BYKdb

Dataset for cluster tadcd of phylum candidatus-cloacimonetes

[Download (right click)] [Edit] [Sequences] [Repertoires]

16 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A523T245      --------------MNEEKIDIRAYVAIVLRRKWIVLTLFLVTFLSTLYFTLRKPPVYES
A0A523T055      MNQNNY-----TKEEKDTHIDILAYLKVLWRRKLVISTAIGATLIFTIIYTLLSPQIYEA
A0A1W9P0R7      MKTNRTKEAILTKEDKDSHLDIIAYLKVLWRRKIVMTTAVGATLFFTLIYTFISPKIYEA
A0A523R6B6      MKHKKI-------EEKDTNIDIIAYLKVLWRRRLVIGTSIGATLIFTIIYTLNSPKIYEA
A0A2G6BVY8      -------MFEDDNNQENYSFPWKEYFSIIYRGRWWILLTFITISSLSTYYTLRMTPVFQA
A0A1V4R675      ---------MEQFPEQEQEIKLRDYYRIILRHIKLIGIIFVLVMVATIYYTARAPRIYES
A0A3D5VBP3      ------MQDQFYEQTEEQEIKLTDYLHIISRYKWLIIAIFVLVVAATVIYTFHSPKIYSA
A0A2N2KUB8      ------MDNQTNTAPVQDEINLSDYLRIVLQYRYLIVLVFSLVVVSTVFYTARQDKIYSA
A0A4R5JP48      ---MEQQPMQNPQTPQVEEINLKEYLRIIYQFRYLVVIIFVVVIIGTILYTYQQPRIYSA
A0A3C1LP64      ------MEQQNIPNPASDEINISDYFRIILQYRYLVILVFILVLIGTIIYTARQPRVYSA
A0A2N2KXM8      ----MENQHINP--VVQEEIKLSDYLRIIVQYRYLVVLIFTLVLAATVIYTARQPKVYST
A0A2N2LDB7      ----MENQVQNQSNVSQDEIKLSDYIRVIVQYRYLIVLVFVLVITLTIFYTARSPRIYSA
A0A3D3EZ13      ----MENQYQNQQ-PLQDEIKLSDYVRIVLQYRYLIVLVFILVMAATIIYTARQDKIYSA
B0VJW4          ----MLENENNQL-PVQEEIKLSDYFRIILQYRYLVILVFLVALVATVYYTARLPKIYSA
A0A496ZR22      --MENFDQT------ETSELQFKEYIRIIIQRKWLVLSIFTIIVLVTMVFTMRQPKIYVT
A0A661UPD3      -MKDQFNQVKFNEDFEEQEIKLTDYLNIIIRFKWIVASIFLAIFVVSFIYTARAPRIYKA
                                   :    *  :: .    :   .      :  :*     :: :

A0A523T245      KATVIIKQLPTA----IPGMDFGYSKANYITNHTLILKSRTLMGKVAENFT-SEEMESAG
A0A523T055      TTSILIQQAPEGKDSFLSPWEYTGERDNFIQNQSHILKSRTNLKLVVDKIKEQHSDKDLP
A0A1W9P0R7      QTSILIQQIPEGKDTFLTPWEYIGARENFINNQAQILKSRTNLKLVIDKIRKEHSGENLP
A0A523R6B6      STKVFIQQAPEG-NTFLSPWGYTGARDNYIKNQTHILKSRINLRLVVDKIKEEHGNEDLP
A0A2G6BVY8      ETTIEIKDKDNMFSDMSS-PFNLKRSDRVIANNSELIKSRTVAKMVMDEVDKSEFAEHIS
A0A1V4R675      NGKILLELNKQT-D--LF-FSTGGFGRNDLNNQMEVIKSPSVMESAVEKLKRNQEAENFP
A0A3D5VBP3      SSTIMLEEKSSE-N--LL-FSSMANKATSINNYIEILKSRPVLEAAYSIIQNSEIYPEIP
A0A2N2KUB8      SARILLEDQKGS-TDLMF-LATPGVGKNSLNNQIELIRSKPIMSLAWDIMKKYPDWDTFP
A0A4R5JP48      TSKILMENKSTG-ADILM-LTGQGSGKNYINNQIQLIKSKPLLSAAWEIMKKNPEWEAYP
A0A3C1LP64      SNRILLETQKSG-AD-LF-LAGTGTGKNELNNQIELIKSKPILNAAWEIMKKYPDWESFP
A0A2N2KXM8      SSRVLIENQKNT-SDLML-FATPGVGTNALNNQIEMMKSLPLGNRAAEIMKKHRDWESFP
A0A2N2LDB7      SSKILLENQKSQ-SDFLF-LATPGVTSTTINNNIELMKSKTIGTMAWEIMKRNPDWDTFP
A0A3D3EZ13      SSRIMLEDQNQG-AEFLF-MGAPGMGKNSINNQIEIIKSRPTLTLAWEIMKKYPDWDLFP
B0VJW4          STRILLEDANKQ-SDLMF-LSTGGLGKNTLNNQIELIHSKPIMNLAWEIMKKYPDWDTFP
A0A496ZR22      SAKVLIEQQKKG-E--FF-FQPAGYGDKSLKNQIILLKSIPIMNSAIEKMKAHPESETFP
A0A661UPD3      TSKVLLEEKMGS-N--LF-FTSMSNKASSINNQIQILQSFPVMKIANQILTRHKEYESFP
                   : ::                      : *   ::.*      . . .          

