BYKdb

Dataset for cluster tadcd of phylum candidatus-cloacimonetes

[Download (right click)] [Edit] [Sequences] [Repertoires]

17 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A523T245      --------------MNEEKIDIRAYVAIVLRRKWIVLTLFLVTFLSTLYFTLRKPPVYES
A0A523T055      MNQNNY-----TKEEKDTHIDILAYLKVLWRRKLVISTAIGATLIFTIIYTLLSPQIYEA
A0A1W9P0R7      MKTNRTKEAILTKEDKDSHLDIIAYLKVLWRRKIVMTTAVGATLFFTLIYTFISPKIYEA
A0A523R6B6      MKHKKI-------EEKDTNIDIIAYLKVLWRRRLVIGTSIGATLIFTIIYTLNSPKIYEA
A0A2G6BVY8      -------MFEDDNNQENYSFPWKEYFSIIYRGRWWILLTFITISSLSTYYTLRMTPVFQA
A0A1V4R675      ---------MEQFPEQEQEIKLRDYYRIILRHIKLIGIIFVLVMVATIYYTARAPRIYES
A0A3D5VBP3      ------MQDQFYEQTEEQEIKLTDYLHIISRYKWLIIAIFVLVVAATVIYTFHSPKIYSA
A0A2N2KUB8      ------MDNQTNTAPVQDEINLSDYLRIVLQYRYLIVLVFSLVVVSTVFYTARQDKIYSA
A0A4R5JP48      ---MEQQPMQNPQTPQVEEINLKEYLRIIYQFRYLVVIIFVVVIIGTILYTYQQPRIYSA
A0A3C1LP64      ------MEQQNIPNPASDEINISDYFRIILQYRYLVILVFILVLIGTIIYTARQPRVYSA
A0A7C7ARK5      ------MEQQNIPNPASDEINISDYFRIILQYRYLVILVFILVLIGTIIYTARQPRVYSA
A0A2N2KXM8      ----MENQHINP--VVQEEIKLSDYLRIIVQYRYLVVLIFTLVLAATVIYTARQPKVYST
A0A2N2LDB7      ----MENQVQNQSNVSQDEIKLSDYIRVIVQYRYLIVLVFVLVITLTIFYTARSPRIYSA
A0A3D3EZ13      ----MENQYQNQQ-PLQDEIKLSDYVRIVLQYRYLIVLVFILVMAATIIYTARQDKIYSA
B0VJW4          ----MLENENNQL-PVQEEIKLSDYFRIILQYRYLVILVFLVALVATVYYTARLPKIYSA
A0A496ZR22      --MENFDQT------ETSELQFKEYIRIIIQRKWLVLSIFTIIVLVTMVFTMRQPKIYVT
A0A661UPD3      -MKDQFNQVKFNEDFEEQEIKLTDYLNIIIRFKWIVASIFLAIFVVSFIYTARAPRIYKA
                                   :    *  :: .    :   .      :  :*     :: :

A0A523T245      KATVIIKQLPTA-----IPGMDFGYSKANYITNHTLILKSRTLMGKVAENFT-SEEMESA
A0A523T055      TTSILIQQAPEG-KDSFLSPWEYTGERDNFIQNQSHILKSRTNLKLVVDKIKEQHSDKDL
A0A1W9P0R7      QTSILIQQIPEG-KDTFLTPWEYIGARENFINNQAQILKSRTNLKLVIDKIRKEHSGENL
A0A523R6B6      STKVFIQQAPEG--NTFLSPWGYTGARDNYIKNQTHILKSRINLRLVVDKIKEEHGNEDL
A0A2G6BVY8      ETTIEIKDKDNMFSDMSS--PFNLKRSDRVIANNSELIKSRTVAKMVMDEVDKSEFAEHI
A0A1V4R675      NGKILLELNKQT-D--LF--FSTGGFGRNDLNNQMEVIKSPSVMESAVEKLKRNQEAENF
A0A3D5VBP3      SSTIMLEEKSSE-N--LL--FSSMANKATSINNYIEILKSRPVLEAAYSIIQNSEIYPEI
A0A2N2KUB8      SARILLEDQKGS-TDLMF--LATPGVGKNSLNNQIELIRSKPIMSLAWDIMKKYPDWDTF
A0A4R5JP48      TSKILMENKSTG-ADILM--LTGQGSGKNYINNQIQLIKSKPLLSAAWEIMKKNPEWEAY
A0A3C1LP64      SNRILLETQKSG-AD-LF--LAGTGTGKNELNNQIELIKSKPILNAAWEIMKKYPDWESF
A0A7C7ARK5      SNRILLETQKSG-AD-LF--LAGTGTGKNELNNQIELIKSKPILNAAWEIMKKYPDWESF
A0A2N2KXM8      SSRVLIENQKNT-SDLML--FATPGVGTNALNNQIEMMKSLPLGNRAAEIMKKHRDWESF
A0A2N2LDB7      SSKILLENQKSQ-SDFLF--LATPGVTSTTINNNIELMKSKTIGTMAWEIMKRNPDWDTF
A0A3D3EZ13      SSRIMLEDQNQG-AEFLF--MGAPGMGKNSINNQIEIIKSRPTLTLAWEIMKKYPDWDLF
B0VJW4          STRILLEDANKQ-SDLMF--LSTGGLGKNTLNNQIELIHSKPIMNLAWEIMKKYPDWDTF
A0A496ZR22      SAKVLIEQQKKG-E--FF--FQPAGYGDKSLKNQIILLKSIPIMNSAIEKMKAHPESETF
A0A661UPD3      TSKVLLEEKMGS-N--LF--FTSMSNKASSINNQIQILQSFPVMKIANQILTRHKEYESF
                   : ::                       : *   ::.*      . . .         

