BYKdb

Dataset for cluster orphancd of phylum calditrichaeota

[Download (right click)] [Edit] [Sequences] [Repertoires]

11 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3M1NH38      ------------------------------------------------------------
A0A3N5KHL3      MALEEFEILDQPQQSSIPIDFGKFIAGIWRRKWLILFL-SVGMTIPFYFHAK-NQVPQYK
A0A3M2FHF6      --MNNNVPAASGDLA---FKLKKIIRLLKRKKITLLSVFSVTFVVVFLAALKFGPQQQYK
H1XXC2          --MNNQKKSTDLNLTDSKMDWQHYIKLFKRKKWLMLLLFIFGFLFSAAFLYKISPRPVYQ
A0A7C2IW62      ------------------------------------------------------------
A0A3M1A6F3      ------------------------------------------------------------
A0A3M1AUM6      ------------------------------------------------------------
A0A6H9LKJ3      ------------------------------------------------------------
A0A6H9L817      ------------------------------------------------------------
A0A523H6J2      ------------------------------------------------------------
A0A523IZX2      ------------------------------------------------------------
                                                                            

A0A3M1NH38      ------------------------------------------------------------
A0A3N5KHL3      SKVVIQSKQY-------GSEEKSFFDAETQAEITSQSFTERMARVLGLAI-LSSDTLYRN
A0A3M2FHF6      ASALLQIDDKRALTSVGGARGRQQNDSKLGL-IMSRSFLKRVVDKTNFQFQVSGQPRYNV
H1XXC2          TQALLQFQDTRSLNEL-DSRRRPDFESKLGI-LMSRKFLGKIVDDLSLVVRFSGVDRYEA
A0A7C2IW62      ------------------------------------------------------------
A0A3M1A6F3      ------------------------------------------------------------
A0A3M1AUM6      ------------------------------------------------------------
A0A6H9LKJ3      ------------------------------------------------------------
A0A6H9L817      ------------------------------------------------------------
A0A523H6J2      ------------------------------------------------------------
A0A523IZX2      ------------------------------------------------------------
                                                                            

A0A3M1NH38      ------------------------------------------------------------
A0A3N5KHL3      VSDVFAEYHTTSEPVVSRYKIEVDDLGVYYLYQKNETSRVLVDSANVWDA---VDALRNA
A0A3M2FHF6      IDSVVLD----DQLKYGKYLIKKDENNLKVFYTDPTKT---IDEELVLETSVPTDHKLSY
H1XXC2          VDSVFLH----PNYLKGRFVLKKQGNKLLLFYTSQDHS---IEDKKVLEVDYPEDRLIVY
A0A7C2IW62      ------------------------------------------------------------
A0A3M1A6F3      ------------------------------------------------------------
A0A3M1AUM6      ------------------------------------------------------------
A0A6H9LKJ3      ------------------------------------------------------------
A0A6H9L817      ------------------------------------------------------------
A0A523H6J2      ------------------------------------------------------------
A0A523IZX2      ------------------------------------------------------------
                                                                            

A0A3M1NH38      -----------------------MVQKVIENLKNIISYKLDQTSRTVMTVLVKHRSPEMA
A0A3N5KHL3      NGLSFRLQPTFVHQAGEFHFRVQPFSKGVKVIQLGIKMDF-SRSGKFMIMEMKGENPNYI
A0A3M2FHF6      GGFTVYFKKNFWENNKKIVFHLLKSSKAVEALRASIKPMFKNRARTMMEVGISGVDRFYI
H1XXC2          GGVGLKLKDRYWQQHDKLIYTVNSRPRAIESLLSSLGYQFKNRARTLLVLTLKGEDRYLI
A0A7C2IW62      ------------------------------------------------------------
A0A3M1A6F3      ------------------------------------------------------------
A0A3M1AUM6      ------------------------------------------------------------
A0A6H9LKJ3      ------------------------------------------------------------
A0A6H9L817      ------------------------------------------------------------
A0A523H6J2      ------------------------------------------------------------
A0A523IZX2      ------------------------------------------------------------
                                                                            