A0A523T245      ISKLSS-------IVGIVSSAITINPVKGSDIIEIKSKTDKPYSAALFANKVAETYIHYN
A0A523T055      IFKNPS-------PIVFLAYNIIVKPVERTDIIRILVHSTSPQEAAIIANAVADNLLEQS
A0A1W9P0R7      ILKDPD-------PITSLAYNIIVKPVERTDIVNILVHSTDPKEAAIIANTVAENLLEQS
A0A523R6B6      IFKNPN-------PVTFLIYNIIIKPVERTDIVNILVHSTNPQEAAVIANVMAENLLEQA
A0A2G6BVY8      VSKEVRKDLNENSRIQMLRRKLSIKPIKNTDILRLIITSSSPFEVSFLANTYAEQFELYS
A0A1V4R675      ILSLDN-------PSSILAKNIDVSAEREVDIIDISFKSTNPNEAQAAVNAVMDSYQDES
A0A3D5VBP3      LNPANHEEPDKFSPIGAIKEKLAVESQRETDIIKISYESTHPGEAKLVANALALGLQNKD
A0A2N2KUB8      ANTSGN-------PIISL-SRMKVESKRETDILTISFESTNQTEAMAAVNSISEAIQQQN
A0A4R5JP48      ISSTEN-------PIDHL-GEVKIEALRETDVLNLSFESTNPGEAMATVNAIADAVVQQN
A0A3C1LP64      AASTPN-------PAAQL-ASVKVESKRETDILTISYESTSQGEAMAAVNSIAEAVQQEN
A0A2N2KXM8      ISQSAS-------PGAFIKARMKVESKRETDILTISYESTSQSEAQAAVNAVAEAIQQEN
A0A2N2LDB7      INSSGS-------PVNTLRSSVKIESKRETDILTISYESTNQVEAMVAVNSLAEAVMLEN
A0A3D3EZ13      IASHEN-------PAGAL-GKVKVESKRETDLLTISIESTSPTEAQAAVNAIAEAIQQQN
B0VJW4          ASQAAD-------PASTL-GRMKVESKRETDVLTISFESTNPTEAMAAVNSIAEAIQQQN
A0A496ZR22      ILKSEN-------PAMSLKGRVDVSSERDTDVLTISISSTNPLEAQVAANSVAESFKEKN
A0A661UPD3      ISQTEG------LPESYLKRNLEIDTERETDILIINFESTSSLEAKEAANAAAHALMQQD
                                 :   : :..    *:: :   :    ..   .*          