A0A523T245      GISKLSS-------IVGIVSSAITINPVKGSDIIEIKSKTDKPYSAALFANKVAETYIHY
A0A523T055      PIFKNPS-------PIVFLAYNIIVKPVERTDIIRILVHSTSPQEAAIIANAVADNLLEQ
A0A1W9P0R7      PILKDPD-------PITSLAYNIIVKPVERTDIVNILVHSTDPKEAAIIANTVAENLLEQ
A0A523R6B6      PIFKNPN-------PVTFLIYNIIIKPVERTDIVNILVHSTNPQEAAVIANVMAENLLEQ
A0A2G6BVY8      SVSKEVRKDLNENSRIQMLRRKLSIKPIKNTDILRLIITSSSPFEVSFLANTYAEQFELY
A0A1V4R675      PILSLDN-------PSSILAKNIDVSAEREVDIIDISFKSTNPNEAQAAVNAVMDSYQDE
A0A3D5VBP3      PLNPANHEEPDKFSPIGAIKEKLAVESQRETDIIKISYESTHPGEAKLVANALALGLQNK
A0A2N2KUB8      PANTSGN-------PIISL-SRMKVESKRETDILTISFESTNQTEAMAAVNSISEAIQQQ
A0A4R5JP48      PISSTEN-------PIDHL-GEVKIEALRETDVLNLSFESTNPGEAMATVNAIADAVVQQ
A0A3C1LP64      PAASTPN-------PAAQL-ASVKVESKRETDILTISYESTSQGEAMAAVNSIAEAVQQE
A0A7C7ARK5      PAASTPN-------PASQL-ASVKVESKRETDILTISYESTSQGEAMAAVNSIAEAVQQE
A0A2N2KXM8      PISQSAS-------PGAFIKARMKVESKRETDILTISYESTSQSEAQAAVNAVAEAIQQE
A0A2N2LDB7      PINSSGS-------PVNTLRSSVKIESKRETDILTISYESTNQVEAMVAVNSLAEAVMLE
A0A3D3EZ13      PIASHEN-------PAGAL-GKVKVESKRETDLLTISIESTSPTEAQAAVNAIAEAIQQQ
B0VJW4          PASQAAD-------PASTL-GRMKVESKRETDVLTISFESTNPTEAMAAVNSIAEAIQQQ
A0A496ZR22      PILKSEN-------PAMSLKGRVDVSSERDTDVLTISISSTNPLEAQVAANSVAESFKEK
A0A661UPD3      PISQTEG------LPESYLKRNLEIDTERETDILIINFESTSSLEAKEAANAAAHALMQQ
                                  :   : :..    *:: :   :    ..   .*         

