BYKdb

Dataset for cluster orphancd of phylum candidatus-omnitrophica

[Download (right click)] [Edit] [Sequences] [Repertoires]

27 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1G1JUC3      MNTANLPPYGAKPAVESHSEDHLEANLFAYWHILVKRRLVLLMALLVCLGLALIINSMQT
A0A2J0KUN7      ----------------MEENSNLEATLRDYLEIVAKRKTVFVVGFIIALIGSIAVIFLFV
A0A7C0WW92      ------------------------------------------------------------
A0A2J0L3X7      ------------------------------------------------------------
A0A1G1J391      ------------------------------------------------------------
A0A1W9RBB3      ------------------------------------------------------------
A0A1W9R9H3      ------------------------------------------------------------
A0A496RIX0      ------------------------------------------------------------
A0A2H0LKN2      ------------------------------------------------------------
A0A1W9RLY2      ------------------------------------------------------------
A0A1G1PTZ0      ------------------------------------------------------------
A0A1G1PYB2      ------------------------------------------------------------
A0A1G1NXZ1      ------------------------------------------------------------
A0A1G1PUA7      ------------------------------------------------------------
A0A1G1QJ19      ------------------------------------------------------------
A0A358AEN7      ------------------------------------------------------------
A0A1G1JRT8      ------------------------------------------------------------
A0A496RSL4      ------------------------------------------------------------
A0A2J0M9Y8      ------------------------------------------------------------
A0A419DVK8      ------------------------------------------------------------
A0A3B9ZHK0      ------------------------------------------------------------
A0A7C4SWC3      ------------------------------------------------------------
A0A1G1MCV8      ------------------------------------------------------------
A0A357BIJ1      ------------------------------------------------------------
A0A3D2GIE7      ------------------------------------------------------------
A0A1G1N811      ------------------------------------------------------------
A0A1G1P565      ------------------------------------------------------------
                                                                            

A0A1G1JUC3      PI-YRTGAELVVEP----------------------------------------------
A0A2J0KUN7      PLKYRATTEIMIGSPVTEVVDQQGTVYIRGKYDVAVAFELMRSDIIPEKISKTIEIEEKV
A0A7C0WW92      ------------------------------------------------------------
A0A2J0L3X7      ------------------------------------------------------------
A0A1G1J391      ------------------------------------------------------------
A0A1W9RBB3      ------------------------------------------------------------
A0A1W9R9H3      ------------------------------------------------------------
A0A496RIX0      ------------------------------------------------------------
A0A2H0LKN2      ------------------------------------------------------------
A0A1W9RLY2      ------------------------------------------------------------
A0A1G1PTZ0      ------------------------------------------------------------
A0A1G1PYB2      ------------------------------------------------------------
A0A1G1NXZ1      ------------------------------------------------------------
A0A1G1PUA7      ------------------------------------------------------------
A0A1G1QJ19      ------------------------------------------------------------
A0A358AEN7      ------------------------------------------------------------
A0A1G1JRT8      ------------------------------------------------------------
A0A496RSL4      ------------------------------------------------------------
A0A2J0M9Y8      ------------------------------------------------------------
A0A419DVK8      ------------------------------------------------------------
A0A3B9ZHK0      ------------------------------------------------------------
A0A7C4SWC3      ------------------------------------------------------------
A0A1G1MCV8      ------------------------------------------------------------
A0A357BIJ1      ------------------------------------------------------------
A0A3D2GIE7      ------------------------------------------------------------
A0A1G1N811      ------------------------------------------------------------
A0A1G1P565      ------------------------------------------------------------
                                                                            

A0A1G1JUC3      -------------------KSSNESNTDLQLNNLMRDPT---YLMTQSRLV----SSKKF
A0A2J0KUN7      LISPGEVKGMIAFIAASAQRTKNPYAHNLILISAIHTDTRKAYLVAKAAIKILFEETRKY
A0A7C0WW92      ------------------------------------------------------------
A0A2J0L3X7      ------------------------------------------------------------
A0A1G1J391      ------------------------------------------------------------
A0A1W9RBB3      ------------------------------------------------------------
A0A1W9R9H3      ------------------------------------------------------------
A0A496RIX0      ------------------------------------------------------------
A0A2H0LKN2      ------------------------------------------------------------
A0A1W9RLY2      ------------------------------------------------------------
A0A1G1PTZ0      ------------------------------------------------------------
A0A1G1PYB2      ------------------------------------------------------------
A0A1G1NXZ1      ------------------------------------------------------------
A0A1G1PUA7      ------------------------------------------------------------
A0A1G1QJ19      ------------------------------------------------------------
A0A358AEN7      ------------------------------------------------------------
A0A1G1JRT8      ------------------------------------------------------------
A0A496RSL4      ------------------------------------------------------------
A0A2J0M9Y8      ------------------------------------------------------------
A0A419DVK8      ------------------------------------------------------------
A0A3B9ZHK0      ------------------------------------------------------------
A0A7C4SWC3      ------------------------------------------------------------
A0A1G1MCV8      ------------------------------------------------------------
A0A357BIJ1      ------------------------------------------------------------
A0A3D2GIE7      ------------------------------------------------------------
A0A1G1N811      ------------------------------------------------------------
A0A1G1P565      ------------------------------------------------------------
                                                                            

