LKN2      ------------------------------------------------------------
A0A1W9RLY2      ------------------------------------------------------------
A0A1G1PTZ0      ------------------------------------------------------------
A0A1G1PYB2      ------------------------------------------------------------
A0A1G1NXZ1      ------------------------------------------------------------
A0A1G1JRT8      ------------------------------------------------------------
A0A1G1MCV8      ------------------------------------------------------------
A0A357BIJ1      ------------------------------------------------------------
A0A3D2GIE7      ------------------------------------------------------------
A0A1G1N811      ------------------------------------------------------------
A0A1G1P565      ------------------------------------------------------------
A0A1G1PUA7      ------------------------------------------------------------
A0A1G1QJ19      ------------------------------------------------------------
A0A358AEN7      ------------------------------------------------------------
A0A496RSL4      ------------------------------------------------------------
A0A2J0M9Y8      ------------------------------------------------------------
A0A3B9ZHK0      ------------------------------------------------------------
A0A419DVK8      ------------------------------------------------------------
                                                                            

A0A1G1JUC3      MALEKVAA------------------EADLLKALKVFGEKYPDVIKLQGMI----RALSG
A0A2J0KUN7      VVTLSIISKKYGGLVDEKLRDELYEKERVLSKLLLTQSEMHPDAVEAKGEVDEAKKKISM
A0A2J0L3X7      ------------------------------------------------------------
A0A1G1J391      --------------------------MKKILDILKKILAYYTPPMYV-------------
A0A1W9RBB3      --------------------------MGKISDALRKVMEEREKQNREAKTLITSTINKED
A0A1W9R9H3      --------------------------MGKISEALKKLNEEKERQKKEIMEKEKVLKKKEE
A0A496RIX0      --------------------------MGKISEALKKVMEEREKQKQ--LQREAIMRASVE
A0A2H0LKN2      --------------------------MSKITKALEKAARERLHKLQEHANVRSEA-----
A0A1W9RLY2      --------------------------MGKITQALRKIQEEKEKKSKIQKTIEDSNVVKDN
A0A1G1PTZ0      ----------------------------KITQALEKAARERLQHTQAHATTTAQA-----
A0A1G1PYB2      --------------------------MSKITQALEKAARERLQHTQAHATTTAQA-----
A0A1G1NXZ1      ------------------------------------------------------------
A0A1G1JRT8      ------------------------------------------------------------
A0A1G1MCV8      ------------------------------------------------------------
A0A357BIJ1      --------------------------MGKITNALKKAAEERLERIEKISRLKEREDL---
A0A3D2GIE7      --------------------------MGKITEALRKAAEDRLERIDKIARIREEKAL---
A0A1G1N811      --------------------------------------------------------M---
A0A1G1P565      --------------------------------------------------------M---
A0A1G1PUA7      ------------------------------------------------------------