A0A3M1NH38      ALIANTLAKRFVELNREVARYKSDKIMEILENQLKIAKQELDEATQKLRAFQERYPWVRL
A0A3N5KHL3      TSELNRIADAYLIEVQKLKSVDSDTYREALRRRLAAAETNMKVSEENLRNFYSQYP-LSL
A0A3M2FHF6      TEVLNVLVDEFVQQNIDVKKYHTREVLTVLTTQLEQAKKDLDAASEELKRFRERNPYVGL
H1XXC2          TATLNKIVDYFVQENLNLKKYQTREVLSVLEEQLQTAKVELDRAAQELKQFREKNPWVGL
A0A7C2IW62      ------------------------------------------------------------
A0A3M1A6F3      ------------------------------------------------------------
A0A3M1AUM6      ------------------------------------------------------------
A0A6H9LKJ3      ------------------------------------------------------------
A0A6H9L817      ------------------------------------------------------------
A0A523H6J2      ------------------------------------------------------------
A0A523IZX2      ------------------------------------------------------------
                                                                            

A0A3M1NH38      SADAQMQIATITELEETEQKLQNKIRDVQGLLQKLEM-SGNTLDLEEMLSLCNEMITLLS
A0A3N5KHL3      DAEKTELMGQLKLNEQALRDLPLQRKQLTSLLARLQAENNADYSAQYRRVVVNQIANYAA
A0A3M2FHF6      AGEATAAVTRISSSENQKNEVLRKKKELSELITRLNTAAGDE-----RYSILNELLAWLA
H1XXC2          TPDATGAISSVSALESQKSQLVNLKNELQSLINRLQAKSGEE-----RYSILNEIISFLG
A0A7C2IW62      ------------------------------------------------------------
A0A3M1A6F3      ------------------------------------------------------------
A0A3M1AUM6      ------------------------------------------------------------
A0A6H9LKJ3      ------------------------------------------------------------
A0A6H9L817      ------------------------------------------------------------
A0A523H6J2      ------------------------------------------------------------
A0A523IZX2      ------------------------------------------------------------
                                                                            

A0A3M1NH38      SSGELAREQFEYPLASVFSAEYEKLTAERRDLLASYAPTHPVVKENEQKIWALLEKVKKG
A0A3N5KHL3      MSNE--------PEMTIYRQNLEQLEARYRELSGLYSSDNEEVKGLEEKIGETQAHIIQF
A0A3M2FHF6      ANGS--------PTVPALASEYTTLNEERIRLANNYAPEHPTVLENKKKIRDLEKKVLYT
H1XXC2          AQDA--------PTAPALASEFTTLTTDRSRLLASYAPSHPYVKENTKKLNELEKKVLLT
A0A7C2IW62      ------------------------------------------------------------
A0A3M1A6F3      ------------------------------------------------------------
A0A3M1AUM6      ------------------------------------------------------------
A0A6H9LKJ3      ------------------------------------------------------------
A0A6H9L817      ------------------------------------------------------------
A0A523H6J2      ------------------------------------------------------------
A0A523IZX2      ------------------------------------------------------------
                                                                            

A0A3M1NH38      ARDYVNKLEQELVGLSQNLQVERKKLRRLPATSLQYAELQREHDLKERVYSTVLVRYNQN
A0A3N5KHL3      ASNYRNVLAERESTLRREKLELESKLKSLPNDEYRLMELERNKKIDEDLFKFLYTEVQKL
A0A3M2FHF6      ANNFLAQYDESLANIESMMRQEQGKIRSLPAKELQYAELQRKKNVADGVYSDLLIRHNKA
H1XXC2          AQNMINAWNKQINDLEQKIVENTNKIKRLPAKELKLAELERQRAVTDEIYSSLLVRYNQA
A0A7C2IW62      ------------------------------------------------------------
A0A3M1A6F3      ------------------------------------------------------------
A0A3M1AUM6      ------------------------------------------------------------
A0A6H9LKJ3      ------------------------------------------------------------
A0A6H9L817      ------------------------------------------------------------
A0A523H6J2      ------------------------------------------------------------
A0A523IZX2      ------------------------------------------------------------
                                                                            

A0A3M1NH38      KLESEVDISDVFIIDPAIPPPEQDVLFALIMKSLMGLLISVGIGFIVAVIVEVFNKTAEN
A0A3N5KHL3      QVSEASQDRGVRILDYAVPPTKPINPSKKSQI-MLGGGLGLLLGLLLSIVIDLADRSLQS
A0A3M2FHF6      KVADAVEVGDIIIIDHAVPPPRVSALGVFLKYGFVALALGLIISIGFVLVADFFDKTVRT
H1XXC2          KIADAVEVGDVVVLDRAVVPLRISQFKTYFKIMLIGLVVGLGLSVVVVIVIDFFDKTVRS
A0A7C2IW62      --SKNVRIIDEAIEPISPVKPKKKLNLMLGVLIGLGLGVGLAFLREYFDNTIKSHEDLEK
A0A3M1A6F3      ------------------------------------------------------------
A0A3M1AUM6      ------------------------------------------------------------
A0A6H9LKJ3      ------------------------------------------------------------
A0A6H9L817      ------------------------------------------------------------
A0A523H6J2      ------------------------------------------------------------
A0A523IZX2      ------------------------------------------------------------
                                                                            