A0A1G1JUC3      AKRVLETAVDTGIQIQMLEQAGRSISHERKKNFKLEDREQELLMRIFAGSITLRPVAAGA
A0A2J0KUN7      RKRVIKEMYDA-LSSQLLE-----------KHRQLEESERELTRYIIDNDIIAKGIEVGS
A0A7C0WW92      ------------------------------------------------------------
A0A2J0L3X7      ------------------------------------------------------------
A0A1G1J391      ------------------------------------------------------------
A0A1W9RBB3      ------------------------------------------------------------
A0A1W9R9H3      ------------------------------------------------------------
A0A496RIX0      ------------------------------------------------------------
A0A2H0LKN2      ------------------------------------------------------------
A0A1W9RLY2      ------------------------------------------------------------
A0A1G1PTZ0      ------------------------------------------------------------
A0A1G1PYB2      ------------------------------------------------------------
A0A1G1NXZ1      ------------------------------------------------------------
A0A1G1PUA7      ------------------------------------------------------------
A0A1G1QJ19      ------------------------------------------------------------
A0A358AEN7      ------------------------------------------------------------
A0A1G1JRT8      ------------------------------------------------------------
A0A496RSL4      ------------------------------------------------------------
A0A2J0M9Y8      ------------------------------------------------------------
A0A419DVK8      ------------------------------------------------------------
A0A3B9ZHK0      ------------------------------------------------------------
A0A7C4SWC3      ------------------------------------------------------------
A0A1G1MCV8      ------------------------------------------------------------
A0A357BIJ1      ------------------------------------------------------------
A0A3D2GIE7      ------------------------------------------------------------
A0A1G1N811      ------------------------------------------------------------
A0A1G1P565      ------------------------------------------------------------
                                                                            

A0A1G1JUC3      RIFSLEVKGTQADLCAELANIAAEVYVEMNHAANIDAFKSRFSMTSKSLNEIREKVKASE
A0A2J0KUN7      -----DLKGGKPGV---------EVWRGPQINEKYLALKSQRLNEEQFLEEVKKNRQQDE
A0A7C0WW92      ------------------------------------------------------------
A0A2J0L3X7      ------------------------------------------------------------
A0A1G1J391      ------------------------------------------------------------
A0A1W9RBB3      ------------------------------------------------------------
A0A1W9R9H3      ------------------------------------------------------------
A0A496RIX0      ------------------------------------------------------------
A0A2H0LKN2      ------------------------------------------------------------
A0A1W9RLY2      ------------------------------------------------------------
A0A1G1PTZ0      ------------------------------------------------------------
A0A1G1PYB2      ------------------------------------------------------------
A0A1G1NXZ1      ------------------------------------------------------------
A0A1G1PUA7      ------------------------------------------------------------
A0A1G1QJ19      ------------------------------------------------------------
A0A358AEN7      ------------------------------------------------------------
A0A1G1JRT8      ------------------------------------------------------------
A0A496RSL4      ------------------------------------------------------------
A0A2J0M9Y8      ------------------------------------------------------------
A0A419DVK8      ------------------------------------------------------------
A0A3B9ZHK0      ------------------------------------------------------------
A0A7C4SWC3      ------------------------------------------------------------
A0A1G1MCV8      ------------------------------------------------------------
A0A357BIJ1      ------------------------------------------------------------
A0A3D2GIE7      ------------------------------------------------------------
A0A1G1N811      ------------------------------------------------------------
A0A1G1P565      ------------------------------------------------------------
                                                                            