A0A1G1QJ19      ------------------------------------------------------------
A0A358AEN7      --------------------------MSRIGEALNKATQEKIARNQEAAFPVQSPLEAQK
A0A496RSL4      --------------------------MGKISDFFKNTQIKQFNGLS----LPSLPRQF--
A0A2J0M9Y8      --------------------------MGKFTEAIRKAAEKRIERVEK---KEEFK-PY--
A0A3B9ZHK0      --------------------------MGKLTDALKKAAEERISRIEKLDSQDEVKYQF--
A0A419DVK8      --------------------------MGKITEALKKAAQERLARIEKLDNREEVKFEF--
                                                                            

A0A1G1JUC3      KLEESQNSLQLSQ--IAQRQRMFSIILKPHLTAEELIPVESDLTNLKNLLEQEIETNREI
A0A2J0KUN7      ELDRALQSLDRSSATLKREEEKLRTLIKEGLS-DKMVEYSS--------LHRDVEVKQEI
A0A2J0L3X7      ------------------------------------------------------------
A0A1G1J391      -------------------------------I----------------------------
A0A1W9RBB3      SGFSSDDISPISLKSSRRSTQKFLPVKDKAYI----------------------------
A0A1W9R9H3      AREEIKEDKSGAVRALLSSWGERLHFKENFFL----------------------------
A0A496RIX0      RKEEKSPKESSPQKAKKIPLEERFKIKEQLYI----------------------------
A0A2H0LKN2      -VEIPIET---PSR-----ISE--------------------------------------
A0A1W9RLY2      FVKKEKEEEDFPFS-----RGKEYSLKNKAFL----------------------------
A0A1G1PTZ0      -VSIHIEPASGPGD-----VGD--------------------------------------
A0A1G1PYB2      -VSIHIEPASGPGD-----VGD--------------------------------------
A0A1G1NXZ1      ------------------------------------------------------------
A0A1G1JRT8      ------------------------------------------------------------
A0A1G1MCV8      -------------------------------M----------------------------
A0A357BIJ1      -------------------------------I----------------------------
A0A3D2GIE7      -------------------------------V----------------------------
A0A1G1N811      -------------------------------V----------------------------
A0A1G1P565      -------------------------------V----------------------------
A0A1G1PUA7      -------------------------------M----------------------------
A0A1G1QJ19      -------------------------------M----------------------------
A0A358AEN7      -------------------PPAQERSRNSGYI----------------------------
A0A496RSL4      -------------------------------V----------------------------
A0A2J0M9Y8      -------------------------------V----------------------------
A0A3B9ZHK0      -------------------------------I----------------------------
A0A419DVK8      -------------------------------I----------------------------
                                                                            

A0A1G1JUC3      YNSIYKRLQEMELAGGASLWVDIKVIEPAAIPGRPIQPNKKMNVLLSLVIGAFIGLALAF
A0A2J0KUN7      YNSVVKQVEELDTYEKLLSTGFLKVVRSPIMPRNPENP-RSGSCTMAFFFSILCGIACVF
A0A2J0L3X7      ------------------------------------------------------------
A0A1G1J391      ------------------------------------------------------------
A0A1W9RBB3      ------------------------------------------------------------