A0A523T245      NIEDKRREVKGVREFAEEQMELVEEQLKKAEDDICNYQKTHKVFGLKKETEAFIEQIAEL
A0A523T055      SRLTARSAVSEVRRFLEEQLKIVEDNLKKSADSLRIFKEKKQVFSLSNEGQALFAKLSTF
A0A1W9P0R7      SRLTARSAVSEVRKFLEKQLKIVQNNLKESADSLRVFKEKNRVFSLSNEGEELFTKLSTF
A0A523R6B6      ARITARSAVSEVRKFLEEQLKIVENNLKQSADSLLIFKEKNRVFSLSTEAQALSSKLSSF
A0A2G6BVY8      SKLSNLGEVGAVTNFLKDQLDVIKKRLKLSEEALELYQKEGGIVVLEAETQLLIENSAKS
A0A1V4R675      SLKYTRAEVTSVREFLEKQLDVTSKKLAISEEDLRAYKIAHEVFALTEETKEMITNMVEF
A0A3D5VBP3      DNEYARIEFKNVREFLENRLDETERRLRNSEEDLRSYKIDKGISMLSEETTQIIEQSAEL
A0A2N2KUB8      NTQYARLEFTTIREFLETQLDAISRRLQSSENDLREFKNLNKLTQLSAETAQLIIQSSEL
A0A4R5JP48      NTQIARLEYTTVREFLGEQLDLISRRLQASEEDLRAFKNENKIVELTETTKKWIEQSADV
A0A3C1LP64      NTQFARLEYTTIREFLETQLDAISRRLQSSENDLREFKNMNKLTELSAETTQLIEESAKI
A0A7C7ARK5      NTQFARLEYTTIREFLETQLDAISRRLQSSENDLREFKNMNKLTELSAETTQLIEESAKI
A0A2N2KXM8      NTLYARLEYTTVREFLEDQLDAISRRLQSSENDLREFKNANQLVELSAETQKLIEQSAEV
A0A2N2LDB7      NTQYARLEFTNIREFLETQLDAITRRLQTSENDLREFKNMNRLVELTEETTKLIEKSSDV
A0A3D3EZ13      NTQFARLEYTTIREFLETQLDAISRRLQASENDLREFKNLNRLTELTAETTKLIEQSSEL
B0VJW4          NTQYARLEFTTIREFLETQLDAISRRLQSSENDLREFKNLNKLTQLSEETNKLIEQASDL
A0A496ZR22      NLEYARTEVAAVREFLEKQLDIIKRKLAISEEDLREFKIQNRISTLSAETAELVRTSSSF
A0A661UPD3      DTDYARREFRNAREFLANQLDEHDRRLRSAEEELRLYKIEHGVSMLSEETQKLIEQTSDL
                              *   .:.    .*  : : :  ::    :  *              

A0A523T245      QTLYEKARIERKGVEKNLEAVKSQLTIEQKEFLETSTDISLPLLKDLKISL--STLEKEK
A0A523T055      DKQYNEVNTEFLTKKKRLDFLKDKYRQNKNDLLRDITETKSPIIISLREKL--IKRETEY
A0A1W9P0R7      DSKYNEIEADYITKKKQLDFLKKKYEQNQKNLVTDITEIKSPLIMNLRKKL--ISLETEY
A0A523R6B6      DNQYNQANTDYLTKKKKLDFLKNKYQQNQKNMVEDITETQNPLIMNLREKL--IKFETEY
A0A2G6BVY8      EAKLNEIELNYQSANQKILFLKKELDEKSKRIVEDISRNATPEIEKLKIKVGELNAKKLN
A0A1V4R675      EAQLSSAQTELQIVEKKLAYLKDELIKIDEALGEEMASISSPVSEQLRQKL--IENESQL
A0A3D5VBP3      ELLLSEAETEYAVAKNRLDFLTSELSDQDKLLSDVNSIITTPLLEQLRREI--VTNQSKY
A0A2N2KUB8      EALYESSLTDQAIKAKSLDMLNRQLREQDSLLVDVNNILKAPYISELRKQI--VDTQSLV
A0A4R5JP48      ESQYESALTDQAVKARTLEVLKRQLKDQDSLMVEVDNVLRAPYIEQLRKDI--TNTQATI
A0A3C1LP64      EAEYEAALTDQAVKARTLELFQKQLQQQDSLVVNVSTVLKTPYINELRKQV--IETQSLI
A0A7C7ARK5      EAEYEAALTDQAVKARTLELFQKQLQQQDSLVVNVSTVLKTPYINELRKQV--IETQSLI
A0A2N2KXM8      EAQYEQALTDQAVKAKTVEMLQRQLSEQDSLIVNVENILNAPYVNELRRQV--IDTQALI
A0A2N2LDB7      EAEYESALTDQAVKAKSLDLLNKQLREQDSLMVNVNNILKAPYVAELRKQV--VDTQSLI
A0A3D3EZ13      EAELEASLTDMAVKAKSLDLLTKQLRDQDSLLVDIDNMIKTPYITELRKQV--VETQALI
B0VJW4          EAEYEAALTDQAVKAKSLDLLNRQLQEQDSLLVNVDNIIKTPYINELRKQI--VDTQSLI
A0A496ZR22      EAQLNDANTELQVAEKKLKFLQSILAQQDSALANEVMAISSPLIEELRKKL--VENEAKY
A0A661UPD3      TAMLSEAETELDVANNHLDFLKVELNVQDDFLTDVNSVLSSPLLEQLKRET--IELQIQY
                    .    :     . :  .       .. .         *   .*. .      :   