A0A1G1JUC3      MALEKVAA------------------EADLLKALKVFGEKYPDVIKLQGMI----RALSG
A0A2J0KUN7      VVTLSIISKKYGGLVDEKLRDELYEKERVLSKLLLTQSEMHPDAVEAKGEVDEAKKKISM
A0A7C0WW92      -IIDDPTTTSEDTALLNKLIERKAELETELAQQLNYFKEKHPIIKGLRSELNSINKKIEE
A0A2J0L3X7      ------------------------------------------------------------
A0A1G1J391      -----------------------------------------------MKKILDILKKILA
A0A1W9RBB3      -----------------------------------------------MGKISDALRKVME
A0A1W9R9H3      -----------------------------------------------MGKISEALKKLNE
A0A496RIX0      -----------------------------------------------MGKISEALKKVME
A0A2H0LKN2      -----------------------------------------------MSKITKALEKAAR
A0A1W9RLY2      -----------------------------------------------MGKITQALRKIQE
A0A1G1PTZ0      -------------------------------------------------KITQALEKAAR
A0A1G1PYB2      -----------------------------------------------MSKITQALEKAAR
A0A1G1NXZ1      ------------------------------------------------------------
A0A1G1PUA7      ------------------------------------------------------------
A0A1G1QJ19      ------------------------------------------------------------
A0A358AEN7      -----------------------------------------------MSRIGEALNKATQ
A0A1G1JRT8      ------------------------------------------------------------
A0A496RSL4      -----------------------------------------------MGKISDFFKNTQI
A0A2J0M9Y8      -----------------------------------------------MGKFTEAIRKAAE
A0A419DVK8      -----------------------------------------------MGKITEALKKAAQ
A0A3B9ZHK0      -----------------------------------------------MGKLTDALKKAAE
A0A7C4SWC3      -----------------------------------------------MGKFTDALRKAAE
A0A1G1MCV8      ------------------------------------------------------------
A0A357BIJ1      -----------------------------------------------MGKITNALKKAAE
A0A3D2GIE7      -----------------------------------------------MGKITEALRKAAE
A0A1G1N811      ------------------------------------------------------------
A0A1G1P565      ------------------------------------------------------------
                                                                            

A0A1G1JUC3      KLEESQNSLQLSQ--IAQRQRMFSIILKPHLTAEELIPVESDLTNLKNLLEQEIETNREI
A0A2J0KUN7      ELDRALQSLDRSSATLKREEEKLRTLIKEGLS-DKMVEYSS--------LHRDVEVKQEI
A0A7C0WW92      ERQRILTLKKKAIQYRILKREVETSKAIYESLLNRLKETRS-------------------
A0A2J0L3X7      ------------------------------------------------------------
A0A1G1J391      YYTPPMYV----------------------------------------------------
A0A1W9RBB3      EREKQNREAKTLITSTINKEDSGFSSDDISPISLKSSRRST-------------------
A0A1W9R9H3      EKERQKKEIMEKEKVLKKKEEAREEIKEDKSGAVRALLSSW-------------------
A0A496RIX0      EREKQKQ--LQREAIMRASVERKEEKSPKESSPQKAKKIPL-------------------
A0A2H0LKN2      ERLHKLQEHANVRSEA------VEIPIET---PSR-----I-------------------
A0A1W9RLY2      EKEKKSKIQKTIEDSNVVKDNFVKKEKEEEDFPFS-----R-------------------
A0A1G1PTZ0      ERLQHTQAHATTTAQA------VSIHIEPASGPGD-----V-------------------
A0A1G1PYB2      ERLQHTQAHATTTAQA------VSIHIEPASGPGD-----V-------------------
A0A1G1NXZ1      ------------------------------------------------------------
A0A1G1PUA7      ------------------------------------------------------------
A0A1G1QJ19      ------------------------------------------------------------
A0A358AEN7      EKIARNQEAAFPVQSPLEAQK-------------------P-------------------
A0A1G1JRT8      ------------------------------------------------------------
A0A496RSL4      KQFNGLSLPSLPR----QF-----------------------------------------
A0A2J0M9Y8      KRIERVEKKEEFK----PY-----------------------------------------
A0A419DVK8      ERLARIEKLDNREEVKFEF-----------------------------------------
A0A3B9ZHK0      ERISRIEKLDSQDEVKYQF-----------------------------------------
A0A7C4SWC3      ERLQRLEKLDTQGEVKYQF-----------------------------------------
A0A1G1MCV8      ------------------------------------------------------------
A0A357BIJ1      ERLERIEKISRLKERE-DL-----------------------------------------
A0A3D2GIE7      DRLERIDKIARIREEK-AL-----------------------------------------
A0A1G1N811      ------------------M-----------------------------------------
A0A1G1P565      ------------------M-----------------------------------------
                                                                            

A0A1G1JUC3      YNSIYKRLQEMELAGGASLWVDIKVIEPAAIPGRPIQPNKKMNVLLSLVIGAFIGLALAF
A0A2J0KUN7      YNSVVKQVEELDTYEKLLSTGFLKVVRSPIMPRNPENP-RSGSCTMAFFFSILCGIACVF
A0A7C0WW92      --------------IQNLRLTNIRVVDRATVPDKPVRPKKKMNLILALFIGLFLSTGTAL
A0A2J0L3X7      ------------------------------------------------------------
A0A1G1J391      -------------------------I----------------------------------
A0A1W9RBB3      --------------QKFLPVKDKAYI----------------------------------
A0A1W9R9H3      --------------GERLHFKENFFL----------------------------------
A0A496RIX0      --------------EERFKIKEQLYI----------------------------------
A0A2H0LKN2      --------------SE--------------------------------------------
A0A1W9RLY2      --------------GKEYSLKNKAFL----------------------------------
A0A1G1PTZ0      --------------GD--------------------------------------------
A0A1G1PYB2      --------------GD--------------------------------------------
A0A1G1NXZ1      ------------------------------------------------------------
A0A1G1PUA7      -------------------------M----------------------------------
A0A1G1QJ19      -------------------------M----------------------------------
A0A358AEN7      --------------PAQERSRNSGYI----------------------------------
A0A1G1JRT8      ------------------------------------------------------------
A0A496RSL4      -------------------------V----------------------------------
A0A2J0M9Y8      -------------------------V----------------------------------
A0A419DVK8      -------------------------I----------------------------------
A0A3B9ZHK0      -------------------------I----------------------------------
A0A7C4SWC3      -------------------------V----------------------------------
A0A1G1MCV8      -------------------------M----------------------------------
A0A357BIJ1      -------------------------I----------------------------------
A0A3D2GIE7      -------------------------V----------------------------------
A0A1G1N811      -------------------------V----------------------------------
A0A1G1P565      -------------------------V----------------------------------
                                                                            