A0A1W9R9H3      ------------------------------------------------------------
A0A496RIX0      ------------------------------------------------------------
A0A2H0LKN2      ------------------------------------------------------------
A0A1W9RLY2      ------------------------------------------------------------
A0A1G1PTZ0      ------------------------------------------------------------
A0A1G1PYB2      ------------------------------------------------------------
A0A1G1NXZ1      ------------------------------------------------------------
A0A1G1JRT8      ------------------------------------------------------------
A0A1G1MCV8      ------------------------------------------------------------
A0A357BIJ1      ------------------------------------------------------------
A0A3D2GIE7      ------------------------------------------------------------
A0A1G1N811      ------------------------------------------------------------
A0A1G1P565      ------------------------------------------------------------
A0A1G1PUA7      ------------------------------------------------------------
A0A1G1QJ19      ------------------------------------------------------------
A0A358AEN7      ------------------------------------------------------------
A0A496RSL4      ------------------------------------------------------------
A0A2J0M9Y8      ------------------------------------------------------------
A0A3B9ZHK0      ------------------------------------------------------------
A0A419DVK8      ------------------------------------------------------------
                                                                            

A0A1G1JUC3      FLEYLDSSLRSLEDVRAHLRVNALGIIPEVEFETADLRELQDKFHAEGSSRVMWSTSD--
A0A2J0KUN7      LFEVLDISIRNVEDVEDIIGITMLAAIPSWEPKTEN-KDAKVKSAKRQDAGLVVARNP--
A0A2J0L3X7      ------------------------------------------------------------
A0A1G1J391      ---------------------------------------KKMKTPDGVDGHLVSYTDK--
A0A1W9RBB3      ---------------------------------------AKTRDDSGMDSKVVVYYDY--
A0A1W9R9H3      ---------------------------------------FSSQSPSGIDPRIVTYYDD--
A0A496RIX0      ---------------------------------------VKPKDNSEIDARVVVYSDY--
A0A2H0LKN2      ---------------------------------------AMAAGRVHIDPHIVAATDS--
A0A1W9RLY2      ---------------------------------------VSKKDISGIDSRIITYYDP--
A0A1G1PTZ0      ---------------------------------------IAVADRIEVDPHIVAATDA--
A0A1G1PYB2      ---------------------------------------IAVADRIEVDPHIVAATDA--
A0A1G1NXZ1      ------------------------------------------MSDSKVDQRVITYFDP--
A0A1G1JRT8      -----------------------------------------------------MLFDTAH
A0A1G1MCV8      ---------------------------------------AKKKVESKIDPRIVAFHDP--
A0A357BIJ1      ---------------------------------------VKKIGESNVDPSIVTYFDP--
A0A3D2GIE7      ---------------------------------------IKKIGDSKVDPRLVTYFDP--
A0A1G1N811      ---------------------------------------IKKIGNSNVDPRIVTYFDP--