A0A523T245      IEDKRREVKGVREFAEEQMELVEEQLKKAEDDICNYQKTHKVFGLKKETEAFIEQIAELQ
A0A523T055      RLTARSAVSEVRRFLEEQLKIVEDNLKKSADSLRIFKEKKQVFSLSNEGQALFAKLSTFD
A0A1W9P0R7      RLTARSAVSEVRKFLEKQLKIVQNNLKESADSLRVFKEKNRVFSLSNEGEELFTKLSTFD
A0A523R6B6      RITARSAVSEVRKFLEEQLKIVENNLKQSADSLLIFKEKNRVFSLSTEAQALSSKLSSFD
A0A2G6BVY8      KLSNLGEVGAVTNFLKDQLDVIKKRLKLSEEALELYQKEGGIVVLEAETQLLIENSAKSE
A0A1V4R675      LKYTRAEVTSVREFLEKQLDVTSKKLAISEEDLRAYKIAHEVFALTEETKEMITNMVEFE
A0A3D5VBP3      NEYARIEFKNVREFLENRLDETERRLRNSEEDLRSYKIDKGISMLSEETTQIIEQSAELE
A0A2N2KUB8      TQYARLEFTTIREFLETQLDAISRRLQSSENDLREFKNLNKLTQLSAETAQLIIQSSELE
A0A4R5JP48      TQIARLEYTTVREFLGEQLDLISRRLQASEEDLRAFKNENKIVELTETTKKWIEQSADVE
A0A3C1LP64      TQFARLEYTTIREFLETQLDAISRRLQSSENDLREFKNMNKLTELSAETTQLIEESAKIE
A0A2N2KXM8      TLYARLEYTTVREFLEDQLDAISRRLQSSENDLREFKNANQLVELSAETQKLIEQSAEVE
A0A2N2LDB7      TQYARLEFTNIREFLETQLDAITRRLQTSENDLREFKNMNRLVELTEETTKLIEKSSDVE
A0A3D3EZ13      TQFARLEYTTIREFLETQLDAISRRLQASENDLREFKNLNRLTELTAETTKLIEQSSELE
B0VJW4          TQYARLEFTTIREFLETQLDAISRRLQSSENDLREFKNLNKLTQLSEETNKLIEQASDLE
A0A496ZR22      LEYARTEVAAVREFLEKQLDIIKRKLAISEEDLREFKIQNRISTLSAETAELVRTSSSFE
A0A661UPD3      TDYARREFRNAREFLANQLDEHDRRLRSAEEELRLYKIEHGVSMLSEETQKLIEQTSDLT
                             *   .:.    .*  : : :  ::    :  *               

A0A523T245      TLYEKARIERKGVEKNLEAVKSQLTIEQKEFLETSTDISLPLLKDLKISL--STLEKEKA
A0A523T055      KQYNEVNTEFLTKKKRLDFLKDKYRQNKNDLLRDITETKSPIIISLREKL--IKRETEYS
A0A1W9P0R7      SKYNEIEADYITKKKQLDFLKKKYEQNQKNLVTDITEIKSPLIMNLRKKL--ISLETEYS
A0A523R6B6      NQYNQANTDYLTKKKKLDFLKNKYQQNQKNMVEDITETQNPLIMNLREKL--IKFETEYS
A0A2G6BVY8      AKLNEIELNYQSANQKILFLKKELDEKSKRIVEDISRNATPEIEKLKIKVGELNAKKLNI
A0A1V4R675      AQLSSAQTELQIVEKKLAYLKDELIKIDEALGEEMASISSPVSEQLRQKL--IENESQLA
A0A3D5VBP3      LLLSEAETEYAVAKNRLDFLTSELSDQDKLLSDVNSIITTPLLEQLRREI--VTNQSKYL
A0A2N2KUB8      ALYESSLTDQAIKAKSLDMLNRQLREQDSLLVDVNNILKAPYISELRKQI--VDTQSLVT
A0A4R5JP48      SQYESALTDQAVKARTLEVLKRQLKDQDSLMVEVDNVLRAPYIEQLRKDI--TNTQATIA
A0A3C1LP64      AEYEAALTDQAVKARTLELFQKQLQQQDSLVVNVSTVLKTPYINELRKQV--IETQSLIT
A0A2N2KXM8      AQYEQALTDQAVKAKTVEMLQRQLSEQDSLIVNVENILNAPYVNELRRQV--IDTQALIT
A0A2N2LDB7      AEYESALTDQAVKAKSLDLLNKQLREQDSLMVNVNNILKAPYVAELRKQV--VDTQSLIN
A0A3D3EZ13      AELEASLTDMAVKAKSLDLLTKQLRDQDSLLVDIDNMIKTPYITELRKQV--VETQALIT
B0VJW4          AEYEAALTDQAVKAKSLDLLNRQLQEQDSLLVNVDNIIKTPYINELRKQI--VDTQSLIT
A0A496ZR22      AQLNDANTELQVAEKKLKFLQSILAQQDSALANEVMAISSPLIEELRKKL--VENEAKYA
A0A661UPD3      AMLSEAETELDVANNHLDFLKVELNVQDDFLTDVNSVLSSPLLEQLKRET--IELQIQYV
                   .    :     . :  .       .. .         *   .*. .      :    

