BYKdb

Dataset for cluster orphancd of phylum calditrichaeota

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3M1A6F3      ------------------------------------------------------------
A0A3M1AUM6      ------------------------------------------------------------
A0A6H9LKJ3      ------------------------------------------------------------
A0A6H9L817      ------------------------------------------------------------
A0A523H6J2      ------------------------------------------------------------
A0A523IZX2      ------------------------------------------------------------
A0A3M1NH38      ------------------------------------------------------------
A0A3N5KHL3      MALEEFEILDQPQQSSIPIDFGKFIAGIWRRKWLILFL-SVGMTIPFYFHAK-NQVPQYK
A0A3M2FHF6      --MNNNVPAASGDLA---FKLKKIIRLLKRKKITLLSVFSVTFVVVFLAALKFGPQQQYK
H1XXC2          --MNNQKKSTDLNLTDSKMDWQHYIKLFKRKKWLMLLLFIFGFLFSAAFLYKISPRPVYQ
                                                                            

A0A3M1A6F3      ------------------------------------------------------------
A0A3M1AUM6      ------------------------------------------------------------
A0A6H9LKJ3      ------------------------------------------------------------
A0A6H9L817      ------------------------------------------------------------
A0A523H6J2      ------------------------------------------------------------
A0A523IZX2      ------------------------------------------------------------
A0A3M1NH38      ------------------------------------------------------------
A0A3N5KHL3      SKVVIQSKQY-------GSEEKSFFDAETQAEITSQSFTERMARVLGLAI-LSSDTLYRN
A0A3M2FHF6      ASALLQIDDKRALTSVGGARGRQQNDSKLGL-IMSRSFLKRVVDKTNFQFQVSGQPRYNV
H1XXC2          TQALLQFQDTRSLNEL-DSRRRPDFESKLGI-LMSRKFLGKIVDDLSLVVRFSGVDRYEA
                                                                            

A0A3M1A6F3      ------------------------------------------------------------
A0A3M1AUM6      ------------------------------------------------------------
A0A6H9LKJ3      ------------------------------------------------------------
A0A6H9L817      ------------------------------------------------------------
A0A523H6J2      ------------------------------------------------------------
A0A523IZX2      ------------------------------------------------------------
A0A3M1NH38      ------------------------------------------------------------
A0A3N5KHL3      VSDVFAEYHTTSEPVVSRYKIEVDDLGVYYLYQKNETSRVLVDSANVWDA---VDALRNA
A0A3M2FHF6      IDSVVLD----DQLKYGKYLIKKDENNLKVFYTDPTKT---IDEELVLETSVPTDHKLSY
H1XXC2          VDSVFLH----PNYLKGRFVLKKQGNKLLLFYTSQDHS---IEDKKVLEVDYPEDRLIVY
                                                                            

A0A3M1A6F3      ------------------------------------------------------------
A0A3M1AUM6      ------------------------------------------------------------
A0A6H9LKJ3      ------------------------------------------------------------
A0A6H9L817      ------------------------------------------------------------
A0A523H6J2      ------------------------------------------------------------
A0A523IZX2      ------------------------------------------------------------
A0A3M1NH38      -----------------------MVQKVIENLKNIISYKLDQTSRTVMTVLVKHRSPEMA
A0A3N5KHL3      NGLSFRLQPTFVHQAGEFHFRVQPFSKGVKVIQLGIKMDF-SRSGKFMIMEMKGENPNYI
A0A3M2FHF6      GGFTVYFKKNFWENNKKIVFHLLKSSKAVEALRASIKPMFKNRARTMMEVGISGVDRFYI
H1XXC2          GGVGLKLKDRYWQQHDKLIYTVNSRPRAIESLLSSLGYQFKNRARTLLVLTLKGEDRYLI
                                                                            