A0A1G1P565      ---------------------------------------IQKIGDSKVDPRIVTYFDP--
A0A1G1PUA7      ---------------------------------------AKATDDSGIDPGVVTYFDP--
A0A1G1QJ19      ---------------------------------------AKATDDSGIDPGVVTYFDP--
A0A358AEN7      ---------------------------------------AKATDDSGIDPGVVTYFDP--
A0A496RSL4      ---------------------------------------LKSVNDANINPHIVTYFYP--
A0A2J0M9Y8      ---------------------------------------IRTVSDSKIDPHVVTYFDP--
A0A3B9ZHK0      ---------------------------------------AKKTVESKIDPRIVSFYDS--
A0A419DVK8      ---------------------------------------AKKQVDSKIDPRIVTFHDP--
                                                                            

A0A1G1JUC3      LKIPLYVAEAYRIIRTNFVF-------------GAVDKSLRIFQVTSAVKGEGKTTTTVN
A0A2J0KUN7      KSI---MGEAFRTLRTNIKF-------------VCVDKNIKSIVITSVGPKEGKSFISSN
A0A2J0L3X7      -------------------------------------------MITSALAGEGKTITAIN
A0A1G1J391      HSF---VAEQYKVLRTNLYS-------------LSPRETLKTIVITSSQSQEGKSVTSCN
A0A1W9RBB3      PPP---ISEQYKILRTNIKSYLNKTVNIDKINMNKTVTPPRMITITSSLRGEGKTVTCAN
A0A1W9R9H3      YSP---LSEQYRLLRTNVKSLVKRIKGNHK--SIKGVNSPAIITFSSSLRNEGKTVTAVN
A0A496RIX0      SSP---ISEQYRILRTNIKSSLTKARASKKISTTKPATSPYIFTITSALHGEGKTVTAVN
A0A2H0LKN2      SSP---IAEQYRILRTNLQS-------------LRLRPGPKTIVVTSSVHSEGKSVTSIN
A0A1W9RLY2      SSP---LSEQYRILRTNLKSILRKIKATRR--NIKSSNFASVFTISSSLHNEGKTITAVN
A0A1G1PTZ0      QSP---ISEQYRILRTNLQS-------------MRMSSGSPVIVVTSAVHAEGKSVTAIN
A0A1G1PYB2      QSP---ISEQYRILRTNLQS-------------MRMSSGSPVIVVTSAVHAEGKSVTAIN
A0A1G1NXZ1      KAV---ITEQYKILRTNVLS------------FSKTK-PLKVMAVSSSIHSEGKTLTALN
A0A1G1JRT8      PSP---VSESFRALRTAILF------------RFRRVSGCRVLLTTSPNPEEGKTTVSLN
A0A1G1MCV8      KSS---VSEQYRILRTNFQG------------ISSPKHPIKAITITSSVHSEGKTITAIN
A0A357BIJ1      KAL---ISEQYKILRTNILS------------MNKGK-PPQTIVITSSIHSEGKTVTVIN
A0A3D2GIE7      KAL---ITEQYKILRTNILS------------ANARR-PLKTLVVTSSLHSEGKTVTALN
A0A1G1N811      KAV---ITEQYKILRTNLLS------------MNKGK-SPRIIVVTSSVHSEGKTVTTLN
A0A1G1P565      KAL---ISEQYKILRTNVLS------------ANAKR-PLKTLVITSSLHSEGKTITALN
A0A1G1PUA7      SSS---IAEQYRSLRTNILL------------NNLSR-PLKTLAICSSLEGEGKTTTAVN
A0A1G1QJ19      SSS---IAEQYRSLRTNILL------------NNLSR-PLKTLAICSSLEGEGKTTTAVN
A0A358AEN7      SSS---IAEQYRSLRTNILL------------NNLSR-PLKTLAICSSLEGEGKTTTAVN
A0A496RSL4      KSP---ISEQYRRLRENIKS------------LSRQK-NIKAIGITSAVTEEGKSITALN
A0A2J0M9Y8      TSP---ISEQYRTLRTNLQA------------LDKAN-PPKVLAITSAIHGEGKTITSIN
A0A3B9ZHK0      HAP---VSEQYRSLRTNLQA------------LNTSK-PAKVIAITSSINGEGKTISAIN
A0A419DVK8      KSS---VSEQYKMLRTNLAA------------LGTKK-PVKVMTITSSTHSEGKTITAIN
                                                              *    ***:    *

A0A1G1JUC3      LGISLAQVGL--KVLLIDADMRRPSLHHALRLPKEGLGLQHVLKEGLPLEAVVQ-KTKTE
A0A2J0KUN7      LALSIANSGE--KVILIDADLRRPTIHKYFGIENQKGLSNLLIGDGSLDEFEAA-DSAFE