A0A523T245      ASLIIQ-AYDEKDPKIREINSKIGAIKSKMNETIVSVLENRG-QIDALTQVQELLLQSIS
A0A523T055      SNYLLQ-GLDDEHPRIKKIKTLIEDTKQRLQSEVKKLIASDAEKGDLLAMNQKIMEELSE
A0A1W9P0R7      SNYLLQ-GLPENHPKMEKIKSLINETKRSLQKEVRKYISSGAENGNLITENQKIT-----
A0A523R6B6      SNYLLQ-GLTAEHSKMQKIKSRIEDTKTQLRKEVTKLITSDSEKGNLLARNQKIAEEIAS
A0A2G6BVY8      IELEKSAGY---KRILKNLQKQIDNLEAKITEKAKYFANSAQASANPVEDKSDIMRKILE
A0A1V4R675      AILLTKKGYTENHPQLVSLRTEIDNIKRQMKSEIAKILEVNKYSFNPLDRRQQLFTDIIS
A0A3D5VBP3      LNLLSKPSYSPDHPELVALKNQIDNAKRQLNEEIQKTTNVKAGTADPLVYRADLISSISK
A0A2N2KUB8      TKLVTKNEYPLDHPQILLLKREMENAKATLDLEVRKLVALSV-NNDPLTTRSELLGKIIQ
A0A4R5JP48      AKLRTNENYSSDHPQIKLLQEELSKTKATLDAEIKKYISKNL-NYDPLSFRNQILTKIVQ
A0A3C1LP64      TKLLTKNNYPTDHPQIIALNAELERTKDELDIEIKKLVATSS-TDDPLAMRNETLVKIIQ
A0A7C7ARK5      TKLLTKNNYPTDHPQIIALNAELERTKDELDIEIKKLVATSS-TDDPLAMRNDTLVKIIQ
A0A2N2KXM8      TNLVTKNEYPLDHPQIALLNAELDRSKANLDLEVRKMVAIQM-QSDPVATRSDLLNRIVQ
A0A2N2LDB7      NKLLSKNEYPLDHPQIMLLNRELENIKATLDTEVRKLVKISL-NSDPLQSRSDLLSRIVA
A0A3D3EZ13      TKLLTKNEYPLDHPQILLLNRELENTRANLDREIRKLVSVSV-SADPLSTRSDLVNRLIQ
B0VJW4          TKLVTKNEYPLDHPQIQLLYREIENAKEKLDQEIRKLVNLAV-TDDPLATRSDLLTRIVQ
A0A496ZR22      AIYLTKEGYSSEHPELRKLKEEIEREREQLKLEIDKVLQLKTDASDPLARRGEIIGEITN
A0A661UPD3      VNFLTKSDYSPDHPELIALKNSIESAKIKLNEEIQKILLVKSGSADPLMFRSSLIEKIST
                     .         :  :   :      :               : :    .       

A0A523T245      LQISIEVAKAKELAYRGVLGVYEGKFSSIPSEQIELARMERQRKANEKIYMMLLEKAEEA
A0A523T055      LEVEIVVLETKKTVIGKIRSSYESQFSTLPSKELRLAQLERAYKINDNIYEMLMEKYEEA
A0A1W9P0R7      ----------------------------------KLAQLERAYKINDNTYEMLMQKYEEA
A0A523R6B6      LEVEIVAIEARKSAVGKIRSSYENQFLKLPSKELKLAQLERAYKINDNIYEMLMEKYEET
A0A2G6BVY8      AQAEQIGLKAQAKKVQETINNYNKKIAMLPETATEFARLKRKYEIDEKTYIMMENKYNEY
A0A1V4R675      TEVEFQTATAKVSGLETVVEEYSVRMSGLPDAELELARLERSKAINEQIYSMLITRYEEA
A0A3D5VBP3      ARVEKNIAESKVENLRKSVEQYNRQLSLLPDAEIELARLERNNRINEKTYTMLNEKFEEA
A0A2N2KUB8      ANLELEMARAKVDGLEQTKEMYDQRIIAIPNTELELARLTRNMLLDEKIHGMMMEKYEDA
A0A4R5JP48      AEVDLEMARTQVHGLEQTKAIFEDRIITLPDKELQLARLTRSMALDEKIYGIMMEKYEDA
A0A3C1LP64      TNVELEIARTKADGLAQTKEMYDERIISLPNTELELARLMRNVQLDGKIHGIMMEKYEDA
A0A7C7ARK5      TNVELEIARTKADGLAQTKEMYDERIISLPNTELELARLMRNVQLDGKIHGIMMEKYEDA
A0A2N2KXM8      ARIELEMARSSVSGLEETKEMYAQRMITLPNTELELARLRRNLLLDEKIHGMMMEKYEDA
A0A2N2LDB7      ANLELELTRAKVNGLSQTKEMYNERIVTLPNTELELARLVRNMKLDEKIYGIMMEKYEDA
A0A3D3EZ13      ANVDLELARTRVDGLGQTKEMYEQRIISLPNTELELARLSRNMMLDSKIHGIMMEKYEDA
B0VJW4          ANIELEMARAKVDGLEQTKEMYNQRLIAIPNTELELARLTRNLMLDEKIHSMMMEKYEDA
A0A496ZR22      AQVELNVAQTKVSAIESIVAKYTQKMTSLPDTELELARLERDKQMNENIHTLLVEKYEEA
A0A661UPD3      AQIEQNIKSTKVISLRAAVEKYNEKMSQLPDTEVQLARLERNYQINEKTYTMLIEKYEEA
                                                   :*.: *    : : : ::  . :: 