A0A3M1A6F3      ------------------------------------------------------------
A0A3M1AUM6      ------------------------------------------------------------
A0A6H9LKJ3      ------------------------------------------------------------
A0A6H9L817      ------------------------------------------------------------
A0A523H6J2      ------------------------------------------------------------
A0A523IZX2      ------------------------------------------------------------
A0A3M1NH38      ALIANTLAKRFVELNREVARYKSDKIMEILENQLKIAKQELDEATQKLRAFQERYPWVRL
A0A3N5KHL3      TSELNRIADAYLIEVQKLKSVDSDTYREALRRRLAAAETNMKVSEENLRNFYSQYP-LSL
A0A3M2FHF6      TEVLNVLVDEFVQQNIDVKKYHTREVLTVLTTQLEQAKKDLDAASEELKRFRERNPYVGL
H1XXC2          TATLNKIVDYFVQENLNLKKYQTREVLSVLEEQLQTAKVELDRAAQELKQFREKNPWVGL
                                                                            

A0A3M1A6F3      ------------------------------------------------------------
A0A3M1AUM6      ------------------------------------------------------------
A0A6H9LKJ3      ------------------------------------------------------------
A0A6H9L817      ------------------------------------------------------------
A0A523H6J2      ------------------------------------------------------------
A0A523IZX2      ------------------------------------------------------------
A0A3M1NH38      SADAQMQIATITELEETEQKLQNKIRDVQGLLQKLEM-SGNTLDLEEMLSLCNEMITLLS
A0A3N5KHL3      DAEKTELMGQLKLNEQALRDLPLQRKQLTSLLARLQAENNADYSAQYRRVVVNQIANYAA
A0A3M2FHF6      AGEATAAVTRISSSENQKNEVLRKKKELSELITRLNTAAGDE-----RYSILNELLAWLA
H1XXC2          TPDATGAISSVSALESQKSQLVNLKNELQSLINRLQAKSGEE-----RYSILNEIISFLG
                                                                            

A0A3M1A6F3      ------------------------------------------------------------
A0A3M1AUM6      ------------------------------------------------------------
A0A6H9LKJ3      ------------------------------------------------------------
A0A6H9L817      ------------------------------------------------------------
A0A523H6J2      ------------------------------------------------------------
A0A523IZX2      ------------------------------------------------------------
A0A3M1NH38      SSGELAREQFEYPLASVFSAEYEKLTAERRDLLASYAPTHPVVKENEQKIWALLEKVKKG
A0A3N5KHL3      MSNE--------PEMTIYRQNLEQLEARYRELSGLYSSDNEEVKGLEEKIGETQAHIIQF
A0A3M2FHF6      ANGS--------PTVPALASEYTTLNEERIRLANNYAPEHPTVLENKKKIRDLEKKVLYT
H1XXC2          AQDA--------PTAPALASEFTTLTTDRSRLLASYAPSHPYVKENTKKLNELEKKVLLT
                                                                            

A0A3M1A6F3      ------------------------------------------------------------
A0A3M1AUM6      ------------------------------------------------------------
A0A6H9LKJ3      ------------------------------------------------------------
A0A6H9L817      ------------------------------------------------------------
A0A523H6J2      ------------------------------------------------------------
A0A523IZX2      ------------------------------------------------------------
A0A3M1NH38      ARDYVNKLEQELVGLSQNLQVERKKLRRLPATSLQYAELQREHDLKERVYSTVLVRYNQN
A0A3N5KHL3      ASNYRNVLAERESTLRREKLELESKLKSLPNDEYRLMELERNKKIDEDLFKFLYTEVQKL
A0A3M2FHF6      ANNFLAQYDESLANIESMMRQEQGKIRSLPAKELQYAELQRKKNVADGVYSDLLIRHNKA
H1XXC2          AQNMINAWNKQINDLEQKIVENTNKIKRLPAKELKLAELERQRAVTDEIYSSLLVRYNQA
                                                                            

A0A3M1A6F3      ------------------------------------------------------------
A0A3M1AUM6      ------------------------------------------------------------
A0A6H9LKJ3      ------------------------------------------------------------
A0A6H9L817      ------------------------------------------------------------
A0A523H6J2      ------------------------------------------------------------
A0A523IZX2      ------------------------------------------------------------
A0A3M1NH38      KLESEVDISDVFIIDPAIPPPEQDVLFALIMKSLMGLLISVGIGFIVAVIVEVFNKTAEN
A0A3N5KHL3      QVSEASQDRGVRILDYAVPPTKPINPSKKSQI-MLGGGLGLLLGLLLSIVIDLADRSLQS
A0A3M2FHF6      KVADAVEVGDIIIIDHAVPPPRVSALGVFLKYGFVALALGLIISIGFVLVADFFDKTVRT
H1XXC2          KIADAVEVGDVVVLDRAVVPLRISQFKTYFKIMLIGLVVGLGLSVVVVIVIDFFDKTVRS
                                                                            