A0A2J0L3X7      LAISMAHDLDNKSILLIDADMRKGKIAKYFGL-GSHPGLSELLKGNADQEGVLI-NPGIP
A0A1G1J391      LSYTLSLDTE-KKILLLDADFRRPSIHRLFGI-PRKPGFTDVLSGLVELEHFTK-KPTFG
A0A1W9RBB3      LAVALARDCE-NKILIVDCDLRGGTLHKLFNL-DCRPGLSDILTTDFDWSVALH-TTKLE
A0A1W9R9H3      LAMSLASEEG-TKVLLIDADLRNGTIHKLLNV-EEEPGLSTVLVGEYDWSVGLH-PTLNK
A0A496RIX0      LAVALASDLE-SRVLLIDCDLRNGEIHKLLNL-NYKPGLSEILTGDFDWSVALH-RTLIR
A0A2H0LKN2      LALTLARQEN-LRVVLVDADLRKGSINKWMGLGERAEGLSTALLRGGELNGSLL-KLKDP
A0A1W9RLY2      LAMSLASETE-TRVLLIDGDLRNGLIHKLLNI-EAEPGLSTILINDYEWTVGLH-PTRKE
A0A1G1PTZ0      LALTLARQEK-LRVVLVDGDLRKSAVHRWLGLGERAEGLSTALARGGELNGSLV-RLQHP
A0A1G1PYB2      LALTLARQEK-LRVVLVDGDLRKSAVHRWLGLGERAEGLSTALARGGELNGSLV-RLQHP
A0A1G1NXZ1      LAVAIAQSTSKPRVLLIDADLRRGRVAKYLGV-KQPVGLANILKDEVKPSDALF-NIDVE
A0A1G1JRT8      LAAAFHQ--NHLKVLLIDADLRKPKIHKIFDV-EDARGLSDVLEGTARPRDVIAENVDGL
A0A1G1MCV8      LAVSMAHDLNKKSILLVDADLRRAKISKYLGV-NAEVGLADLIANGTNIDDTLL-NIGID
A0A357BIJ1      LAVALAQSVQKPKVLLVDADMRRGRMVKYLGV-DHKVGLMEILTGAAKAEDVLF-HLEYD
A0A3D2GIE7      LAMVIAQSTQKPKVLVVDADMRRGRVTKYLGV-DHPMGLTEILTDKIDPSEALF-HTDME
A0A1G1N811      LAMAIAQSAQKLKVLLIDADLRRGRMAKYLGV-NQKIGLTEVLKGEADVADVMF-NIDVE
A0A1G1P565      LAMAIAQSTQKPKVLLIDADMRRGRVARYLGV-EQKTGLTEILTEKADPSQTLF-HIDIE
A0A1G1PUA7      LAITMAGDLE-RSILLVDCDLRAGTVHQLLAI-KSAAGLSDILASGAELESTLG-QTRIR
A0A1G1QJ19      LAITMAGDLE-RSILLVDCDLRAGTVHQLLAI-KSAAGLSDILASGAELESTLG-QTRIR
A0A358AEN7      LAITMAGDLE-RSILLVDCDLRAGTVHQLLAI-KSAAGLSDILASGAELESTLG-QTRIR
A0A496RSL4      LAVIMTRDIDFNNILLIDCDLRCGVVDLALGL-KSKTGLSEYLSIGTDIDNILF-KTKID
A0A2J0M9Y8      MAITFAHDLNNKSILLVDADLRKGNLTKALGL-KADKGFADILTDGTTVEDSLL-SIDIK
A0A3B9ZHK0      LAITMAKDLNQKSILLIDADLRRSRITKYLGI-TPELGLSDIITNGSNIDDALL-NIGIE
A0A419DVK8      LAISMAHDLNNKNILLVDADMRRARITRYLGV-ASESGLSDILNDGANIDQALL-NIGIN
                :.  :        ::::* *:*   :   : :          :                 

A0A1G1JUC3      NLQVITSGGIPEHPAELLSAPVLTAFLNTLREV-FDVVLIDSPPVISVADAPIIASRVDG
A0A2J0KUN7      NLKIIPAGPIPPNPNEILGTRRMEEILEHLKGT-CNIIIIDSPPLLTVSDALILAKKTDG
A0A2J0L3X7      NLTVVLAGKTPKNASELLNSKKMEQILSYFKTR-FDYILIDTPPVMPLTDACILGPVVDG
A0A1G1J391      NLHVIPSGTLITNPSEFLSSIKMRNLIKELKTS-FDYVIFDSPPVINVTDSCILGSICDG
A0A1W9RBB3      NLFVLPRGETIPNSSDLFSSKRMKLIIEKLKSEQFSYIILDTPPLLFFTDASVLGVQTQG
A0A1W9R9H3      NLFVIPRGKISAHPCEFLGSRKMRMILERLRGEKFNYILIDTPPLLSFADAYLIAQLTDG
A0A496RIX0      NLFIIPRGQPPSNPSELLGSKKMRLILERLKVEEFTYIILDTPPLLTFTDATILGVQTEG
A0A2H0LKN2      ALAVLPCGDYPEHPAELLESSSMKKVLAGLREQ-FDVIVIDAPPVLPVADPGILAAQADG
A0A1W9RLY2      NLFVIPRGKISPISSELLSSRKMHIILEKLREENFNYIIIDTPPLLSFADAQLVTQFTDG
A0A1G1PTZ0      PLAVLPAGPHPEDPAELLGSSSMKRVLAALKRQ-FDLIVIDAPPTMLVTDPAILASQADG
A0A1G1PYB2      PLAVLPAGPHPEDPAELLGSSSMKRVLAALKRQ-FDLIVIDAPPTMLVTDPAILASQADG
A0A1G1NXZ1      NLTFIAAGPIPTNPVELLSSDRMNRFLILMRSK-FDYIIVDTPPVISVTDAGIVGAQTDG
A0A1G1JRT8      GFDVLFSGPHSDHPTEILGSKQMSDMLTELKSH-YDIIIIDSPPYLAVADVAVLNEYVDG
A0A1G1MCV8      NLTVMPAGKIPHNPAELLGSAKLKNIITALKSK-YDYIIIDTPPIIHVTDAGLVGAQTDG