A0A1G1JUC3      FLEYLDSSLRSLEDVRAHLRVNALGIIPEVEFETADLRELQDKFHAEGSSRVMWSTSDL-
A0A2J0KUN7      LFEVLDISIRNVEDVEDIIGITMLAAIPSWEPKTEN-KDAKVKSAKRQDAGLVVARNPK-
A0A7C0WW92      FIENLDLSIKEPDEVQKYLGLPILGTI----------PLYKQKKDRSVHPALSILTNSH-
A0A2J0L3X7      ------------------------------------------------------------
A0A1G1J391      ---------------------------------------KKMKTPDGVDGHLVSYTDKH-
A0A1W9RBB3      ---------------------------------------AKTRDDSGMDSKVVVYYDYP-
A0A1W9R9H3      ---------------------------------------FSSQSPSGIDPRIVTYYDDY-
A0A496RIX0      ---------------------------------------VKPKDNSEIDARVVVYSDYS-
A0A2H0LKN2      ---------------------------------------AMAAGRVHIDPHIVAATDSS-
A0A1W9RLY2      ---------------------------------------VSKKDISGIDSRIITYYDPS-
A0A1G1PTZ0      ---------------------------------------IAVADRIEVDPHIVAATDAQ-
A0A1G1PYB2      ---------------------------------------IAVADRIEVDPHIVAATDAQ-
A0A1G1NXZ1      ------------------------------------------MSDSKVDQRVITYFDPK-
A0A1G1PUA7      ---------------------------------------AKATDDSGIDPGVVTYFDPS-
A0A1G1QJ19      ---------------------------------------AKATDDSGIDPGVVTYFDPS-
A0A358AEN7      ---------------------------------------AKATDDSGIDPGVVTYFDPS-
A0A1G1JRT8      -----------------------------------------------------MLFDTAH
A0A496RSL4      ---------------------------------------LKSVNDANINPHIVTYFYPK-
A0A2J0M9Y8      ---------------------------------------IRTVSDSKIDPHVVTYFDPT-
A0A419DVK8      ---------------------------------------AKKQVDSKIDPRIVTFHDPK-
A0A3B9ZHK0      ---------------------------------------AKKTVESKIDPRIVSFYDSH-
A0A7C4SWC3      ---------------------------------------AKKTADSRIDPRIVSFYDSH-
A0A1G1MCV8      ---------------------------------------AKKKVESKIDPRIVAFHDPK-
A0A357BIJ1      ---------------------------------------VKKIGESNVDPSIVTYFDPK-
A0A3D2GIE7      ---------------------------------------IKKIGDSKVDPRLVTYFDPK-
A0A1G1N811      ---------------------------------------IKKIGNSNVDPRIVTYFDPK-
A0A1G1P565      ---------------------------------------IQKIGDSKVDPRIVTYFDPK-
                                                                            

