BYKdb

Dataset for cluster tadcd of phylum candidate-division-wor-3

[Download (right click)] [Edit] [Sequences] [Repertoires]

13 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A7C0XDY3      --------------MNSEEKGREVSLYDYINLIYRHRVLIIVVFVITTLGAWIFSLLSPP
A0A7C4TFL4      MVCNFDPRDIFVAVIYRSKMNKELTFQDYLYVIIKRRWLIIICILLGTFGAFLASLRLPK
A0A7C6EHP6      MVGAFEYWHIDFTNFNLRKMNKEPTFQDYIDIIYKRRLLIIICVIVASFSALLISLQLPK
A0A0S8GJS7      -------------------MKQQYTLTDYINIMREHIRPIAVCTAAAAVVALLMSFILPK
A0A1F4UBB9      -------------------MKSEPTLQDYIGVIIERRWLVISCVIGVTFCALVISLFLPK
A0A1V4QH99      -------------------MKSEPTLQDYFNIIMERRRLIIICVAVTTVVALIASFVLPK
A0A7C4Y470      ----------------MPSETTHYDFLKLLKVIRRRQWIIYLSILFILFLTTLYIIFAPK
A0A7C0ZBM3      ------------------MHEDRVELEHYIGVFRRRWWIISSVMVLTLVFSIIYYIKAPP
A0A7C4U9D2      ------------------MDEERVDLEHYIMMLKRKFYVFLSIFFISLVYSFIYYFRTPE
A0A235BXH5      ------------------MEEEQVSFEDYLRIIYERKWIIIVAFFAVVISTAVFTYRQEP
A0A7C3N5N8      -------------MLEDLQEQEKLSLNDYLAIVSKYKVLILVIALLIFFLSVVLTLLEKP
A0A348MM93      -------------MPERVVEDEGKELKTYFFLLLENKILFLTTFFIVIALVFIVTKVTKP
A0A7C3J6H2      -------------MPERVIEDEGKELKTYFFLLLENKILFLTTFFVVIAMVFIITKITKP
                                         :   : :.      .            :       

A0A7C0XDY3      VYKASSVVKLALKETRLNVIPEISPALRTVDPVQSQIEIIKSRALLENLVMKHGLNISFL
A0A7C4TFL4      VYEAKVKFRLDLSQTKPTFFTEFYPS-QRVDPVESELEIIRSRAIARSVVKKLGLNFILK
A0A7C6EHP6      VYEAKVRFKLELSEAKPVFFTELYTP-QRVDPVESELEIIRSRALARSVVKKLGLNFVIN
A0A0S8GJS7      TYEAEVTFKLDLSESKPLFYSPIYSQ-KQIDPVESQLEIIQSRTLAQTVVKELGLNFVVK
A0A1F4UBB9      IYEARVRFKLDLSESKPMFFSEIYTP-QRVDVVESQLEIIRSRTLARTVVQDLGLNFVVN
A0A1V4QH99      VYEARVKFKLDLSESKPMFFSEIYTP-QTVDPVESQLEIVRSRTIAKSVIKKLGLNFIPA
A0A7C4Y470      YYEASSKILITTRRYSI-GPEMIYQD-EEKAVDNELEILNSANFIMKV------------
A0A7C0ZBM3      VYETSTTMLIRQKPVGI-FGTPNYQV-VSGNEMVNHTLLLKSQSLMKM------------
A0A7C4U9D2      IYRTTASIFVVKKSINI-FSPYTFQG-IEEKDMVDHTLLLKSNMVIKM------------
A0A235BXH5      VYEATCTIMVESRKRQRDIFEL--VY-PRWVNILNYSEILKSVAIAKS------------
A0A7C3N5N8      KYTAKTILMFERVNTGSTFFPVTDPL-GMEALLNNQTQILKSRSLMER------------
A0A348MM93      TYQSTALILIETSDKGLSFLPITDMN-PRKTVINNHIEMIQSRTLFER------------
A0A7C3J6H2      TYQSTALILIETSDKGLSFLPMTDMN-PRQTVINNHMEMIQSRTLFER------------
                 * :   . .                        .   :  :  :               