A0A523T245      KISEASEIGTVSMLDRALLPKKEIRKQKITNIMLGFIMGLIISIGVAFVIEYFDTSIKSI
A0A523T055      KITEAGQLGNVKIIDTAFIPSTPIRPNKKKNILFALLVGIGIGLVFTVFTEYLDTSIKEP
A0A1W9P0R7      KITEAGQLGSVKIIDKAFIPTFAIKPNKKKNLLFAILVGIGIGLVFTVFTEYIDTSIKEP
A0A523R6B6      KITEAGQLGNVKIIDKAYAPSFHIRPNKKKNILFALLVGIGIGLVFTVFSEYLDTSIKEP
A0A2G6BVY8      KIALAGQVGNARIVDKAITPKSPIRPDKPLYITIGLGVGLGLGVFISFLLAFFDNSIKTI
A0A1V4R675      KISEEGKL--------------------------------------------LNTKITNL
A0A3D5VBP3      RIAEKSKMGKIRIVEEAQLPEAPIKPNKKMNLLIAIVLGLGGGIGSSFLLHSLDSKIRTF
A0A2N2KUB8      KIAEQAKVGNVRIIDFAERPTIPIKPRVSMNILVGIILGLGLGIGAAFIVHSLDTKLRTL
A0A4R5JP48      RIAEQAKIGNIRVIDYATRPDKPIKPNISMNLLVGILLGLGLGIATALIVHSMDTKLRTL
A0A3C1LP64      KIAEQAKVGNIRIVDLASRPVSPIKPRVSMNILVGVILGLGLGIGAAFLVHSLDNKLRTL
A0A7C7ARK5      KIAEQAKVGNIRIVDLASRPVSPIKPRVSMNILVGVILGLGLGIGAAFLVHSLDNKLRTL
A0A2N2KXM8      KIAEQAKVGNIRIIEYADLPRVPIKPRVSMNILVGIILGLGLGIGAAFLIHSLDNKLRTL
A0A2N2LDB7      KVAEQAKVGNIRIVEYAEKPVSPIKPRVSMNIMVGIILGLGLGIGVAFIVHSLDTKLRTL
A0A3D3EZ13      KIAEQAKVGNIRIIDYATRPQIPIKPKVPMNILVGIILGLGLGVGAAFLVHSLDTKLRTL
B0VJW4          KIAEQAKIGNIRIIDYAERPTVPIKPRVSMNILVGVIIGLGLGIGTAFLVHSLDTKLRTL
A0A496ZR22      KISEQGKIGNIRILETAYLPVSPTKPKPKMNLMISIVLGLGLGIGSALILSSMDTTLRSL
A0A661UPD3      KIAEKSKLGKIRIVEEARIPDVPIKPNKKMNMMIAIVLGLGLGIGAALLVHSLDSKIRTF
                .::  .::                                            ::..:   