A0A1G1JUC3      -KIPLYVAEAYRIIRTNFVF-------------GAVDK-SLRIFQVTSAVKGEGKTTTTV
A0A2J0KUN7      -SI---MGEAFRTLRTNIKF-------------VCVDK-NIKSIVITSVGPKEGKSFISS
A0A7C0WW92      -SR---VLESYRAIKANLTL-------------SNPDL-SKRLLLVTSSVPNEGKSVFSV
A0A2J0L3X7      --------------------------------------------MITSALAGEGKTITAI
A0A1G1J391      -SF---VAEQYKVLRTNLYS-------------LSPRE-TLKTIVITSSQSQEGKSVTSC
A0A1W9RBB3      -PP---ISEQYKILRTNIKSYLNKTVNIDKINMNKTVT-PPRMITITSSLRGEGKTVTCA
A0A1W9R9H3      -SP---LSEQYRLLRTNVKSLVKRIKGNHK--SIKGVN-SPAIITFSSSLRNEGKTVTAV
A0A496RIX0      -SP---ISEQYRILRTNIKSSLTKARASKKISTTKPAT-SPYIFTITSALHGEGKTVTAV
A0A2H0LKN2      -SP---IAEQYRILRTNLQS-------------LRLRP-GPKTIVVTSSVHSEGKSVTSI
A0A1W9RLY2      -SP---LSEQYRILRTNLKSILRKIKATRR--NIKSSN-FASVFTISSSLHNEGKTITAV
A0A1G1PTZ0      -SP---ISEQYRILRTNLQS-------------MRMSS-GSPVIVVTSAVHAEGKSVTAI
A0A1G1PYB2      -SP---ISEQYRILRTNLQS-------------MRMSS-GSPVIVVTSAVHAEGKSVTAI
A0A1G1NXZ1      -AV---ITEQYKILRTNVLS-------------FSKTK-PLKVMAVSSSIHSEGKTLTAL
A0A1G1PUA7      -SS---IAEQYRSLRTNILL-------------NNLSR-PLKTLAICSSLEGEGKTTTAV
A0A1G1QJ19      -SS---IAEQYRSLRTNILL-------------NNLSR-PLKTLAICSSLEGEGKTTTAV
A0A358AEN7      -SS---IAEQYRSLRTNILL-------------NNLSR-PLKTLAICSSLEGEGKTTTAV
A0A1G1JRT8      PSP---VSESFRALRTAILF-------------RFRRVSGCRVLLTTSPNPEEGKTTVSL
A0A496RSL4      -SP---ISEQYRRLRENIKS-------------LSRQK-NIKAIGITSAVTEEGKSITAL
A0A2J0M9Y8      -SP---ISEQYRTLRTNLQA-------------LDKAN-PPKVLAITSAIHGEGKTITSI
A0A419DVK8      -SS---VSEQYKMLRTNLAA-------------LGTKK-PVKVMTITSSTHSEGKTITAI
A0A3B9ZHK0      -AP---VSEQYRSLRTNLQA-------------LNTSK-PAKVIAITSSINGEGKTISAI
A0A7C4SWC3      -SP---VTEQYRTLRTNLQA-------------LKTEK-PIKALTITSSTHSEGKTITAI
A0A1G1MCV8      -SS---VSEQYRILRTNFQG-------------ISSPKHPIKAITITSSVHSEGKTITAI
A0A357BIJ1      -AL---ISEQYKILRTNILS-------------MNKGK-PPQTIVITSSIHSEGKTVTVI
A0A3D2GIE7      -AL---ITEQYKILRTNILS-------------ANARR-PLKTLVVTSSLHSEGKTVTAL
A0A1G1N811      -AV---ITEQYKILRTNLLS-------------MNKGK-SPRIIVVTSSVHSEGKTVTTL
A0A1G1P565      -AL---ISEQYKILRTNVLS-------------ANAKR-PLKTLVITSSLHSEGKTITAL
                                                               *    ***:    

