BYKdb

Dataset for cluster tadcd of phylum candidate-division-ta06

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A523UVV6      --MDSGEEKTQSLLDYAQILWKRRVIILVLFLLASLSTLFYVMRTRPIYEAYTTIRLENV
A0A523XWF4      --MDSGEEKTQSLLDYAQILWKRRVIILVLFLLASLSTLFYVMRTRPIYEAYTTIRLENV
A0A101I342      MPERVVEDEGKELKTYFFLLLENKILFLTTFFIVIALVFIVTKVTKPTYQSTALILIETS
A0A117M5Y1      MLEDLQDQEKLSLNDYLAIVSKYKFLILIVALLIFSLSVLFTFLEKPKYTAKTVLMFERV
                      :::  .*  *  :: : ..::*   ::     .: .   .* * : : : :*  

A0A523UVV6      GAQGTLLSDLAALRRGNPIETEIEVIRSRSLAEKVVTALNLNFGTTGQSKDFSGKLEEII
A0A523XWF4      GAQGTLLSDLAALRRGNPIETEIEVIKSRSLAEKVVTALNLNFGTTGQSKDFSGKLEEII
A0A101I342      DKGLSFLPITDMNPRKTVINNHIEMIQSRTLFERVENAI---------------------
A0A117M5Y1      NTGSTFFPVTDPLGMEALLNNQTQILKSRSLMERVNLSL---------------------
                .   :::.          ::.  :::.**:* *.*  ::                     

A0A523UVV6      LTRDFPYGDYVIEIVSKAGAFKLRGLNGTTIGSGKVGETFATDGLSFRLNSSSFSPGDSL
A0A523XWF4      LTRDFPYGDYVIEIVSKAGAFKLRGLNGTTIGSGKVGETFATDGLSFRLNSSSFSPGDSL
A0A101I342      ---------------SNSGYMDSLFIGKYKEKEGRISY----------------------
A0A117M5Y1      ---------------KEDTILK-------QKGYKKVSA----------------------
                               .:   :.            .:.                       

A0A523UVV6      FFRVADPVSAARRIQGSTTVRPVKGANIIRISARDTSPTLAARIANELANQFLKQNLAYA
A0A523XWF4      FFRVADPVSAARRIQGSTTVRPVKGANIIRISARDTSPTLAARIANELANQFLKQNLAYA
A0A101I342      -------------LRKNLMVIPVKDTDILKIVYNDRTPEDAFYITKIIVDQYYNINLEMT
A0A117M5Y1      -------------SRQNLSINKIKDTYIIEVVYKSIDPFLAAYITNKIAREYYKMNLDAM
                              . .  :  :*.: *: :  ..  *  *  *:: :. :: : **   

A0A523UVV6      RGEARSAKEFIQEQLAVAADTLRDAEQKLKEYKEKARFVLLDENAKENISTLARFEAVRE
A0A523XWF4      RGEARSAKEFIQEQLAVAADTLRDAEEKLKEYKEKARFVLLDENAKENISTLARFEAVRE
A0A101I342      RGELSEVRKFLEEQLVKIESDLQKNEENLKKFKENNSIIELSEETSKLVEMISNFEGQKK
A0A117M5Y1      RMTVSQVRIFLEEQLKKIEKELNSSELLLRDYKKSNKISSLEDETRVLIDQVSQFETDYK
                *    ... *::***    . *.. *  *..:*:.  :  *.:::   :. ::.**   :

A0A523UVV6      EAKMKKIEVERRLLLLRAQLAGKGAFADYKIVAASPIVTGNPVISKLKGNLSNLEIRRAQ
A0A523XWF4      EAKMKKIEVERRLSLLRAQLAGKGAFADYKIVAASPIVTGNPVISKLKGNLSNLEMRRAQ
A0A101I342      QYFVEREMLLSKLTYLKENLSQSN-----KMIAEGFLNELDPFLERSKRELDSLQSNYAY
A0A117M5Y1      GIMLNIDTYTKQKEYLLKELDQTQ-----KEMIENISSYRTDVMENIFAEISKLETDKAY
                   ::      .   *  :*  .      * :  .       .:..   ::..*:   * 

A0A523UVV6      LLEE-YTALHPDVIEIEGEIEKVKEELNKSIRQVLETGPSASDPV--YQSIISGIINAEV
A0A523XWF4      LLEE-YTELHPDVIEIESEIEKVKEELSKSIRQVLETGPSAADPV--YQSIISGIINAEV
A0A101I342      FLSIGYDTTHPKMKEIKTRVENLKNNIIQNSKTSFQKKYFASNPLDYSKNLMDEIITVQL
A0A117M5Y1      FISQGYSNDHPKILQINSKIESLKKQLKDETEKSLKENRVQQNPLKYSGEIIQQIAEINN
                ::.  *   **.: :*:  :*.:*::: ..    ::      :*:    .::. *   : 

