BYKdb

Dataset for cluster orphancd of phylum balneolaeota

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A345UMN6      MELENNERRKSMRSNGASEDPFNPGAIPGEEDDQNDPFDPQLILYSLWDGKWIILACVVI
A0A6C1NYF2      ---------------------------MNQKHPHEDLPSLSEIREILLSGKWWIISIFLF
A0A3D2IJ12      ------------------------------------------------------------
A0A356WWN1      ------------------------------------------------------------
A0A3D4V2H8      ------------------------------------------------------------
                                                                            

A0A345UMN6      LGALGYYYTQTLPNQYRTTGLFLIENQRADR--GLNLFEFTRARNLTWDEVGTEMQFIVN
A0A6C1NYF2      AATATYLYVSTLTPEYEARSTIFVDLSQQNEIPGFGAGDQRSAAAMS-ERLAADIAIVQR
A0A3D2IJ12      ------------------------------------------------------------
A0A356WWN1      ------------------------------------------------------------
A0A3D4V2H8      ------------------------------------------------------------
                                                                            

A0A345UMN6      SHELAENVGRRLIQELVNPVTGDTLPMLRQ----------------NGLGFMPEEQV---
A0A6C1NYF2      SSDLAEQVARRLISVGFSPFDGEQLPILIQYVDPDTANNSLTTRFNRMLGTSTDNPANYV
A0A3D2IJ12      ------------------------------------------------------------
A0A356WWN1      ------------------------------------------------------------
A0A3D4V2H8      ------------------------------------------------------------
                                                                            

A0A345UMN6      ---LQRLARRLPNRISLHQIDQM-NLVEIRTTSFDPQEAAFIANFYIEEYRILDETITRS
A0A6C1NYF2      MLDVPRVARRIPRHITIMPIRGVPNMFDIIAVSSNPGEASLLANIYAEEYARYDRDRSRE
A0A3D2IJ12      ------------------------------------------------------------
A0A356WWN1      ------------------------------------------------------------
A0A3D4V2H8      ------------------------------------------------------------
                                                                            

A0A345UMN6      NLTSAASYLEQLEERNTMTLGEQDEQIRMFLDSDWTLITDEQGTAAAQELRGLFREAEEL
A0A6C1NYF2      KIRATLQYLQTLERDQHQSLRSYETQIRKFLETDYSLVTDPAGQRAAEQLSDLYRQIDET
A0A3D2IJ12      ------------------------------------------------------------
A0A356WWN1      ------------------------------------------------------------
A0A3D4V2H8      ------------------------------------------------------------
                                                                            

A0A345UMN6      RFRKVAVSDFLDRLREEKDMVLNMLYDGATDNDMELVNAFEQAILDLRLQAESFYIEQPQ
A0A6C1NYF2      QHQINTTRRLLEILKKEEEDTRQLLSVSRSTNIDQQITVIRSRILDLQIQAEDYYIERPE
A0A3D2IJ12      ------------------------------------------------------------
A0A356WWN1      ------------------------------------------------------------
A0A3D4V2H8      ------------------------------------------------------------
                                                                            

A0A345UMN6      LRTNPEGNSVLSQILRRIDYLEGLRDERLESQRDRVRDRQGLDQASLASYLTDIRSEIRS
A0A6C1NYF2      LRQFPERNANLNAIVSRIQSLEA-SIERLNREVSENIQRGVMSQENLTTMLQQLRQDYNR
A0A3D2IJ12      -----------NEILKVKRQIKDRTNNLLSSGSDLYLSFIGSGDGTLTQRIAEISQKLIE
A0A356WWN1      ------------------------------------------------------------
A0A3D4V2H8      ------------------------------------------------------------
                                                                            

A0A345UMN6      NEARLVDMQLREDFIAERVDDIQSDMSSIMERSAELQRLRRNQVISEELYLNLLKRLQET
A0A6C1NYF2      EDANLQALEERLIFLRNQANEFQGNVYSSLEKSHRLSDMERDRRINEELYTRLLTTLQET
A0A3D2IJ12      LKVEQAQLKTQENIISKRYAEVNNRLEDLPDEIIQLARLKRNVRVNEEMYLQVSSQFAEM
A0A356WWN1      -----------------------------------------------------------M
A0A3D4V2H8      ------------------------------------------------------------
                                                                            

A0A345UMN6      QIAIQSEVSRVREIRAASVPSSPFSPNRLRNYILSLILGFGLGAGIVLLRNLLDDLIHDP
A0A6C1NYF2      QIAERAELGRVRIVSEAGIPGAPARPNKLLLMVLGMGLGLALSIGILFVKRMMDNTIHTP
A0A3D2IJ12      SLWEKTQFGLGRPLDYAVPAKEPVKPKKKIIVVVGFFMGCVLAVGFVLVREMLNDTITST
A0A356WWN1      NLWERTQFGMGRPLDYAVVPNNPIKPQKKLWVLIGFLLGGILGVGFIFIKEALDDTIKSS
A0A3D4V2H8      -------------------------PKKKIIVVVGFFMGCVLAVGFVLVREMLNDTITST
                                         *:.    ::.: :*  *. *::::.  ::: *  .