A0A3M1A6F3      ----------------MKLSKLQKLPSLDKIIKNNNHEKIYRGYYKDSAFNAESERVLSK
A0A3M1AUM6      --------------------------------MQSFVGNIVDYFEEESPEATEFRRLYSK
A0A6H9LKJ3      -------------------------------MARKKPQTILEFYDLESPYVTEFRRLLHR
A0A6H9L817      ---------------------------------MDFGGSILDYFKDESPEATEFRRLHSK
A0A523H6J2      -----------------------------MLKSPITDIEHLKEARNDTPGNAEIMRLLSK
A0A523IZX2      -----------------------------MLNSPRTDIEHLKEARNDTPGNAEIMRLLTK
A0A3M1NH38      VEELQEMLDIPVVGEIPMIKVEQGDGEGIQELRGKRDPKLITLDYSPTLASESYRDLRTK
A0A3N5KHL3      VKDVERHLKLPVLGTIPEVLFKDIPEYRDDQKAEQIDKQLVTHDYSPTPIGEAYRALRTH
A0A3M2FHF6      ADELEKAVPIRVVAKIPVVGTTKEITMEDFAKNKRIDPKLVTADYSPTPMGEAYRSLRTQ
H1XXC2          AEELEKAIPIKVIGKIPVIKTEKEIVDVKFDDAVRIDPKLVTADYSPTPVGEAYRSLRTQ
                                                               :        :  .

A0A3M1A6F3      IDTFRRGRTKQSVMVTSAILGEGKSTISSHIALASARNRKSPTLLIDLDLRRPRIHEIFG
A0A3M1AUM6      LQNLYSGQNIKNLLITSATMNEGKSTTAALLACTIARYRETKTILVDCDLRRPRVHQLFN
A0A6H9LKJ3      IKTTESQRDIKSIMLTSAMLSEGKSTICSFLGITAALKKGMKTLILDTDLRRPSINKLFK
A0A6H9L817      MLNLHGGQEFKNVLITSATISEGKSTAAALLACTVARYRDTKTIIVDCDLRRPRVHSLFG
A0A523H6J2      LDTFRNGTHKQTVMITSALSGEGKSTISTNIAIASSRNRQRPSLIIDFDLRRPRLHHIFK
A0A523IZX2      LDTFRNGTPKQTIMFTSALLGEGKSTISANIAIASSRNRQKPSLLIDFDLRRPKLHHIFK
A0A3M1NH38      VLFMNQNEDLSSLMVTSLRPNEGKSLTTANLAITVAQQK-ISTLLIDGDLRRGVLHNTFG
A0A3N5KHL3      LLFSKDTEQLRSLLITSICPEEGKSFTAANLAIIMAQQR-TNTLLVDADLRRGVQHNTFN
A0A3M2FHF6      LLFNNEDKRNRSLFVTSLNPNEGKSLNASNLAITFAQQK-IPTLLVDADLRRGVLHSSFA
H1XXC2          LLFNS-DKKLRSVFITSLNPDEGKSLNAGNLAITFAQQK-LPTILLDADLRRGVLHNSFA
                :          .::.**    ****     :.   :  .   ::::* ****   :  * 