A0A7C0XDY3      TPVDAFEFDTLWTTRKAKEGIYTVKFKGE-YFQVFAPDGSVIGNGRLGEPFNGGVLGFLI
A0A7C4TFL4      NPRRAL-FDSVKISENARPGRYLMKLENN-HFTILTNGGEIIGKGYVGELFDNGSIRFLI
A0A7C6EHP6      NHGRAF-FDSIQVNDNFPAGRYLIKMEDDRNFVVYNSKEEILGKGSVGENFSSNGLRFIL
A0A0S8GJS7      DSYRTY-FDSVFVADDCPPGTYYVRFHNS-EFTIVGSRGEVIGTGTVGEHYDSGALRFRI
A0A1F4UBB9      NHKIYF-LDSIRVANDFPPGKYSVRFRSE-NFGIYDKGDREIGTGKVGDLFDNGKLRFLI
A0A1V4QH99      NENYSY-FDSISVSEKFPPGKYYLKFNDN-NFVFLDKDGNEIGQGQVGRLFKKGSIQFRV
A0A7C4Y470      -------FENLKKSKNLPI--LSSRNPFY-------------------------------
A0A7C0ZBM3      -------VAENLPDSALALSGLSSREEAF-------------------------------
A0A7C4U9D2      -------VSEALTDEELSRANLSSKEEAY-------------------------------
A0A235BXH5      -------TIEKIAGSDLPI-------SKT-------------------------------
A0A7C3N5N8      -------VNLALKEDTILK-------QKG-------------------------------
A0A348MM93      -------VENAISNSGYMDSLFIGKYKEK-------------------------------
A0A7C3J6H2      -------VENAISNSGYMDSLFIGKFKER-------------------------------
                                                                            

A0A7C0XDY3      RAKR-KDYPLVIKFIVTAPDRVALSLKGIFKVTQKGQTDLAVISAQGSSPDFVKKMADAL
A0A7C4TFL4      KETP-REN---LEFAIVPVERATDDLIDRISVSQIRNTNLVLLKVKYFIPELCARIANTI
A0A7C6EHP6      KEKPTRDY---LEFSITNIEKATEDLMHNISASQIKNTSLVLLKARSTLPELAAKIANSL
A0A0S8GJS7      NEKR-ADN---MKLTIMTLNKRARELQKQVRVDQIRNSQLVRLKARSRNPQVAAAIANTL
A0A1F4UBB9      RERP-NED---MRITIKNINKSAEELQDIVNASQIKNTVLVMLKAKSNSPELAAKIANTL
A0A1V4QH99      KTKP-KDI---LEVKIMDMEKRVDKLLSNISANQIKNTALVLLKARSRNPYLAALIANTL
A0A7C4Y470      ------------------E------FTKSVSIIPIGRSNTIKLSFISRNPEEAMIVANTL
A0A7C0ZBM3      ------------------RRILSDIYSGRIQIEPLRNSNIIKITVQENNPYMAYYFANGI
A0A7C4U9D2      ------------------KRLLWDYSNERIVIEPFRNSSIIKINVTEENPYRAYYFANYI
A0A235BXH5      ------------------GNPV-GVLRGGLSVTRVRDTDILEISVKGKTPQEASVLANTI
A0A7C3N5N8      ------------------YTKV-SASRQNLSISKIQDTYIIEVVYKTTDPFLAAYITNKI
A0A348MM93      ------------------EGRI-SYLRKNLMVIPVKDTDILKIVYNDRTPEDAFYITKII
A0A7C3J6H2      ------------------EGRI-SYLRGNLMVIPVKDTDILKIVYKDRTPEDAFYITKII
                                             .       :    :      *     .:. :