A0A345UMN6      GQLRNAGFNVIGVIPDFTDYINTHFKNTERLPIRGRSVDVNLISLIDPISAGAEAYRRLR
A0A6C1NYF2      EELRQRGFNVLSAIPNMEAYKGLVKPAHKLKPVNGLKADARLVVLHEPLSPVSESYRRLR
A0A3D2IJ12      DALKEFQKPVLGAIPDFSVIGEL--DPNERQYIGKKSVSNQLITLFDHISPISEAYRRLR
A0A356WWN1      DALRSYKVPFLGNIPDYNIIDSF--DPGQKQYVQGKPVSNQLLTFLDHISPISEAYRRLR
A0A3D4V2H8      DALKEFQKPVLGAIPDFSVIGEL--DPNERQYIGKKSVSNQLITLFDHISPISEAYRRLR
                  *..    .:. **:            :   :    .. .*: : : :*. :*:*****

A0A345UMN6      TSIEFSNADREYQTLVVTSSKPGEGKSLTSINLALTYAQFGKRTLVIDCDLRKPTIHKKL
A0A6C1NYF2      TNLLFSNVDKPVKSILITSSIPGEGKSLTAVNLAVVMAQAGKRTLLVDADLRKPAATNLL
A0A3D2IJ12      INVVYANPDKDYKILMVSSATKGEGKSTVAANLAVTFTGSEKKVLIIDLDLRRPTQHKIF
A0A356WWN1      INTIYANPDKDYKVLMVTSSTKGEGKSTIAANLAVTFAEAEKSVLIIDLDLRRPTMHKIF
A0A3D4V2H8      INVVYANPDKDYKILMVSSATKGEGKSTVAANLAVTFTGSEKKVLIIDLDLRRPTQHKIF
                 .  ::* *.  : ::::*:  *****  : ***:. :   * .*::* ***.*:  : :

A0A345UMN6      GLDKSPGLTDILFDKDTLENCLIDASTDNFFVITAGNSIPNPAETMGSKRMQELLSSLKK
A0A6C1NYF2      GLPAEPGLSDTLFRNGGLTIDEFTTPIDNLYVLPSGKPISNPSEFLGSKRMDEFIDAISA
A0A3D2IJ12      GENKEPGLSDALFDST-IDARLS-TVAPNVDLITVGHKTPEPASVLDSKRLKQLIDKYKS
A0A356WWN1      GENKEPGIVEMLFDTAGFDSTINPTIAPNVDLLTVGKKTPEPASVLDSRRLKDVIDKLKD
A0A3D4V2H8      GENKEPGLSDALFDST-IDARLS-TVAPNVDLITVGHKTPEPASVLDSKRLKQLIDKYKS
                *   .**: : ** .  :      :   *. ::. *:  .:*:. :.*.*:.:.:.  . 

A0A345UMN6      EFDIIILDTPPLLVVSDAMPLAVATDATVLVSKMDETELSILKETRQDLRNLGVNIAGSV
A0A6C1NYF2      SFDIVIFDSPPLQLVTDASILANKVDATIIVAQGDETTWQILENTRQYLQDVGVYVAGVV
A0A3D2IJ12      EYDHIILDTAPYGIISDSASLLRLIDGLIVVSRFNVTTKRELKFTLEGLEHLNADVLGIV
A0A356WWN1      KYDHIILDTAPYGIISDSASLLRLTDGIIVVSRFATTTHKELEFTLNGLKQLNAEIVGLV
A0A3D4V2H8      EYDHIILDTAPYGIISDSASLLRLIDGLIVVSRFNVTTKRELKFTLEGLEHLNADVLGIV
                .:* :*:*:.*  :::*:  *    *. ::*:.   *    *: * : *  :.. : * *

A0A345UMN6      LNAYDTNSVKSYYK--YNYKYNYKYKY---DYAYKDYKLDYTDQPDQK-----------
A0A6C1NYF2      LNRFNFKSSTGYSR--YGYEITYGKTYGASGNGNGSIGKRKTGKADSKPAGLVQSKQSV
A0A3D2IJ12      LNAFDPKKSTDYYTNYNYYKRTYSEYYKYR-----------------------------
A0A356WWN1      LNAFDPKKSSDYYTNYYYYKRAYSDYYEEDKA---------------------------
A0A3D4V2H8      LNAFDPKKSTDYYTNYNYYKRTYSEYYKYR-----------------------------
                ** :: :. ..*      *:  *   *                                

© 1998-2021Legal notice