A0A1G1JUC3      NLGISLAQVGL--KVLLIDADMRRPSLHHALRLPKEGLGLQHVLKEGLPLEAVVQ-KTKT
A0A2J0KUN7      NLALSIANSGE--KVILIDADLRRPTIHKYFGIENQKGLSNLLIGDGSLDEFEAA-DSAF
A0A7C0WW92      GLAGVMARAGE--KVLLVDVDFRHPNLHQVFGI-QRTNGLSDLLAEGVQNLHNYIKSTEI
A0A2J0L3X7      NLAISMAHDLDNKSILLIDADMRKGKIAKYFGL-GSHPGLSELLKGNADQEGVLI-NPGI
A0A1G1J391      NLSYTLSLDTEK-KILLLDADFRRPSIHRLFGI-PRKPGFTDVLSGLVELEHFTK-KPTF
A0A1W9RBB3      NLAVALARDCEN-KILIVDCDLRGGTLHKLFNL-DCRPGLSDILTTDFDWSVALH-TTKL
A0A1W9R9H3      NLAMSLASEEGT-KVLLIDADLRNGTIHKLLNV-EEEPGLSTVLVGEYDWSVGLH-PTLN
A0A496RIX0      NLAVALASDLES-RVLLIDCDLRNGEIHKLLNL-NYKPGLSEILTGDFDWSVALH-RTLI
A0A2H0LKN2      NLALTLARQENL-RVVLVDADLRKGSINKWMGLGERAEGLSTALLRGGELNGSLL-KLKD
A0A1W9RLY2      NLAMSLASETET-RVLLIDGDLRNGLIHKLLNI-EAEPGLSTILINDYEWTVGLH-PTRK
A0A1G1PTZ0      NLALTLARQEKL-RVVLVDGDLRKSAVHRWLGLGERAEGLSTALARGGELNGSLV-RLQH
A0A1G1PYB2      NLALTLARQEKL-RVVLVDGDLRKSAVHRWLGLGERAEGLSTALARGGELNGSLV-RLQH
A0A1G1NXZ1      NLAVAIAQSTSKPRVLLIDADLRRGRVAKYLGV-KQPVGLANILKDEVKPSDALF-NIDV
A0A1G1PUA7      NLAITMAGDLER-SILLVDCDLRAGTVHQLLAI-KSAAGLSDILASGAELESTLG-QTRI
A0A1G1QJ19      NLAITMAGDLER-SILLVDCDLRAGTVHQLLAI-KSAAGLSDILASGAELESTLG-QTRI
A0A358AEN7      NLAITMAGDLER-SILLVDCDLRAGTVHQLLAI-KSAAGLSDILASGAELESTLG-QTRI
A0A1G1JRT8      NLAAAFHQ--NHLKVLLIDADLRKPKIHKIFDV-EDARGLSDVLEGTARPRDVIAENVDG
A0A496RSL4      NLAVIMTRDIDFNNILLIDCDLRCGVVDLALGL-KSKTGLSEYLSIGTDIDNILF-KTKI
A0A2J0M9Y8      NMAITFAHDLNNKSILLVDADLRKGNLTKALGL-KADKGFADILTDGTTVEDSLL-SIDI
A0A419DVK8      NLAISMAHDLNNKNILLVDADMRRARITRYLGV-ASESGLSDILNDGANIDQALL-NIGI
A0A3B9ZHK0      NLAITMAKDLNQKSILLIDADLRRSRITKYLGI-TPELGLSDIITNGSNIDDALL-NIGI
A0A7C4SWC3      NLAMSMAQDLSKKDILLVDADLRRARITKYLGF-KAETGLSNLLTNGAPIEDALV-SIGI
A0A1G1MCV8      NLAVSMAHDLNKKSILLVDADLRRAKISKYLGV-NAEVGLADLIANGTNIDDTLL-NIGI
A0A357BIJ1      NLAVALAQSVQKPKVLLVDADMRRGRMVKYLGV-DHKVGLMEILTGAAKAEDVLF-HLEY
A0A3D2GIE7      NLAMVIAQSTQKPKVLVVDADMRRGRVTKYLGV-DHPMGLTEILTDKIDPSEALF-HTDM
A0A1G1N811      NLAMAIAQSAQKLKVLLIDADLRRGRMAKYLGV-NQKIGLTEVLKGEADVADVMF-NIDV
A0A1G1P565      NLAMAIAQSTQKPKVLLIDADMRRGRVARYLGV-EQKTGLTEILTEKADPSQTLF-HIDI
                .:.  :        ::::* *:*   :   : .          :                

A0A1G1JUC3      ENLQVITSGGIPEHPAELLSAPVLTAFLNTLREV-FDVVLIDSPPVISVADAPIIASRVD
A0A2J0KUN7      ENLKIIPAGPIPPNPNEILGTRRMEEILEHLKGT-CNIIIIDSPPLLTVSDALILAKKTD
A0A7C0WW92      ENLDLLTCGSLPPDPAELLGTKKMEEVIQDLSKR-YDRIIFDAPPVLAVTDALVLSTRVD
A0A2J0L3X7      PNLTVVLAGKTPKNASELLNSKKMEQILSYFKTR-FDYILIDTPPVMPLTDACILGPVVD
A0A1G1J391      GNLHVIPSGTLITNPSEFLSSIKMRNLIKELKTS-FDYVIFDSPPVINVTDSCILGSICD
A0A1W9RBB3      ENLFVLPRGETIPNSSDLFSSKRMKLIIEKLKSEQFSYIILDTPPLLFFTDASVLGVQTQ
A0A1W9R9H3      KNLFVIPRGKISAHPCEFLGSRKMRMILERLRGEKFNYILIDTPPLLSFADAYLIAQLTD
A0A496RIX0      RNLFIIPRGQPPSNPSELLGSKKMRLILERLKVEEFTYIILDTPPLLTFTDATILGVQTE
A0A2H0LKN2      PALAVLPCGDYPEHPAELLESSSMKKVLAGLREQ-FDVIVIDAPPVLPVADPGILAAQAD
A0A1W9RLY2      ENLFVIPRGKISPISSELLSSRKMHIILEKLREENFNYIIIDTPPLLSFADAQLVTQFTD
A0A1G1PTZ0      PPLAVLPAGPHPEDPAELLGSSSMKRVLAALKRQ-FDLIVIDAPPTMLVTDPAILASQAD
A0A1G1PYB2      PPLAVLPAGPHPEDPAELLGSSSMKRVLAALKRQ-FDLIVIDAPPTMLVTDPAILASQAD
A0A1G1NXZ1      ENLTFIAAGPIPTNPVELLSSDRMNRFLILMRSK-FDYIIVDTPPVISVTDAGIVGAQTD
A0A1G1PUA7      RNLTVLPRGEIPRNPSELLSSKKMRGLLQELKSK-FDYIILDSPPIMPLTDACVISSQVD
A0A1G1QJ19      RNLTVLPRGEIPRNPSELLSSKKMRGLLQELKSK-FDYIILDSPPIMPLTDACVISSQVD
A0A358AEN7      RNLTVLPRGEIPRNPSELLSSKKMRGLLQELKSK-FDYIILDSPPIMPLTDACVISSQVD
A0A1G1JRT8      LGFDVLFSGPHSDHPTEILGSKQMSDMLTELKSH-YDIIIIDSPPYLAVADVAVLNEYVD
A0A496RSL4      DKLTVMPKGSIIENPSELLASEKMQTLLAILRKR-FDLIILDTPPILPIADAGVVGAQVD
A0A2J0M9Y8      KNLHILPVGNKPNNPAELMGSAKMRQFISEVRKQ-YDYVFFDCPPVIPVTDASVLAHQCD
A0A419DVK8      NNLTILPSGKIPHNPAELLGSGKFKNLVAALKNK-YDYVIFDTPPIISVTDAGILGAQTD
A0A3B9ZHK0      ENLTVLSAGKHPTNPAELLGSQKFKNLMNQVKAK-YDYIILDTPPIIPVTDAGLIGAQAD
A0A7C4SWC3      NNLTVLPAGKIPGNPAELIGSAKMRNLITAFKAK-YDYIIFDTPPVIPVTDACLLGPQTD
A0A1G1MCV8      DNLTVMPAGKIPHNPAELLGSAKLKNIITALKSK-YDYIIIDTPPIIHVTDAGLVGAQTD
A0A357BIJ1      DNLAFVGSGGIPENPAELLASDKMKQFLAEMKSD-FDYILIDTPPIIPVTDAGIVGPIAD
A0A3D2GIE7      ENLAFIASGSVAENPAELLGSDRMRQFLADMKTQ-FDFILIDTPPIIAVTDPGIVGALVD
A0A1G1N811      ENLTFIASGTVPENPAELLDSEIMKNLLTTMRTK-FDYVLIDTPPIVSVTDSGIVGSQVD
A0A1G1P565      ENLTFLSSGAVAENPAELLASDGMQRLLADMKTQ-FDHVIIDTPPIISVTDSGIIGALAD
                  : .:  *     . ::: :  :  .:  .       :..* ** : .:*  ::    :

