BYKdb

Dataset for cluster orphancd of phylum balneolaeota

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3D2IJ12      ------------------------------------------------------------
A0A356WWN1      ------------------------------------------------------------
A0A3D4V2H8      ------------------------------------------------------------
A0A6M1T8Y1      -------------------------MKATKSTFSQDLFDPKKIVPLVQRHVWSILIFTIL
A0A345UMN6      MELENNERRKSMRSNGASEDPFNPGAIPGEEDDQNDPFDPQLILYSLWDGKWIILACVVI
A0A6C1NYF2      ---------------------------MNQKHPHEDLPSLSEIREILLSGKWWIISIFLF
                                                                            

A0A3D2IJ12      ------------------------------------------------------------
A0A356WWN1      ------------------------------------------------------------
A0A3D4V2H8      ------------------------------------------------------------
A0A6M1T8Y1      SVLVTYYTVNNYLLPVYQSKGTLIIT-TNENTLPGSGGARGGVGSGVGDIVSRSFTSNFG
A0A345UMN6      LGALGYYYTQT-LPNQYRTTGLFLIENQRADR--GLNLFE----------FTRARNLTWD
A0A6C1NYF2      AATATYLYVST-LTPEYEARSTIFVDLSQQNEIPGFGAGD----------QRSAAAMS-E
                                                                            

A0A3D2IJ12      ------------------------------------------------------------
A0A356WWN1      ------------------------------------------------------------
A0A3D4V2H8      ------------------------------------------------------------
A0A6M1T8Y1      NPVQNAIYLFRAQDLSDQVAKDLIASFDSTNYQGYTTLWLKY------------------
A0A345UMN6      EVGTEMQFIVNSHELAENVGRRLIQELVNPVTGDTLPMLRQ----------------NGL
A0A6C1NYF2      RLAADIAIVQRSSDLAEQVARRLISVGFSPFDGEQLPILIQYVDPDTANNSLTTRFNRML
                                                                            

A0A3D2IJ12      ------------------------------------------------------------
A0A356WWN1      ------------------------------------------------------------
A0A3D4V2H8      ------------------------------------------------------------
A0A6M1T8Y1      ------PEDSTIISLDRASSRIRNGLSVKTVEPTGQRFEPNLLEISYQSYSPKEAAKVVN
A0A345UMN6      GFMPEEQV------LQRLARRLPNRISLHQIDQM------NLVEIRTTSFDPQEAAFIAN
A0A6C1NYF2      GTSTDNPANYVMLDVPRVARRIPRHITIMPIRGV-----PNMFDIIAVSSNPGEASLLAN
                                                                            

A0A3D2IJ12      ------------------------------------------------------------
A0A356WWN1      ------------------------------------------------------------
A0A3D4V2H8      ------------------------------------------------------------
A0A6M1T8Y1      LALETFQEKSLEQKQKSASRALSFLQEKKLEANAQLDDAEERLVNFKDENQLVAIDEQAS
A0A345UMN6      FYIEEYRILDETITRSNLTSAASYLEQLEERNTMTLGEQDEQIRMFLDSDWTLITDEQGT
A0A6C1NYF2      IYAEEYARYDRDRSREKIRATLQYLQTLERDQHQSLRSYETQIRKFLETDYSLVTDPAGQ
                                                                            

A0A3D2IJ12      ------------------------------------------------------------
A0A356WWN1      ------------------------------------------------------------
A0A3D4V2H8      ------------------------------------------------------------
A0A6M1T8Y1      NSVNSLSELQAEKQTLEIELESINTSINNYEQQVEAIKPGLKDQFTNAIGPTISRFQDRL
A0A345UMN6      AAAQELRGLFREAEELRFRKVAVSDFLDRLREEKDMVLNMLYDGATDNDMELVNAFEQAI
A0A6C1NYF2      RAAEQLSDLYRQIDETQHQINTTRRLLEILKKEEEDTRQLLSVSRSTNIDQQITVIRSRI
                                                                            