A0A7C0XDY3      ADEYVAFTLYGMQEEAKALRSFLEEQLNKVEKELKLAEDSLRAFKEKAGIFLLDESARTL
A0A7C4TFL4      AYEYIQYSLENIRESARGSKEFIETQIEIFGSELDSAEEKLRRYKQKSGVFLLSETAEEI
A0A7C6EHP6      SQEYILYTLESLRESARGSKEFIETQIKIFGTELDSAEENLRRYKQQSGVFLLSETAKEI
A0A0S8GJS7      ANEYINYSLRTVREVARGSKEFIESQILIFGEELNHAEEDLRQYKEKAGIFLLNASAHEI
A0A1F4UBB9      AYEYINYSLSSIREAARSSKEFIESQISIFGEELNNAEEDLRHFKEKTGIFLLSETATEI
A0A1V4QH99      AREYINYCLQVVRESARGSKEFIESQIRIFGDELNRAEEELRKYKEKSGIFLLQESAKEI
A0A7C4Y470      AETAVEFSLDFEKAEIVQVMRFLESQIPVAKERLKDIEKKLEEYKSSTGIISVDEYVNTL
A0A7C0ZBM3      AQNYQKFDIQNKKLQVSALKEFVEAQLKKMEKVLKESEEKLKEYKKKHLTLEISSETSAL
A0A7C4U9D2      AQCYRDFDIENQRRQVSSLKEFTRSQLLKMEKVLKESEERLKEYKMKHKTFDISQETREI
A0A235BXH5      AEVLIESELATGRKEYTEQRHFLEEQIPKVKERLEIIENNLKKFKEETGLIALSEETGQL
A0A7C3N5N8      AREYYKMNLDAMRMTVSQVRIFLEEQLKKIETELNHSELLLRDYKKSNKISSLEDETKIL
A0A348MM93      VDQYYNINLEMTRGELSEVRKFLEEQLVKIESDLQKNEENLKKFKENNSIIELSEETSKL
A0A7C3J6H2      VEQYYNINLEMTRGELSEVRKFLEEQLVKIESDLQQNEENLKRFKENNSIIELSEETSKL
                        :   .        *   *:      *.  *  *  :* .     :.  .  :

A0A7C0XDY3      IERLSALQSELAKAETEKQEAEHKLASLRAQLGEKTATFEKYKQTASSPEVSSNPLVRSL
A0A7C4TFL4      ITALAQFEVEKEKAVVELNETETSIKKLEAELAKDEASYGVYKKMASFPTISNSPLILSL
A0A7C6EHP6      INAVAQFEVEREKAVVELHETESSIKKLESELAKDEASYGYYKRMASFPTISNSPLIITL
A0A0S8GJS7      ISSLAQFETERERAIVALHESESAIENLEAELSRDAASYGAYKQMASFPTLSSSPIIVSL
A0A1F4UBB9      ISSLAEFEVSREQAVVELNEMESSIVNLEDELSKDEATFGVYKKMASFPTISNSPIITNL
A0A1V4QH99      IKSLADFETQKEKALVELHEVESSIKNLETELSKDEAAYGAYKRMASFPTLSRSPIILSL
A0A7C4Y470      SSELSNFDHIYNETIIEYSSKETQLKSLKERLNEVK------KNLSIDLSGIVNSSIKNI
A0A7C0ZBM3      VEKLTDFEAEYQKLFVEKEALKERITLVQSRMDNQQ------KKLLETTWESILPLIEDL
A0A7C4U9D2      INKLTSFEAEYQNLYIEKIGLEEKIKSIDSSMTQEQ------KKFVETKWISLLPIVEEL
A0A235BXH5      TEKLFEFDRLRGQTESELEFQKTKLVSLEASLEETQ------RTLVEKISQVSSPYILEL
A0A7C3N5N8      INQVSQFETDYKGILLNIDTYTKQKEYLLRELDQTQ------KEMLENISSYRTNVMENI
A0A348MM93      VEMISNFEGQKKQYFVEREMLLSKLTYLKENLSQSN------KMIAEGFLNELDPFLERS
A0A7C3J6H2      VEMISNFESQKKQYYVEREMLLAKLNYLKENLAQSN------KMIAEGFLNELDPFLERS
                   :  ::                   :   :          .             :   