A0A3M1NH38      VEELQEMLDIPVVGEIPMIKVEQGDGEGIQELRGKRDPKLITLDYSPTLASESYRDLRTK
A0A3N5KHL3      VKDVERHLKLPVLGTIPEVLFKDIPEYRDDQKAEQIDKQLVTHDYSPTPIGEAYRALRTH
A0A3M2FHF6      ADELEKAVPIRVVAKIPVVGTTKEITMEDFAKNKRIDPKLVTADYSPTPMGEAYRSLRTQ
H1XXC2          AEELEKAIPIKVIGKIPVIKTEKEIVDVKFDDAVRIDPKLVTADYSPTPVGEAYRSLRTQ
A0A7C2IW62      LGFNILASIPQIQMDKYEKKLERKLEKIGPVEGRKIESRLITHLDPKSPVSEAYRTLRTN
A0A3M1A6F3      ----------------MKLSKLQKLPSLDKIIKNNNHEKIYRGYYKDSAFNAESERVLSK
A0A3M1AUM6      --------------------------------MQSFVGNIVDYFEEESPEATEFRRLYSK
A0A6H9LKJ3      -------------------------------MARKKPQTILEFYDLESPYVTEFRRLLHR
A0A6H9L817      ---------------------------------MDFGGSILDYFKDESPEATEFRRLHSK
A0A523H6J2      -----------------------------MLKSPITDIEHLKEARNDTPGNAEIMRLLSK
A0A523IZX2      -----------------------------MLNSPRTDIEHLKEARNDTPGNAEIMRLLTK
                                                               :        :  .

A0A3M1NH38      VLFMNQNEDLSSLMVTSLRPNEGKSLTTANLAITVAQQK-ISTLLIDGDLRRGVLHNTFG
A0A3N5KHL3      LLFSKDTEQLRSLLITSICPEEGKSFTAANLAIIMAQQR-TNTLLVDADLRRGVQHNTFN
A0A3M2FHF6      LLFNNEDKRNRSLFVTSLNPNEGKSLNASNLAITFAQQK-IPTLLVDADLRRGVLHSSFA
H1XXC2          LLFNS-DKKLRSVFITSLNPDEGKSLNAGNLAITFAQQK-LPTILLDADLRRGVLHNSFA
A0A7C2IW62      LQFSKVDHQLKSILVTSSGPKEGKSTTAANLAIALAQI-GQKVVLVDADFRRPVVHSIFG
A0A3M1A6F3      IDTFRRGRTKQSVMVTSAILGEGKSTISSHIALASARNRKSPTLLIDLDLRRPRIHEIFG
A0A3M1AUM6      LQNLYSGQNIKNLLITSATMNEGKSTTAALLACTIARYRETKTILVDCDLRRPRVHQLFN
A0A6H9LKJ3      IKTTESQRDIKSIMLTSAMLSEGKSTICSFLGITAALKKGMKTLILDTDLRRPSINKLFK
A0A6H9L817      MLNLHGGQEFKNVLITSATISEGKSTAAALLACTVARYRDTKTIIVDCDLRRPRVHSLFG
A0A523H6J2      LDTFRNGTHKQTVMITSALSGEGKSTISTNIAIASSRNRQRPSLIIDFDLRRPRLHHIFK
A0A523IZX2      LDTFRNGTPKQTIMFTSALLGEGKSTISANIAIASSRNRQKPSLLIDFDLRRPKLHHIFK
                :          .::.**    ****     :.   :       :::* *:**   :  * 