A0A3D2IJ12      ---------------------------NEILKVKRQIKDRTNNLLSSGSDLYLSFIGSGD
A0A356WWN1      ------------------------------------------------------------
A0A3D4V2H8      ------------------------------------------------------------
A0A6M1T8Y1      ADLKTRRFVILSQNPQLKENPDSEPELRRLNQQIKEVEEEIQKLSEGLLNDTQGFTDTGD
A0A345UMN6      LDLRLQAESFYIEQPQLRTNPEGNSVLSQILRRIDYLEGLRDERLESQRDRVRDRQGLDQ
A0A6C1NYF2      LDLQIQAEDYYIERPELRQFPERNANLNAIVSRIQSLEA-SIERLNREVSENIQRGVMSQ
                                                                            

A0A3D2IJ12      GTLTQRIAEISQKLIELKVEQAQLKTQENIISKRYAEVNNRLEDLPDEIIQLARLKRNVR
A0A356WWN1      ------------------------------------------------------------
A0A3D4V2H8      ------------------------------------------------------------
A0A6M1T8Y1      GNLAEELSNIRQNLIGLRLNKNQYESQIEVLNERIKDAESFLDSYPDKQVKLARLEAEVE
A0A345UMN6      ASLASYLTDIRSEIRSNEARLVDMQLREDFIAERVDDIQSDMSSIMERSAELQRLRRNQV
A0A6C1NYF2      ENLTTMLQQLRQDYNREDANLQALEERLIFLRNQANEFQGNVYSSLEKSHRLSDMERDRR
                                                                            

A0A3D2IJ12      VNEEMYLQVSSQFAEMSLWEKTQFGLGRPLDYAVPAKEPVKPKKKIIVVVGFFMGCVLAV
A0A356WWN1      ---------------MNLWERTQFGMGRPLDYAVVPNNPIKPQKKLWVLIGFLLGGILGV
A0A3D4V2H8      -----------------------------------------PKKKIIVVVGFFMGCVLAV
A0A6M1T8Y1      RHKQYLSNLISQESEIALWQQTQNSSGTIVDRANPRYSPVKPNKILWLGFAAMVGIILPI
A0A345UMN6      ISEELYLNLLKRLQETQIAIQSEVSRVREIRAASVPSSPFSPNRLRNYILSLILGFGLGA
A0A6C1NYF2      INEELYTRLLTTLQETQIAERAELGRVRIVSEAGIPGAPARPNKLLLMVLGMGLGLALSI
                                                         *:.     ..  :*  *  

A0A3D2IJ12      GFVLVREMLNDTITSTDALKEFQKPVLGAIPDFSVIGELD--PNERQYIGKKSVSNQLIT
A0A356WWN1      GFIFIKEALDDTIKSSDALRSYKVPFLGNIPDYNIIDSFD--PGQKQYVQGKPVSNQLLT
A0A3D4V2H8      GFVLVREMLNDTITSTDALKEFQKPVLGAIPDFSVIGELD--PNERQYIGKKSVSNQLIT
A0A6M1T8Y1      GLLILKNGFSTIINSSEQLKYFPYPLLSVIYDHSLIKTNSWFSSNDSDVKGTGISKSVVF
A0A345UMN6      GIVLLRNLLDDLIHDPGQLRNAGFNVIGVIPDFTDYINTHFKNTERLPIRGRSVDVNLIS
A0A6C1NYF2      GILFVKRMMDNTIHTPEELRQRGFNVLSAIPNMEAYKGLVKPAHKLKPVNGLKADARLVV
                *::::.  :.  *  .  *.     .:. * :            :   :     .  :: 

A0A3D2IJ12      LFDHISPISEAYRRLRINVVYANPDKDYKILMVSSATKGEGKSTVAANLAVTFTGSEKKV
A0A356WWN1      FLDHISPISEAYRRLRINTIYANPDKDYKVLMVTSSTKGEGKSTIAANLAVTFAEAEKSV
A0A3D4V2H8      LFDHISPISEAYRRLRINVVYANPDKDYKILMVSSATKGEGKSTVAANLAVTFTGSEKKV
A0A6M1T8Y1      YHYIDTPVAESYRKIVSQLLYTNPDSIPKSILITSSGKGEGKTTLTANLGAAFAEIDKKV
A0A345UMN6      LIDPISAGAEAYRRLRTSIEFSNADREYQTLVVTSSKPGEGKSLTSINLALTYAQFGKRT
A0A6C1NYF2      LHEPLSPVSESYRRLRTNLLFSNVDKPVKSILITSSIPGEGKSLTAVNLAVVMAQAGKRT
                     :. :*:**.:  .  ::* *   : ::::*:  ****:  : **. . :   * .