A0A523T245      SLIIQ-AYDEKDPKIREINSKIGAIKSKMNETIVSVLENRG-QIDALTQVQELLLQSISL
A0A523T055      NYLLQ-GLDDEHPRIKKIKTLIEDTKQRLQSEVKKLIASDAEKGDLLAMNQKIMEELSEL
A0A1W9P0R7      NYLLQ-GLPENHPKMEKIKSLINETKRSLQKEVRKYISSGAENGNLITENQKIT------
A0A523R6B6      NYLLQ-GLTAEHSKMQKIKSRIEDTKTQLRKEVTKLITSDSEKGNLLARNQKIAEEIASL
A0A2G6BVY8      ELEKSAGY---KRILKNLQKQIDNLEAKITEKAKYFANSAQASANPVEDKSDIMRKILEA
A0A1V4R675      ILLTKKGYTENHPQLVSLRTEIDNIKRQMKSEIAKILEVNKYSFNPLDRRQQLFTDIIST
A0A3D5VBP3      NLLSKPSYSPDHPELVALKNQIDNAKRQLNEEIQKTTNVKAGTADPLVYRADLISSISKA
A0A2N2KUB8      KLVTKNEYPLDHPQILLLKREMENAKATLDLEVRKLVALSV-NNDPLTTRSELLGKIIQA
A0A4R5JP48      KLRTNENYSSDHPQIKLLQEELSKTKATLDAEIKKYISKNL-NYDPLSFRNQILTKIVQA
A0A3C1LP64      KLLTKNNYPTDHPQIIALNAELERTKDELDIEIKKLVATSS-TDDPLAMRNETLVKIIQT
A0A2N2KXM8      NLVTKNEYPLDHPQIALLNAELDRSKANLDLEVRKMVAIQM-QSDPVATRSDLLNRIVQA
A0A2N2LDB7      KLLSKNEYPLDHPQIMLLNRELENIKATLDTEVRKLVKISL-NSDPLQSRSDLLSRIVAA
A0A3D3EZ13      KLLTKNEYPLDHPQILLLNRELENTRANLDREIRKLVSVSV-SADPLSTRSDLVNRLIQA
B0VJW4          KLVTKNEYPLDHPQIQLLYREIENAKEKLDQEIRKLVNLAV-TDDPLATRSDLLTRIVQA
A0A496ZR22      IYLTKEGYSSEHPELRKLKEEIEREREQLKLEIDKVLQLKTDASDPLARRGEIIGEITNA
A0A661UPD3      NFLTKSDYSPDHPELIALKNSIESAKIKLNEEIQKILLVKSGSADPLMFRSSLIEKISTA
                    .         :  :   :      :               : :    .        

A0A523T245      QISIEVAKAKELAYRGVLGVYEGKFSSIPSEQIELARMERQRKANEKIYMMLLEKAEEAK
A0A523T055      EVEIVVLETKKTVIGKIRSSYESQFSTLPSKELRLAQLERAYKINDNIYEMLMEKYEEAK
A0A1W9P0R7      ---------------------------------KLAQLERAYKINDNTYEMLMQKYEEAK
A0A523R6B6      EVEIVAIEARKSAVGKIRSSYENQFLKLPSKELKLAQLERAYKINDNIYEMLMEKYEETK
A0A2G6BVY8      QAEQIGLKAQAKKVQETINNYNKKIAMLPETATEFARLKRKYEIDEKTYIMMENKYNEYK
A0A1V4R675      EVEFQTATAKVSGLETVVEEYSVRMSGLPDAELELARLERSKAINEQIYSMLITRYEEAK
A0A3D5VBP3      RVEKNIAESKVENLRKSVEQYNRQLSLLPDAEIELARLERNNRINEKTYTMLNEKFEEAR
A0A2N2KUB8      NLELEMARAKVDGLEQTKEMYDQRIIAIPNTELELARLTRNMLLDEKIHGMMMEKYEDAK
A0A4R5JP48      EVDLEMARTQVHGLEQTKAIFEDRIITLPDKELQLARLTRSMALDEKIYGIMMEKYEDAR
A0A3C1LP64      NVELEIARTKADGLAQTKEMYDERIISLPNTELELARLMRNVQLDGKIHGIMMEKYEDAK
A0A2N2KXM8      RIELEMARSSVSGLEETKEMYAQRMITLPNTELELARLRRNLLLDEKIHGMMMEKYEDAK
A0A2N2LDB7      NLELELTRAKVNGLSQTKEMYNERIVTLPNTELELARLVRNMKLDEKIYGIMMEKYEDAK
A0A3D3EZ13      NVDLELARTRVDGLGQTKEMYEQRIISLPNTELELARLSRNMMLDSKIHGIMMEKYEDAK
B0VJW4          NIELEMARAKVDGLEQTKEMYNQRLIAIPNTELELARLTRNLMLDEKIHSMMMEKYEDAK
A0A496ZR22      QVELNVAQTKVSAIESIVAKYTQKMTSLPDTELELARLERDKQMNENIHTLLVEKYEEAK
A0A661UPD3      QIEQNIKSTKVISLRAAVEKYNEKMSQLPDTEVQLARLERNYQINEKTYTMLIEKYEEAK
                                                  :*.: *    : : : ::  . :: .