A0A7C0XDY3      KEKLTSLEIQKAMLLEKY-TELHPEVVAVNREIAKTKEELNRAVANALKSGPSAGDPI--
A0A7C4TFL4      KEQLKNLELKKQEYTLDP-NK-TAELKIVEEQIAQVKEEINKATKQIVLAGPSIDDPI--
A0A7C6EHP6      KEQLKNLEIQKQEYQNDP-VK----LRQIQEQIAQVEQEINQTSKQILQAGPSVGDPV--
A0A0S8GJS7      KDKLQTLELQKQEMAQTD-VG-SNDVPRIEAQIQKTEEELQKATRQIVLAGPSIDDPV--
A0A1F4UBB9      KDKLKSLELKKQELVQIN-AK-AGEIAEIDRKIQAAEIELKKATEQIVLSGPSIKDPI--
A0A1V4QH99      KKKLKSLQLQKQELLSRG-EK-GEKLIRVEADIQATEQELSKATHQIALAGPSINDPI--
A0A7C4Y470      RTELFNLENELLTYELKGITQDNQRVSILKKNIEDLKKKLQEEVVKVAGDSIFVNDPLSL
A0A7C0ZBM3      RNSLAELENERSRLLIQGFSKDDPKVLSIQKRIDNTRKALKDKVSELFSSDE-TPDPVGN
A0A7C4U9D2      GENLSELETQLSNMVIQGLKEDDPKVISIKNRIKSTQNEMRQKVEELFQSKD-ISDPIGN
A0A235BXH5      RRRLVELETTHSMYLVQGLPENNPKLVSLRKSIDETKAKLIEETNKIKDKELPTLDPLSF
A0A7C3N5N8      FAEISKLETDKAYFISQGYSNEHPKILEINSKIESLKNQLKDETEKSLKENTVPKNPLKY
A0A348MM93      KRELDSLQSNYAYFLSIGYDTTHPKMKEIKTRVENLKNNIIQNSKTSFQKKYFASNPLDY
A0A7C3J6H2      KRELDSLQSSYAYFLSLGYDTAHPKMKEIKIRVENLKNNIIQNSKTSFQEKYFASNPLDY
                   :  *:                 :  :   :      :               :*:  

A0A7C0XDY3      FQNLIAGIIESETKIQSTEGRINALKQLIKKYEAQMKLLPQKEVQLAELTRNVEANRAVY
A0A7C4TFL4      FKNIITNIMNYETKIFALQSRIEALNQILSRYNLRLKQLPEAEVNLAQLERQRKANEEIY
A0A7C6EHP6      FQALITNIINSETHLIALQSRVDALNQIIEKHNRRLKQLPEAEVNLAQLERQKKANEEIY
A0A0S8GJS7      FRSIITQIIDQETRAISLQSRIAALNQIIGRQNARLKQLPEAEVELAQLERQKMANENIY
A0A1F4UBB9      YQSLISQIINNGTKAIALQSRIDALNQIISRQNRRLKQLPEAEVNLAQLERQKMANEEIY
A0A1V4QH99      FQSIISNIINKETKKIALQSSIDALNQIISRQNRRLKQLPEAEVNLAQLERKKLANEEIY
A0A7C4Y470      TSELSLKIIETEIDFEILKSKMEVLENLKKDYEKKIRSFPFQETKFLSFIREYKIAEDVV
A0A7C0ZBM3      IQELLKQSILLKIDLAALEAKEGAYKKILEKYRAKLESIPDKEIELARLERERKANEKIY
A0A7C4U9D2      IREMLKNTLFLKIDLAVNDAKMNAYKNIIDDYQKKLLLIPEREIELARLEREANANEKIY
A0A235BXH5      SQKLVDEIISLRTEITAGETRLNVIKNILKEYERRLQRVPGQELRLVGLEREREINASTY
A0A7C3N5N8      SGDIVQQIVEINNNISLLQAKAEALKKVIDVYNSRLENVPDQSIQLVRLERNAKVNEDIY
A0A348MM93      SKNLMDEIITVQLDVKVKESMIEAFNNVLKIFEEKMKKIPFQELMLARLERNKKVSEELY
A0A7C3J6H2      SKNLMDEIIIVQLDVKVKESMIEALNNVLKIFEEKMKRIPFQELMLARLERNKKVSEELY
                   :    :         .    . :::      .:  .*  .  :  : *:        