A0A3M1NH38      NKKTPGLSDFLISSATVDFDNLSKLIQPTFIPNLFLITCGSPIPNPTEMLGGDRFVAFLK
A0A3N5KHL3      VPREPGLTNYLS-----NKGTLNTLIHSTHIPNLSVMSCGSLVPNPSELLGSIQMKRLLS
A0A3M2FHF6      CNKKPGLADFLYSSADINDENINKVIQQTHIPNLYLMSSGMAVPNPSEILGTQRAADLFK
H1XXC2          CKKKPGFSDFLYSNADITDENVRKIIQTTHIPNLYLISSGVPIPNPSELLGSTRAQELIR
A0A7C2IW62      IKKDEGVTNYLM-----DTIKFDQIVKPTFNENLFVICSGVLPPNPSELLASKAMENLIE
A0A3M1A6F3      QNKTPGLAEILS-----RKLTLHSCIRDSEIENLKIITSGSLQGNPLNIINAETIHAFFN
A0A3M1AUM6      LAKEDGVADVLM-----SKRRLDACFKQSPLENLKILTSGGIVDNPTELFNSSKMKDLFS
A0A6H9LKJ3      LDAKAGLNEILT-----EGYNPKDAISKTSIDKLDILTTGGFCEHPSEVFDAEVIGTLID
A0A6H9L817      LPKDDGVADVLT-----GRRSLDACFKPSPIDNLQVLTSGGVIDNPTELFNSPRMKDLFS
A0A523H6J2      VDKEPGVVDAVT-----NQISFQELIKDSGFPNLKIITSGNLNDSPIKIFNAQNIKAFLE
A0A523IZX2      VDKAPGVVDAVT-----NQISFQELVKDSGFPNLKIITSGNLNESPIKIFNAQNIKAFLD
                     *. : :              .  :   :* ::  *     * :::       :: 

A0A3M1NH38      LLRSRFGMVIMDTPPIQASSDAAILARYFDGVLTVIKAGSTDIGQLRQKLNEYPNLRKKV
A0A3N5KHL3      DVKRKFDFIIFDAPPLDAATDSVVIGTVVDAVTIVLRAGKTNRKIAKERLEIFQNVPAKI
A0A3M2FHF6      FLAERFGFLIVDTPPIMVTSDSVVLSRYVEQGLFVIRAGQTNVESVKEKLAEYKNFEKRL
H1XXC2          FLSHRFGFVIIDTPPLAVASDAVIVSRYVDGGLLVVRAGKSNIVQLKSKIEEYQDLRKNL
A0A7C2IW62      RLIKDFDTVIFDSPPVIAVTDAAILSRKVDGTILVVNSGNTNRDALIRCNTLLESVGTIP
A0A3M1A6F3      EIYKYFDFIVVDAPPVIPVSDPLILGKVVDHVVMVVRVGKTPKPIAKRAIEMLQSVEVNI
A0A3M1AUM6      EIKFYFDAVIVDSPPINPVTDALILSSEMDGALMVVKAGKTPKDVVRRAVDLMRNTGLNI
A0A6H9LKJ3      EMKFYYDIVLIDCAPLLPVSDPMLLATKTDGVLMVVKAGSTQKEVVRRAVEILDPTTTNI
A0A6H9L817      EIKFYFDAVIVDTPPIIPVTDSLILSTEMDGAIMVIKAGDTKKQIVNRAVELMRNSGLNI
A0A523H6J2      TASSFYDYIVVDAPPVIPVSDPLIIGKFVDNVILVAKAGETPKRVIKRAVDMIHNVEIEI
A0A523IZX2      TASSYYDNIIVDAPPVIPVSDPLVIGKFVDNVILVAKAGETPKRVIQRAVDMIHNVEIKI
                     :. ::.* .*:   :*. ::.   :    * . *.:                   

A0A3M1NH38      IGAVLN-MVQMNIKKNQYQYSYYNY--------------------------
A0A3N5KHL3      IGTIIN-GTDEAI--LKSTYSYYHY--------------------------
A0A3M2FHF6      FGIILN-CAELDMKSDHYKYSYYNY--------------------------
H1XXC2          VGIVLN-FAKEDMDHKKYRYTYYNY--------------------------
A0A7C2IW62      LGILLNGVNIEGMYGSYYYYYYHHYYSKPGRKKKKSMSKIISI--------
A0A3M1A6F3      LGIVLN--DVDSLLPAYYNNRYYKYPYYSEVEESNNNLE------------
A0A3M1AUM6      LGVIVN--NMKGVLPYYYDYKYYGYKYYTKDLKA-----------------
A0A6H9LKJ3      LGVVFN--NMNHSLPYYYDYSYYHYEYNHNQKKSREGKSGDDSQNKLKVDK
A0A6H9L817      LGVIVN--NMKGVLPYYYDHKYYGYDYTPGTTEEKFF--------------
A0A523H6J2      SGIILN--NMRNVLPYYYDHKYYGYDYYNYNTNDK----------------
A0A523IZX2      SGIILN--NMRNVLPYYYDHKYYGYDYYNYDSDDK----------------
                 * :.*               *: *                          

© 1998-2021Legal notice