A0A523T245      ISEASEIGTVSMLDRALLPKKEIRKQKITNIMLGFIMGLIISIGVAFVIEYFDTSIKSIE
A0A523T055      ITEAGQLGNVKIIDTAFIPSTPIRPNKKKNILFALLVGIGIGLVFTVFTEYLDTSIKEPK
A0A1W9P0R7      ITEAGQLGSVKIIDKAFIPTFAIKPNKKKNLLFAILVGIGIGLVFTVFTEYIDTSIKEPK
A0A523R6B6      ITEAGQLGNVKIIDKAYAPSFHIRPNKKKNILFALLVGIGIGLVFTVFSEYLDTSIKEPK
A0A2G6BVY8      IALAGQVGNARIVDKAITPKSPIRPDKPLYITIGLGVGLGLGVFISFLLAFFDNSIKTIE
A0A1V4R675      ISEEGKL--------------------------------------------LNTKITNLS
A0A3D5VBP3      IAEKSKMGKIRIVEEAQLPEAPIKPNKKMNLLIAIVLGLGGGIGSSFLLHSLDSKIRTFD
A0A2N2KUB8      IAEQAKVGNVRIIDFAERPTIPIKPRVSMNILVGIILGLGLGIGAAFIVHSLDTKLRTLE
A0A4R5JP48      IAEQAKIGNIRVIDYATRPDKPIKPNISMNLLVGILLGLGLGIATALIVHSMDTKLRTLE
A0A3C1LP64      IAEQAKVGNIRIVDLASRPVSPIKPRVSMNILVGVILGLGLGIGAAFLVHSLDNKLRTLE
A0A2N2KXM8      IAEQAKVGNIRIIEYADLPRVPIKPRVSMNILVGIILGLGLGIGAAFLIHSLDNKLRTLD
A0A2N2LDB7      VAEQAKVGNIRIVEYAEKPVSPIKPRVSMNIMVGIILGLGLGIGVAFIVHSLDTKLRTLE
A0A3D3EZ13      IAEQAKVGNIRIIDYATRPQIPIKPKVPMNILVGIILGLGLGVGAAFLVHSLDTKLRTLE
B0VJW4          IAEQAKIGNIRIIDYAERPTVPIKPRVSMNILVGVIIGLGLGIGTAFLVHSLDTKLRTLE
A0A496ZR22      ISEQGKIGNIRILETAYLPVSPTKPKPKMNLMISIVLGLGLGIGSALILSSMDTTLRSLN
A0A661UPD3      IAEKSKLGKIRIVEEARIPDVPIKPNKKMNMMIAIVLGLGLGIGAALLVHSLDSKIRTFD
                ::  .::                                            ::..:   .