A0A523T245      EDVEKTLKMPLLASIPSIRSNGKKDEI-----------------------SVLQNKLITH
A0A523T055      KDIQEFIGEPTLGIIPNINHRE--------LISRYGDNGKVADIRQL---------LLTH
A0A1W9P0R7      KEVEEYIGEPTLGIIPNINHT---------FLSKEKNNGKLGNAKKL---------LLTE
A0A523R6B6      KDIEEHIGEPTLGIIPYVNHKE--------FTEKYSDNGKIADSRRL---------LLTH
A0A2G6BVY8      EDIERF-KINFLGAVPTINIKDMKKKMRKKMDDLTDSEK-----------TKINSKLISH
A0A1V4R675      SDVERYVKLPILGTIPDIPLDEKQLADIEDRM--GKEKDKERLQELTTTQRQMVARLVPH
A0A3D5VBP3      DDVRNYVSLPILGTIPFIRVHDSDIDYLEKQIKNATGEGKEELKHIK---QQVESRLITN
A0A2N2KUB8      EDMETYVRLPIVGTIPLIRESESKLQEFNYMIEAAEGENREQLTRSM---HFVLMQLVSH
A0A4R5JP48      EDIESYVRLPILGTIPLIQESESRIMEFNRMIEQSEGENKEQLSKSL---HYVMMQLVSH
A0A3C1LP64      EDMETYVRLPIVGTIPVIQESEARMEEFNAMIEKAEGENKEQLSKSM---HYVMMQLVSH
A0A7C7ARK5      EDMETYVRLPIVGTIPVIQESEARMEEFNAMIEKAEGENKEQLSKSM---HYVMMQLVSH
A0A2N2KXM8      DDMETFVKLPIVGTIPVIQESEARIEEFNELIENAEGENKERLMKSM---HFVLMQLISH
A0A2N2LDB7      EDMETFVRLPIVGTIPMIAESESKLEEFNRMIEQSDGEHKEQLLKSM---HYVMMQLVSH
A0A3D3EZ13      EDMESYVRLPIVGTIPVIREAESKLAEFNDMIEKSEGEARAQLAKSM---HFVMQQLVSH
B0VJW4          EDMENYVRLPIAGTIPVIHEAESKLQEFNDMINSATGENREQLTRSM---HFVMMQLVSH
A0A496ZR22      NDIERYVKLPVVGTIPDIPVDEVALSQLSE--ELRNERDKEKLKQLTQTQQRIVARLVPH
A0A661UPD3      DDVRKYVSLPVLGTIPLIQTDDIELDNIEQKIEITEGPEREKYKIIL---QQIQEKLITN
                .::         . :* :                                      *:. 

A0A523T245      QKPRSHISESYRSLRTNLQFAS--VDGGIKTVVVTSPAPREGKTLTASNLAIAQAQAGRK
A0A523T055      YAPHSTISEAYRSLRTNLQYFN--HDKPLKNLLVTSTIAKEGKSTIVSNLGITMSQRGLK
A0A1W9P0R7      FPPRSGVAEAYRSLRTNLQYFN--TDKPIKSILITSSIAQEGKSTIVSNLAISLSQLGLK
A0A523R6B6      YAPRSNVSEAYRSLRTNLQYFN--HDTPLKSLLITSTIAKEGKSTIAANLGITLSQRGLK
A0A2G6BVY8      FSPKSPISEAYRTIRTNIYFSS--VDSPPSVIVVSSSVPKEGKSTTSSNLAVTIAQSGKK
A0A1V4R675      YSPKSPIAEAYRTFRTNVVSLPFKVPGLGKIFLVTSSGPKEGKSTSAGNLAITLSQMRSK
A0A3D5VBP3      YAPKSSTSESFRMLRTNIVAKK--KKGQPLSLLVTSSGPKEGKSTIISNLAVALSQMDKK
A0A2N2KUB8      YAPKSPIAEAYRTLRTNILARK--AEG-STTLLITSSGPKEGKSTTIANLSITLAQMNNK
A0A4R5JP48      YAPKSPISEAYRTLRTNILSKK--TEG-STSMLITSAGPKEGKSTTISNLAITFSQMNAK
A0A3C1LP64      YAPKSPVAESYRTLRTNILSRR-NTTG-STSMLITSSGPKEGKSTTIVNTAITLAQMNAK
A0A7C7ARK5      YAPKSPVAESYRTLRTNILSRR-NTTG-STSMLITSSGPKEGKSTTIVNTAITLAQMNAK
A0A2N2KXM8      YAPKSPIAESYRTLRTNILAKK--PEG-STTLLVTSSGPKEGKSTSIVNLAITFSQMNSK
A0A2N2LDB7      YAPKSPIAEAYRTLRTNILSKK--SEG-SVCLMVTSSGPKEGKSTTIVNLAITLSQMNAK
A0A3D3EZ13      YAPKSPIAEAYRTLRTNILSRK--AEG-SVTLLVTSSGPKEGKSTSIANLAITLAQMNAR
B0VJW4          YAPKSPIAEAYRTLRTNILAHK--GES-SIAILITSSGPKEGKSTSIANLAITFAQMNSK
A0A496ZR22      YAPKSPIAEAYRTFRTNVLSAY-RNPGPIKTLAISSAGPKEGKSTTVANLAITIAQMDSK
A0A661UPD3      YSPKSSTAEAFRILRTNIISRK-KNSD-CTTLLITSSGPKEGKSTIQANMATALAQMDAK
                  *.*  :*::* :***:             . ::*. ..***:    * . : :*   .