A0A1G1JUC3      GTILVARSGYIPRRLSIQAKKAIEAVNGKIIGCVLNSVA-----ASHHPYYYYRYYSDHS
A0A2J0KUN7      GVIFTFFTNKTAKKAGKRAVFLLKNAGINMLGGVLNYVK-----TSKGGYYYYYY----S
A0A7C0WW92      GVIIIVRFEYTHRKALQRAKEALEGVNARILGAVLNMVT-----PRGGGYYYYYYYHYGE
A0A2J0L3X7      GIIMVIQAGKTQRDIIAHAEQRLYQARAKTIGYVLTNIE-----YHLPQYLYRYVHQYDG
A0A1G1J391      GVILVVKAGITPKNMIEEAFTMLTHAQAKPKACVLTNTSIPVYYYYVSRYKYYYKYRYGY
A0A1W9RBB3      GIILVVQARRTPLQVVKKAEEFIKQSSNRLIGFIFTQVD-----YYASN--YYYNYYYYR
A0A1W9R9H3      GLIIIVEAHRTKAEIVRKAKEVCEEAHTKILGFILTKVD-----YYTPD--SYYYYYNYR
A0A496RIX0      GVVMVVEAQRTRAHIVKKAKEFLEQTHSRFLGFILTKVD-----HYTPDFYGYYYHYHYK
A0A2H0LKN2      GVLLVVRAGKTQRKTVLQAQSLLRQMKANVLGCVLTHVE-----YYLPGYYRYYHQYRYG
A0A1W9RLY2      GIIIVVEANHTKAEVVKKAKELCEQANNKILGFILTKVD-----YYAPDFYYYYYNYKNY
A0A1G1PTZ0      GTLLVVRAGKTQRKTVARAHALLTQMHAKVVGCVLTHVE-----YYLPGYYQHYYAYRYG
A0A1G1PYB2      GTLLVVRAGKTQRKTVARAHALLTQMHAKVVGCVLTHVE-----YYLPGYYQHYYAYRYG
A0A1G1NXZ1      GVLMVIQAGRTQRGIVKRATELLNQAHSKVLGHILTNIE-----YHLPEYIYRYL-----
A0A1G1PUA7      GVIFVVQAHRTPRRVVKQAQNMLEHVHAKILGFILTQTE-----TKEHADRYGYYGYGEV
A0A1G1QJ19      GVIFVVQAHRTPRRVVKQAQNMLEHVHAKILGFILTQTE-----TKEHADRYGYYGYGEV
A0A358AEN7      GVIFVVQAHRTPRRVVKQAQNMLEHVHAKILGFILTQTE-----TKEHADRYGYYGYGEV
A0A1G1JRT8      GITVVTRYHKTDKRHLKDMKKRLSREAEKILGIVINQVS-----VKEKDYYYQQYYYYGY
A0A496RSL4      GMILVVRLGKTQKGMVEQAEELLVQSKVNLLGYVLTHVE-----YHIPEYVYKYV-----
A0A2J0M9Y8      GALMILQAGRTQKGIISHAQDRMSQAKVKVLGYVMTNIE-----YHIPEYIYRYL-----
A0A419DVK8      GVIMVIQANRTQKGVVKHAETLLRQAEAKLLGYILTNIQ-----YHIPAYIYRYL-----
A0A3B9ZHK0      GVIMVVQASRTQRGVVKHSEGLLKQAQAKILGYILTNVQ-----YHIPGYIYRYL-----
A0A7C4SWC3      GIVMVIQAGRTQKGVIKHSEGLLRQAQAKLLGYILTNVQ-----YHIPAYIYRYL-----
A0A1G1MCV8      GTIMVIQANRTQKGVVEHAEMLLKQAQAKVLGYILTNIQ-----YHIPAYLYRYL-----
A0A357BIJ1      GVLMVVQAGRTQRGIIRRAEDLLFQTHSKILGHVLTNIE-----YHLPEYIYRYL-----
A0A3D2GIE7      GILLTIQAGRTQRGIVRRATELLDQSQSKIIGHVLTNIE-----YHLPEYIYRYL-----
A0A1G1N811      GVLLVIQAGRTQRGIVKRATELLNQAHSKLLGHVLTNIE-----YHLPEYIYRYL-----
A0A1G1P565      GVLLVIQAGRTQRGIVQRATELLEQAHCKTIGHVLTNIE-----YHLPEYIYRYL-----
                *  .                        .  . ::.                        