A0A3M1A6F3      QNKTPGLAEILS-----RKLTLHSCIRDSEIENLKIITSGSLQGNPLNIINAETIHAFFN
A0A3M1AUM6      LAKEDGVADVLM-----SKRRLDACFKQSPLENLKILTSGGIVDNPTELFNSSKMKDLFS
A0A6H9LKJ3      LDAKAGLNEILT-----EGYNPKDAISKTSIDKLDILTTGGFCEHPSEVFDAEVIGTLID
A0A6H9L817      LPKDDGVADVLT-----GRRSLDACFKPSPIDNLQVLTSGGVIDNPTELFNSPRMKDLFS
A0A523H6J2      VDKEPGVVDAVT-----NQISFQELIKDSGFPNLKIITSGNLNDSPIKIFNAQNIKAFLE
A0A523IZX2      VDKAPGVVDAVT-----NQISFQELVKDSGFPNLKIITSGNLNESPIKIFNAQNIKAFLD
A0A3M1NH38      NKKTPGLSDFLISSATVDFDNLSKLIQPTFIPNLFLITCGSPIPNPTEMLGGDRFVAFLK
A0A3N5KHL3      VPREPGLTNYLS-----NKGTLNTLIHSTHIPNLSVMSCGSLVPNPSELLGSIQMKRLLS
A0A3M2FHF6      CNKKPGLADFLYSSADINDENINKVIQQTHIPNLYLMSSGMAVPNPSEILGTQRAADLFK
H1XXC2          CKKKPGFSDFLYSNADITDENVRKIIQTTHIPNLYLISSGVPIPNPSELLGSTRAQELIR
                     *. : :              .  : : :* ::: *     * :::.      :: 

A0A3M1A6F3      EIYKYFDFIVVDAPPVIPVSDPLILGKVVDHVVMVVRVGKTPKPIAKRAIEMLQSVEVNI
A0A3M1AUM6      EIKFYFDAVIVDSPPINPVTDALILSSEMDGALMVVKAGKTPKDVVRRAVDLMRNTGLNI
A0A6H9LKJ3      EMKFYYDIVLIDCAPLLPVSDPMLLATKTDGVLMVVKAGSTQKEVVRRAVEILDPTTTNI
A0A6H9L817      EIKFYFDAVIVDTPPIIPVTDSLILSTEMDGAIMVIKAGDTKKQIVNRAVELMRNSGLNI
A0A523H6J2      TASSFYDYIVVDAPPVIPVSDPLIIGKFVDNVILVAKAGETPKRVIKRAVDMIHNVEIEI
A0A523IZX2      TASSYYDNIIVDAPPVIPVSDPLVIGKFVDNVILVAKAGETPKRVIQRAVDMIHNVEIKI
A0A3M1NH38      LLRSRFGMVIMDTPPIQASSDAAILARYFDGVLTVIKAGSTDIGQLRQKLNEYPNLRKKV
A0A3N5KHL3      DVKRKFDFIIFDAPPLDAATDSVVIGTVVDAVTIVLRAGKTNRKIAKERLEIFQNVPAKI
A0A3M2FHF6      FLAERFGFLIVDTPPIMVTSDSVVLSRYVEQGLFVIRAGQTNVESVKEKLAEYKNFEKRL
H1XXC2          FLSHRFGFVIIDTPPLAVASDAVIVSRYVDGGLLVVRAGKSNIVQLKSKIEEYQDLRKNL
                     :. ::.* .*:   :*. ::.   :    * ..*.:     .  :         :

A0A3M1A6F3      LGIVLNDVDSLL-PAYYNNRYYKYPYYSEVEESNNNLE------------
A0A3M1AUM6      LGVIVNNMKGVL-PYYYDYKYYGYKYYTKDLKA-----------------
A0A6H9LKJ3      LGVVFNNMNHSL-PYYYDYSYYHYEYNHNQKKSREGKSGDDSQNKLKVDK
A0A6H9L817      LGVIVNNMKGVL-PYYYDHKYYGYDYTPGTTEEKFF--------------
A0A523H6J2      SGIILNNMRNVL-PYYYDHKYYGYDYYNYNTNDK----------------
A0A523IZX2      SGIILNNMRNVL-PYYYDHKYYGYDYYNYDSDDK----------------
A0A3M1NH38      IGAVLNMVQMNIKKNQYQYSYYNY--------------------------
A0A3N5KHL3      IGTIINGTDEAI--LKSTYSYYHY--------------------------
A0A3M2FHF6      FGIILNCAELDMKSDHYKYSYYNY--------------------------
H1XXC2          VGIVLNFAKEDMDHKKYRYTYYNY--------------------------
                 * :.*     :        ** *                          

© 1998-2021Legal notice