A0A523T245      TLLLDTDLRRPMIHRLFNLKKEDGISKVLTG-ELKLDDAIKKTDIENLSVITSGPIPPNP
A0A523T055      TVLIDADLRKPVLHKFFQLKIEPGLTDLIIKSEMTLDKVIRKTNIENLFVITSGGIPPNP
A0A1W9P0R7      TVMVDADLRKPMLHKLFEADLSPGLTNLIISKDVEFKKTIKNTRIENLFLITAGSVPPNP
A0A523R6B6      TIIIDADLRKPVLHKLFNVNIKPGLTDLIINPDMNTKDIIRKTSIENLFLITAGDIPPNP
A0A2G6BVY8      VVLIDADLRRPVVHKNFNILREIGVTDFLIK-NSSVRDISKMTDIENLSIITCGDIPPNP
A0A1V4R675      TILVDCDMRRPMIHNLFIVSRENGLSKFLTTDNIDIHDIIKPSGMDNLDIITAGHVPPNP
A0A3D5VBP3      VILVDLDLRRPMQHKIFNLEKNEGISDFLYDHDKELETFIKKTKIDNLDIITSGFIPPNP
A0A2N2KUB8      VVLIDMDMRRPTIHSKFALEKENGVSDYLIDPDVTLDQVVKSSGIMNLDIITSGFVPPNP
A0A4R5JP48      VILVDMDMRRPMLHNKFALEKENGISDYLIDQDVPLKQIIKASGIPNLDIITSGFIPPNP
A0A3C1LP64      VILVDMDMRRPMIHNKFGIEKENGLSDYLIDPDVSIEQVTKATGIPNLDVITSGFVPPNP
A0A7C7ARK5      VILVDMDMRRPMIHNKFGIEKENGLSDYLIDPDVSIEQVTKATGIPNLDVITSGFVPPNP
A0A2N2KXM8      VVLIDMDMRRPMVHNKFGIEKENGLSDYLIDADVKIEQVVKSSGIVNLDVITSGFVPPNP
A0A2N2LDB7      VVLIDMDMRRPMVHNKFGVEKENGSSDYLIDPELTIPQVAKATGIQNLDIITSGFVPPNP
A0A3D3EZ13      VVLVDMDMRRPTVHTRFNLDKENGSSDYLIESDLRVEQIVKESGIPNLDIITSGFVPPNP
B0VJW4          VILVDMDLRRPTVHSKLGLEKENGTSDFLIDPEVSVEQVIKPSGIANLDVITSGFIPPNP
A0A496ZR22      TLLIDADLRRPMIHNLFYKDKEPGLTNYFIDENCQLSDIIRQTEIKNLDIITCGHVPPNP
A0A661UPD3      VILVDLDLRRPMVHTIMGFDKEIGISDFLMDKSTKIEKVIKKSNVENLDIITSGIIPPNP
                .:::* *:*.*  *  :    . * :. :   .       . : : ** :**.* :****

A0A523T245      SELLASRKMKDVLKELRGKFDKIVMDSPPLIAVTDPIVLGKEVDGMVFVVRSGKTVREIA
A0A523T055      TDLLESKKMEAIVIELRKSFDFIIFDSPPIMIVADAVVLSRNIDGVLLIVEAKKTRRDAI
A0A1W9P0R7      AELLESKRMKEVSYEITKEFDYLIFDAPPIVLVADAVILSTLVDGVILIIEAKKTRRDAI
A0A523R6B6      TDLLESKRMKGILYTIQKNFDFVLLDSPPIMVVTDAVVISRIIDGVLLVVEAKKTKRNAV
A0A2G6BVY8      SELIASAKMDKFIEELKKEYDVIIFDTPPVITVTDAVVLSRKTDGIVLVVSSGTVGKEEV
A0A1V4R675      SELLSSKKMDELFAKLREEYDYIIVDSPPIIAVTDALILSKKVDELVLVIRVNSTEREII
A0A3D5VBP3      SELLASSHMDEVLDILKQKYDYILLDTPPTMAVTDSIILAKKVDFRALVVRINQADKIVI
A0A2N2KUB8      SELIASPRSDVLIEELKKRYDYILFDTPPIIAVTDALILTKKVDMTFVVVRCGFTEKGII
A0A4R5JP48      SELISSPRMDKIIEELKSQYDYILFDTPPIIAVTDALILTKKVDLTFLVVRCGTTEKGIV
A0A3C1LP64      AELISSARTDILLEELKAHYDFVLFDTPPIIAVTDALILTKKVDLTFLVVRCGFTEKGII
A0A7C7ARK5      AELISSARTDILLEELKAHYDFVLFDTPPIIAVTDALILTKKVDLTFLVVRCGFTEKGII
A0A2N2KXM8      SELISSARTDMLIAELKERYDFILFDTPPIIAVTDALILTKKVDMTFVVVRCGQTEKGII
A0A2N2LDB7      SELISSKRMDQMIVELKSIYDYVLFDTPPIIAVTDALILTKKVDMTFVVVRCGYTEKGII
A0A3D3EZ13      SELIASNRFDKMIKELKSLYDYILFDTPPVIAVTDALILTKKVDMTFVVVRCGFTDKGII
B0VJW4          SELIASPRTDNLLEELKSRYDYVLVDSPPLIAVTDALILTKKVDMTYLVVRCGFTDKGII
A0A496ZR22      SELIASKKMDQLINKVKETYEYILFDSPPIIAVTDAMILSKKVDALSLVIRAGVTDRSIV
A0A661UPD3      SELLASKRMDEAIESLKEKYDYILFDSPPVIAVTDSMVMANKVDLLILAIRVDQADKNVV
                ::*: * . .     :   :: ::.*:** : *:*.:::    *   . :    . .   