A0A523T245      DVEKTLKMPLLASIPSIRSNGKKDEI-----------------------SVLQNKLITHQ
A0A523T055      DIQEFIGEPTLGIIPNINHRE--------LISRYGDNGKVADIRQL---------LLTHY
A0A1W9P0R7      EVEEYIGEPTLGIIPNINHT---------FLSKEKNNGKLGNAKKL---------LLTEF
A0A523R6B6      DIEEHIGEPTLGIIPYVNHKE--------FTEKYSDNGKIADSRRL---------LLTHY
A0A2G6BVY8      DIERF-KINFLGAVPTINIKDMKKKMRKKMDDLTDSEK-----------TKINSKLISHF
A0A1V4R675      DVERYVKLPILGTIPDIPLDEKQLADIEDRM--GKEKDKERLQELTTTQRQMVARLVPHY
A0A3D5VBP3      DVRNYVSLPILGTIPFIRVHDSDIDYLEKQIKNATGEGKEELKHIK---QQVESRLITNY
A0A2N2KUB8      DMETYVRLPIVGTIPLIRESESKLQEFNYMIEAAEGENREQLTRSM---HFVLMQLVSHY
A0A4R5JP48      DIESYVRLPILGTIPLIQESESRIMEFNRMIEQSEGENKEQLSKSL---HYVMMQLVSHY
A0A3C1LP64      DMETYVRLPIVGTIPVIQESEARMEEFNAMIEKAEGENKEQLSKSM---HYVMMQLVSHY
A0A2N2KXM8      DMETFVKLPIVGTIPVIQESEARIEEFNELIENAEGENKERLMKSM---HFVLMQLISHY
A0A2N2LDB7      DMETFVRLPIVGTIPMIAESESKLEEFNRMIEQSDGEHKEQLLKSM---HYVMMQLVSHY
A0A3D3EZ13      DMESYVRLPIVGTIPVIREAESKLAEFNDMIEKSEGEARAQLAKSM---HFVMQQLVSHY
B0VJW4          DMENYVRLPIAGTIPVIHEAESKLQEFNDMINSATGENREQLTRSM---HFVMMQLVSHY
A0A496ZR22      DIERYVKLPVVGTIPDIPVDEVALSQLSE--ELRNERDKEKLKQLTQTQQRIVARLVPHY
A0A661UPD3      DVRKYVSLPVLGTIPLIQTDDIELDNIEQKIEITEGPEREKYKIIL---QQIQEKLITNY
                ::         . :* :                                      *:.  

A0A523T245      KPRSHISESYRSLRTNLQFAS--VDGGIKTVVVTSPAPREGKTLTASNLAIAQAQAGRKT
A0A523T055      APHSTISEAYRSLRTNLQYFN--HDKPLKNLLVTSTIAKEGKSTIVSNLGITMSQRGLKT
A0A1W9P0R7      PPRSGVAEAYRSLRTNLQYFN--TDKPIKSILITSSIAQEGKSTIVSNLAISLSQLGLKT
A0A523R6B6      APRSNVSEAYRSLRTNLQYFN--HDTPLKSLLITSTIAKEGKSTIAANLGITLSQRGLKT
A0A2G6BVY8      SPKSPISEAYRTIRTNIYFSS--VDSPPSVIVVSSSVPKEGKSTTSSNLAVTIAQSGKKV
A0A1V4R675      SPKSPIAEAYRTFRTNVVSLPFKVPGLGKIFLVTSSGPKEGKSTSAGNLAITLSQMRSKT
A0A3D5VBP3      APKSSTSESFRMLRTNIVAKK--KKGQPLSLLVTSSGPKEGKSTIISNLAVALSQMDKKV
A0A2N2KUB8      APKSPIAEAYRTLRTNILARK--AEG-STTLLITSSGPKEGKSTTIANLSITLAQMNNKV
A0A4R5JP48      APKSPISEAYRTLRTNILSKK--TEG-STSMLITSAGPKEGKSTTISNLAITFSQMNAKV
A0A3C1LP64      APKSPVAESYRTLRTNILSRR-NTTG-STSMLITSSGPKEGKSTTIVNTAITLAQMNAKV
A0A2N2KXM8      APKSPIAESYRTLRTNILAKK--PEG-STTLLVTSSGPKEGKSTSIVNLAITFSQMNSKV
A0A2N2LDB7      APKSPIAEAYRTLRTNILSKK--SEG-SVCLMVTSSGPKEGKSTTIVNLAITLSQMNAKV
A0A3D3EZ13      APKSPIAEAYRTLRTNILSRK--AEG-SVTLLVTSSGPKEGKSTSIANLAITLAQMNARV
B0VJW4          APKSPIAEAYRTLRTNILAHK--GES-SIAILITSSGPKEGKSTSIANLAITFAQMNSKV
A0A496ZR22      APKSPIAEAYRTFRTNVLSAY-RNPGPIKTLAISSAGPKEGKSTTVANLAITIAQMDSKT
A0A661UPD3      SPKSSTAEAFRILRTNIISRK-KNSD-CTTLLITSSGPKEGKSTIQANMATALAQMDAKV
                 *.*  :*::* :***:             . ::*. ..***:    * . : :*   ..