A0A3D2IJ12      LIIDLDLRRPTQHKIFGENKEPGLSDALFDST-IDARLS-TVAPNVDLITVGHKTPEPAS
A0A356WWN1      LIIDLDLRRPTMHKIFGENKEPGIVEMLFDTAGFDSTINPTIAPNVDLLTVGKKTPEPAS
A0A3D4V2H8      LIIDLDLRRPTQHKIFGENKEPGLSDALFDST-IDARLS-TVAPNVDLITVGHKTPEPAS
A0A6M1T8Y1      LIIDCDFRRPAVHKLFSIDNSDGINEVLFEGSKLSGAIKESGIEGLSLLPTGGKPMSPAN
A0A345UMN6      LVIDCDLRKPTIHKKLGLDKSPGLTDILFDKDTLENCLIDASTDNFFVITAGNSIPNPAE
A0A6C1NYF2      LLVDADLRKPAATNLLGLPAEPGLSDTLFRNGGLTIDEFTTPIDNLYVLPSGKPISNPSE
                *::* *:*.*:  : :.   . *: : **    :      :   .. ::. *    .*:.

A0A3D2IJ12      VLDSKRLKQLIDKYKSEYDHIILDTAPYGIISDSASLLRLIDGLIVVSRFNVTTKRELKF
A0A356WWN1      VLDSRRLKDVIDKLKDKYDHIILDTAPYGIISDSASLLRLTDGIIVVSRFATTTHKELEF
A0A3D4V2H8      VLDSKRLKQLIDKYKSEYDHIILDTAPYGIISDSASLLRLIDGLIVVSRFNVTTKRELKF
A0A6M1T8Y1      LLASDKFKEMIKVVCPNYDIILFDTPPHGLVSDVASLLNLTDSVIVAAKFGETKINVLSH
A0A345UMN6      TMGSKRMQELLSSLKKEFDIIILDTPPLLVVSDAMPLAVATDATVLVSKMDETELSILKE
A0A6C1NYF2      FLGSKRMDEFIDAISASFDIVIFDSPPLQLVTDASILANKVDATIIVAQGDETTWQILEN
                 : * .:.:.:.    .:* :::*:.*  :::*   *    *. ::.:.   *    *. 

A0A3D2IJ12      TLEGLEHLNADVLGIVLNAFDPKKSTDYYTNYNYYKRTYSEYYKYR--------------
A0A356WWN1      TLNGLKQLNAEIVGLVLNAFDPKKSSDYYTNYYYYKRAYSDYYEEDKA------------
A0A3D4V2H8      TLEGLEHLNADVLGIVLNAFDPKKSTDYYTNYNYYKRTYSEYYKYR--------------
A0A6M1T8Y1      TLDDLDNNEETNLSLVLTAYKPDKSYDSYETKGLHTYRYSQYYEYEKV------------
A0A345UMN6      TRQDLRNLGVNIAGSVLNA------YDTNSVKSYYKYNYKYNYKYKY---DYAYKDYKLD
A0A6C1NYF2      TRQYLQDVGVYVAGVVLNR------FNFKSSTGYSRYGYEITYGKTYGASGNGNGSIGKR
                * : *        . **.        :           *.  *                 

A0A3D2IJ12      -------------------
A0A356WWN1      -------------------
A0A3D4V2H8      -------------------
A0A6M1T8Y1      -------------------
A0A345UMN6      YTDQPDQK-----------
A0A6C1NYF2      KTGKADSKPAGLVQSKQSV
                                   

© 1998-2021Legal notice