A0A523UVV6      EVGAIEDRIAALGEVVEVYNSKLEDLPEKEITLARLTRRREVREKIYTMLLTKLEEARIS
A0A523XWF4      EAGAIEDRIAALGEVVEVYNSKLEGLPEKEITLARLTRRMKVGEKIYTMLLTKLEEARIS
A0A101I342      DVKVKESMIEAFNNVLKIFEEKMKKIPFQELMLARLERNKKVSEELYLMLKGKFEEAKVA
A0A117M5Y1      NVSLLQAKAEGLKKVIDVYNSKLENVPDKSIQLVRLERNAKVNEDIYLMLKRRYEEAKLQ
                :.   :    .: :*:.:::.*:: :* :.: *.** *. :* *.:* **  . ***.: 

A0A523UVV6      EAMKVGNTRIVDGAIRPDRPILPKKKRTTFLGAVGGLIIGIGLALFLEYLDTSVKTGEDI
A0A523XWF4      EAMKIGNTRIVDGAIRPDRPILPKKKRTTFLGAVGGLIIGIGLALFLEYLDTSVKTGEDI
A0A101I342      EAGKLGSVKIIDKPVLNKSPVLPKKNRNYLFGFFLALILGVGIVFLKEYIDDSVKDIDEI
A0A117M5Y1      EVAEVGNLSIIDTAVVSKIPVSPKKEKNFLLGIILGIFFGVTLAFILFFLDESIRTAEEV
                *. ::*.  *:* .:  . *: ***:.. ::* . .:::*: :.::  ::* *:.  :::

A0A523UVV6      ERDLRLPFLGAVPSV---------RNDHGGALEGDEEVLKRVLISRFDPRSPIAEAYRTV
A0A523XWF4      ERDLRLPFLGAVPSV---------RNDHGGALEGDEEVLKRVLISRFEPGSRIAEAYRTV
A0A101I342      ERELKINIIGNIPSI-------KIKNGKQVSAE------KGKLLTELPENSPIVESYKIL
A0A117M5Y1      EHYTGEQILGIITYIGGNGKKDKVKGEKKVTEDEIVEKIRKKLIINMEPHAPIAEAYRSI
                *.     ::* :. :         .. :  : :      .  *:  :   : *.*:*. :

A0A523UVV6      RTNLQYVQLDKK-YRTIMFTSPLPEEGKSTSLANISLTLSQLGAKTLVVDSDLRRPVQHR
A0A523XWF4      RTNLQYVQLDKK-YRTILFTSPLPEEGKSTSLANISLTFSQLGGKTLVVDSDLRRPVQHR
A0A101I342      RTNLLYHSDGKEPPKVVVVTSATKGEGKSTTASNLGIVMAQLDKKVLLIDGDLRRPVLDK
A0A117M5Y1      RTQIKYRSKEGE-KLVYVFTSSIPGEGKSTTISNLCITMANLGKKVILIDADMRKPVIHK
                **:: * .   :   . :.**.   *****: :*: :.:::*. *.:::*.*:*.**  .

A0A523UVV6      IFGVHKSPGLTGILVNEESPDEVISPTKYENLYVLPSGPIPPNPSELLSSDRMKQLITQL
A0A523XWF4      IFGVHKFPGLTGILVNEESPDEVISPTKFENLYVLPSGPIPPNPSELLSSDRMKQLVTQL
A0A101I342      MFKINFDKGFTNLLKGEISVEDVIYSSGIDNLWIIPFGERTSHSTELLEGRITKKIFEQL
A0A117M5Y1      IFNVKNGIGLAHYINRKATYEEIKRDTEVENLKVITYGTRPVNPSELLENPKMKELLEIC
                :* ::   *::  :  : : :::   :  :** ::. *  . :.:***..   *::.   

A0A523UVV6      KEEFEFILFDSPPILVVTDAAVLGGKTDGTVVVVRFEKTDRRAALEAKKLLENAKVEVLG
A0A523XWF4      KEEFEFILFDSPPILVVTDAAVLGGKTDGTVVVVRFEKTDRRAALEAKKLLENAKVKVLG
A0A101I342      RNMFDFIVIDTSPVLSVADPTIISRLSDGLLWVVQFKKAKKRELHYTKKLLKNLNIPVIG
A0A117M5Y1      KNEFDYVFLDAPPVNVVTDPIVLANYADKLLWVVSPGKVKRKDLRHARKLLVPVKRKILG
                .: *:::.:*:.*:  *:*. ::.  :*  : **   *....    :.***   :  ::*

A0A523UVV6      VVLNDVKIERALGGYGYHYYCRSYYPPYYGDDKGEKVKKKRKRVSSRKRTALSGVTSGLR
A0A523XWF4      VVLNDVKTERALGGYGYHYYYRSYYPSHYSDDKGEKVKKKRKRVSSRKRTALSGVTSGLR
A0A101I342      FVFNNINTESF---YGKYYYYHYYYHYHTKEGER--------------------------
A0A117M5Y1      VILNSSKTEF-------SSYYSVYYKKYYGEGEL--------------------------
                .::*. : *          *   **  :  :.:                           

A0A523UVV6      SVLRSSRWRQGRRKRIS
A0A523XWF4      SVLRSSRWRQGRRKRIS
A0A101I342      -----------------
A0A117M5Y1      -----------------
                                 

© 1998-2020Legal notice