A0A7C0XDY3      SMLINKLEETKIAEAQKSTDAKVIEYATRPIAPIKPRKKMNVLLGAILGLVLGVGGAFVL
A0A7C4TFL4      TMLLSKLEESKIAEAMQISGAKIIDYAITPDYPVEPKPRQNALLGFLLGLLIGVGGAFLL
A0A7C6EHP6      TMLLSKLEESKIAEAMQISQARIIDHAIVPDRPVEPKPKQNAILGFLIGLLIGVGGAFLL
A0A0S8GJS7      TMLLGKLEESKIAEAMQISEARIIDVANVPERPTHPRPVLNAVLGVLLGLMIGVGGVILK
A0A1F4UBB9      TMLLGKLEESKIAEAMQISEARIIDEAIVPDEPYSPKPKQNTILGFILGLFIGVGAAFLL
A0A1V4QH99      TMLMGKLEESKIAEAMQISEARIIDSATPPKNPMAPKKKQNTILGFFLGLIIGIGGAFLL
A0A7C4Y470      KLLTEKYEEFRIEEAKKIGNVKVIEYATIPIFPVKPQKKLSLLLGFFGGILIGIIGVVLL
A0A7C0ZBM3      MMLLEKSEEARITEASEIGDVILLDQAPLVKTPLKLPKTKKTIFFIFLGLIISLGLAFIV
A0A7C4U9D2      MMLLEKAEEASITEASEIGNILVLDPAPLNTTPLKGVKVRRIIFYLFVGLSLGIVFTILA
A0A235BXH5      ELLVQRYEEVKIAEAGKTSNVRVIDPARPPGRPISPKKRMNLTLAVVIGLIVGVGGAFVV
A0A7C3N5N8      LMLKRRYEEAKLQEVAEVGNVSIIDTAVVSKIPVSPKKEKNFLMGIILGIFFGITVAFIL
A0A348MM93      LMLKGKFEEAKVAEAGKLGSVKIIDKPVLNKSPVLPKKNRNYLFGFFLALILGVGIVFLK
A0A7C3J6H2      LMLKGKFEEAKVAEAGKLGSVKIIDKPVLNKSPVLPKKNRNYLFGFFLAIILGVGIVFLK
                 :*  . **  : *. :     ::: .     *          :  . .: ..:  ..: 

A0A7C0XDY3      EYVDVNVKTPEEVEELLGVQVLGNIPYI----------------KSAEDAEPRVRLITNL
A0A7C4TFL4      EYLDSSIKSAKEIEDITGISVLASVPRI----------------KDKE----MKIIPSIF
A0A7C6EHP6      EYIDTTVKTSKEIEDLTGISVLATVPLV----------------KNKH----HIDIPTIQ
A0A0S8GJS7      ERLDTSVKTAKELEELTGSSVLASIPLM----------------KGKE----RALIATVE
A0A1F4UBB9      EYLDTSLKTSKEIEELTGLSVLAAIPLV----------------KNKE----RTHIPTID
A0A1V4QH99      EYFDTSLKSTKEVEELTGLSVLATIPLV----------------KNRN----Q-HIPTIH
A0A7C4Y470      EIFANKIVDEDDVRENCHIPVIAIIPEV-------------KIKNNDGFSK---YLITNL
A0A7C0ZBM3      DYFDPSIKSEEEVSAILKVPALGLIP---------------RMDGEDGL------LYVME
A0A7C4U9D2      DYLDISVKSEEDVNFILKIPLYGIIP---------------KIQNNKGN------VFD-E
A0A235BXH5      DYMDNSIKTSKDIERYTGLSILGSVPIV-------------KKKNDTPL-----LLLKGF
A0A7C3N5N8      FFLDESIRTTEEVEHYTGEQILGIITYIGGNGRKDKSKGEKKVSEDEMIEKMRKKLIINM
A0A348MM93      EYIDDSVKDIDEIERELKINIIGNIPSI-------------KIKNGKQVSAEKGKLLTEL
A0A7C3J6H2      EYIDDSVKDIDEIERELKINIIGNIPLI-------------KIRNGKQVSTEKGKLLTEV
                  .  .:   .::         . :.                             :    