A0A523T245      LLLDTDLRRPMIHRLFNLKKEDGISK-VLTGELKLDDAIKKTDIENLSVITSGPIPPNPS
A0A523T055      VLIDADLRKPVLHKFFQLKIEPGLTDLIIKSEMTLDKVIRKTNIENLFVITSGGIPPNPT
A0A1W9P0R7      VMVDADLRKPMLHKLFEADLSPGLTNLIISKDVEFKKTIKNTRIENLFLITAGSVPPNPA
A0A523R6B6      IIIDADLRKPVLHKLFNVNIKPGLTDLIINPDMNTKDIIRKTSIENLFLITAGDIPPNPT
A0A2G6BVY8      VLIDADLRRPVVHKNFNILREIGVTDFLI-KNSSVRDISKMTDIENLSIITCGDIPPNPS
A0A1V4R675      ILVDCDMRRPMIHNLFIVSRENGLSKFLTTDNIDIHDIIKPSGMDNLDIITAGHVPPNPS
A0A3D5VBP3      ILVDLDLRRPMQHKIFNLEKNEGISDFLYDHDKELETFIKKTKIDNLDIITSGFIPPNPS
A0A2N2KUB8      VLIDMDMRRPTIHSKFALEKENGVSDYLIDPDVTLDQVVKSSGIMNLDIITSGFVPPNPS
A0A4R5JP48      ILVDMDMRRPMLHNKFALEKENGISDYLIDQDVPLKQIIKASGIPNLDIITSGFIPPNPS
A0A3C1LP64      ILVDMDMRRPMIHNKFGIEKENGLSDYLIDPDVSIEQVTKATGIPNLDVITSGFVPPNPA
A0A2N2KXM8      VLIDMDMRRPMVHNKFGIEKENGLSDYLIDADVKIEQVVKSSGIVNLDVITSGFVPPNPS
A0A2N2LDB7      VLIDMDMRRPMVHNKFGVEKENGSSDYLIDPELTIPQVAKATGIQNLDIITSGFVPPNPS
A0A3D3EZ13      VLVDMDMRRPTVHTRFNLDKENGSSDYLIESDLRVEQIVKESGIPNLDIITSGFVPPNPS
B0VJW4          ILVDMDLRRPTVHSKLGLEKENGTSDFLIDPEVSVEQVIKPSGIANLDVITSGFIPPNPS
A0A496ZR22      LLIDADLRRPMIHNLFYKDKEPGLTNYFIDENCQLSDIIRQTEIKNLDIITCGHVPPNPS
A0A661UPD3      ILVDLDLRRPMVHTIMGFDKEIGISDFLMDKSTKIEKVIKKSNVENLDIITSGIIPPNPS
                :::* *:*.*  *  :    . * :. .   .       . : : ** :**.* :****:

A0A523T245      ELLASRKMKDVLKELRGKFDKIVMDSPPLIAVTDPIVLGKEVDGMVFVVRSGKTVREIAE
A0A523T055      DLLESKKMEAIVIELRKSFDFIIFDSPPIMIVADAVVLSRNIDGVLLIVEAKKTRRDAIR
A0A1W9P0R7      ELLESKRMKEVSYEITKEFDYLIFDAPPIVLVADAVILSTLVDGVILIIEAKKTRRDAIF
A0A523R6B6      DLLESKRMKGILYTIQKNFDFVLLDSPPIMVVTDAVVISRIIDGVLLVVEAKKTKRNAVY
A0A2G6BVY8      ELIASAKMDKFIEELKKEYDVIIFDTPPVITVTDAVVLSRKTDGIVLVVSSGTVGKEEVR
A0A1V4R675      ELLSSKKMDELFAKLREEYDYIIVDSPPIIAVTDALILSKKVDELVLVIRVNSTEREIIE
A0A3D5VBP3      ELLASSHMDEVLDILKQKYDYILLDTPPTMAVTDSIILAKKVDFRALVVRINQADKIVIK
A0A2N2KUB8      ELIASPRSDVLIEELKKRYDYILFDTPPIIAVTDALILTKKVDMTFVVVRCGFTEKGIIK
A0A4R5JP48      ELISSPRMDKIIEELKSQYDYILFDTPPIIAVTDALILTKKVDLTFLVVRCGTTEKGIVK
A0A3C1LP64      ELISSARTDILLEELKAHYDFVLFDTPPIIAVTDALILTKKVDLTFLVVRCGFTEKGIIK
A0A2N2KXM8      ELISSARTDMLIAELKERYDFILFDTPPIIAVTDALILTKKVDMTFVVVRCGQTEKGIIK
A0A2N2LDB7      ELISSKRMDQMIVELKSIYDYVLFDTPPIIAVTDALILTKKVDMTFVVVRCGYTEKGIIK
A0A3D3EZ13      ELIASNRFDKMIKELKSLYDYILFDTPPVIAVTDALILTKKVDMTFVVVRCGFTDKGIIK
B0VJW4          ELIASPRTDNLLEELKSRYDYVLVDSPPLIAVTDALILTKKVDMTYLVVRCGFTDKGIIK
A0A496ZR22      ELIASKKMDQLINKVKETYEYILFDSPPIIAVTDAMILSKKVDALSLVIRAGVTDRSIVE
A0A661UPD3      ELLASKRMDEAIESLKEKYDYILFDSPPVIAVTDSMVMANKVDLLILAIRVDQADKNVVK
                :*: * . .     :   :: ::.*:** : *:*.:::    *   . :    . .    