A0A1G1JUC3      YGYYGSEANGAGGKKRRSPIQGERVSSLEKLKLVFQSLLPKGNARFENLPPQPRHSGSRT
A0A2J0KUN7      YEYYADKND-----KKKS------------------------------------------
A0A7C0WW92      KS----------------------------------------------------------
A0A2J0L3X7      NYSYEEKAAAKT------------------------------------------------
A0A1G1J391      RSDTPIDTSVK-------------------------------------------------
A0A1W9RBB3      DRGSNYQKGKY-------------------------------------------------
A0A1W9R9H3      KYGRKI------------------------------------------------------
A0A496RIX0      SAGVGS------------------------------------------------------
A0A2H0LKN2      VVKDKDGNGKAAAGSPAQPEAQSSTPQT--------------------------------
A0A1W9RLY2      KKDV--------------------------------------------------------
A0A1G1PTZ0      EKKEATSDKGQATSSKQQGTSDKKQVSGLGG-----------------------------
A0A1G1PYB2      EKKEATSDKGQATSSKQQGTSDKKQVSGLGG-----------------------------
A0A1G1NXZ1      ------------------------------------------------------------
A0A1G1PUA7      QKSDSDSLEQTEKAIK--------------------------------------------
A0A1G1QJ19      QKSDSDSLEQTEKAIK--------------------------------------------
A0A358AEN7      QKSDSDSLEQTEKAIK--------------------------------------------
A0A1G1JRT8      GDAKPRKR----------------------------------------------------
A0A496RSL4      ------------------------------------------------------------
A0A2J0M9Y8      ------------------------------------------------------------
A0A419DVK8      ------------------------------------------------------------
A0A3B9ZHK0      ------------------------------------------------------------
A0A7C4SWC3      ------------------------------------------------------------
A0A1G1MCV8      ------------------------------------------------------------
A0A357BIJ1      ------------------------------------------------------------
A0A3D2GIE7      ------------------------------------------------------------
A0A1G1N811      ------------------------------------------------------------
A0A1G1P565      ------------------------------------------------------------
                                                                            

A0A1G1JUC3      ETETSTPTMTV
A0A2J0KUN7      -----------
A0A7C0WW92      -----------
A0A2J0L3X7      -----------
A0A1G1J391      -----------
A0A1W9RBB3      -----------
A0A1W9R9H3      -----------
A0A496RIX0      -----------
A0A2H0LKN2      -----------
A0A1W9RLY2      -----------
A0A1G1PTZ0      -----------
A0A1G1PYB2      -----------
A0A1G1NXZ1      -----------
A0A1G1PUA7      -----------
A0A1G1QJ19      -----------
A0A358AEN7      -----------
A0A1G1JRT8      -----------
A0A496RSL4      -----------
A0A2J0M9Y8      -----------
A0A419DVK8      -----------
A0A3B9ZHK0      -----------
A0A7C4SWC3      -----------
A0A1G1MCV8      -----------
A0A357BIJ1      -----------
A0A3D2GIE7      -----------
A0A1G1N811      -----------
A0A1G1P565      -----------
                           

© 1998-2021Legal notice