A0A7C0XDY3      DPKSVTVEAYRSLKVNLKFASTG-EPIRTFMVSSAKAEEGKTLTAVNLAITSVQAGERVI
A0A7C4TFL4      EIDSELAEAYRILRTNISFTAAE-KSIKSLLVTSTAPQEGKTTTSINLGITFNQLGYRVL
A0A7C6EHP6      EPYSDIAESYRILRTNLAFSAAA-RPIKSLLVTSTIPQEGKTTTCLNLGITLSQQGHKVV
A0A0S8GJS7      EPHSEIAEAYRILRTNIAFATTA-RPIQTLLVTSTIPQEGKTTTCINLAITLSQQGHKVI
A0A1F4UBB9      EPHSQIAEAYRILRTNIGFAATA-KPIKTLLVTSTMPQEGKTTTCLNLGTTLAQQGHKTI
A0A1V4QH99      EPYSQIAEAYRILRTNLAFTAAT-KPLKSLLITSTLPQEGKTTTCINLGITFAQQGHKVI
A0A7C4Y470      EKNKELIEAYRIMKTNINFLNIE-RRSKVFLVTSSLPEEGKSTVSSNIAITTANAGYNTI
A0A7C0ZBM3      HPDSHVAEAFRTLRTNIVLSSPK-EKPGVILITSLTTGEGKSFVSSNLAYSFSLS-KKTL
A0A7C4U9D2      HKKSLISEPFRTLRTNIILSDTD-EKK-TILITSIREEEGKSFVASNLALSFILSDKKVL
A0A235BXH5      PSRSALHEAYRGIRTSLQFINPD-NPIRTFLVTSPLPREGKTTIALNLAVVLSQLGLKTM
A0A7C3N5N8      EPHAPIAEAYRSIRTQIKYRSKEGE-KLVYVFTSSIPGEGKSTTISNLGITMANLGKKVV
A0A348MM93      PENSPIVESYKILRTNLLYHSDGKEPPKVVVVTSATKGEGKSTTASNLGIVMAQLDKKVL
A0A7C3J6H2      SESSPIVESYKILRTNLLYHSEETNPPKVIVVTSATKGEGKSTTASNLGIVMAQLDKKVL
                       *.:. :...:             :.:*    ***:    *:.        ..:

A0A7C0XDY3      LVDADMRNPSVHRFLE---MTKSPGFTDVLKGEETLDDAIKHPEFLRDLAVLTCGSDVVN
A0A7C4TFL4      LMDCDFRRPMFYRYFKTFIKDNQLGLSDVLANQIKLKDVIIQTS-EPNLKFITSGTVSVN
A0A7C6EHP6      MLDCDFRRPKLHNYFRDIVKDNHNGLTDVLINRIKLKDAIVKSQ-FENLYFITSGTIPSN
A0A0S8GJS7      VVDCDFRRPMLHNYFAQYVTDNRHGLSDVLIGRLKLESAIVRNS-VHNLSFITSGTIPSN
A0A1F4UBB9      VIDCDFRRPMLHRYFSAFIKDNTHGLSDVLVEHLQLKEAIVKST-TPNLFFITSGTIPSN
A0A1V4QH99      LLDCDFRRPMLHTYFGELAKDNHHGLSDVLIRKLKLNEAIRKGT-LGNLFFVTSGTIPSN
A0A7C4Y470      LIDLDLRKPSLHKVFG---IENSIGLTDIVMNPKRLEDSIHKI--KDNLYFLKSGTIPPD
A0A7C0ZBM3      LIDADMRKPRLYQAMG---VERTPGLSDYLSGELKKPPIVK----VDGLDFLPSGSSSPS
A0A7C4U9D2      LIDADFRKPQIHRFCG---VEKEPGLSDYLSGNVKDVPIIK----KEKLFILASGSSTPN
A0A235BXH5      VLDADMRKPAVHKFLG---IE-GKSLAEFLAHGGDIESFILPTE-IENVSVIISKETPPN
A0A7C3N5N8      LIDADMRKPVIHKIFN---VRNGIGLAHYINGKATFEEIKRDTE-VDNLTVITYGTRPIN
A0A348MM93      LIDGDLRRPVLDKMFK---INFDKGFTNLLKGEISVEDVIYSSG-IDNLWIIPFGERTSH
A0A7C3J6H2      LIDGDLRRPVLDKMFN---LDFDKGFTNLLKGETSVENVIYPSG-IDNLWIIPFGERTSH
                ::* *:*.* .             .::  :                  : .:        