A0A523T245      KSLDNAKFAKIKLLGCVLNDVDVRHIYGSYN-----YYYYYYYYSEDEGKKGKKRHRKRA
A0A523T055      EAKTVIEHVGGRVLGAVLNKARFSRLDHLYG-SYSGYYYYYGYEKEGKSRKTRKSKKGGT
A0A1W9P0R7      SSKEIIKNVGGKILGTVLNKTRFSRMDYMYG-G-YSGYYYYGYDESGHKTK-KKKQKGGK
A0A523R6B6      DVKEVIENVGGKILGAVINKIRFSRIDHLYG-GYYSAYHYYDYGREERTKK-QKIKKGGI
A0A2G6BVY8      RSQDLLRSVDANIIGVILNNLDIKKLYGNYY-YYYHYYQYYYYYGADKKKKRRGRA----
A0A1V4R675      QAKSLLHNIDVKVAGVVVNGIEVKKYYSGYK-YYYYYYYYYYTDDEKGAKKKKRKTQGHS
A0A3D5VBP3      RIKEILDNVDSDFTGAIINGIHPQKYYS----SYEYNYYYYYYYGKEDEKKDGALPKKSS
A0A2N2KUB8      RTKELMENIDGKIDGIIVNSIYVQKYYSKQN-YYYYYYYYYYYYGDEVPKK-QK--KNVN
A0A4R5JP48      RARDMMENVNATIDGIIVNGVYVQKYYSKSN-YYYYYYYYYYYYGEQQPKK-QK--KANL
A0A3C1LP64      RTKELMANIDATIDGIIVNGIYAQKYYSRQNYYYYYYYYYYYYYGDEAPNKLKK--KHAG
A0A2N2KXM8      RTKELMENIDAKIDGIIVNGIFVHKYYSKQN-YYYYYYYYYYYYGDEAPRK-QK--KDVR
A0A2N2LDB7      RTKELMENIDSKIDGIVVNSIYVQRYYSKQSYYYYYYYYYYYYYGDDVPKK-QM--KNVN
A0A3D3EZ13      RTKELMENIDARIDGIIVNGIYVQKYYNKQN-YYYYYYYYYYYYGDEVPKK-QR--KNVN
B0VJW4          RTKELMNNIEGRLDGIIVNGIYVQKYYSKQN-YYYYYYYYYYYYGEEVPQK-QK--RNVN
A0A496ZR22      RAKSLLEHIGITVNGVVINGIDVHKYYSGYSYYYYYYYYYYYYYGGEKKKERKGLAKLVP
A0A661UPD3      RTKELLENIKVDIAGVVINGIQPHRYYNSYD----YNYYYYYYYGKSEEKKSKN------
                            . * ::*     .            * **         :         

A0A523T245      ----------
A0A523T055      A---------
A0A1W9P0R7      RNEL------
A0A523R6B6      K---------
A0A2G6BVY8      ----------
A0A1V4R675      RLSRKA----
A0A3D5VBP3      ----------
A0A2N2KUB8      RFLRKNKSVS
A0A4R5JP48      SFIRKNKSIP
A0A3C1LP64      RFLRKDKPVA
A0A2N2KXM8      RFLRKNKSVS
A0A2N2LDB7      KFLRKNQPVS
A0A3D3EZ13      RFLRKNKSIS
B0VJW4          RFLRKNKSIS
A0A496ZR22      KFLRKDQFVS
A0A661UPD3      KFFGKNKPLS
                          

© 1998-2020Legal notice