A0A523T245      EKSLDNAKFAKIKLLGCVLNDVDVRHIYGSYN-----YYYYYYYYSEDEGKKGKKRHRKR
A0A523T055      REAKTVIEHVGGRVLGAVLNKAR----FSRLDHLYGSYSGYYYYYGYEKEGKSRKTRKSK
A0A1W9P0R7      FSSKEIIKNVGGKILGTVLNKTR----FSRMDYMYGG-YSGYYYYGYDESGHKTK-KKKQ
A0A523R6B6      YDVKEVIENVGGKILGAVINKIR----FSRIDHLYGGYYSAYHYYDYGREERTKK-QKIK
A0A2G6BVY8      RRSQDLLRSVDANIIGVILNNLDIKKLYGNYY-YYYHYYQYYYYYGADKKKKRRGRA---
A0A1V4R675      EQAKSLLHNIDVKVAGVVVNGIEVKKYYSGYK-YYYYYYYYYYTDDEKGAKKKKRKTQGH
A0A3D5VBP3      KRIKEILDNVDSDFTGAIINGIHPQKYYS----SYEYNYYYYYYYGKEDEKKDGALPKKS
A0A2N2KUB8      KRTKELMENIDGKIDGIIVNSIYVQKYYSKQN-YYYYYYYYYYYYGDEVPKK-QK--KNV
A0A4R5JP48      KRARDMMENVNATIDGIIVNGVYVQKYYSKSN-YYYYYYYYYYYYGEQQPKK-QK--KAN
A0A3C1LP64      KRTKELMANIDATIDGIIVNGIYAQKYYSRQNYYYYYYYYYYYYYGDEAPNKLKK--KHA
A0A7C7ARK5      KRTKELMANIDATIDGIIVNGIYAQKYYGRQN--YYYYYYYYYYYGDEAPNKLKK--KHA
A0A2N2KXM8      KRTKELMENIDAKIDGIIVNGIFVHKYYSKQN-YYYYYYYYYYYYGDEAPRK-QK--KDV
A0A2N2LDB7      KRTKELMENIDSKIDGIVVNSIYVQRYYSKQSYYYYYYYYYYYYYGDDVPKK-QM--KNV
A0A3D3EZ13      KRTKELMENIDARIDGIIVNGIYVQKYYNKQN-YYYYYYYYYYYYGDEVPKK-QR--KNV
B0VJW4          KRTKELMNNIEGRLDGIIVNGIYVQKYYSKQN-YYYYYYYYYYYYGEEVPQK-QK--RNV
A0A496ZR22      ERAKSLLEHIGITVNGVVINGIDVHKYYSGYSYYYYYYYYYYYYYGGEKKKERKGLAKLV
A0A661UPD3      KRTKELLENIKVDIAGVVINGIQPHRYYNSYD----YNYYYYYYYGKSEEKKSKN-----
                             . * ::*       :.            *:  .              

A0A523T245      A----------
A0A523T055      KGGTA------
A0A1W9P0R7      KGGKRNEL---
A0A523R6B6      KGGIK------
A0A2G6BVY8      -----------
A0A1V4R675      SRLSRKA----
A0A3D5VBP3      S----------
A0A2N2KUB8      NRFLRKNKSVS
A0A4R5JP48      LSFIRKNKSIP
A0A3C1LP64      GRFLRKDKPVA
A0A7C7ARK5      GRFLRKDKPVA
A0A2N2KXM8      RRFLRKNKSVS
A0A2N2LDB7      NKFLRKNQPVS
A0A3D3EZ13      NRFLRKNKSIS
B0VJW4          NRFLRKNKSIS
A0A496ZR22      PKFLRKDQFVS
A0A661UPD3      -KFFGKNKPLS
                           

© 1998-2021Legal notice