A0A7C0XDY3      TLEVINSESFGRLLNELVNRYDTVIFDSAPILLVSDTLAMADRVKNLLLVVRAGYTERPA
A0A7C4TFL4      PAELLGSQKMANVLDELKSEFDFLIIDAPPALAVADTRILGKICDGIIVVVMAGRTNRNA
A0A7C6EHP6      PAELLGSNRMVDILNDLKGNFDYVLIDAPPALGIADARVLGKVCDAILVVVMSGKTNRDA
A0A0S8GJS7      PAELLGSEKMVQMIEKLKASFEFVIIDAPPTLGVADARVLGRICDAVLVVVKAQMTNREA
A0A1F4UBB9      PAELLGSQKMQQVLNTLKETFEFILVDAPPALGVADARVLGKIVDAIAVVVMAKKSSRDA
A0A1V4QH99      PSELLGSPRMREVLQELKKQYEFILIDAPPSLGVADARVLGKICDGIIVVVMARRTSRDA
A0A7C4Y470      ASEIISSNNMKEIMEKISRKFDYVFIDSPPLI-IPETRLIGLLSDGVILVLKSNYISPET
A0A7C0ZBM3      PVELLDSERMRKLLIDLKEIYDVIILDSPPLFSVADAVVLSARVDSMALVISHGETPRPL
A0A7C4U9D2      PTELLDSKKMREFMRNIKKDFDIVIIDSPPIFTVADTMIISNMTDKTILVVRYSKTPKIL
A0A235BXH5      PAELLSSNKMKKLLLDLKERFDVIIIDTPPVLSCTDATVLAPLTDGVLIAVQSHKTNRNA
A0A7C3N5N8      PSELLENPKMKELLEICKNDYDYVLVDAPPVNVVTDPIVLANYADKLLWVVSPGKVKRKD
A0A348MM93      STELLEGRITKKIFEQLRNMFDFIVIDTSPVLSVADPTIISRLSDGLLWVVQFKKAKKRE
A0A7C3J6H2      STELLEGKLTKKIFEQLREMFDFIIVDTSPVLSVADPTIVSRLSDGLLWVVQFKKAKKRE
                . *:: .     .:      :: :..*:.*    .:.  :.   .    .:         

A0A7C0XDY3      LVAALRALKRANVNLVGAVVNAIHLQKHYGYYYPYKYYGYEEREKRKGKKSRSWWRYFTK
A0A7C4TFL4      VLDVKEELQKAGEKIIGYVLNGVDRVSPY-Y-----YYRHRS------------------
A0A7C6EHP6      VLEVKDELERAGEKIIGYVLNGVDVGQRY-YRHRYYYYRHYTKPSA--------------
A0A0S8GJS7      VIDVKNEIERSGEKVIGFVLNGIDITSSY-YRRRYHYYRSA-------------------
A0A1F4UBB9      VLEIKEELERSGEKIIGFVLNGIDLSRHY-YRNRYYYYYHTTAE----------------
A0A1V4QH99      VIEIKEELERAGDKIVGFVLNGVDFEGHY-YRHRYYYYHYPSVKK---------------
A0A7C4Y470      LHRSINVINSIEKRIIGIVITR--LKKHHRSYYYYQYYYNKEEKND--------------
A0A7C0ZBM3      LLRAKDQLTSQN-NLLGFIINKVNIQREYRYYHYYRREYTS-------------------
A0A7C4U9D2      LQRLKMFMNNKSIKIDGYVLNAVNLSRGYRYYYYYKDYYTKR------------------
A0A235BXH5      LGRVRDVMESVRAKLIGVVLNAVPSGRGGYGYYHYYHYYHYYPEEEGKGN----------
A0A7C3N5N8      LRHARKLLVPVKRKILGVILNSSKTEV----SSYYSVYYKKYYGEGEL------------
A0A348MM93      LHYTKKLLKNLNIPVIGFVFNNINTESFYGKYYYYHYYYHYHTKEGER------------
A0A7C3J6H2      LHYTKKLLKNLNIPILGFVFNNINTESFYGKYYYYHYYYHYHTKEGEK------------
                :      :      : * :..                                       

A0A7C0XDY3      RG
A0A7C4TFL4      --
A0A7C6EHP6      --
A0A0S8GJS7      --
A0A1F4UBB9      --
A0A1V4QH99      --
A0A7C4Y470      --
A0A7C0ZBM3      --
A0A7C4U9D2      --
A0A235BXH5      --
A0A7C3N5N8      --
A0A348MM93      --
A0A7C3J6H2      --
                  

© 1998-2021Legal notice