A0A357BIJ1      NLAFVGSGGIPENPAELLASDKMKQFLAEMKSD-FDYILIDTPPIIPVTDAGIVGPIADG
A0A3D2GIE7      NLAFIASGSVAENPAELLGSDRMRQFLADMKTQ-FDFILIDTPPIIAVTDPGIVGALVDG
A0A1G1N811      NLTFIASGTVPENPAELLDSEIMKNLLTTMRTK-FDYVLIDTPPIVSVTDSGIVGSQVDG
A0A1G1P565      NLTFLSSGAVAENPAELLASDGMQRLLADMKTQ-FDHVIIDTPPIISVTDSGIIGALADG
A0A1G1PUA7      NLTVLPRGEIPRNPSELLSSKKMRGLLQELKSK-FDYIILDSPPIMPLTDACVISSQVDG
A0A1G1QJ19      NLTVLPRGEIPRNPSELLSSKKMRGLLQELKSK-FDYIILDSPPIMPLTDACVISSQVDG
A0A358AEN7      NLTVLPRGEIPRNPSELLSSKKMRGLLQELKSK-FDYIILDSPPIMPLTDACVISSQVDG
A0A496RSL4      KLTVMPKGSIIENPSELLASEKMQTLLAILRKR-FDLIILDTPPILPIADAGVVGAQVDG
A0A2J0M9Y8      NLHILPVGNKPNNPAELMGSAKMRQFISEVRKQ-YDYVFFDCPPVIPVTDASVLAHQCDG
A0A3B9ZHK0      NLTVLSAGKHPTNPAELLGSQKFKNLMNQVKAK-YDYIILDTPPIIPVTDAGLIGAQADG
A0A419DVK8      NLTILPSGKIPHNPAELLGSGKFKNLVAALKNK-YDYVIFDTPPIISVTDAGILGAQTDG
                 : .:  *     . ::: :  :  .:  ..      :..* ** : .:*  ::    :*

A0A1G1JUC3      TILVARSGYIPRRLSIQAKKAIEAVNGKIIGCVLNSVAASHHPYYYYRYYSDHSYGYYGS
A0A2J0KUN7      VIFTFFTNKTAKKAGKRAVFLLKNAGINMLGGVLNYVKTSKGGYYYYYY----SYEYYAD
A0A2J0L3X7      IIMVIQAGKTQRDIIAHAEQRLYQARAKTIGYVLTNIE-----YHLPQY----LYRYVHQ
A0A1G1J391      VILVVKAGITPKNMIEEAFTMLTHAQAKPKACVLTNTSIPVYYYYVSRY----KYYYKYR
A0A1W9RBB3      IILVVQARRTPLQVVKKAEEFIKQSSNRLIGFIFTQVD-----YYASN------YYYNYY
A0A1W9R9H3      LIIIVEAHRTKAEIVRKAKEVCEEAHTKILGFILTKVD-----YYTPD------SYYYYY
A0A496RIX0      VVMVVEAQRTRAHIVKKAKEFLEQTHSRFLGFILTKVD-----HYTPDF----YGYYYHY
A0A2H0LKN2      VLLVVRAGKTQRKTVLQAQSLLRQMKANVLGCVLTHVE-----YYLPGY----YRYYHQY
A0A1W9RLY2      IIIVVEANHTKAEVVKKAKELCEQANNKILGFILTKVD-----YYAPDF----YYYYYNY
A0A1G1PTZ0      TLLVVRAGKTQRKTVARAHALLTQMHAKVVGCVLTHVE-----YYLPGY----YQHYYAY
A0A1G1PYB2      TLLVVRAGKTQRKTVARAHALLTQMHAKVVGCVLTHVE-----YYLPGY----YQHYYAY
A0A1G1NXZ1      VLMVIQAGRTQRGIVKRATELLNQAHSKVLGHILTNIE-----YHLPEY----IYRYL--
A0A1G1JRT8      ITVVTRYHKTDKRHLKDMKKRLSREAEKILGIVINQVS-----VKEKDY----YYQQYYY
A0A1G1MCV8      TIMVIQANRTQKGVVEHAEMLLKQAQAKVLGYILTNIQ-----YHIPAY----LYRYL--
A0A357BIJ1      VLMVVQAGRTQRGIIRRAEDLLFQTHSKILGHVLTNIE-----YHLPEY----IYRYL--
A0A3D2GIE7      ILLTIQAGRTQRGIVRRATELLDQSQSKIIGHVLTNIE-----YHLPEY----IYRYL--
A0A1G1N811      VLLVIQAGRTQRGIVKRATELLNQAHSKLLGHVLTNIE-----YHLPEY----IYRYL--
A0A1G1P565      VLLVIQAGRTQRGIVQRATELLEQAHCKTIGHVLTNIE-----YHLPEY----IYRYL--
A0A1G1PUA7      VIFVVQAHRTPRRVVKQAQNMLEHVHAKILGFILTQTE-----TKEHAD----RYGYYGY
A0A1G1QJ19      VIFVVQAHRTPRRVVKQAQNMLEHVHAKILGFILTQTE-----TKEHAD----RYGYYGY
A0A358AEN7      VIFVVQAHRTPRRVVKQAQNMLEHVHAKILGFILTQTE-----TKEHAD----RYGYYGY
A0A496RSL4      MILVVRLGKTQKGMVEQAEELLVQSKVNLLGYVLTHVE-----YHIPEY----VYKYV--
A0A2J0M9Y8      ALMILQAGRTQKGIISHAQDRMSQAKVKVLGYVMTNIE-----YHIPEY----IYRYL--
A0A3B9ZHK0      VIMVVQASRTQRGVVKHSEGLLKQAQAKILGYILTNVQ-----YHIPGY----IYRYL--
A0A419DVK8      VIMVIQANRTQKGVVKHAETLLRQAEAKLLGYILTNIQ-----YHIPAY----IYRYL--
                  .                        .  . ::.                         

A0A1G1JUC3      EANGAGGKKRRSPIQGERVSSLEKLKLVFQSLLPKGNARFENLPPQPRHSGSRTETETST
A0A2J0KUN7      KND-----KKKS------------------------------------------------
A0A2J0L3X7      YDGNYSYEEKAAAKT---------------------------------------------
A0A1G1J391      YGYRSDTPIDTSVK----------------------------------------------
A0A1W9RBB3      YYRDRGSNYQKGKY----------------------------------------------
A0A1W9R9H3      NYRKYGRKI---------------------------------------------------
A0A496RIX0      HYKSAGVGS---------------------------------------------------
A0A2H0LKN2      RYGVVKDKDGNGKAAAGSPAQPEAQSSTPQT-----------------------------
A0A1W9RLY2      KNYKKDV-----------------------------------------------------
A0A1G1PTZ0      RYGEKKEATSDKGQATSSKQQGTSDKKQVSGLGG--------------------------
A0A1G1PYB2      RYGEKKEATSDKGQATSSKQQGTSDKKQVSGLGG--------------------------
A0A1G1NXZ1      ------------------------------------------------------------
A0A1G1JRT8      YGYGDAKPRKR-------------------------------------------------
A0A1G1MCV8      ------------------------------------------------------------
A0A357BIJ1      ------------------------------------------------------------
A0A3D2GIE7      ------------------------------------------------------------
A0A1G1N811      ------------------------------------------------------------
A0A1G1P565      ------------------------------------------------------------
A0A1G1PUA7      GEVQKSDSDSLEQTEKAIK-----------------------------------------
A0A1G1QJ19      GEVQKSDSDSLEQTEKAIK-----------------------------------------
A0A358AEN7      GEVQKSDSDSLEQTEKAIK-----------------------------------------
A0A496RSL4      ------------------------------------------------------------
A0A2J0M9Y8      ------------------------------------------------------------
A0A3B9ZHK0      ------------------------------------------------------------
A0A419DVK8      ------------------------------------------------------------
                                                                            

A0A1G1JUC3      PTMTV
A0A2J0KUN7      -----
A0A2J0L3X7      -----
A0A1G1J391      -----
A0A1W9RBB3      -----
A0A1W9R9H3      -----
A0A496RIX0      -----
A0A2H0LKN2      -----
A0A1W9RLY2      -----
A0A1G1PTZ0      -----
A0A1G1PYB2      -----
A0A1G1NXZ1      -----
A0A1G1JRT8      -----
A0A1G1MCV8      -----
A0A357BIJ1      -----
A0A3D2GIE7      -----
A0A1G1N811      -----
A0A1G1P565      -----
A0A1G1PUA7      -----
A0A1G1QJ19      -----
A0A358AEN7      -----
A0A496RSL4      -----
A0A2J0M9Y8      -----
A0A3B9ZHK0      -----
A0A419DVK8      -----
                     

© 1998-2020Legal notice